2W2VA

Rac2 (g12v) in complex with gtpgs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
171
Chain Sequence
MQAIKCVVVGDVAVGKTCLLISYTTNAFPIPTVFDNYSANVMVPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 61
structure length 171
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2vA00
1XXHE 5GJBA 4JLDA 3FKQA 1RJ9A 4EQ6B 3H2YA 3BH6A 3L0PA 1NLZA 2NIPA 4TTRA 3HWSA 5HR5A 4HAXA 5AK0A 1R0ZA 3FDIA 3GLFE 2B8TA 2ONKA 2RMKA 5EUQB 3I5YA 4MRRA 1O87A 3CX8A 5E95A 1EFTA 4QHSA 4ITRC 5LDDC 1Y3AA 2PX0A 3F0TA 5LB4A 2XJ4A 2XTMA 3KJIA 1JAHA 4HB2A 2QPAA 4A36A 1EGAA 2GAOA 4AY2A 2HEIA 2RKOA 4UNNA 1JNYA 1VYUA 5CDFE 2SHKA 4OHVA 4XTRA 5FR1A 3QUSA 1E2JA 2PZFA 4HYYA 1P2UA 3TW4A 2GJKA 4DVGA 3UXMA 4V0OA 3KQUA 3FHTA 4DCUA 5F9FA 2JA1A 1AQUA 1AGPA 1N0UA 4RZ2A 1ZM4A 3ZDQA 3K0EA 2IUSA 3NBYC 1H65A 2P65A 3NVAA 2B8WA 1P72A 1KAOA 4TZ0A 1F2UB 1N6IA 1EFUA 4M1YA 4IOJA 1G5PA 2QE7A 3V00A 1C4OA 3SS8A 5JJKA 4URYR 2CLCX 2W0SA 2D3WA 3IHLA 4TMTA 2CJWA 1QG2A 2D2FA 1FP7A 3GLHE 1XEXB 2FFBA 2EWWA 1VG9B 5KNCA 1FOEB 4Q1BA 4RD1A 1BOFA 4M1OA 5UKDA 1DVRA 2BOVA 4B2IA 4TL7A 4DDUA 4ZI3A 1MOZA 2ZRMA 5K8TA 3AVVA 1Z06A 4AYWA 3NBFA 2C9CA 1N3BA 4MYUA 4WXPA 5C1BA 3IUYA 4Q18A 1EFCA 2RGNC 5JHGB 2J0UB 3EWSA 3Q9LA 4GPTA 3MWJA 4F4IA 2XZPA 5KSPA 4C0LA 2FFQA 4LRWA 4YDSA 1W5SA 5DYIA 4QNRA 3U44B 3W6NA 2P5SA 4DCSA 2BM1A 3EG5A 4FCVA 4F91B 3DMDA 3ZD6A 1XRJA 2PMKA 4QHTA 1XTQA 3N70A 2ZS9A 5FTLA 2Q3FA 2VF8A 3NH6A 3KDSE 3Q7QA 4WVFA 4ABYA 1SVIA 1VCOA 2V7QA 4BZQA 4A8JA 1Z6AA 3BERA 3LQRA 2FSGA 2MMGA 1AIPA 3OAAA 3QOFA 3I62A 4IVRA 2WWWA 5EE3A 2AD5A 4I1UA 2CMKA 1X86B 4JYCA 1E32A 3RWMB 1N6PA 4EPTA 1XEWX 3BGWA 3AP3A 3T12A 2F1HA 3QIAA 2W6ID 1W4BA 3WYFA 4ZDIA 1B23P 3MCAA 3LH5A 1UFQA 1KDRA 3PUVA 4YLGA 1KMHB 1N5IA 1X3SA 4DUGD 2WTUA 2BBTA 1JJ7A 4LUCA 2XJ9A 4CT5A 1GFIA 4ILEA 3HDTA 3D6TB 4ZV4A 4TMWA 3UWKA 1SVKA 3A4NA 1M7HA 2ATXA 2IYXA 4FCWA 1XWIA 4AKEA 2R65A 1J90A 2WSSA 1VECA 3U3MA 2CHGA 2ZI3A 3BB4A 4PQRA 2HXYA 1FX0B 4UNSA 3GMTA 2D7CA 1FW6A 3O8RA 3ZYCA 1E1QD 4RD0A 2FSIA 1GNQA 1XTRA 2ZANA 4CW7A 1E96A 2I4IA 2ZI5A 5IT5A 1HY3A 1XJQA 3ADCA 1RRFA 3LBHA 4RD3A 1LW7A 4TMVA 4JS0A 4C2TA 4N1AA 3SHWA 2R62A 2JIZD 3P32A 2G0NA 3GFOA 4OQMA 2W58A 4QHYA 2V6IA 3I72A 3G5UA 2C78A 1A2BA 1AKYA 1Z8FA 2P2LA 2JJ8A 2ZRFA 1KSFX 3VKWA 4HAUA 3R8FA 1E9AA 3DEFA 1E9FA 5JJIA 2OCAA 4BLOA 1NLFA 1OH6A 3ICQB 3THWA 3SYNA 3LVQE 4IFBA 2QGZA 4ZI2A 4BEBA 1G7SA 1Z0IA 5C4MA 2NZ8A 3H86A 2QENA 5FH9A 2YWFA 3GPLA 4Z8YA 2IUUA 4B3FX 2D74A 4ASUD 8OHMA 3SJBA 1OIVA 1VCMA 2ZRAA 5L3SA 3A4MA 4B47A 4A15A 3W34A 1H8HA 3WY9A 2EFDB 4KCGA 1AS2A 1DAFA 2HJGA 5DIFA 3TVDA 4IEIA 1DPFA 4R7ZA 5HCIA 1LVGA 2FEOA 4JBWA 3GJXC 3KKNA 1R0YA 1CLUA 1PLLA 1Q22A 3KB2A 5AJYA 5AUPB 3PUXA 4TLBA 3X1DA 5KNBA 3PENA 4C3ZA 4TQUS 3X1ZA 2QAJA 5GJWC 3TSWA 1JJVA 3AQ4A 1ZBDA 3K8YA 1E2GA 1DADA 2X2FA 3QVUA 1P6XA 3QG1A 3DPUA 4QRHA 2UZIR 3E2IA 4URWR 2J5XA 5JS7A 1OFTA 3FMIA 3KKPA 5C4GB 3B13B 5GVSA 4QG7A 2BMJA 3EXAA 1NKTA 4IW3B 4L16A 2VO1A 4PC6A 4B6EA 3UPUA 2GJSA 3WRYC 5CJPA 3T1TA 1SKYB 1XEXA 4C0HA 1BS1A 3DMNA 4C7OA 2CNWD 4HB3A 4KLZA 2XAUA 1ZINA 2R6GA 3MJHA 3IBGA 3FKSD 3HR8A 4RY2A 1KMQA 2I1QA 4ZDJA 4PO1A 2WMOB 2JDID 4B76A 2PLFA 1L8QA 1Z6GA 4M1MA 4LX0A 3WNBA 4Q9IA 2O8EA 4FMDB 2GEDA 1U8YA 2G77B 2XXAB 4R98A 1KI7A 2N46A 2A2ZA 4W7SA 2GCOB 5BN4A 4Q1CA 4LGMA 3A1TA 4PQYA 4RVCA 3R9IA 2RH5A 5E4FA 1KJWA 4G3XA 5JCZA 1MO4A 5J47A 3RAPR 2VL7A 4OHWA 2W2TA 3ECCA 2CE2X 1LV7A 1V43A 4WIAA 4B2LA 1AM4D 2OM2A 2PJRA 5FL3A 1K5DA 3RS4A 5DN6A 3IPYA 4C0QC 1XDBA 2EFGA 2GETA 3TJZA 5EXSA 2ZQ5A 1QG4A 4HAWA 1G17A 3DVLA 3SFZA 2QROA 1OXTA 1EXMA 4ASUA 3FWYA 1T0HB 1RRGA 2CL7X 3FVQA 3PEYA 1W4RA 3BFKA 4XD7A 4YONB 3ZZTA 4W9MC 4BASA 3K1JA 4D0LB 121PA 5JCPA 1EESA 2GVZC 1W0KD 4U02A 4BLPA 3LNCA 5JRZA 1S1CA 3TAUA 2XNSA 5L3VA 2E87A 2VP5A 4NHOA 4FMCF 4UQOA 4Q4AA 5EXTA 2GK7A 4OQLA 3U2QA 4F93B 3MWKA 3SOPA 5EE9A 4BLRA 1AK2A 5FUVA 3GJ0A 2DFKB 3TQCA 3K0CC 1IJFA 3B5JA 4ZIRB 5CJ2A 1XMIA 1HQCA 1NF3A 2F1IA 1U90A 3W5JA 2QMHA 2GEVA 1FTNA 4A0GA 1NBME 1TUEA 5IK2A 3GLGE 1GM5A 1Q44A 1XD2A 5FFMA 2QAGA 1YVDA 3VHXA 1MV5A 2G88A 4KYUA 3W5IA 2ZYTX 3K0AA 1P62B 1E2EA 4TLEA 5BYKA 1AN0A 3U6KA 1NN5A 2QGNA 3ADKA 4DSTA 3DHWC 3ADBA 3MD0A 4Y0VA 2WWIA 4DSNA 4GT1A 2IYSA 1WXQA 2DR3A 2ZE6A 4JZKA 4AG6A 5CM9C 2GJ8A 1CBUA 1MO3A 4TTPA 4TYQA 1OJLA 2PJZA 3CH5A 3EZ6A 4KSCA 3TSZA 3KQKA 1QDEA 1QHHA 3CRVA 3P1JA 3T61A 4DLWA 1N6HA 3L8YA 1OH7A 3J81k 3THYB 3C14C 3CRW1 2J7KA 4IRUB 3B1YA 1QF9A 4MRVA 3L0IB 4GMDA 2PBRA 2WM9B 1KSGA 1WBDA 1Z2AA 2GK6A 2J0UA 3WRXC 4NYIQ 1Z3IX 2CCGA 4D26A 1OKKD 1CJVC 1NMZA 5J4HA 1NBMA 2PLRA 3K9HA 1KGDA 1ZW6A 2QMUA 1G3RA 4EPWA 2ERXA 5BQ5A 5F2EA 4EDHA 5AJVB 2BKUA 1S96A 4PFSA 1OXSC 5B2ZA 2HYIC 2GF0A 4NP6A 3AKEA 2RGXA 4H1UA 3SQXA 4TLAA 1XD2B 4M22A 5CB8A 3CX7A 2ZE5A 5GADl 5FOUA 3T5DA 4UNRA 3LX8A 2BJWA 3LLMA 5KSZA 4LBZA 3U3OA 3SBDA 1IY2A 4B33A 2GWHA 1C9KA 1D2MA 2OBMA 4TWZA 2B92A 3THOA 1AGRA 4B32A 2O8FA 4Q9KA 4XVQA 3UMFA 1E6CA 2QQEA 1NIPA 1S9DA 2CCJA 2YINC 3F8TA 3FPAA 2NPFA 3BRWD 2YHSA 5FPYA 4YQFA 2F43B 3U7EB 1X8JA 1SQ5A 4IDOA 3AP2A 1T5LA 4NDZA 5GJCA 4Q4LA 3X1YA 