2W2BA

Crystal structure of single point mutant tyr20phe p-coumaric acid decarboxylase from lactobacillus plantarum: structural insights into the active site and decarboxylation catalytic mechanism
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
177
Chain Sequence
b'TKTFKTLDDFLGTHFIYTFDNGWEYEWYAKNDHTVDYRIHGGMVAGRWVTDQKADIVMLTEGIYKISWTEPTGTDVALDFMPNEKKLHGTIFFPKWVEEHPEITVTYQNEHIDLMEQSREKYATYPKLVVPEFANITYMGDAGQNNEDVISEAPYKEMPNDIRNGKYFDQNYHRLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-COUMARIC ACID DECARBOXYLASE
publication title P-Coumaric Acid Decarboxylase from Lactobacillus Plantarum: Structural Insights Into the Active Site and Decarboxylation Catalytic Mechanism.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
total genus 53
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05870 PA_decarbox Phenolic acid decarboxylase (PAD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2w2bA00
1HBQA 3CBCA 1PM1X 4R0BA 4TKHA 3APXA 4ZR2A 2G79A 3VG2A 3NR3A 5HA1A 3RZYA 4UU2A 5B29A 2HMBA 1GKAA 3FR5A 3KFHA 1KT7A 2RQ0A 3WJGA 4YBUA 5HCDC 4GNYA 2W2BA 2ANSA 4ZHHA 4YCEA 1MX7A 2HZQA 1GX8A 5HWZA 1OBUA 2Q2MA 5EEDA 5HBSA 2QO6A 4TNNA 3VG5A 3UEXA 2WR6A 3MBTA 3P6DA 2HNXA 2HYSA 2L5PA 2OVEA 1MUPA 3FR2A 2F73A 3KFGA 1NGLA 5AQ6A 1BSQA 3G7XA 2JU7A 1SY0A 4IMOA 2QO5A 4ORSA 3WVMA 4ZHCA 3L4RA 5F6ZA 2AT5X 4OS8A 4MVLA 3WJEA 1FE3A 1EUOA 3D95A 1JJXA 1X8OA 1ZNGA 1DC9A 1RBPA 2A13A 3DTQA 4GH7A 2LBVA 2WWPA 1MDCA 4I9SA 1ADLA 3UEWA 1BRPA 3BX7A 1TXLA 3PEDA 4Y0RA 2LFOA 1YWDA 1HMTA 4KIIA 4YBPA 4YFRA 1CBRA 5HAEA 3EBWA 4ZFXA 1LICA 1U0XA 4YKMA 4ALOA 4ZH9A 1H91A 3Q6LA 3UEUA 4XMHA 1O8VA 3NQ9A 2WQAE 3P6EA 1S7DA 4I9RA 1HMRA 5EDCA 1I06A 5C0NA 4GNWA 2MM3A 5L8IA 2A2UA 2ACOA 4XMDA 4OMXA 5KICA 5EPQA 1YWCA 1SY2A 1ZNHA 3T1DA 3NQ3A 2CZTA 1VYFA 2QOSC 3NADA 4TLJA 1KXOA 1DZKA 1CBSA 1LIFA 3CR6A 2K62A 3FIQA 1RLBE 4IAXA 5HZ5A 4YH0A 3VG6A 3O19A 3CQNA 4AZRA 4CK4A 3F9DA 4MVKA 1Z24A 5HTDA 2A3FX 5D8JA 4MVIA 2NNEA 3VG7A 4GKCA 1R0UA 1DZJA 5LJGA 3TGBA 1S2PA 1BWYA 1T68X 2DM5A 1JBHA 2FR3A 1VPRA 4IAWA 1YWBA 1E5PA 3APWA 2CBSA 1JYJA 1VYGA 1ZRYA 2E4JA 1OPAA 4LKTA 4ES7A 4QGVA 1DV9A 1KZXA 2KTDA 3BU1A 4BOEA 3NX1A 4N7DA 2G7BA 1OEKA 1ERXA 1DZPA 5D45A 3U0DA 4K19A 3B2LA 4NYRA 3HWGA 2RCQA 4OS0A 4OS3A 2Q4NA 4YFQA 1GT1A 4QGXA 3FA8A 2POAA 1JYDA 3TF6A 3BU9A 4N7CA 3WJFA 1GT5A 1EW3A 2GC9A 5DPQA 2NNDA 1BEBA 3HK1A 4DQ3A 4XMCA 1DF3A 1SA8A 3EBKA 1CBIA 1ICNA 2QM9A 4EEJA 2WQ9A 4WBKA 4RUNA 1G74A 3CMPA 4ZHFA 1ERBA 1PBOA 2L68A 3WXQA 5F7GA 1ML7A 5HTEA 1X8QA 3APUA 1OEEA 2WUTA 3FLLA 1IFBA 2WSJA 4IBAA 4I3DA 1X71A 1LPJA 4ODDA 1FENA 1OBQA 1YIVA 4A1YA 5H8TA 1LIDA 2JU3A 2OVDA 1KT5A 1CJ5A 2JU8A 4AZPA 5IO6A 3ELXA 4TQ2A 4AZQA 1BRQA 1QFVA 1X8UA 4IB6A 3WJBA 2Q2PA 5H9KA 1EALA 1B56A 2FLJA 1A57A 4ZH6A 1LIEA 2O62A 1L6MA 2X45A 4NP1A 4BVMA 4NNTA 5EDBA 1PEEA 2CZUA 3D96A 1A3YA 4ZCBA 3FA6A 3OJYC 1B0OA 1OBPA 3P6GA 1YWAA 4EDEA 2A0AA 1IIUA 1KQWA 1T0VA 1YUPA 3PECA 4AZOA 1A18A 3F8AA 5EZ2A 3TGAA 1ACDA 3O2YA 3GAQA 3AKMA 2OZQA 3IA8A 4YMYA 2GJ5A 2NP1A 1QABE 3ZQ3A 1G85A 3FEPA 3QKGA 2AT0X 1LF7A 1JJJA 1HBPA 1FEMA 1ZNKA 4HPAA 2RD7C 2AL0X 3HWFA 2G78A 2FWVA 5F1EA 3UEVA 1KOIA 1EQDA 5D48A 1X8NA 3BLGA 5HZQA 4PSQA 5L8NA 2ALLX 5LJBA 2AT3X 1BBPA 2KT4B 3B2HA 4EFGA 5LJDA 3C76X 2FRSA 5D47A 3SAOA 4QYNA 5LJHA 1SXUA 1CBQA 1T8VA 3P6FA 3ZUIA 1SY3A 1B4MA 1AB0A 4M6SA 1GT3A 2LB6A 3FW5A 5JR8A 1QG5A 3BS2A 1ZNLA 4ALBA 1BSOA 1SXYA 3TGCA 1GKAB 4IB8A 3D97A 3EYCA 1D3SA 5H9AA 1I04A 1TVQA 3FMZA 3CQRA 2MJIA 2AMMX 4QGWA 2K23A 5HA0A 1I4UA 2LKKA 2AH7X 3FA7A 1EIIA 5HZ8A 5HCEC 3ZUOA 2CM4A 3RSWA 1E00A 4A60A 3KZAA 1A2DA 4WFVA 4BQUA 1TOUA 1SXWA 3APVA 3STKA 3WBGA 4DQ4A 1EPBA 5HZ6A 4ORYA 4ARHA 1FELA 5H9NA 1BLRA 1N0SA 3B2IA 5L8OA 2FS7A 3U03A 5F6BA 2R56A 1NP1A 4LKPA 2L9CA 4RUUA 1ZNEA 2PY1A 4XMFA 2AKQA 4YGHA 1IFCA 4I3CA 2EU7X 4ZGUA 1JV4A 2BLGA 3FA9A 1E02A 4I3BA 4AZNA 2HZRA 3NX2A 4ZJ0A 1BSYA 3BY0A 3NP1A 1GX9A 4NNSA 3ELZA 5LJCA 2Q39A 4ZHGA 2XSTA 4GRJA 1JZUA 1MX8A 1D2UA 4OMWA 1GXAA 3O22A 2QO4A 4ZHDA 3B2KA 1DZMA 1G7NA 3JS1A 1XKIA 1X89A 3S26A 1S44A 3K3LA 2W2AA 3CBSA 2RCTA 3KFIA 5LJKA 5BVTA 1KZWA 1LNMA 1AVGI 4D6AA 3C78X 1I05A 1OPBA 2R74A 1BM5A 1KT4A 2ACPX 3KFFA 1IW2A 1ICMA 2R73A 2P8GA 2HLVA 3JSQA 4NYQA 2W2FA 5HZ9A 5CE4A 4YKOA 1FDQA 5EEEA 3FR4A 5IO7A 3NPOA 4HPCA 4QYPA 4Y0PA 2CM9A 4TKBA 4AZMA 1B8EA 2AT6X 2FR2A 3I0AA 1LIBA 1O1UA 4YCHA 4YDAA 5FENA 1NP4A 2FT9A 4UU3A 4A8ZA 1CRBA 1MVGA 4YDBA 2Q9SA 1GM6A 1QY1A 4GE1A 3PH6A 4D6BA 4YGZA 1LFOA 4ORRA 1IKJA 1TW4A 3HWEA 1KT3A 4Y0QA 1ALBA 4ORWA 1HN2A 4NLJA 2WEWA 4LZVA 3TZSA 4HPBA 4GETA 3VG4A 1YP7A 5BVSA 1QY0A 1QY2A 3BDRA 3FELA 4AYHA 1HMSA 5D4AA 4O9SA 3IFBA 5H9LA 2YG2A 1BJ7A 3FEKA 3BRNA 1U18A 4HFOA 1P6PA 2N93A 5K06A 1GT4A 5KHPA 3P6CA 5DG4A 2FS6A 1EPAA 2MO5A 2FTBA 1ZNDA 5F58A 2LBAA 3WJDA 5BVQA 3BX8A 1KT6A 3DSZA 1EIOA 5LKEA 4NLIA 1QQSA 3I17A 2ASNX 2OFMX 3PPTA 2GTFX 1KGLA 1UZ2X 4Y0SA 2IFBA 4LZUA 4M7MA 1IKEA 3STNA 3WJCA 4XMEA 5LJEA 3PH5A 1KQXA 2AT8X 3CWKA 1TOWA 3KQ0A 1QWDA 3P6HA 3C77X 2L67A 4A1HA 1FTPA 2XKLA 2A2GA 3BSZE 4YFPA 4WFUA 1O1VA 1AQBA 1PMPA 1DFVA 3AKNA 4IB7A 3PP6A 3EM0A 4EXZA 4QAEA 1AELA 4YGGA 4HPDA 4QZTA 2NNQA 2OFRX 1U17A 5KIDA 5FFHA 1XCAA 2OVAA 2JOZA 1GGLA 5LKFA 3EMMA 5FAZA 1YP6A 3MVFA 4IB9A 1EXSA 2JN3A 4IMNA 2X46A 4ORXA 1X8PA 1OEJA 3B2JA 4ORUA 1G5WA 4XMGA 1LKEA 1E06A 1QFTA 4AW8A 5IO5A 5B27A 3VG3A 1HQPA 4TJZA 1SY1A 3HWDA 1UREA 5HCCC 2CBRA 2RA6A 3FENA 4QZUA 3STMX 3FW4A 2WEXA 1SXXA 4TKJA 3U9PC
chains in the Genus database with same CATH superfamily
