2W2WA

Plcg2 split pleckstrin homology (ph) domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDKVEELFEWFQSIREITWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE PHOSPHODIESTERASE GA
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 24
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2wA00
2ROZB 3WYFB 3KY9A 1X11A 2I5CA 2YT1A 4K17A 5C5BA 1BTKA 5DH9B 2J59M 1W1GA 2D11A 1BTNA 3SNHA 3PSCA 4F7UP 1V88A 4YONA 3FEHA 3U7DA 1N3HA 2YT0A 3TVVA 3ML4A 4TYZA 4TKNA 1UEFA 1P3RA 2P0DA 2D9YA 3AU4A 4GPTB 2PZ1A 4DXAB 2AL6A 1LB1A 4PNKA 3HW2B 1AWEA 2P0HA 5KQ4A 3N7CA 2H7EA 4EKUA 3TO1A 1J19A 2MDXA 2EC1A 2V76A 5LOPB 2YVCA 3PG7A 2I5FA 2J0KA 2NZ8B 2GS0A 3AU5A 2YS5A 2L2IA 3VIAA 3KSYA 1MK9B 4KHOA 3GYPA 4ZRIA 2CY4A 4PQ0A 4DX8A 1U2BA 3VOQA 4C0AA 1ZM0A 2AEHA 5FI1A 3P7ZA 1TXDA 3SYXA 4GXBA 1NI2A 3ULBA 1U5EA 3G9WA 4NY0A 2D10A 1ZC3B 4DX90 5DIFB 1OQNA 1GC6A 3ULCA 4Y94A 2X18A 3D8EA 3KRXA 5KQ1A 1M7RA 2Z0QA 1FOEA 1X05A 4HAVB 1EF1A 5JLJB 1SGHA 1ISNA 1TQZA 4NSWA 2XQNM 4EMOA 2LULA 3OANA 1QQGA 4HAUB 2I1JA 4KHAA 2EJ8A 1W1HA 5FI0A 2UZSA 3TFMA 4WJ7A 4Z2MB 4A6FB 3V5WA 5D3XA 2P0FA 2DTCA 2J0MA 2LYDA 1OY2A 2IFSA 4MK0A 3FSSA 5J3TA 5LONB 2I1KA 2LG1A 1H4RA 2E2XA 3CXBB 3RCPA 3HK0A 1ZVRA 4GZUA 1NU2A 3AJ4A 2W2XC 4XWXA 5JP4A 5HE1A 3U8ZA 1J0WA 1UNPA 4HAWB 1XX0A 3KRWA 1I7AA 2EMTA 5C79A 2D9ZA 3DXEA 2GCLA 2LKOA 2YRYA 2CAYA 1MAIA 1EVHA 1XKEA 1DDWA 4HB4B 2VSZA 1SHCA 2COFA 2FJLA 2N23A 3ODOA 2Q13A 1RJ2A 3O96A 4HB3B 1I2HA 4EJNA 1WJ1A 2VKIA 4HB2B 1H10A 1UPRA 3PVUA 2D9XA 2DHKA 4F7HA 1FAOA 5D3WA 1LW3A 3D8FA 3PP2A 3LJUX 4KHBB 2KUPA 4CYEA 2YF0A 2MKRA 3TCAA 1FHXA 1XODA 2UVMA 5HE3A 4HDOA 1MIXA 2UZRA 1MPHA 5HE0A 1BAKA 1FGZA 2Y8GA 2ROVA 1V5UA 1QC6A 3DXCA 1RRPB 2RUKB 2Z0PA 1Y19B 4K2OA 2DYNA 5L81A 3M1IB 1XD4A 5HE2A 4HAZB 5CLLB 4ZRKA 4CHMA 1KZGA 2DA0A 1OMWA 2COAA 2DYQA 3SUZA 4A6HA 1V61A 3ODXA 3NSUA 2CRFA 2DX1A 4A6FA 1U29A 4HB0B 4K81A 1V89A 4IAPA 2RSGA 5EFXA 1NTVA 1KI1B 1XCGA 1WG7A 2D9VA 3BJIA 3HQCA 4P7IA 2CY5A 2CODA 2W2XD 2YS1A 1DROA 1B55A 3UZTA 2K00A 3QBVB 1P6SA 1TJ6A 2LOXA 3P6AA 1DDVA 3CIKA 1WGQA 4D0NB 1WGUA 1GG3A 2MFQA 3MPXA 1BWNA 4H8SA 5D27A 2R0DA 4HDQA 2DLWA 2Z0OA 4HATB 1X1GA 5D3VA 4KAXB 5KCVA 1UNRA 2RNRB 3A8PA 4GMXB 5C16A 3GYOA 4BBKA 3TW1A 4HAXB 2ZPYA 2HTHB 3WA0A 5J3YA 3DXDA 3T06A 2W2WA 1UNQA 2Y7BA 2DFKA 2M14A 1UPQA 1V5PA 2OTXA 2DKQA 4GN1A 2HE7A 2R09A 5GOWB 2G35A 3BINA 3IVFA 1FB8A 3F0WA 1NTYA 2D9WA 5D3YA 1DBHA 2N0YA 2K2UA 3PVWA 1U5FA 2ADZA 1DDMA 1W1DA 2GJYA 4ZRJA 3ZVRA 4KVGB 2RLOA 1DYNA 4GMVA 3PZDA 3KZ1A 4DBBA 3ODWA 5JHHA 1GC7A 2D4QA 2DKPA 3SV1A 5C5BB 3SO6A 2D2QA 4K2PA 2Y8FA 1WJMA 5J3QA 1ZC4B 1X1FA 1Z87A 4L6EA 2YS3A 1EAZA 5CLQB 2NMBA 1K5DB 1PLSA 2H7DA 4CHJA 2JP2A 2M38A 4WVFB 3FM8C 3PVLA 1M7EA 4WSFA 2GCJA 2DN6A 1MIZB 2YSZA 1WI1A 2COCA 1Y5OA 4IOYX 1AQCA 4A5KA 3QWMA 3ZDTA 5C6RA 5DHFB 2EMSA 2RGNB 4B6HA 5DI9B 1E5WA 3QIJA 1V5MA 2ELAA 2LOZA 4HAYB 2P8VA 1K5GB 2QKLA 2L1CA 2KGXB 3MDBC 1PMSA 4MY6A 1WVHA 5DHAB 1ZSQA 2OQBA 2RVBB 1EGXA 4MT7A 4YL8A 2DHJA 2K2JA 1MK7B 2VRWB 2BCJA 2IYBA 3X23A 4HHVA 1IRSA 3PEGA 1Q67A 1U27A 3A98B 1MKEA 1FGYA 1U5GA 2ELBA 1P5TA 2QKMA 4Z2NA 1PFJA 1U5DA 4IFSA 4A6KA 1KZ7A 2DX5A 1X86A 1FHWA 4F7GA 1FHOA 3A8QA 3D8DA 2DHIA 2MWNB 3F5RA 2KCJA 1XR0B 5JHGA 2J0JA