621PA 1OFUX 1XMSA 1OH5A 2ZREA 3VR5A 2XB2A 1VHLA 1E0KA 1NLYA 2C96A 2CLDX 2IYZA 4PHHA 4B2PA 4NBSA 5C2JB 2W00A 4E03A 3FMOB 3HU2A 3X1XA 3TUZC 3VKGA 2NQ2C 2ORWA 2QRZA 3IEUA 3QKRB 2O0HA 3ZVRA 1IY0A 1LTQA 3CH4B 4DHEA 1RJ9B 2O8CB 3PITA 4EIWA 2QSZA 2NPIA 1IONA 1DO0A 1P60A 1SXJE 1F6BA 1Q21A 3BORA 5JWRA 1UDWA 5EE1A 5JS8A 5G40A 4PO9A 3BD9A 1RYHA 5FUXA 3SZRA 1ONBA 2DFLA 2ZEJA 2F1RA 3RABA 1HUQA 2ATVA 1NJGA 3GLFB 4TMKA 1XX6A 1GRNA 1WRBA 1U99A 3QF7A 2J9RA 4EPVA 5JI2E 1NP6A 2JLZA 2XZLA 2RGBA 2D06A 2GXSA 4KSBA 2V9PA 1G4AE 1CR4A 3CX6A 1HA3A 1DAEA 2ZETA 1NY6A 3FKSA 2R44A 2WHXA 1U98A 3H84A 5JEEA 3SR0A 3QNUA 1SKQA 1G1MA 4JLJA 1R0WA 3LA6A 2WIBA 4PTLA 2NTYC 4F38A 1EX6A 4HDCA 5EE0A 1RYFA 2VPPA 1YR6A 1U2RA 1MRSA 4MKIA 1UF9A 4HLDA 4PSVA 2DBYA 3AV0B 5IHPA 2BM0A 2GEUA 3C8UA 3SI7A 4KFRA 1JEEA 2VLIA 4F4JA 3I1FA 3I8SA 1YJ5A 1I4TD 3S1AB 3VQTA 4NCHA 4G01B 1A2KC 1RW4A 1SXJC 1GKUB 3U7HB 3FE2A 5AJZA 4B3CA 2BCGY 2C77A 3CPHA 2MSEB 4M9SA 3PEWA 5A4JA 5L3QA 3SJZA 2AHOA 3PJRA 4LHXA 4X8OA 1UBFA 4JVLA 4XIGS 3LX5A 1G3MA 2IF0A 3QKRA 3EW9A 4PPFA 2DB3A 2WKRA 1N0VC 4GL2A 2P67A 3FFBA 4IKEA 1TEXA 2Z5FA 4V0MA 1KO1A 4R71A 3RS0A 4TL8A 4NMMA 1HH4A 2A30A 3P20A 1X8KA 1VYVA 4HEJA 2QBYA 2FN4A 1ZYUA 1KNXA 3IHWA 4PHGA 4MH0R 3G82C 2V54A 4URUR 3GEEA 1D2NA 2RGDA 1MABA 3RS5A 2O8FB 5CK4A 1Z6YA 2ZVQX 4Q5IA 2WVJA 1GITA 1PLKA 4RKFA 1F2UA 1YZTA 2JAQA 3PR1A 3AF4A 5CDFA 4HUQB 5KOYA 1KK3A 1MO6A 3VR1A 5BXQC 4NKRA 3D8BA 5J4KA 1E9DA 1I4LD 5KDLA 5FL7A 4XSGA 1G6OA 2XNDD 4H9GA 5TV2A 5TXGA 5KTYA 2O52A 2DHRA 1OE0A 4DDWA 3GLHB 5HTKA 2WWFA 1HYQA 5EUMA 1H8ED 2F3TA 2AXNA 1KNQA 2FFAA 2FU5C 3BFVA 1BYIA 1M6NA 3CRRA 4OK5A 4Q48A 5J4VA 3OHMA 1KIMA 1Z0DA 1YZGA 4TN1A 2B7CA 4Q1AA 3THXA 4GOKA 4Q4HA 2A3RA 4DB2A 1ZC4A 1U0LA 4V0ME 2ZXUA 2EYQA 4XWKA 2ZRHA 1T6NA 4DLUA 1M74A 1KHTA 4JKIA 4BLQA 2Z43A 2BKEA 1ZNXA 2BCJQ 3NTUA 4POAA 4KJZA 2ODBA 2FSHA 4XWAA 1UKVY 2DFNA 3B9QA 4C0AC 2C04A 1US8B 3LLUA 4YDHB 4V0LA 1R6BX 1W48A 1GUAA 3TNFA 1KI4A 3C15C 4YMVA 1N6KA 3K09A 4KFTA 4PSKA 3MFYA 3LW8A 2ZSFA 2IUTA 4HAZA 4EUNA 4QGAA 1ZD8A 2CHQA 3A1VA 3BAFA 4A8JC 5JBQA 1RVDA 2AXPA 4YMSA 4JLVA 4HATA 1W2HA 2HLDD 4BFSA 2C8VA 2VP6A 4DT1A 3IGFA 4QBIA 4A6XA 3QKTA 4M0LA 5EP1A 2QM8A 2PT7A 1VKJA 3MJRA 4B74A 2ECKA 2HCJB 2IT1A 3QXXA 1BH2A 1QZXA 1XPOA 2G3YA 1SXJA 1S0UA 1VPLA 2UVQA 4PAQA 2PT5A 1K6MA 3IQXA 1OXXK 1TTTA 2ZI6A 4L5BA 2HV8A 2ZJOA 4BGDA 1J7KA 2ZRBA 4WOPA 2GBLC 1SVLA 4IOKA 3K09C 1G20E 2A5YB 1U9IC 3Q8XB 1TMKA 3HR7A 3EPHA 3E70C 3BB1A 2OT3B 1KI8A 1YQTA 1IQPA 4TT3D 3WP1B 2IS6A 1MR3F 3SC3A 1RC8A 2VYFA 1NMYA 3DL0A 1BIFA 1TQ6A 1U8ZA 3BBPA 2GZHA 4CYMA 1TQ4A 3LXRA 6Q21A 4LJ5A 1G5RA 2YOGA 3LRPA 2WJJA 4U7DA 1NSFA 3IIKA 2OESA 1OKKA 2N42A 4JL8A 4A1FA 3VTKA 2FWRA 1YZKA 3OE7D 5FI0B 1W0JA 3RRNA 2KWIA 1DTSA 2FZ4A 3UMSA 2NO6A 1HTWA 1Z6XA 1ZUNB 2XTNA 3TIFA 2VP2A 4XJXA 4HAVA 3GEHA 2L0XA 1U94A 4IDQA 4NTZA 4JLMA 4IFEA 2C03A 4PC1A 3OEHA 5D3MB 2CXXA 4ERNA 4KBFA 4HZUA 1UBGA 4N0DA 2J0SA 2EWVA 2FA9A 3U7FB 3LO5A 4QBHA 2WZQA 4TMXA 4AIIA 4F4CA 4QXAA 3TQFA 4I1VA 4NH0A 3GLHA 1G8GA 4JLNA 2GVDC 1Q1EA 3GEIA 2HF9A 1NVWQ 2CK3D 4WXRA 1KOFA 3QJYA 2JJ1A 4LBVA 1MO5A 1FMLA 5CK5A 3MUFA 3VR2A 4GOJA 3RLFA 2WJYA 3TSOA 5DHFA 3BS4A 1TADA 2ANCA 4LBWA 1DO2A 1AKEA 5JI3E 2D7DA 2BC9A 4TSFA 1E3MA 3RHFA 4RJLA 5HE8A 2QPTA 1TUIA 1SKYE 1VDZA 3ZD7A 1GRRA 1AZTA 3LV8A 1E2KA 3BH0A 1P5ZB 1N6OA 2FZLA 2ZR0A 1MRNA 2ONJA 3ZZ0A 4MDEA 1WA5A 5JZVA 1NG9A 1GDDA 1Z0AA 1L4YA 4BFZA 3AUYA 1N2CE 3LBNA 1BYUA 3EARA 2QTFA 3EPJA 4QM6A 2H8KA 1OH8A 2W2XA 4W5JA 2CVHA 4LV8B 4C7OB 3ICEA 1T0JB 1XNJA 3F3YA 5EXPA 2IF2A 1E4YA 2VHUA 1UJ2A 4GZMA 1XF9A 2IK8A 3CZQA 4NL4H 4OJKA 1OIXA 2WJIA 1M7BA 2HUPA 3R9XA 3IDQA 1N0WA 4XVUA 4O25A 1S2MA 5DLQC 5A0FA 1SVMA 3N5CA 1Z83A 4CEJB 1NVVQ 3I92A 3VKHA 1COWD 5KPDA 2XZOA 4TQ9A 1W36D 1CJKC 2YZ2A 4B3XA 4EAQA 4US1R 4CVNA 1QBKC 2EFCB 5EZ6B 1JALA 4P32A 3RNLA 1G64A 5B58C 1U9IA 3SQWA 1FTSA 1XD8A 1KI2A 1ZM7A 3GD7A 1QHGA 4N3NA 4CT4B 2IYTA 2ZRNA 1GKYA 2E9SA 4D0NA 1G9XA 3KKOA 4GNKA 5EXXA 1KKMA 3T35A 5KUTA 3R7WB 4DLZA 2JEOA 4JL5A 5IF9A 4M9ZA 1J8MF 4RFSB 2ZI9A 1UKYA 4QC2A 1SGWA 4N0EA 1JXOA 2WWGA 1G6HA 2QN6A 3BJIC 4MRNA 4PSAA 4UKDA 2JLYA 3CNOA 4FXPA 4BQSA 3FHOA 2CL6X 2F1JA 1GRQA 2J41A 4P4SA 4PHTA 4TYNA 2ZJ5A 5EP2A 1CULC 3FTQA 1UAAA 5DH9A 1QHYA 5JFGA 2ZSEA 2JDIA 2YYZA 4GMXA 4D4KA 1U8AA 3PVSA 4DJTA 2ASEA 4DCVA 1HT1E 2QT0A 1XXHA 1SZPA 5DGXA 3R7WA 4CRWB 3KB1A 2AWNA 3A1UA 3TBKA 4WBSA 4BRUA 3ZJYA 1II8A 1ZM9A 5IRCD 2Q9AA 2EVWX 4ON9A 3WMGA 5AUOB 2D62A 4URXR 4ZKDA 5LD2B 1JAIA 2GHIA 1DG3A 2HLDA 1I2MA 1M34E 3K0CA 2O8CA 4A2PA 1KI9A 4Q9LA 4PPQA 3A1SA 1E99A 3GJ3A 2ZJZA 2H7VA 3AVWA 5TMPA 3ZH9B 3EX7C 2ANBA 4LWZA 4LJ7A 3CPJB 3OIVA 3FGNA 1NJFA 2FDCA 1R10A 3K0SA 5FBWB 1G8YA 4KVGA 1E94E 1PZNA 4O0MA 4XH9B 1W4CA 2VA8A 2WPDA 5BWMA 1VHTA 1YU9A 3C5CA 4A82A 4D80A 3RSOA 1EX7A 2EQBA 1W5TA 2W2VA 2ZYVX 5TY0A 2OG2A 2OCYC 1HEIA 2G0TA 2BMFA 4NCKA 3ZQJA 2Z83A 1AZSC 4FCTA 1JBKA 3QXHA 1JPNA 4BEJA 5DI9A 5FPKA 5DI3A 3AUXA 4DEXA 4DZZA 2B6HA 4GSYA 4TYPA 2QEQA 1KDTA 2FG5A 3I61A 2KE5A 3CR7A 4TLDA 3W6OA 2XXAA 3MG9A 3WMEA 1P75A 2GZAA 2EW1A 3B6EA 