1HBQA 3CBCA 1PM1X 4JHQA 1SWLA 4R0BA 2CAMA 4TKHA 1SREA 4MISA 3APXA 1SWHA 1PTSA 4ZR2A 2G79A 3VG2A 3NR3A 5HA1A 3RY2A 3RZYA 2FKJA 4UU2A 5B29A 2RTEB 1LDOA 1Y9LA 2HMBA 1GKAA 3FR5A 1SLEB 3KFHA 2IZAA 1KT7A 2RQ0A 4GZVA 4NW4A 3RDQA 3T2XA 3WJGA 2X55A 4YBUA 4EQAC 5HCDC 3D4RA 2W2BA 2ANSA 4GNYA 4YCEA 4ZHHA 1MX7A 2HZQA 1VWKB 1N9MA 1GX8A 3AEHA 5HWZA 1OBUA 2DJGA 2Q2MA 3FYFA 4FBOA 5EEDA 1MOYA 2A5CA 3PDFA 5HBSA 4MIRA 4U9CA 2QO6A 4TNNA 3VG5A 3UEXA 2WR6A 3MBTA 3P6DA 2I5ZO 4BGFA 2HNXA 1SRIA 2HYSA 2L5PA 2OVEA 1MUPA 4CPHA 3FR2A 2F73A 3KFGA 2RTNB 1NGLA 5CYBA 5AQ6A 1BSQA 3G7XA 2JU7A 4ML7B 4Z2VA 1SY0A 4IMOA 2QO5A 4ORSA 4ZGFA 3WVMA 4ZHCA 3L4RA 3VHHA 1MM9A 2AT5X 4OS8A 5F6ZA 4MVLA 3WJEA 1FE3A 1EUOA 3D95A 2OY5O 1X8OA 1JJXA 2OFAA 5B5FA 4CDCA 1W5RA 1ZNGA 1DC9A 4BJ8A 1RBPA 2OVSA 3ZW1B 5FQ6E 2A13A 3T6FA 3DTQA 4GH7A 2LBVA 2WWPA 1MDCA 4I9SA 4O4UA 4QRLA 3S5VA 1ADLA 4EKVA 3UEWA 1BRPA 3BX7A 1TXLA 3PEDA 4L1NA 4Y0RA 2LFOA 1YWDA 1STSB 2C4IA 1HMTA 4KIIA 4YBPA 4YFRA 1CBRA 5HAEA 3EBWA 2IZKA 4ZFXA 3LHNA 3VPJE 3OE3A 4BX6B 1LICA 1U0XA 4YKMA 4ALOA 1SLGB 4ZH9A 1H91A 2UZ2A 3Q6LA 4GGTA 3RBYA 3UEUA 4XMHA 1O8VA 3NQ9A 2WQAE 1HXLA 3P6EA 3SLOA 1S7DA 4I9RA 1HMRA 1RSUB 3PQSA 3QQ2A 5EDCA 2OL6O 1VWIB 1I06A 1FJ1E 1LDQA 3D9WA 4GNWA 2ZAGA 2MM3A 1VWHB 3HTYA 5L8IA 5C0NA 2A2UA 2ACOA 2IZLB 4I6SA 4XMDA 1SWCA 4OMXA 4CDEA 5KICA 5EPQA 1YWCA 5BYPA 1SY2A 1SMPI 1LUQA 1ZNHA 1JMXA 4DCBA 3T1DA 3NQ3A 2CZTA 4I60A 3SZHA 3JQOA 1VYFA 2QOSC 3NADA 3LV4A 1OSPO 4TLJA 1KXOA 1DZKA 1CBSA 1LIFA 3CR6A 3RDMA 2K62A 2C1SA 3EW1A 3FIQA 1RLBE 4IAXA 5HZ5A 4YH0A 3VG6A 1NQNA 4GD9A 4LQZA 5JD2A 3O19A 3CQNA 1KFFA 1RSTB 3RE6A 5B10O 4AZRA 3WZPA 4CK4A 4BX5B 1N7YA 3F9DA 4MVKA 1Z24A 4GK9A 4KCAA 4O4OA 5HTDA 4GGRA 2A3FX 5D8JA 2RTIB 4MVIA 2NNEA 1VWRB 4GKCA 1R0UA 1DZJA 5LJGA 3VG7A 3ZWEA 3TGBA 1S2PA 1BWYA 1T68X 2X4MA 2DM5A 1N43A 2A8GA 3P02A 2FR3A 1JBHA 1VPRA 4IAWA 4BCSA 3VHIA 1YWBA 1E5PA 3APWA 5IRWA 1JYJA 2CBSA 1VYGA 1ZRYA 2E4JA 1OPAA 2IZCB 4LKTA 4ES7A 4QGVA 1DV9A 1KZXA 2KTDA 3BU1A 4BOEA 3MX7A 1Y53X 3NX1A 4N7DA 2FHNX 2G7BA 2OY7A 1OEKA 1ERXA 1DZPA 5D45A 3U0DA 4K19A 3B2LA 2Y3FA 4NYRA 3HWGA 2RCQA 2VFCA 4WHIA 4OS0A 4OS3A 2Q4NA 4YFQA 4BX5A 1GT1A 4QGXA 3FA8A 2POAA 1JYDA 1RAVA 4Z2OA 4GDZA 3BU9A 1NBXA 4N7CA 3TF6A 2RTBB 3WJFA 1Y0GA 1GT5A 1EW3A 2GC9A 5DPQA 2JMBA 2F09A 1BEBA 2NNDA 3HK1A 2X8FA 4DQ3A 4XMCA 1DF3A 1VWGB 1SA8A 3EBKA 1CBIA 1KL5A 1ICNA 4U3QA 1KL3A 3VE1A 2FGSA 2QM9A 3WZQA 4EEJA 2WQ9A 4CDDA 1Y9TA 2IZHB 4RUNA 1G74A 3CMPA 4WBKA 4ZHFA 4ON1A 1ERBA 1PBOA 2L68A 3WXQA 5F7GA 1ML7A 5HTEA 3RY1A 4Z28A 1X8QA 3APUA 1OEEA 2BS5A 4L3RA 2WUTA 2OL8O 2RTQB 3X00A 3FLLA 1IFBA 2WSJA 3P24A 4IBAA 3RDSA 4I3DA 1SWOA 1LPJA 1X71A 4ODDA 1FENA 1OBQA 1YIVA 4A1YA 5H8TA 1VWOB 1LIDA 2JU3A 2OVDA 1KT5A 2X8SA 1CJ5A 2JU8A 4AZPA 5IO6A 1SWPA 3ELXA 4TQ2A 1RXKA 4AZQA 1BRQA 1QFVA 1X8UA 4IB6A 3WJBA 2Q2PA 5H9KA 4B55A 1EALA 1B56A 2FLJA 4CPEA 1A57A 4ZH6A 4GU8A 5AJCA 2RTHB 1LIEA 2KW1A 4Y59A 2O62A 2IZEB 1L6MA 2X45A 4NP1A 4O3WA 4NNTA 4BVMA 5EDBA 1PEEA 2Y3EA 2CZUA 2IZJA 1A3YA 3D96A 4ZCBA 3FA6A 3OJYC 1B0OA 1VWPB 2OFBA 5FQ8E 3VU1A 1OBPA 3P6GA 1YWAA 4JNJA 4EDEA 1NC9A 2A0AA 1LCWA 1IIUA 1KQWA 2DJFA 4NV8A 1IJ8A 1T0VA 1YUPA 3PECA 2Y32A 4AZOA 5L3YA 1A18A 3F8AA 3NQKA 1RXHA 5EZ2A 1ACDA 2OY8A 2KTSA 3O2YA 3TGAA 3GAQA 3AKMA 5IRAA 2OZQA 2Z4IA 2G8CO 3IA8A 4YMYA 2GJ5A 2NP1A 1JQPA 1QABE 3ZQ3A 1G85A 3FEPA 2AF5A 1SLFB 2MF6A 3QKGA 3WYPA 2BHVA 2AT0X 2IZGB 2GTLN 1LF7A 2AVIA 4BX7B 1JJJA 4I95A 1HBPA 1FEMA 1ZNKA 4HPAA 1PBYA 3FIDA 2RD7C 2AL0X 3HWFA 2G78A 2FWVA 2KD2A 5F1EA 3UEVA 1KOIA 1EQDA 5D48A 1X8NA 5IXGA 3BLGA 5HZQA 4Z2PA 4PSQA 5L8NA 2ALLX 5LJBA 2AT3X 1BBPA 1SRHA 2KT4B 4MEEA 3B2HA 4EFGA 1E2TA 4JO6A 5LJDA 3C76X 2FRSA 1SWGA 5D47A 4QYNA 3SAOA 5LJHA 1SXUA 1CBQA 2FKGA 3UAQA 3RE5A 1T8VA 2GTLM 4Z27A 3P6FA 3ZUIA 1SY3A 1B4MA 4O3ZA 1AB0A 4M6SA 2OF9A 2C1QA 1GT3A 2LB6A 3OBLA 3FW5A 4KH8A 5CSEA 1HXZA 1SWNA 2LA7A 4O3YA 3VGWA 5JR8A 1QG5A 1SRFA 3BS2A 4IABA 1ZNLA 4ALBA 1BSOA 1SXYA 5B11O 4O4XA 2MHDA 3ZW2A 2OYBO 3TGCA 3RDUA 4Z6JA 1GKAB 4IB8A 1JIWI 2OF8A 1VWJB 3D97A 3EYCA 2OY1O 1D3SA 5H9AA 4KC8A 1I04A 2JW1A 1TVQA 3FMZA 4INNA 1AVDA 1DF8A 2AMMX 2GTLO 2MJIA 2BSZA 2JGSA 2K23A 3CQRA 1VWMB 3EC5A 4QGWA 5HA0A 5FQ7E 4U46A 4MVEA 1I4UA 2LKKA 2Z4HA 5F2BA 2AH7X 3FA7A 3S60A 3ZW1A 1EIIA 5HZ8A 3Q34A 5HCEC 3ZUOA 2CM4A 3RSWA 4CPHB 1E00A 2QOMA 3NBXX 1KL4A 4A60A 3MM0A 2RTOB 3KZAA 3CKGA 1A2DA 4WFVA 1LCVA 2WEXA 4BQUA 1TOUA 4C5PA 3HOLA 1SXWA 3APVA 4GUZA 3STKA 3WBGA 1EPBA 3SLTA 3SZJA 1HQQA 1JJUA 1SWEA 1VWNB 1STPA 1LCZA 4ORYA 4ARHA 1FELA 5H9NA 4BX6A 1BLRA 2RTDB 1N0SA 3B2IA 5K68A 5L8OA 2FS7A 3U03A 5F6BA 2R56A 1NP1A 4LKPA 2L9CA 1HY2A 4OKAA 4RUUA 1W6FA 1VYOA 5CHKA 1ZNEA 2PY1A 2RTMA 4XMFA 2AKQA 1K24A 4YGHA 1IFCA 4I3CA 4CSBA 2PI3O 4OELA 2EU7X 3OD9A 1JV4A 4COTA 4ZGUA 2BLGA 2BT9A 3FA9A 1E02A 4I3BA 1VWBB 2G5LA 4AZNA 2HZRA 5AJBA 3NX2A 1EI5A 4ZJ0A 1BSYA 3ZW0A 1W4TA 3BY0A 3NP1A 1GX9A 5HZ6A 4NNSA 1MEPA 3ELZA 1SWBA 5LJCA 2Q39A 4ZHGA 2XSTA 4GRJA 1JZUA 1VWLB 1MX8A 1D2UA 4OMWA 3RDOA 1GXAA 1SWSA 3O22A 2QO4A 4GJVA 3FDCA 4ZHDA 3B2KA 1DZMA 1G7NA 3T2WA 1UYNX 3JS1A 5B2AO 2FHLA 1XKIA 1X89A 3S26A 3VHMA 1S44A 3K3LA 2W2AA 1JMZA 1NQMA 2RCTA 3CBSA 2MWHA 3KFIA 5LJKA 2RTKA 4JGLA 3WYQA 5BVTA 1KZWA 1LNMA 1AVGI 4PJ2A 4D6AA 3C78X 1I05A 4Y5DA 1OPBA 2R74A 4OEMA 3T6LA 4DNEA 1BM5A 1KT4A 1WUBA 2ACPX 3KFFA 1IW2A 2X8TA 2RTJA 1ICMA 2R73A 2RTAA 3PQUA 3ZI8A 2P8GA 2HLVA 4O49A 3JSQA 4NYQA 2W2FA 5HZ9A 5CE4A 4YKOA 1FDQA 1VWAB 5EEEA 1SWJA 3FR4A 1SWQA 1VWDB 5B3MO 5IO7A 1SWFA 3NPOA 4HPCA 4QYPA 4Y0PA 2CM9A 4TKBA 2I5VO 4AZMA 1B8EA 2AT6X 2BC3A 2FR2A 1LIBA 2IZDB 1O1UA 3I0AA 3V8UA 4YCHA 3WOVA 