2W2CA

Structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent protein kinase ii delta
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
128
Chain Sequence
EDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENAKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II DELTA CH
publication title Structure of the Camkiidelta/Calmodulin Complex Reveals the Molecular Mechanism of Camkii Kinase Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 128
sequence length 133
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w2cA00
5KP3A 4HM8B 1OGZA 5KP1A 4HVNA 4XBTA 4MJDA 3WMDA 4OVMA 1O7GB 3BB9A 1O7PB 4XDVA 3S5CA 1S5AA 3JUQA 3E99A 3T8NA 3FZWA 3EC9A 3GZBA 3JUNA 4STDA 3KE7A 5D81A 2GBXB 1O7WB 5JPUA 3FF2A 3F8HA 4HJLB 5DRVA 3JUOA 3HK4A 3EHCA 5AI1A 4LGQA 1VZZA 3OWUA 3H3HA 4K1UA 3MSOA 3NV0A 4HM5B 1HKXA 2GEXA 2GEYA 3DXOA 4L7KA 3DMCA 1OPYA 2Z76A 3EJVA 4IIAA 2GXFA 2STDA 1U5OA 5FW5A 2JQ5A 1QJGA 3MYTA 1Z1SA 4Q53A 3F14A 1ULJB 4XM4A 3G16A 3MG2A 3EN1B 3ER7A 1OF5B 3CU3A 3CNXA 4X2OA 3CPOA 4RZMA 1ZO2A 5BVBA 5IG3A 2W2CA 3B7CA 4KVHA 2INXA 1Q40A 3CNMA 3FLJA 3KKGA 3A76A 5AIGA 5IG0A 3MG1A 4R9KA 3EBTA 4FCJA 3NHXA 2BMOB 2XSHB 3I0YA 5AEWB 5CXOA 4HKVB 3VSYA 4PEJA 1OF5A 3NXJA 3EBYA 1TUHA 2HMJB 1JB2A 1C7HA 1QMAA 2XSOB 3KZTA 3OWSA 3KSPA 2F98A 1OGXA 2RGQA 4HM6B 5EVHA 5D83A 3GZXB 3OWYA 2CKFB 4WYKB 3F40A 2QGUA 1CQSA 3ECFA 3GZYB 2CHCA 4OUQA 4HZBB 3MHEA 3DUKA 2F99A 6STDA 1DMMA 4XBXA 4HM0B 2HMNB 3DZLA 2BNGA 1Q40B 3G8ZA 5AIHA 5IG4A 4LMIA 2YFLB 3JUMA 3M8CA 3EF8A 1ZX2A 3B4OA 8CHOA 1GY7A 5HGRA 3FSDA 4HM4B 1JN5A 3JUPA 3OV4A 4WYKA 1GY6A 1OHPA 7STDA 4I4KA 3MKIA 4HM7B 1IDPA 4FCMA 3T8UA 1OUNA 2Z77A 4WWUC 1W6YA 1ULIB 4HZ9B 1W02A 2B1XB 1JB5A 3EN8A 3K0ZA 3H51A 1EA2A 3GWRA 3EQQB 1E3VA 3FH1A 4U13A 2RFRA 3GRDA 5BXQA 1OH0A 4HM2B 1O7MB 2YFIB 4R1KA 4L8OA 1DMNA 1E3RA 2HMKB 3EX9A 3DM8A 4XDWA 5IEPA 2XR8B 2R4IA 1NWWA 1K41A 1A2KA 5AIIA 2K54A 1JB4A 4GB5A 3NUVA 3BLZA 3B8LA 3F7SA 1JKGB 1OCVA 5TGNA 5KP4A 1UUVB 4J8TA 1JN5B 5IEOA 1EG9B 1TP6A 1AR0A 1E97A 1WQLB 2XRXB 3F8XA 5G2GA 4X2HA 3RGAA 4XB5A 2A15A 2YFJB 1NDOB 3UNLA 3SOYA 4N3VA 5IERA 3OX9A 2F86B 3B4PA 3VGNA 1JKGA 1OHOA 3D9RA 1NU3A 3K7CA 2UX0A 3OXAA 2BMQB 4LEHA 1SJWA 3SEDA 4H3UA 3STDA 2HMOB 5AIFA 1ISKA 2OWPA 5JPPA 2RCDA 2Z7AA 2PZVA 2I9WA 4R9LA 4HM3B 1W00A 3Q90A 4XBYA 1BUQA 5CF1A 2QIYA 2HMLB 3FF0A 1O7NB 2HMMB 5IENA 5CK6A 1O7HB 2GBWB 3SOAA 5IF6A 4WP5A 3F7XA 3IPTA 2B24B 3RGRA 3LZAA 3F9SA 5DREA 5STDA 3G0KA 5CF2A 1DMQA 1W01A 3ROBA 4ORLA 3LYGA 1GS3A 3HZPA 3GZRA 2IMJA 4CDLA 3NM2A 1UUWB 5AEUB 5D82A 5CLKA 3HX8A 1Q42A 1OHSA 3NBRA 4L8PA 1ASKA 3UJMA 3FKAA 1GY5A 1GYBA 4K1VA 2BMRB 5IG5A 3NV0B 4HM1B 3MG3A 4J9AA 1STDA 3FGYA
chains in the Genus database with same CATH superfamily
5KP3A 4HM8B 1OGZA 5KP1A 4ILFA 2IYJA 2BIRA 4HVNA 5BU4A 4XBTA 3CCE3 2O9UX 4MJDA 3WMDA 1DETA 1QAFA 1AVKA 1Q824 1HU9A 5JBSA 2XH9A 1PY3A 4OVMA 1O7GB 1RN7A 3BB9A 4AEQA 1W6CA 4N6V0 2Q07A 1O7PB 3GSPA 4XDVA 3S5CA 3LH4A 1S5AA 2BU4A 3PXMA 1SIHA 3KFQC 3JUQA 3E99A 3T8NA 5A0OB 1YGWA 3FZWA 1VQL3 3NBJA 3EC9A 3SXXA 3GZBA 3JUNA 4STDA 4EYCA 3KE7A 3EB8A 5D81A 2GBXB 3AHWA 1O7WB 2ML6A 4WHAA 3V98A 4EW5A 1BNRA 1VQ63 5JPUA 9RNTA 3FF2A 3F8HA 1RHLA 4HJLB 1Y4KA 5DRVA 3JUOA 2D42A 2OTJ3 3HK4A 3RNTA 3EHCA 4N6LA 5AI1A 4LGQA 3LTCA 1IT8A 1VZZA 1DE3A 3CCJ3 2UGIA 3OWUA 3H3HA 2YX9A 3X3YA 4HOHA 3N54B 4K1UA 1QALA 1UDII 4QWTA 3S67A 2BT3A 3MSOA 1Q7Y4 3NV0A 5ELUA 4HAAA 3WODG 4HM5B 1HKXA 2GEXA 1NNVA 5LC7A 3KIIA 2GEYA 3DXOA 1PU4A 3EE1A 4L7KA 1LXEA 3DMCA 3ZG5A 3CME3 1OPYA 2W03A 2Z76A 2IY2A 2K3DA 2GXFA 2STDA 3EJVA 4IIAA 4OK0A 1U5OA 4I5QA 5FW5A 2JQ5A 3Q2PA 1QJGA 4FMBA 1MGRA 1ZS7A 2K0MA 1L5GB 3LTDA 3MYTA 1LRAA 3CMA3 1Z1SA 4Q53A 3WA2X 2OOVC 1B21A 3F14A 1ULJB 1RCLA 1VQK3 4GSPA 1RGCA 3N9HA 4XM4A 2V1LA 2XFSA 1LOYA 2H0IA 1AQZA 3G16A 3MG2A 3EN1B 4FR9A 3ER7A 4K90B 3U1WA 4BTXA 1BRGA 1V58A 1OF5B 3CU3A 3CNXA 3LT9A 1BRJA 4X2OA 3CPOA 4RZMA 1X1XA 3T0UA 1BNEA 1ZO2A 2W56B 4KT3B 1S723 5BVBA 2M7OA 5IG3A 2CFKA 1JBTA 2W0QA 4LZIA 2W9QA 1BSAA 2KF3A 3BIRA 2W2CA 1RNBA 1UCLA 1AY7A 1K28A 3B7CA 1N8R4 4O8SA 4H61A 1BNGA 4KVHA 1BANA 2INXA 3FG1A 1Q40A 3CNMA 4O2HA 3WDGB 2CC3A 1UCJA 1LOWA 1G0TA 2PNCA 2Y74A 1WMOA 1FUSA 3A76A 3FLJA 2OQEC 3KKGA 5AIGA 5IG0A 4EC6A 1N9EA 1EQKA 1TIJA 1AV4A 4CJNA 4N6MA 3MG1A 1A2VA 4R9KA 4CPKA 1M9GA 5GSPA 3EBTA 