2W2XC

Complex of rac2 and plcg2 spph domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2xC00
4IAPA 3P6AA 2J0MA 2Y8FA 4F7HA 2VKIA 4CHJA 3M1IB 3SO6A 4HB4B 1X11A 4H8SA 1P3RA 1IRSA 2DYNA 3QBVB 1E5WA 1I2HA 1Y5OA 2N23A 2YRYA 2DHIA 1U5DA 4L6EA 4NSWA 4PNKA 3PG7A 4HATB 4K2OA 2DLWA 2VRWB 3KZ1A 1K5GB 1V88A 1BAKA 1M7EA 3PVUA 5CLQB 1Z87A 1MIXA 2YS1A 5C16A 4GZUA 3X23A 2J0KA 2DX1A 2EMTA 4EKUA 5CLLB 5LOPB 3ZDTA 3QWMA 2RSGA 1TJ6A 4P7IA 2D9YA 1WGQA 2OTXA 3N7CA 4WJ7A 4YONA 4A6HA 1U27A 1V5PA 2FJLA 1LB1A 3ODWA 5DH9B 2YT1A 2CAYA 5C5BB 2JP2A 4XWXA 3F0WA 2GS0A 4ZRJA 3LJUX 5J3TA 1V89A 2V76A 1RJ2A 3G9WA 3DXDA 4HDQA 1MPHA 4EMOA 2K2JA 4HAXB 4MT7A 3MDBC 2I1JA 2CRFA 5D3YA 1U29A 5JLJB 1SGHA 5HE2A 3HK0A 2Y7BA 2M38A 1K5DB 1X1FA 2ELAA 5FI1A 1WJ1A 1WVHA 1NTYA 4B6HA 1UNPA 1UNRA 5J3QA 1DROA 2LOZA 5KQ4A 1FGYA 3KRWA 4HB2B 1TQZA 2UZSA 3RCPA 1UNQA 3ML4A 1M7RA 3U7DA 2BCJA 2OQBA 5D3VA 4A6KA 2EJ8A 2CY5A 4K2PA 1EF1A 2X18A 2D9ZA 1DBHA 5HE3A 3HQCA 5D3WA 3UZTA 2N0YA 4DXAB 1MK7B 2XQNM 4ZRIA 1B55A 2M14A 1U5EA 2I5FA 2HTHB 2GCJA 5JHHA 1QC6A 1MK9B 3KRXA 2G35A 2NMBA 3D8DA 4HB0B 2LOXA 3QIJA 2P0HA 1ZSQA 5EFXA 1WJMA 1GC7A 1TXDA 1W1GA 1PMSA 2DFKA 3OANA 5KCVA 1FB8A 1SHCA 1XCGA 2EMSA 1DDMA 1OMWA 2KUPA 1OY2A 4NY0A 1WG7A 2IFSA 4CHMA 2QKLA 1U5GA 3P7ZA 3PVWA 4BBKA 1U5FA 3TW1A 2H7EA 2K2UA 4K81A 4WSFA 3WA0A 2VSZA 1W1HA 2ADZA 3VIAA 3TFMA 2CY4A 3FM8C 2H7DA 5DHFB 2D10A 1XKEA 1XD4A 1NU2A 3HW2B 2Z0OA 3FSSA 2MDXA 3ODXA 4C0AA 4GMXB 5D27A 5C6RA 1X86A 1J0WA 4YL8A 1UEFA 2W2XC 1GC6A 2DHJA 3T06A 2QKMA 2YT0A 2D4QA 3A8QA 4KAXB 1ZVRA 1NI2A 4MY6A 2D9XA 2P0FA 1X05A 2RGNB 4DX8A 2COAA 3IVFA 1RRPB 2D9WA 2P0DA 1EGXA 3WYFB 1FHOA 4A5KA 5DI9B 1KI1B 3PZDA 1I7AA 4F7UP 4GMVA 2YSZA 2D2QA 2GJYA 3FEHA 1PFJA 1N3HA 4WVFB 2GCLA 2E2XA 2PZ1A 3VOQA 4IOYX 2RVBB 2W2XD 2YF0A 2COFA 2J59M 1UPRA 1BTKA 4GXBA 2UZRA 2YVCA 2Z0PA 3PP2A 3A8PA 1MKEA 1AWEA 2L2IA 1GG3A 1Q67A 4HAVB 4KVGB 1MIZB 2YS3A 4PQ0A 3ODOA 3DXEA 2J0JA 