4YDAA 1GX3A 1NP4A 2FT9A 2IZIA 4UU3A 4A8ZA 5FENA 1CRBA 1MVGA 4HWMA 4YDBA 3WZNA 2M4LA 2Q9SA 4CDFA 1GM6A 1QY1A 1VWCB 3PH6A 2RTGB 4GE1A 4O4SA 4D6BA 3WZOA 4YGZA 1SWKA 1LFOA 1VWFB 4NV7A 4ORRA 1IKJA 1TW4A 2X32A 1STRB 3HWEA 1KT3A 2RTFB 4Y0QA 1ALBA 4ORWA 1HN2A 4NLJA 4U8UN 2WEWA 3AUMO 3RWXA 4LZVA 4BBOA 3TZSA 4HPBA 4GETA 4IRWA 4YVBA 3VG4A 1YP7A 4KC7A 5BVSA 1QY0A 3MG5A 1K3BA 1QY2A 2RN4A 3BDRA 1Y52X 3FELA 3LTWA 4GDAA 4AYHA 1HMSA 5D4AA 4O9SA 2VFBA 3IFBA 4O3XB 5H9LA 2YG2A 3KVNA 1BJ7A 3FEKA 2IZBA 2F01A 1U18A 2RTLA 3BRNA 3GE2A 4HFOA 4GGZA 3H3IA 1P6PA 2N93A 1I78A 5K06A 3RKGA 1GT4A 1NDJA 3PK2A 5KHPA 3P6CA 5DG4A 1N9YA 1SWUA 2FS6A 1N4JA 1EPAA 1SWDA 2MO5A 4FGIB 4U8UM 2FTBA 2YMSA 1ZNDA 5F58A 2RTRB 3HOEA 2LBAA 3WJDA 5BVQA 3BX8A 2OL7A 1KT6A 2BS6A 3E3CA 1VWQB 3DSZA 1EIOA 1SRGA 5LKEA 4CPIA 4NLIA 1QQSA 3I17A 2ASNX 2OFMX 1RXJA 2GTFX 2A5BA 2QCBA 3PPTA 3ZW0B 4CPFA 1KGLA 1UZ2X 4Y0SA 3CKFA 1I9HA 2IFBA 1Y55X 4LZUA 2RTCB 4M7MA 1LELA 1IKEA 3STNA 3WJCA 2X34A 1SWAA 5AEOA 4XMEA 5LJEA 2ZSCA 1KQXA 3PH5A 2AT8X 4QNIA 3CWKA 1TOWA 3SZIA 3KQ0A 1QWDA 3SLJA 3P6HA 3S5XA 3C77X 4U8UO 4DQ4A 3EW2A 3N91A 2L67A 2ZAIA 3F6ZB 1AVEA 4A1HA 1FTPA 2XKLA 1SRJA 2A2GA 5B5GA 3BSZE 4YFPA 4WFUA 1O1VA 4BX7A 1AQBA 1PMPA 1DFVA 5K67A 1SWTA 3AKNA 4IB7A 4QQ1A 3PP6A 3EM0A 4EXZA 4QAEA 3ZZVA 1AELA 4YGGA 4HPDA 4QZTA 2WPUA 2X56A 4KT5A 2GH7A 2NNQA 3HPEA 2OFRX 1SLDB 1U17A 2QMIA 5FFHA 4CV7A 1XCAA 5KIDA 2OVAA 1MK5A 2JOZA 1VWEB 1GGLA 2RTPB 5IRUA 5LKFA 3RDXA 3EMMA 4FBVA 5FAZA 4FQBB 4ID2A 1YP6A 3MVFA 4IB9A 3VE2A 1EXSA 2JN3A 2HKDA 2X46A 4IMNA 4ORXA 1WBIA 3SOTA 1SWRA 1X8PA 1OEJA 3B2JA 4ORUA 1G5WA 4XMGA 2VDFA 1LKEA 1E06A 1QFTA 4AW8A 4GJSA 5IO5A 1UYOX 5B27A 3VG3A 1HQPA 4TJZA 1SY1A 3HWDA 1UREA 5HCCC 2CBRA 2RA6A 3FENA 4QZUA 3STMX 3FW4A 2IZFB 4FBRA 1SXXA 4TKJA 3U9PC 2UYWA
chains in the Genus database with same CATH topology
1HBQA 3CBCA 1PM1X 4R0BA 4TKHA 4MISA 3APXA 4ZR2A 2G79A 3VG2A 3NR3A 5HA1A 3RZYA 4UU2A 5B29A 1Y9LA 2HMBA 1GKAA 3FR5A 3KFHA 1KT7A 2RQ0A 4GZVA 4NW4A 4EQAC 3WJGA 4YBUA 5HCDC 3D4RA 2W2BA 2ANSA 4GNYA 4YCEA 4ZHHA 1MX7A 2HZQA 1GX8A 5HWZA 1OBUA 3FYFA 2Q2MA 4FBOA 5EEDA 5HBSA 4MIRA 4U9CA 2QO6A 4TNNA 3VG5A 3UEXA 2WR6A 3MBTA 3P6DA 2HNXA 2HYSA 2L5PA 2OVEA 1MUPA 3FR2A 2F73A 3KFGA 1NGLA 5CYBA 5AQ6A 1BSQA 3G7XA 2JU7A 4ML7B 4ZGFA 1SY0A 4IMOA 2QO5A 4ORSA 3WVMA 4ZHCA 3L4RA 5F6ZA 2AT5X 4OS8A 4MVLA 3WJEA 1FE3A 1EUOA 3D95A 1JJXA 1X8OA 1ZNGA 1DC9A 1RBPA 2OVSA 3ZW1B 5FQ6E 2A13A 3DTQA 4GH7A 2LBVA 2WWPA 1MDCA 4I9SA 4O4UA 4QRLA 3S5VA 1ADLA 3UEWA 1BRPA 3BX7A 1TXLA 3PEDA 4L1NA 4Y0RA 2LFOA 1YWDA 1HMTA 4KIIA 4YBPA 4YFRA 1CBRA 5HAEA 3EBWA 4ZFXA 3LHNA 3VPJE 3OE3A 1LICA 1U0XA 4YKMA 4ALOA 3RBYA 4ZH9A 1H91A 3Q6LA 3UEUA 4XMHA 1O8VA 3NQ9A 2WQAE 3P6EA 1S7DA 4I9RA 1HMRA 3PQSA 5EDCA 1I06A 5C0NA 4GNWA 2ZAGA 2MM3A 3HTYA 5L8IA 2A2UA 2ACOA 4I6SA 4XMDA 4OMXA 5KICA 5EPQA 1YWCA 5BYPA 1SY2A 1SMPI 1ZNHA 3T1DA 3NQ3A 2CZTA 3JQOA 1VYFA 2QOSC 3NADA 3LV4A 4TLJA 1KXOA 1DZKA 1CBSA 1LIFA 3CR6A 2K62A 3FIQA 1RLBE 4IAXA 5HZ5A 4YH0A 3VG6A 4LQZA 3O19A 3CQNA 4AZRA 4CK4A 3F9DA 4MVKA 1Z24A 4GK9A 4KCAA 4O4OA 5HTDA 2A3FX 5D8JA 4MVIA 2NNEA 3VG7A 4GKCA 1R0UA 1DZJA 5LJGA 3ZWEA 3TGBA 1S2PA 1BWYA 1T68X 2DM5A 3P02A 1JBHA 2FR3A 1VPRA 4IAWA 1YWBA 1E5PA 3APWA 2CBSA 1JYJA 1VYGA 1ZRYA 2E4JA 1OPAA 4LKTA 4ES7A 4QGVA 1DV9A 1KZXA 2KTDA 3BU1A 4BOEA 3MX7A 3NX1A 4N7DA 2G7BA 1OEKA 1ERXA 1DZPA 5D45A 3U0DA 4K19A 3B2LA 4NYRA 3HWGA 2RCQA 4WHIA 4OS0A 4OS3A 2Q4NA 4YFQA 1GT1A 4QGXA 3FA8A 2POAA 1JYDA 4GDZA 3BU9A 4N7CA 3TF6A 3WJFA 1GT5A 1EW3A 2GC9A 5DPQA 2JMBA 2F09A 1BEBA 2NNDA 3HK1A 2X8FA 4DQ3A 4XMCA 1DF3A 1SA8A 3EBKA 1CBIA 4U3QA 1ICNA 3VE1A 2QM9A 4EEJA 2WQ9A 1Y9TA 4WBKA 4RUNA 1G74A 3CMPA 4ZHFA 4ON1A 1ERBA 1PBOA 2L68A 3WXQA 5F7GA 1ML7A 5HTEA 1X8QA 3APUA 1OEEA 2BS5A 4L3RA 2WUTA 3FLLA 1IFBA 2WSJA 3P24A 4IBAA 4I3DA 1X71A 1LPJA 4ODDA 1FENA 1OBQA 1YIVA 4A1YA 5H8TA 1LIDA 2JU3A 2OVDA 1KT5A 2X8SA 1CJ5A 2JU8A 4AZPA 5IO6A 3ELXA 4TQ2A 4AZQA 1BRQA 1QFVA 1X8UA 4IB6A 3WJBA 2Q2PA 5H9KA 1EALA 1B56A 2FLJA 1A57A 4ZH6A 4GU8A 5AJCA 1LIEA 2KW1A 2O62A 1L6MA 2X45A 4NP1A 4O3WA 4NNTA 4BVMA 5EDBA 1PEEA 2CZUA 3D96A 1A3YA 4ZCBA 3FA6A 3OJYC 1B0OA 5FQ8E 3VU1A 1OBPA 3P6GA 1YWAA 4EDEA 2A0AA 1IIUA 1KQWA 1T0VA 1YUPA 3PECA 4AZOA 1A18A 3F8AA 3NQKA 5EZ2A 3TGAA 1ACDA 3O2YA 2KTSA 3GAQA 3AKMA 2OZQA 2Z4IA 3IA8A 4YMYA 2GJ5A 2NP1A 1QABE 3ZQ3A 1G85A 3FEPA 3QKGA 2BHVA 2AT0X 2GTLN 1LF7A 1JJJA 4I95A 1HBPA 1FEMA 1ZNKA 4HPAA 2RD7C 2AL0X 3HWFA 2G78A 2FWVA 2KD2A 5F1EA 3UEVA 1KOIA 1EQDA 5D48A 1X8NA 3BLGA 5HZQA 4PSQA 5L8NA 2ALLX 5LJBA 2AT3X 1BBPA 2KT4B 3B2HA 4EFGA 5LJDA 3C76X 2FRSA 5D47A 3SAOA 4QYNA 5LJHA 1SXUA 1CBQA 3UAQA 1T8VA 2GTLM 3P6FA 3ZUIA 1SY3A 1B4MA 4O3ZA 1AB0A 4M6SA 1GT3A 2LB6A 3OBLA 3FW5A 4KH8A 2LA7A 4O3YA 5JR8A 1QG5A 3BS2A 4IABA 1ZNLA 4ALBA 1BSOA 1SXYA 4O4XA 2MHDA 3ZW2A 3TGCA 1GKAB 4IB8A 1JIWI 3D97A 3EYCA 1D3SA 5H9AA 4KC8A 1I04A 2JW1A 1TVQA 3FMZA 4INNA 2GTLO 2MJIA 2AMMX 3CQRA 4QGWA 2K23A 5HA0A 5FQ7E 3S60A 4MVEA 1I4UA 2LKKA 2Z4HA 2AH7X 3ZW1A 3FA7A 1EIIA 5HZ8A 5HCEC 3ZUOA 2CM4A 3RSWA 1E00A 3NBXX 4A60A 3KZAA 1A2DA 4WFVA 4BQUA 1TOUA 3HOLA 1SXWA 3APVA 3STKA 3WBGA 4DQ4A 1EPBA 5HZ6A 4ORYA 4ARHA 1FELA 5H9NA 1BLRA 1N0SA 3B2IA 5L8OA 2FS7A 3U03A 5F6BA 2R56A 1NP1A 4LKPA 2L9CA 4RUUA 1ZNEA 2PY1A 4XMFA 2AKQA 4YGHA 1IFCA 4I3CA 4CSBA 2EU7X 3OD9A 1JV4A 4COTA 4ZGUA 2BLGA 2BT9A 3FA9A 1E02A 4I3BA 4AZNA 2HZRA 5AJBA 3NX2A 1EI5A 4ZJ0A 1BSYA 3ZW0A 3BY0A 3NP1A 1GX9A 4NNSA 3ELZA 5LJCA 2Q39A 4ZHGA 2XSTA 4GRJA 1JZUA 1MX8A 1D2UA 4OMWA 1GXAA 3O22A 2QO4A 4ZHDA 3B2KA 1DZMA 1G7NA 3JS1A 1XKIA 1X89A 3S26A 