4FCJA 3D3LA 2CX0A 3I553 4KFDA 3NHXA 2WO0A 2J8XB 2BMOB 2JDIH 1BRSA 1G96A 3FG3A 3DGYA 1BSEA 1BUJA 2XSHB 3I0YA 3PZWA 1MWTA 2W9PA 1RDSA 4ZM8A 1FGMA 5AEWB 3NQYA 5CXOA 1CYUA 1W7CA 1U8CB 5BIRA 3MWZA 1SIIA 4HKVB 3VSYA 1KSIA 4PEJA 1YJW3 1BSBA 1OF5A 2ZHXB 1X1WA 1FGOA 2CFDA 3NXJA 2CX1A 1TFOA 2L4VA 3EBYA 3UL6A 1YIT3 2W56A 3PGBA 3D5IA 4MMZB 7RNTA 1TUHA 2HMJB 1JB2A 1I70A 1C7HA 1QMAA 1RGHA 2XSOB 5G1LA 3KZTA 1D6YA 3OWSA 4IPBA 3HOHA 4FMDA 3KSPA 1RGEA 3J7Yd 1W2B2 2CFLA 2F98A 3DGOA 1OGXA 1VQ53 2RGQA 4HM6B 2MC8A 5EVHA 1D6UA 1A2PA 5D83A 5AYSC 3GZXB 3OWYA 3WA3A 3LXUX 2CKFB 3S29A 1MWUA 2KXGA 4WYKB 1BU4A 1FZUA 3CCR3 1W5ZA 3F40A 2QGUA 1IVXA 1CQSA 3BNCA 3I563 3ECFA 3GZYB 2KF4A 2L1SA 4BL3A 2XFTA 1I2EA 8RNTA 3N8BA 2CHCA 1VQN3 1B2ZA 3QRDA 3D4AA 4OUQA 1RKYA 4HZBB 1OACA 2OOVA 4CCVA 3G713 1WMNA 1N8QA 2RNTA 2GSPA 3DGNA 3AMOA 4MEIA 1BOXA 3MHEA 1RNTA 1RTUA 3DUKA 4N6NB 1YHQ3 3HI7A 4G1MB 4R80A 3ZFZA 1JV2B 1LOVA 1MNLA 3PCSA 2F99A 6STDA 2FGTA 1DMMA 4XBXA 1JBSA 4HM0B 1GOYA 5AYRB 3G6E3 1I3FA 1UUGB 2HMNB 3K63A 1KQS2 1BRNL 3LMLA 1FUWA 1T3BA 1LQMB 1CEWI 1RGLA 2BNGA 1Q40B 2C4BA 2WOFA 3DZLA 1T2IA 3K5TA 1QAKA 2ZDJA 4MMXB 3PYJA 4TX4A 3G8ZA 5AIHA 3DY5A 5IG4A 2RBIA 4LMIA 2OCTA 1FYSA 5LC6A 4BTYA 3CC23 3WOFB 2YFLB 3JUMA 3M8CA 2KAAA 3EF8A 1ZX2A 2XGLA 3CCQ3 2GU1A 2P05A 3B4OA 3PS8A 1GOVA 1GY7A 1SARA 5HGRA 8CHOA 1JZOA 3FSDA 5G1KA 2OQEA 4GHOA 4HM4B 4NHFA 1JN5A 3JUPA 1X1UA 3OV4A 4WYKA 3ZG0A 1UGHI 1EUIC 1GY6A 1IYYA 2C11A 1IK3A 1TU5A 2F5MA 1GD4A 1RGAA 2CFGA 3KCHA 1B20A 1LQGC 1RGGA 3UB1A 2WGQA 5EQLA 1OHPA 3X41A 1BNIA 7STDA 3IJEB 3X3XA 4I4KA 1TRQA 3MKIA 4HM7B 1IDPA 4FCMA 1RLSA 3T8UA 4EV5A 4RBNA 1DVDA 1OUNA 3AGOA 3TDGA 2Z77A 1T5YA 4WWUC 1JNQA 2W04A 1UCIA 4GL6A 3CPW2 1FW7A 1FGRA 1G02A 1W6YA 1GMRA 1ULIB 4HZ9B 1W02A 2B1XB 1JB5A 1A90A 1MOLA 1BRIA 1ROAA 2IUJA 1N9JA 3EN8A 4JF8A 3K0ZA 3H51A 1UW1A 1WTHA 1EA2A 3FG4A 4MMYB 1RSNA 2KCDA 3GWRA 4KFFA 2E2VA 3EQQB 1US1A 1E3VA 3FH1A 4EV2A 1GSPA 1UCKA 2AADA 2RSXA 4U13A 2RFRA 3V99A 1F8NA 3GRDA 3DGLA 1J2BA 2P38A 5BXQA 1I3IA 1OH0A 4HM2B 1I8VA 1O7MB 1FUTA 1JZDA 1T2HA 4HBRA 2YFIB 4R1KA 3LOYA 3VF1A 2MF7A 4L8OA 1YJN3 1DMNA 1E3RA 2IUKA 2H0HA 2HMKB 4NREA 3AMOB 3EX9A 2WOHA 4J5KA 1RN4A 2E2TA 3DM8A 1WNHA 3BNBA 3AHSA 3NBBA 4XDWA 3LTBA 1M1K4 3KSED 1GMQA 1B2XA 1GOUA 2XR8B 5IEPA 2P0MA 1JBRA 1IQ8A 3DGMA 2O3OA 2R4IA 3V92A 1NWWA 1K41A 3D79A 3CCV3 1RGKA 1A2KA 1I0VA 1VQP3 5AIIA 2R41A 1IQYA 2K54A 1JB4A 4GB5A 1A67A 1N5PA 2CG0A 3NUVA 3X42A 3BLZA 2D1WA 3PCRA 3B8LA 3F7SA 1VQM3 1JKGB 1OCVA 3G4S3 3CCS3 1VQ43 2ZL8A 3BNEA 1VQ83 1MGWA 1M1XB 3A5EA 2CK3H 1RN1A 1RMSA 1IVWA 4NPBA 5TGNA 1YJ93 5KP4A 4FCZA 1UUVB 5HOHA 4LSOA 4LYLB 1X1YA 4J8TA 2XF3A 3S27A 1JN5B 3UL5A 2F56A 2P09A 3HIGA 2Y73A 5IEOA 2F5WA 1N5HA 2XGNA 1B2MA 5FGOA 3CC73 1EG9B 3NM7A 3NX0A 1TP6A 1AR0A 2Z6BA 3KN4A 1E97A 4O3VA 1WQLB 2HOHA 1BNJA 3L0RA 2XRXB 2H0GA 4RNZA 3CCU3 2E2UA 2ZA4A 1VQ73 3JVCA 3F8XA 1DVCA 1TRPA 1WMPA 4X2HA 1BSDA 2KF6A 3AGNA 5G2GA 5M1AA 3CCL3 3RGAA 4XB5A 3X3ZA 1RRHA 1YNVX 1MWSA 2P0XA 1HZ1A 2A15A 1UI7A 3X40A 2YFJB 3WOEB 1YVBI 1YIJ3 1IVUA 4IT7A 1NDOB 5ELJA 4EBGA 3UNLA 3SOYA 2KF5A 1Q814 4N3VA 5IERA 1VQO3 3CD63 3OX9A 3S28A 1FA3A 5M19A 2F86B 2LQVA 1JRQA 1CH0A 1TTOA 2GU3A 2C10A 1LVNA 3B4PA 1JKGA 3VGNA 1JJ22 4BTWA 1BGSA 4FMAA 1OHOA 1YGEA 3D9RA 1I0XA 1CYVA 6RNTA 1NU3A 1TJDA 3SYUA 1B2UA 3K7CA 2UX0A 2FXTA 4JRFA 3OXAA 2F4YA 4KZ1A 2BMQB 1K734 4LEHA 1SJWA 3SEDA 1IV9A 3CCM3 5IW9A 1PFPA 2UUGC 4H3UA 1BVIA 3FCSB 3STDA 3IMAB 3BNDA 3O8YA 3Q3FA 1AVLA 2HMOB 5AIFA 2SBLA 1ISKA 2OWPA 4KFEA 1EEJA 4BL2A 1NO3A 2CIUA 1IV7A 1BIRA 4BIRA 5JPPA 2RCDA 1BNSA 2Z7AA 2PZVA 4AKYA 2I9WA 1D6ZA 5M18A 1LOXA 4R9LA 4HM3B 1W00A 2OTL3 1IT7A 3Q90A 4XBYA 1BUQA 5EEOA 2W6JH 1IVVA 5CF1A 2QEX3 1K8A4 4K61A 4DKIA 2QIYA 2HMLB 1V57A 3FF0A 1O7NB 2HMMB 2XEPA 3QK9A 4J5GA 4N6TA 1QVF2 1B27A 5IENA 5CK6A 1STFI 1LNIA 4HYZA 3SX1A 4AKZA 1GMPA 1UGIA 1O7HB 2GBWB 3DH2A 3SOAA 1KD14 1C54A 1KWIA 2CFWA 1VQ93 1Q9EA 1HYFA 1I2FA 5IF6A 3Q1CA 2CWUA 1LNHA 4R4KA 3OW22 1EKMA 1Q7HA 4WP5A 3F7XA 3IPTA 2B24B 1RGFA 3RGRA 1B3SA 1IQXA 1M904 1DYUA 2ML5A 5RNTA 3MPHA 1TFKA 6GSPA 3LT8A 3LZAA 1W2ZA 1R4YA 4RNYA 3F9SA 4EXRA 2FNQA 3K9MC 1YI23 3BU4A 5DREA 3HIIA 3NQZA 3SVAA 1VQQA 1YVSA 1ZGXA 3G0KA 5STDA 5CF2A 1UI8A 1DMQA 1W01A 3ROBA 2CWVA 4ORLA 3CXC2 3LYGA 2QA43 3WR2A 3WHOA 1GS3A 1GD3A 3HZPA 3CC43 3GZRA 2IMJA 2IA7A 3SLUA 4CDLA 1PYLA 3NM2A 1UUWB 2CWTA 5AEUB 5D82A 2CW9A 1R4CA 2BHMA 4RNTA 5CLKA 1NJI4 3HX8A 1Q42A 1OHSA 1W6GA 2LYXA 1Q864 2SARA 1BRHA 3NBRA 4L8PA 1I2GA 4WFOA 1V74A 1RJOA 4BU4A 2CG1A 1QVG2 1ASKA 1ROVA 3UJMA 3ALAA 1BNFA 4N6OB 2WGOA 3FKAA 1GY5A 1KC84 1NB3I 1GYBA 2BO9B 2KRTA 3GAXA 4O02B 1BAOA 3RDEA 1B2SA 1FGQA 2CH9A 3U97A 4N6UA 2AAEA 1IU7A 4K1VA 1FGTA 1K9M4 1NB5I 2BMRB 5IG5A 3NV0B 1RCKA 1W4NA 3MG3A 4HM1B 4J9AA 1MWRA 1STDA 3D5GA 1SQWA 4FMCA 5I97A 1BRKA 1SPUA 3FGYA 7GSPA 3URPA 3LTAA 1BSCA 1RRLA
