2W2WA

Plcg2 split pleckstrin homology (ph) domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
108
structure length
108
Chain Sequence
b'KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDKVEELFEWFQSIREITWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE PHOSPHODIESTERASE GA
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 24
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2wA00
5C5BA 3ML4A 4CHMA 1ISNA 1MIZB 1RJ2A 3AJ4A 1U27A 4K17A 1TXDA 2I5FA 1W1DA 1DBHA 4WVFB 3VOQA 2UZRA 1V89A 3ODXA 1KZGA 2CAYA 2R0DA 4HB4B 3RCPA 2N0YA 3U7DA 1J0WA 3V5WA 3ZDTA 4EKUA 1I2HA 1MIXA 5LOPB 4D0NB 3LJUX 2M38A 3PZDA 3IVFA 1V5UA 3ODWA 5LONB 4HB3B 5JLJB 1KI1B 3PSCA 2MDXA 2D9VA 4GMXB 3D8EA 1J19A 3DXEA 2COFA 2I5CA 2KUPA 3QWMA 1TJ6A 3KSYA 1FHOA 2CY5A 1FHWA 3PVUA 1H10A 3A8QA 1OQNA 2W2XD 2DKPA 1NU2A 3WYFB 1K5GB 2Y8FA 3ZVRA 3KZ1A 1XD4A 2R09A 2I1KA 2YS1A 5DIFB 2EC1A 2CODA 5GOWB 4MK0A 2DA0A 1FGZA 1X1FA 2RSGA 1P3RA 2GCLA 3FEHA 2D2QA 2GS0A 4XWXA 2CRFA 4HAUB 1M7RA 3SUZA 1UPRA 2J0MA 4MT7A 2VSZA 1Q67A 2P0HA 5L81A 1EVHA 4F7GA 2OTXA 2RVBB 1XKEA 2MKRA 3T06A 4KAXB 4BBKA 1WJ1A 2PZ1A 2FJLA 2N23A 1LB1A 2HTHB 5D3VA 2RUKB 2D9YA 4YL8A 1U5FA 4PQ0A 5D3YA 3MPXA 2MFQA 4KHBB 4H8SA 1SHCA 2J0JA 2DHJA 1BAKA 3PVWA 3FM8C 1U5DA 1EAZA 3ULCA 2DKQA 3NSUA 1X86A 4ZRIA 5C16A 2YT0A 2LYDA 1FOEA 4Z2NA 4EJNA 3BINA 3TVVA 5J3QA 1ZVRA 4ZRJA 3KY9A 5HE1A 1DYNA 2D9XA 1KZ7A 4DXAB 2YVCA 2DLWA 3PEGA 1Z87A 2GCJA 2UVMA 4CYEA 3UZTA 2ZPYA 1V61A 3WA0A 4HDOA 2DHIA 3N7CA 1PMSA 1U2BA 2D11A 2QKMA 3P6AA 4B6HA 3GYOA 4HAZB 4KHOA 4IAPA 2YRYA 3AU4A 5D27A 3ULBA 1ZC3B 2COCA 1IRSA 5JP4A 1DDWA 5CLLB 5C79A 2BCJA 1X1GA 1H4RA 1B55A 3OANA 5CLQB 3G9WA 2LG1A 2V76A 2Z0QA 2LULA 1UEFA 2DX5A 2H7DA 2YT1A 4GMVA 1WI1A 3P7ZA 1DDMA 2HE7A 2RLOA 2D10A 5JHHA 2EJ8A 4TYZA 5DHFB 1P6SA 5EFXA 3ODOA 4K2PA 1NTYA 2K00A 4NY0A 2Q13A 3O96A 1MK7B 3VIAA 1UNPA 5C6RA 1Y5OA 3D8DA 3F0WA 4DX90 2KCJA 3SV1A 1XR0B 2ADZA 1WG7A 5DHAB 1ZSQA 2D4QA 3SYXA 2DTCA 2IYBA 2D9ZA 4IFSA 1V5PA 4WSFA 3DXDA 2P8VA 1FGYA 3TFMA 2EMSA 1N3HA 2L1CA 2JP2A 2L2IA 2K2JA 4K2OA 4DBBA 2IFSA 1TQZA 1XX0A 2DHKA 2YS5A 5J3YA 4F7HA 3TW1A 1RRPB 4HAXB 2DYNA 2ROZB 2K2UA 1XODA 1MK9B 2AEHA 4HB2B 4TKNA 1FB8A 4IOYX 1U5GA 1K5DB 4KVGB 4A6KA 5FI0A 4GN1A 3F5RA 1FHXA 2NZ8B 1GG3A 1BWNA 2KGXB 4A5KA 4HATB 1BTNA 1AQCA 4F7UP 2LOZA 1X11A 1SGHA 2J59M 3MDBC 4WJ7A 2VRWB 1MPHA 4HB0B 4A6HA 1WVHA 2CY4A 1V5MA 1U29A 1FAOA 3M1IB 4PNKA 4HAYB 2DFKA 1WGUA 1P5TA 1UPQA 2GJYA 3A8PA 1EGXA 2YF0A 3FSSA 1OY2A 4GZUA 1DROA 4K81A 1DDVA 2Y7BA 4ZRKA 5J3TA 2EMTA 1BTKA 1W1HA 2UZSA 1NI2A 2LKOA 3A98B 4GPTB 1GC6A 4NSWA 2ELAA 3SO6A 1EF1A 3SNHA 3GYPA 4MY6A 2COAA 4P7IA 3KRXA 4EMOA 3D8FA 5DI9B 4CHJA 3HQCA 1UNRA 2NMBA 2VKIA 3KRWA 4A6FB 5KQ1A 5KCVA 3TO1A 1WGQA 5C5BB 2OQBA 5KQ4A 2W2WA 5HE0A 2RGNB 3X23A 2RNRB 1I7AA 4HAWB 2Z0PA 4HHVA 2ROVA 1ZM0A 4C0AA 2AL6A 2W2XC 3PP2A 5HE3A 3PVLA 5DH9B 2M14A 3CIKA 2Y8GA 1NTVA 3CXBB 4DX8A 4L6EA 1X05A 3HK0A 2J0KA 1AWEA 2MWNB 2E2XA 2QKLA 2P0DA 3AU5A 2X18A 1LW3A 4Z2MB 1PFJA 2Z0OA 1V88A 3QIJA 1Y19B 2D9WA 5D3XA 5D3WA 2YSZA 2G35A 2XQNM 2YS3A 2DN6A 1QC6A 1WJMA 3U8ZA 4HDQA 5JHGA 4KHAA 1PLSA 4Y94A 1MKEA 1M7EA 2DX1A 1U5EA 4GXBA 4HAVB 3HW2B 3DXCA 4YONA 1GC7A 3PG7A 2ELBA 2H7EA 1UNQA 2DYQA 2I1JA 2P0FA 1E5WA 5FI1A 2LOXA 1W1GA 1ZC4B 5HE2A 3QBVB 1OMWA 3TCAA 4A6FA 1QQGA 1MAIA 3BJIA 1XCGA