1S44A 3K3LA 2W2AA 3CBSA 2RCTA 3KFIA 2MWHA 5LJKA 5BVTA 4JGLA 1KZWA 1LNMA 1AVGI 4PJ2A 4D6AA 3C78X 1I05A 1OPBA 2R74A 1BM5A 1KT4A 2ACPX 3KFFA 1IW2A 2X8TA 1ICMA 2R73A 3PQUA 3ZI8A 2P8GA 2HLVA 4O49A 3JSQA 4NYQA 2W2FA 5HZ9A 5CE4A 4YKOA 1FDQA 5EEEA 3FR4A 5IO7A 3NPOA 4HPCA 4QYPA 4Y0PA 2CM9A 4TKBA 4AZMA 1B8EA 2AT6X 2FR2A 3I0AA 1LIBA 3V8UA 1O1UA 4YCHA 3WOVA 4YDAA 5FENA 1NP4A 2FT9A 4UU3A 4A8ZA 1CRBA 1MVGA 4HWMA 4YDBA 2M4LA 2Q9SA 1GM6A 1QY1A 4GE1A 3PH6A 4D6BA 4O4SA 4YGZA 1LFOA 4ORRA 1IKJA 1TW4A 3HWEA 1KT3A 4Y0QA 1ALBA 4ORWA 1HN2A 4NLJA 4U8UN 2WEWA 3RWXA 4LZVA 3TZSA 4HPBA 4GETA 3VG4A 1YP7A 4KC7A 5BVSA 1QY0A 1QY2A 2RN4A 3BDRA 3FELA 4AYHA 1HMSA 5D4AA 4O9SA 4O3XB 3IFBA 5H9LA 2YG2A 1BJ7A 3FEKA 3BRNA 1U18A 3GE2A 4HFOA 3H3IA 1P6PA 2N93A 5K06A 3RKGA 1GT4A 5KHPA 3P6CA 5DG4A 2FS6A 1EPAA 2MO5A 4FGIB 4U8UM 2FTBA 2YMSA 1ZNDA 5F58A 3HOEA 2LBAA 3WJDA 5BVQA 3BX8A 1KT6A 2BS6A 3E3CA 3DSZA 1EIOA 5LKEA 4NLIA 1QQSA 3I17A 2ASNX 2OFMX 3PPTA 2GTFX 3ZW0B 1KGLA 1UZ2X 4Y0SA 2IFBA 4LZUA 4M7MA 1IKEA 3STNA 3WJCA 5AEOA 4XMEA 5LJEA 3PH5A 1KQXA 2AT8X 4QNIA 3CWKA 1TOWA 3KQ0A 1QWDA 3P6HA 3S5XA 3C77X 4U8UO 3N91A 2L67A 2ZAIA 3F6ZB 4A1HA 1FTPA 2XKLA 2A2GA 3BSZE 4YFPA 4WFUA 1O1VA 1AQBA 1PMPA 1DFVA 3AKNA 4IB7A 4QQ1A 3PP6A 3EM0A 4EXZA 4QAEA 3ZZVA 1AELA 4YGGA 4HPDA 4QZTA 4KT5A 2NNQA 2OFRX 1U17A 2QMIA 5KIDA 5FFHA 4CV7A 1XCAA 2OVAA 2JOZA 1GGLA 5LKFA 3EMMA 4FBVA 5FAZA 4FQBB 4ID2A 1YP6A 3MVFA 4IB9A 3VE2A 1EXSA 2JN3A 4IMNA 2X46A 4ORXA 3SOTA 1X8PA 1OEJA 3B2JA 4ORUA 1G5WA 4XMGA 1LKEA 1E06A 1QFTA 4AW8A 5IO5A 5B27A 3VG3A 1HQPA 4TJZA 1SY1A 3HWDA 1UREA 5HCCC 2CBRA 2RA6A 3FENA 4QZUA 3STMX 3FW4A 2WEXA 4FBRA 1SXXA 4TKJA 3U9PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HBQ A;  3CBC A;  1PM1 X;  4R0B A;  4TKH A;  3APX A;  4ZR2 A;  2G79 A;  3VG2 A;  3NR3 A;  5HA1 A;  3RZY A;  4UU2 A;  5B29 A;  2HMB A;  1GKA A;  3FR5 A;  3KFH A;  1KT7 A;  2RQ0 A;  3WJG A;  4YBU A;  5HCD C;  4GNY A;  2W2B A;  2ANS A;  4ZHH A;  4YCE A;  1MX7 A;  2HZQ A;  1GX8 A;  5HWZ A;  1OBU A;  2Q2M A;  5EED A;  5HBS A;  2QO6 A;  4TNN A;  3VG5 A;  3UEX A;  2WR6 A;  3MBT A;  3P6D A;  2HNX A;  2HYS A;  2L5P A;  2OVE A;  1MUP A;  3FR2 A;  2F73 A;  3KFG A;  1NGL A;  5AQ6 A;  1BSQ A;  3G7X A;  2JU7 A;  1SY0 A;  4IMO A;  2QO5 A;  4ORS A;  3WVM A;  4ZHC A;  3L4R A;  5F6Z A;  2AT5 X;  4OS8 A;  4MVL A;  3WJE A;  1FE3 A;  1EUO A;  3D95 A;  1JJX A;  1X8O A;  1ZNG A;  1DC9 A;  1RBP A;  2A13 A;  3DTQ A;  4GH7 A;  2LBV A;  2WWP A;  1MDC A;  4I9S A;  1ADL A;  3UEW A;  1BRP A;  3BX7 A;  1TXL A;  3PED A;  4Y0R A;  2LFO A;  1YWD A;  1HMT A;  4KII A;  4YBP A;  4YFR A;  1CBR A;  5HAE A;  3EBW A;  4ZFX A;  1LIC A;  1U0X A;  4YKM A;  4ALO A;  4ZH9 A;  1H91 A;  3Q6L A;  3UEU A;  4XMH A;  1O8V A;  3NQ9 A;  2WQA E;  3P6E A;  1S7D A;  4I9R A;  1HMR A;  5EDC A;  1I06 A;  5C0N A;  4GNW A;  2MM3 A;  5L8I A;  2A2U A;  2ACO A;  4XMD A;  4OMX A;  5KIC A;  5EPQ A;  1YWC A;  1SY2 A;  1ZNH A;  3T1D A;  3NQ3 A;  2CZT A;  1VYF A;  2QOS C;  3NAD A;  4TLJ A;  1KXO A;  1DZK A;  1CBS A;  1LIF A;  3CR6 A;  2K62 A;  3FIQ A;  1RLB E;  4IAX A;  5HZ5 A;  4YH0 A;  3VG6 A;  3O19 A;  3CQN A;  4AZR A;  4CK4 A;  3F9D A;  4MVK A;  1Z24 A;  5HTD A;  2A3F X;  5D8J A;  4MVI A;  2NNE A;  3VG7 A;  4GKC A;  1R0U A;  1DZJ A;  5LJG A;  3TGB A;  1S2P A;  1BWY A;  1T68 X;  2DM5 A;  1JBH A;  2FR3 A;  1VPR A;  4IAW A;  1YWB A;  1E5P A;  3APW A;  2CBS A;  1JYJ A;  1VYG A;  1ZRY A;  2E4J A;  1OPA A;  4LKT A;  4ES7 A;  4QGV A;  1DV9 A;  1KZX A;  2KTD A;  3BU1 A;  4BOE A;  3NX1 A;  4N7D A;  2G7B A;  1OEK A;  1ERX A;  1DZP A;  5D45 A;  3U0D A;  4K19 A;  3B2L A;  4NYR A;  3HWG A;  2RCQ A;  4OS0 A;  4OS3 A;  2Q4N A;  4YFQ A;  1GT1 A;  4QGX A;  3FA8 A;  2POA A;  1JYD A;  3TF6 A;  3BU9 A;  4N7C A;  3WJF A;  1GT5 A;  1EW3 A;  2GC9 A;  5DPQ A;  2NND A;  1BEB A;  3HK1 A;  4DQ3 A;  4XMC A;  1DF3 A;  1SA8 A;  3EBK A;  1CBI A;  1ICN A;  2QM9 A;  4EEJ A;  2WQ9 A;  4WBK A;  4RUN A;  1G74 A;  3CMP A;  4ZHF A;  1ERB A;  1PBO A;  2L68 A;  3WXQ A;  5F7G A;  1ML7 A;  5HTE A;  1X8Q A;  3APU A;  1OEE A;  2WUT A;  3FLL A;  1IFB A;  2WSJ A;  4IBA A;  4I3D A;  1X71 A;  1LPJ A;  4ODD A;  1FEN A;  1OBQ A;  1YIV A;  4A1Y A;  5H8T A;  1LID A;  2JU3 A;  2OVD A;  1KT5 A;  1CJ5 A;  2JU8 A;  4AZP A;  5IO6 A;  3ELX A;  4TQ2 A;  4AZQ A;  1BRQ A;  1QFV A;  1X8U A;  4IB6 A;  3WJB A;  2Q2P A;  5H9K A;  1EAL A;  1B56 A;  2FLJ A;  1A57 A;  4ZH6 A;  1LIE A;  2O62 A;  1L6M A;  2X45 A;  4NP1 A;  4BVM A;  4NNT A;  5EDB A;  1PEE A;  2CZU A;  3D96 A;  1A3Y A;  4ZCB A;  3FA6 A;  3OJY C;  1B0O A;  1OBP A;  3P6G A;  1YWA A;  4EDE A;  2A0A A;  1IIU A;  1KQW A;  1T0V A;  1YUP A;  3PEC A;  4AZO A;  1A18 A;  3F8A A;  5EZ2 A;  3TGA A;  1ACD A;  3O2Y A;  3GAQ A;  3AKM A;  2OZQ A;  3IA8 A;  4YMY A;  2GJ5 A;  2NP1 A;  1QAB E;  3ZQ3 A;  1G85 A;  3FEP A;  3QKG A;  2AT0 X;  1LF7 A;  1JJJ A;  1HBP A;  1FEM A;  1ZNK A;  4HPA A;  2RD7 C;  2AL0 X;  3HWF A;  2G78 A;  2FWV A;  5F1E A;  3UEV A;  1KOI A;  1EQD A;  5D48 A;  1X8N A;  3BLG A;  5HZQ A;  4PSQ A;  5L8N A;  2ALL X;  5LJB A;  2AT3 X;  1BBP A;  2KT4 B;  3B2H A;  4EFG A;  5LJD A;  3C76 X;  2FRS A;  5D47 A;  3SAO A;  4QYN A;  5LJH A;  1SXU A;  1CBQ A;  1T8V A;  3P6F A;  3ZUI A;  1SY3 A;  1B4M A;  1AB0 A;  4M6S A;  1GT3 A;  2LB6 A;  3FW5 A;  5JR8 A;  1QG5 A;  3BS2 A;  1ZNL A;  4ALB A;  1BSO A;  1SXY A;  3TGC A;  1GKA B;  4IB8 A;  3D97 A;  3EYC A;  1D3S A;  5H9A A;  1I04 A;  1TVQ A;  3FMZ A;  3CQR A;  2MJI A;  2AMM X;  4QGW A;  2K23 