3CRMA 1DAGA 2IL1A 4FMBB 3WP0A 4URZR 1ANKA 4A9AA 4ZCMA 3AF0A 3WNDA 2IYYA 1E2PA 1DARA 4D4MA 3G0HA 1MABB 2XOKA 4Q4JB 1G3UA 2CHVA 4PANA 2ZRIA 2NMVA 3B1ZA 3M0EA 4PQFA 4LJ6A 2WOOA 1KYIA 1QVRA 1P9NA 3HU1A 1CR0A 1Q12A 3L82B 4DWJA 2C95A 4EFMA 1OYYA 4CEIA 1P2TA 1LY1A 1XTKA 3TW8B 3WXMA 2VRWA 4P31A 1Z29A 1VIAA 2AFHE 2VP9A 3TLXA 4BRWA 4YMTA 1I2DA 4RCZA 5KPJA 1KJYA 2D2EA 2ZE7A 1P3JA 3SEAA 3L0OA 3UMRA 2IWHA 4FN5A 4Q19A 4LJ4A 2RCNA 3KKMA 3Q72A 4FINA 3RS7A 4BE7B 1CF4A 2W83A 1P2SA 2WAXA 5HCNA 2ZI4A 3C5HA 5EP4A 2DWQA 3BK7A 1GL6A 3AGQA 1CIPA 3CZPA 2HT6A 4KHZA 3FHCB 1P9WA 4YC7A 3GLIA 2BWJA 2FEMA 3QXJA 4MGKR 3BE4A 2Q9BA 4JT2A 3P26A 4QJ3A 2R8RA 4IDNA 1XCPA 3B1VA 3DZ8A 1XTIA 2GA8A 2WKPA 3OAAD 2C9OA 1EWQA 1N5KA 1HV8A 4D6PA 1XD9A 2JLSA 4Z54A 2AKYA 4ARZA 4DEYA 1JEDA 4LZZA 1IN4A 2H92A 2WPDD 4M1TA 2IXFA 2GJAA 2OFXA 1SXJB 1ZM2A 2UKDA 3B9PA 1FFHA 3EC1A 4PC7A 1MH1A 4LHYA 2QP9X 4XSHA 4ZIRA 5JMTA 2GXAA 4MKFA 2Z0MA 5KNDA 1TF7A 1XTJA 3Q3JB 5FR2A 521PA 3SBEA 4BECA 2PL3A 2RGCA 3CWQA 3L43A 4A6PA 2Q3MA 3AEZA 5DI3B 2A5JA 5E7JA 4JL6A 2R2AA 1NG1A 2YC4C 4OI1A 4QBFA 4PZYA 4ZDKA 2NOAA 4DC9A 3FFAA 5HE9A 1D9XA 1ZUHA 4NCNA 3EIQA 1YE8A 2YJTD 3N2IA 5G41A 2NO7A 3ETLA 3P4YA 4OYHA 1U0HC 5H68A 3PV0A 3VX3A 3EA0A 2VQSA 2ZITA 5KYKA 3AF3A 1CXZA 3QVVA 3D7MA 5FOWA 1R5BA 2P6RA 1KSHA 3VU9A 1JPJA 1ESNA 1Q1BA 2XTZA 3TMKA 2ZPTX 2ZRGA 3U60B 4OQNA 1N5LA 1OFIA 2JATA 4NYMR 5KSOA 1ZD9A 4P33A 4Q4HB 4BPBA 3GJ4A 2KB0A 5BN3A 3KXKA 2GXUA 3OESA 1E9EA 3P27A 4XOIA 2A9KA 3W90A 3A37A 4CF7A 3LXXA 3BH7A 1XTSA 2IYWA 1EFRA 2TMKA 3U61B 1CP2A 4AYXA 2H16A 2D4HA 2ZE8A 2Z4SA 5FBRB 4DBLC 5P21A 3PXGA 3LW7A 3OIUA 5L3RA 1WCV1 2ZRJA 2C98A 3DO6A 2YC2C 3HP1A 2CCKA 4ACAA 3QEOA 1LS1A 2H5EA 2R6FA 4RSGA 2VBCA 4K81B 1S3GA 2GESA 3R20A 4DIDA 5CYOA 4QNMA 4AC9A 4PC3A 1OV4A 4HDQB 4PZZA 3TUJC 2DFTA 5F9HA 1T3HA 2WWYA 1R8QA 1FZQA 1HQYE 1P61B 5TARA 1WP9A 2E1RA 1PUIA 3CF0A 2F6RA 2QBYB 4GRAA 1HT2E 5D3MA 3EAQA 1ZCAA 4RFSA 4DB4A 5HZHA 2OXRA 5JRJA 4MKGA 2NZJA 2ZSDA 1F48A 3K9GA 4K8OA 2X1VA 4DRZA 3I8XA 4DIEA 5G3ZA 1F5NA 1Z0KA 4ZO4A 4D0GA 2V4ZA 2BDTA 1YRBA 1NY5A 2Q9CA 1CJTC 4LOAA 1TNDA 2Y8EA 4U00A 4L9WA 1RIFA 1QHIA 1LB1B 2ZIAA 4OQFA 4E09A 3NG1A 2H1LA 3GLGB 2X19A 4WZAE 2BV3A 3BC1A 2VP0A 4TYWA 4JLAA 4FWIB 4L4UA 2X77A 2XOKD 3MSXA 4W5WA 4Q66C 4B43A 3KQHA 2ZR9A 1E0JA 3KTAB 1DG1G 5JWHA 5K8UA 2GILA 2QQ0A 3AVOA 5FOVA 1R7RA 2FGJA 1D6JA 5J5CA 2IA5A 1KTVA 3QBVA 2KI5A 2VHTA 3T1QA 1IXZA 3QKSB 3H4MA 1V5WA 2FX3A 3THWB 1G8HA 1OT3A 3FOZA 3WHLA 3VR3A 1BO6A 2IEZA 4PO8A 3EC2A 1G3QA 1QHNA 1KI1A 1N25A 1XJCA 1GOTA 4OI0A 3C41J 2C5LA 2JIZA 1VMAA 1D2EA 3CKLA 1VG1A 3W8NA 1WB9A 2WSMA 3Q5EA 3QXSA 3NXSA 4NYIR 3QG5A 4ZCIA 1GL9B 1Q20A 4MDFA 3NKVA 3R9WA 2IYVA 3NHAA 5DISB 3CONA 3JZAA 4KITB 3RDPA 1P9RA 2IYUA 2IXGA 1M2OB 1SHKA 4IEEA 4Q02A 4M1KA 2OLJA 3CF6R 1E1RA 4FI3C 2NO9A 3SE0A 4CIDA 1W36C 1ZIOA 3ASYA 1KAGA 2BEJA 2JLQA 4WAUA 3U3RA 2ORVA 2AD1A 3RRZA 4M9QA 3ZVMA 2GBLA 4BLSA 1Z6TA 3DM9B 2PH1A 4UJ3A 1NNEA 3B8HA 1BKDR 1TU3A 2C9YA 3SYLA 3TE6A 4WA7A 3THXB 2F43A 2O5VA 4B3DA 3GJ8A 1W47A 1WMSA 2Q3HA 1F3OA 1AS3A 1ZM3A 2PEYA 4YXWD 3K53A 4EFLA 1AJEA 4DDVA 2KJQA 2REBA 4M9XA 4B44A 4G5OA 3T15A 4LYFA 4QFMA 1VIYA 2ZRKA 5B57C 3A58B 3AP1A 1KDPA 1JI0A 2PCJA 4HUQA 2JCSA 3C16C 4LK2A 3B1XA 1ZCBA 2AX4A 1E9BA 1VCNA 3HYRA 2JJ2A 3Q5DA 4QJ5A 2YOFA 3SN6A 1TX4B 2V1UA 3CNNA 5CIQA 1X8LA 1YKSA 1P2VA 2ODNA 3QKSA 4KVAA 4X8HA 3KTAA 1E9SA 2ZUCA 5CIWA 1YZQA 3VNVA 4WW0A 4NYJQ 2ZUBA 1R4AA 1ZJ6A 3L8ZA 2CVFA 1S8FA 4DSUA 3JZMA 4DDTA 1J8YF 1FL9A 1XCGB 4AK9A 1RKBA 3KX2A 1ZD1A 2CNWA 1G7CA 4LHWA 4JBXA 4GP7A 1UM8A 3EIHA 1SHZA 3GJ5A 3DZDA 4J0QA 4A0FA 3GLIB 2IHBA 4LCBA 5LBIA 4A8JB 1L7VC 3BB3A 4OHXA 1SVSA 1KY3A 2ZVPX 4LSGA 4EJSC 1AQYA 1KO7A 4I4LA 1A1VA 4PC2A 2VHJA 2ZU0C 3U6BA 3KXLA 1E2QA 2EU8A 5L3QB 4GZLA 1KI6A 5AUNB 2J0VA 3CWZA 1Z28A 3MWLA 1XCMA 4M1SA 1QHHB 1YR9A 2QORA 5JWOA 2O8DA 3A36A 1CS4C 2QG6A 3OE7A 4HB4A 3PIRA 4BZPA 2XSZA 3V4RA 1IJEA 4CEJA 3MWYW 2X8AA 4AKIA 3K9NA 3S1AA 4URVR 1UEJA 3T06B 3MAAC 4V0KA 5G53C 4HB0A 3U3KA 4EPRA 5JJLA 2NO1A 4JVNA 1EFRD 3LY5A 5CM8B 4OK6A 1T4GA 1NN3A 3ND9A 1G18A 3AGPA 4KV9A 5FI1B 1B0UA 3VMFA 2ODEA 2GXQA 4G5GA 3AM1A 3T1OA 2I3BA 1NVXQ 2PZEA 4DLSA 1N6LA 4U5XA 4D4JA 4JSTA 4B73A 5KO2A 2OE2A 1G16A 3IO3A 1NIJA 4R2IA 1G8PA 4C0BA 3U3JA 3SU8A 3MLEA 1O3YA 2FPKA 3EA5A 1LF5A 1PJRA 3K70B 3B1WA 5FUYA 1W46A 1P73A 3H1TA 4OBEA 3K0FB 2A5GA 2DCUA 2PEZA 4NONA 4OJQA 2ZRLA 2ZS7A 4PAMA 5BW8A 3QPWA 3DKPA 5E7IA 2MMCA 4H1VA 2QTVB 1GSIA 3NEJA 4IVPA 1T5IA 2HXSA 1KZ7B 1Z07A 2O0KA 1TQDA 1FQKA 4E5UA 2DWOA 4L8GA 3F5FA 3AF1A 2CK3A 2EYUA 4HI0E 1DBSA 3B78A 2KBFA 3QENA 4M2LA 2BBWA 1T9HA 1J2JA 2B21A 2QP3A 2FF7A 2IS1A 5B64A 1KSJA 4QOSA 5DE3A 2FJUA 4Q03A 4V02A 4LI0A 4JMPA 4NYJR 1XEFA 3AVQA 4G1UC 1VG0B 3VR6A 1CJMA 3I73A 1KO4A 1FNNA 1CU1A 4II7A 4MYCA 4ESHA 3ZQ6A 4Q01A 4B71A 2RB4A 3TGPA 3RS2A 2ZJBA 1F2TA 2OCBA 3C4JA 3QPVA 1X1SA 3CNLA 2N1BA 4NCIA 4B3BA 4XWOA 2Z6VA 2IEYA 4CEHA 1Z2CA 4PHFA 4DLYA 2O8EB 2O8BB 2P0EA 1OPXA 2G83A 5L8VA 1GTVA 4A0RA 3WBKA 1COWA 2OEPA 2AWOA 2W0MA 2FGKA 4MGYR 4ZDWA 1ZU4A 1T91A 3QBTA 2CL0X 