chains in the Genus database with same CATH superfamily
2ROZB 3WYFB 3KY9A 1X11A 2I5CA 2YT1A 4K17A 4QJ4B 5C5BA 1BTKA 5DH9B 2J59M 1W1GA 2D11A 1BTNA 2K49A 1T77A 3SNHA 3PSCA 4F7UP 1V88A 4YONA 3FEHA 3U7DA 1N3HA 2YT0A 2Z59A 3TVVA 3ML4A 2KUQA 4TYZA 4TKNA 1UEFA 3HSAA 1P3RA 2P0DA 2D9YA 3AU4A 4GPTB 2PZ1A 4DXAB 4QJ5B 2AL6A 1LB1A 2KIGA 4PNKA 3HW2B 1AWEA 5IRSA 2P0HA 2GUMA 5KQ4A 3NWAA 3N7CA 2H7EA 4EKUA 3TO1A 1J19A 2MDXA 2EC1A 2V76A 5LOPB 2YVCA 3PG7A 2I5FA 2J0KA 2NZ8B 2GS0A 3AU5A 2YS5A 2L2IA 3VIAA 3KSYA 1MK9B 4KHOA 3GYPA 4ZRIA 2CY4A 4PQ0A 4DX8A 1U2BA 3VOQA 4C0AA 1ZM0A 2AEHA 5FI1A 3P7ZA 1TXDA 3SYXA 4GXBA 1NI2A 3ULBA 1U5EA 3G9WA 4NY0A 2D10A 1ZC3B 4DX90 5DIFB 1OQNA 1GC6A 2KIEA 3ULCA 4Y94A 2X18A 3D8EA 3KRXA 5KQ1A 1M7RA 2Z0QA 4DIXA 1FOEA 1X05A 4HAVB 1EF1A 5JLJB 1SGHA 1ISNA 1TQZA 4NSWA 1MI1A 2XQNM 4EMOA 2LULA 3OANA 4GNKB 1QQGA 4HAUB 2I1JA 4KHAA 2EJ8A 1W1HA 5FI0A 2UZSA 3TFMA 4WJ7A 4Z2MB 4A6FB 3V5WA 5D3XA 2P0FA 2DTCA 2J0MA 2LYDA 1OY2A 2IFSA 4MK0A 3FSSA 5J3TA 5LONB 2I1KA 2LG1A 1H4RA 2E2XA 3CXBB 3RCPA 3HK0A 1ZVRA 4GZUA 1NU2A 3AJ4A 2W2XC 4XWXA 5JP4A 2ZKMX 5HE1A 3U8ZA 1J0WA 1UNPA 4HAWB 1XX0A 3KRWA 1I7AA 2EMTA 5C79A 2D9ZA 3DXEA 2GCLA 2LKOA 2YRYA 3A58A 2CAYA 1MAIA 1EVHA 1XKEA 1DDWA 4HB4B 2VSZA 1SHCA 2COFA 2FJLA 2N23A 3ODOA 2Q13A 1RJ2A 3O96A 4HB3B 1I2HA 4EJNA 1WJ1A 2VKIA 4HB2B 1H10A 1UPRA 3PVUA 2D9XA 2DHKA 4F7HA 1FAOA 5M4YB 5D3WA 1LW3A 3D8FA 3PP2A 3LJUX 4KHBB 4L1RA 2KUPA 4CYEA 2YF0A 2MKRA 3HIEA 3TCAA 1FHXA 1XODA 2UVMA 5HE3A 4HDOA 1MIXA 2UZRA 1MPHA 5HE0A 1BAKA 1FGZA 2Y8GA 2ROVA 1V5UA 1QC6A 3DXCA 1RRPB 2RUKB 2Z0PA 1Y19B 4K2OA 2DYNA 5L81A 3M1IB 1XD4A 5HE2A 4HSIA 4HAZB 5CLLB 4ZRKA 4CHMA 1KZGA 2DA0A 1OMWA 2COAA 2DYQA 3SUZA 4A6HA 1V61A 3ODXA 3NSUA 2CRFA 2DX1A 4A6FA 1U29A 4HB0B 4K81A 1V89A 4IAPA 2RSGA 5EFXA 1NTVA 1KI1B 1XCGA 1WG7A 2D9VA 3BJIA 3HQCA 4P7IA 2CY5A 2CODA 2W2XD 2YS1A 1DROA 1B55A 3UZTA 2K00A 3QBVB 1P6SA 1TJ6A 2LOXA 3NWDA 3P6AA 1DDVA 3CIKA 1WGQA 4D0NB 1WGUA 2K8EA 1GG3A 2MFQA 3MPXA 1BWNA 4H8SA 5D27A 2R0DA 4HDQA 2DLWA 2Z0OA 4HATB 1X1GA 5D3VA 4KAXB 5KCVA 1UNRA 2RNRB 3A8PA 4GMXB 5C16A 4GOUA 3GYOA 4BBKA 3TW1A 4HAXB 2ZPYA 2HTHB 3WA0A 4CSQA 5J3YA 3DXDA 3T06A 2W2WA 1UNQA 2Y7BA 2Z13A 2DFKA 2M14A 1UPQA 1V5PA 2OTXA 2DKQA 4GN1A 2HE7A 2R09A 4QXAB 5GOWB 2G35A 3BINA 3IVFA 1FB8A 3F0WA 1NTYA 2D9WA 5D3YA 1DBHA 2N0YA 2K2UA 3PVWA 1U5FA 2ADZA 1DDMA 1W1DA 4KHBA 2GJYA 4ZRJA 3ZVRA 4KVGB 2RLOA 1DYNA 4OSNA 4GMVA 3PZDA 3KZ1A 4DBBA 3ODWA 5JHHA 1GC7A 2D4QA 2DKPA 3SV1A 5C5BB 3SO6A 2D2QA 4K2PA 2Z4DA 2Z14A 2Y8FA 1WJMA 5J3QA 1ZC4B 1X1FA 1Z87A 3NW8A 4L6EA 2YS3A 