A;  5HA0 A;  1I4U A;  2LKK A;  2AH7 X;  3FA7 A;  1EII A;  5HZ8 A;  5HCE C;  3ZUO A;  2CM4 A;  3RSW A;  1E00 A;  4A60 A;  3KZA A;  1A2D A;  4WFV A;  4BQU A;  1TOU A;  1SXW A;  3APV A;  3STK A;  3WBG A;  4DQ4 A;  1EPB A;  5HZ6 A;  4ORY A;  4ARH A;  1FEL A;  5H9N A;  1BLR A;  1N0S A;  3B2I A;  5L8O A;  2FS7 A;  3U03 A;  5F6B A;  2R56 A;  1NP1 A;  4LKP A;  2L9C A;  4RUU A;  1ZNE A;  2PY1 A;  4XMF A;  2AKQ A;  4YGH A;  1IFC A;  4I3C A;  2EU7 X;  4ZGU A;  1JV4 A;  2BLG A;  3FA9 A;  1E02 A;  4I3B A;  4AZN A;  2HZR A;  3NX2 A;  4ZJ0 A;  1BSY A;  3BY0 A;  3NP1 A;  1GX9 A;  4NNS A;  3ELZ A;  5LJC A;  2Q39 A;  4ZHG A;  2XST A;  4GRJ A;  1JZU A;  1MX8 A;  1D2U A;  4OMW A;  1GXA A;  3O22 A;  2QO4 A;  4ZHD A;  3B2K A;  1DZM A;  1G7N A;  3JS1 A;  1XKI A;  1X89 A;  3S26 A;  1S44 A;  3K3L A;  2W2A A;  3CBS A;  2RCT A;  3KFI A;  5LJK A;  5BVT A;  1KZW A;  1LNM A;  1AVG I;  4D6A A;  3C78 X;  1I05 A;  1OPB A;  2R74 A;  1BM5 A;  1KT4 A;  2ACP X;  3KFF A;  1IW2 A;  1ICM A;  2R73 A;  2P8G A;  2HLV A;  3JSQ A;  4NYQ A;  2W2F A;  5HZ9 A;  5CE4 A;  4YKO A;  1FDQ A;  5EEE A;  3FR4 A;  5IO7 A;  3NPO A;  4HPC A;  4QYP A;  4Y0P A;  2CM9 A;  4TKB A;  4AZM A;  1B8E A;  2AT6 X;  2FR2 A;  3I0A A;  1LIB A;  1O1U A;  4YCH A;  4YDA A;  5FEN A;  1NP4 A;  2FT9 A;  4UU3 A;  4A8Z A;  1CRB A;  1MVG A;  4YDB A;  2Q9S A;  1GM6 A;  1QY1 A;  4GE1 A;  3PH6 A;  4D6B A;  4YGZ A;  1LFO A;  4ORR A;  1IKJ A;  1TW4 A;  3HWE A;  1KT3 A;  4Y0Q A;  1ALB A;  4ORW A;  1HN2 A;  4NLJ A;  2WEW A;  4LZV A;  3TZS A;  4HPB A;  4GET A;  3VG4 A;  1YP7 A;  5BVS A;  1QY0 A;  1QY2 A;  3BDR A;  3FEL A;  4AYH A;  1HMS A;  5D4A A;  4O9S A;  3IFB A;  5H9L A;  2YG2 A;  1BJ7 A;  3FEK A;  3BRN A;  1U18 A;  4HFO A;  1P6P A;  2N93 A;  5K06 A;  1GT4 A;  5KHP A;  3P6C A;  5DG4 A;  2FS6 A;  1EPA A;  2MO5 A;  2FTB A;  1ZND A;  5F58 A;  2LBA A;  3WJD A;  5BVQ A;  3BX8 A;  1KT6 A;  3DSZ A;  1EIO A;  5LKE A;  4NLI A;  1QQS A;  3I17 A;  2ASN X;  2OFM X;  3PPT A;  2GTF X;  1KGL A;  1UZ2 X;  4Y0S A;  2IFB A;  4LZU A;  4M7M A;  1IKE A;  3STN A;  3WJC A;  4XME A;  5LJE A;  3PH5 A;  1KQX A;  2AT8 X;  3CWK A;  1TOW A;  3KQ0 A;  1QWD A;  3P6H A;  3C77 X;  2L67 A;  4A1H A;  1FTP A;  2XKL A;  2A2G A;  3BSZ E;  4YFP A;  4WFU A;  1O1V A;  1AQB A;  1PMP A;  1DFV A;  3AKN A;  4IB7 A;  3PP6 A;  3EM0 A;  4EXZ A;  4QAE A;  1AEL A;  4YGG A;  4HPD A;  4QZT A;  2NNQ A;  2OFR X;  1U17 A;  5KID A;  5FFH A;  1XCA A;  2OVA A;  2JOZ A;  1GGL A;  5LKF A;  3EMM A;  5FAZ A;  1YP6 A;  3MVF A;  4IB9 A;  1EXS A;  2JN3 A;  4IMN A;  2X46 A;  4ORX A;  1X8P A;  1OEJ A;  3B2J A;  4ORU A;  1G5W A;  4XMG A;  1LKE A;  1E06 A;  1QFT A;  4AW8 A;  5IO5 A;  5B27 A;  3VG3 A;  1HQP A;  4TJZ A;  1SY1 A;  3HWD A;  1URE A;  5HCC C;  2CBR A;  2RA6 A;  3FEN A;  4QZU A;  3STM X;  3FW4 A;  2WEX A;  1SXX A;  4TKJ A;  3U9P C; 
#chains in the Genus database with same CATH topology
 1HBQ A;  3CBC A;  1PM1 X;  4JHQ A;  1SWL A;  4R0B A;  2CAM A;  4TKH A;  1SRE A;  4MIS A;  3APX A;  1SWH A;  1PTS A;  4ZR2 A;  2G79 A;  3VG2 A;  3NR3 A;  5HA1 A;  3RY2 A;  3RZY A;  2FKJ A;  4UU2 A;  5B29 A;  2RTE B;  1LDO A;  1Y9L A;  2HMB A;  1GKA A;  3FR5 A;  1SLE B;  3KFH A;  2IZA A;  1KT7 A;  2RQ0 A;  4GZV A;  4NW4 A;  3RDQ A;  3T2X A;  3WJG A;  2X55 A;  4YBU A;  4EQA C;  5HCD C;  3D4R A;  2W2B A;  2ANS A;  4GNY A;  4YCE A;  4ZHH A;  1MX7 A;  2HZQ A;  1VWK B;  1N9M A;  1GX8 A;  3AEH A;  5HWZ A;  1OBU A;  2DJG A;  2Q2M A;  3FYF A;  4FBO A;  5EED A;  1MOY A;  2A5C A;  3PDF A;  5HBS A;  4MIR A;  4U9C A;  2QO6 A;  4TNN A;  3VG5 A;  3UEX A;  2WR6 A;  3MBT A;  3P6D A;  2I5Z O;  4BGF A;  2HNX A;  1SRI A;  2HYS A;  2L5P A;  2OVE A;  1MUP A;  4CPH A;  3FR2 A;  2F73 A;  3KFG A;  2RTN B;  1NGL A;  5CYB A;  5AQ6 A;  1BSQ A;  3G7X A;  2JU7 A;  4ML7 B;  4Z2V A;  1SY0 A;  4IMO A;  2QO5 A;  4ORS A;  4ZGF A;  3WVM A;  4ZHC A;  3L4R A;  3VHH A;  1MM9 A;  2AT5 X;  4OS8 A;  5F6Z A;  4MVL A;  3WJE A;  1FE3 A;  1EUO A;  3D95 A;  2OY5 O;  1X8O A;  1JJX A;  2OFA A;  5B5F A;  4CDC A;  1W5R A;  1ZNG A;  1DC9 A;  4BJ8 A;  1RBP A;  2OVS A;  3ZW1 B;  5FQ6 E;  2A13 A;  3T6F A;  3DTQ A;  4GH7 A;  2LBV A;  2WWP A;  1MDC A;  4I9S A;  4O4U A;  4QRL A;  3S5V A;  1ADL A;  4EKV A;  3UEW A;  1BRP A;  3BX7 A;  1TXL A;  3PED A;  4L1N A;  4Y0R A;  2LFO A;  1YWD A;  1STS B;  2C4I A;  1HMT A;  4KII A;  4YBP A;  4YFR A;  1CBR A;  5HAE A;  3EBW A;  2IZK A;  4ZFX A;  3LHN A;  3VPJ E;  3OE3 A;  4BX6 B;  1LIC A;  1U0X A;  4YKM A;  4ALO A;  1SLG B;  4ZH9 A;  1H91 A;  2UZ2 A;  3Q6L A;  4GGT A;  3RBY A;  3UEU A;  4XMH A;  1O8V A;  3NQ9 A;  2WQA E;  1HXL A;  3P6E A;  3SLO A;  1S7D A;  4I9R A;  1HMR A;  1RSU B;  3PQS A;  3QQ2 A;  5EDC A;  2OL6 O;  1VWI B;  1I06 A;  1FJ1 E;  1LDQ A;  3D9W A;  4GNW A;  2ZAG A;  2MM3 A;  1VWH B;  3HTY A;  5L8I A;  5C0N A;  2A2U A;  2ACO A;  2IZL B;  4I6S A;  4XMD A;  1SWC A;  4OMX A;  4CDE A;  5KIC A;  5EPQ A;  1YWC A;  5BYP A;  1SY2 A;  1SMP I;  1LUQ A;  1ZNH A;  1JMX A;  4DCB A;  3T1D A;  3NQ3 A;  2CZT A;  4I60 A;  3SZH A;  3JQO A;  1VYF A;  2QOS C;  3NAD A;  3LV4 A;  1OSP O;  4TLJ A;  1KXO A;  1DZK A;  1CBS A;  1LIF A;  3CR6 A;  3RDM A;  2K62 A;  2C1S A;  3EW1 A;  3FIQ A;  1RLB E;  4IAX A;  5HZ5 A;  4YH0 A;  3VG6 A;  1NQN A;  4GD9 A;  4LQZ A;  5JD2 A;  3O19 A;  3CQN A;  1KFF A;  1RST B;  3RE6 A;  5B10 O;  4AZR A;  3WZP A;  4CK4 A;  4BX5 B;  1N7Y A;  3F9D A;  4MVK A;  1Z24 A;  4GK9 A;  4KCA A;  4O4O A;  5HTD A;  4GGR A;  2A3F X;  5D8J A;  