3U8ZA 4HAWB 2KGXB 3O96A 2MKRA 2LULA 2R0DA 1UPQA 3SNHA 5DHAB 2Y8GA 2RNRB 4D0NB 5FI0A 1OQNA 2IYBA 4Y94A 1V5UA 2D11A 2DYQA 1P6SA 2ROVA 3AU4A 1XR0B 2DKQA 1X1GA 4TKNA 3GYPA 2COCA 2L1CA 2UVMA 5GOWB 1XODA 4Z2NA 3BJIA 4KHAA 4A6FA 2D9VA 1V61A 1FOEA 1XX0A 2ELBA 1W1DA 3F5RA 4KHOA 1ZC3B 3SV1A 2NZ8B 2K00A 4HAZB 3ZVRA 1DYNA 1KZ7A 1QQGA 2ZPYA 2AL6A 5J3YA 1KZGA 1AQCA 5DIFB 2EC1A 3PEGA 2P8VA 1P5TA 2DX5A 1DDVA 5L81A 3GYOA 5JHGA 4GN1A 4HHVA 2DHKA 5LONB 1H4RA 3PSCA 4ZRKA 1J19A 2DA0A 3CIKA 4DBBA 2MFQA 3NSUA 3AU5A 1NTVA 2RUKB 3TVVA 3SYXA 1MAIA 2MWNB 2AEHA 2CODA 4IFSA 2RLOA 4K17A 4F7GA 1ZC4B 2DN6A 5KQ1A 1FHWA 5JP4A 1LW3A 2I1KA 3MPXA 3V5WA 3D8EA 3ULBA 3A98B 2ROZB 3KY9A 1FAOA 3DXCA 2YS5A 1PLSA 1BTNA 1FHXA 1DDWA 2R09A 1ZM0A 3TCAA 1BWNA 2DTCA 2KCJA 1WI1A 2W2WA 3SUZA 4MK0A 1U2BA 3CXBB 2LYDA 4EJNA 3BINA 4HAUB 5HE0A 3D8FA 1ISNA 1EVHA 5D3XA 4A6FB 2HE7A 3PVLA 4CYEA 4HAYB 4Z2MB 3AJ4A 4HDOA 2I5CA 5C79A 2Z0QA 3ULCA 4GPTB 1Y19B 1H10A 3TO1A 4TYZA 2DKPA 2LG1A 1EAZA 2LKOA 3KSYA 4DX90 2Q13A 5C5BA 1V5MA 4HB3B 1WGUA 1FGZA 5HE1A 4KHBB
chains in the Genus database with same CATH superfamily
4IAPA 3P6AA 2J0MA 2Y8FA 3NW8A 4F7HA 2VKIA 4CHJA 3M1IB 3SO6A 4HB4B 1X11A 4H8SA 1P3RA 3NWFA 1IRSA 2DYNA 3QBVB 1E5WA 1I2HA 1Y5OA 2N23A 2YRYA 2DHIA 3A58A 1U5DA 4L6EA 4NSWA 4PNKA 3PG7A 4HATB 4K2OA 2DLWA 2VRWB 3KZ1A 1K5GB 1V88A 1BAKA 1M7EA 3PVUA 5CLQB 1Z87A 1MIXA 2YS1A 2R2YA 5C16A 4GZUA 3X23A 2J0KA 2DX1A 2EMTA 4EKUA 3OHMB 5CLLB 5LOPB 4OSNA 3ZDTA 3QWMA 2RSGA 4HSIA 1TJ6A 4P7IA 2D9YA 1WGQA 2OTXA 3N7CA 4WJ7A 4YONA 4A6HA 1U27A 3FVCA 1V5PA 2FJLA 1LB1A 3ODWA 5DH9B 2YT1A 2YT2A 2CAYA 5C5BB 2JP2A 4XWXA 3F0WA 2GS0A 4ZRJA 3LJUX 5J3TA 1V89A 2V76A 4KHBA 1RJ2A 3G9WA 3DXDA 4HDQA 1MPHA 2KIGA 4EMOA 2K2JA 4HAXB 4MT7A 3MDBC 2I1JA 2CRFA 5D3YA 1U29A 5JLJB 1SGHA 5HE2A 3HK0A 3NWAA 2Y7BA 2M38A 1K5DB 1X1FA 2ELAA 5FI1A 1WJ1A 1WVHA 1NTYA 4B6HA 1UNPA 1UNRA 5J3QA 1DROA 2LOZA 5KQ4A 1FGYA 3KRWA 4HB2B 5LG4B 