2W2FA

Crystal structure of single point mutant arg48gln of p-coumaric acid decarboxylase from lactobacillus plantarum structural insights into the active site and decarboxylation catalytic mechanism
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
175
structure length
175
Chain Sequence
b'TKTFKTLDDFLGTHFIYTYDNGWEYEWYAKNDHTVDYRIHGGMVAGQWVTDQKADIVMLTEGIYKISWTEPTGTDVALDFMPNEKKLHGTIFFPKWVEEHPEITVTYQNEHIDLMEQSREKYATYPKLVVPEFANITYMGDAGQNNEDVISEAPYKEMPNDIRNGKYFDQNYHRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-COUMARIC ACID DECARBOXYLASE
publication title P-Coumaric Acid Decarboxylase from Lactobacillus Plantarum: Structural Insights Into the Active Site and Decarboxylation Catalytic Mechanism.
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Lyase
total genus 48
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05870 PA_decarbox Phenolic acid decarboxylase (PAD)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2w2fA00
4IB6A 1JJXA 1X71A 4IB9A 3ELXA 1H91A 1KT3A 3TGCA 5EDBA 1ZNEA 4YCHA 2WWPA 2XKLA 1A3YA 4DQ4A 1U0XA 4AZMA 5H9LA 1S7DA 3APUA 5KICA 1RBPA 2FS6A 1GT4A 3FA7A 1VYGA 1KZWA 2OZQA 4YKOA 2ASNX 2WEXA 2ALLX 2CZTA 1G7NA 4HPDA 4DQ3A 1P6PA 3BS2A 4YKMA 2HLVA 1ICNA 4ZH9A 1DF3A 1IFBA 3NADA 4ZFXA 3NPOA 4ORYA 1T0VA 1X89A 1GX8A 5LJGA 2FS7A 1DC9A 4OMWA 2QO4A 2FT9A 3TZSA 2OVEA 2AH7X 1UREA 4ZH6A 4EXZA 4YBPA 1AQBA 2L9CA 4WFUA 1PM1X 4Y0PA 5FENA 3BSZE 2RQ0A 4ZHDA 5LJEA 3FIQA 3HWGA 4IMNA 4BVMA 4QYPA 4QAEA 4RUUA 5HAEA 5FFHA 3FLLA 1OEKA 4RUNA 1GKAA 4M7MA 2W2FA 4K19A 4PSQA 4EFGA 3NQ9A 3WJEA 1PMPA 1GGLA 1TW4A 5B27A 4O9SA 3TF6A 2W2BA 3KQ0A 4ODDA 2HMBA 3FELA 1AB0A 1FEMA 1EW3A 1PBOA 4ZR2A 3KFHA 1GT5A 2CBRA 5HBSA 1KXOA 3BY0A 5AQ6A 5HA0A 4ORUA 1ICMA 3JSQA 4A60A 1LF7A 3APXA 1DZPA 4ZCBA 2CZUA 2JU8A 2FTBA 2RA6A 1HBPA 3FA9A 3VG6A 5B29A 1SY0A 5IO5A 4NYQA 1DZJA 1YWCA 4YH0A 5HZ8A 2DM5A 3FW5A 1QABE 4ORRA 3C77X 5EDCA 1S44A 4GNYA 2P8GA 3F8AA 5H8TA 1T8VA 4NNSA 4M6SA 5HTDA 5C0NA 1GXAA 5D48A 5KHPA 2YG2A 1E06A 5HTEA 4QZTA 4QGWA 1LIEA 1OPAA 3KFIA 3CR6A 5D4AA 3C76X 1LFOA 3BU1A 3UEXA 1IW2A 3L4RA 1BSOA 3BDRA 3KFGA 4WBKA 4XMEA 1EXSA 2A2UA 3BX7A 1DV9A 4YFRA 1L6MA 1ERBA 3I17A 4UU3A 4ZJ0A 2AT0X 1KZXA 4YDBA 4Y0RA 4D6AA 3IA8A 3QKGA 3FEPA 2G7BA 4XMHA 1CBRA 1R0UA 1JYDA 1MDCA 2L67A 4GKCA 3B2HA 1ML7A 2FLJA 2ACPX 5LJKA 1HMRA 4KIIA 4IBAA 3FENA 1ZNLA 3P6CA 1FTPA 1KQXA 4OMXA 5K06A 1DFVA 1OEEA 5H9KA 2W2AA 1X8QA 5D47A 4AZRA 4TLJA 3U03A 3BU9A 1G85A 2FR2A 2Q4NA 2RCQA 4IAWA 4NLJA 4I3BA 4AZQA 2KT4B 2GTFX 5D45A 5L8IA 1E02A 1O1UA 3MBTA 2A2GA 2K62A 2NNEA 1HBQA 3BX8A 2XSTA 3IFBA 5DPQA 3RSWA 2G78A 3P6DA 1X8OA 4GH7A 3FMZA 3CBCA 1SY1A 3NX1A 2GJ5A 2LBVA 2Q2PA 3EMMA 5BVSA 2OFRX 1SY2A 2X45A 1UZ2X 1BSYA 3FA8A 1IKJA 4ZHFA 2N93A 3O22A 5H9AA 4AZOA 3WJGA 1MX7A 2L5PA 1YP6A 2LKKA 5H9NA 2E4JA 2WEWA 3D97A 4TKBA 1SXXA 2FR3A 2QOSC 5HZ5A 1SXUA 1A2DA 3WJFA 5EEEA 3DSZA 3PECA 1GM6A 4IB8A 5HCCC 1KGLA 3FA6A 2EU7X 1D3SA 3EM0A 1MUPA 1I4UA 4ORXA 5DG4A 1XKIA 3RZYA 3CQRA 4I9RA 3D96A 3U9PC 4R0BA 4ORSA 1ERXA 1FDQA 3CBSA 1MVGA 5HZ6A 1IIUA 1B4MA 4MVKA 1HMTA 2LFOA 2GC9A 1TVQA 1BM5A 4NLIA 1EUOA 2MO5A 4ZGUA 1E5PA 2POAA 1CBSA 1G5WA 5HCDC 1O1VA 5FAZA 1YP7A 3WJDA 5HA1A 2AT5X 3EYCA 1EPAA 1OBQA 1HMSA 4D6BA 4A1YA 1B0OA 3FW4A 1HQPA 2WQAE 1T68X 2CM9A 1TOWA 5HCEC 4UU2A 3P6EA 4OS8A 3NQ3A 4Y0SA 4N7DA 1CRBA 1YUPA 2QO5A 5LJDA 3NX2A 3TGBA 1KT6A 4YMYA 4NNTA 2MJIA 3Q6LA 4GRJA 4A8ZA 4ZHGA 3PP6A 3D95A 5KIDA 1QWDA 1O8VA 4TJZA 3VG3A 1GT3A 2FRSA 5L8NA 2AL0X 1QY1A 1X8PA 4I3CA 5BVQA 2ANSA 3PEDA 4XMDA 1FE3A 3DTQA 3STMX 4NYRA 1EPBA 1JV4A 3JS1A 2L68A 2OVAA 3HWDA 3STKA 1ADLA 4YCEA 2IFBA 1BBPA 3KZAA 2AMMX 1ZNGA 2A13A 1B8EA 2NNQA 3WBGA 4YFPA 3UEVA 3OJYC 4AZNA 4XMFA 3P6FA 1ZNDA 4YBUA 3VG4A 4IB7A 1PEEA 1YIVA 3APVA 1BLRA 1LIBA 3PPTA 1SXWA 3FR4A 3PH5A 2ACOA 2KTDA 2JU7A 1B56A 1NGLA 1LIDA 1ACDA 4TQ2A 1BEBA 5LKFA 1LPJA 1X8UA 1VPRA 5JR8A 4TNNA 2R74A 1ZNHA 2MM3A 3UEWA 1GT1A 3VG5A 4HPCA 2QO6A 4ALOA 4YGZA 4ZHCA 3U0DA 2R73A 1S2PA 3B2KA 5EZ2A 1X8NA 2AKQA 4EDEA 1JZUA 1OBUA 5HZ9A 1Z24A 2Q2MA 1KQWA 2CBSA 1NP1A 3AKMA 4QYNA 1BRQA 1BSQA 2HZQA 4YDAA 1EALA 4I3DA 2FWVA 1IFCA 2WSJA 3HWFA 1I04A 3GAQA 3WXQA 3ZQ3A 1U17A 2CM4A 1KT7A 1QFTA 2BLGA 3MVFA 4EEJA 1I06A 2NP1A 4HPAA 2NNDA 5BVTA 2RD7C 3P6HA 4A1HA 4HFOA 4ALBA 1QFVA 1FENA 5LJHA 1EIOA 2LBAA 1QY2A 4ORWA 1YWDA 1A57A 1OBPA 2O62A 1OPBA 1QQSA 1HN2A 3NR3A 1KT5A 1SY3A 3UEUA 1LIFA 1BWYA 3T1DA 1A18A 2Q39A 1ZRYA 3O19A 5D8JA 3BRNA 1VYFA 3C78X 1G74A 4BQUA 2AT3X 3G7XA 4IMOA 1GKAB 3FR5A 2WR6A 5CE4A 1BRPA 4NP1A 4QZUA 3NP1A 5HWZA 5F1EA 3STNA 4LKPA 1AELA 1KOIA 2A0AA 1KT4A 4AW8A 1EQDA 2AT6X 1DZKA 3CWKA 2WUTA 3B2LA 4ZHHA 3WVMA 2QM9A 3FEKA 4GNWA 3CMPA 3AKNA 1XCAA 1CBIA 1NP4A 3VG2A 1SA8A 1AVGI 2F73A 4AZPA 2WQ9A 3APWA 1CBQA 5LKEA 3FR2A 4TKJA 4Y0QA 1TXLA 2HNXA 3EBKA 3ZUIA 4XMCA 4AYHA 2Q9SA 4GETA 1FELA 3EBWA 1ZNKA 1JJJA 1ALBA 1MX8A 2JOZA 2AT8X 3KFFA 1QG5A 1TOUA 2RCTA 3WJBA 1DZMA 3WJCA 3PH6A 3I0AA 5EPQA 4LKTA 5IO7A 3HWEA 4LZVA 3S26A 3BLGA 4GE1A 1JYJA 4QGXA 4IAXA 1QY0A 4YFQA 4HPBA 4ES7A 2K23A 1EIIA 2HYSA 3B2JA 1YWAA 5F6BA 4QGVA 4LZUA 3B2IA 1LICA 4ARHA 1U18A 3F9DA 2JN3A 4OS0A 3CQNA 2PY1A 1SXYA 1N0SA 2OVDA 5LJBA 5L8OA 5F58A 1BJ7A 1I05A 3K3LA 5F6ZA 5EEDA 1LNMA 1LKEA 1RLBE 1E00A 3SAOA 3ZUOA 2JU3A 4YGHA 5IO6A 2HZRA 4MVLA 1GX9A 4MVIA 4WFVA 4XMGA 3VG7A 4OS3A 4TKHA 4CK4A 3ELZA 2OFMX 2LB6A 2X46A 4I9SA 3TGAA 2G79A 3O2YA 5F7GA 5LJCA 3HK1A 4YGGA 4BOEA 1IKEA 1OEJA 2A3FX 2R56A 4N7CA 1YWBA 1CJ5A 1JBHA 5HZQA 1D2UA 3P6GA
chains in the Genus database with same CATH superfamily