chains in the Genus database with same CATH topology
5KP3A 4HM8B 1OGZA 5KP1A 4HVNA 4XBTA 3CCE3 2O9UX 4MJDA 3WMDA 1Q824 1QAFA 1AVKA 1HU9A 5JBSA 2XH9A 4OVMA 1O7GB 1RN7A 3BB9A 4AEQA 1W6CA 4N6V0 2Q07A 1O7PB 4XDVA 3S5CA 3LH4A 1S5AA 3PXMA 1SIHA 3KFQC 3JUQA 3E99A 3T8NA 5A0OB 1VQL3 3FZWA 3NBJA 3EC9A 3SXXA 3GZBA 3JUNA 4STDA 4EYCA 3KE7A 3EB8A 5D81A 2GBXB 1O7WB 2ML6A 4WHAA 3V98A 1VQ63 5JPUA 3FF2A 3F8HA 4HJLB 5DRVA 1Y4KA 3JUOA 2D42A 2OTJ3 3HK4A 3EHCA 4N6LA 5AI1A 4LGQA 3LTCA 1IT8A 1VZZA 3CCJ3 3OWUA 3H3HA 2YX9A 3X3YA 3N54B 4K1UA 1QALA 4QWTA 3S67A 2BT3A 3MSOA 1Q7Y4 3NV0A 5ELUA 3WODG 4HM5B 1HKXA 2GEXA 5LC7A 3KIIA 2GEYA 3DXOA 1PU4A 3EE1A 4L7KA 1LXEA 3DMCA 3CME3 1OPYA 2W03A 2Z76A 3EJVA 4IIAA 2GXFA 2STDA 4OK0A 1U5OA 5FW5A 2JQ5A 3Q2PA 1QJGA 4FMBA 1L5GB 2K0MA 3LTDA 3MYTA 3CMA3 1Z1SA 4Q53A 3WA2X 2OOVC 3F14A 1ULJB 1VQK3 3N9HA 4XM4A 2V1LA 2XFSA 3G16A 3MG2A 4FR9A 3EN1B 4BTXA 3ER7A 4K90B 3U1WA 1OF5B 3CU3A 3CNXA 3LT9A 4X2OA 3CPOA 4RZMA 3T0UA 1ZO2A 2W56B 1S723 5BVBA 2M7OA 5IG3A 2CFKA 2W0QA 4LZIA 2W9QA 2W2CA 1K28A 3B7CA 1N8R4 4O8SA 4H61A 4KVHA 2INXA 3FG1A 1Q40A 3CNMA 4O2HA 3WDGB 2CC3A 3FLJA 3KKGA 2PNCA 2Y74A 1WMOA 3A76A 2OQEC 5AIGA 5IG0A 4EC6A 1N9EA 1EQKA 1TIJA 1AV4A 4N6MA 3MG1A 1A2VA 4R9KA 1M9GA 3EBTA 4FCJA 3D3LA 3I553 4KFDA 3NHXA 2WO0A 2BMOB 2JDIH 3FG3A 1G96A 2XSHB 3I0YA 3PZWA 2W9PA 4ZM8A 1FGMA 5AEWB 3NQYA 5CXOA 1CYUA 1W7CA 1U8CB 3MWZA 1SIIA 4HKVB 3VSYA 1KSIA 4PEJA 1YJW3 1OF5A 1FGOA 2CFDA 3NXJA 3UL6A 1TFOA 2L4VA 3EBYA 1YIT3 2W56A 3PGBA 4MMZB 1TUHA 2HMJB 1JB2A 1C7HA 1QMAA 2XSOB 3KZTA 1D6YA 3OWSA 4IPBA 4FMDA 3KSPA 3J7Yd 1W2B2 2CFLA 2F98A 3DGOA 1OGXA 1VQ53 2RGQA 4HM6B 2MC8A 5EVHA 1D6UA 5D83A 5AYSC 3GZXB 3OWYA 3WA3A 3LXUX 2CKFB 3S29A 2KXGA 4WYKB 3CCR3 1W5ZA 3F40A 2QGUA 1IVXA 1CQSA 3BNCA 3I563 3ECFA 3GZYB 2XFTA 3N8BA 2CHCA 1VQN3 3QRDA 4OUQA 1RKYA 4HZBB 1OACA 2OOVA 4CCVA 3G713 1WMNA 1N8QA 3DGNA 4MEIA 3AMOA 4N6NB 3S27A 3MHEA 1YHQ3 3DUKA 3HI7A 4G1MB 4R80A 1JV2B 1MNLA 3PCSA 2F99A 6STDA 2FGTA 1DMMA 4XBXA 4HM0B 3G6E3 5AYRB 2HMNB 1KQS2 3K63A 1FUWA 3LMLA 3DZLA 1CEWI 2BNGA 2WOFA 1Q40B 3K5TA 1QAKA 2ZDJA 4MMXB 3PYJA 4TX4A 3G8ZA 5AIHA 3DY5A 5IG4A 4LMIA 2OCTA 5LC6A 4BTYA 3CC23 3WOFB 2YFLB 3JUMA 3M8CA 3EF8A 1ZX2A 2XGLA 3CCQ3 2GU1A 2P05A 3B4OA 3PS8A 8CHOA 1GY7A 5HGRA 3FSDA 2OQEA 4HM4B 4NHFA 1JN5A 3JUPA 3OV4A 4WYKA 1GY6A 2C11A 1IK3A 1TU5A 1GD4A 2CFGA 3UB1A 2WGQA 5EQLA 1OHPA 3X41A 7STDA 3IJEB 3X3XA 4I4KA 3MKIA 4HM7B 1IDPA 4FCMA 3T8UA 4EV5A 4RBNA 1DVDA 1OUNA 3TDGA 2Z77A 1T5YA 4WWUC 1JNQA 2W04A 4GL6A 3CPW2 1FGRA 1W6YA 1ULIB 4HZ9B 1W02A 2B1XB 1JB5A 1A90A 1MOLA 1ROAA 2IUJA 1N9JA 3EN8A 4JF8A 3K0ZA 3H51A 1UW1A 1WTHA 1EA2A 3FG4A 4MMYB 2KCDA 3GWRA 4KFFA 2E2VA 3EQQB 1US1A 1E3VA 3FH1A 4EV2A 2RSXA 4U13A 3V99A 2RFRA 1J2BA 1F8NA 3GRDA 3DGLA 2P38A 5BXQA 1OH0A 4HM2B 1O7MB 4HBRA 2YFIB 4R1KA 3LOYA 3VF1A 2MF7A 4L8OA 1YJN3 1DMNA 1E3RA 2IUKA 2HMKB 4NREA 3AMOB 3EX9A 2WOHA 2E2TA 3DM8A 1WNHA 3BNBA 3NBBA 4XDWA 3LTBA 1M1K4 3KSED 5IEPA 2XR8B 2P0MA 1IQ8A 3DGMA 2O3OA 2R4IA 3V92A 1NWWA 1K41A 3CCV3 1A2KA 1VQP3 5AIIA 1IQYA 2K54A 1JB4A 4GB5A 1A67A 1N5PA 2CG0A 3NUVA 3X42A 3BLZA 2D1WA 3PCRA 3B8LA 3F7SA 1VQM3 1JKGB 1OCVA 3G4S3 3CCS3 1VQ43 2ZL8A 3BNEA 1VQ83 1M1XB 5TGNA 2CK3H 1YJ93 1IVWA 5KP4A 4FCZA 1UUVB 4LSOA 4J8TA 2XF3A 1JN5B 3UL5A 2P09A 3HIGA 2Y73A 5IEOA 1N5HA 2XGNA 5FGOA 3CC73 1EG9B 3NM7A 3NX0A 1TP6A 1AR0A 2Z6BA 3KN4A 1E97A 4O3VA 1WQLB 3L0RA 2XRXB 4RNZA 3CCU3 2E2UA 1VQ73 3JVCA 3F8XA 1DVCA 1WMPA 5G2GA 4X2HA 3CCL3 3RGAA 4XB5A 3X3ZA 1RRHA 2P0XA 2A15A 1UI7A 3X40A 2YFJB 3WOEB 1YVBI 1YIJ3 1IVUA 4IT7A 1NDOB 5ELJA 4EBGA 3UNLA 3SOYA 1Q814 4N3VA 5IERA 1VQO3 3CD63 3OX9A 3S28A 1FA3A 2F86B 2LQVA 1JRQA 3B4PA 1JJ22 2GU3A 2C10A 1LVNA 3VGNA 1JKGA 4BTWA 4FMAA 1OHOA 1YGEA 3D9RA 1CYVA 1NU3A 3K7CA 2UX0A 2FXTA 