chains in the Genus database with same CATH superfamily
5C5BA 3ML4A 4CHMA 1ISNA 1MIZB 1RJ2A 3AJ4A 1U27A 4K17A 1TXDA 2I5FA 1W1DA 5IRSA 1DBHA 4WVFB 3VOQA 2UZRA 1MI1A 1V89A 3ODXA 1KZGA 2CAYA 2R0DA 4HB4B 3RCPA 2N0YA 3U7DA 1J0WA 3V5WA 3ZDTA 4EKUA 1I2HA 1MIXA 5LOPB 4D0NB 3LJUX 2M38A 3PZDA 3IVFA 1V5UA 3ODWA 5LONB 4HB3B 5JLJB 1KI1B 3PSCA 2MDXA 4DIXA 2D9VA 4GMXB 3D8EA 1J19A 3DXEA 2COFA 2I5CA 2KUPA 3QWMA 1TJ6A 3KSYA 2R2YA 1FHOA 2CY5A 1FHWA 3PVUA 1H10A 3A8QA 1OQNA 2W2XD 2DKPA 1NU2A 3WYFB 3HSAA 3B77A 1K5GB 2Y8FA 3ZVRA 3KZ1A 2KR0A 2Z13A 1XD4A 2R09A 2I1KA 2YS1A 5DIFB 2EC1A 2CODA 5GOWB 4MK0A 2DA0A 1FGZA 1X1FA 2RSGA 1P3RA 2GCLA 3FEHA 2D2QA 2GS0A 4XWXA 5I2SA 1ZYIA 2CRFA 2NBVA 4HAUB 1M7RA 3SUZA 1UPRA 2J0MA 4MT7A 2VSZA 1Q67A 2P0HA 5L81A 4L1RA 1EVHA 4F7GA 2OTXA 2RVBB 1XKEA 2MKRA 3T06A 4KAXB 4BBKA 1WJ1A 2PZ1A 2FJLA 2N23A 1LB1A 2HTHB 2Z4DA 5D3VA 2RUKB 2D9YA 4YL8A 1U5FA 4PQ0A 5D3YA 3MPXA 2MFQA 4KHBB 4H8SA 1SHCA 2J0JA 2DHJA 1BAKA 3PVWA 3FM8C 1U5DA 1EAZA 3ULCA 2DKQA 3NSUA 1X86A 4ZRIA 5C16A 2YT0A 2LYDA 1FOEA 4Z2NA 4EJNA 3BINA 4HSIA 3TVVA 5J3QA 1ZVRA 4ZRJA 3KY9A 5HE1A 1DYNA 2D9XA 1KZ7A 4DXAB 2YVCA 2DLWA 3PEGA 1Z87A 2GCJA 2UVMA 4CYEA 4QJ5B 3UZTA 2ZPYA 1V61A 3WA0A 4HDOA 2DHIA 3N7CA 1PMSA 4QJ3B 1U2BA 2D11A 2K49A 2QKMA 3P6AA 4B6HA 3GYOA 4HAZB 4KHOA 4IAPA 2YRYA 3AU4A 5D27A 3ULBA 1ZC3B 2COCA 1IRSA 5JP4A 1DDWA 5CLLB 5C79A 5M4YB 2BCJA 3OHMB 1X1GA 1H4RA 1B55A 3OANA 5CLQB 3DCXA 4D6WA 3G9WA 2LG1A 5LG4B 2V76A 2Z0QA 2LULA 1UEFA 2DX5A 2H7DA 2YT1A 4GMVA 1WI1A 3P7ZA 2KIGA 1DDMA 2HE7A 2RLOA 2D10A 5JHHA 2EJ8A 4TYZA 5DHFB 1P6SA 5EFXA 3ODOA 4K2PA 1NTYA 2K00A 4NY0A 2Q13A 3O96A 1MK7B 2Z59A 3VIAA 1UNPA 5C6RA 1Y5OA 3D8DA 3F0WA 4KHBA 2KIEA 4GNKB 4DX90 2KCJA 3SV1A 1XR0B 2ADZA 1WG7A 5DHAB 1ZSQA 2D4QA 3SYXA 2DTCA 2IYBA 2D9ZA 4IFSA 3U12A 1V5PA 4WSFA 3DXDA 2P8VA 1FGYA 3TFMA 2EMSA 1N3HA 2GUMA 2L1CA 3NWFA 4GOUA 2JP2A 2L2IA 2K2JA 2RRFA 4K2OA 4DBBA 2IFSA 1TQZA 1XX0A 2DHKA 2YS5A 5J3YA 4F7HA 3TW1A 1RRPB 4HAXB 2DYNA 2ROZB 2K2UA 1XODA 1MK9B 2AEHA 4HB2B 4TKNA 1FB8A 4IOYX 1U5GA 1K5DB 4KVGB 4OT1A 4A6KA 5FI0A 2ZKMX 4GN1A 3F5RA 1FHXA 2NZ8B 1GG3A 1BWNA 4OSNA 2KGXB 4A5KA 2YT2A 4HATB 1BTNA 1AQCA 4F7UP 2LOZA 1X11A 1SGHA 2J59M 3MDBC 4WJ7A 2VRWB 1MPHA 4HB0B 4A6HA 3NW8A 1WVHA 2CY4A 2KUQA 1V5MA 1U29A 1FAOA 3M1IB 3FVCA 4PNKA 4HAYB 2DFKA 1WGUA 1P5TA 1UPQA 2GJYA 3A8PA 1EGXA 2YF0A 3FSSA 2K8EA 1OY2A 4GZUA 1DROA 4K81A 1DDVA 2Y7BA 4ZRKA 5J3TA 2EMTA 1BTKA 4QXAB 1W1HA 2UZSA 3NWAA 1NI2A 2LKOA 3A98B 4GPTB 1GC6A 4NSWA 