4IB6A 3RE5A 1X71A 4BGFA 1JJXA 1SLGB 2OL7A 3MG5A 4IB9A 3ELXA 2ZAIA 1H91A 1KT3A 1VWGB 3TGCA 3N91A 5EDBA 1VWOB 1ZNEA 4YCHA 1LUQA 2X8TA 2AF5A 2WWPA 2XKLA 1A3YA 1LCVA 4DQ4A 1U0XA 4GGTA 4AZMA 2KW1A 5H9LA 3LHNA 1S7DA 3APUA 5FQ8E 1RBPA 4EKVA 5KICA 2FS6A 3RDXA 1GT4A 3HPEA 3FA7A 1VYGA 1KZWA 2OZQA 3D4RA 3EC5A 2ASNX 4YKOA 4CPIA 2WEXA 2ALLX 2CZTA 1G7NA 4HPDA 4DQ3A 1P6PA 3BS2A 4YKMA 2HLVA 3OE3A 1ICNA 4ZH9A 1DF3A 1IFBA 1SWOA 1DF8A 3NADA 1Y0GA 3NPOA 4JNJA 1T0VA 1X89A 1GX8A 4ORYA 5CSEA 5LJGA 3VGWA 2CAMA 4CPEA 2FS7A 4GUZA 2OFBA 1VWHB 1DC9A 2RTCB 4OMWA 1SWRA 2FT9A 2QO4A 3TZSA 3PK2A 4GGZA 3WZQA 2OVEA 2AH7X 1UREA 4ZH6A 4EXZA 4FBRA 4YBPA 4GGRA 3LTWA 1AQBA 2L9CA 4WFUA 1PM1X 4Y0PA 1SMPI 1VWAB 4QQ1A 5IRUA 5FENA 4CDEA 3BSZE 2RQ0A 3PDFA 3VE1A 4ZHDA 1WBIA 2DJGA 5LJEA 3FIQA 3HWGA 3PQUA 4IMNA 4NW4A 3UAQA 4BVMA 1SWSA 4QYPA 3RY2A 3SLOA 4QAEA 4RUUA 5HAEA 5B5GA 1JMXA 5FFHA 1NC9A 3FLLA 2QMIA 1STRB 1OEKA 2Y3EA 2IZCB 1GKAA 4M7MA 4RUNA 2W2FA 4IRWA 4DCBA 4K19A 4PSQA 4EFGA 3NQ9A 2ZAGA 3WJEA 1PMPA 1GGLA 4CDCA 1TW4A 3S5VA 5B27A 4O9SA 5B11O 3TF6A 2W2BA 3KQ0A 4ODDA 2HMBA 2RTKA 3FELA 1AB0A 3P24A 1FEMA 1EW3A 1PBOA 4ZR2A 3KFHA 1GT5A 2CBRA 5HBSA 2OY5O 3WYQA 1KXOA 3BY0A 3OBLA 5AQ6A 5HA0A 4ORUA 1ICMA 1RSUB 1SRIA 3JSQA 4MVEA 4A60A 1LF7A 3APXA 1DZPA 4ZCBA 2CZUA 2JU8A 2FTBA 2BSZA 2RA6A 1HBPA 3X00A 2FHNX 2RTOB 3FA9A 3VG6A 5B29A 1SY0A 1FJ1E 4NYQA 5IO5A 1DZJA 2OYBO 2C4IA 1YWCA 4I6SA 4QNIA 4YH0A 3RDQA 4BCSA 5HZ8A 2DM5A 3FW5A 1QABE 4ORRA 3C77X 2MWHA 5EDCA 1S44A 4GNYA 2P8GA 3F8AA 5H8TA 2RTHB 1KL5A 1T8VA 2VFCA 4NNSA 3HOEA 4M6SA 5HTDA 5C0NA 1GXAA 5D48A 4ML7B 5KHPA 1VWIB 1E06A 2YG2A 5HTEA 2RTQB 4QZTA 3VHHA 3VU1A 4BX6B 1SWJA 2AVIA 4QGWA 3ZI8A 4U8UN 3WZNA 2YMSA 1I78A 1SWEA 1LIEA 1OPAA 3KFIA 2IZGB 3CR6A 5D4AA 3C76X 1K24A 1LFOA 2KD2A 1N4JA 3BU1A 3UEXA 2RTFB 1Y55X 1IW2A 3L4RA 1BSOA 3BDRA 3PQSA 4O3WA 3KFGA 4WBKA 3CKGA 2GTLN 4XMEA 1EXSA 2A2UA 3BX7A 1DV9A 1SRHA 4YFRA 2A8GA 1L6MA 1ERBA 2OVSA 3I17A 4UU3A 4ZJ0A 2AT0X 1KZXA 4JGLA 4YDBA 4BJ8A 4Y0RA 4D6AA 3IA8A 3QKGA 3WOVA 3FEPA 4BX6A 2G8CO 3VPJE 2G7BA 4XMHA 3VE2A 4GJSA 1CBRA 2VDFA 1R0UA 2IZHB 1JYDA 1MDCA 2L67A 2OY1O 3B2HA 4GKCA 1LCWA 1JIWI 1ML7A 1SWGA 4GDAA 4O3YA 2FLJA 2ACPX 4WHIA 3RDUA 5LJKA 3SLTA 5K68A 1HMRA 5L8IA 4KIIA 4IBAA 2OF8A 3FENA 5FQ7E 2F09A 2OF9A 1ZNLA 1VWMB 1N43A 4MEEA 1I9HA 3P6CA 5CYBA 1FTPA 1KQXA 4OMXA 5K06A 1DFVA 1OEEA 5H9KA 2W2AA 5B3MO 1SWHA 1X8QA 5D47A 4O49A 4AZRA 4TLJA 3U03A 3BU9A 1G85A 2QCBA 3HTYA 4KC7A 3RDSA 2FR2A 2Q4NA 4INNA 3ZW1B 2RCQA 4IAWA 4NLJA 4I3BA 4AZQA 2RN4A 3OD9A 2KT4B 2GTFX 4FBVA 5D45A 1E02A 1JMZA 1O1UA 3MBTA 2A2GA 2K62A 2NNEA 1HBQA 3BX8A 2XSTA 2OL6O 1NQMA 2G5LA 1SRFA 3IFBA 2OY7A 3ZWEA 1HXZA 1STSB 3T6LA 3RDOA 4JHQA 3RY1A 5DPQA 4BX7B 2RTDB 3RSWA 2G78A 3D9WA 3P6DA 1X8OA 4Y5DA 1RSTB 1SWDA 2X34A 1KL3A 2QOMA 2UZ2A 3FMZA 4GH7A 3CBCA 1SY1A 3NX1A 2GJ5A 2IZJA 2LBVA 1SWCA 2Q2PA 2OFAA 3EMMA 5BVSA 3GE2A 2RTNB 2OFRX 1SY2A 2X45A 3ZW1A 1UZ2X 1BSYA 2BS6A 3AEHA 1IKJA 3FA8A 2N93A 4GZVA 4ZFXA 4ZHFA 3O22A 1UYNX 4CSBA 5H9AA 4AZOA 4GJVA 3WJGA 1MX7A 2I5ZO 5B2AO 2L5PA 1YP6A 2LKKA 2OY8A 4Y59A 2E4JA 2WEWA 3D97A 5H9NA 4TKBA 1SXXA 2FR3A 2QOSC 2OL8O 5HZ5A 5AEOA 5B10O 3SZHA 1SXUA 1A2DA 3WJFA 5EEEA 3DSZA 3SZIA 1VWKB 2X32A 1GM6A 3PECA 4IB8A 5HCCC 1KGLA 3FA6A 4O3ZA 1HQQA 4OELA 1OSPO 2IZIA 1VWBB 2X56A 4U46A 4CPFA 5AJCA 2EU7X 2F01A 4B55A 4L3RA 1D3SA 3EM0A 4I60A 1VWJB 1VYOA 1MUPA 1I4UA 4KT5A 4ORXA 5DG4A 1XKIA 2IZFB 3RZYA 3CQRA 4I9RA 4KCAA 3D96A 3U9PC 3MX7A 4R0BA 4O4SA 4ORSA 1ERXA 1FDQA 4ZGFA 3CBSA 1MVGA 5HZ6A 5K67A 3RWXA 1IIUA 4LQZA 1B4MA 4MVKA 1HMTA 1VWEB 2LFOA 2GC9A 3ZW2A 1TVQA 1BM5A 4NLIA 1EUOA 3VHMA 2MO5A 4ZGUA 4GDZA 4PJ2A 1E5PA 2POAA 1CBSA 1G5WA 2M4LA 5HCDC 3AUMO 5IRAA 1O1VA 5FAZA 1YP7A 3WJDA 2JW1A 4U9CA 2IZAA 5HA1A 3SLJA 4EQAC 1SLEB 1AVEA 2AT5X 1VWRB 1NDJA 3EYCA 1EPAA 1OBQA 1HMSA 4D6BA 4A1YA 1B0OA 3FW4A 1SWLA 1HQPA 2WQAE 1T68X 2CM9A 1TOWA 3QQ2A 5HCEC 1LELA 3ZW0B 2IZDB 4U8UM 4UU2A 3P6EA 4OS8A 3NQ3A 4Y0SA 3MM0A 4N7DA 5F2BA 5JD2A 1CRBA 1YUPA 5L3YA 1VWNB 1Y9TA 2QO5A 1W6FA 4KH8A 5LJDA 3NX2A 3TGBA 1KT6A 4YMYA 4NNTA 2MJIA 3Q6LA 4GRJA 4A8ZA 4ZHGA 2FKJA 3P02A 3PP6A 3D95A 5KIDA 1SWFA 2FGSA 1QWDA 1O8VA 4QRLA 4TJZA 1GT3A 2FRSA 2GTLM 2MHDA 3VG3A 5L8NA 2AL0X 1RXJA 1Y53X 4L1NA 3SZJA 1QY1A 1K3BA 4GK9A 3V8UA 1X8PA 4I3CA 2RTIB 5BVQA 2ANSA 2WPUA 3PEDA 4ID2A 4XMDA 4JO6A 2X8SA 1FE3A 2RTRB 3DTQA 3STMX 4NYRA 1EPBA 1JV4A 4CDDA 4CDFA 3JS1A 2L68A 2OVAA 3T2XA 3HWDA 3RBYA 3T6FA 3STKA 1ADLA 4YCEA 2IFBA 1BBPA 3KZAA 2AMMX 1ZNGA 2A13A 1B8EA 3S60A 1NQNA 2NNQA 3WBGA 4YFPA 3UEVA 3OJYC 4AZNA 4C5PA 4XMFA 3P6FA 1ZNDA 4YBUA 3VG4A 4IB7A 1PEEA 1YIVA 3APVA 1BLRA 1N7YA 1JQPA 1LIBA 2X4MA 3PPTA 1SXWA 3FR4A 3PH5A 4OKAA 2ACOA 1LDQA 2KTDA 3E3CA 2JU7A 4CPHB 1LDOA 1RAVA 1B56A 1NGLA 1LIDA 1ACDA 4TQ2A 1BEBA 5LKFA 3H3IA 1LPJA 3CKFA 4ON1A 1X8UA 4IABA 1VPRA 5JR8A 4TNNA 2R74A 1ZNHA 2MM3A 4BBOA 1VWFB 3UEWA 1GT1A 3VG5A 4HPCA 2QO6A 4ALOA 4YGZA 4Z27A 4ZHCA 3JQOA 3U0DA 2RTGB 1SREA 1RXKA 1S2PA 2R73A 1X8NA 2AKQA 3B2KA 3EW1A 5EZ2A 4EDEA 1JZUA 5HZQA 1OBUA 1VWDB 5HZ9A 4U3QA 1Z24A 2Q2MA 1KQWA 3RDMA 2CBSA 1NP1A 3AKMA 4QYNA 1BRQA 1BSQA 2HZQA 4YDAA 1EALA 4NV7A 2UYWA 4I3DA 2FWVA 1IFCA 1EIOA 3RKGA 4CPHA 2IZLB 1SRGA 1SWAA 1VWLB 1I04A 2C1QA 2RTJA 1EI5A 2WSJA 3HWFA 3GAQA 3WXQA 2IZEB 1U17A 2Z4HA 3ZQ3A 1PBYA 4GD9A 2CM4A 1KT7A 1QFTA 2BLGA 3MVFA 4EEJA 1I06A 2NP1A 3Q34A 4HPAA 4YVBA 2NNDA 1GX3A 5BVTA 2RD7C 3P6HA 1VWCB 4A1HA 4HFOA 4ALBA 2VFBA 1QFVA 1FENA 5IXGA 2X8FA 2RTLA 3ZZVA 2LBAA 1QY2A 4ORWA 1MEPA 5LJHA 3WZOA 2RTEB 1YWDA 1SWUA 4BX7A 1A57A 3NQKA 4MISA 4O3XB 3RE6A 1OBPA 2O62A 1OPBA 