4JRFA 3OXAA 4KZ1A 2BMQB 1K734 4LEHA 1SJWA 3SEDA 1IV9A 3CCM3 5IW9A 1PFPA 4H3UA 3FCSB 3STDA 3IMAB 3BNDA 3O8YA 1AVLA 2HMOB 5AIFA 2SBLA 1ISKA 2OWPA 4KFEA 1NO3A 2CIUA 1IV7A 5JPPA 2RCDA 2Z7AA 2PZVA 4AKYA 2I9WA 1D6ZA 1LOXA 4R9LA 4HM3B 1W00A 2OTL3 1IT7A 3Q90A 4XBYA 1BUQA 5EEOA 2W6JH 1IVVA 5CF1A 2QEX3 1K8A4 4K61A 2QIYA 2HMLB 3FF0A 1O7NB 2HMMB 2XEPA 3QK9A 4N6TA 1QVF2 5IENA 5CK6A 1STFI 4HYZA 3SX1A 4AKZA 1O7HB 2GBWB 3SOAA 1KD14 1KWIA 2CFWA 1VQ93 5IF6A 3Q1CA 2CWUA 1LNHA 4R4KA 3OW22 1EKMA 4WP5A 3F7XA 3IPTA 2B24B 3RGRA 1IQXA 1M904 1DYUA 2ML5A 3MPHA 1TFKA 3LT8A 3LZAA 1W2ZA 4RNYA 3F9SA 4EXRA 2FNQA 3K9MC 1YI23 5DREA 3SVAA 3HIIA 3NQZA 5STDA 3G0KA 5CF2A 1UI8A 1DMQA 1W01A 3ROBA 2CWVA 4ORLA 3CXC2 3LYGA 2QA43 1GS3A 1GD3A 3HZPA 3CC43 3GZRA 2IMJA 2IA7A 3SLUA 4CDLA 3NM2A 1UUWB 2CWTA 5AEUB 5D82A 2CW9A 1R4CA 2BHMA 5CLKA 1NJI4 3HX8A 1Q42A 1OHSA 1W6GA 2LYXA 1Q864 3NBRA 4L8PA 4WFOA 1V74A 1RJOA 2CG1A 1QVG2 1ASKA 1ROVA 3UJMA 3ALAA 4N6OB 2WGOA 3FKAA 1GY5A 1KC84 1NB3I 1GYBA 2BO9B 2KRTA 3GAXA 4O02B 3RDEA 1FGQA 2CH9A 3U97A 4N6UA 1IU7A 4K1VA 1FGTA 1K9M4 1NB5I 2BMRB 5IG5A 3NV0B 4HM1B 1W4NA 3MG3A 4J9AA 1STDA 1SQWA 4FMCA 5I97A 3FGYA 1SPUA 3LTAA 1RRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP3 A;  4HM8 B;  1OGZ A;  5KP1 A;  4HVN A;  4XBT A;  4MJD A;  3WMD A;  4OVM A;  1O7G B;  3BB9 A;  1O7P B;  4XDV A;  3S5C A;  1S5A A;  3JUQ A;  3E99 A;  3T8N A;  3FZW A;  3EC9 A;  3GZB A;  3JUN A;  4STD A;  3KE7 A;  5D81 A;  2GBX B;  1O7W B;  5JPU A;  3FF2 A;  3F8H A;  4HJL B;  5DRV A;  3JUO A;  3HK4 A;  3EHC A;  5AI1 A;  4LGQ A;  1VZZ A;  3OWU A;  3H3H A;  4K1U A;  3MSO A;  3NV0 A;  4HM5 B;  1HKX A;  2GEX A;  2GEY A;  3DXO A;  4L7K A;  3DMC A;  1OPY A;  2Z76 A;  3EJV A;  4IIA A;  2GXF A;  2STD A;  1U5O A;  5FW5 A;  2JQ5 A;  1QJG A;  3MYT A;  1Z1S A;  4Q53 A;  3F14 A;  1ULJ B;  4XM4 A;  3G16 A;  3MG2 A;  3EN1 B;  3ER7 A;  1OF5 B;  3CU3 A;  3CNX A;  4X2O A;  3CPO A;  4RZM A;  1ZO2 A;  5BVB A;  5IG3 A;  2W2C A;  3B7C A;  4KVH A;  2INX A;  1Q40 A;  3CNM A;  3FLJ A;  3KKG A;  3A76 A;  5AIG A;  5IG0 A;  3MG1 A;  4R9K A;  3EBT A;  4FCJ A;  3NHX A;  2BMO B;  2XSH B;  3I0Y A;  5AEW B;  5CXO A;  4HKV B;  3VSY A;  4PEJ A;  1OF5 A;  3NXJ A;  3EBY A;  1TUH A;  2HMJ B;  1JB2 A;  1C7H A;  1QMA A;  2XSO B;  3KZT A;  3OWS A;  3KSP A;  2F98 A;  1OGX A;  2RGQ A;  4HM6 B;  5EVH A;  5D83 A;  3GZX B;  3OWY A;  2CKF B;  4WYK B;  3F40 A;  2QGU A;  1CQS A;  3ECF A;  3GZY B;  2CHC A;  4OUQ A;  4HZB B;  3MHE A;  3DUK A;  2F99 A;  6STD A;  1DMM A;  4XBX A;  4HM0 B;  2HMN B;  3DZL A;  2BNG A;  1Q40 B;  3G8Z A;  5AIH A;  5IG4 A;  4LMI A;  2YFL B;  3JUM A;  3M8C A;  3EF8 A;  1ZX2 A;  3B4O A;  8CHO A;  1GY7 A;  5HGR A;  3FSD A;  4HM4 B;  1JN5 A;  3JUP A;  3OV4 A;  4WYK A;  1GY6 A;  1OHP A;  7STD A;  4I4K A;  3MKI A;  4HM7 B;  1IDP A;  4FCM A;  3T8U A;  1OUN A;  2Z77 A;  4WWU C;  1W6Y A;  1ULI B;  4HZ9 B;  1W02 A;  2B1X B;  1JB5 A;  3EN8 A;  3K0Z A;  3H51 A;  1EA2 A;  3GWR A;  3EQQ B;  1E3V A;  3FH1 A;  4U13 A;  2RFR A;  3GRD A;  5BXQ A;  1OH0 A;  4HM2 B;  1O7M B;  2YFI B;  4R1K A;  4L8O A;  1DMN A;  1E3R A;  2HMK B;  3EX9 A;  3DM8 A;  4XDW A;  5IEP A;  2XR8 B;  2R4I A;  1NWW A;  1K41 A;  1A2K A;  5AII A;  2K54 A;  1JB4 A;  4GB5 A;  3NUV A;  3BLZ A;  3B8L A;  3F7S A;  1JKG B;  1OCV A;  5TGN A;  5KP4 A;  1UUV B;  4J8T A;  1JN5 B;  5IEO A;  1EG9 B;  1TP6 A;  1AR0 A;  1E97 A;  1WQL B;  2XRX B;  3F8X A;  5G2G A;  4X2H A;  3RGA A;  4XB5 A;  2A15 A;  2YFJ B;  1NDO B;  3UNL A;  3SOY A;  4N3V A;  5IER A;  3OX9 A;  2F86 B;  3B4P A;  3VGN A;  1JKG A;  1OHO A;  3D9R A;  1NU3 A;  3K7C A;  2UX0 A;  3OXA A;  2BMQ B;  4LEH A;  1SJW A;  3SED A;  4H3U A;  3STD A;  2HMO B;  5AIF A;  1ISK A;  2OWP A;  5JPP A;  2RCD A;  2Z7A A;  2PZV A;  2I9W A;  4R9L A;  4HM3 B;  1W00 A;  3Q90 A;  4XBY A;  1BUQ A;  5CF1 A;  2QIY A;  2HML B;  3FF0 A;  1O7N B;  2HMM B;  5IEN A;  5CK6 A;  1O7H B;  2GBW B;  3SOA A;  5IF6 A;  4WP5 A;  3F7X A;  3IPT A;  2B24 B;  3RGR A;  3LZA A;  3F9S A;  5DRE A;  5STD A;  3G0K A;  5CF2 A;  1DMQ A;  1W01 A;  3ROB A;  4ORL A;  3LYG A;  1GS3 A;  3HZP A;  3GZR A;  2IMJ A;  4CDL A;  3NM2 A;  1UUW B;  5AEU B;  5D82 A;  5CLK A;  3HX8 A;  1Q42 A;  1OHS A;  3NBR A;  4L8P A;  1ASK A;  3UJM A;  3FKA A;  1GY5 A;  1GYB A;  4K1V A;  2BMR B;  5IG5 A;  3NV0 B;  4HM1 B;  3MG3 A;  4J9A A;  1STD A;  3FGY A; 