3HSAA 2KIEA 1TQZA 2UZSA 3RCPA 1UNQA 3ML4A 1M7RA 5IRSA 3U7DA 2BCJA 2OQBA 3DCXA 5D3VA 4A6KA 2EJ8A 2CY5A 4K2PA 1EF1A 2X18A 2D9ZA 1DBHA 2Z59A 5HE3A 3HQCA 5D3WA 3UZTA 2N0YA 4DXAB 1MK7B 2XQNM 4ZRIA 1B55A 2M14A 1U5EA 2I5FA 2HTHB 2GCJA 5JHHA 1QC6A 1MK9B 3KRXA 2G35A 2NMBA 3D8DA 4HB0B 2LOXA 3HIEA 3QIJA 2P0HA 1ZSQA 5EFXA 1WJMA 1GC7A 2KR0A 1TXDA 1W1GA 1PMSA 2DFKA 3OANA 5KCVA 1FB8A 1SHCA 1XCGA 2EMSA 1DDMA 1OMWA 2KUPA 1OY2A 4NY0A 1WG7A 2IFSA 4CHMA 2QKLA 1U5GA 3P7ZA 3PVWA 4BBKA 1U5FA 3TW1A 2H7EA 2K2UA 4K81A 4WSFA 3WA0A 2VSZA 3U12A 1W1HA 2ADZA 3VIAA 3TFMA 2CY4A 3FM8C 2H7DA 5DHFB 2D10A 1XKEA 1XD4A 1NU2A 3HW2B 2Z0OA 3FSSA 2MDXA 3ODXA 4C0AA 4GMXB 5D27A 2Z4DA 1X86A 1J0WA 5C6RA 4YL8A 1MI1A 1UEFA 2W2XC 2FJUB 1GC6A 2DHJA 3T06A 2QKMA 2YT0A 2ZKMX 2D4QA 3A8QA 4KAXB 1ZVRA 1NI2A 4MY6A 2D9XA 1T77A 2P0FA 1X05A 3NWDA 2RGNB 4DX8A 2COAA 3IVFA 1RRPB 4L1RA 2D9WA 2P0DA 1EGXA 3WYFB 1FHOA 4A5KA 5DI9B 1KI1B 3PZDA 1I7AA 4F7UP 4GMVA 2YSZA 2D2QA 2GJYA 3FEHA 1PFJA 1N3HA 4WVFB 2GCLA 2E2XA 2PZ1A 3VOQA 4IOYX 4CSQA 2RVBB 2W2XD 4GOUA 2YF0A 2COFA 4GNKB 4DIXA 2J59M 1UPRA 2GUMA 1BTKA 4GXBA 2UZRA 2YVCA 2Z0PA 3PP2A 2Z14A 2KUQA 3A8PA 1MKEA 1AWEA 2L2IA 1GG3A 1Q67A 4HAVB 4KVGB 3B77A 1MIZB 2YS3A 4PQ0A 3ODOA 3DXEA 2J0JA 3U8ZA 4D6WA 4HAWB 2KGXB 3O96A 2MKRA 2LULA 2R0DA 1UPQA 3SNHA 5DHAB 2Y8GA 2RNRB 4D0NB 5FI0A 1OQNA 2IYBA 4Y94A 1V5UA 2D11A 2DYQA 1P6SA 2ROVA 3AU4A 1XR0B 2DKQA 1X1GA 4TKNA 3GYPA 2COCA 2L1CA 4QJ3B 2UVMA 5GOWB 1XODA 4Z2NA 3BJIA 4OT1A 4KHAA 4A6FA 2D9VA 1V61A 1FOEA 4QJ5B 2Z13A 1XX0A 2ELBA 1W1DA 3F5RA 4KHOA 1ZC3B 3SV1A 5I2SA 2NZ8B 4QXAB 2K00A 4HAZB 3ZVRA 1DYNA 1KZ7A 1QQGA 2ZPYA 2AL6A 5J3YA 1KZGA 2RRFA 1AQCA 5DIFB 2EC1A 3PEGA 2K49A 2P8VA 1P5TA 2DX5A 1DDVA 5L81A 3GYOA 5JHGA 4GN1A 4QJ4B 4HHVA 2DHKA 5LONB 1H4RA 3PSCA 4ZRKA 1J19A 2DA0A 3CIKA 4DBBA 2MFQA 3NSUA 3AU5A 1NTVA 2RUKB 3TVVA 3SYXA 1MAIA 2MWNB 2AEHA 2CODA 4IFSA 2RLOA 4K17A 4F7GA 1ZC4B 2DN6A 5KQ1A 1FHWA 5JP4A 