2ELAA 3SO6A 1EF1A 3SNHA 3GYPA 4MY6A 2COAA 4P7IA 3KRXA 4EMOA 3D8FA 5DI9B 4CHJA 3HQCA 1UNRA 2NMBA 2VKIA 3KRWA 4A6FB 5KQ1A 3A58A 5KCVA 3TO1A 1WGQA 5C5BB 2OQBA 5KQ4A 2W2WA 5HE0A 2RGNB 3X23A 2RNRB 1I7AA 4HAWB 2Z0PA 4HHVA 2ROVA 1ZM0A 4C0AA 2AL6A 2W2XC 2Z14A 3HIEA 3PP2A 5HE3A 3NWDA 3PVLA 5DH9B 2M14A 3CIKA 2Y8GA 1NTVA 3CXBB 4DX8A 4L6EA 1X05A 3HK0A 2J0KA 1AWEA 2MWNB 2E2XA 2QKLA 2P0DA 3AU5A 2X18A 1T77A 1LW3A 4Z2MB 1PFJA 2Z0OA 1V88A 3QIJA 1Y19B 2D9WA 5D3XA 5D3WA 5I2MA 2YSZA 2G35A 2XQNM 2YS3A 2DN6A 1QC6A 1WJMA 3U8ZA 4QJ4B 4HDQA 5JHGA 4KHAA 4CSQA 1PLSA 4Y94A 1MKEA 1M7EA 2DX1A 1U5EA 4GXBA 4HAVB 3HW2B 3DXCA 4YONA 1GC7A 3PG7A 2ELBA 2H7EA 1UNQA 2DYQA 2I1JA 2P0FA 1E5WA 5FI1A 2LOXA 1W1GA 1ZC4B 5HE2A 3QBVB 1OMWA 3TCAA 4A6FA 1QQGA 1MAIA 3BJIA 1XCGA 2FJUB
chains in the Genus database with same CATH topology
5C5BA 3ML4A 4CHMA 1ISNA 1MIZB 1RJ2A 3AJ4A 1U27A 4K17A 1TXDA 2I5FA 1W1DA 1DBHA 4WVFB 3VOQA 2UZRA 1V89A 3ODXA 1KZGA 2CAYA 2R0DA 4HB4B 3RCPA 2N0YA 3U7DA 1J0WA 3V5WA 3ZDTA 4EKUA 1I2HA 1MIXA 5LOPB 4D0NB 3LJUX 2M38A 3PZDA 3IVFA 1V5UA 3ODWA 5LONB 4HB3B 5JLJB 1KI1B 3PSCA 2MDXA 2D9VA 4GMXB 3D8EA 1J19A 3DXEA 2COFA 2I5CA 2KUPA 3QWMA 1TJ6A 3KSYA 1FHOA 2CY5A 1FHWA 3PVUA 1H10A 3A8QA 1OQNA 2W2XD 2DKPA 1NU2A 3WYFB 1K5GB 2Y8FA 3ZVRA 3KZ1A 1XD4A 2R09A 2I1KA 2YS1A 5DIFB 2EC1A 2CODA 5GOWB 4MK0A 2DA0A 1FGZA 1X1FA 2RSGA 1P3RA 2GCLA 3FEHA 2D2QA 2GS0A 4XWXA 2CRFA 4HAUB 1M7RA 3SUZA 1UPRA 2J0MA 4MT7A 2VSZA 1Q67A 2P0HA 5L81A 1EVHA 4F7GA 2OTXA 2RVBB 1XKEA 2MKRA 3T06A 4KAXB 4BBKA 1WJ1A 2PZ1A 2FJLA 2N23A 1LB1A 2HTHB 5D3VA 2RUKB 2D9YA 4YL8A 1U5FA 4PQ0A 5D3YA 3MPXA 2MFQA 4KHBB 4H8SA 1SHCA 2J0JA 2DHJA 1BAKA 3PVWA 3FM8C 1U5DA 1EAZA 3ULCA 2DKQA 3NSUA 1X86A 4ZRIA 5C16A 2YT0A 2LYDA 1FOEA 4Z2NA 4EJNA 3BINA 3TVVA 5J3QA 1ZVRA 4ZRJA 3KY9A 5HE1A 1DYNA 2D9XA 1KZ7A 4DXAB 2YVCA 2DLWA 3PEGA 1Z87A 2GCJA 2UVMA 4CYEA 3UZTA 2ZPYA 1V61A 3WA0A 4HDOA 2DHIA 3N7CA 1PMSA 1U2BA 2D11A 2QKMA 3P6AA 4B6HA 3GYOA 4HAZB 4KHOA 4IAPA 2YRYA 3AU4A 5D27A 3ULBA 1ZC3B 2COCA 1IRSA 5JP4A 1DDWA 5CLLB 5C79A 2BCJA 1X1GA 1H4RA 1B55A 3OANA 5CLQB 3G9WA 2LG1A 2V76A 2Z0QA 2LULA 1UEFA 2DX5A 2H7DA 2YT1A 4GMVA 1WI1A 3P7ZA 1DDMA 2HE7A 2RLOA 2D10A 5JHHA 2EJ8A 4TYZA 5DHFB 1P6SA 5EFXA 3ODOA 4K2PA 1NTYA 2K00A 4NY0A 2Q13A 3O96A 1MK7B 3VIAA 1UNPA 5C6RA 1Y5OA 3D8DA 3F0WA 4DX90 2KCJA 3SV1A 1XR0B 2ADZA 1WG7A 5DHAB 1ZSQA 2D4QA 3SYXA 2DTCA 2IYBA 2D9ZA 4IFSA 1V5PA 4WSFA 3DXDA 2P8VA 1FGYA 3TFMA 2EMSA 1N3HA 2L1CA 2JP2A 2L2IA 2K2JA 4K2OA 4DBBA 2IFSA 1TQZA 1XX0A 2DHKA 2YS5A 5J3YA 4F7HA 3TW1A 1RRPB 4HAXB 2DYNA 2ROZB 2K2UA 1XODA 1MK9B 2AEHA 4HB2B 4TKNA 1FB8A 4IOYX 1U5GA 1K5DB 4KVGB 4A6KA 5FI0A 4GN1A 3F5RA 1FHXA 2NZ8B 1GG3A 1BWNA 2KGXB 4A5KA 4HATB 1BTNA 1AQCA 4F7UP 2LOZA 1X11A 1SGHA 2J59M 3MDBC 4WJ7A 2VRWB 1MPHA 4HB0B 4A6HA 1WVHA 2CY4A 1V5MA 1U29A 1FAOA 3M1IB 4PNKA 4HAYB 2DFKA 1WGUA 1P5TA 1UPQA 2GJYA 3A8PA 1EGXA 2YF0A 3FSSA 1OY2A 4GZUA 1DROA 