1EAZA 5CLQB 2NMBA 1K5DB 1PLSA 2H7DA 4CHJA 2JP2A 2M38A 4WVFB 2RRFA 3FM8C 3PVLA 2NBVA 1M7EA 3OHMB 4WSFA 2GCJA 2DN6A 1MIZB 3DCXA 2YSZA 1WI1A 2COCA 2FJUB 1Y5OA 4IOYX 1AQCA 4QJ3B 4A5KA 5LG4B 3QWMA 3ZDTA 5C6RA 3B77A 5DHFB 2EMSA 2RGNB 4B6HA 2R2YA 4D6WA 5DI9B 1E5WA 3QIJA 1V5MA 2ELAA 5I2SA 2LOZA 4HAYB 2P8VA 1K5GB 2QKLA 2L1CA 2KGXB 3MDBC 1PMSA 4MY6A 1ZYIA 1WVHA 5DHAB 5I2MA 1ZSQA 2OQBA 2RVBB 1EGXA 4MT7A 4YL8A 2DHJA 3FVCA 2K2JA 1MK7B 2KR0A 2VRWB 2BCJA 3U12A 2IYBA 3X23A 4HHVA 1IRSA 3PEGA 1Q67A 1U27A 3A98B 3NWFA 1MKEA 1FGYA 1U5GA 2ELBA 1P5TA 2QKMA 4Z2NA 1PFJA 1U5DA 4IFSA 4OT1A 4A6KA 1KZ7A 2DX5A 1X86A 1FHWA 4F7GA 1FHOA 3A8QA 3D8DA 2DHIA 2MWNB 3F5RA 2KCJA 1XR0B 5JHGA 2YT2A 2J0JA
chains in the Genus database with same CATH topology
2ROZB 3WYFB 3KY9A 1X11A 2I5CA 2YT1A 4K17A 5C5BA 1BTKA 5DH9B 2J59M 1W1GA 2D11A 1BTNA 3SNHA 3PSCA 4F7UP 1V88A 4YONA 3FEHA 3U7DA 1N3HA 2YT0A 3TVVA 3ML4A 4TYZA 4TKNA 1UEFA 1P3RA 2P0DA 2D9YA 3AU4A 4GPTB 2PZ1A 4DXAB 2AL6A 1LB1A 4PNKA 3HW2B 1AWEA 2P0HA 5KQ4A 3N7CA 2H7EA 4EKUA 3TO1A 1J19A 2MDXA 2EC1A 2V76A 5LOPB 2YVCA 3PG7A 2I5FA 2J0KA 2NZ8B 2GS0A 3AU5A 2YS5A 2L2IA 3VIAA 3KSYA 1MK9B 4KHOA 3GYPA 4ZRIA 2CY4A 4PQ0A 4DX8A 1U2BA 3VOQA 4C0AA 1ZM0A 2AEHA 5FI1A 3P7ZA 1TXDA 3SYXA 4GXBA 1NI2A 3ULBA 1U5EA 3G9WA 4NY0A 2D10A 1ZC3B 4DX90 5DIFB 1OQNA 1GC6A 3ULCA 4Y94A 2X18A 3D8EA 3KRXA 5KQ1A 1M7RA 2Z0QA 1FOEA 1X05A 4HAVB 1EF1A 5JLJB 1SGHA 1ISNA 1TQZA 4NSWA 2XQNM 4EMOA 2LULA 3OANA 1QQGA 4HAUB 2I1JA 4KHAA 2EJ8A 1W1HA 5FI0A 2UZSA 3TFMA 4WJ7A 4Z2MB 4A6FB 3V5WA 5D3XA 2P0FA 2DTCA 2J0MA 2LYDA 1OY2A 2IFSA 4MK0A 3FSSA 5J3TA 5LONB 2I1KA 2LG1A 1H4RA 2E2XA 3CXBB 3RCPA 3HK0A 1ZVRA 4GZUA 1NU2A 3AJ4A 2W2XC 4XWXA 5JP4A 5HE1A 3U8ZA 1J0WA 1UNPA 4HAWB 1XX0A 3KRWA 1I7AA 2EMTA 5C79A 2D9ZA 3DXEA 2GCLA 2LKOA 2YRYA 2CAYA 1MAIA 1EVHA 1XKEA 1DDWA 4HB4B 2VSZA 1SHCA 2COFA 2FJLA 2N23A 3ODOA 2Q13A 1RJ2A 3O96A 4HB3B 1I2HA 4EJNA 1WJ1A 2VKIA 4HB2B 1H10A 1UPRA 3PVUA 2D9XA 2DHKA 4F7HA 1FAOA 5D3WA 1LW3A 3D8FA 3PP2A 3LJUX 4KHBB 2KUPA 4CYEA 2YF0A 2MKRA 3TCAA 1FHXA 1XODA 2UVMA 5HE3A 4HDOA 1MIXA 2UZRA 1MPHA 5HE0A 1BAKA 1FGZA 2Y8GA 2ROVA 1V5UA 1QC6A 3DXCA 1RRPB 2RUKB 2Z0PA 1Y19B 4K2OA 2DYNA 5L81A 3M1IB 1XD4A 5HE2A 4HAZB 5CLLB 4ZRKA 4CHMA 1KZGA 2DA0A 1OMWA 2COAA 2DYQA 3SUZA 4A6HA 1V61A 3ODXA 3NSUA 2CRFA 2DX1A 4A6FA 1U29A 4HB0B 4K81A 1V89A 4IAPA 2RSGA 5EFXA 1NTVA 1KI1B 1XCGA 1WG7A 2D9VA 3BJIA 3HQCA 4P7IA 2CY5A 2CODA 2W2XD 2YS1A 1DROA 1B55A 3UZTA 2K00A 3QBVB 1P6SA 1TJ6A 2LOXA 3P6AA 1DDVA 3CIKA 1WGQA 4D0NB 1WGUA 1GG3A 2MFQA 3MPXA 1BWNA 4H8SA 5D27A 2R0DA 4HDQA 2DLWA 2Z0OA 4HATB 1X1GA 5D3VA 4KAXB 5KCVA 1UNRA 2RNRB 3A8PA 4GMXB 5C16A 3GYOA 4BBKA 3TW1A 4HAXB 2ZPYA 2HTHB 3WA0A 5J3YA 3DXDA 3T06A 2W2WA 1UNQA 2Y7BA 2DFKA 2M14A 1UPQA 1V5PA 2OTXA 2DKQA 4GN1A 2HE7A 2R09A 5GOWB 2G35A 3BINA 3IVFA 1FB8A 3F0WA 1NTYA 2D9WA 5D3YA 1DBHA 2N0YA 2K2UA 3PVWA 1U5FA 2ADZA 1DDMA 1W1DA 2GJYA 