1QQSA 2I5VO 1HN2A 1UYOX 4BX5B 3NR3A 5FQ6E 1KT5A 1SY3A 3UEUA 1SLFB 1SRJA 1LIFA 1BWYA 3T1DA 1A18A 2Q39A 2RTBB 1ZRYA 3O19A 1SWQA 5D8JA 3BRNA 1VYFA 3FYFA 3C78X 1G74A 4BQUA 2LA7A 2AT3X 3G7XA 4IMOA 1GKAB 3FR5A 2WR6A 5CE4A 1BRPA 3NBXX 4NP1A 3NP1A 2HKDA 4QZUA 5HWZA 5F1EA 1PTSA 4LKPA 3STNA 1AELA 4U8UO 1AVDA 1KOIA 3LV4A 1Y9LA 3WYPA 2IZKA 2A0AA 2RTPB 4BX5A 1KT4A 4AW8A 1Y52X 1EQDA 1VWQB 2AT6X 2JGSA 1DZKA 1MM9A 2Y3FA 3CWKA 2WUTA 3B2LA 5AJBA 2RTAA 4ZHHA 5IRWA 2RTMA 3WVMA 2GTLO 2QM9A 4CV7A 3VHIA 3FEKA 4HWMA 4GNWA 3CMPA 2A5BA 3AKNA 1SWPA 1XCAA 1CBIA 1NP4A 2A5CA 2BT9A 4O4OA 1SA8A 2PI3O 3VG2A 1W4TA 1AVGI 1MK5A 2F73A 2WQ9A 4AZPA 3APWA 1CBQA 5LKEA 3FR2A 1SWKA 4TKJA 4Y0QA 2DJFA 1IJ8A 1TXLA 2HNXA 2MF6A 3EBKA 4XMCA 3T2WA 3ZUIA 4AYHA 2Q9SA 4O4XA 5B5FA 1NBXA 1HY2A 4GETA 1FELA 2C1SA 4DNEA 3EBWA 1ZNKA 1JJJA 1ALBA 1MX8A 2JOZA 4OEMA 2AT8X 3KFFA 1QG5A 2ZSCA 3KVNA 1TOUA 1LCZA 2KTSA 2RCTA 3WJBA 4FBOA 3WZPA 1KL4A 1DZMA 2BS5A 3WJCA 4I95A 3PH6A 3I0AA 5EPQA 4FGIB 1KFFA 4LKTA 5IO7A 3HWEA 4Z6JA 1STPA 4LZVA 3S26A 4O4UA 1JJUA 4FQBB 3BLGA 4GE1A 1JYJA 4QGXA 4IAXA 1QY0A 3ZW0A 4NV8A 4YFQA 4Z2PA 4HPBA 3S5XA 4ES7A 2K23A 1E2TA 1EIIA 2HYSA 3B2JA 1N9MA 3FIDA 1YWAA 1WUBA 2FHLA 1RXHA 4LZUA 3B2IA 5F6BA 1LICA 4QGVA 4Z2VA 4ARHA 1U18A 4Z2OA 1SWTA 2Z4IA 3F9DA 2JN3A 4OS0A 1HXLA 5CHKA 2GH7A 3CQNA 2PY1A 1SXYA 2BHVA 1N0SA 2OVDA 5LJBA 2X55A 5L8OA 3HOLA 5F58A 1BJ7A 1SWNA 1I05A 3EW2A 3K3LA 5F6ZA 1VWPB 3SOTA 4MIRA 5EEDA 2BC3A 1LNMA 1LKEA 1RLBE 4COTA 1E00A 3SAOA 3ZUOA 2JU3A 1N9YA 4YGHA 5IO6A 2HZRA 4MVLA 1GX9A 5BYPA 1MOYA 4MVIA 4WFVA 4XMGA 1SLDB 3VG7A 4OS3A 4TKHA 1W5RA 4CK4A 3ELZA 4KC8A 2OFMX 2LB6A 2X46A 4I9SA 3TGAA 2G79A 3O2YA 4GU8A 5F7GA 5LJCA 3HK1A 4YGGA 4BOEA 1IKEA 1OEJA 2JMBA 2Y32A 2A3FX 2R56A 4N7CA 1SWBA 3FDCA 1YWBA 1CJ5A 1JBHA 4Z28A 3F6ZB 1D2UA 2FKGA 3P6GA 2IZBA
chains in the Genus database with same CATH topology
4IB6A 1JJXA 1X71A 4IB9A 3ELXA 2ZAIA 1H91A 1KT3A 3TGCA 3N91A 5EDBA 1ZNEA 4YCHA 2X8TA 2WWPA 2XKLA 1A3YA 4DQ4A 1U0XA 4AZMA 2KW1A 5H9LA 3LHNA 1S7DA 3APUA 5FQ8E 1RBPA 5KICA 2FS6A 1GT4A 3FA7A 1VYGA 1KZWA 2OZQA 3D4RA 4YKOA 2ASNX 2WEXA 2ALLX 2CZTA 1G7NA 4HPDA 4DQ3A 1P6PA 3BS2A 4YKMA 2HLVA 3OE3A 1ICNA 4ZH9A 1DF3A 1IFBA 3NADA 4ZFXA 3NPOA 4ORYA 1T0VA 1X89A 1GX8A 5LJGA 2FS7A 1DC9A 4OMWA 2QO4A 2FT9A 3TZSA 2OVEA 2AH7X 1UREA 4ZH6A 4EXZA 4FBRA 4YBPA 1AQBA 2L9CA 4WFUA 1PM1X 4Y0PA 1SMPI 4QQ1A 5FENA 3BSZE 2RQ0A 3VE1A 4ZHDA 5LJEA 3FIQA 3HWGA 3PQUA 4IMNA 4NW4A 3UAQA 4BVMA 4QYPA 4QAEA 4RUUA 5HAEA 5FFHA 3FLLA 2QMIA 1OEKA 4RUNA 1GKAA 4M7MA 2W2FA 4K19A 4PSQA 4EFGA 3NQ9A 2ZAGA 3WJEA 1PMPA 1GGLA 1TW4A 3S5VA 5B27A 4O9SA 3TF6A 2W2BA 3KQ0A 4ODDA 2HMBA 3FELA 1AB0A 3P24A 1FEMA 1EW3A 1PBOA 4ZR2A 3KFHA 1GT5A 2CBRA 5HBSA 1KXOA 3BY0A 3OBLA 5AQ6A 5HA0A 4ORUA 1ICMA 3JSQA 4MVEA 4A60A 1LF7A 3APXA 1DZPA 4ZCBA 2CZUA 2JU8A 2FTBA 2RA6A 1HBPA 3FA9A 3VG6A 5B29A 1SY0A 5IO5A 4NYQA 1DZJA 1YWCA 4I6SA 4QNIA 4YH0A 5HZ8A 2DM5A 3FW5A 1QABE 4ORRA 3C77X 2MWHA 5EDCA 1S44A 4GNYA 2P8GA 3F8AA 5H8TA 1T8VA 4NNSA 3HOEA 4M6SA 5HTDA 5C0NA 1GXAA 5D48A 4ML7B 5KHPA 2YG2A 1E06A 5HTEA 3VU1A 4QZTA 4QGWA 3ZI8A 4U8UN 2YMSA 1LIEA 1OPAA 3KFIA 3CR6A 5D4AA 3C76X 1LFOA 2KD2A 3BU1A 3UEXA 1IW2A 3L4RA 1BSOA 3BDRA 3PQSA 4O3WA 3KFGA 4WBKA 2GTLN 4XMEA 1EXSA 2A2UA 3BX7A 1DV9A 4YFRA 1L6MA 1ERBA 2OVSA 3I17A 4UU3A 4ZJ0A 2AT0X 1KZXA 4JGLA 4YDBA 4Y0RA 4D6AA 3IA8A 3QKGA 3WOVA 3FEPA 3VPJE 2G7BA 4XMHA 3VE2A 1CBRA 1R0UA 1JYDA 1MDCA 2L67A 4GKCA 3B2HA 1JIWI 1ML7A 4O3YA 2FLJA 2ACPX 4WHIA 5LJKA 1HMRA 4KIIA 4IBAA 3FENA 5FQ7E 2F09A 1ZNLA 5CYBA 3P6CA 1FTPA 1KQXA 4OMXA 5K06A 1DFVA 1OEEA 5H9KA 2W2AA 1X8QA 5D47A 4O49A 4AZRA 4TLJA 3U03A 3BU9A 1G85A 3HTYA 4KC7A 2FR2A 2Q4NA 4INNA 3ZW1B 2RCQA 4IAWA 4NLJA 4I3BA 4AZQA 2RN4A 3OD9A 2KT4B 2GTFX 4FBVA 5D45A 1E02A 5L8IA 1O1UA 3MBTA 2A2GA 2K62A 2NNEA 1HBQA 3BX8A 2XSTA 3IFBA 3ZWEA 5DPQA 3RSWA 2G78A 3P6DA 1X8OA 4GH7A 3FMZA 3CBCA 1SY1A 3NX1A 2GJ5A 2LBVA 2Q2PA 3EMMA 5BVSA 3GE2A 2OFRX 1SY2A 2X45A 3ZW1A 1UZ2X 1BSYA 2BS6A 3FA8A 1IKJA 4GZVA 2N93A 4ZHFA 3O22A 4CSBA 5H9AA 4AZOA 3WJGA 1MX7A 2L5PA 1YP6A 2LKKA 5H9NA 2E4JA 2WEWA 3D97A 4TKBA 1SXXA 2FR3A 2QOSC 5HZ5A 5AEOA 1SXUA 1A2DA 3WJFA 5EEEA 3DSZA 3PECA 1GM6A 4IB8A 5HCCC 1KGLA 3FA6A 4O3ZA 5AJCA 2EU7X 4L3RA 1D3SA 3EM0A 1MUPA 1I4UA 4KT5A 4ORXA 5DG4A 1XKIA 3RZYA 3CQRA 4I9RA 4KCAA 3D96A 3U9PC 3MX7A 4R0BA 4O4SA 4ORSA 1ERXA 1FDQA 4ZGFA 3CBSA 1MVGA 5HZ6A 3RWXA 1IIUA 4LQZA 1B4MA 4MVKA 1HMTA 2LFOA 2GC9A 3ZW2A 1TVQA 1BM5A 4NLIA 1EUOA 2MO5A 4ZGUA 4GDZA 4PJ2A 1E5PA 2POAA 1CBSA 1G5WA 2M4LA 5HCDC 1O1VA 5FAZA 1YP7A 3WJDA 2JW1A 4U9CA 5HA1A 4EQAC 2AT5X 3EYCA 1EPAA 1OBQA 1HMSA 4D6BA 4A1YA 1B0OA 3FW4A 1HQPA 2WQAE 1T68X 2CM9A 1TOWA 5HCEC 3ZW0B 4U8UM 4UU2A 3P6EA 4OS8A 3NQ3A 4Y0SA 4N7DA 1CRBA 1YUPA 1Y9TA 2QO5A 4KH8A 5LJDA 3NX2A 3TGBA 1KT6A 4YMYA 4NNTA 2MJIA 3Q6LA 4GRJA 4A8ZA 4ZHGA 3P02A 3PP6A 3D95A 5KIDA 4QRLA 1QWDA 1O8VA 4TJZA 3VG3A 1GT3A 2FRSA 2GTLM 2MHDA 5L8NA 2AL0X 4L1NA 1QY1A 3V8UA 4GK9A 1X8PA 4I3CA 5BVQA 2ANSA 3PEDA 4ID2A 4XMDA 2X8SA 1FE3A 3DTQA 3STMX 4NYRA 1EPBA 1JV4A 3JS1A 2L68A 2OVAA 3HWDA 3RBYA 3STKA 1ADLA 4YCEA 2IFBA 1BBPA 3KZAA 2AMMX 1ZNGA 2A13A 1B8EA 3S60A 2NNQA 3WBGA 4YFPA 3UEVA 3OJYC 4AZNA 4XMFA 3P6FA 1ZNDA 4YBUA 3VG4A 4IB7A 1PEEA 1YIVA 3APVA 1BLRA 1LIBA 3PPTA 1SXWA 3FR4A 3PH5A 2ACOA 2KTDA 3E3CA 2JU7A 1B56A 1NGLA 1LIDA 1ACDA 4TQ2A 1BEBA 5LKFA 3H3IA 1LPJA 4ON1A 1X8UA 4IABA 1VPRA 5JR8A 4TNNA 2R74A 1ZNHA 2MM3A 3UEWA 1GT1A 3VG5A 4HPCA 2QO6A 4ALOA 4YGZA 4ZHCA 3U0DA 3JQOA 2R73A 1S2PA 3B2KA 5EZ2A 1X8NA 2AKQA 4EDEA 1JZUA 5HZQA 1OBUA 5HZ9A 4U3QA 1Z24A 