#chains in the Genus database with same CATH topology
 5KP3 A;  4HM8 B;  1OGZ A;  5KP1 A;  4ILF A;  2IYJ A;  2BIR A;  4HVN A;  5BU4 A;  4XBT A;  3CCE 3;  2O9U X;  4MJD A;  3WMD A;  1DET A;  1QAF A;  1AVK A;  1Q82 4;  1HU9 A;  5JBS A;  2XH9 A;  1PY3 A;  4OVM A;  1O7G B;  1RN7 A;  3BB9 A;  4AEQ A;  1W6C A;  4N6V 0;  2Q07 A;  1O7P B;  3GSP A;  4XDV A;  3S5C A;  3LH4 A;  1S5A A;  2BU4 A;  3PXM A;  1SIH A;  3KFQ C;  3JUQ A;  3E99 A;  3T8N A;  5A0O B;  1YGW A;  3FZW A;  1VQL 3;  3NBJ A;  3EC9 A;  3SXX A;  3GZB A;  3JUN A;  4STD A;  4EYC A;  3KE7 A;  3EB8 A;  5D81 A;  2GBX B;  3AHW A;  1O7W B;  2ML6 A;  4WHA A;  3V98 A;  4EW5 A;  1BNR A;  1VQ6 3;  5JPU A;  9RNT A;  3FF2 A;  3F8H A;  1RHL A;  4HJL B;  1Y4K A;  5DRV A;  3JUO A;  2D42 A;  2OTJ 3;  3HK4 A;  3RNT A;  3EHC A;  4N6L A;  5AI1 A;  4LGQ A;  3LTC A;  1IT8 A;  1VZZ A;  1DE3 A;  3CCJ 3;  2UGI A;  3OWU A;  3H3H A;  2YX9 A;  3X3Y A;  4HOH A;  3N54 B;  4K1U A;  1QAL A;  1UDI I;  4QWT A;  3S67 A;  2BT3 A;  3MSO A;  1Q7Y 4;  3NV0 A;  5ELU A;  4HAA A;  3WOD G;  4HM5 B;  1HKX A;  2GEX A;  1NNV A;  5LC7 A;  3KII A;  2GEY A;  3DXO A;  1PU4 A;  3EE1 A;  4L7K A;  1LXE A;  3DMC A;  3ZG5 A;  3CME 3;  1OPY A;  2W03 A;  2Z76 A;  2IY2 A;  2K3D A;  2GXF A;  2STD A;  3EJV A;  4IIA A;  4OK0 A;  1U5O A;  4I5Q A;  5FW5 A;  2JQ5 A;  3Q2P A;  1QJG A;  4FMB A;  1MGR A;  1ZS7 A;  2K0M A;  1L5G B;  3LTD A;  3MYT A;  1LRA A;  3CMA 3;  1Z1S A;  4Q53 A;  3WA2 X;  2OOV C;  1B21 A;  3F14 A;  1ULJ B;  1RCL A;  1VQK 3;  4GSP A;  1RGC A;  3N9H A;  4XM4 A;  2V1L A;  2XFS A;  1LOY A;  2H0I A;  1AQZ A;  3G16 A;  3MG2 A;  3EN1 B;  4FR9 A;  3ER7 A;  4K90 B;  3U1W A;  4BTX A;  1BRG A;  1V58 A;  1OF5 B;  3CU3 A;  3CNX A;  3LT9 A;  1BRJ A;  4X2O A;  3CPO A;  4RZM A;  1X1X A;  3T0U A;  1BNE A;  1ZO2 A;  2W56 B;  4KT3 B;  1S72 3;  5BVB A;  2M7O A;  5IG3 A;  2CFK A;  1JBT A;  2W0Q A;  4LZI A;  2W9Q A;  1BSA A;  2KF3 A;  3BIR A;  2W2C A;  1RNB A;  1UCL A;  1AY7 A;  1K28 A;  3B7C A;  1N8R 4;  4O8S A;  4H61 A;  1BNG A;  4KVH A;  1BAN A;  2INX A;  3FG1 A;  1Q40 A;  3CNM A;  4O2H A;  3WDG B;  2CC3 A;  1UCJ A;  1LOW A;  1G0T A;  2PNC A;  2Y74 A;  1WMO A;  1FUS A;  3A76 A;  3FLJ A;  2OQE C;  3KKG A;  5AIG A;  5IG0 A;  4EC6 A;  1N9E A;  1EQK A;  1TIJ A;  1AV4 A;  4CJN A;  4N6M A;  3MG1 A;  1A2V A;  4R9K A;  4CPK A;  1M9G A;  5GSP A;  3EBT A;  4FCJ A;  3D3L A;  2CX0 A;  3I55 3;  4KFD A;  3NHX A;  2WO0 A;  2J8X B;  2BMO B;  2JDI H;  1BRS A;  1G96 A;  3FG3 A;  3DGY A;  1BSE A;  1BUJ A;  2XSH B;  3I0Y A;  3PZW A;  1MWT A;  2W9P A;  1RDS A;  4ZM8 A;  1FGM A;  5AEW B;  3NQY A;  5CXO A;  1CYU A;  1W7C A;  1U8C B;  5BIR A;  3MWZ A;  1SII A;  4HKV B;  3VSY A;  1KSI A;  4PEJ A;  1YJW 3;  1BSB A;  1OF5 A;  2ZHX B;  1X1W A;  1FGO A;  2CFD A;  3NXJ A;  2CX1 A;  1TFO A;  2L4V A;  3EBY A;  3UL6 A;  1YIT 3;  2W56 A;  3PGB A;  3D5I A;  4MMZ B;  7RNT A;  1TUH A;  2HMJ B;  1JB2 A;  1I70 A;  1C7H A;  1QMA A;  1RGH A;  2XSO B;  5G1L A;  3KZT A;  1D6Y A;  3OWS A;  4IPB A;  3HOH A;  4FMD A;  3KSP A;  1RGE A;  3J7Y d;  1W2B 2;  2CFL A;  2F98 A;  3DGO A;  1OGX A;  1VQ5 3;  2RGQ A;  4HM6 B;  2MC8 A;  5EVH A;  1D6U A;  1A2P A;  5D83 A;  5AYS C;  3GZX B;  3OWY A;  3WA3 A;  3LXU X;  2CKF B;  3S29 A;  1MWU A;  2KXG A;  4WYK B;  1BU4 A;  1FZU A;  3CCR 3;  1W5Z A;  3F40 A;  2QGU A;  1IVX A;  1CQS A;  3BNC A;  3I56 3;  3ECF A;  3GZY B;  2KF4 A;  2L1S A;  4BL3 A;  2XFT A;  1I2E A;  8RNT A;  3N8B A;  2CHC A;  1VQN 3;  1B2Z A;  3QRD A;  3D4A A;  4OUQ A;  1RKY A;  4HZB B;  1OAC A;  2OOV A;  4CCV A;  3G71 3;  1WMN A;  1N8Q A;  2RNT A;  2GSP A;  3DGN A;  3AMO A;  4MEI A;  1BOX A;  3MHE A;  1RNT A;  1RTU A;  3DUK A;  4N6N B;  1YHQ 3;  3HI7 A;  4G1M B;  4R80 A;  3ZFZ A;  1JV2 B;  1LOV A;  1MNL A;  3PCS A;  2F99 A;  6STD A;  2FGT A;  1DMM A;  4XBX A;  1JBS A;  4HM0 B;  1GOY A;  5AYR B;  3G6E 3;  1I3F A;  1UUG B;  2HMN B;  3K63 A;  1KQS 2;  1BRN L;  3LML A;  1FUW A;  1T3B A;  1LQM B;  1CEW I;  1RGL A;  2BNG A;  1Q40 B;  2C4B A;  2WOF A;  3DZL A;  1T2I A;  3K5T A;  1QAK A;  2ZDJ A;  4MMX B;  3PYJ A;  4TX4 A;  3G8Z A;  5AIH A;  3DY5 A;  5IG4 A;  2RBI A;  4LMI A;  2OCT