4ZRJA 3ZVRA 4KVGB 2RLOA 1DYNA 4GMVA 3PZDA 3KZ1A 4DBBA 3ODWA 5JHHA 1GC7A 2D4QA 2DKPA 3SV1A 5C5BB 3SO6A 2D2QA 4K2PA 2Y8FA 1WJMA 5J3QA 1ZC4B 1X1FA 1Z87A 4L6EA 2YS3A 1EAZA 5CLQB 2NMBA 1K5DB 1PLSA 2H7DA 4CHJA 2JP2A 2M38A 4WVFB 3FM8C 3PVLA 1M7EA 4WSFA 2GCJA 2DN6A 1MIZB 2YSZA 1WI1A 2COCA 1Y5OA 4IOYX 1AQCA 4A5KA 3QWMA 3ZDTA 5C6RA 5DHFB 2EMSA 2RGNB 4B6HA 5DI9B 1E5WA 3QIJA 1V5MA 2ELAA 2LOZA 4HAYB 2P8VA 1K5GB 2QKLA 2L1CA 2KGXB 3MDBC 1PMSA 4MY6A 1WVHA 5DHAB 1ZSQA 2OQBA 2RVBB 1EGXA 4MT7A 4YL8A 2DHJA 2K2JA 1MK7B 2VRWB 2BCJA 2IYBA 3X23A 4HHVA 1IRSA 3PEGA 1Q67A 1U27A 3A98B 1MKEA 1FGYA 1U5GA 2ELBA 1P5TA 2QKMA 4Z2NA 1PFJA 1U5DA 4IFSA 4A6KA 1KZ7A 2DX5A 1X86A 1FHWA 4F7GA 1FHOA 3A8QA 3D8DA 2DHIA 2MWNB 3F5RA 2KCJA 1XR0B 5JHGA 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROZ B;  3WYF B;  3KY9 A;  1X11 A;  2I5C A;  2YT1 A;  4K17 A;  5C5B A;  1BTK A;  5DH9 B;  2J59 M;  1W1G A;  2D11 A;  1BTN A;  3SNH A;  3PSC A;  4F7U P;  1V88 A;  4YON A;  3FEH A;  3U7D A;  1N3H A;  2YT0 A;  3TVV A;  3ML4 A;  4TYZ A;  4TKN A;  1UEF A;  1P3R A;  2P0D A;  2D9Y A;  3AU4 A;  4GPT B;  2PZ1 A;  4DXA B;  2AL6 A;  1LB1 A;  4PNK A;  3HW2 B;  1AWE A;  2P0H A;  5KQ4 A;  3N7C A;  2H7E A;  4EKU A;  3TO1 A;  1J19 A;  2MDX A;  2EC1 A;  2V76 A;  5LOP B;  2YVC A;  3PG7 A;  2I5F A;  2J0K A;  2NZ8 B;  2GS0 A;  3AU5 A;  2YS5 A;  2L2I A;  3VIA A;  3KSY A;  1MK9 B;  4KHO A;  3GYP A;  4ZRI A;  2CY4 A;  4PQ0 A;  4DX8 A;  1U2B A;  3VOQ A;  4C0A A;  1ZM0 A;  2AEH A;  5FI1 A;  3P7Z A;  1TXD A;  3SYX A;  4GXB A;  1NI2 A;  3ULB A;  1U5E A;  3G9W A;  4NY0 A;  2D10 A;  1ZC3 B;  4DX9 0;  5DIF B;  1OQN A;  1GC6 A;  3ULC A;  4Y94 A;  2X18 A;  3D8E A;  3KRX A;  5KQ1 A;  1M7R A;  2Z0Q A;  1FOE A;  1X05 A;  4HAV B;  1EF1 A;  5JLJ B;  1SGH A;  1ISN A;  1TQZ A;  4NSW A;  2XQN M;  4EMO A;  2LUL A;  3OAN A;  1QQG A;  4HAU B;  2I1J A;  4KHA A;  2EJ8 A;  1W1H A;  5FI0 A;  2UZS A;  3TFM A;  4WJ7 A;  4Z2M B;  4A6F B;  3V5W A;  5D3X A;  2P0F A;  2DTC A;  2J0M A;  2LYD A;  1OY2 A;  2IFS A;  4MK0 A;  3FSS A;  5J3T A;  5LON B;  2I1K A;  2LG1 A;  1H4R A;  2E2X A;  3CXB B;  3RCP A;  3HK0 A;  1ZVR A;  4GZU A;  1NU2 A;  3AJ4 A;  2W2X C;  4XWX A;  5JP4 A;  5HE1 A;  3U8Z A;  1J0W A;  1UNP A;  4HAW B;  1XX0 A;  3KRW A;  1I7A A;  2EMT A;  5C79 A;  2D9Z A;  3DXE A;  2GCL A;  2LKO A;  2YRY A;  2CAY A;  1MAI A;  1EVH A;  1XKE A;  1DDW A;  4HB4 B;  2VSZ A;  1SHC A;  2COF A;  2FJL A;  2N23 A;  3ODO A;  2Q13 A;  1RJ2 A;  3O96 A;  4HB3 B;  1I2H A;  4EJN A;  1WJ1 A;  2VKI A;  4HB2 B;  1H10 A;  1UPR A;  3PVU A;  2D9X A;  2DHK A;  4F7H A;  1FAO A;  5D3W A;  1LW3 A;  3D8F A;  3PP2 A;  3LJU X;  4KHB B;  2KUP A;  4CYE A;  2YF0 A;  2MKR A;  3TCA A;  1FHX A;  1XOD A;  2UVM A;  5HE3 A;  4HDO A;  1MIX A;  2UZR A;  1MPH A;  5HE0 A;  1BAK A;  1FGZ A;  2Y8G A;  2ROV A;  1V5U A;  1QC6 A;  3DXC A;  1RRP B;  2RUK