2Q2MA 1KQWA 2CBSA 1NP1A 3AKMA 4QYNA 1BRQA 1BSQA 2HZQA 4YDAA 1EALA 4I3DA 2FWVA 1IFCA 3RKGA 2WSJA 3HWFA 1I04A 1EI5A 3GAQA 3WXQA 3ZQ3A 1U17A 2Z4HA 2CM4A 1KT7A 1QFTA 2BLGA 3MVFA 4EEJA 1I06A 2NP1A 4HPAA 2NNDA 5BVTA 2RD7C 3P6HA 4A1HA 4HFOA 4ALBA 1QFVA 1FENA 2X8FA 5LJHA 3ZZVA 2LBAA 1QY2A 4ORWA 1EIOA 1YWDA 1A57A 3NQKA 4MISA 4O3XB 1OBPA 2O62A 1OPBA 1QQSA 1HN2A 3NR3A 5FQ6E 1KT5A 1SY3A 3UEUA 1LIFA 1BWYA 3T1DA 1A18A 2Q39A 1ZRYA 3O19A 5D8JA 3BRNA 1VYFA 3FYFA 3C78X 1G74A 4BQUA 2LA7A 2AT3X 3G7XA 4IMOA 1GKAB 3FR5A 2WR6A 5CE4A 1BRPA 3NBXX 4NP1A 3NP1A 4QZUA 5HWZA 5F1EA 3STNA 4LKPA 1AELA 4U8UO 1KOIA 3LV4A 1Y9LA 2A0AA 1KT4A 4AW8A 1EQDA 2AT6X 1DZKA 3CWKA 2WUTA 3B2LA 5AJBA 4ZHHA 3WVMA 2GTLO 2QM9A 4CV7A 3FEKA 4HWMA 4GNWA 3CMPA 3AKNA 1XCAA 1CBIA 1NP4A 2BT9A 4O4OA 1SA8A 3VG2A 1AVGI 2F73A 4AZPA 2WQ9A 3APWA 1CBQA 5LKEA 3FR2A 4TKJA 4Y0QA 1TXLA 2HNXA 3EBKA 3ZUIA 4XMCA 4AYHA 2Q9SA 4O4XA 4GETA 1FELA 3EBWA 1ZNKA 1JJJA 1ALBA 1MX8A 2JOZA 2AT8X 3KFFA 1QG5A 1TOUA 2KTSA 2RCTA 3WJBA 4FBOA 2BS5A 1DZMA 3WJCA 4I95A 3PH6A 3I0AA 5EPQA 4FGIB 4LKTA 5IO7A 3HWEA 4LZVA 3S26A 4O4UA 4FQBB 3BLGA 4GE1A 1JYJA 4QGXA 4IAXA 1QY0A 3ZW0A 4YFQA 4HPBA 3S5XA 4ES7A 2K23A 1EIIA 2HYSA 3B2JA 1YWAA 5F6BA 4QGVA 4LZUA 3B2IA 1LICA 4ARHA 1U18A 2Z4IA 3F9DA 2JN3A 4OS0A 3CQNA 2PY1A 1SXYA 2BHVA 1N0SA 2OVDA 5LJBA 5L8OA 3HOLA 5F58A 1BJ7A 1I05A 3K3LA 5F6ZA 3SOTA 4MIRA 5EEDA 1LNMA 1LKEA 1RLBE 4COTA 1E00A 3SAOA 3ZUOA 2JU3A 4YGHA 5IO6A 2HZRA 4MVLA 1GX9A 5BYPA 4MVIA 4WFVA 4XMGA 3VG7A 4OS3A 4TKHA 4CK4A 3ELZA 4KC8A 2OFMX 2LB6A 2X46A 4I9SA 3TGAA 2G79A 3O2YA 4GU8A 5F7GA 5LJCA 3HK1A 4YGGA 4BOEA 1IKEA 1OEJA 2JMBA 2A3FX 2R56A 4N7CA 1YWBA 1CJ5A 1JBHA 3F6ZB 1D2UA 3P6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IB6 A;  1JJX A;  1X71 A;  4IB9 A;  3ELX A;  1H91 A;  1KT3 A;  3TGC A;  5EDB A;  1ZNE A;  4YCH A;  2WWP A;  2XKL A;  1A3Y A;  4DQ4 A;  1U0X A;  4AZM A;  5H9L A;  1S7D A;  3APU A;  5KIC A;  1RBP A;  2FS6 A;  1GT4 A;  3FA7 A;  1VYG A;  1KZW A;  2OZQ A;  4YKO A;  2ASN X;  2WEX A;  2ALL X;  2CZT A;  1G7N A;  4HPD A;  4DQ3 A;  1P6P A;  3BS2 A;  4YKM A;  2HLV A;  1ICN A;  4ZH9 A;  1DF3 A;  1IFB A;  3NAD A;  4ZFX A;  3NPO A;  4ORY A;  1T0V A;  1X89 A;  1GX8 A;  5LJG A;  2FS7 A;  1DC9 A;  4OMW A;  2QO4 A;  2FT9 A;  3TZS A;  2OVE A;  2AH7 X;  1URE A;  4ZH6 A;  4EXZ A;  4YBP A;  1AQB A;  2L9C A;  4WFU A;  1PM1 X;  4Y0P A;  5FEN A;  3BSZ E;  2RQ0 A;  4ZHD A;  5LJE A;  3FIQ A;  3HWG A;  4IMN A;  4BVM A;  4QYP A;  4QAE A;  4RUU A;  5HAE A;  5FFH A;  3FLL A;  1OEK A;  4RUN A;  1GKA A;  4M7M A;  2W2F A;  4K19 A;  4PSQ A;  4EFG A;  3NQ9 A;  3WJE A;  1PMP A;  1GGL A;  1TW4 A;  5B27 A;  4O9S A;  3TF6 A;  2W2B A;  3KQ0 A;  4ODD A;  2HMB A;  3FEL A;  1AB0 A;  1FEM A;  1EW3 A;  1PBO A;  4ZR2 A;  3KFH A;  1GT5 A;  2CBR A;  5HBS A;  1KXO A;  3BY0 A;  5AQ6 A;  5HA0 A;  4ORU A;  1ICM A;  3JSQ A;  4A60 A;  1LF7 A;  3APX A;  1DZP A;  4ZCB A;  2CZU A;  2JU8 A;  2FTB A;  2RA6 A;  1HBP A;  3FA9 A;  3VG6 A;  5B29 A;  1SY0 A;  5IO5 A;  4NYQ A;  1DZJ A;  1YWC A;  4YH0 A;  5HZ8 A;  2DM5 A;  3FW5 A;  1QAB E;  4ORR A;  3C77 X;  5EDC A;  1S44 A;  4GNY A;  2P8G A;  3F8A A;  5H8T A;  1T8V A;  4NNS A;  4M6S A;  5HTD A;  5C0N A;  1GXA A;  5D48 A;  5KHP A;  2YG2 A;  1E06 A;  5HTE A;  4QZT A;  4QGW A;  1LIE A;  1OPA A;  3KFI A;  3CR6 A;  5D4A A;  3C76 X;  1LFO A;  3BU1 A;  3UEX A;  1IW2 A;  3L4R A;  1BSO A;  3BDR A;  3KFG A;  4WBK A;  4XME A;  1EXS A;  2A2U A;  3BX7 A;  1DV9 A;  4YFR A;  1L6M A;  1ERB A;  3I17 A;  4UU3 A;  4ZJ0 A;  2AT0 X;  1KZX A;  4YDB A;  4Y0R A;  4D6A A;  3IA8 A;  3QKG A;  3FEP A;  2G7B A;  4XMH A;  1CBR A;  1R0U A;  1JYD A;  1MDC A;  2L67 A;  4GKC A;  3B2H A;  1ML7 A;  2FLJ A;  2ACP X;  5LJK A;  1HMR A;  4KII A;  4IBA A;  3FEN A;  1ZNL A;  3P6C A;  1FTP A;  1KQX A;  4OMX A;  5K06 A;  1DFV A;  1OEE A;  5H9K A;  2W2A A;  1X8Q A;  5D47 A;  4AZR A;  4TLJ A;  3U03 A;  3BU9 A;  1G85 A;  2FR2 A;  2Q4N A;  2RCQ A;  4IAW A;  4NLJ A;  4I3B A;  4AZQ A;  2KT4 B;  2GTF X;  5D45 A;  5L8I A;  1E02 A;  1O1U A;  3MBT A;  2A2G A;  2K62 A;  2NNE A;  1HBQ A;  3BX8 A;  2XST A;  3IFB A;  5DPQ A;  3RSW A;  2G78 A;  3P6D A;  1X8O A;  4GH7 A;  3FMZ A;  3CBC A;  1SY1 A;  3NX1 A;  2GJ5 A;  2LBV A;  2Q2P A;  3EMM A;  5BVS A;  2OFR X;  1SY2 A;  2X45 A;  1UZ2 X;  1BSY A;  3FA8 A;  1IKJ A;  4ZHF A;  2N93 A;  3O22 A;  5H9A A;  4AZO A;  3WJG A;  1MX7 A;  2L5P A;  1YP6 A;  2LKK A;  5H9N A;  2E4J A;  2WEW A;  3D97 A;  4TKB A;  1SXX A;  2FR3 A;  2QOS C;  5HZ5 A;  1SXU A;  1A2D A;  3WJF A;  5EEE A;  3DSZ A;  3PEC A;  1GM6 A;  4IB8 A;  5HCC C;  1KGL A;  3FA6 A;  2EU7 X;  1D3S A;  3EM0 A;  1MUP A;  1I4U A;  4ORX A;  5DG4 A;  1XKI A;  3RZY A;  3CQR A;  4I9R A;  3D96 A;  3U9P C;  4R0B A;  4ORS A;  1ERX A;  1FDQ A;  3CBS A;  1MVG A;  5HZ6 A;  1IIU A;  1B4M A;  4MVK A;  1HMT A;  2LFO A;  2GC9 A;  1TVQ A;  1BM5 A;  4NLI A;  1EUO A;  2MO5 A;  4ZGU A;  1E5P A;  2POA A;  1CBS A;  1G5W A;  5HCD C;  1O1V A;  5FAZ A;  1YP7 A;  3WJD A;  5HA1 A;  2AT5 X;  3EYC A;  1EPA A;  1OBQ A;  1HMS A;  4D6B A;  4A1Y A;  1B0O A;  3FW4 A;  1HQP A;  2WQA E;  1T68 X;  2CM9 A;  1TOW A;  5HCE C;  4UU2 A;  3P6E A;  4OS8 A;  3NQ3 A;  4Y0S A;  4N7D A;  1CRB A;  1YUP A;  2QO5 A;  5LJD A;  3NX2 A;  3TGB A;  1KT6 A;  4YMY A;  4NNT A;  2MJI A;  3Q6L A;  4GRJ A;  4A8Z A;  4ZHG A;  3PP6 A;  3D95 A;  5KID A;  1QWD A;  1O8V A;  4TJZ A;  3VG3 A;  1GT3 A;  2FRS A;  5L8N A;  2AL0 X;  1QY1 A;  1X8P A;  4I3C A;  5BVQ A;  2ANS A;  3PED A;  4XMD A;  