1LW3A 2I1KA 3MPXA 3V5WA 3D8EA 3ULBA 3A98B 2ROZB 3KY9A 1FAOA 3DXCA 2YS5A 1PLSA 1BTNA 1FHXA 5M4YB 1DDWA 2R09A 1ZM0A 5I2MA 1BWNA 2DTCA 3TCAA 2KCJA 1WI1A 2W2WA 3SUZA 4MK0A 1U2BA 3CXBB 1ZYIA 2LYDA 4EJNA 3BINA 4HAUB 5HE0A 3D8FA 1ISNA 1EVHA 5D3XA 4A6FB 2HE7A 3PVLA 4CYEA 4HAYB 2K8EA 4Z2MB 3AJ4A 4HDOA 2I5CA 5C79A 2Z0QA 3ULCA 4GPTB 1Y19B 1H10A 3TO1A 4TYZA 2DKPA 2LG1A 1EAZA 2LKOA 3KSYA 4DX90 2Q13A 5C5BA 1V5MA 4HB3B 1WGUA 1FGZA 5HE1A 4KHBB 2NBVA
chains in the Genus database with same CATH topology
4IAPA 3P6AA 2J0MA 2Y8FA 4F7HA 2VKIA 4CHJA 3M1IB 3SO6A 4HB4B 1X11A 4H8SA 1P3RA 1IRSA 2DYNA 3QBVB 1E5WA 1I2HA 1Y5OA 2N23A 2YRYA 2DHIA 1U5DA 4L6EA 4NSWA 4PNKA 3PG7A 4HATB 4K2OA 2DLWA 2VRWB 3KZ1A 1K5GB 1V88A 1BAKA 1M7EA 3PVUA 5CLQB 1Z87A 1MIXA 2YS1A 5C16A 4GZUA 3X23A 2J0KA 2DX1A 2EMTA 4EKUA 5CLLB 5LOPB 3ZDTA 3QWMA 2RSGA 1TJ6A 4P7IA 2D9YA 1WGQA 2OTXA 3N7CA 4WJ7A 4YONA 4A6HA 1U27A 1V5PA 2FJLA 1LB1A 3ODWA 5DH9B 2YT1A 2CAYA 5C5BB 2JP2A 4XWXA 3F0WA 2GS0A 4ZRJA 3LJUX 5J3TA 1V89A 2V76A 1RJ2A 3G9WA 3DXDA 4HDQA 1MPHA 4EMOA 2K2JA 4HAXB 4MT7A 3MDBC 2I1JA 2CRFA 5D3YA 1U29A 5JLJB 1SGHA 5HE2A 3HK0A 2Y7BA 2M38A 1K5DB 1X1FA 2ELAA 5FI1A 1WJ1A 1WVHA 1NTYA 4B6HA 1UNPA 1UNRA 5J3QA 1DROA 2LOZA 5KQ4A 1FGYA 3KRWA 4HB2B 1TQZA 2UZSA 3RCPA 1UNQA 3ML4A 1M7RA 3U7DA 2BCJA 2OQBA 5D3VA 4A6KA 2EJ8A 2CY5A 4K2PA 1EF1A 2X18A 2D9ZA 1DBHA 5HE3A 3HQCA 5D3WA 3UZTA 2N0YA 4DXAB 1MK7B 2XQNM 4ZRIA 1B55A 2M14A 1U5EA 2I5FA 2HTHB 2GCJA 5JHHA 1QC6A 1MK9B 3KRXA 2G35A 2NMBA 3D8DA 4HB0B 2LOXA 3QIJA 2P0HA 1ZSQA 5EFXA 1WJMA 1GC7A 1TXDA 1W1GA 1PMSA 2DFKA 3OANA 5KCVA 1FB8A 1SHCA 1XCGA 2EMSA 1DDMA 1OMWA 2KUPA 1OY2A 4NY0A 1WG7A 2IFSA 4CHMA 2QKLA 1U5GA 3P7ZA 3PVWA 4BBKA 1U5FA 3TW1A 2H7EA 2K2UA 4K81A 4WSFA 3WA0A 2VSZA 1W1HA 2ADZA 3VIAA 3TFMA 2CY4A 3FM8C 2H7DA 5DHFB 2D10A 1XKEA 1XD4A 1NU2A 3HW2B 2Z0OA 3FSSA 2MDXA 3ODXA 4C0AA 4GMXB 5D27A 5C6RA 1X86A 1J0WA 4YL8A 1UEFA 2W2XC 1GC6A 2DHJA 3T06A 2QKMA 