B;  2Z0P A;  1Y19 B;  4K2O A;  2DYN A;  5L81 A;  3M1I B;  1XD4 A;  5HE2 A;  4HAZ B;  5CLL B;  4ZRK A;  4CHM A;  1KZG A;  2DA0 A;  1OMW A;  2COA A;  2DYQ A;  3SUZ A;  4A6H A;  1V61 A;  3ODX A;  3NSU A;  2CRF A;  2DX1 A;  4A6F A;  1U29 A;  4HB0 B;  4K81 A;  1V89 A;  4IAP A;  2RSG A;  5EFX A;  1NTV A;  1KI1 B;  1XCG A;  1WG7 A;  2D9V A;  3BJI A;  3HQC A;  4P7I A;  2CY5 A;  2COD A;  2W2X D;  2YS1 A;  1DRO A;  1B55 A;  3UZT A;  2K00 A;  3QBV B;  1P6S A;  1TJ6 A;  2LOX A;  3P6A A;  1DDV A;  3CIK A;  1WGQ A;  4D0N B;  1WGU A;  1GG3 A;  2MFQ A;  3MPX A;  1BWN A;  4H8S A;  5D27 A;  2R0D A;  4HDQ A;  2DLW A;  2Z0O A;  4HAT B;  1X1G A;  5D3V A;  4KAX B;  5KCV A;  1UNR A;  2RNR B;  3A8P A;  4GMX B;  5C16 A;  3GYO A;  4BBK A;  3TW1 A;  4HAX B;  2ZPY A;  2HTH B;  3WA0 A;  5J3Y A;  3DXD A;  3T06 A;  2W2W A;  1UNQ A;  2Y7B A;  2DFK A;  2M14 A;  1UPQ A;  1V5P A;  2OTX A;  2DKQ A;  4GN1 A;  2HE7 A;  2R09 A;  5GOW B;  2G35 A;  3BIN A;  3IVF A;  1FB8 A;  3F0W A;  1NTY A;  2D9W A;  5D3Y A;  1DBH A;  2N0Y A;  2K2U A;  3PVW A;  1U5F A;  2ADZ A;  1DDM A;  1W1D A;  2GJY A;  4ZRJ A;  3ZVR A;  4KVG B;  2RLO A;  1DYN A;  4GMV A;  3PZD A;  3KZ1 A;  4DBB A;  3ODW A;  5JHH A;  1GC7 A;  2D4Q A;  2DKP A;  3SV1 A;  5C5B B;  3SO6 A;  2D2Q A;  4K2P A;  2Y8F A;  1WJM A;  5J3Q A;  1ZC4 B;  1X1F A;  1Z87 A;  4L6E A;  2YS3 A;  1EAZ A;  5CLQ B;  2NMB A;  1K5D B;  1PLS A;  2H7D A;  4CHJ A;  2JP2 A;  2M38 A;  4WVF B;  3FM8 C;  3PVL A;  1M7E A;  4WSF A;  2GCJ A;  2DN6 A;  1MIZ B;  2YSZ A;  1WI1 A;  2COC A;  1Y5O A;  4IOY X;  1AQC A;  4A5K A;  3QWM A;  3ZDT A;  5C6R A;  5DHF B;  2EMS A;  2RGN B;  4B6H A;  5DI9 B;  1E5W A;  3QIJ A;  1V5M A;  2ELA A;  2LOZ A;  4HAY B;  2P8V A;  1K5G B;  2QKL A;  2L1C A;  2KGX B;  3MDB C;  1PMS A;  4MY6 A;  1WVH A;  5DHA B;  1ZSQ A;  2OQB A;  2RVB B;  1EGX A;  4MT7 A;  4YL8 A;  2DHJ A;  2K2J A;  1MK7 B;  2VRW B;  2BCJ A;  2IYB A;  3X23 A;  4HHV A;  1IRS A;  3PEG A;  1Q67 A;  1U27 A;  3A98 B;  1MKE A;  1FGY A;  1U5G A;  2ELB A;  1P5T A;  2QKM A;  4Z2N A;  1PFJ A;  1U5D A;  4IFS A;  4A6K A;  1KZ7 A;  2DX5 A;  1X86 A;  1FHW A;  4F7G A;  1FHO A;  3A8Q A;  3D8D A;  2DHI A;  2MWN B;  3F5R A;  2KCJ A;  1XR0 B;  5JHG A;  2J0J A; 
#chains in the Genus database with same CATH topology
 2ROZ B;  3WYF B;  3KY9 A;  1X11 A;  2I5C A;  2YT1 A;  4K17 A;  4QJ4 B;  5C5B A;  1BTK A;  5DH9 B;  2J59 M;  1W1G A;  2D11 A;  1BTN A;  2K49 A;  1T77 A;  3SNH A;  3PSC A;  4F7U P;  1V88 A;  4YON A;  3FEH A;  3U7D A;  1N3H A;  2YT0 A;  2Z59 A;  3TVV A;  3ML4 A;  2KUQ A;  4TYZ A;  4TKN A;  1UEF A;  3HSA A;  1P3R A;  2P0D A;  2D9Y A;  3AU4 A;  4GPT B;  2PZ1 A;  4DXA B;  4QJ5 B;  2AL6 A;  1LB1 A;  2KIG A;  4PNK A;  3HW2 B;  1AWE A;  5IRS A;  2P0H A;  2GUM A;  5KQ4 A;  3NWA A;  3N7C A;  2H7E A;  4EKU A;  3TO1 A;  1J19 A;  2MDX A;  2EC1 A;  2V76 A;  5LOP