4K81A 1DDVA 2Y7BA 4ZRKA 5J3TA 2EMTA 1BTKA 1W1HA 2UZSA 1NI2A 2LKOA 3A98B 4GPTB 1GC6A 4NSWA 2ELAA 3SO6A 1EF1A 3SNHA 3GYPA 4MY6A 2COAA 4P7IA 3KRXA 4EMOA 3D8FA 5DI9B 4CHJA 3HQCA 1UNRA 2NMBA 2VKIA 3KRWA 4A6FB 5KQ1A 5KCVA 3TO1A 1WGQA 5C5BB 2OQBA 5KQ4A 2W2WA 5HE0A 2RGNB 3X23A 2RNRB 1I7AA 4HAWB 2Z0PA 4HHVA 2ROVA 1ZM0A 4C0AA 2AL6A 2W2XC 3PP2A 5HE3A 3PVLA 5DH9B 2M14A 3CIKA 2Y8GA 1NTVA 3CXBB 4DX8A 4L6EA 1X05A 3HK0A 2J0KA 1AWEA 2MWNB 2E2XA 2QKLA 2P0DA 3AU5A 2X18A 1LW3A 4Z2MB 1PFJA 2Z0OA 1V88A 3QIJA 1Y19B 2D9WA 5D3XA 5D3WA 2YSZA 2G35A 2XQNM 2YS3A 2DN6A 1QC6A 1WJMA 3U8ZA 4HDQA 5JHGA 4KHAA 1PLSA 4Y94A 1MKEA 1M7EA 2DX1A 1U5EA 4GXBA 4HAVB 3HW2B 3DXCA 4YONA 1GC7A 3PG7A 2ELBA 2H7EA 1UNQA 2DYQA 2I1JA 2P0FA 1E5WA 5FI1A 2LOXA 1W1GA 1ZC4B 5HE2A 3QBVB 1OMWA 3TCAA 4A6FA 1QQGA 1MAIA 3BJIA 1XCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5B A;  3ML4 A;  4CHM A;  1ISN A;  1MIZ B;  1RJ2 A;  3AJ4 A;  1U27 A;  4K17 A;  1TXD A;  2I5F A;  1W1D A;  1DBH A;  4WVF B;  3VOQ A;  2UZR A;  1V89 A;  3ODX A;  1KZG A;  2CAY A;  2R0D A;  4HB4 B;  3RCP A;  2N0Y A;  3U7D A;  1J0W A;  3V5W A;  3ZDT A;  4EKU A;  1I2H A;  1MIX A;  5LOP B;  4D0N B;  3LJU X;  2M38 A;  3PZD A;  3IVF A;  1V5U A;  3ODW A;  5LON B;  4HB3 B;  5JLJ B;  1KI1 B;  3PSC A;  2MDX A;  2D9V A;  4GMX B;  3D8E A;  1J19 A;  3DXE A;  2COF A;  2I5C A;  2KUP A;  3QWM A;  1TJ6 A;  3KSY A;  1FHO A;  2CY5 A;  1FHW A;  3PVU A;  1H10 A;  3A8Q A;  1OQN A;  2W2X D;  2DKP A;  1NU2 A;  3WYF B;  1K5G B;  2Y8F A;  3ZVR A;  3KZ1 A;  1XD4 A;  2R09 A;  2I1K A;  2YS1 A;  5DIF B;  2EC1 A;  2COD A;  5GOW B;  4MK0 A;  2DA0 A;  1FGZ A;  1X1F A;  2RSG A;  1P3R A;  2GCL A;  3FEH A;  2D2Q A;  2GS0 A;  4XWX A;  2CRF A;  4HAU B;  1M7R A;  3SUZ A;  1UPR A;  2J0M A;  4MT7 A;  2VSZ A;  1Q67 A;  2P0H A;  5L81 A;  1EVH A;  4F7G A;  2OTX A;  2RVB B;  1XKE A;  2MKR A;  3T06 A;  4KAX B;  4BBK A;  1WJ1 A;  2PZ1 A;  2FJL A;  2N23 A;  1LB1 A;  2HTH B;  5D3V A;  2RUK B;  2D9Y A;  4YL8 A;  1U5F A;  4PQ0 A;  5D3Y A;  3MPX A;  2MFQ A;  4KHB B;  4H8S A;  1SHC A;  2J0J A;  2DHJ A;  1BAK A;  3PVW A;  3FM8 C;  1U5D A;  1EAZ A;  3ULC A;  2DKQ A;  3NSU A;  1X86 A;  4ZRI A;  5C16 A;  2YT0 A;  2LYD A;  1FOE A;  4Z2N A;  4EJN A;  3BIN A;  3TVV A;  5J3Q A;  1ZVR A;  4ZRJ A;  3KY9 A;  5HE1 A;  1DYN A;  2D9X A;  1KZ7 A;  4DXA B;  2YVC A;  2DLW A;  3PEG A;  1Z87 A;  2GCJ A;  2UVM A;  4CYE A;  3UZT A;  2ZPY A;  1V61 A;  3WA0 A;  4HDO A;  2DHI A;  3N7C A;  1PMS A;  1U2B A;  2D11 A;  2QKM A;  3P6A A;  4B6H A;  3GYO A;  4HAZ B;  4KHO A;  4IAP A;  2YRY A;  3AU4 A;  5D27 A;  3ULB A;  1ZC3 B;  2COC A;  1IRS A;  5JP4 A;  1DDW A;  5CLL B;  5C79 A;  2BCJ A;  1X1G A;  1H4R A;  1B55 A;  3OAN A;  5CLQ B;  3G9W A;  2LG1 A;  2V76 A;  2Z0Q A;  2LUL A;  1UEF A;  2DX5 A;  2H7D A;  2YT1 A;  4GMV A;  1WI1 A;  3P7Z A;  1DDM A;  2HE7 A;  2RLO A;  2D10 A;  5JHH A;  2EJ8 