2W2GA

Human sars coronavirus unique domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
264
structure length
257
Chain Sequence
KIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLRAPAVVSVSSPDAVTTYNGYLTSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Sars-Unique Domain (Sud) of Sars Coronavirus Contains Two Macrodomains that Bind G-Quadruplexes.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Rna binding protein
molecule keywords NON-STRUCTURAL PROTEIN 3
total genus 82
structure length 257
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11633 SUD-M Single-stranded poly(A) binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2w2gA02
3.40.220.30 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2w2gA01
2JZEA 2JZDA 2KQVA 2JZFA 2W2GA 2RNKA 2WCTA
chains in the Genus database with same CATH superfamily
4TU0A 4ETJA 3SIHA 2L8RA 2J9AA 4J4ZA 4GVVA 2BFRA 1TXZA 3KR5A 3T8WA 4K3NA 3JRUA 3KZWA 5CMSA 2RNKA 3GPOA 3SIJA 3EWOA 1YD9A 2JZEA 3V45A 4GUAA 3EWPA 3SIIA 3KQZA 2JZDA 4J5RA 2KQVA 4UMLA 5E3BA 1BPNA 2LGRA 5D8NA 1LCPA 1BLLE 4ZX8A 4ABLA 4ZI6A 3GPQA 3Q6ZA 3EKEA 5FSYA 2BFQA 5AILA 4JVVA 1LAMA 4R6TA 4JLLA 3EWQA 4R76A 2X47A 3H8EA 3PEIA 4ZX9A 5DUSA 2WCTA 1BPMA 1ZR3A 3GQOA 4GVWA 3ETIA 2FAVA 1HJZA 2EEEA 5HIHA 3VFQA 5HOLA 2VRIA 2EWBA 5CB5A 3EW5A 3H8FA 4JGKA 3H8GA 5FSVA 4R7MA 3GQEA 3EJGA 3SIGA 4J5SA 4KSIA 4ABKA 5CBMA 3Q71A 2FXKA 2DX6A 4JCAA 4ZY0A 4D86A 2AFCA 4ZY1A 1VHUA 5CB3A 3IIDA 1TY8A 4IQYA 4ZY2A 3KQXA 4K0CA 1GYTA 4ETKA 3IIFA 3EWRA 4J5QA 5FSXA 3IJ3A 2FG1A 3GPGA 3KR4A 2XD7A 5FSZA 2JZFA 5FSUA 2W2GA 2ACFA 4X2TA 4ESSA 1LAPA 1ZR5A 4KYBA 3JZTA 1SPVA 1LANA 1NJRA 3V2BA 3EJFA 4ZYQA
chains in the Genus database with same CATH topology
2JZEA 2JZDA 2KQVA 2JZFA 2W2GA 2RNKA 2WCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZE A;  2JZD A;  2KQV A;  2JZF A;  2W2G A;  2RNK A;  2WCT A; 
#chains in the Genus database with same CATH topology
 4TU0 A;  4ETJ A;  3SIH A;  2L8R A;  2J9A A;  4J4Z A;  4GVV A;  2BFR A;  1TXZ A;  3KR5 A;  3T8W A;  4K3N A;  3JRU A;  3KZW A;  5CMS A;  2RNK A;  3GPO A;  3SIJ A;  3EWO A;  1YD9 A;  2JZE A;  3V45 A;  4GUA A;  3EWP A;  3SII A;  3KQZ A;  2JZD A;  4J5R A;  2KQV A;  4UML A;  5E3B A;  1BPN A;  2LGR A;  5D8N A;  1LCP A;  1BLL E;  4ZX8 A;  4ABL A;  4ZI6 A;  3GPQ A;  3Q6Z A;  3EKE A;  5FSY A;  2BFQ A;  5AIL A;  4JVV A;  1LAM A;  4R6T A;  4JLL A;  3EWQ A;  4R76 A;  2X47 A;  3H8E A;  3PEI A;  4ZX9 A;  5DUS A;  2WCT A;  1BPM A;  1ZR3 A;  3GQO A;  4GVW A;  3ETI A;  2FAV A;  1HJZ A;  2EEE A;  5HIH A;  3VFQ A;  5HOL A;  2VRI A;  2EWB A;  5CB5 A;  3EW5 A;  3H8F A;  4JGK A;  3H8G A;  5FSV A;  4R7M A;  3GQE A;  3EJG A;  3SIG A;  4J5S A;  4KSI A;  4ABK A;  5CBM A;  3Q71 A;  2FXK A;  2DX6 A;  4JCA A;  4ZY0 A;  4D86 A;  2AFC A;  4ZY1 A;  1VHU A;  5CB3 A;  3IID A;  1TY8 A;  4IQY A;  4ZY2 A;  3KQX A;  4K0C A;  1GYT A;  4ETK A;  3IIF A;  3EWR A;  4J5Q A;  5FSX A;  3IJ3 A;  2FG1 A;  3GPG A;  3KR4 A;  2XD7 A;  5FSZ A;  2JZF A;  5FSU A;  2W2G A;  2ACF A;  4X2T A;  4ESS A;  1LAP A;  1ZR5 A;  4KYB A;  3JZT A;  1SPV A;  1LAN A;  1NJR A;  3V2B A;  3EJF A;  4ZYQ A; 
#chains in the Genus database with same CATH homology
 2JZE A;  2JZD A;  2KQV A;  2JZF A;  2W2G A;  2RNK A;  2WCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...