2RTI B;  4MVI A;  2NNE A;  1VWR B;  4GKC A;  1R0U A;  1DZJ A;  5LJG A;  3VG7 A;  3ZWE A;  3TGB A;  1S2P A;  1BWY A;  1T68 X;  2X4M A;  2DM5 A;  1N43 A;  2A8G A;  3P02 A;  2FR3 A;  1JBH A;  1VPR A;  4IAW A;  4BCS A;  3VHI A;  1YWB A;  1E5P A;  3APW A;  5IRW A;  1JYJ A;  2CBS A;  1VYG A;  1ZRY A;  2E4J A;  1OPA A;  2IZC B;  4LKT A;  4ES7 A;  4QGV A;  1DV9 A;  1KZX A;  2KTD A;  3BU1 A;  4BOE A;  3MX7 A;  1Y53 X;  3NX1 A;  4N7D A;  2FHN X;  2G7B A;  2OY7 A;  1OEK A;  1ERX A;  1DZP A;  5D45 A;  3U0D A;  4K19 A;  3B2L A;  2Y3F A;  4NYR A;  3HWG A;  2RCQ A;  2VFC A;  4WHI A;  4OS0 A;  4OS3 A;  2Q4N A;  4YFQ A;  4BX5 A;  1GT1 A;  4QGX A;  3FA8 A;  2POA A;  1JYD A;  1RAV A;  4Z2O A;  4GDZ A;  3BU9 A;  1NBX A;  4N7C A;  3TF6 A;  2RTB B;  3WJF A;  1Y0G A;  1GT5 A;  1EW3 A;  2GC9 A;  5DPQ A;  2JMB A;  2F09 A;  1BEB A;  2NND A;  3HK1 A;  2X8F A;  4DQ3 A;  4XMC A;  1DF3 A;  1VWG B;  1SA8 A;  3EBK A;  1CBI A;  1KL5 A;  1ICN A;  4U3Q A;  1KL3 A;  3VE1 A;  2FGS A;  2QM9 A;  3WZQ A;  4EEJ A;  2WQ9 A;  4CDD A;  1Y9T A;  2IZH B;  4RUN A;  1G74 A;  3CMP A;  4WBK A;  4ZHF A;  4ON1 A;  1ERB A;  1PBO A;  2L68 A;  3WXQ A;  5F7G A;  1ML7 A;  5HTE A;  3RY1 A;  4Z28 A;  1X8Q A;  3APU A;  1OEE A;  2BS5 A;  4L3R A;  2WUT A;  2OL8 O;  2RTQ B;  3X00 A;  3FLL A;  1IFB A;  2WSJ A;  3P24 A;  4IBA A;  3RDS A;  4I3D A;  1SWO A;  1LPJ A;  1X71 A;  4ODD A;  1FEN A;  1OBQ A;  1YIV A;  4A1Y A;  5H8T A;  1VWO B;  1LID A;  2JU3 A;  2OVD A;  1KT5 A;  2X8S A;  1CJ5 A;  2JU8 A;  4AZP A;  5IO6 A;  1SWP A;  3ELX A;  4TQ2 A;  1RXK A;  4AZQ A;  1BRQ A;  1QFV A;  1X8U A;  4IB6 A;  3WJB A;  2Q2P A;  5H9K A;  4B55 A;  1EAL A;  1B56 A;  2FLJ A;  4CPE A;  1A57 A;  4ZH6 A;  4GU8 A;  5AJC A;  2RTH B;  1LIE A;  2KW1 A;  4Y59 A;  2O62 A;  2IZE B;  1L6M A;  2X45 A;  4NP1 A;  4O3W A;  4NNT A;  4BVM A;  5EDB A;  1PEE A;  2Y3E A;  2CZU A;  2IZJ A;  1A3Y A;  3D96 A;  4ZCB A;  3FA6 A;  3OJY C;  1B0O A;  1VWP B;  2OFB A;  5FQ8 E;  3VU1 A;  1OBP A;  3P6G A;  1YWA A;  4JNJ A;  4EDE A;  1NC9 A;  2A0A A;  1LCW A;  1IIU A;  1KQW A;  2DJF A;  4NV8 A;  1IJ8 A;  1T0V A;  1YUP A;  3PEC A;  2Y32 A;  4AZO A;  5L3Y A;  1A18 A;  3F8A A;  3NQK A;  1RXH A;  5EZ2 A;  1ACD A;  2OY8 A;  2KTS A;  3O2Y A;  3TGA A;  3GAQ A;  3AKM A;  5IRA A;  2OZQ A;  2Z4I A;  2G8C O;  3IA8 A;  4YMY A;  2GJ5 A;  2NP1 A;  1JQP A;  1QAB E;  3ZQ3 A;  1G85 A;  3FEP A;  2AF5 A;  1SLF B;  2MF6 A;  3QKG A;  3WYP A;  2BHV A;  2AT0 X;  2IZG B;  2GTL N;  1LF7 A;  2AVI A;  4BX7 B;  1JJJ A;  4I95 A;  1HBP A;  1FEM A;  1ZNK A;  4HPA A;  1PBY A;  3FID A;  2RD7 C;  2AL0 X;  3HWF A;  2G78 A;  2FWV A;  2KD2 A;  5F1E A;  3UEV A;  1KOI A;  1EQD A;  5D48 A;  1X8N A;  5IXG A;  3BLG A;  5HZQ A;  4Z2P A;  4PSQ A;  5L8N A;  2ALL X;  5LJB A;  2AT3 X;  1BBP A;  1SRH A;  2KT4 B;  4MEE A;  3B2H A;  4EFG A;  1E2T A;  4JO6 A;  5LJD A;  3C76 X;  2FRS A;  1SWG A;  5D47 A;  4QYN A;  3SAO A;  5LJH A;  1SXU A;  1CBQ A;  2FKG A;  3UAQ A;  3RE5 A;  1T8V A;  2GTL M;  4Z27 A;  3P6F A;  3ZUI A;  1SY3 A;  1B4M A;  4O3Z A;  1AB0 A;  4M6S A;  2OF9 A;  2C1Q A;  1GT3 A;  2LB6 A;  3OBL A;  3FW5 A;  4KH8 A;  5CSE A;  1HXZ A;  1SWN A;  2LA7 A;  4O3Y A;  3VGW A;  5JR8 A;  1QG5 A;  1SRF A;  3BS2 A;  4IAB A;  1ZNL A;  4ALB A;  1BSO A;  1SXY A;  5B11 O;  4O4X A;  2MHD A;  3ZW2 A;  2OYB O;  3TGC A;  3RDU A;  4Z6J A;  1GKA B;  4IB8 A;  1JIW I;  2OF8 A;  1VWJ B;  3D97 A;  3EYC A;  2OY1 O;  1D3S A;  5H9A A;  4KC8 A;  1I04 A;  2JW1 A;  1TVQ A;  3FMZ A;  4INN A;  1AVD A;  1DF8 A;  2AMM X;  2GTL O;  2MJI A;  2BSZ A;  2JGS A;  2K23 A;  3CQR A;  1VWM B;  3EC5 A;  4QGW A;  5HA0 A;  5FQ7 E;  4U46 A;  4MVE A;  1I4U A;  2LKK A;  2Z4H A;  5F2B A;  2AH7 X;  3FA7 A;  3S60 A;  3ZW1 A;  1EII A;  5HZ8 A;  3Q34 A;  5HCE C;  3ZUO A;  2CM4 A;  3RSW A;  4CPH B;  1E00 A;  2QOM A;  3NBX X;  1KL4 A;  4A60 A;  3MM0 A;  2RTO B;  3KZA A;  3CKG A;  1A2D A;  4WFV A;  1LCV A;  2WEX A;  4BQU A;  1TOU A;  4C5P A;  3HOL A;  1SXW A;  3APV A;  4GUZ A;  3STK A;  3WBG A;  1EPB A;  3SLT A;  3SZJ A;  1HQQ A;  1JJU A;  1SWE A;  1VWN B;  1STP A;  1LCZ A;  4ORY A;  4ARH A;  1FEL A;  5H9N A;  4BX6 A;  1BLR A;  2RTD B;  1N0S A;  3B2I A;  5K68 A;  5L8O A;  2FS7 A;  3U03 A;  5F6B A;  2R56 A;  1NP1 A;  4LKP A;  2L9C A;  1HY2 A;  4OKA A;  4RUU A;  1W6F A;  1VYO A;  5CHK A;  1ZNE A;  2PY1 A;  2RTM A;  4XMF A;  2AKQ A;  1K24 A;  4YGH A;  1IFC A;  4I3C A;  4CSB A;  2PI3 O;  4OEL A;  2EU7 X;  3OD9 A;  1JV4 A;  4COT A;  4ZGU A;  2BLG A;  2BT9 A;  3FA9 A;  1E02 A;  4I3B A;  1VWB B;  2G5L A;  4AZN A;  2HZR A;  5AJB A;  3NX2 A;  1EI5 A;  4ZJ0 A;  1BSY A;  3ZW0 A;  1W4T A;  3BY0 A;  3NP1 A;  1GX9 A;  5HZ6 A;  4NNS A;  1MEP A;  3ELZ A;  1SWB A;  5LJC A;  2Q39 A;  4ZHG A;  2XST A;  4GRJ A;  1JZU A;  1VWL B;  1MX8 A;  1D2U A;  4OMW A;  3RDO A;  1GXA A;  1SWS A;  3O22 A;  2QO4 A;  4GJV A;  3FDC A;  4ZHD A;  3B2K A;  1DZM A;  1G7N A;  3T2W A;  1UYN X;  3JS1 A;  5B2A O;  2FHL A;  1XKI A;  1X89 A;  3S26 A;  3VHM A;  1S44 A;  3K3L A;  2W2A A;  1JMZ A;  1NQM A;  2RCT A;  3CBS A;  2MWH A;  3KFI A;  5LJK A;  2RTK A;  4JGL A;  3WYQ A;  5BVT A;  1KZW A;  1LNM A;  1AVG I;  4PJ2 A;  4D6A A;  3C78 X;  1I05 A;  4Y5D A;  1OPB A;  2R74 A;  4OEM A;  3T6L A;  4DNE A;  1BM5 A;  1KT4 A;  1WUB A;  2ACP X;  3KFF A;  1IW2 A;  2X8T A;  2RTJ A;  1ICM A;  2R73 A;  2RTA A;  3PQU A;  3ZI8 A;  2P8G A;  2HLV A;  4O49 A;  3JSQ A;  4NYQ A;  2W2F A;  5HZ9 A;  5CE4 A;  4YKO A;  1FDQ A;  1VWA B;  5EEE A;  1SWJ A;  3FR4 A;  1SWQ A;  1VWD B;  5B3M O;  5IO7 A;  1SWF A;  3NPO A;  4HPC A;  4QYP A;  4Y0P A;  2CM9 A;  4TKB A;  2I5V O;  4AZM A;  1B8E A;  2AT6 X;  2BC3 A;  2FR2 A;  1LIB A;  2IZD B;  1O1U A;  3I0A A;  3V8U A;  4YCH A;  3WOV A;  4YDA A;  1GX3 A;  1NP4 A;  2FT9 A;  2IZI A;  4UU3 A;  4A8Z A;  5FEN A;  1CRB A;  1MVG A;  4HWM A;  4YDB A;  3WZN A;  2M4L A;  2Q9S A;  4CDF A;  1GM6 A;  1QY1 A;  1VWC B;  3PH6 A;  2RTG B;  4GE1 A;  4O4S A;  4D6B A;  3WZO A;  4YGZ A;  1SWK A;  1LFO A;  1VWF B;  4NV7 A;  4ORR A;  1IKJ A;  1TW4 A;  2X32 A;  1STR B;  3HWE A;  1KT3 A;  2RTF B;  4Y0Q A;  1ALB A;  4ORW A;  1HN2 A;  4NLJ A;  4U8U N;  2WEW A;  3AUM O;  3RWX A;  4LZV A;  4BBO A;  3TZS A;  4HPB A;  4GET A;  4IRW A;  4YVB A;  3VG4 A;  1YP7 A;  4KC7 A;  5BVS A;  1QY0 A;  3MG5 A;  1K3B A;  1QY2 A;  2RN4 A;  3BDR A;  1Y52 X;  3FEL A;  3LTW A;  4GDA A;  4AYH A;  1HMS A;  5D4A A;  4O9S A;  2VFB A;  3IFB A;  4O3X B;  5H9L A;  2YG2 A;  3KVN A;  1BJ7 A;  3FEK A;  2IZB A;  2F01 A;  1U18 A;  2RTL A;  3BRN A;  3GE2 A;  4HFO A;  4GGZ A;  3H3I A;  1P6P A;  2N93 A;  1I78 A;  5K06 A;  3RKG A;  1GT4 A;  1NDJ A;  3PK2 A;  5KHP A;  3P6C A;  5DG4 A;  1N9Y A;  1SWU A;  2FS6 A;  1N4J A;  1EPA A;  1SWD A;  2MO5 A;  4FGI B;  4U8U M;  2FTB A;  2YMS A;  1ZND A;  5F58 A;  2RTR B;  3HOE A;  2LBA A;  3WJD A;  5BVQ A;  3BX8 A;  2OL7 A;  1KT6 A;  2BS6 A;  3E3C A;  1VWQ B;  3DSZ A;  1EIO A;  1SRG A;  5LKE A;  4CPI A;  4NLI A;  1QQS A;  3I17 A;  2ASN X;  2OFM X;  1RXJ A;  2GTF X;  2A5B A;  2QCB A;  3PPT A;  3ZW0 B;  4CPF A;  1KGL A;  1UZ2 X;  4Y0S A;  3CKF A;  1I9H A;  2IFB A;  1Y55 X;  4LZU A;  2RTC B;  4M7M A;  1LEL A;  1IKE A;  3STN A;  3WJC A;  2X34 A;  1SWA A;  5AEO A;  4XME A;  5LJE A;  2ZSC A;  1KQX A;  3PH5 A;  2AT8 X;  4QNI A;  3CWK A;  1TOW A;  3SZI A;  3KQ0 A;  1QWD A;  3SLJ A;  3P6H A;  3S5X A;  3C77 X;  4U8U O;  4DQ4 A;  3EW2 A;  3N91 A;  2L67 A;  2ZAI A;  3F6Z B;  1AVE A;  4A1H A;  1FTP A;  2XKL A;  1SRJ A;  2A2G A;  5B5G A;  3BSZ E;  4YFP A;  4WFU A;  1O1V A;  4BX7 A;  1AQB A;  1PMP A;  1DFV A;  5K67 A;  1SWT A;  3AKN A;  4IB7 A;  4QQ1 A;  3PP6 A;  3EM0 A;  4EXZ A;  4QAE A;  3ZZV A;  1AEL A;  4YGG A;  4HPD A;  4QZT A;  2WPU A;  2X56 A;  4KT5 A;  2GH7 A;  2NNQ A;  3HPE A;  2OFR X;  1SLD B;  1U17 A;  2QMI A;  5FFH A;  4CV7 A;  1XCA A;  5KID A;  2OVA A;  1MK5 A;  2JOZ A;  1VWE B;  1GGL A;  2RTP B;  5IRU A;  5LKF A;  3RDX A;  3EMM A;  4FBV A;  5FAZ A;  4FQB B;  4ID2 A;  1YP6 A;  3MVF A;  4IB9 A;  3VE2 A;  1EXS A;  2JN3 A;  2HKD A;  2X46 A;  4IMN A;  4ORX A;  1WBI A;  3SOT A;  1SWR A;  1X8P A;  1OEJ A;  3B2J A;  4ORU A;  1G5W A;  4XMG A;  2VDF A;  1LKE A;  1E06 A;  1QFT A;  4AW8 A;  4GJS A;  5IO5 A;  1UYO X;  5B27 A;  3VG3 A;  1HQP A;  4TJZ A;  1SY1 A;  3HWD A;  1URE A;  5HCC C;  2CBR A;  2RA6 A;  3FEN A;  4QZU A;  3STM X;  3FW4 A;  2IZF B;  4FBR A;  1SXX A;  4TKJ A;  3U9P C;  2UYW A; 
#chains in the Genus database with same CATH homology
 1HBQ A;  3CBC A;  1PM1 X;  4R0B A;  4TKH A;  4MIS A;  3APX A;  4ZR2 A;  2G79 A;  3VG2 A;  3NR3 A;  5HA1 A;  3RZY A;  4UU2 A;  5B29 A;  1Y9L A;  2HMB A;  1GKA A;  3FR5 A;  3KFH A;  1KT7 A;  2RQ0 A;  4GZV A;  4NW4 A;  4EQA C;  3WJG A;  4YBU A;  5HCD C;  3D4R A;  2W2B A;  2ANS A;  4GNY A;  4YCE A;  4ZHH A;  1MX7 A;  2HZQ A;  1GX8 A;  5HWZ A;  1OBU A;  3FYF A;  2Q2M A;  4FBO A;  5EED A;  5HBS A;  4MIR A;  4U9C A;  2QO6 A;  4TNN A;  3VG5 A;  3UEX A;  2WR6 A;  3MBT A;  3P6D A;  2HNX A;  2HYS A;  2L5P A;  2OVE A;  1MUP A;  3FR2 A;  2F73 A;  3KFG A;  1NGL A;  5CYB A;  5AQ6 A;  1BSQ A;  3G7X A;  2JU7 A;  4ML7 B;  4ZGF A;  1SY0 A;  4IMO A;  2QO5 A;  4ORS A;  3WVM A;  4ZHC A;  3L4R A;  5F6Z A;  2AT5 X;  4OS8 A;  4MVL A;  3WJE A;  1FE3 A;  1EUO A;  3D95 A;  1JJX A;  1X8O A;  1ZNG A;  1DC9 A;  1RBP A;  2OVS A;  3ZW1 B;  5FQ6 E;  2A13 A;  3DTQ A;  4GH7 A;  2LBV A;  2WWP A;  1MDC A;  4I9S A;  4O4U A;  4QRL A;  3S5V A;  1ADL A;  3UEW A;  1BRP A;  3BX7 A;  1TXL A;  3PED A;  4L1N A;  4Y0R A;  2LFO A;  1YWD A;  1HMT A;  4KII A;  4YBP A;  4YFR A;  1CBR A;  5HAE A;  3EBW A;  4ZFX A;  3LHN A;  3VPJ E;  3OE3 A;  1LIC A;  1U0X A;  4YKM A;  4ALO A;  3RBY A;  4ZH9 A;  1H91 A;  3Q6L A;  3UEU A;  4XMH A;  1O8V A;  3NQ9 A;  2WQA E;  3P6E A;  1S7D A;  4I9R A;  1HMR A;  3PQS A;  5EDC A;  1I06 A;  5C0N A;  4GNW A;  2ZAG A;  2MM3 A;  3HTY A;  5L8I A;  2A2U A;  2ACO A;  4I6S A;  4XMD A;  4OMX A;  5KIC A;  5EPQ A;  1YWC A;  5BYP A;  1SY2 A;  1SMP I;  1ZNH A;  3T1D A;  3NQ3 A;  2CZT A;  3JQO A;  1VYF A;  2QOS C;  3NAD A;  3LV4 A;  4TLJ A;  1KXO A;  1DZK A;  1CBS A;  1LIF A;  3CR6 A;  2K62 A;  3FIQ A;  1RLB E;  4IAX A;  5HZ5 A;  4YH0 A;  3VG6 A;  4LQZ A;  3O19 A;  3CQN A;  4AZR A;  4CK4 A;  3F9D A;  4MVK A;  1Z24 A;  4GK9 A;  4KCA A;  4O4O A;  5HTD A;  2A3F X;  5D8J A;  4MVI A;  2NNE A;  3VG7 A;  4GKC A;  1R0U A;  1DZJ A;  5LJG A;  3ZWE A;  3TGB A;  1S2P A;  1BWY A;  1T68 X;  2DM5 A;  3P02 A;  1JBH A;  2FR3 A;  1VPR A;  4IAW A;  1YWB A;  1E5P A;  3APW A;  2CBS A;  1JYJ A;  1VYG A;  1ZRY A;  2E4J A;  1OPA A;  4LKT A;  4ES7 A;  4QGV A;  1DV9 A;  1KZX A;  2KTD A;  3BU1 A;  4BOE A;  3MX7 A;  3NX1 A;  4N7D A;  2G7B A;  1OEK A;  1ERX A;  1DZP A;  5D45 A;  3U0D A;  4K19 A;  3B2L A;  4NYR A;  3HWG A;  2RCQ A;  4WHI A;  4OS0 A;  4OS3 A;  2Q4N A;  4YFQ A;  1GT1 A;  4QGX A;  3FA8 A;  2POA A;  1JYD A;  4GDZ A;  3BU9 A;  4N7C A;  3TF6 A;  3WJF A;  1GT5 A;  1EW3 A;  2GC9 A;  5DPQ A;  2JMB A;  2F09 A;  1BEB A;  2NND A;  