A;  1FYS A;  5LC6 A;  4BTY A;  3CC2 3;  3WOF B;  2YFL B;  3JUM A;  3M8C A;  2KAA A;  3EF8 A;  1ZX2 A;  2XGL A;  3CCQ 3;  2GU1 A;  2P05 A;  3B4O A;  3PS8 A;  1GOV A;  1GY7 A;  1SAR A;  5HGR A;  8CHO A;  1JZO A;  3FSD A;  5G1K A;  2OQE A;  4GHO A;  4HM4 B;  4NHF A;  1JN5 A;  3JUP A;  1X1U A;  3OV4 A;  4WYK A;  3ZG0 A;  1UGH I;  1EUI C;  1GY6 A;  1IYY A;  2C11 A;  1IK3 A;  1TU5 A;  2F5M A;  1GD4 A;  1RGA A;  2CFG A;  3KCH A;  1B20 A;  1LQG C;  1RGG A;  3UB1 A;  2WGQ A;  5EQL A;  1OHP A;  3X41 A;  1BNI A;  7STD A;  3IJE B;  3X3X A;  4I4K A;  1TRQ A;  3MKI A;  4HM7 B;  1IDP A;  4FCM A;  1RLS A;  3T8U A;  4EV5 A;  4RBN A;  1DVD A;  1OUN A;  3AGO A;  3TDG A;  2Z77 A;  1T5Y A;  4WWU C;  1JNQ A;  2W04 A;  1UCI A;  4GL6 A;  3CPW 2;  1FW7 A;  1FGR A;  1G02 A;  1W6Y A;  1GMR A;  1ULI B;  4HZ9 B;  1W02 A;  2B1X B;  1JB5 A;  1A90 A;  1MOL A;  1BRI A;  1ROA A;  2IUJ A;  1N9J A;  3EN8 A;  4JF8 A;  3K0Z A;  3H51 A;  1UW1 A;  1WTH A;  1EA2 A;  3FG4 A;  4MMY B;  1RSN A;  2KCD A;  3GWR A;  4KFF A;  2E2V A;  3EQQ B;  1US1 A;  1E3V A;  3FH1 A;  4EV2 A;  1GSP A;  1UCK A;  2AAD A;  2RSX A;  4U13 A;  2RFR A;  3V99 A;  1F8N A;  3GRD A;  3DGL A;  1J2B A;  2P38 A;  5BXQ A;  1I3I A;  1OH0 A;  4HM2 B;  1I8V A;  1O7M B;  1FUT A;  1JZD A;  1T2H A;  4HBR A;  2YFI B;  4R1K A;  3LOY A;  3VF1 A;  2MF7 A;  4L8O A;  1YJN 3;  1DMN A;  1E3R A;  2IUK A;  2H0H A;  2HMK B;  4NRE A;  3AMO B;  3EX9 A;  2WOH A;  4J5K A;  1RN4 A;  2E2T A;  3DM8 A;  1WNH A;  3BNB A;  3AHS A;  3NBB A;  4XDW A;  3LTB A;  1M1K 4;  3KSE D;  1GMQ A;  1B2X A;  1GOU A;  2XR8 B;  5IEP A;  2P0M A;  1JBR A;  1IQ8 A;  3DGM A;  2O3O A;  2R4I A;  3V92 A;  1NWW A;  1K41 A;  3D79 A;  3CCV 3;  1RGK A;  1A2K A;  1I0V A;  1VQP 3;  5AII A;  2R41 A;  1IQY A;  2K54 A;  1JB4 A;  4GB5 A;  1A67 A;  1N5P A;  2CG0 A;  3NUV A;  3X42 A;  3BLZ A;  2D1W A;  3PCR A;  3B8L A;  3F7S A;  1VQM 3;  1JKG B;  1OCV A;  3G4S 3;  3CCS 3;  1VQ4 3;  2ZL8 A;  3BNE A;  1VQ8 3;  1MGW A;  1M1X B;  3A5E A;  2CK3 H;  1RN1 A;  1RMS A;  1IVW A;  4NPB A;  5TGN A;  1YJ9 3;  5KP4 A;  4FCZ A;  1UUV B;  5HOH A;  4LSO A;  4LYL B;  1X1Y A;  4J8T A;  2XF3 A;  3S27 A;  1JN5 B;  3UL5 A;  2F56 A;  2P09 A;  3HIG A;  2Y73 A;  5IEO A;  2F5W A;  1N5H A;  2XGN A;  1B2M A;  5FGO A;  3CC7 3;  1EG9 B;  3NM7 A;  3NX0 A;  1TP6 A;  1AR0 A;  2Z6B A;  3KN4 A;  1E97 A;  4O3V A;  1WQL B;  2HOH A;  1BNJ A;  3L0R A;  2XRX B;  2H0G A;  4RNZ A;  3CCU 3;  2E2U A;  2ZA4 A;  1VQ7 3;  3JVC A;  3F8X A;  1DVC A;  1TRP A;  1WMP A;  4X2H A;  1BSD A;  2KF6 A;  3AGN A;  5G2G A;  5M1A A;  3CCL 3;  3RGA A;  4XB5 A;  3X3Z A;  1RRH A;  1YNV X;  1MWS A;  2P0X A;  1HZ1 A;  2A15 A;  1UI7 A;  3X40 A;  2YFJ B;  3WOE B;  1YVB I;  1YIJ 3;  1IVU A;  4IT7 A;  1NDO B;  5ELJ A;  4EBG A;  3UNL A;  3SOY A;  2KF5 A;  1Q81 4;  4N3V A;  5IER A;  1VQO 3;  3CD6 3;  3OX9 A;  3S28 A;  1FA3 A;  5M19 A;  2F86 B;  2LQV A;  1JRQ A;  1CH0 A;  1TTO A;  2GU3 A;  2C10 A;  1LVN A;  3B4P A;  1JKG A;  3VGN A;  1JJ2 2;  4BTW A;  1BGS A;  4FMA A;  1OHO A;  1YGE A;  3D9R A;  1I0X A;  1CYV A;  6RNT A;  1NU3 A;  1TJD A;  3SYU A;  1B2U A;  3K7C A;  2UX0 A;  2FXT A;  4JRF A;  3OXA A;  2F4Y A;  4KZ1 A;  2BMQ B;  1K73 4;  4LEH A;  1SJW A;  3SED A;  1IV9 A;  3CCM 3;  5IW9 A;  1PFP A;  2UUG C;  4H3U A;  1BVI A;  3FCS B;  3STD A;  3IMA B;  3BND A;  3O8Y A;  3Q3F A;  1AVL A;  2HMO B;  5AIF A;  2SBL A;  1ISK A;  2OWP A;  4KFE A;  1EEJ A;  4BL2 A;  1NO3 A;  2CIU A;  1IV7 A;  1BIR A;  4BIR A;  5JPP A;  2RCD A;  1BNS A;  2Z7A A;  2PZV A;  4AKY A;  2I9W A;  1D6Z A;  5M18 A;  1LOX A;  4R9L A;  4HM3 B;  1W00 A;  2OTL 3;  1IT7 A;  3Q90 A;  4XBY A;  1BUQ A;  5EEO A;  2W6J H;  1IVV A;  5CF1 A;  2QEX 3;  1K8A 4;  4K61 A;  4DKI A;  2QIY A;  2HML B;  1V57 A;  3FF0 A;  1O7N B;  2HMM B;  2XEP A;  3QK9 A;  4J5G A;  4N6T A;  1QVF 2;  1B27 A;  5IEN A;  5CK6 A;  1STF I;  1LNI A;  4HYZ A;  3SX1 A;  4AKZ A;  1GMP A;  1UGI A;  1O7H B;  2GBW B;  3DH2 A;  3SOA A;  1KD1 4;  1C54 A;  1KWI A;  2CFW A;  1VQ9 3;  1Q9E A;  1HYF A;  1I2F A;  5IF6 A;  3Q1C A;  2CWU A;  1LNH A;  4R4K A;  3OW2 2;  1EKM A;  1Q7H A;  4WP5 A;  3F7X A;  3IPT A;  2B24 B;  1RGF A;  3RGR A;  1B3S A;  1IQX A;  1M90 4;  1DYU A;  2ML5 A;  5RNT A;  3MPH A;  1TFK A;  6GSP A;  3LT8 A;  3LZA A;  1W2Z A;  1R4Y A;  4RNY A;  3F9S A;  4EXR A;  2FNQ A;  3K9M C;  1YI2 3;  3BU4 A;  5DRE A;  3HII A;  3NQZ A;  3SVA A;  1VQQ A;  1YVS A;  1ZGX A;  3G0K A;  5STD A;  5CF2 A;  1UI8 A;  1DMQ A;  1W01 A;  3ROB A;  2CWV A;  4ORL A;  3CXC 2;  3LYG A;  2QA4 3;  3WR2 A;  3WHO A;  1GS3 A;  1GD3 A;  3HZP A;  3CC4 3;  3GZR A;  2IMJ A;  2IA7 A;  3SLU A;  4CDL A;  1PYL A;  3NM2 A;  1UUW B;  2CWT A;  5AEU B;  5D82 A;  2CW9 A;  1R4C A;  2BHM A;  4RNT A;  5CLK A;  1NJI 4;  3HX8 A;  1Q42 A;  1OHS A;  1W6G A;  2LYX A;  1Q86 4;  2SAR A;  1BRH A;  3NBR A;  4L8P A;  1I2G A;  4WFO A;  1V74 A;  1RJO A;  4BU4 A;  2CG1 A;  1QVG 2;  1ASK A;  1ROV A;  3UJM A;  3ALA A;  1BNF A;  4N6O B;  2WGO A;  3FKA A;  1GY5 A;  1KC8 4;  1NB3 I;  1GYB A;  2BO9 B;  2KRT A;  3GAX A;  4O02 B;  1BAO A;  3RDE A;  1B2S A;  1FGQ A;  2CH9 A;  3U97 A;  4N6U A;  2AAE A;  1IU7 A;  4K1V A;  1FGT A;  1K9M 4;  1NB5 I;  2BMR B;  5IG5 A;  3NV0 B;  1RCK A;  1W4N A;  3MG3 A;  4HM1 B;  4J9A A;  1MWR A;  1STD A;  3D5G A;  1SQW A;  4FMC A;  5I97 A;  1BRK A;  1SPU A;  3FGY A;  7GSP A;  3URP A;  3LTA A;  1BSC A;  1RRL A; 
#chains in the Genus database with same CATH homology
 5KP3 A;  4HM8 B;  1OGZ A;  5KP1 A;  4HVN A;  4XBT A;  3CCE 3;  2O9U X;  4MJD A;  3WMD A;  1Q82 4;  1QAF A;  1AVK A;  1HU9 A;  5JBS A;  2XH9 A;  4OVM A;  1O7G B;  1RN7 A;  3BB9 A;  4AEQ A;  1W6C A;  4N6V 0;  2Q07 A;  1O7P B;  4XDV A;  3S5C A;  3LH4 A;  1S5A A;  3PXM A;  1SIH A;  3KFQ C;  3JUQ A;  3E99 A;  3T8N A;  5A0O B;  1VQL 3;  3FZW A;  3NBJ A;  3EC9 A;  3SXX A;  3GZB A;  3JUN A;  4STD A;  4EYC A;  3KE7 A;  3EB8 A;  5D81 A;  2GBX B;  1O7W B;  2ML6 A;  4WHA A;  3V98 A;  1VQ6 3;  5JPU A;  3FF2 A;  3F8H A;  4HJL B;  5DRV A;  1Y4K A;  3JUO A;  2D42 A;  2OTJ 3;  3HK4 A;  3EHC A;  4N6L A;  5AI1 A;  4LGQ A;  3LTC A;  1IT8 A;  1VZZ A;  3CCJ 3;  3OWU A;  3H3H A;  2YX9 A;  3X3Y A;  3N54 B;  4K1U A;  1QAL A;  4QWT A;  3S67 A;  2BT3 A;  3MSO A;  1Q7Y 4;  3NV0 A;  5ELU A;  3WOD G;  4HM5 B;  1HKX A;  2GEX A;  5LC7 A;  3KII A;  2GEY A;  3DXO A;  1PU4 A;  3EE1 A;  4L7K A;  1LXE A;  3DMC A;  3CME 3;  1OPY A;  2W03 A;  2Z76 A;  3EJV A;  4IIA A;  2GXF A;  2STD A;  4OK0 A;  1U5O A;  5FW5 A;  2JQ5 A;  3Q2P A;  1QJG A;  4FMB A;  1L5G B;  2K0M A;  3LTD A;  3MYT A;  3CMA 3;  1Z1S A;  4Q53 A;  3WA2 X;  2OOV C;  3F14 A;  1ULJ B;  1VQK 3;  3N9H A;  4XM4 A;  2V1L A;  2XFS A;  3G16 A;  3MG2 A;  4FR9 A;  3EN1 B;  4BTX A;  3ER7 A;  4K90 B;  3U1W A;  1OF5 B;  3CU3 A;  3CNX A;  3LT9 A;  4X2O A;  3CPO A;  4RZM A;  3T0U A;  1ZO2 A;  2W56 B;  1S72 3;  5BVB A;  2M7O A;  5IG3 A;  2CFK A;  2W0Q A;  4LZI A;  2W9Q A;  2W2C A;  1K28 A;  3B7C A;  1N8R 4;  4O8S A;  4H61 A;  4KVH A;  2INX A;  3FG1 A;  1Q40 A;  3CNM A;  4O2H A;  3WDG B;  2CC3 A;  3FLJ A;  3KKG A;  2PNC A;  2Y74 A;  1WMO A;  3A76 A;  2OQE C;  5AIG A;  5IG0 A;  4EC6 A;  1N9E A;  1EQK A;  1TIJ A;  1AV4 A;  4N6M A;  3MG1 A;  1A2V A;  4R9K A;  1M9G A;  3EBT A;  4FCJ A;  3D3L A;  3I55 3;  4KFD A;  3NHX A;  2WO0 A;  2BMO B;  2JDI H;  3FG3 A;  1G96 A;  2XSH B;  3I0Y A;  3PZW A;  2W9P A;  4ZM8 A;  1FGM A;  5AEW B;  3NQY A;  5CXO A;  1CYU A;  1W7C A;  1U8C B;  3MWZ A;  1SII A;  4HKV B;  3VSY A;  1KSI A;  4PEJ A;  1YJW 3;  1OF5 A;  1FGO A;  2CFD A;  3NXJ A;  3UL6 A;  1TFO A;  2L4V A;  3EBY A;  1YIT 3;  2W56 A;  3PGB A;  4MMZ B;  1TUH A;  2HMJ B;  1JB2 A;  1C7H A;  1QMA A;  2XSO B;  3KZT A;  1D6Y A;  3OWS A;  4IPB A;  4FMD A;  3KSP A;  3J7Y d;  1W2B 2;  2CFL A;  2F98 A;  3DGO A;  1OGX A;  1VQ5 3;  2RGQ A;  4HM6 B;  2MC8 A;  5EVH A;  1D6U A;  5D83 A;  5AYS C;  3GZX B;  3OWY A;  3WA3 A;  3LXU X;  2CKF B;  3S29 A;  2KXG A;  4WYK B;  3CCR 3;  1W5Z A;  3F40 A;  2QGU A;  1IVX A;  1CQS A;  3BNC A;  3I56 3;  3ECF A;  3GZY B;  2XFT A;  3N8B A;  2CHC A;  1VQN 3;  3QRD A;  4OUQ A;  1RKY A;  4HZB B;  1OAC A;  2OOV A;  4CCV A;  3G71 3;  1WMN A;  1N8Q A;  3DGN A;  4MEI A;  3AMO A;  4N6N B;  3S27 A;  3MHE A;  1YHQ 3;  3DUK A;  3HI7 A;  4G1M B;  4R80 A;  1JV2 B;  1MNL A;  3PCS A;  2F99 A;  6STD A;  2FGT A;  1DMM A;  4XBX A;  4HM0 B;  3G6E 3;  5AYR B;  2HMN B;  1KQS 2;  3K63 A;  1FUW A;  3LML A;  3DZL A;  1CEW I;  2BNG A;  2WOF A;  1Q40 B;  3K5T A;  1QAK A;  2ZDJ A;  4MMX B;  3PYJ A;  4TX4 