B;  2YVC A;  3PG7 A;  2I5F A;  2J0K A;  2NZ8 B;  2GS0 A;  3AU5 A;  2YS5 A;  2L2I A;  3VIA A;  3KSY A;  1MK9 B;  4KHO A;  3GYP A;  4ZRI A;  2CY4 A;  4PQ0 A;  4DX8 A;  1U2B A;  3VOQ A;  4C0A A;  1ZM0 A;  2AEH A;  5FI1 A;  3P7Z A;  1TXD A;  3SYX A;  4GXB A;  1NI2 A;  3ULB A;  1U5E A;  3G9W A;  4NY0 A;  2D10 A;  1ZC3 B;  4DX9 0;  5DIF B;  1OQN A;  1GC6 A;  2KIE A;  3ULC A;  4Y94 A;  2X18 A;  3D8E A;  3KRX A;  5KQ1 A;  1M7R A;  2Z0Q A;  4DIX A;  1FOE A;  1X05 A;  4HAV B;  1EF1 A;  5JLJ B;  1SGH A;  1ISN A;  1TQZ A;  4NSW A;  1MI1 A;  2XQN M;  4EMO A;  2LUL A;  3OAN A;  4GNK B;  1QQG A;  4HAU B;  2I1J A;  4KHA A;  2EJ8 A;  1W1H A;  5FI0 A;  2UZS A;  3TFM A;  4WJ7 A;  4Z2M B;  4A6F B;  3V5W A;  5D3X A;  2P0F A;  2DTC A;  2J0M A;  2LYD A;  1OY2 A;  2IFS A;  4MK0 A;  3FSS A;  5J3T A;  5LON B;  2I1K A;  2LG1 A;  1H4R A;  2E2X A;  3CXB B;  3RCP A;  3HK0 A;  1ZVR A;  4GZU A;  1NU2 A;  3AJ4 A;  2W2X C;  4XWX A;  5JP4 A;  2ZKM X;  5HE1 A;  3U8Z A;  1J0W A;  1UNP A;  4HAW B;  1XX0 A;  3KRW A;  1I7A A;  2EMT A;  5C79 A;  2D9Z A;  3DXE A;  2GCL A;  2LKO A;  2YRY A;  3A58 A;  2CAY A;  1MAI A;  1EVH A;  1XKE A;  1DDW A;  4HB4 B;  2VSZ A;  1SHC A;  2COF A;  2FJL A;  2N23 A;  3ODO A;  2Q13 A;  1RJ2 A;  3O96 A;  4HB3 B;  1I2H A;  4EJN A;  1WJ1 A;  2VKI A;  4HB2 B;  1H10 A;  1UPR A;  3PVU A;  2D9X A;  2DHK A;  4F7H A;  1FAO A;  5M4Y B;  5D3W A;  1LW3 A;  3D8F A;  3PP2 A;  3LJU X;  4KHB B;  4L1R A;  2KUP A;  4CYE A;  2YF0 A;  2MKR A;  3HIE A;  3TCA A;  1FHX A;  1XOD A;  2UVM A;  5HE3 A;  4HDO A;  1MIX A;  2UZR A;  1MPH A;  5HE0 A;  1BAK A;  1FGZ A;  2Y8G A;  2ROV A;  1V5U A;  1QC6 A;  3DXC A;  1RRP B;  2RUK B;  2Z0P A;  1Y19 B;  4K2O A;  2DYN A;  5L81 A;  3M1I B;  1XD4 A;  5HE2 A;  4HSI A;  4HAZ B;  5CLL B;  4ZRK A;  4CHM A;  1KZG A;  2DA0 A;  1OMW A;  2COA A;  2DYQ A;  3SUZ A;  4A6H A;  1V61 A;  3ODX A;  3NSU A;  2CRF A;  2DX1 A;  4A6F A;  1U29 A;  4HB0 B;  4K81 A;  1V89 A;  4IAP A;  2RSG A;  5EFX A;  1NTV A;  1KI1 B;  1XCG A;  1WG7 A;  2D9V A;  3BJI A;  3HQC A;  4P7I A;  2CY5 A;  2COD A;  2W2X D;  2YS1 A;  1DRO A;  1B55 A;  3UZT A;  2K00 A;  3QBV B;  1P6S A;  1TJ6 A;  2LOX A;  3NWD A;  3P6A A;  1DDV A;  3CIK A;  1WGQ A;  4D0N B;  1WGU A;  2K8E A;  1GG3 A;  2MFQ A;  3MPX A;  1BWN A;  4H8S A;  5D27 A;  2R0D A;  4HDQ A;  2DLW A;  2Z0O A;  4HAT B;  1X1G A;  5D3V A;  4KAX B;  5KCV A;  1UNR A;  2RNR B;  3A8P A;  4GMX B;  5C16 A;  4GOU A;  3GYO A;  4BBK A;  3TW1 A;  4HAX B;  2ZPY A;  2HTH B;  3WA0 A;  4CSQ A;  5J3Y A;  3DXD A;  3T06 A;  2W2W A;  1UNQ A;  2Y7B A;  2Z13 A;  2DFK A;  2M14 A;  1UPQ A;  1V5P A;  2OTX A;  2DKQ A;  4GN1 A;  2HE7 A;  2R09 A;  4QXA B;  5GOW B;  2G35 A;  3BIN A;  3IVF A;  1FB8 A;  3F0W A;  1NTY A;  2D9W A;  5D3Y A;  1DBH A;  2N0Y A;  2K2U A;  3PVW A;  1U5F A;  2ADZ A;  1DDM A;  1W1D A;  4KHB A;  2GJY A;  4ZRJ A;  