1FE3 A;  3DTQ A;  3STM X;  4NYR A;  1EPB A;  1JV4 A;  3JS1 A;  2L68 A;  2OVA A;  3HWD A;  3STK A;  1ADL A;  4YCE A;  2IFB A;  1BBP A;  3KZA A;  2AMM X;  1ZNG A;  2A13 A;  1B8E A;  2NNQ A;  3WBG A;  4YFP A;  3UEV A;  3OJY C;  4AZN A;  4XMF A;  3P6F A;  1ZND A;  4YBU A;  3VG4 A;  4IB7 A;  1PEE A;  1YIV A;  3APV A;  1BLR A;  1LIB A;  3PPT A;  1SXW A;  3FR4 A;  3PH5 A;  2ACO A;  2KTD A;  2JU7 A;  1B56 A;  1NGL A;  1LID A;  1ACD A;  4TQ2 A;  1BEB A;  5LKF A;  1LPJ A;  1X8U A;  1VPR A;  5JR8 A;  4TNN A;  2R74 A;  1ZNH A;  2MM3 A;  3UEW A;  1GT1 A;  3VG5 A;  4HPC A;  2QO6 A;  4ALO A;  4YGZ A;  4ZHC A;  3U0D A;  2R73 A;  1S2P A;  3B2K A;  5EZ2 A;  1X8N A;  2AKQ A;  4EDE A;  1JZU A;  1OBU A;  5HZ9 A;  1Z24 A;  2Q2M A;  1KQW A;  2CBS A;  1NP1 A;  3AKM A;  4QYN A;  1BRQ A;  1BSQ A;  2HZQ A;  4YDA A;  1EAL A;  4I3D A;  2FWV A;  1IFC A;  2WSJ A;  3HWF A;  1I04 A;  3GAQ A;  3WXQ A;  3ZQ3 A;  1U17 A;  2CM4 A;  1KT7 A;  1QFT A;  2BLG A;  3MVF A;  4EEJ A;  1I06 A;  2NP1 A;  4HPA A;  2NND A;  5BVT A;  2RD7 C;  3P6H A;  4A1H A;  4HFO A;  4ALB A;  1QFV A;  1FEN A;  5LJH A;  1EIO A;  2LBA A;  1QY2 A;  4ORW A;  1YWD A;  1A57 A;  1OBP A;  2O62 A;  1OPB A;  1QQS A;  1HN2 A;  3NR3 A;  1KT5 A;  1SY3 A;  3UEU A;  1LIF A;  1BWY A;  3T1D A;  1A18 A;  2Q39 A;  1ZRY A;  3O19 A;  5D8J A;  3BRN A;  1VYF A;  3C78 X;  1G74 A;  4BQU A;  2AT3 X;  3G7X A;  4IMO A;  1GKA B;  3FR5 A;  2WR6 A;  5CE4 A;  1BRP A;  4NP1 A;  4QZU A;  3NP1 A;  5HWZ A;  5F1E A;  3STN A;  4LKP A;  1AEL A;  1KOI A;  2A0A A;  1KT4 A;  4AW8 A;  1EQD A;  2AT6 X;  1DZK A;  3CWK A;  2WUT A;  3B2L A;  4ZHH A;  3WVM A;  2QM9 A;  3FEK A;  4GNW A;  3CMP A;  3AKN A;  1XCA A;  1CBI A;  1NP4 A;  3VG2 A;  1SA8 A;  1AVG I;  2F73 A;  4AZP A;  2WQ9 A;  3APW A;  1CBQ A;  5LKE A;  3FR2 A;  4TKJ A;  4Y0Q A;  1TXL A;  2HNX A;  3EBK A;  3ZUI A;  4XMC A;  4AYH A;  2Q9S A;  4GET A;  1FEL A;  3EBW A;  1ZNK A;  1JJJ A;  1ALB A;  1MX8 A;  2JOZ A;  2AT8 X;  3KFF A;  1QG5 A;  1TOU A;  2RCT A;  3WJB A;  1DZM A;  3WJC A;  3PH6 A;  3I0A A;  5EPQ A;  4LKT A;  5IO7 A;  3HWE A;  4LZV A;  3S26 A;  3BLG A;  4GE1 A;  1JYJ A;  4QGX A;  4IAX A;  1QY0 A;  4YFQ A;  4HPB A;  4ES7 A;  2K23 A;  1EII A;  2HYS A;  3B2J A;  1YWA A;  5F6B A;  4QGV A;  4LZU A;  3B2I A;  1LIC A;  4ARH A;  1U18 A;  3F9D A;  2JN3 A;  4OS0 A;  3CQN A;  2PY1 A;  1SXY A;  1N0S A;  2OVD A;  5LJB A;  5L8O A;  5F58 A;  1BJ7 A;  1I05 A;  3K3L A;  5F6Z A;  5EED A;  1LNM A;  1LKE A;  1RLB E;  1E00 A;  3SAO A;  3ZUO A;  2JU3 A;  4YGH A;  5IO6 A;  2HZR A;  4MVL A;  1GX9 A;  4MVI A;  4WFV A;  4XMG A;  3VG7 A;  4OS3 A;  4TKH A;  4CK4 A;  3ELZ A;  2OFM X;  2LB6 A;  2X46 A;  4I9S A;  3TGA A;  2G79 A;  3O2Y A;  5F7G A;  5LJC A;  3HK1 A;  4YGG A;  4BOE A;  1IKE A;  1OEJ A;  2A3F X;  2R56 A;  4N7C A;  1YWB A;  1CJ5 A;  1JBH A;  5HZQ A;  1D2U A;  3P6G A; 
#chains in the Genus database with same CATH topology
 4IB6 A;  3RE5 A;  1X71 A;  4BGF A;  1JJX A;  1SLG B;  2OL7 A;  3MG5 A;  4IB9 A;  3ELX A;  2ZAI A;  1H91 A;  1KT3 A;  1VWG B;  3TGC A;  3N91 A;  5EDB A;  1VWO B;  1ZNE A;  4YCH A;  1LUQ A;  2X8T A;  2AF5 A;  2WWP A;  2XKL A;  1A3Y A;  1LCV A;  4DQ4 A;  1U0X A;  4GGT A;  4AZM A;  2KW1 A;  5H9L A;  3LHN A;  1S7D A;  3APU A;  5FQ8 E;  1RBP A;  4EKV A;  5KIC A;  2FS6 A;  3RDX A;  1GT4 A;  3HPE A;  3FA7 A;  1VYG A;  1KZW A;  2OZQ A;  3D4R A;  3EC5 A;  2ASN X;  4YKO A;  4CPI A;  2WEX A;  2ALL X;  2CZT A;  1G7N A;  4HPD A;  4DQ3 A;  1P6P A;  3BS2 A;  4YKM A;  2HLV A;  3OE3 A;  1ICN A;  4ZH9 A;  1DF3 A;  1IFB A;  1SWO A;  1DF8 A;  3NAD A;  1Y0G A;  3NPO A;  4JNJ A;  1T0V A;  1X89 A;  1GX8 A;  4ORY A;  5CSE A;  5LJG A;  3VGW A;  2CAM A;  4CPE A;  2FS7 A;  4GUZ A;  2OFB A;  1VWH B;  1DC9 A;  2RTC B;  4OMW A;  1SWR A;  2FT9 A;  2QO4 A;  3TZS A;  3PK2 A;  4GGZ A;  3WZQ A;  2OVE A;  2AH7 X;  1URE A;  4ZH6 A;  4EXZ A;  4FBR A;  4YBP A;  4GGR A;  3LTW A;  1AQB A;  2L9C A;  4WFU A;  1PM1 X;  4Y0P A;  1SMP I;  1VWA B;  4QQ1 A;  5IRU A;  5FEN A;  4CDE A;  3BSZ E;  2RQ0 A;  3PDF A;  3VE1 A;  4ZHD A;  1WBI A;  2DJG A;  5LJE A;  3FIQ A;  3HWG A;  3PQU A;  4IMN A;  4NW4 A;  3UAQ A;  4BVM A;  1SWS A;  4QYP A;  3RY2 A;  3SLO A;  4QAE A;  4RUU A;  5HAE A;  5B5G A;  1JMX A;  5FFH A;  1NC9 A;  3FLL A;  2QMI A;  1STR B;  1OEK A;  2Y3E A;  2IZC B;  1GKA A;  4M7M A;  4RUN A;  2W2F A;  4IRW A;  4DCB A;  4K19 A;  4PSQ A;  4EFG A;  3NQ9 A;  2ZAG A;  3WJE A;  1PMP A;  1GGL A;  4CDC A;  1TW4 A;  3S5V A;  5B27 A;  4O9S A;  5B11 O;  3TF6 A;  2W2B A;  3KQ0 A;  4ODD A;  2HMB A;  2RTK A;  3FEL A;  1AB0 A;  3P24 A;  1FEM A;  1EW3 A;  1PBO A;  4ZR2 A;  3KFH A;  1GT5 A;  2CBR A;  5HBS A;  2OY5 O;  3WYQ A;  1KXO A;  3BY0 A;  3OBL A;  5AQ6 A;  5HA0 A;  4ORU A;  1ICM A;  1RSU B;  1SRI A;  3JSQ A;  4MVE A;  4A60 A;  1LF7 A;  3APX A;  1DZP A;  4ZCB A;  2CZU A;  2JU8 A;  2FTB A;  2BSZ A;  2RA6 A;  1HBP A;  3X00 A;  2FHN X;  2RTO B;  3FA9 A;  3VG6 A;  5B29 A;  1SY0 A;  1FJ1 E;  4NYQ A;  5IO5 A;  1DZJ A;  2OYB O;  2C4I A;  1YWC A;  4I6S A;  4QNI A;  4YH0 A;  3RDQ A;  4BCS A;  5HZ8 A;  2DM5 A;  3FW5 A;  1QAB E;  4ORR A;  3C77 X;  2MWH A;  5EDC A;  1S44 A;  4GNY A;  2P8G A;  3F8A A;  5H8T A;  2RTH B;  1KL5 A;  1T8V A;  2VFC A;  4NNS A;  3HOE A;  4M6S A;  5HTD A;  5C0N A;  1GXA A;  5D48 A;  4ML7 B;  5KHP A;  1VWI B;  1E06 A;  2YG2 A;  5HTE A;  2RTQ B;  4QZT A;  3VHH A;  3VU1 A;  4BX6 B;  1SWJ A;  2AVI A;  4QGW A;  3ZI8 A;  4U8U N;  3WZN A;  2YMS A;  1I78 A;  1SWE A;  