4BFWA 2IS4A 1ZNWA 2FMXA 2OAQ1 5SZHB 1R5NA 1TAGA 3U4QA 3AVPA 4C30A 821PA 4A4DA 3KFXA 1UDXA 1EFHA 1ELOA 3NEYA 3GFPA 4C2UA 2VTKA 2CDNA 4LHZA 1ZP6A 3A8TA 2A5DA 4MGZR 2JLRA 3M1IA 2FV8A 4Y0AA 5HKKD 3NDPA 2JJ2D 4MA4A 5KDOA 1RZ3A 1VCIA 5SZJA 4TYYA 4LJYA 2QL6A 4O2RA 1RRCA 5H70A 3IIJA 1NBMD 5HPYB 1ZMXA 2WICA 2Z4RA 1HURA 1KDOA 3FYHA 3Q85A 1UBCA 4V03A 3FB4A 1XJ0A 3K70D 2CEAA 1UKZA 1Z5ZA 3LAWA 4MYTA 1L2TA 4YMUA 2BIFA 2IHYA 4BFYA 1G291 2REXB 1KI3A 3KL4A 3LVRE 4TL6A 1FPMA 1DELA 3IQWA 4R9UC 3ZLJA 4RZXA 4EPYA 1W1WA 2Q0HA 3SFVA 3KXIA 3DDCA 2EFHB 1IXRC 4M1WA 1RPZA 4RFVA 3K9LA 3CIOA 1M1YE 4TSFD 2BBSA 3B2EA 5L3SB 3N2EA 5BN5A 1GILA 2CJWB 1OHHD 2FE4A 1GKIA 1G19A 3AKCA 3B85A 3CW2A 3PUYA 3K0AB 1E2DA 2GTPA 1Q3HA 5FBVB 4IJMA 2ZJYA 5FPHA 5EE5B 3GP8A 4KYIB 4P4TA 3TR5A 3VHLB 1SVWA 2QA5A 2WJGA 4HZIA 2IXEA 4RD4A 2BBOA 2QY9A 2ZI7A 3LFUA 1KK1A 4JIMA 1G5TA 2XNDA 4IDPA 3H0KA 2QRNA 4CZ2A 2NGRA 5F3WB 4O2LA 1FMJA 2XITA 3KZ1E 2FSFA 1GL7A 3WYAA 2DY1A 2IYQA 1IXSB 2OV2A 4KFSA 1WDTA 4QBGB 2GJ9A 1E1RD 2AK3A 2H17A 3GQBA 3W6PA 5C46F 3CO5A 3LQQA 4HZUB 4YMWA 1AA9A 3QF4B 2UZ3A 2PX3A 1G7TA 2QT1A 4L15A 5AWFC 2AK2A 1XPRA 2LKDA 2RGNA 1YR7A 1OXVA 1GG2A 3UATA 4S35A 2P5TB 2OXCA 3AKYA 4FW9A 3LD9A 1L4UA 4KXFB 1Q57A 4M53A 3EPKA 1N6NA 1JR3E 2G9NA 3M6AA 4BFUA 1NKSA 4XTCS 3E5HA 1TEVA 1S9HA 2QAGC 1SULA 3EPLA 2VEDA 4LY6A 1F60A 3TVTA 4NZYA 3CR8A 4JLBA 2J59A 1DAKA 3QY0A 1IOZA 1OFHA 5EP3A 5CYPA 4LPSA 5TDHA 4JJZA 3JVVA 4MUBA 1GVNB 4JLOA 1II8B 2OCPA 1KO5A 2QI9C 2BJVA 2BMDA 4C4PA 1D5CA 3OIWA 1A82A 1XB2A 2JGNA 4B35A 3K0FA 2ZU6A 1JR3D 3C7KA 1Z47A 2HF8A 3TR0A 4C0KA 4EFNA 3K70C 1XXHB 1UEIA 5IK2D 5JECA 5FUWA 3UG6A 5FOTA 1YHNA 3JVUA 2QE7D 4ZCLA 721PA 1SVOA 2G1KA 5J4LA 3LBIA 4AYTA 4US2R 1UKEA 2V8OA 4GOXA 4PAOA 4OQXA 5GVRA 3QSYA 2JLUA 5CB6A 1CKEA 1RRPA 4MQBA 2PZGA 4P4SB 1W4AA 3KKQA 1XPUA 1M7GA 2V7QD 2O8BA 4NYMQ 4UXJA 2WJHA 2A7QA 4JJKA 1M8PA 2KBEA 3EZFA 2VHCA 5LD2C 3B82A 4JKYA 5F98A 2R9VA 1QHXA 3OIYA 4BFTA 3UG7A 5FPSA 3HU3A 1XFAA 2A78A 4PXAA 4DLXA 5AJWA 3CRQA 2JLWA 2GNOA 2WWHA 1ODFA 2QP4A 3EZ2A 3UANA 3AVTA 1GAJA 1CJUC 2IYLD 2RHDA 4IXNA 1KI6B 5JHHB 1ZC3A 2BVNA 2WAYA 5FL7D 1UBEA 2FFHA 2J3EA 3OZXA 5EJEA 4MGIR 2MSDB 1IN8A 3EZ9A 4UNQA 2WOJA 2R6DA 2P3SA 2V55B 1Z0JA 1TF2A 4Q7MB 3HPRA 1QRAA 4HAYA 1FP6A 5M04A 1E2HA 3OFND 3VNUA 2BHRA 3CPEA 4JT4A 1GNPA 1S1MA 3ADDA 3E1SA 3ONWA 3QF4A 2WSSD 4PR0A 4S2EA 3SJCA 4KU4A 3NIBA 2WBLC 1ZAKA 2IS2A 3OEHD 1BMFA 4LDJA 4D81A 4OI4A 2CBZA 4Q4JA 4OHZA 1W7AA 4JYBA 1E79A 3AB3A 3WMFA 4LBYA 2ZJAA 2GDJA 4DUGA 4B3GA 1ESMA 3I3SR 4M8NE 4PX9A 4Z8XA 4KODA 3RC8A 1IY1A 2IYRA 1LFDB 2ZR7A 4LJ9A 2I1VB 3RSLA 3GCGA 4DCTA 1A5TA 2OFWA 3T34A 3LWNA 2HCBA 1CRQA 3L0SA 4L9SA 4AKHA 5DNYB 4NCJA 4FMDF 4DSOA 5KHOC 2VP4A 1Q3TA 1LF0A 1JR6A 3AKDA 3SNHA 1E2IA 1MKYA 5TVKA 1Z63A 5HKKA 1ZNYA 1T3SA 2A5FA 2HJVA 5FTKA 1ZIPA 3VAAA 3I5XA 4DLTA 4ZPXA 2OZEA 3IBYA 3IPXA 4X8LA 3D31A 4DLRA 2LKCA 2LCFA 4MITA 3VR4A 4JBYA 5JEDA 1H8HD 4MRSA 4A2WA 1YZUA 1CR1A 4OK3A 1OW3B 3RWOA 1II9A 3NC0C 1OHHA 2G6BA 4QGHA 1J99A 5E7MA 3GJ7A 4IOLA 2CLSA 4BWYA 2ZROA 4GP6A 1E2MA 2QMEA 2YWEA 3DOEA 3OEED 1G8FA 3PFIA 5H8WA 2P6UA 5AR1A 4DCNA 2ZSAA 4G5RA 5K8IA 1XU4A 1NN0A 4RCYA 2H18A 3O8DA 2F7SA 5TB5A 4E07A 1JQJC 4FMCB 4CDGA 2FPMA 3KJHA 1NN1A 3MGCA 3UK6A 3IEVA 1BMFD 1TF5A 3R8CA 4LYHA 1PV4A 3ND8A 3REGA 1GIAA 1TU4A 3EIEA 4TT3A 1YRAA 2GF9A 5DYGA 3TRFA 3WYGA 5FTJA 1II0A 1KMHA 4M4SA 2J45A 2V3CC 1IN5A 2QU8A 3BIFA 1KZGB 3FMPB 2AN9A 3B60A 1A4RA 2QAGB 4PZLA 3ZVLA 1XBTA 2ZAMA 1XZQA 3A1WA 3ZIAD 1E0SA 4B34A 5A5GA 1OB5A 4UJ5A 4D4LA 4Q7LA 1OIWA 2OUKA 3QPUA 1E69A 2ZS8A 2K5UA 4UXIA 3SYKA 4QKQA 4RZ3A 5CITA 1IBRA 2X2EA 3RVBA 1WBBA 1SXJD 1U81A 1JXMA 1E79D 3W3ZB 2VHQA 2V1XA 2J1LA 3NBXX 2VSXA 3UIEA 4DT1B 1IHUA 5BYJA 1GZSA 4UXHA 3GLFA 2AKAB 5SZIA 4JSYA 3TUIC 3GLGA 4C0JA 2JLVA 5C18A 2OBLA 2R6AA 1NVUQ 2B7BA 3QE0A 4AURA 4KI0A 5CLQA 4C9BA 1E4VA 3EWAA 2GCNA 3OF5A 1US8A 2REOA 2QMOA 1DE0A 3VFDA 3U44A 1CR2A 2YVUA 4Q1EA 2QSYA 2BEKA 2FNAA 4OKSA 1FQJA 2OHFA 1N5JA 2RGGA 1GWNA 3L2OB 3FMFA 4G5QA 4RD2A 4Q1FA 4Q00A 4QGFA 4BLTA 5KSYA 4CEIB 2H57A 4IXMA 1IN6A 3X2SA 2ERYA 2ODWA 4DXAA 1E2LA 2OFOA 1CRPA 1DS6A 1T8TA 1W0JD 4I99A 4NE2A 1JQLB 1ZRHA 1OLOA 3OFNA 4QL3A 4RKEA 1VTKA 2Q21A 1CEEA 4TMZA 3GJ6A 4A92A 5EQTA 3O47A 4Q1DA 3CM0A 221PA 1T8UA 4Q7KA 2OO7A 2J7PD 5ELXA 3A4LA 4GFDA 1GNRA 2F3RA 5HZKA 1Q1ZA 3ZIAA 1W0KA 1TPZA 2WKQA 3CB4A 1W49A 3HPQA 4GBMA 4A0HA 4BFXA 3D3QA 1Z08A 3DOFA 4M21A 4OI2A 4FD2A 4XVRA 1R8SA 1FUUA 2WWXA 4I1OA 4Z1MD 2JJ1D 2LWIA 2ZM5A 1ETUA 5DN6D 3CF2A 1J70A 4B6FA 1Z0FA 2ZUDA 1XMVA 1NVVR 2F9MA 3U7GA 2IC5A 3RANA 4GI7A 1NMXA 1ZUIA 1OYWA 1ZU5A 4HSEA 4QJ4A 4F7WA 3ZVNA 2HT1A 3RYTC 3UWOA 4WZBE 2VSOA 4LJAA 3NDBB 1DAMA 1E2NA 1K8RA 1EWRA 4EKDA 2ZRDA 3KUDA 3CUEF 1WQ1R 2AFIE 2O8DB 1JECA 3IO5A 1Q1QA 1KJZA 2ZJ8A 3GLIE 2O0JA 2HDNB 2RGAA 5AJXA 3ASZA 5IDVA 2WIAA 4YXWA 3THYA 4TLCA 4I1SA 3QKUA 1W44A 2R6CA 2W6JA 2WV9A 5H1YA 2ZYUX 3KFVA 4D25A 1JR3A 4RZUA 3V9PA 1Q0UA 2XSZD 1EK0A 5J40A 4QGGA 2V6JA 3U5ZB 2GKSA 2MSCB 3OEEA 3VX4A 1S4QA 2XX3A 4IOMA 4AWXA 1MT0A 2YV5A 4DKXA 3BFXA 2RHMA 5DSZA 4A2QA 