A;  4TYZ A;  5DHF B;  1P6S A;  5EFX A;  3ODO A;  4K2P A;  1NTY A;  2K00 A;  4NY0 A;  2Q13 A;  3O96 A;  1MK7 B;  3VIA A;  1UNP A;  5C6R A;  1Y5O A;  3D8D A;  3F0W A;  4DX9 0;  2KCJ A;  3SV1 A;  1XR0 B;  2ADZ A;  1WG7 A;  5DHA B;  1ZSQ A;  2D4Q A;  3SYX A;  2DTC A;  2IYB A;  2D9Z A;  4IFS A;  1V5P A;  4WSF A;  3DXD A;  2P8V A;  1FGY A;  3TFM A;  2EMS A;  1N3H A;  2L1C A;  2JP2 A;  2L2I A;  2K2J A;  4K2O A;  4DBB A;  2IFS A;  1TQZ A;  1XX0 A;  2DHK A;  2YS5 A;  5J3Y A;  4F7H A;  3TW1 A;  1RRP B;  4HAX B;  2DYN A;  2ROZ B;  2K2U A;  1XOD A;  1MK9 B;  2AEH A;  4HB2 B;  4TKN A;  1FB8 A;  4IOY X;  1U5G A;  1K5D B;  4KVG B;  4A6K A;  5FI0 A;  4GN1 A;  3F5R A;  1FHX A;  2NZ8 B;  1GG3 A;  1BWN A;  2KGX B;  4A5K A;  4HAT B;  1BTN A;  1AQC A;  4F7U P;  2LOZ A;  1X11 A;  1SGH A;  2J59 M;  3MDB C;  4WJ7 A;  2VRW B;  1MPH A;  4HB0 B;  4A6H A;  1WVH A;  2CY4 A;  1V5M A;  1U29 A;  1FAO A;  3M1I B;  4PNK A;  4HAY B;  2DFK A;  1WGU A;  1P5T A;  1UPQ A;  2GJY A;  3A8P A;  1EGX A;  2YF0 A;  3FSS A;  1OY2 A;  4GZU A;  1DRO A;  4K81 A;  1DDV A;  2Y7B A;  4ZRK A;  5J3T A;  2EMT A;  1BTK A;  1W1H A;  2UZS A;  1NI2 A;  2LKO A;  3A98 B;  4GPT B;  1GC6 A;  4NSW A;  2ELA A;  3SO6 A;  1EF1 A;  3SNH A;  3GYP A;  4MY6 A;  2COA A;  4P7I A;  3KRX A;  4EMO A;  3D8F A;  5DI9 B;  4CHJ A;  3HQC A;  1UNR A;  2NMB A;  2VKI A;  3KRW A;  4A6F B;  5KQ1 A;  5KCV A;  3TO1 A;  1WGQ A;  5C5B B;  2OQB A;  5KQ4 A;  2W2W A;  5HE0 A;  2RGN B;  3X23 A;  2RNR B;  1I7A A;  4HAW B;  2Z0P A;  4HHV A;  2ROV A;  1ZM0 A;  4C0A A;  2AL6 A;  2W2X C;  3PP2 A;  5HE3 A;  3PVL A;  5DH9 B;  2M14 A;  3CIK A;  2Y8G A;  1NTV A;  3CXB B;  4DX8 A;  4L6E A;  1X05 A;  3HK0 A;  2J0K A;  1AWE A;  2MWN B;  2E2X A;  2QKL A;  2P0D A;  3AU5 A;  2X18 A;  1LW3 A;  4Z2M B;  1PFJ A;  2Z0O A;  1V88 A;  3QIJ A;  1Y19 B;  2D9W A;  5D3X A;  5D3W A;  2YSZ A;  2G35 A;  2XQN M;  2YS3 A;  2DN6 A;  1QC6 A;  1WJM A;  3U8Z A;  4HDQ A;  5JHG A;  4KHA A;  1PLS A;  4Y94 A;  1MKE A;  1M7E A;  2DX1 A;  1U5E A;  4GXB A;  4HAV B;  3HW2 B;  3DXC A;  4YON A;  1GC7 A;  3PG7 A;  2ELB A;  2H7E A;  1UNQ A;  2DYQ A;  2I1J A;  2P0F A;  1E5W A;  5FI1 A;  2LOX A;  1W1G A;  1ZC4 B;  5HE2 A;  3QBV B;  1OMW A;  3TCA A;  4A6F A;  1QQG A;  1MAI A;  3BJI A;  1XCG A; 
#chains in the Genus database with same CATH topology
 5C5B A;  3ML4 A;  4CHM A;  1ISN A;  1MIZ B;  1RJ2 A;  3AJ4 A;  1U27 A;  4K17 A;  1TXD A;  2I5F A;  1W1D A;  5IRS A;  1DBH A;  4WVF B;  3VOQ A;  2UZR A;  1MI1 A;  1V89 A;  3ODX A;  1KZG A;  2CAY A;  2R0D A;  4HB4 B;  3RCP A;  2N0Y A;  3U7D A;  1J0W A;  3V5W A;  3ZDT A;  4EKU A;  1I2H A;  1MIX A;  5LOP B;  4D0N B;  3LJU X;  2M38 A;  3PZD A;  3IVF A;  1V5U A;  3ODW A;  5LON B;  4HB3 B;  5JLJ B;  1KI1 B;  3PSC A;  2MDX A;  4DIX A;  2D9V A;  4GMX B;  3D8E A;  1J19 A;  3DXE A;  2COF A;  2I5C A;  2KUP A;  3QWM A;  1TJ6 A;  