1LIE A;  1OPA A;  3KFI A;  2IZG B;  3CR6 A;  5D4A A;  3C76 X;  1K24 A;  1LFO A;  2KD2 A;  1N4J A;  3BU1 A;  3UEX A;  2RTF B;  1Y55 X;  1IW2 A;  3L4R A;  1BSO A;  3BDR A;  3PQS A;  4O3W A;  3KFG A;  4WBK A;  3CKG A;  2GTL N;  4XME A;  1EXS A;  2A2U A;  3BX7 A;  1DV9 A;  1SRH A;  4YFR A;  2A8G A;  1L6M A;  1ERB A;  2OVS A;  3I17 A;  4UU3 A;  4ZJ0 A;  2AT0 X;  1KZX A;  4JGL A;  4YDB A;  4BJ8 A;  4Y0R A;  4D6A A;  3IA8 A;  3QKG A;  3WOV A;  3FEP A;  4BX6 A;  2G8C O;  3VPJ E;  2G7B A;  4XMH A;  3VE2 A;  4GJS A;  1CBR A;  2VDF A;  1R0U A;  2IZH B;  1JYD A;  1MDC A;  2L67 A;  2OY1 O;  3B2H A;  4GKC A;  1LCW A;  1JIW I;  1ML7 A;  1SWG A;  4GDA A;  4O3Y A;  2FLJ A;  2ACP X;  4WHI A;  3RDU A;  5LJK A;  3SLT A;  5K68 A;  1HMR A;  5L8I A;  4KII A;  4IBA A;  2OF8 A;  3FEN A;  5FQ7 E;  2F09 A;  2OF9 A;  1ZNL A;  1VWM B;  1N43 A;  4MEE A;  1I9H A;  3P6C A;  5CYB A;  1FTP A;  1KQX A;  4OMX A;  5K06 A;  1DFV A;  1OEE A;  5H9K A;  2W2A A;  5B3M O;  1SWH A;  1X8Q A;  5D47 A;  4O49 A;  4AZR A;  4TLJ A;  3U03 A;  3BU9 A;  1G85 A;  2QCB A;  3HTY A;  4KC7 A;  3RDS A;  2FR2 A;  2Q4N A;  4INN A;  3ZW1 B;  2RCQ A;  4IAW A;  4NLJ A;  4I3B A;  4AZQ A;  2RN4 A;  3OD9 A;  2KT4 B;  2GTF X;  4FBV A;  5D45 A;  1E02 A;  1JMZ A;  1O1U A;  3MBT A;  2A2G A;  2K62 A;  2NNE A;  1HBQ A;  3BX8 A;  2XST A;  2OL6 O;  1NQM A;  2G5L A;  1SRF A;  3IFB A;  2OY7 A;  3ZWE A;  1HXZ A;  1STS B;  3T6L A;  3RDO A;  4JHQ A;  3RY1 A;  5DPQ A;  4BX7 B;  2RTD B;  3RSW A;  2G78 A;  3D9W A;  3P6D A;  1X8O A;  4Y5D A;  1RST B;  1SWD A;  2X34 A;  1KL3 A;  2QOM A;  2UZ2 A;  3FMZ A;  4GH7 A;  3CBC A;  1SY1 A;  3NX1 A;  2GJ5 A;  2IZJ A;  2LBV A;  1SWC A;  2Q2P A;  2OFA A;  3EMM A;  5BVS A;  3GE2 A;  2RTN B;  2OFR X;  1SY2 A;  2X45 A;  3ZW1 A;  1UZ2 X;  1BSY A;  2BS6 A;  3AEH A;  1IKJ A;  3FA8 A;  2N93 A;  4GZV A;  4ZFX A;  4ZHF A;  3O22 A;  1UYN X;  4CSB A;  5H9A A;  4AZO A;  4GJV A;  3WJG A;  1MX7 A;  2I5Z O;  5B2A O;  2L5P A;  1YP6 A;  2LKK A;  2OY8 A;  4Y59 A;  2E4J A;  2WEW A;  3D97 A;  5H9N A;  4TKB A;  1SXX A;  2FR3 A;  2QOS C;  2OL8 O;  5HZ5 A;  5AEO A;  5B10 O;  3SZH A;  1SXU A;  1A2D A;  3WJF A;  5EEE A;  3DSZ A;  3SZI A;  1VWK B;  2X32 A;  1GM6 A;  3PEC A;  4IB8 A;  5HCC C;  1KGL A;  3FA6 A;  4O3Z A;  1HQQ A;  4OEL A;  1OSP O;  2IZI A;  1VWB B;  2X56 A;  4U46 A;  4CPF A;  5AJC A;  2EU7 X;  2F01 A;  4B55 A;  4L3R A;  1D3S A;  3EM0 A;  4I60 A;  1VWJ B;  1VYO A;  1MUP A;  1I4U A;  4KT5 A;  4ORX A;  5DG4 A;  1XKI A;  2IZF B;  3RZY A;  3CQR A;  4I9R A;  4KCA A;  3D96 A;  3U9P C;  3MX7 A;  4R0B A;  4O4S A;  4ORS A;  1ERX A;  1FDQ A;  4ZGF A;  3CBS A;  1MVG A;  5HZ6 A;  5K67 A;  3RWX A;  1IIU A;  4LQZ A;  1B4M A;  4MVK A;  1HMT A;  1VWE B;  2LFO A;  2GC9 A;  3ZW2 A;  1TVQ A;  1BM5 A;  4NLI A;  1EUO A;  3VHM A;  2MO5 A;  4ZGU A;  4GDZ A;  4PJ2 A;  1E5P A;  2POA A;  1CBS A;  1G5W A;  2M4L A;  5HCD C;  3AUM O;  5IRA A;  1O1V A;  5FAZ A;  1YP7 A;  3WJD A;  2JW1 A;  4U9C A;  2IZA A;  5HA1 A;  3SLJ A;  4EQA C;  1SLE B;  1AVE A;  2AT5 X;  1VWR B;  1NDJ A;  3EYC A;  1EPA A;  1OBQ A;  1HMS A;  4D6B A;  4A1Y A;  1B0O A;  3FW4 A;  1SWL A;  1HQP A;  2WQA E;  1T68 X;  2CM9 A;  1TOW A;  3QQ2 A;  5HCE C;  1LEL A;  3ZW0 B;  2IZD B;  4U8U M;  4UU2 A;  3P6E A;  4OS8 A;  3NQ3 A;  4Y0S A;  3MM0 A;  4N7D A;  5F2B A;  5JD2 A;  1CRB A;  1YUP A;  5L3Y A;  1VWN B;  1Y9T A;  2QO5 A;  1W6F A;  4KH8 A;  5LJD A;  3NX2 A;  3TGB A;  1KT6 A;  4YMY A;  4NNT A;  2MJI A;  3Q6L A;  4GRJ A;  4A8Z A;  4ZHG A;  2FKJ A;  3P02 A;  3PP6 A;  3D95 A;  5KID A;  1SWF A;  2FGS A;  1QWD A;  1O8V A;  4QRL A;  4TJZ A;  1GT3 A;  2FRS A;  2GTL M;  2MHD A;  3VG3 A;  5L8N A;  2AL0 X;  1RXJ A;  1Y53 X;  4L1N A;  3SZJ A;  1QY1 A;  1K3B A;  4GK9 A;  3V8U A;  1X8P A;  4I3C A;  2RTI B;  5BVQ A;  2ANS A;  2WPU A;  3PED A;  4ID2 A;  4XMD A;  4JO6 A;  2X8S A;  1FE3 A;  2RTR B;  3DTQ A;  3STM X;  4NYR A;  1EPB A;  1JV4 A;  4CDD A;  4CDF A;  3JS1 A;  2L68 A;  2OVA A;  3T2X A;  3HWD A;  3RBY A;  3T6F A;  3STK A;  1ADL A;  4YCE A;  2IFB A;  1BBP A;  3KZA A;  2AMM X;  1ZNG A;  2A13 A;  1B8E A;  3S60 A;  1NQN A;  2NNQ A;  3WBG A;  4YFP A;  3UEV A;  3OJY C;  4AZN A;  4C5P A;  4XMF A;  3P6F A;  1ZND A;  4YBU A;  3VG4 A;  4IB7 A;  1PEE A;  1YIV A;  3APV A;  1BLR A;  1N7Y A;  1JQP A;  1LIB A;  2X4M A;  3PPT A;  1SXW A;  3FR4 A;  3PH5 A;  4OKA A;  2ACO A;  1LDQ A;  2KTD A;  3E3C A;  2JU7 A;  4CPH B;  1LDO A;  1RAV A;  1B56 A;  1NGL A;  1LID A;  1ACD A;  4TQ2 A;  1BEB A;  5LKF A;  3H3I A;  1LPJ A;  3CKF A;  4ON1 A;  1X8U A;  4IAB A;  1VPR A;  5JR8 A;  4TNN A;  2R74 A;  1ZNH A;  2MM3 A;  4BBO A;  1VWF B;  3UEW A;  1GT1 A;  3VG5 A;  4HPC A;  2QO6 A;  4ALO A;  4YGZ A;  4Z27 A;  4ZHC A;  3JQO A;  3U0D A;  2RTG B;  1SRE A;  1RXK A;  1S2P A;  2R73 A;  1X8N A;  2AKQ A;  3B2K A;  3EW1 A;  5EZ2 A;  4EDE A;  1JZU A;  5HZQ A;  1OBU A;  1VWD B;  5HZ9 A;  4U3Q A;  1Z24 A;  2Q2M A;  1KQW A;  3RDM A;  2CBS A;  1NP1 A;  3AKM A;  4QYN A;  1BRQ A;  1BSQ A;  2HZQ A;  4YDA A;  1EAL A;  4NV7 A;  2UYW A;  4I3D A;  2FWV A;  1IFC A;  1EIO A;  3RKG A;  4CPH A;  2IZL B;  1SRG A;  1SWA A;  1VWL B;  1I04 A;  2C1Q A;  2RTJ A;  1EI5 A;  2WSJ A;  3HWF A;  3GAQ A;  3WXQ A;  2IZE B;  1U17 A;  2Z4H A;  3ZQ3 A;  1PBY A;  4GD9 A;  2CM4 A;  1KT7 A;  1QFT A;  2BLG A;  3MVF A;  4EEJ A;  1I06 A;  2NP1 A;  3Q34 A;  4HPA A;  4YVB A;  2NND A;  1GX3 A;  5BVT A;  2RD7 C;  3P6H A;  1VWC B;  4A1H A;  4HFO A;  4ALB A;  2VFB A;  1QFV A;  1FEN A;  