5FOSA 1X1RA 5JSZB 2YNMA 4ESVA 1IAQA 3P4XA 1W2GA 2YOHA 4Q47A 5JLJA 1IM2A 3AVXA 4JVSB 3KJGA 1E0AA 1G3IA 4KLNA 3PUZA 4ARZB 5GJVC 1W36B 4BUJA 1KK0A 1C1YA 2Q6TA 4HLUA 4RD6A 5G3YA 1N6RA 4D2IA 1I4DD 4PPNA 1RE0A 5D3QA 3KQLA 1ZNZA 3EASA 3NBZC 4GDFA 3W9YA 1OF1A 4DLVA 4P4UA 1R2QA 2QM7A 3M4YA 3SDZA 1OSNA 1G4UR 3W3AA 3KJEA 3PG5A 3KQNA 4C0SA 2F55A 1D8TA 4LV6A 4B75A 4KFUA 4LYAA 4BFVA 4E22A 1PUJA 1Y63A 1YZNA 4ACBA 1F2TB 3HJNA 1E98A 3CBQA 4HUTA 1PVOA 4XD7D 1QHSA 2J0QA 5FBLB 4LHVA 2J7PA 4Q9JA 5B30A 3T1VA 4Q21A 1RFLA 3PQCA 4IHQA 2C99A 4ZKEA 1NRJB 3UKDA 3TAHA 5CLLA 2XEXA 2FPLA 2PMDA 4TZ6A 2ZJ2A 4TQAA 1IN7A 4O3MA 4MUAA 5DO9A 4KBGA 1KO8A 1VYTA 3PEVA 2OAP1 2YWHA 5FTNA 3RS3A 1D9ZA 4HLCA 4I81A 4TL9A 4AD8A 1E2FA 3BWDD 2YWGA 2P6NA 3GFTA 1FNMA 5SZKB 1G7RA 3QQ5A 3TKLA 3VU9B 2IX3A 1FX0A 4QM7A 2QTHA 1DOAA 2ZRCA 2ZSBA 4LPKA 4EQ6A 5FOXA 1UPTA 1DAIA 2ZRPA 1HE1C 1CTQA 1JB1A 3ZS8A 4UNPA 4Q7JB 2QPOA 4W5HA 4AG5A 2OSBA 2RAPA 1E9RA 1XEWY 1EG7A 1G41A 3TH5A 1G21E 3IIMA 4FWTA 3MMPA 4R2HA 1WE2A 4EJSA 3I32A 3WHKA 2ZTSA 3DM5A 1OB2A 1OXUA 2VF7A 3PCRB 2GCOA 3RRYA 4AKGA 2W6JD 5KU1A 2HYDA 3T5GA 1XMJA 1E1QA 3ZGXA 2J87A 2WMNB 4G0NA 2QUZA 2GAAA 3O8BA 1LNZA 2JLXA 1FUKA 1QVAA 3IKJA 3AF2A 4JVMA 2C2HA 2NO0A 2DYKA 5DHAA 4AI6A 1UADA 4KO8A 1NSTA 5AUQA 4OL0A 3AH8A 4LV5B 4BZXA 3X1WA 2PCLA 4PPGA 1KY2A 3PEUA 2VIIA 1P4SA 3IILA 4MRPA 2ZYWX 1HE8B 1VG8A 2FOLA 3PUWA 4MYHA 4WZ6A 1TL7C 1ZVQA 3NC1C 2IW3A 3CLVA 4NPHA 4OHYA 3RRMA 1AS0A 1Z22A 4Z1MA 1U0JA 2OBNA 4EPXA 4TTQA 3NH9A 5EZ5A 2VSFA 3REFA 1GP2A 3DKVA 4FIDA 2KSQA 4LC0A 4LJ8A 3NWJA 4Q9HA 4KAXA 4HLUC 2XGJA 1DEKA 3NHBA 4X8MA 1E9CA 3O8CA 1XZPA 1T3LA 4P0TA 3TK1A 2DWPA 2NG1A 1P7CA 2GCPA 3WNCA 3ZS9A 3RC3A 4CGZA 3A6PC 3QI2A 1X6VA 2QNRA 3Q7PA 2W6IA 2WJVA 2F9LA 4V0NA 5FTMA 1PLJA 3BOSA 4JLKA 1XP8A 2CE7A 1S3SA 5ANRB 4D82A 5LPNA 1YZLA 1H8EA 5K8LA 1DAHA 2J46A 2QZ4A 2AR7A 4G5SA 5E3HA 4HLQB 1KK2A 2AL7A 3U4QB 3HYTA 2EFEB 3EZ7A 4F92B 1YR8A 4MKHA 2YKGA 4IVQA 2OILA 3MRSA 2IWRA 3AVUA 1NI3A 3B7GA 1K5GA 1NL3A 3KUCA 3AVYA 1KKLA 2G1JA 2JASA 1TQ2A 2ZAOA 1WF3A 3QXCA 4US0R 3SJAA 4Z51A 5J4YA 3QEJA 2BMEA 5JSZA 5FBQB 4LYJA 1LS6A 4LC1A 4NU0A 2IBMA 4HDOB 4JLPA 1A7JA 2GRJA 3W8RA 3WBJA 2GZDA 3BXZA 5FPTA 3ZZUA 4CEHB 2XB4A 1R0XA 5KDDA 1R5OA 4EJSB 3I4LA 3LDAA 3SHFA 2FH5B 2DPXA 4P3YA 4B48A 4IDHA 2VH5R 4K46A 4Q4AB 421PA 2RGEA 2OLKA 3V4FA 2ORIA 5LB2A
chains in the Genus database with same CATH superfamily
2Q2NA 2XNKA 3D6HA 2RGWA 1UJ4A 4JLDA 1LFAA 4WKOA 3FKQA 1OPRA 4HNTA 4UVHA 1RJ9A 1GDTA 3H2YA 4HGQA 1I3NA 3Q4GA 4D45A 3HWSA 1T10A 3HI4A 3FDIA 1SIWA 5H0IA 2OCIA 4BP9A 2NYVA 3L7CA 3V1LA 3F6PA 3T0IA 1AUOA 1LH0A 5H4GA 5MFZA 2C2MA 3CR3C 3KJZA 1O87A 4XUEA 2AZ4A 1EFTA 2GD0A 4ITRC 1GAXA 1Y3AA 1XVIA 2XJ4A 3KJIA 2V9ZA 4H1HA 1MQSA 2QPAA 3KAKA 3GNQA 1BZYA 3NHRA 4HB2A 3WZ2A 4BB6A 1EGAA 2GAOA 3GNSA 2HEIA 1GUBA 1OGIA 3F5DA 4X7PA 3OCYA 2RKOA 2QN7A 4X64B 1HRDA 4ND2A 1M2JA 5CDFE 2XB8A 4PVDA 3ZZMA 1MZPA 2E0IA 2OGZA 3GBSA 3VU0A 5A4IS 2PO7A 2C5AA 4BWVA 1P2UA 2GJKA 1LBTA 4V0OA 3FHTA 3K0BA 1CQPA 2EJTA 3K1TA 2WUFA 5CXSA 4TS4A 2JA1A 3B3GA 4B4DA 4WEOA 3SVLA 1AGPA 1N0UA 4IINA 1YWGO 2O7RA 4TKVB 1K7CA 3FF1A 5TGTA 3PNPA 2B8WA 1NONA 5AH0A 2N0SA 3DNFA 1NX9A 4JR2A 2OO5A 4KWEA 2OAGA 4M1YA 4R2XA 2F1OA 4IOJA 2AS0A 2QE7A 5GONA 1VYHA 2AE2A 3V00A 4E2FA 1FDRA 3WYCA 1E2UA 8AT1A 1F0KA 2O2ZA 3DLAA 2D3WA 4B40A 4MJXA 1WHTA 5GY7A 4UBMA 4FFPA 2EWWA 5T8KA 4TVKA 2OMEA 1CUIA 3OF2A 4PYRA 4EA8A 5DEIA 3FMGA 4ZVVA 1U5BA 4JBHA 4I08A 4YREA 3RVPA 4RD1A 1BOFA 4TTIA 4X44A 5UKDA 1ORDA 2DWUA 3EXG1 1MOZA 1WULS 3ZQUA 4MQLA 3NBFA 4S1TA 1N3BA 2GR9A 4WXPA 4M37A 1OX5A 1EFPA 5C1BA 1VGRA 1Z4IA 3VOSA 1EFCA 3FHLA 4MJLA 4XR9A 3HFRA 1J2EA 5C32A 3D7SA 2J0UB 3K6KA 4E88A 4RZIA 1XU9A 2UUPA 5K8CA 4BVLA 2FFQA 1SO8A 3ZU5A 4LRWA 3GIDA 1P2BA 5TPZA 1W5SA 4I4TF 4U2DA 2X6RA 2F8TA 2CLHB 1QCZA 4DCSA 4CUJA 2LIPA 3EG5A 1G8KA 5FB3A 2QW0X 2EKQA 3MGGA 3SLRA 3WGGA 2PMKA 3BVPA 2ZS9A 4AX8A 4RENA 4BAUA 1PR1A 2Q3FA 4QPNA 3QVXA 3NH6A 3HDHA 4TTTS 3VNBA 4BZQA 4DPLA 2V7QA 1Q92A 2BFNA 2XIJA 5B4UA 2UXBB 5EKUA 1D04A 1I7QB 1Z6AA 1KYVA 4M6WA 4L8YA 1ZZGA 3OAAA 3FPHA 4A8PA 4E46A 3ZDZB 4CM8A 1SEPA 2AD5A 4R68A 1EHIA 1KAMA 5JQWA 1K75A 4I1UA 4FZ3A 2CXQA 2CMKA 4M60A 3H9UA 4Q15A 4EPTA 2I6SA 1EGMB 3BA1A 5G0TA 3NPMA 5JZBA 3QBDA 1NVBA 4S12A 4XGQA 3WYFA 3ZIDA 3K9FC 2IXDA 1B23P 1YMQA 4FD3A 2R84A 2FMKA 2HHJA 2ZIXB 1UFQA 3PUVA 4L50A 1DEAA 1KMHB 1Y9ZA 4KQ9A 2XECA 1J8QA 4DMLA 4DUGD 2NACA 4N76A 3F8WA 3Q88A 5KQSA 1E7MA 4O29A 2WU1A 5FX2A 4DDMA 3NKFA 2XJ9A 2A67A 3MW8A 3NNNA 3FVTA 3AUKA 4ILEA 3RTBA 3THSA 4PGFA 2QX8A 2P0AA 4G25A 5IULC 5ALSA 1NNI1 5E2IA 1FFWA 4IIHA 2PQ6A 3T1NA 2Q28A 3NHKA 1EU1A 4QRDA 3CINA 4UHKA 4FCWA 1CHNA 1CSEE 1LNSA 1JVNA 3AL3A 4AIRA 2I4TA 1PJ3A 2WSSA 1O97C 1VECA 3Q1KA 5LQSA 1PSZA 2YVLA 1CUAA 4LRSB 2JFBA 4B8ZA 2QQFA 1OY1A 1ZVVA 3OQ6A 4EI8A 2HXYA 2O2EA 3OZ7A 2QZZA 1N9GB 4JASB 1KAHA 4L5JA 4MUYA 1B7GO 3IB6A 4B8YA 2AXQA 4JMLA 4O1MA 5JMOA 9LDTA 4QUKA 4LCEA 3HCWA 3TOVA 5K0EA 1SBYA 1XRNA 1ISGA 1E1QD 3TBHA 4LIPD 1JEYB 2FSIA 1J06A 1XTRA 3URKA 4TXLA 4CW7A 1PP4A 2WB4A 1XJQA 1QIIA 