A;  3G8Z A;  5AIH A;  3DY5 A;  5IG4 A;  4LMI A;  2OCT A;  5LC6 A;  4BTY A;  3CC2 3;  3WOF B;  2YFL B;  3JUM A;  3M8C A;  3EF8 A;  1ZX2 A;  2XGL A;  3CCQ 3;  2GU1 A;  2P05 A;  3B4O A;  3PS8 A;  8CHO A;  1GY7 A;  5HGR A;  3FSD A;  2OQE A;  4HM4 B;  4NHF A;  1JN5 A;  3JUP A;  3OV4 A;  4WYK A;  1GY6 A;  2C11 A;  1IK3 A;  1TU5 A;  1GD4 A;  2CFG A;  3UB1 A;  2WGQ A;  5EQL A;  1OHP A;  3X41 A;  7STD A;  3IJE B;  3X3X A;  4I4K A;  3MKI A;  4HM7 B;  1IDP A;  4FCM A;  3T8U A;  4EV5 A;  4RBN A;  1DVD A;  1OUN A;  3TDG A;  2Z77 A;  1T5Y A;  4WWU C;  1JNQ A;  2W04 A;  4GL6 A;  3CPW 2;  1FGR A;  1W6Y A;  1ULI B;  4HZ9 B;  1W02 A;  2B1X B;  1JB5 A;  1A90 A;  1MOL A;  1ROA A;  2IUJ A;  1N9J A;  3EN8 A;  4JF8 A;  3K0Z A;  3H51 A;  1UW1 A;  1WTH A;  1EA2 A;  3FG4 A;  4MMY B;  2KCD A;  3GWR A;  4KFF A;  2E2V A;  3EQQ B;  1US1 A;  1E3V A;  3FH1 A;  4EV2 A;  2RSX A;  4U13 A;  3V99 A;  2RFR A;  1J2B A;  1F8N A;  3GRD A;  3DGL A;  2P38 A;  5BXQ A;  1OH0 A;  4HM2 B;  1O7M B;  4HBR A;  2YFI B;  4R1K A;  3LOY A;  3VF1 A;  2MF7 A;  4L8O A;  1YJN 3;  1DMN A;  1E3R A;  2IUK A;  2HMK B;  4NRE A;  3AMO B;  3EX9 A;  2WOH A;  2E2T A;  3DM8 A;  1WNH A;  3BNB A;  3NBB A;  4XDW A;  3LTB A;  1M1K 4;  3KSE D;  5IEP A;  2XR8 B;  2P0M A;  1IQ8 A;  3DGM A;  2O3O A;  2R4I A;  3V92 A;  1NWW A;  1K41 A;  3CCV 3;  1A2K A;  1VQP 3;  5AII A;  1IQY A;  2K54 A;  1JB4 A;  4GB5 A;  1A67 A;  1N5P A;  2CG0 A;  3NUV A;  3X42 A;  3BLZ A;  2D1W A;  3PCR A;  3B8L A;  3F7S A;  1VQM 3;  1JKG B;  1OCV A;  3G4S 3;  3CCS 3;  1VQ4 3;  2ZL8 A;  3BNE A;  1VQ8 3;  1M1X B;  5TGN A;  2CK3 H;  1YJ9 3;  1IVW A;  5KP4 A;  4FCZ A;  1UUV B;  4LSO A;  4J8T A;  2XF3 A;  1JN5 B;  3UL5 A;  2P09 A;  3HIG A;  2Y73 A;  5IEO A;  1N5H A;  2XGN A;  5FGO A;  3CC7 3;  1EG9 B;  3NM7 A;  3NX0 A;  1TP6 A;  1AR0 A;  2Z6B A;  3KN4 A;  1E97 A;  4O3V A;  1WQL B;  3L0R A;  2XRX B;  4RNZ A;  3CCU 3;  2E2U A;  1VQ7 3;  3JVC A;  3F8X A;  1DVC A;  1WMP A;  5G2G A;  4X2H A;  3CCL 3;  3RGA A;  4XB5 A;  3X3Z A;  1RRH A;  2P0X A;  2A15 A;  1UI7 A;  3X40 A;  2YFJ B;  3WOE B;  1YVB I;  1YIJ 3;  1IVU A;  4IT7 A;  1NDO B;  5ELJ A;  4EBG A;  3UNL A;  3SOY A;  1Q81 4;  4N3V A;  5IER A;  1VQO 3;  3CD6 3;  3OX9 A;  3S28 A;  1FA3 A;  2F86 B;  2LQV A;  1JRQ A;  3B4P A;  1JJ2 2;  2GU3 A;  2C10 A;  1LVN A;  3VGN A;  1JKG A;  4BTW A;  4FMA A;  1OHO A;  1YGE A;  3D9R A;  1CYV A;  1NU3 A;  3K7C A;  2UX0 A;  2FXT A;  4JRF A;  3OXA A;  4KZ1 A;  2BMQ B;  1K73 4;  4LEH A;  1SJW A;  3SED A;  1IV9 A;  3CCM 3;  5IW9 A;  1PFP A;  4H3U A;  3FCS B;  3STD A;  3IMA B;  3BND A;  3O8Y A;  1AVL A;  2HMO B;  5AIF A;  2SBL A;  1ISK A;  2OWP A;  4KFE A;  1NO3 A;  2CIU A;  1IV7 A;  5JPP A;  2RCD A;  2Z7A A;  2PZV A;  4AKY A;  2I9W A;  1D6Z A;  1LOX A;  4R9L A;  4HM3 B;  1W00 A;  2OTL 3;  1IT7 A;  3Q90 A;  4XBY A;  1BUQ A;  5EEO A;  2W6J H;  1IVV A;  5CF1 A;  2QEX 3;  1K8A 4;  4K61 A;  2QIY A;  2HML B;  3FF0 A;  1O7N B;  2HMM B;  2XEP A;  3QK9 A;  4N6T A;  1QVF 2;  5IEN A;  5CK6 A;  1STF I;  4HYZ A;  3SX1 A;  4AKZ A;  1O7H B;  2GBW B;  3SOA A;  1KD1 4;  1KWI A;  2CFW A;  1VQ9 3;  5IF6 A;  3Q1C A;  2CWU A;  1LNH A;  4R4K A;  3OW2 2;  1EKM A;  4WP5 A;  3F7X A;  3IPT A;  2B24 B;  3RGR A;  1IQX A;  1M90 4;  1DYU A;  2ML5 A;  3MPH A;  1TFK A;  3LT8 A;  3LZA A;  1W2Z A;  4RNY A;  3F9S A;  4EXR A;  2FNQ A;  3K9M C;  1YI2 3;  5DRE A;  3SVA A;  3HII A;  3NQZ A;  5STD A;  3G0K A;  5CF2 A;  1UI8 A;  1DMQ A;  1W01 A;  3ROB A;  2CWV A;  4ORL A;  3CXC 2;  3LYG A;  2QA4 3;  1GS3 A;  1GD3 A;  3HZP A;  3CC4 3;  3GZR A;  2IMJ A;  2IA7 A;  3SLU A;  4CDL A;  3NM2 A;  1UUW B;  2CWT A;  5AEU B;  5D82 A;  2CW9 A;  1R4C A;  2BHM A;  5CLK A;  1NJI 4;  3HX8 A;  1Q42 A;  1OHS A;  1W6G A;  2LYX A;  1Q86 4;  3NBR A;  4L8P A;  4WFO A;  1V74 A;  1RJO A;  2CG1 A;  1QVG 2;  1ASK A;  1ROV A;  3UJM A;  3ALA A;  4N6O B;  2WGO A;  3FKA A;  1GY5 A;  1KC8 4;  1NB3 I;  1GYB A;  2BO9 B;  2KRT A;  3GAX A;  4O02 B;  3RDE A;  1FGQ A;  2CH9 A;  3U97 A;  4N6U A;  1IU7 A;  4K1V A;  1FGT A;  1K9M 4;  1NB5 I;  2BMR B;  5IG5 A;  3NV0 B;  4HM1 B;  1W4N A;  3MG3 A;  4J9A A;  1STD A;  1SQW A;  4FMC A;  5I97 A;  3FGY A;  1SPU A;  3LTA A;  1RRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...