5IXG A;  2X8F A;  2RTL A;  3ZZV A;  2LBA A;  1QY2 A;  4ORW A;  1MEP A;  5LJH A;  3WZO A;  2RTE B;  1YWD A;  1SWU A;  4BX7 A;  1A57 A;  3NQK A;  4MIS A;  4O3X B;  3RE6 A;  1OBP A;  2O62 A;  1OPB A;  1QQS A;  2I5V O;  1HN2 A;  1UYO X;  4BX5 B;  3NR3 A;  5FQ6 E;  1KT5 A;  1SY3 A;  3UEU A;  1SLF B;  1SRJ A;  1LIF A;  1BWY A;  3T1D A;  1A18 A;  2Q39 A;  2RTB B;  1ZRY A;  3O19 A;  1SWQ A;  5D8J A;  3BRN A;  1VYF A;  3FYF A;  3C78 X;  1G74 A;  4BQU A;  2LA7 A;  2AT3 X;  3G7X A;  4IMO A;  1GKA B;  3FR5 A;  2WR6 A;  5CE4 A;  1BRP A;  3NBX X;  4NP1 A;  3NP1 A;  2HKD A;  4QZU A;  5HWZ A;  5F1E A;  1PTS A;  4LKP A;  3STN A;  1AEL A;  4U8U O;  1AVD A;  1KOI A;  3LV4 A;  1Y9L A;  3WYP A;  2IZK A;  2A0A A;  2RTP B;  4BX5 A;  1KT4 A;  4AW8 A;  1Y52 X;  1EQD A;  1VWQ B;  2AT6 X;  2JGS A;  1DZK A;  1MM9 A;  2Y3F A;  3CWK A;  2WUT A;  3B2L A;  5AJB A;  2RTA A;  4ZHH A;  5IRW A;  2RTM A;  3WVM A;  2GTL O;  2QM9 A;  4CV7 A;  3VHI A;  3FEK A;  4HWM A;  4GNW A;  3CMP A;  2A5B A;  3AKN A;  1SWP A;  1XCA A;  1CBI A;  1NP4 A;  2A5C A;  2BT9 A;  4O4O A;  1SA8 A;  2PI3 O;  3VG2 A;  1W4T A;  1AVG I;  1MK5 A;  2F73 A;  2WQ9 A;  4AZP A;  3APW A;  1CBQ A;  5LKE A;  3FR2 A;  1SWK A;  4TKJ A;  4Y0Q A;  2DJF A;  1IJ8 A;  1TXL A;  2HNX A;  2MF6 A;  3EBK A;  4XMC A;  3T2W A;  3ZUI A;  4AYH A;  2Q9S A;  4O4X A;  5B5F A;  1NBX A;  1HY2 A;  4GET A;  1FEL A;  2C1S A;  4DNE A;  3EBW A;  1ZNK A;  1JJJ A;  1ALB A;  1MX8 A;  2JOZ A;  4OEM A;  2AT8 X;  3KFF A;  1QG5 A;  2ZSC A;  3KVN A;  1TOU A;  1LCZ A;  2KTS A;  2RCT A;  3WJB A;  4FBO A;  3WZP A;  1KL4 A;  1DZM A;  2BS5 A;  3WJC A;  4I95 A;  3PH6 A;  3I0A A;  5EPQ A;  4FGI B;  1KFF A;  4LKT A;  5IO7 A;  3HWE A;  4Z6J A;  1STP A;  4LZV A;  3S26 A;  4O4U A;  1JJU A;  4FQB B;  3BLG A;  4GE1 A;  1JYJ A;  4QGX A;  4IAX A;  1QY0 A;  3ZW0 A;  4NV8 A;  4YFQ A;  4Z2P A;  4HPB A;  3S5X A;  4ES7 A;  2K23 A;  1E2T A;  1EII A;  2HYS A;  3B2J A;  1N9M A;  3FID A;  1YWA A;  1WUB A;  2FHL A;  1RXH A;  4LZU A;  3B2I A;  5F6B A;  1LIC A;  4QGV A;  4Z2V A;  4ARH A;  1U18 A;  4Z2O A;  1SWT A;  2Z4I A;  3F9D A;  2JN3 A;  4OS0 A;  1HXL A;  5CHK A;  2GH7 A;  3CQN A;  2PY1 A;  1SXY A;  2BHV A;  1N0S A;  2OVD A;  5LJB A;  2X55 A;  5L8O A;  3HOL A;  5F58 A;  1BJ7 A;  1SWN A;  1I05 A;  3EW2 A;  3K3L A;  5F6Z A;  1VWP B;  3SOT A;  4MIR A;  5EED A;  2BC3 A;  1LNM A;  1LKE A;  1RLB E;  4COT A;  1E00 A;  3SAO A;  3ZUO A;  2JU3 A;  1N9Y A;  4YGH A;  5IO6 A;  2HZR A;  4MVL A;  1GX9 A;  5BYP A;  1MOY A;  4MVI A;  4WFV A;  4XMG A;  1SLD B;  3VG7 A;  4OS3 A;  4TKH A;  1W5R A;  4CK4 A;  3ELZ A;  4KC8 A;  2OFM X;  2LB6 A;  2X46 A;  4I9S A;  3TGA A;  2G79 A;  3O2Y A;  4GU8 A;  5F7G A;  5LJC A;  3HK1 A;  4YGG A;  4BOE A;  1IKE A;  1OEJ A;  2JMB A;  2Y32 A;  2A3F X;  2R56 A;  4N7C A;  1SWB A;  3FDC A;  1YWB A;  1CJ5 A;  1JBH A;  4Z28 A;  3F6Z B;  1D2U A;  2FKG A;  3P6G A;  2IZB A; 
#chains in the Genus database with same CATH homology
 4IB6 A;  1JJX A;  1X71 A;  4IB9 A;  3ELX A;  2ZAI A;  1H91 A;  1KT3 A;  3TGC A;  3N91 A;  5EDB A;  1ZNE A;  4YCH A;  2X8T A;  2WWP A;  2XKL A;  1A3Y A;  4DQ4 A;  1U0X A;  4AZM A;  2KW1 A;  5H9L A;  3LHN A;  1S7D A;  3APU A;  5FQ8 E;  1RBP A;  5KIC A;  2FS6 A;  1GT4 A;  3FA7 A;  1VYG A;  1KZW A;  2OZQ A;  3D4R A;  4YKO A;  2ASN X;  2WEX A;  2ALL X;  2CZT A;  1G7N A;  4HPD A;  4DQ3 A;  1P6P A;  3BS2 A;  4YKM A;  2HLV A;  3OE3 A;  1ICN A;  4ZH9 A;  1DF3 A;  1IFB A;  3NAD A;  4ZFX A;  3NPO A;  4ORY A;  1T0V A;  1X89 A;  1GX8 A;  5LJG A;  2FS7 A;  1DC9 A;  4OMW A;  2QO4 A;  2FT9 A;  3TZS A;  2OVE A;  2AH7 X;  1URE A;  4ZH6 A;  4EXZ A;  4FBR A;  4YBP A;  1AQB A;  2L9C A;  4WFU A;  1PM1 X;  4Y0P A;  1SMP I;  4QQ1 A;  5FEN A;  3BSZ E;  2RQ0 A;  3VE1 A;  4ZHD A;  5LJE A;  3FIQ A;  3HWG A;  3PQU A;  4IMN A;  4NW4 A;  3UAQ A;  4BVM A;  4QYP A;  4QAE A;  4RUU A;  5HAE A;  5FFH A;  3FLL A;  2QMI A;  1OEK A;  4RUN A;  1GKA A;  4M7M A;  2W2F A;  4K19 A;  4PSQ A;  4EFG A;  3NQ9 A;  2ZAG A;  3WJE A;  1PMP A;  1GGL A;  1TW4 A;  3S5V A;  5B27 A;  4O9S A;  3TF6 A;  2W2B A;  3KQ0 A;  4ODD A;  2HMB A;  3FEL A;  1AB0 A;  3P24 A;  1FEM A;  1EW3 A;  1PBO A;  4ZR2 A;  3KFH A;  1GT5 A;  2CBR A;  5HBS A;  1KXO A;  3BY0 A;  3OBL A;  5AQ6 A;  5HA0 A;  4ORU A;  1ICM A;  3JSQ A;  4MVE A;  4A60 A;  1LF7 A;  3APX A;  1DZP A;  4ZCB A;  2CZU A;  2JU8 A;  2FTB A;  2RA6 A;  1HBP A;  3FA9 A;  3VG6 A;  5B29 A;  1SY0 A;  5IO5 A;  4NYQ A;  1DZJ A;  1YWC A;  4I6S A;  4QNI A;  4YH0 A;  5HZ8 A;  2DM5 A;  3FW5 A;  1QAB E;  4ORR A;  3C77 X;  2MWH A;  5EDC A;  1S44 A;  4GNY A;  2P8G A;  3F8A A;  5H8T A;  1T8V A;  4NNS A;  3HOE A;  4M6S A;  5HTD A;  5C0N A;  1GXA A;  5D48 A;  4ML7 B;  5KHP A;  2YG2 A;  1E06 A;  5HTE A;  3VU1 A;  4QZT A;  4QGW A;  3ZI8 A;  4U8U N;  2YMS A;  1LIE A;  1OPA A;  3KFI A;  3CR6 A;  5D4A A;  3C76 X;  1LFO A;  2KD2 A;  3BU1 A;  3UEX A;  1IW2 A;  3L4R A;  1BSO A;  3BDR A;  3PQS A;  4O3W A;  3KFG A;  4WBK A;  2GTL N;  4XME A;  1EXS A;  2A2U A;  3BX7 A;  1DV9 A;  4YFR A;  1L6M A;  1ERB A;  2OVS A;  3I17 A;  4UU3 A;  4ZJ0 A;  2AT0 X;  1KZX A;  4JGL A;  4YDB A;  4Y0R A;  4D6A A;  3IA8 A;  3QKG A;  3WOV A;  3FEP A;  3VPJ E;  2G7B A;  4XMH A;  3VE2 A;  1CBR A;  1R0U A;  1JYD A;  1MDC A;  2L67 A;  4GKC A;  3B2H A;  1JIW I;  1ML7 A;  4O3Y A;  2FLJ A;  2ACP X;  4WHI A;  5LJK A;  1HMR A;  4KII A;  4IBA A;  3FEN A;  5FQ7 E;  2F09 A;  1ZNL A;  5CYB A;  3P6C A;  1FTP A;  1KQX A;  4OMX A;  5K06 A;  1DFV