4Y6LA 1I3MA 3KALA 2QN2A 4RA9B 3FGOA 2OQVA 4EKIA 3IP1A 2WVHA 1BVRA 4TMVA 2FG7C 3I6MA 1U8EA 5DYYA 4N1AA 3PGKA 3T0FA 2CF5A 4EA9A 5JVDB 3KV3O 3SIWA 3FFWA 3JSXA 3ZXIA 3GFOA 2NQ8A 2W58A 2VSQA 4X20B 4BNDB 2H3HA 1LXCA 1A2BA 1AKYA 2XRFA 3CE9A 3JQBC 4BKMA 5AW7A 4QM6A 3R8FA 3ZLTA 3DEFA 3GVPA 3ZDYB 3V2UA 3IE1A 2EZ8A 2AYZA 4JWKA 1WZ2A 1OC4A 5HQ3A 2XUZA 1Z12A 2C94A 1ECJA 1VE7A 4UNIA 4WD3A 3WYDA 3ICQB 3THWA 4PNEA 1RC1A 1Y7IA 2V5AA 4ZI2A 3HB1A 1KOLA 1ZRMA 3AIMA 5J3JA 2H08A 2AV6A 1KAEA 2RAFA 4B3FX 1RJWA 2D74A 1KWGA 3MXOA 2WHPB 3F5SA 1NUTA 3SJBA 4WH0A 4QG3A 1WUKS 8OHMA 2ZRAA 3MJFA 5GTDA 5BNFA 5CCBA 2PRJA 4CM8B 2BKLA 4DJDC 1H9CA 1I8TA 3W34A 1AS2A 1NTRA 3CO0S 2UYYA 4HP8A 4R7ZA 5AI0A 1WKCA 3VH1A 4JBWA 2N9UA 3GJXC 2JJMA 3JX9A 4FBLA 1W1UA 2WFLA 1FVFA 3A1NA 4N01A 3ST7A 1PLLA 3WYBA 1F20A 1VRCA 3E9NA 1P33A 1EWTA 1R27A 3MS2A 3PUXA 3PENA 1XAIA 2ILVA 3UUEA 3X1DA 4A5OA 3L4BA 4LQLA 3FOAA 1Z18A 5GJWC 3X1ZA 4N12A 2I2DA 3TSWA 1FNBA 3AQ4A 1HQDA 5ESRA 4UOEA 1E2GA 5IC4A 5HQJA 3RFCA 4YJ2B 3OUUA 3QVUA 4GLFA 4Q4CA 2GTIA 3G9ZA 3KLNA 2YCLA 4W1RA 3GROA 3E2IA 2HMTA 2TYSB 1FRVA 2J5XA 4Z3KA 1OFTA 4I5DA 4TGLA 3IAS1 2OM6A 5C4GB 1RHRA 3B13B 1WW2A 1X7WA 1FBNA 2BMJA 3E7FA 5J1TB 4RHFA 3PXEA 2YWXA 3SK0A 4B6EA 5C1DA 1EA5A 4FZJA 4H1TA 3WRYC 1RQXA 4M3NA 1TKRA 2FWAA 4PNHA 1U02A 3T1TA 1X1DA 2YHAA 2O19A 4C0HA 1BS1A 1CZOA 2OQIA 4AMZA 2IZ1A 2HBRA 4KLZA 1D03A 2XAUA 4MQ6A 3MJHA 1PQUA 3PC8A 1C81A 3FKSD 4WKBA 3TLKA 3UAYA 3KYBA 3W3AH 4YUXA 4E94A 2XUFA 3P5SA 4KXVA 4OMCA 1L8QA 2OOKA 3IAXA 4G0YA 1BXGA 2O8EA 1N75A 5AKXA 2F3QA 3A05A 1TK2A 3FLAA 3VPHA 2YDYA 2XXAB 4HFJA 4R98A 4D56A 3MUEA 2H4FA 1TVCA 1WY7A 2NAPA 4OFZA 1VIDA 4PQYA 4RVCA 3K31A 3RF7A 1L7MA 3GOHA 3IBCA 5E4FA 4E5VA 3GA5A 1AKNA 1KJWA 1YBAA 3HJGA 1NASA 3O8LA 3QU7A 5A4MS 2AOXA 2VL7A 1K9VF 1P5RA 4I55B 3DXYA 1U2ZA 5KX5F 1LV7A 2Z95A 5D3ZA 4RK6A 5ALGA 2P9ZA 2EJBA 4Z0TA 5FL3A 2I1WA 4LQ4A 2FEKA 3W3AD 4C0QC 1XDBA 3O90A 4I36A 2VOEA 3ULKA 5KNDD 2ZQ5A 3H65A 4HAWA 3SFZA 1EXMA 2P6OA 2R6JA 1VP3A 1ZXXA 1NW3A 3FWYA 2BJHA 5L7YA 3FVQA 2CL7X 3I23A 1QYRA 4XUDA 5JMWA 1MAVA 1QZ3A 1IXKA 2PZ8A 1Y98A 3PNYA 3RAGA 5LQAA 4D0LB 2IYFA 121PA 5JCPA 4QQFA 1EESA 4NMWA 1S1CA 1WZCA 3P4UA 1ZVMA 1E20A 4RH3A 1BDJA 3CQ9A 4XYEA 2NUTA 2VTBA 3CE6A 4UQOA 3UFXA 1KERA 5EXTA 4X9XA 1BXRA 3P0HA 1PO7A 1SC1A 2YYYA 2R751 3MWKA 5CYFA 4F93B 2P11A 3MTBA 1P2DA 1LV8A 2EG5A 4FKBA 1M5UA 2FJ0A 4RZHA 4S2UA 4ZQEA 3R0JA 5ADHA 4CQMB 4JU8A 5IBPA 1K8XB 2HREA 3I45A 1UP4A 3PFWO 4NEHB 2RHTA 4DUYB 3K0CC 1IJFA 2WV7A 1TA4A 3B5JA 1XMIA 1HQCA 3NXKA 1NF3A 2Q3CA 1U90A 5I7EA 2A0UA 3Q3GE 1NBME 3TEFA 3U19A 4NDAA 2Y92A 3ZEAA 1V16A 2Q2QA 4OH7A 1GM5A 1V4VA 4G5HA 3FYCA 2QKYA 2QAGA 4KQCA 3VHXA 5DCLA 1QANA 2G88A 2JIBA 4WCVA 3W5IA 2ZYTX 3N07A 4IIUA 3WLTA 1GDHA 2C07A 2TS1A 4GRIA 4MLCA 4E11A 2C0QA 4V1CB 4DNQA 2A4MA 4K9QA 5DGIA 1PNQA 3Q7IA 1PWXA 1Q0SA 1S2OA 3MD0A 3HRIA 4Y0VA 3VYTB 4DUZB 3ZWBA 2X7XA 2WVAA 5LBUA 1R0BA 3SSAA 5CM9C 3TI9A 4LRXA 3P97A 3C3YA 1PJBA 1H0RA 2HNKA 1XIVA 2QRJA 4DJFC 4QLBA 3CRVA 1HFWA 4R6XA 4CKBB 2HRRA 3J81k 1PWZA 3THYB 4X63A 1PL6A 2NO5A 1GZ7A 3JD2A 3IC5A 2PBRA 4ND8B 3T5MA 2W2MA 1XROA 1Z2AA 3ISTA 4KVFA 3WZLA 1K5HA 4NYIQ 1L4KA 3B6ZA 3T7DA 2CCGA 1ND5A 5JNTA 1VJ5A 2VHWA 1CRLA 1FS5A 1MRZA 1NBAA 5L53A 2EGUA 1N2ZA 1Y6ZA 1DQZA 2A9RA 4HXFB 1L7EA 3A2MA 4ZVQA 3RV4A 2WW8A 4ZAXA 5IM4A 3Q8MA 2B7LA 2ZKIA 2HRQA 1T0BA 3KS9A 3UJHA 3A28A 4NG5A 2G5TA 2ZG6A 2GN2A 3ZHRA 4OLBA 4EH1A 3EVTA 3JQ8B 3NYIA 4DC0A 1OTYA 2GF0A 3TTWA 3ZHTA 3DCYA 3AKEA 4NP6A 4TUYB 3GCXA 4LXYA 4C4SA 4AZWA 1PFUA 2PUGA 4MLDA 5TMBA 3RAJA 4NBVA 5J59A 1G2QA 3EF0A 5FA5A 4G1BA 4MW9A 2J6CA 3UT5A 2WNHA 2ZE5A 4Y6PA 5GADl 2ISQA 1Y6RA 4MPJA 3ES9A 5KSZA 4I1IA 4Y9RA 1D2GA 4WLNA 3H6GA 1U1IA 1VOTA 4NG4A 4NWIA 3OPYA 1KZ6A 3VZBA 4BV2A 3WWEA 4B6OA 1D2MA 1HO3A 2GZRA 4DV5B 1ULZA 3THOA 3TWOA 2PFSA 2NUPB 2HU2A 2IEAA 3U56A 4IJVA 2O8FA 2B2CA 3UMFA 3F2IA 5DNDA 4PFJA 1EFKA 4YYEA 5B3AA 4Q3KA 2YHSA 1GQRA 4WKPA 5EWJB 5BN5B 2F43B 5ALNA 3ZBPA 4AULA 4IDOA 1I36A 4KPFC 3LU1A 621PA 2XMSA 1WLSA 3BKXA 4MCJA 3KD3A 1OFUX 1XMSA 4ZT7A 1RCFA 4GGPA 3ZI7A 1SVNA 2QR5A 1G9TA 3R5XA 2IYZA 4P81A 3EDMA 5JZSA 4NBSA 3PPWA 2JAPA 1JSXA 4JI1B 1L3BA 2NQ2C 3VKGA 2NU6B 1U4OA 2PWBA 1LTQA 4ZXPA 3CH4B 3V42A 3WQHA 2O8CB 1IONA 2NPIA 2QSZA 1P60A 3EZLA 3LKVA 1F6BA 4KE6A 4N5MA 2FRVA 4WXMA 5J5AA 5C0OE 4RTLA 3QYPA 2A57A 3BD9A 3DGEC 5FNVF 1RYHA 4DDHA 2OWEA 1VKHA 3BUSA 3UGJA 3HSYA 4BEWA 1T1GA 5P8WA 2Z30A 1JHPA 3ZC3A 4AJPA 5IWCA 1ORTA 1WEHA 1RWWA 1GPH1 1IRIA 4FU0A 1HUQA 4R1NA 4XX0A 5A9TA 9ATCA 3ZW9A 4JJFA 1XX6A 2R4QA 4EYEA 1CJSA 3FTCA 4WY5A 2GAJA 3ROKA 4YHBA 4B9AA 4EPVA 2HW8A 1C5KA 2NP7A 3WLEA 5C8ZA 1A71A 1Y6QA 1I2BA 2V9PA 4KSBA 4QWWA 3ZY2A 5KJFA 3CX6A 1FJ2A 1HA3A 1S2NA 3DKRA 2G04A 1ZI8A 1WXEA 4RIIA 5AM2A 3RYIB 1U98A 1BXGB 1SUPA 2FCAA 3WK7A 3T0GA 4RK1A 1W5BA 1OASA 3DUWA 3OLZA 4YV0A 2IQ5A 2NTYC 3JU3A 1C80A 4U7WA 2MHCA 3DDSA 1AQLA 1KF0A 2MYPA 3N87A 4U2KA 4ZRNA 5K0LA 4YV1A 1P9LA 2VPPA 4EKNB 2VXOA 4R8KA 3VO1A 1X14A 4WGGA 4RQBA 5HFAA 4IKOA 4JXJA 1V3TA 4FYIA 1IAVA 5D86A 3V5NA 1TZBA 3I9LA 3L1JA 3MIIA 4A91A 