3ZVR A;  4KVG B;  2RLO A;  1DYN A;  4OSN A;  4GMV A;  3PZD A;  3KZ1 A;  4DBB A;  3ODW A;  5JHH A;  1GC7 A;  2D4Q A;  2DKP A;  3SV1 A;  5C5B B;  3SO6 A;  2D2Q A;  4K2P A;  2Z4D A;  2Z14 A;  2Y8F A;  1WJM A;  5J3Q A;  1ZC4 B;  1X1F A;  1Z87 A;  3NW8 A;  4L6E A;  2YS3 A;  1EAZ A;  5CLQ B;  2NMB A;  1K5D B;  1PLS A;  2H7D A;  4CHJ A;  2JP2 A;  2M38 A;  4WVF B;  2RRF A;  3FM8 C;  3PVL A;  2NBV A;  1M7E A;  3OHM B;  4WSF A;  2GCJ A;  2DN6 A;  1MIZ B;  3DCX A;  2YSZ A;  1WI1 A;  2COC A;  2FJU B;  1Y5O A;  4IOY X;  1AQC A;  4QJ3 B;  4A5K A;  5LG4 B;  3QWM A;  3ZDT A;  5C6R A;  3B77 A;  5DHF B;  2EMS A;  2RGN B;  4B6H A;  2R2Y A;  4D6W A;  5DI9 B;  1E5W A;  3QIJ A;  1V5M A;  2ELA A;  5I2S A;  2LOZ A;  4HAY B;  2P8V A;  1K5G B;  2QKL A;  2L1C A;  2KGX B;  3MDB C;  1PMS A;  4MY6 A;  1ZYI A;  1WVH A;  5DHA B;  5I2M A;  1ZSQ A;  2OQB A;  2RVB B;  1EGX A;  4MT7 A;  4YL8 A;  2DHJ A;  3FVC A;  2K2J A;  1MK7 B;  2KR0 A;  2VRW B;  2BCJ A;  3U12 A;  2IYB A;  3X23 A;  4HHV A;  1IRS A;  3PEG A;  1Q67 A;  1U27 A;  3A98 B;  3NWF A;  1MKE A;  1FGY A;  1U5G A;  2ELB A;  1P5T A;  2QKM A;  4Z2N A;  1PFJ A;  1U5D A;  4IFS A;  4OT1 A;  4A6K A;  1KZ7 A;  2DX5 A;  1X86 A;  1FHW A;  4F7G A;  1FHO A;  3A8Q A;  3D8D A;  2DHI A;  2MWN B;  3F5R A;  2KCJ A;  1XR0 B;  5JHG A;  2YT2 A;  2J0J A; 
#chains in the Genus database with same CATH homology
 2ROZ B;  3WYF B;  3KY9 A;  1X11 A;  2I5C A;  2YT1 A;  4K17 A;  5C5B A;  1BTK A;  5DH9 B;  2J59 M;  1W1G A;  2D11 A;  1BTN A;  3SNH A;  3PSC A;  4F7U P;  1V88 A;  4YON A;  3FEH A;  3U7D A;  1N3H A;  2YT0 A;  3TVV A;  3ML4 A;  4TYZ A;  4TKN A;  1UEF A;  1P3R A;  2P0D A;  2D9Y A;  3AU4 A;  4GPT B;  2PZ1 A;  4DXA B;  2AL6 A;  1LB1 A;  4PNK A;  3HW2 B;  1AWE A;  2P0H A;  5KQ4 A;  3N7C A;  2H7E A;  4EKU A;  3TO1 A;  1J19 A;  2MDX A;  2EC1 A;  2V76 A;  5LOP B;  2YVC A;  3PG7 A;  2I5F A;  2J0K A;  2NZ8 B;  2GS0 A;  3AU5 A;  2YS5 A;  2L2I A;  3VIA A;  3KSY A;  1MK9 B;  4KHO A;  3GYP A;  4ZRI A;  2CY4 A;  4PQ0 A;  4DX8 A;  1U2B A;  3VOQ A;  4C0A A;  1ZM0 A;  2AEH A;  5FI1 A;  3P7Z A;  1TXD A;  3SYX A;  4GXB A;  1NI2 A;  3ULB A;  1U5E A;  3G9W A;  4NY0 A;  2D10 A;  1ZC3 B;  4DX9 0;  5DIF B;  1OQN A;  1GC6 A;  3ULC A;  4Y94 A;  2X18 A;  3D8E A;  3KRX A;  5KQ1 A;  1M7R A;  2Z0Q A;  1FOE A;  1X05 A;  4HAV B;  1EF1 A;  5JLJ B;  1SGH A;  1ISN A;  1TQZ A;  4NSW A;  2XQN M;  4EMO A;  2LUL A;  3OAN A;  1QQG A;  4HAU B;  2I1J A;  4KHA A;  2EJ8 A;  1W1H A;  5FI0 A;  2UZS A;  3TFM A;  4WJ7 A;  4Z2M B;  4A6F B;  3V5W A;  5D3X A;  2P0F A;  2DTC A;  2J0M A;  2LYD A;  1OY2 A;  2IFS A;  4MK0 A;  3FSS A;  5J3T A;  5LON B;  2I1K A;  2LG1 A;  1H4R A;  2E2X A;  3CXB B;  3RCP A;  3HK0 A;  1ZVR A;  4GZU A;  1NU2 A;  3AJ4 A;  2W2X C;  4XWX A;  5JP4 A;  5HE1 A;  3U8Z A;  1J0W A;  1UNP A;  4HAW B;  1XX0 A;  3KRW A;  1I7A A;  2EMT A;  