3KSY A;  2R2Y A;  1FHO A;  2CY5 A;  1FHW A;  3PVU A;  1H10 A;  3A8Q A;  1OQN A;  2W2X D;  2DKP A;  1NU2 A;  3WYF B;  3HSA A;  3B77 A;  1K5G B;  2Y8F A;  3ZVR A;  3KZ1 A;  2KR0 A;  2Z13 A;  1XD4 A;  2R09 A;  2I1K A;  2YS1 A;  5DIF B;  2EC1 A;  2COD A;  5GOW B;  4MK0 A;  2DA0 A;  1FGZ A;  1X1F A;  2RSG A;  1P3R A;  2GCL A;  3FEH A;  2D2Q A;  2GS0 A;  4XWX A;  5I2S A;  1ZYI A;  2CRF A;  2NBV A;  4HAU B;  1M7R A;  3SUZ A;  1UPR A;  2J0M A;  4MT7 A;  2VSZ A;  1Q67 A;  2P0H A;  5L81 A;  4L1R A;  1EVH A;  4F7G A;  2OTX A;  2RVB B;  1XKE A;  2MKR A;  3T06 A;  4KAX B;  4BBK A;  1WJ1 A;  2PZ1 A;  2FJL A;  2N23 A;  1LB1 A;  2HTH B;  2Z4D A;  5D3V A;  2RUK B;  2D9Y A;  4YL8 A;  1U5F A;  4PQ0 A;  5D3Y A;  3MPX A;  2MFQ A;  4KHB B;  4H8S A;  1SHC A;  2J0J A;  2DHJ A;  1BAK A;  3PVW A;  3FM8 C;  1U5D A;  1EAZ A;  3ULC A;  2DKQ A;  3NSU A;  1X86 A;  4ZRI A;  5C16 A;  2YT0 A;  2LYD A;  1FOE A;  4Z2N A;  4EJN A;  3BIN A;  4HSI A;  3TVV A;  5J3Q A;  1ZVR A;  4ZRJ A;  3KY9 A;  5HE1 A;  1DYN A;  2D9X A;  1KZ7 A;  4DXA B;  2YVC A;  2DLW A;  3PEG A;  1Z87 A;  2GCJ A;  2UVM A;  4CYE A;  4QJ5 B;  3UZT A;  2ZPY A;  1V61 A;  3WA0 A;  4HDO A;  2DHI A;  3N7C A;  1PMS A;  4QJ3 B;  1U2B A;  2D11 A;  2K49 A;  2QKM A;  3P6A A;  4B6H A;  3GYO A;  4HAZ B;  4KHO A;  4IAP A;  2YRY A;  3AU4 A;  5D27 A;  3ULB A;  1ZC3 B;  2COC A;  1IRS A;  5JP4 A;  1DDW A;  5CLL B;  5C79 A;  5M4Y B;  2BCJ A;  3OHM B;  1X1G A;  1H4R A;  1B55 A;  3OAN A;  5CLQ B;  3DCX A;  4D6W A;  3G9W A;  2LG1 A;  5LG4 B;  2V76 A;  2Z0Q A;  2LUL A;  1UEF A;  2DX5 A;  2H7D A;  2YT1 A;  4GMV A;  1WI1 A;  3P7Z A;  2KIG A;  1DDM A;  2HE7 A;  2RLO A;  2D10 A;  5JHH A;  2EJ8 A;  4TYZ A;  5DHF B;  1P6S A;  5EFX A;  3ODO A;  4K2P A;  1NTY A;  2K00 A;  4NY0 A;  2Q13 A;  3O96 A;  1MK7 B;  2Z59 A;  3VIA A;  1UNP A;  5C6R A;  1Y5O A;  3D8D A;  3F0W A;  4KHB A;  2KIE A;  4GNK B;  4DX9 0;  2KCJ A;  3SV1 A;  1XR0 B;  2ADZ A;  1WG7 A;  5DHA B;  1ZSQ A;  2D4Q A;  3SYX A;  2DTC A;  2IYB A;  2D9Z A;  4IFS A;  3U12 A;  1V5P A;  4WSF A;  3DXD A;  2P8V A;  1FGY A;  3TFM A;  2EMS A;  1N3H A;  2GUM A;  2L1C A;  3NWF A;  4GOU A;  2JP2 A;  2L2I A;  2K2J A;  2RRF A;  4K2O A;  4DBB A;  2IFS A;  1TQZ A;  1XX0 A;  2DHK A;  2YS5 A;  5J3Y A;  4F7H A;  3TW1 A;  1RRP B;  4HAX B;  2DYN A;  2ROZ B;  2K2U A;  1XOD A;  1MK9 B;  2AEH A;  4HB2 B;  4TKN A;  1FB8 A;  4IOY X;  1U5G A;  1K5D B;  4KVG B;  4OT1 A;  4A6K A;  5FI0 A;  2ZKM X;  4GN1 A;  3F5R A;  1FHX A;  2NZ8 B;  1GG3 A;  1BWN A;  4OSN A;  2KGX B;  4A5K A;  2YT2 A;  4HAT B;  1BTN A;  1AQC A;  4F7U P;  2LOZ A;  1X11 A;  1SGH A;  2J59 M;  3MDB C;  4WJ7 A;  2VRW B;  1MPH A;  4HB0 B;  4A6H A;  3NW8 A;  1WVH A;  2CY4 A;  2KUQ A;  1V5M A;  1U29 A;  1FAO A;  3M1I B;  3FVC A;  4PNK A;  4HAY B;  2DFK A;  1WGU A;  1P5T A;  1UPQ A;  2GJY A;  3A8P A;  1EGX A;  2YF0 A;  3FSS A;  2K8E