3RIMA 4MP8A 2BM0A 2I78A 3C8UA 4JX9A 3SI7A 3VZPA 1F8GA 3DAOA 3L8GA 4DFDA 4F4JA 5A7FA 1YJ5A 3OCXA 1SKUA 3T9CA 4Z0NA 2O7QA 3GWZA 3IULA 3O75A 4UVGA 4NX2A 3R7BA 2VRCD 1M34B 4LECA 5HS6A 1OLSA 3WKCA 4EWLA 2WUDA 3L77A 4B3CA 1UT6A 1YZHA 4QQKA 5A9RA 4X3CA 4LDQA 3PEWA 2WU8A 3PD0A 1YUBA 4RW0A 2VCHA 5L3QA 1Q1GA 1R9JA 3A06A 4OP2A 4XIGS 3BE5A 1A8UA 3EGCA 3STHA 2VEOA 2DB3A 4YJ2F 3ZY5A 1V8DA 1Z4NA 1KR5A 2GARA 1N0VC 3K4QA 4TWRA 4NS4A 3AHIA 1XQ1A 4PX3A 4JQOA 5ALFA 3H2IA 4TL8A 4GS5A 3TLZA 1SWVA 1DNPA 4Z99A 2I2WA 4JBIA 5EZYA 1SUFA 5B4VA 1X8KA 3P71T 1WQ4A 2FW7A 3O38A 3GGSA 5AJHA 1AUXA 5ILGA 4ER3A 5CD1A 1KNXA 3F96A 5CLJA 4MH0R 2V54A 1IEVA 3T7IA 3QMMA 1NXPA 4Y1RB 2QR2A 3NRCA 2XHZA 1PGNA 4WSOA 5IW8A 4F71A 1DIOB 2VNJA 3PDUA 3D6VA 1REQB 4NV3A 3W2IA 3ZWKA 5IKXA 2AFHB 2R8XA 2ZVQX 2WF5A 4RXTA 5U4XA 4MW1A 2Q5FA 1F2UA 3PR1A 5ALYA 3EFEA 5KOYA 1MO6A 1P31A 1JFFB 2HTEA 2IHJA 2XPCA 1RXUA 4KPUA 3VR1A 2QRUA 4IIGA 1O5IA 1XC7A 2X1LA 3FYUA 1Z4QA 2X86A 1X3LA 5IN4A 3KVVA 3SZLA 1J8DA 3AHDA 2BCEA 1OI4A 5KTYA 2WT8A 1D1PA 2O52A 4ADSG 3IHTA 1P1JA 1QYCA 4MVJP 4DDWA 4DQVA 2WLTA 3PHIA 2C4MA 2VPQA 1XNHA 1HYQA 2QMYA 3BQMB 4I1PA 1DWPA 1F8UA 1PTJA 2AXNA 1OZHA 4KNYA 4LQDA 1I1NA 3CRRA 1M6NA 4JHXA 4YTEA 3RKRA 3DFUA 5J4VA 4I46A 1Z0DA 2H85A 1YZGA 3BF8A 5BNIA 3O93A 4Q1AA 5JJBA 1QQAA 4RLHA 5KOHB 4Q4HA 4I55F 1ZC4A 4V0ME 1FTGA 2ZXUA 4XWKA 1JDUA 3KEGA 3R0VA 1CY2A 1OAOC 1KHTA 1Y1RA 4HVAA 4ZVPA 4BLQA 1HE4A 4QAQA 4X1OA 1WMDA 4LDRA 4LDAA 1M2NA 1OAKA 4IPTA 4PZAA 2P2SA 3HEMA 3HABA 3QW4B 4L3VA 2C04A 2CFCA 3P9YA 1YFKA 4LVUA 1R6BX 2QJWA 4V0LA 3EXEB 4F8EA 1QRSA 2VDNB 4UU0A 2CF6A 3BD7A 1WX1A 2ZSFA 1SBCA 1XCLA 3WMXA 4UUMA 5EWMB 5JS2A 2RGRA 1RVDA 1PS0A 1HZZA 1VE3A 2AXPA 3FCUB 4HATA 4RF3A 4YMSA 4TS9A 4WJZA 4EX6A 3K96A 5HF5A 4CI0B 3RQIA 5EP1A 2O2SA 1CUCA 3DW1X 3TIGA 5K0BA 1U0RA 2F8SA 5DNVA 2HSZA 2O23A 5ETJA 3D7RA 2HCJB 1G6KA 5EGSA 1KS9A 1SBHA 3H7AA 1QZXA 3RBXA 4EHFA 2G3YA 2ZB3A 1SXJA 1S0UA 1VPLA 2C4VA 2E4WA 4GBJA 4DARA 5CT8A 1UQUA 2WIJA 3G2PA 2E82A 1T1IA 2GBFA 4BNTA 2EKBA 2QY6A 1DC8A 5K0CA 2OHXA 2OCGA 2ZJOA 1QQ6A 1J7KA 3H5IA 2VBGA 3MT9A 4X95A 3AHHA 2EL9A 3LDUA 2KPOA 4WOPA 3TPFA 2GBLC 3DDWA 3LC7O 4Q7QA 2ZXFA 3RF6A 1FNCA 4DJAA 3T9EA 1JA1A 1N8KA 1DKPA 1WVIA 5BRAA 4N6GA 3EPHA 4HDKB 2MIIA 4R54A 1C1DB 1PFYA 4PYNA 4EY7A 3BB1A 1HYHA 1T36B 1YQTA 4OVKA 4U63A 5T8KC 1SY7A 5H83A 2IS6A 2J9ZB 3SC3A 4XB1A 3QE3A 1NMYA 5IFKA 2ZB2A 2ATCA 1MG0A 1RQGA 1BIFA 4UZFA 4DEVA 1WO8A 1WEKA 2HWYA 2XD9A 4C3ZA 1NUUA 1KZ1A 2D7JA 2GZHA 4CYMA 4RTNA 3HG7A 3P2JA 4WE3A 2A8YA 1G5RA 4I5EA 5CLIA 3LRPA 2WJJA 1U0OC 4K7JA 3WRVA 4U7DA 4GAEA 2J32A 3S2FA 2PS9A 3FR8A 1C29B 4JT8A 4BMCA 3FROA 1URPA 1OKKA 1WUYA 2N42A 1ZH8A 5FI0B 2X2PA 4X24A 4YT8A 2P6PA 3T52A 4BO6A 2CFTA 2QRHA 1UJ5A 4KQ1A 2KWIA 2FZ4A 3G02A 3EMKA 5H3LA 2XTNA 1GQFA 1AVTA 2VP2A 3KV1A 3UXEA 2CLMB 2ODTX 3GEHA 2L0XA 4HWKA 4UPEA 1ID1A 3SQOA 4NTZA 4ZI7F 2C03A 3D6NB 3P96A 5INTA 2WD7B 3AINA 2NN3C 2QN8A 3LHIA 3SBXA 5FOQA 3A6GA 3KKLA 1FJHA 3VDQA 3V33A 4TMXA 4AIIA 4Z5XA 4KNVA 1LA2A 5AD1A 4F4CA 3H4VA 1JDBC 3H8VA 4G2NA 2IYPA 1XN1A 4WNYA 5ALTA 3EXHA 2CK3D 1KOFA 2CZQA 2JJ1A 3MJSA 4N4AA 5GONB 3MCZA 3QOWA 3VR2A 1MJ5A 5FBVB 1A9YA 4L9AA 2GZ2A 2PKWA 1O95A 5DP1A 5KC8A 2YXLA 5SY6A 2WJYA 4OXNA 3I6QA 2ANCA 1K5PA 3CLUD 1V7QA 4LBWA 4DLPA 5A5VA 1ZEJA 3WK5A 5JI3E 1JG4A 1NLMA 2BC9A 1TUIA 3PFNA 3ZD7A 1E8DA 3LV8A 1AZTA 2O7NA 4MKIA 1KXJA 1OLXA 1N6OA 2ZR0A 4CTNA 5CEFA 1MJFA 2EARA 2HRBA 3B3QA 5JZVA 1Z0AA 3HGQA 4NICA 4EA6A 5CHEA 3ROGA 2YFQA 4IICA 4DHWA 2C9BA 2IP4A 4LV8B 2CFRA 4ZAZA 3EULA 4WZBB 1VMDA 3O4RA 2B25A 1QK4A 3O4VA 1XF9A 1U2GA 4OJKA 3QMWA 1M7BA 2HUPA 3G9TA 3HJAA 2VUHB 2WUVA 4J43A 4TZKA 1QNFA 5EZYB 3GRCA 3E82A 1GXSA 1N0WA 1M8KA 3M6VA 1CDOA 1E7RA 5A0FA 4IGIA 3N5CA 1Q7EA 4J29A 1DBVO 4J0GA 1IN1A 1COWD 1WM1A 4TQ9A 3RGWS 2XUKA 2GPNA 2BFCB 1R6XA 1SIBE 3G17A 4BMVA 4EAQA 3OOSA 2PA3A 3FZEA 5EZ6B 3MCVA 1EPUA 2WC1A 4P32A 1G64A 1ZHHA 5DDIP 5AXBA 3R8XA 2VF5X 3IE2A 1FTSA 3RNLA 3SQWA 4BO0A 1QHGA 3LPNA 4BIMA 4PCAA 1M34A 4Q3AA 1GKYA 3LKBA 1NX6A 2ZP1A 1G9XA 5FNVB 4GNKA 4D0NA 5TR9A 4G8DA 1D3AA 2Q7XA 4CV1A 1DIAA 3PXAA 2SICE 4JL5A 1J8MF 1TUBB 5F5LA 1NULA 2OO3A 4PY2A 2I7VA 5JR3A 1Y3CE 4WOBA 1OXBB 1M6EX 2WWGA 1G6HA 4PSAA 4MRNA 4Q12A 1VJ0A 4UKDA 1U7ZA 3CNOA 3MTJA 3NFYA 3FHOA 3NIWA 3PGLA 1GRQA 5D5PA 1AA6A 3HXLA 2G9VA 4H0CA 2Z3ZA 1L5SA 3WQRA 1CULC 4R5HA 4QRIA 1Q0PA 1QHYA 4FONA 3ACBA 1Z4LA 2O1WA 2ZYRA 1U8XX 3IQGX 5BQ3A 3LTNC 3C43A 1ECGA 1K7XB 1KVUA 4G65A 4EHAA 1BTOA 3EC7A 4MV6A 1JIKA 4RGVA 4U2EA 3RYIA 2PKRA 3A25A 4OHMA 2ZFUA 4Y7DA 2AN3A 5DRYA 1ZRNA 2PTHA 4LMPA 5DGXA 3V80A 2HN9A 3STYA 5DPMA 4AG3A 5B7QA 3S1SA 2PN1A 3FOWA 2OV3A 3ZJYA 1SR8A 1T35A 1B3RA 3IEIA 4KO1S 5CTJA 4Z0HO 4DXHA 2UVDA 4TTSA 3U1VA 4K03A 2C9DA 4HDSB 4XM2A 2ZYDA 2ZBDA 3OIFA 5L6MB 4FZVA 1NJSA 2NTNA 3I4FA 1FEZA 2Z04A 3OOEA 4N40A 3IMKA 2YYSA 1Q0TA 3R7FA 3AVWA 2ZLBA 2ANBA 3OX2A 5DJ5A 1A1SA 3LMKA 1DBRA 4BOYA 4UAGA 5JSYA 1F9EA 2E4AA 3HEBA 3AY6A 4X7BA 4ENRA 2Q49A 5KVQA 2BLNA 1G8YA 3HH8A 4KVGA 4MGEA 3TMAA 1HYBA 1NW6A 3FNGA 4GVLA 4O0MA 4PV7A 4XH9B 4MPPA 4HNSA 2VA8A 