A;  1OEE A;  5H9K A;  2W2A A;  1X8Q A;  5D47 A;  4O49 A;  4AZR A;  4TLJ A;  3U03 A;  3BU9 A;  1G85 A;  3HTY A;  4KC7 A;  2FR2 A;  2Q4N A;  4INN A;  3ZW1 B;  2RCQ A;  4IAW A;  4NLJ A;  4I3B A;  4AZQ A;  2RN4 A;  3OD9 A;  2KT4 B;  2GTF X;  4FBV A;  5D45 A;  1E02 A;  5L8I A;  1O1U A;  3MBT A;  2A2G A;  2K62 A;  2NNE A;  1HBQ A;  3BX8 A;  2XST A;  3IFB A;  3ZWE A;  5DPQ A;  3RSW A;  2G78 A;  3P6D A;  1X8O A;  4GH7 A;  3FMZ A;  3CBC A;  1SY1 A;  3NX1 A;  2GJ5 A;  2LBV A;  2Q2P A;  3EMM A;  5BVS A;  3GE2 A;  2OFR X;  1SY2 A;  2X45 A;  3ZW1 A;  1UZ2 X;  1BSY A;  2BS6 A;  3FA8 A;  1IKJ A;  4GZV A;  2N93 A;  4ZHF A;  3O22 A;  4CSB A;  5H9A A;  4AZO A;  3WJG A;  1MX7 A;  2L5P A;  1YP6 A;  2LKK A;  5H9N A;  2E4J A;  2WEW A;  3D97 A;  4TKB A;  1SXX A;  2FR3 A;  2QOS C;  5HZ5 A;  5AEO A;  1SXU A;  1A2D A;  3WJF A;  5EEE A;  3DSZ A;  3PEC A;  1GM6 A;  4IB8 A;  5HCC C;  1KGL A;  3FA6 A;  4O3Z A;  5AJC A;  2EU7 X;  4L3R A;  1D3S A;  3EM0 A;  1MUP A;  1I4U A;  4KT5 A;  4ORX A;  5DG4 A;  1XKI A;  3RZY A;  3CQR A;  4I9R A;  4KCA A;  3D96 A;  3U9P C;  3MX7 A;  4R0B A;  4O4S A;  4ORS A;  1ERX A;  1FDQ A;  4ZGF A;  3CBS A;  1MVG A;  5HZ6 A;  3RWX A;  1IIU A;  4LQZ A;  1B4M A;  4MVK A;  1HMT A;  2LFO A;  2GC9 A;  3ZW2 A;  1TVQ A;  1BM5 A;  4NLI A;  1EUO A;  2MO5 A;  4ZGU A;  4GDZ A;  4PJ2 A;  1E5P A;  2POA A;  1CBS A;  1G5W A;  2M4L A;  5HCD C;  1O1V A;  5FAZ A;  1YP7 A;  3WJD A;  2JW1 A;  4U9C A;  5HA1 A;  4EQA C;  2AT5 X;  3EYC A;  1EPA A;  1OBQ A;  1HMS A;  4D6B A;  4A1Y A;  1B0O A;  3FW4 A;  1HQP A;  2WQA E;  1T68 X;  2CM9 A;  1TOW A;  5HCE C;  3ZW0 B;  4U8U M;  4UU2 A;  3P6E A;  4OS8 A;  3NQ3 A;  4Y0S A;  4N7D A;  1CRB A;  1YUP A;  1Y9T A;  2QO5 A;  4KH8 A;  5LJD A;  3NX2 A;  3TGB A;  1KT6 A;  4YMY A;  4NNT A;  2MJI A;  3Q6L A;  4GRJ A;  4A8Z A;  4ZHG A;  3P02 A;  3PP6 A;  3D95 A;  5KID A;  4QRL A;  1QWD A;  1O8V A;  4TJZ A;  3VG3 A;  1GT3 A;  2FRS A;  2GTL M;  2MHD A;  5L8N A;  2AL0 X;  4L1N A;  1QY1 A;  3V8U A;  4GK9 A;  1X8P A;  4I3C A;  5BVQ A;  2ANS A;  3PED A;  4ID2 A;  4XMD A;  2X8S A;  1FE3 A;  3DTQ A;  3STM X;  4NYR A;  1EPB A;  1JV4 A;  3JS1 A;  2L68 A;  2OVA A;  3HWD A;  3RBY A;  3STK A;  1ADL A;  4YCE A;  2IFB A;  1BBP A;  3KZA A;  2AMM X;  1ZNG A;  2A13 A;  1B8E A;  3S60 A;  2NNQ A;  3WBG A;  4YFP A;  3UEV A;  3OJY C;  4AZN A;  4XMF A;  3P6F A;  1ZND A;  4YBU A;  3VG4 A;  4IB7 A;  1PEE A;  1YIV A;  3APV A;  1BLR A;  1LIB A;  3PPT A;  1SXW A;  3FR4 A;  3PH5 A;  2ACO A;  2KTD A;  3E3C A;  2JU7 A;  1B56 A;  1NGL A;  1LID A;  1ACD A;  4TQ2 A;  1BEB A;  5LKF A;  3H3I A;  1LPJ A;  4ON1 A;  1X8U A;  4IAB A;  1VPR A;  5JR8 A;  4TNN A;  2R74 A;  1ZNH A;  2MM3 A;  3UEW A;  1GT1 A;  3VG5 A;  4HPC A;  2QO6 A;  4ALO A;  4YGZ A;  4ZHC A;  3U0D A;  3JQO A;  2R73 A;  1S2P A;  3B2K A;  5EZ2 A;  1X8N A;  2AKQ A;  4EDE A;  1JZU A;  5HZQ A;  1OBU A;  5HZ9 A;  4U3Q A;  1Z24 A;  2Q2M A;  1KQW A;  2CBS A;  1NP1 A;  3AKM A;  4QYN A;  1BRQ A;  1BSQ A;  2HZQ A;  4YDA A;  1EAL A;  4I3D A;  2FWV A;  1IFC A;  3RKG A;  2WSJ A;  3HWF A;  1I04 A;  1EI5 A;  3GAQ A;  3WXQ A;  3ZQ3 A;  1U17 A;  2Z4H A;  2CM4 A;  1KT7 A;  1QFT A;  2BLG A;  3MVF A;  4EEJ A;  1I06 A;  2NP1 A;  4HPA A;  2NND A;  5BVT A;  2RD7 C;  3P6H A;  4A1H A;  4HFO A;  4ALB A;  1QFV A;  1FEN A;  2X8F A;  5LJH A;  3ZZV A;  2LBA A;  1QY2 A;  4ORW A;  1EIO A;  1YWD A;  1A57 A;  3NQK A;  4MIS A;  4O3X B;  1OBP A;  2O62 A;  1OPB A;  1QQS A;  1HN2 A;  3NR3 A;  5FQ6 E;  1KT5 A;  1SY3 A;  3UEU A;  1LIF A;  1BWY A;  3T1D A;  1A18 A;  2Q39 A;  1ZRY A;  3O19 A;  5D8J A;  3BRN A;  1VYF A;  3FYF A;  3C78 X;  1G74 A;  4BQU A;  2LA7 A;  2AT3 X;  3G7X A;  4IMO A;  1GKA B;  3FR5 A;  2WR6 A;  5CE4 A;  1BRP A;  3NBX X;  4NP1 A;  3NP1 A;  4QZU A;  5HWZ A;  5F1E A;  3STN A;  4LKP A;  1AEL A;  4U8U O;  1KOI A;  3LV4 A;  1Y9L A;  2A0A A;  1KT4 A;  4AW8 A;  1EQD A;  2AT6 X;  1DZK A;  3CWK A;  2WUT A;  3B2L A;  5AJB A;  4ZHH A;  3WVM A;  2GTL O;  2QM9 A;  4CV7 A;  3FEK A;  4HWM A;  4GNW A;  3CMP A;  3AKN A;  1XCA A;  1CBI A;  1NP4 A;  2BT9 A;  4O4O A;  1SA8 A;  3VG2 A;  1AVG I;  2F73 A;  4AZP A;  2WQ9 A;  3APW A;  1CBQ A;  5LKE A;  3FR2 A;  4TKJ A;  4Y0Q A;  1TXL A;  2HNX A;  3EBK A;  3ZUI A;  4XMC A;  4AYH A;  2Q9S A;  4O4X A;  4GET A;  1FEL A;  3EBW A;  1ZNK A;  1JJJ A;  1ALB A;  1MX8 A;  2JOZ A;  2AT8 X;  3KFF A;  1QG5 A;  1TOU A;  2KTS A;  2RCT A;  3WJB A;  4FBO A;  2BS5 A;  1DZM A;  3WJC A;  4I95 A;  3PH6 A;  3I0A A;  5EPQ A;  4FGI B;  4LKT A;  5IO7 A;  3HWE A;  4LZV A;  3S26 A;  4O4U A;  4FQB B;  3BLG A;  4GE1 A;  1JYJ A;  4QGX A;  4IAX A;  1QY0 A;  3ZW0 A;  4YFQ A;  4HPB A;  3S5X A;  4ES7 A;  2K23 A;  1EII A;  2HYS A;  3B2J A;  1YWA A;  5F6B A;  4QGV A;  4LZU A;  3B2I A;  1LIC A;  4ARH A;  1U18 A;  2Z4I A;  3F9D A;  2JN3 A;  4OS0 A;  3CQN A;  2PY1 A;  1SXY A;  2BHV A;  1N0S A;  2OVD A;  5LJB A;  5L8O A;  3HOL A;  5F58 A;  1BJ7 A;  1I05 A;  3K3L A;  5F6Z A;  3SOT A;  4MIR A;  5EED A;  1LNM A;  1LKE A;  1RLB E;  4COT A;  1E00 A;  3SAO A;  3ZUO A;  2JU3 A;  4YGH A;  5IO6 A;  2HZR A;  4MVL A;  1GX9 A;  5BYP A;  4MVI A;  4WFV A;  4XMG A;  3VG7 A;  4OS3 A;  4TKH A;  4CK4 A;  3ELZ A;  4KC8 A;  2OFM X;  2LB6 A;  2X46 A;  4I9S A;  3TGA A;  2G79 A;  3O2Y A;  4GU8 A;  5F7G A;  5LJC A;  3HK1 A;  4YGG A;  4BOE A;  1IKE A;  1OEJ A;  2JMB A;  2A3F X;  2R56 A;  4N7C A;  1YWB A;  1CJ5 A;  1JBH A;  3F6Z B;  1D2U A;  3P6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...