5C79 A;  2D9Z A;  3DXE A;  2GCL A;  2LKO A;  2YRY A;  2CAY A;  1MAI A;  1EVH A;  1XKE A;  1DDW A;  4HB4 B;  2VSZ A;  1SHC A;  2COF A;  2FJL A;  2N23 A;  3ODO A;  2Q13 A;  1RJ2 A;  3O96 A;  4HB3 B;  1I2H A;  4EJN A;  1WJ1 A;  2VKI A;  4HB2 B;  1H10 A;  1UPR A;  3PVU A;  2D9X A;  2DHK A;  4F7H A;  1FAO A;  5D3W A;  1LW3 A;  3D8F A;  3PP2 A;  3LJU X;  4KHB B;  2KUP A;  4CYE A;  2YF0 A;  2MKR A;  3TCA A;  1FHX A;  1XOD A;  2UVM A;  5HE3 A;  4HDO A;  1MIX A;  2UZR A;  1MPH A;  5HE0 A;  1BAK A;  1FGZ A;  2Y8G A;  2ROV A;  1V5U A;  1QC6 A;  3DXC A;  1RRP B;  2RUK B;  2Z0P A;  1Y19 B;  4K2O A;  2DYN A;  5L81 A;  3M1I B;  1XD4 A;  5HE2 A;  4HAZ B;  5CLL B;  4ZRK A;  4CHM A;  1KZG A;  2DA0 A;  1OMW A;  2COA A;  2DYQ A;  3SUZ A;  4A6H A;  1V61 A;  3ODX A;  3NSU A;  2CRF A;  2DX1 A;  4A6F A;  1U29 A;  4HB0 B;  4K81 A;  1V89 A;  4IAP A;  2RSG A;  5EFX A;  1NTV A;  1KI1 B;  1XCG A;  1WG7 A;  2D9V A;  3BJI A;  3HQC A;  4P7I A;  2CY5 A;  2COD A;  2W2X D;  2YS1 A;  1DRO A;  1B55 A;  3UZT A;  2K00 A;  3QBV B;  1P6S A;  1TJ6 A;  2LOX A;  3P6A A;  1DDV A;  3CIK A;  1WGQ A;  4D0N B;  1WGU A;  1GG3 A;  2MFQ A;  3MPX A;  1BWN A;  4H8S A;  5D27 A;  2R0D A;  4HDQ A;  2DLW A;  2Z0O A;  4HAT B;  1X1G A;  5D3V A;  4KAX B;  5KCV A;  1UNR A;  2RNR B;  3A8P A;  4GMX B;  5C16 A;  3GYO A;  4BBK A;  3TW1 A;  4HAX B;  2ZPY A;  2HTH B;  3WA0 A;  5J3Y A;  3DXD A;  3T06 A;  2W2W A;  1UNQ A;  2Y7B A;  2DFK A;  2M14 A;  1UPQ A;  1V5P A;  2OTX A;  2DKQ A;  4GN1 A;  2HE7 A;  2R09 A;  5GOW B;  2G35 A;  3BIN A;  3IVF A;  1FB8 A;  3F0W A;  1NTY A;  2D9W A;  5D3Y A;  1DBH A;  2N0Y A;  2K2U A;  3PVW A;  1U5F A;  2ADZ A;  1DDM A;  1W1D A;  2GJY A;  4ZRJ A;  3ZVR A;  4KVG B;  2RLO A;  1DYN A;  4GMV A;  3PZD A;  3KZ1 A;  4DBB A;  3ODW A;  5JHH A;  1GC7 A;  2D4Q A;  2DKP A;  3SV1 A;  5C5B B;  3SO6 A;  2D2Q A;  4K2P A;  2Y8F A;  1WJM A;  5J3Q A;  1ZC4 B;  1X1F A;  1Z87 A;  4L6E A;  2YS3 A;  1EAZ A;  5CLQ B;  2NMB A;  1K5D B;  1PLS A;  2H7D A;  4CHJ A;  2JP2 A;  2M38 A;  4WVF B;  3FM8 C;  3PVL A;  1M7E A;  4WSF A;  2GCJ A;  2DN6 A;  1MIZ B;  2YSZ A;  1WI1 A;  2COC A;  1Y5O A;  4IOY X;  1AQC A;  4A5K A;  3QWM A;  3ZDT A;  5C6R A;  5DHF B;  2EMS A;  2RGN B;  4B6H A;  5DI9 B;  1E5W A;  3QIJ A;  1V5M A;  2ELA A;  2LOZ A;  4HAY B;  2P8V A;  1K5G B;  2QKL A;  2L1C A;  2KGX B;  3MDB C;  1PMS A;  4MY6 A;  1WVH A;  5DHA B;  1ZSQ A;  2OQB A;  2RVB B;  1EGX A;  4MT7 A;  4YL8 A;  2DHJ A;  2K2J A;  1MK7 B;  2VRW B;  2BCJ A;  2IYB A;  3X23 A;  4HHV A;  1IRS A;  3PEG A;  1Q67 A;  1U27 A;  3A98 B;  1MKE A;  1FGY A;  1U5G A;  2ELB A;  1P5T A;  2QKM A;  4Z2N A;  1PFJ A;  1U5D A;  4IFS A;  4A6K A;  1KZ7 A;  2DX5 A;  1X86 A;  1FHW A;  4F7G A;  1FHO A;  3A8Q A;  3D8D A;  2DHI A;  2MWN B;  3F5R A;  2KCJ A;  1XR0 B;  5JHG A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...