2LW7A 2WPDA 5BWMA 1EK5A 5JH7F 1QGED 4A82A 1EX7A 4IQ0A 4ARBA 2ZYVX 4CXMA 4ZEXA 4BO4A 2WZDA 3FLMA 1HEIA 3ZQJA 3ODPA 1BS2A 1XMPA 5ADWA 1KEEB 3NIGB 1UKBA 3M83A 1JBKA 1UMKA 3QXHA 1WDLA 2BYTA 1JJBA 1MD9A 1MA3A 5DI9A 2XRMA 3D2BA 5AXDA 2I33A 3AUXA 4L28A 3O03A 1CE8B 2PGXA 2J6IA 1JIJA 1L1RA 2O7SA 4QYMA 4U7FA 1ENZA 4OQQA 3TB4A 3W6OA 3WL3A 5BWBA 5ERXA 2E6KA 5KTMA 2Q1SA 1P75A 2PYDA 3TNLA 3WLNA 5JZMA 2GZAA 4O4HB 2EW1A 3E8MA 2LCQA 1DAGA 2IL1A 1Y8RA 1DSSG 1ANKA 1BAPA 4X1KB 2JIQA 5AJUA 5F2KA 3W04A 1SCBA 1MEOA 3CMCO 1E2PA 3F1KA 3HMQA 2BHNA 4PONA 5CPFA 4HGZA 4D4MA 3G0HA 4NFYA 4K9MA 3IQZA 1NPTO 3G9QA 3HI6A 4PQFA 3V6MA 2NMVA 5CDGA 2WOOA 5CFQA 2PKCA 1X9HA 3UMVA 3OQ1A 1V96A 5A7HA 2C95A 2OK7A 3IH5A 3UYLA 1N2GA 1NURA 1P2TA 5CBPB 3OQBA 1LY1A 2OCXA 5AW2A 1DZ3A 1HORA 3TW8B 4B83A 1GKKA 1LJUA 1Z75A 2VRWA 2P1RA 3SS9X 5JADA 3BDIA 2OB2A 5CRIA 2W93A 3A1EA 5DNEA 1OAOA 2PY6A 4YP9A 1I2DA 2OC9A 3HVKA 3S27A 2VRNA 1YK1A 4GWKA 3SIRA 1KJYA 3QPCA 1J1IA 3SSNA 3WLKX 3KUKA 3LVFO 2D2EA 3RW9A 3SMVA 3EUEA 2HH9A 4KVZA 1Q7CA 1Q3KA 4TV8F 3SR3A 4GOMD 1P91A 1V8PA 3K8ZA 4F2GA 4PTZA 2XGGA 1ABBA 4G0WA 3AJRA 3CCFA 4LJ4A 3KE9A 4ZCPA 4FINA 3ZJ5A 1TJ4A 4BE7B 2IPXA 5EYPA 4EGSA 2W83A 1P2SA 1CF4A 3SS7X 1C8LA 3OD1A 3C1TA 3WADA 4GKKB 3TQOA 1L7DA 3Q0IA 1DKUA 1ZG3A 5BVHA 3RSSA 2R1VA 4MUNA 3UF0A 2DG2A 2W2LD 2ZRQA 3BDAA 3LYAA 1DLIA 3GVCA 3VYWA 3ZGYA 3GLIA 4ZJUA 2CHEA 4JT2A 1SVUA 1G21B 3DZ8A 1X2EA 3EW7A 2GA8A 4Z7OB 2C9OA 2OOSA 2GWRA 3ZBUA 1L5GB 4PS1A 5LPNA 1V4NA 1EWQA 1LPPA 2OVFA 4O4JA 2Q6VA 4P9NA 1ZH6A 1ZJJA 1XD9A 1H2FA 2BR3A 4Z54A 5F7OA 2X6TA 2W8ZA 5TT0A 2PLNA 3VR4D 2ONYA 4X54A 3T9DA 4D3ZA 1QTNA 2OXTA 5LJIA 4DQKA 2YJ6A 3CKKA 1ISSA 1FFHA 2C3MA 4PC7A 1MH1A 1R0LA 2WF7A 1XZAA 4O4IA 4XSHA 2OXIA 2E18A 5BUZA 2HQSA 1JU4A 1TFUA 2YR0A 4U8GA 5T4BA 4MIOA 2Z0MA 5KNDA 4FR5A 1XTJA 521PA 1O6CA 2YY6A 5EJ6A 3DDOA 4PAGA 1NE7A 4NABA 4UTVA 5DCWA 4DQLA 4LF8B 4A6PA 3OJOA 3RC7A 3L1UA 5DI3B 4NQRA 1P4AA 4OOFA 4OI1A 4B09A 4P5DA 5AQEA 3ZWPA 4CQMA 4ECAA 2JZCA 4PLCA 4DWVA 3U26A 1H1LB 3WLIA 1KQ3A 2JNWA 4DC9A 1U1CA 1CJCA 1FP2A 5BV7A 3VNAA 2GPSA 4G0QA 1YE8A 2YJTD 2XVAA 2MINA 3AI1A 3HDYA 1NPYA 3N7TA 4CL8A 1DU4A 4IX9A 1E1CA 1AGXA 2ZITA 3T7AA 3AF3A 3D3NA 4I0WB 1BWRA 2ZYIA 1QX3A 1R5BA 1STOA 1U04A 3FPBA 3IKMB 4RQAA 3VU9A 4ZOLF 5K3BA 1H6AA 2ZR8A 4ZYUA 4I4TA 2JCYA 1ESNA 3NOXA 1PKEA 3QPBA 5COQA 2CMGA 2ZRGA 4JA0A 2W98A 1M1ZA 5G4LA 4B80A 3MJEA 1N5LA 3JR7A 2JATA 1J21A 1O97D 3AB7A 1F6DA 1H69A 1ZD9A 4P33A 4QDOA 1A5SB 1YA8A 3IQHX 4GMHA 2GNPA 4L07A 2BGTA 4U7TB 2KB0A 5BSKA 1Q7RA 1J5EB 1E9EA 4HC4A 2PSJA 1RCTE 1XL1A 3IVXA 3LIIA 1VM6A 4HHEA 4CF7A 3LXXA 2C61A 2VH1A 6GPBA 2AUMA 1G5HA 3U61B 3O74A 2FEWB 1CP2A 4HN2A 3D8TA 4MV1A 4Y2SA 4DE5A 3CJRA 2Z4SA 1EUQA 3NYWA 1RABA 2X8LA 3KSDO 1ESDA 1PR6A 4TLLB 3SLGA 4CLHA 4EENA 1WCV1 2JIRA 1LPAB 3LQ1A 4EVSA 3OMLA 2A33A 2YC2C 4J0EA 1WNFA 4RPKA 4BXOA 3HP1A 2CCKA 3YASA 3RC1A 4F84A 1QZTA 3EF3A 2B2XA 1LS1A 1RYEA 3C2QA 5I45A 2HA6A 5GONF 2Q27A 3NTXA 1KMMA 2H2GA 2VPYA 2BAGA 5EIEA 3RU2A 1N2OA 5TMDA 2ACVA 2B1JA 4II3A 1XAJA 4PU0A 5AKKA 4QNMA 1IDOA 1S4MA 4OD0A 4PZZA 3TUJC 4EKEA 1T3HA 2IZ0A 1GGHA 2P5UA 1R0KA 2PHZA 4MR8A 4RYLA 1IVYA 2MYUA 2A1UB 1PEKE 3AIIA 1WP9A 1EJ6A 1ZMRA 2E1RA 2PLWA 2F6RA 3BK1A 3C3WA 3CF0A 4GRAA 4F2PA 3KEMA 1ZCAA 1Y8AA 1IFXA 1Z62A 1YBVA 2FN9A 1JEOA 3L0YA 3QHPA 3QW2A 1JVBA 4WKNA 5K3AA 4Z4HA 4N5LA 3M4NA 1ZCJA 3QUTA 4RKYA 5CAEA 4J0CA 1F48A 3U7RA 2GBCA 2OV1A 1UR5A 3LZCA 1TJ5A 3FI9A 2R8YA 5G3ZA 2R86A 4BMNA 3ITNA 4ZO4A 4YRCA 5B36A 4D0GA 3RB8A 2VQDA 3DFZA 2QL7A 2BDTA 3GZ4A 3QZUA 4EL5A 4KGVA 2XKAA 2Q9CA 5JYEA 1CJTC 2W6OA 1O94A 1TNDA 2RC6A 5L95A 1THZA 3QVMA 1ZVKA 3G88A 3Q15C 1B6GA 1LB1B 1WXFA 3CLTD 2H1LA 1LX6A 1NF8A 1IULA 4WZAE 3G8BA 4TYWA 3JALB 4EHIA 2DQZA 4OP1A 3KYIB 2I71A 2FZGA 2UZ1B 4W5WA 1KMCA 2FPIB 4DA8A 3O31A 3P9XA 5DGDA 2YV3A 1T1JA 1TZCA 5JWHA 5AM5A 2BI8A 1QOPB 2UZ0A 3BM5A 5IKEA 5K8UA 2SKCA 3S2ZA 1UXGA 1M5TA 3U3XA 2VWPA 4R2MA 1YZVA 2KI5A 2FWJA 2VHTA 3PRYA 5LZ8A 3WJ2A 3ZXYA 3RYCA 3NUZA 5B37A 1GV0A 1ZHFA 1N33B 3VSAA 4ZOEA 3CVJA 4AJOA 2MYNA 3FDJA 3LXUX 4MWOA 1OT3A 5ICSA 3WHLA 1IQUA 3PSAA 1CZUA 4L72A 1BO6A 1WCYA 3U62A 4YRQA 4PO8A 1B2LA 1G3QA 1KI1A 2H59A 3N75A 4BMZA 4OI0A 3EVNA 1V5FA 3BL8A 4C06A 2XCQA 1B6TA 1EQAA 4G4SO 1VMAA 3CKLA 1JLLB 1WB9A 2WSMA 4NYIR 3W2HA 5AVKA 4ZCIA 1BXRB 3CVXA 1XNQB 4MJ7A 1SQ0A 1FFBA 5JH7A 5LU8A 4X20A 5EIXA 1SU4A 1Q0LA 1IWPB 2IYVA 1D6SA 3PHGA 1ZUWA 2II6A 4RK4A 5DISB 3TQQA 4GE3A 2FR1A 4CFYA 3JZAA 4CDMA 4KITB 4FGSA 4GKBA 1HKUA 1Y7HA 3K9BA 3KVRA 2VYCA 4G89A 3TDKA 4KQXA 1Z2DA 3ERCA 2Z3VA 5CXXA 4EYQA 3I09A 4YRZA 3SJUA 5GQSA 5E2AA 4F5WA 3OICA 1ZIOA 2OZLB 4JEIA 1KAGA 1PW7A 2YUTA 5B3JA 5JYCA 3MCUA 4RDCA 2HRDA 1OVMA 4C07A 4L85A 1ZONA 4W9NC 3RRZA 3ZVMA 1Z9BA 4BB0A 4ND4A 4OTZA 3M4XA 1HDYA 1CVIA 1ND6A 4B3TB 3HZZA 4EG5A 2WJ6A 1Z6TA 4D57A 1RM3A 1BKDR 5B7GA 2C9YA 4NBWA 3SYLA 2EX1A 4WA7A 4NK5A 4KWCA 1W1IA 4OLAA 2O5VA 1NR7A 5KNBH 3KSUA 3EIXA 4DMCA 3T1YB 1AS3A 2B9EA 1AO0A 3HCRA 3HWWA 3K53A 1L8LA 5DX8A 2DEUA 3PB3A 3N76A 4FFWA 5EJ8A 5IT4A 1KU0A 1E59A 1PGPA 2JGIA 4OYYA 4BZZA 4G5OA 1IYZA