3HK1 A;  2X8F A;  4DQ3 A;  4XMC A;  1DF3 A;  1SA8 A;  3EBK A;  1CBI A;  4U3Q A;  1ICN A;  3VE1 A;  2QM9 A;  4EEJ A;  2WQ9 A;  1Y9T A;  4WBK A;  4RUN A;  1G74 A;  3CMP A;  4ZHF A;  4ON1 A;  1ERB A;  1PBO A;  2L68 A;  3WXQ A;  5F7G A;  1ML7 A;  5HTE A;  1X8Q A;  3APU A;  1OEE A;  2BS5 A;  4L3R A;  2WUT A;  3FLL A;  1IFB A;  2WSJ A;  3P24 A;  4IBA A;  4I3D A;  1X71 A;  1LPJ A;  4ODD A;  1FEN A;  1OBQ A;  1YIV A;  4A1Y A;  5H8T A;  1LID A;  2JU3 A;  2OVD A;  1KT5 A;  2X8S A;  1CJ5 A;  2JU8 A;  4AZP A;  5IO6 A;  3ELX A;  4TQ2 A;  4AZQ A;  1BRQ A;  1QFV A;  1X8U A;  4IB6 A;  3WJB A;  2Q2P A;  5H9K A;  1EAL A;  1B56 A;  2FLJ A;  1A57 A;  4ZH6 A;  4GU8 A;  5AJC A;  1LIE A;  2KW1 A;  2O62 A;  1L6M A;  2X45 A;  4NP1 A;  4O3W A;  4NNT A;  4BVM A;  5EDB A;  1PEE A;  2CZU A;  3D96 A;  1A3Y A;  4ZCB A;  3FA6 A;  3OJY C;  1B0O A;  5FQ8 E;  3VU1 A;  1OBP A;  3P6G A;  1YWA A;  4EDE A;  2A0A A;  1IIU A;  1KQW A;  1T0V A;  1YUP A;  3PEC A;  4AZO A;  1A18 A;  3F8A A;  3NQK A;  5EZ2 A;  3TGA A;  1ACD A;  3O2Y A;  2KTS A;  3GAQ A;  3AKM A;  2OZQ A;  2Z4I A;  3IA8 A;  4YMY A;  2GJ5 A;  2NP1 A;  1QAB E;  3ZQ3 A;  1G85 A;  3FEP A;  3QKG A;  2BHV A;  2AT0 X;  2GTL N;  1LF7 A;  1JJJ A;  4I95 A;  1HBP A;  1FEM A;  1ZNK A;  4HPA A;  2RD7 C;  2AL0 X;  3HWF A;  2G78 A;  2FWV A;  2KD2 A;  5F1E A;  3UEV A;  1KOI A;  1EQD A;  5D48 A;  1X8N A;  3BLG A;  5HZQ A;  4PSQ A;  5L8N A;  2ALL X;  5LJB A;  2AT3 X;  1BBP A;  2KT4 B;  3B2H A;  4EFG A;  5LJD A;  3C76 X;  2FRS A;  5D47 A;  3SAO A;  4QYN A;  5LJH A;  1SXU A;  1CBQ A;  3UAQ A;  1T8V A;  2GTL M;  3P6F A;  3ZUI A;  1SY3 A;  1B4M A;  4O3Z A;  1AB0 A;  4M6S A;  1GT3 A;  2LB6 A;  3OBL A;  3FW5 A;  4KH8 A;  2LA7 A;  4O3Y A;  5JR8 A;  1QG5 A;  3BS2 A;  4IAB A;  1ZNL A;  4ALB A;  1BSO A;  1SXY A;  4O4X A;  2MHD A;  3ZW2 A;  3TGC A;  1GKA B;  4IB8 A;  1JIW I;  3D97 A;  3EYC A;  1D3S A;  5H9A A;  4KC8 A;  1I04 A;  2JW1 A;  1TVQ A;  3FMZ A;  4INN A;  2GTL O;  2MJI A;  2AMM X;  3CQR A;  4QGW A;  2K23 A;  5HA0 A;  5FQ7 E;  3S60 A;  4MVE A;  1I4U A;  2LKK A;  2Z4H A;  2AH7 X;  3ZW1 A;  3FA7 A;  1EII A;  5HZ8 A;  5HCE C;  3ZUO A;  2CM4 A;  3RSW A;  1E00 A;  3NBX X;  4A60 A;  3KZA A;  1A2D A;  4WFV A;  4BQU A;  1TOU A;  3HOL A;  1SXW A;  3APV A;  3STK A;  3WBG A;  4DQ4 A;  1EPB A;  5HZ6 A;  4ORY A;  4ARH A;  1FEL A;  5H9N A;  1BLR A;  1N0S A;  3B2I A;  5L8O A;  2FS7 A;  3U03 A;  5F6B A;  2R56 A;  1NP1 A;  4LKP A;  2L9C A;  4RUU A;  1ZNE A;  2PY1 A;  4XMF A;  2AKQ A;  4YGH A;  1IFC A;  4I3C A;  4CSB A;  2EU7 X;  3OD9 A;  1JV4 A;  4COT A;  4ZGU A;  2BLG A;  2BT9 A;  3FA9 A;  1E02 A;  4I3B A;  4AZN A;  2HZR A;  5AJB A;  3NX2 A;  1EI5 A;  4ZJ0 A;  1BSY A;  3ZW0 A;  3BY0 A;  3NP1 A;  1GX9 A;  4NNS A;  3ELZ A;  5LJC A;  2Q39 A;  4ZHG A;  2XST A;  4GRJ A;  1JZU A;  1MX8 A;  1D2U A;  4OMW A;  1GXA A;  3O22 A;  2QO4 A;  4ZHD A;  3B2K A;  1DZM A;  1G7N A;  3JS1 A;  1XKI A;  1X89 A;  3S26 A;  1S44 A;  3K3L A;  2W2A A;  3CBS A;  2RCT A;  3KFI A;  2MWH A;  5LJK A;  5BVT A;  4JGL A;  1KZW A;  1LNM A;  1AVG I;  4PJ2 A;  4D6A A;  3C78 X;  1I05 A;  1OPB A;  2R74 A;  1BM5 A;  1KT4 A;  2ACP X;  3KFF A;  1IW2 A;  2X8T A;  1ICM A;  2R73 A;  3PQU A;  3ZI8 A;  2P8G A;  2HLV A;  4O49 A;  3JSQ A;  4NYQ A;  2W2F A;  5HZ9 A;  5CE4 A;  4YKO A;  1FDQ A;  5EEE A;  3FR4 A;  5IO7 A;  3NPO A;  4HPC A;  4QYP A;  4Y0P A;  2CM9 A;  4TKB A;  4AZM A;  1B8E A;  2AT6 X;  2FR2 A;  3I0A A;  1LIB A;  3V8U A;  1O1U A;  4YCH A;  3WOV A;  4YDA A;  5FEN A;  1NP4 A;  2FT9 A;  4UU3 A;  4A8Z A;  1CRB A;  1MVG A;  4HWM A;  4YDB A;  2M4L A;  2Q9S A;  1GM6 A;  1QY1 A;  4GE1 A;  3PH6 A;  4D6B A;  4O4S A;  4YGZ A;  1LFO A;  4ORR A;  1IKJ A;  1TW4 A;  3HWE A;  1KT3 A;  4Y0Q A;  1ALB A;  4ORW A;  1HN2 A;  4NLJ A;  4U8U N;  2WEW A;  3RWX A;  4LZV A;  3TZS A;  4HPB A;  4GET A;  3VG4 A;  1YP7 A;  4KC7 A;  5BVS A;  1QY0 A;  1QY2 A;  2RN4 A;  3BDR A;  3FEL A;  4AYH A;  1HMS A;  5D4A A;  4O9S A;  4O3X B;  3IFB A;  5H9L A;  2YG2 A;  1BJ7 A;  3FEK A;  3BRN A;  1U18 A;  3GE2 A;  4HFO A;  3H3I A;  1P6P A;  2N93 A;  5K06 A;  3RKG A;  1GT4 A;  5KHP A;  3P6C A;  5DG4 A;  2FS6 A;  1EPA A;  2MO5 A;  4FGI B;  4U8U M;  2FTB A;  2YMS A;  1ZND A;  5F58 A;  3HOE A;  2LBA A;  3WJD A;  5BVQ A;  3BX8 A;  1KT6 A;  2BS6 A;  3E3C A;  3DSZ A;  1EIO A;  5LKE A;  4NLI A;  1QQS A;  3I17 A;  2ASN X;  2OFM X;  3PPT A;  2GTF X;  3ZW0 B;  1KGL A;  1UZ2 X;  4Y0S A;  2IFB A;  4LZU A;  4M7M A;  1IKE A;  3STN A;  3WJC A;  5AEO A;  4XME A;  5LJE A;  3PH5 A;  1KQX A;  2AT8 X;  4QNI A;  3CWK A;  1TOW A;  3KQ0 A;  1QWD A;  3P6H A;  3S5X A;  3C77 X;  4U8U O;  3N91 A;  2L67 A;  2ZAI A;  3F6Z B;  4A1H A;  1FTP A;  2XKL A;  2A2G A;  3BSZ E;  4YFP A;  4WFU A;  1O1V A;  1AQB A;  1PMP A;  1DFV A;  3AKN A;  4IB7 A;  4QQ1 A;  3PP6 A;  3EM0 A;  4EXZ A;  4QAE A;  3ZZV A;  1AEL A;  4YGG A;  4HPD A;  4QZT A;  4KT5 A;  2NNQ A;  2OFR X;  1U17 A;  2QMI A;  5KID A;  5FFH A;  4CV7 A;  1XCA A;  2OVA A;  2JOZ A;  1GGL A;  5LKF A;  3EMM A;  4FBV A;  5FAZ A;  4FQB B;  4ID2 A;  1YP6 A;  3MVF A;  4IB9 A;  3VE2 A;  1EXS A;  2JN3 A;  4IMN A;  2X46 A;  4ORX A;  3SOT A;  1X8P A;  1OEJ A;  3B2J A;  4ORU A;  1G5W A;  4XMG A;  1LKE A;  1E06 A;  1QFT A;  4AW8 A;  5IO5 A;  5B27 A;  3VG3 A;  1HQP A;  4TJZ A;  1SY1 A;  3HWD A;  1URE A;  5HCC C;  2CBR A;  2RA6 A;  3FEN A;  4QZU A;  3STM X;  3FW4 A;  2WEX A;  4FBR A;  1SXX A;  4TKJ A;  3U9P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...