A;  1OY2 A;  4GZU A;  1DRO A;  4K81 A;  1DDV A;  2Y7B A;  4ZRK A;  5J3T A;  2EMT A;  1BTK A;  4QXA B;  1W1H A;  2UZS A;  3NWA A;  1NI2 A;  2LKO A;  3A98 B;  4GPT B;  1GC6 A;  4NSW A;  2ELA A;  3SO6 A;  1EF1 A;  3SNH A;  3GYP A;  4MY6 A;  2COA A;  4P7I A;  3KRX A;  4EMO A;  3D8F A;  5DI9 B;  4CHJ A;  3HQC A;  1UNR A;  2NMB A;  2VKI A;  3KRW A;  4A6F B;  5KQ1 A;  3A58 A;  5KCV A;  3TO1 A;  1WGQ A;  5C5B B;  2OQB A;  5KQ4 A;  2W2W A;  5HE0 A;  2RGN B;  3X23 A;  2RNR B;  1I7A A;  4HAW B;  2Z0P A;  4HHV A;  2ROV A;  1ZM0 A;  4C0A A;  2AL6 A;  2W2X C;  2Z14 A;  3HIE A;  3PP2 A;  5HE3 A;  3NWD A;  3PVL A;  5DH9 B;  2M14 A;  3CIK A;  2Y8G A;  1NTV A;  3CXB B;  4DX8 A;  4L6E A;  1X05 A;  3HK0 A;  2J0K A;  1AWE A;  2MWN B;  2E2X A;  2QKL A;  2P0D A;  3AU5 A;  2X18 A;  1T77 A;  1LW3 A;  4Z2M B;  1PFJ A;  2Z0O A;  1V88 A;  3QIJ A;  1Y19 B;  2D9W A;  5D3X A;  5D3W A;  5I2M A;  2YSZ A;  2G35 A;  2XQN M;  2YS3 A;  2DN6 A;  1QC6 A;  1WJM A;  3U8Z A;  4QJ4 B;  4HDQ A;  5JHG A;  4KHA A;  4CSQ A;  1PLS A;  4Y94 A;  1MKE A;  1M7E A;  2DX1 A;  1U5E A;  4GXB A;  4HAV B;  3HW2 B;  3DXC A;  4YON A;  1GC7 A;  3PG7 A;  2ELB A;  2H7E A;  1UNQ A;  2DYQ A;  2I1J A;  2P0F A;  1E5W A;  5FI1 A;  2LOX A;  1W1G A;  1ZC4 B;  5HE2 A;  3QBV B;  1OMW A;  3TCA A;  4A6F A;  1QQG A;  1MAI A;  3BJI A;  1XCG A;  2FJU B; 
#chains in the Genus database with same CATH homology
 5C5B A;  3ML4 A;  4CHM A;  1ISN A;  1MIZ B;  1RJ2 A;  3AJ4 A;  1U27 A;  4K17 A;  1TXD A;  2I5F A;  1W1D A;  1DBH A;  4WVF B;  3VOQ A;  2UZR A;  1V89 A;  3ODX A;  1KZG A;  2CAY A;  2R0D A;  4HB4 B;  3RCP A;  2N0Y A;  3U7D A;  1J0W A;  3V5W A;  3ZDT A;  4EKU A;  1I2H A;  1MIX A;  5LOP B;  4D0N B;  3LJU X;  2M38 A;  3PZD A;  3IVF A;  1V5U A;  3ODW A;  5LON B;  4HB3 B;  5JLJ B;  1KI1 B;  3PSC A;  2MDX A;  2D9V A;  4GMX B;  3D8E A;  1J19 A;  3DXE A;  2COF A;  2I5C A;  2KUP A;  3QWM A;  1TJ6 A;  3KSY A;  1FHO A;  2CY5 A;  1FHW A;  3PVU A;  1H10 A;  3A8Q A;  1OQN A;  2W2X D;  2DKP A;  1NU2 A;  3WYF B;  1K5G B;  2Y8F A;  3ZVR A;  3KZ1 A;  1XD4 A;  2R09 A;  2I1K A;  2YS1 A;  5DIF B;  2EC1 A;  2COD A;  5GOW B;  4MK0 A;  2DA0 A;  1FGZ A;  1X1F A;  2RSG A;  1P3R A;  2GCL A;  3FEH A;  2D2Q A;  2GS0 A;  4XWX A;  2CRF A;  4HAU B;  1M7R A;  3SUZ A;  1UPR A;  2J0M A;  4MT7 A;  2VSZ A;  1Q67 A;  2P0H A;  5L81 A;  1EVH A;  4F7G A;  2OTX A;  2RVB B;  1XKE A;  2MKR A;  3T06 A;  4KAX B;  4BBK A;  1WJ1 A;  2PZ1 A;  2FJL A;  2N23 A;  1LB1 A;  2HTH B;  5D3V A;  2RUK B;  2D9Y A;  4YL8 A;  1U5F A;  4PQ0 A;  5D3Y A;  3MPX A;  2MFQ A;  4KHB B;  4H8S A;  1SHC A;  2J0J A;  2DHJ A;  1BAK A;  3PVW A;  3FM8 C;  1U5D A;  1EAZ A;  3ULC A;  2DKQ A;  3NSU A;  1X86 A;  4ZRI A;  5C16 A;  2YT0 A;  2LYD A;  1FOE A;  4Z2N A;  4EJN A;  3BIN A;  3TVV A;  5J3Q A;  1ZVR A;  4ZRJ A;  3KY9 A;  5HE1 A;  1DYN A;  2D9X A;  1KZ7 A;  4DXA B;  2YVC A;  2DLW A;  3PEG A;  1Z87 A;  2GCJ A;  2UVM A;  4CYE A;  3UZT A;  2ZPY A;  1V61 A;  3WA0 A;  4HDO A;  2DHI A;  3N7C A;  1PMS A;  1U2B A;  2D11 A;  2QKM A;  3P6A A;  4B6H A;  3GYO A;  4HAZ B;  4KHO A;  4IAP A;  2YRY A;  3AU4 A;  5D27 A;  3ULB A;  1ZC3 B;  2COC A;  1IRS A;  5JP4 A;  1DDW A;  5CLL B;  5C79 A;  2BCJ A;  1X1G A;  1H4R A;  1B55 A;  3OAN A;  5CLQ B;  3G9W A;  2LG1 A;  2V76 A;  2Z0Q A;  2LUL A;  1UEF A;  2DX5 A;  2H7D A;  2YT1 A;  4GMV A;  1WI1 A;  3P7Z A;  1DDM A;  2HE7 A;  2RLO A;  2D10 A;  5JHH A;  2EJ8 A;  4TYZ A;  5DHF B;  1P6S A;  5EFX A;  3ODO A;  4K2P A;  1NTY A;  2K00 A;  4NY0 A;  2Q13 A;  3O96 A;  1MK7 B;  3VIA A;  1UNP A;  5C6R A;  1Y5O A;  3D8D A;  3F0W A;  4DX9 0;  2KCJ A;  3SV1 A;  1XR0 B;  2ADZ A;  1WG7 A;  5DHA B;  1ZSQ A;  2D4Q A;  3SYX A;  2DTC A;  2IYB A;  2D9Z A;  4IFS A;  1V5P A;  4WSF A;  3DXD A;  2P8V A;  1FGY A;  3TFM A;  2EMS A;  1N3H A;  2L1C A;  2JP2 A;  2L2I A;  2K2J A;  4K2O A;  4DBB A;  2IFS A;  1TQZ A;  1XX0 A;  2DHK A;  2YS5 A;  5J3Y A;  4F7H A;  3TW1 A;  1RRP B;  4HAX B;  2DYN A;  2ROZ B;  2K2U A;  1XOD A;  1MK9 B;  2AEH A;  4HB2 B;  4TKN A;  1FB8 A;  4IOY X;  1U5G A;  1K5D B;  4KVG B;  4A6K A;  5FI0 A;  4GN1 A;  3F5R A;  1FHX A;  2NZ8 B;  1GG3 A;  1BWN A;  2KGX B;  4A5K A;  4HAT B;  1BTN A;  1AQC A;  4F7U P;  2LOZ A;  1X11 A;  1SGH A;  2J59 M;  3MDB C;  4WJ7 A;  2VRW B;  1MPH A;  4HB0 B;  4A6H A;  1WVH A;  2CY4 A;  1V5M A;  1U29 A;  1FAO A;  3M1I B;  4PNK A;  4HAY B;  2DFK A;  1WGU A;  1P5T A;  1UPQ A;  2GJY A;  3A8P A;  1EGX A;  2YF0 A;  3FSS A;  1OY2 A;  4GZU A;  1DRO A;  4K81 A;  1DDV A;  2Y7B A;  4ZRK A;  5J3T A;  2EMT A;  1BTK A;  1W1H A;  2UZS A;  1NI2 A;  2LKO A;  3A98 B;  4GPT B;  1GC6 A;  4NSW A;  2ELA A;  3SO6 A;  1EF1 A;  3SNH A;  3GYP A;  4MY6 A;  2COA A;  4P7I A;  3KRX A;  4EMO A;  3D8F A;  5DI9 B;  4CHJ A;  3HQC A;  1UNR A;  2NMB A;  2VKI A;  3KRW A;  4A6F B;  5KQ1 A;  5KCV A;  3TO1 A;  1WGQ A;  5C5B B;  2OQB A;  5KQ4 A;  2W2W A;  5HE0 A;  2RGN B;  3X23 A;  2RNR B;  1I7A A;  4HAW B;  2Z0P A;  4HHV A;  2ROV A;  1ZM0 A;  4C0A A;  2AL6 A;  2W2X C;  3PP2 A;  5HE3 A;  3PVL A;  5DH9 B;  2M14 A;  3CIK A;  2Y8G A;  1NTV A;  3CXB B;  4DX8 A;  4L6E A;  1X05 A;  3HK0 A;  2J0K A;  1AWE A;  2MWN B;  2E2X A;  2QKL A;  2P0D A;  3AU5 A;  2X18 A;  1LW3 A;  4Z2M B;  1PFJ A;  2Z0O A;  1V88 A;  3QIJ A;  1Y19 B;  2D9W A;  5D3X A;  5D3W A;  2YSZ A;  2G35 A;  2XQN M;  2YS3 A;  2DN6 A;  1QC6 A;  1WJM A;  3U8Z A;  4HDQ A;  5JHG A;  4KHA A;  1PLS A;  4Y94 A;  1MKE A;  1M7E A;  2DX1 A;  1U5E A;  4GXB A;  4HAV B;  3HW2 B;  3DXC A;  4YON A;  1GC7 A;  3PG7 A;  2ELB A;  2H7E A;  1UNQ A;  2DYQ A;  2I1J A;  2P0F A;  1E5W A;  5FI1 A;  2LOX A;  1W1G A;  1ZC4 B;  5HE2 A;  3QBV B;  1OMW A;  3TCA A;  4A6F A;  1QQG A;  1MAI A;  3BJI A;  1XCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...