2YT0A 2D4QA 3A8QA 4KAXB 1ZVRA 1NI2A 4MY6A 2D9XA 2P0FA 1X05A 2RGNB 4DX8A 2COAA 3IVFA 1RRPB 2D9WA 2P0DA 1EGXA 3WYFB 1FHOA 4A5KA 5DI9B 1KI1B 3PZDA 1I7AA 4F7UP 4GMVA 2YSZA 2D2QA 2GJYA 3FEHA 1PFJA 1N3HA 4WVFB 2GCLA 2E2XA 2PZ1A 3VOQA 4IOYX 2RVBB 2W2XD 2YF0A 2COFA 2J59M 1UPRA 1BTKA 4GXBA 2UZRA 2YVCA 2Z0PA 3PP2A 3A8PA 1MKEA 1AWEA 2L2IA 1GG3A 1Q67A 4HAVB 4KVGB 1MIZB 2YS3A 4PQ0A 3ODOA 3DXEA 2J0JA 3U8ZA 4HAWB 2KGXB 3O96A 2MKRA 2LULA 2R0DA 1UPQA 3SNHA 5DHAB 2Y8GA 2RNRB 4D0NB 5FI0A 1OQNA 2IYBA 4Y94A 1V5UA 2D11A 2DYQA 1P6SA 2ROVA 3AU4A 1XR0B 2DKQA 1X1GA 4TKNA 3GYPA 2COCA 2L1CA 2UVMA 5GOWB 1XODA 4Z2NA 3BJIA 4KHAA 4A6FA 2D9VA 1V61A 1FOEA 1XX0A 2ELBA 1W1DA 3F5RA 4KHOA 1ZC3B 3SV1A 2NZ8B 2K00A 4HAZB 3ZVRA 1DYNA 1KZ7A 1QQGA 2ZPYA 2AL6A 5J3YA 1KZGA 1AQCA 5DIFB 2EC1A 3PEGA 2P8VA 1P5TA 2DX5A 1DDVA 5L81A 3GYOA 5JHGA 4GN1A 4HHVA 2DHKA 5LONB 1H4RA 3PSCA 4ZRKA 1J19A 2DA0A 3CIKA 4DBBA 2MFQA 3NSUA 3AU5A 1NTVA 2RUKB 3TVVA 3SYXA 1MAIA 2MWNB 2AEHA 2CODA 4IFSA 2RLOA 4K17A 4F7GA 1ZC4B 2DN6A 5KQ1A 1FHWA 5JP4A 1LW3A 2I1KA 3MPXA 3V5WA 3D8EA 3ULBA 3A98B 2ROZB 3KY9A 1FAOA 3DXCA 2YS5A 1PLSA 1BTNA 1FHXA 1DDWA 2R09A 1ZM0A 3TCAA 1BWNA 2DTCA 2KCJA 1WI1A 2W2WA 3SUZA 4MK0A 1U2BA 3CXBB 2LYDA 4EJNA 3BINA 4HAUB 5HE0A 3D8FA 1ISNA 1EVHA 5D3XA 4A6FB 2HE7A 3PVLA 4CYEA 4HAYB 4Z2MB 3AJ4A 4HDOA 2I5CA 5C79A 2Z0QA 3ULCA 4GPTB 1Y19B 1H10A 3TO1A 4TYZA 2DKPA 2LG1A 1EAZA 2LKOA 3KSYA 4DX90 2Q13A 5C5BA 1V5MA 4HB3B 1WGUA 1FGZA 5HE1A 4KHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAP A;  3P6A A;  2J0M A;  2Y8F A;  4F7H A;  2VKI A;  4CHJ A;  3M1I B;  3SO6 A;  4HB4 B;  1X11 A;  4H8S A;  1P3R A;  1IRS A;  2DYN A;  3QBV B;  1E5W A;  1I2H A;  1Y5O A;  2N23 A;  2YRY A;  2DHI A;  1U5D A;  4L6E A;  4NSW A;  4PNK A;  3PG7 A;  4HAT B;  4K2O A;  2DLW A;  2VRW B;  3KZ1 A;  1K5G B;  1V88 A;  1BAK A;  1M7E A;  3PVU A;  5CLQ B;  1Z87 A;  1MIX A;  2YS1 A;  5C16 A;  4GZU A;  3X23 A;  2J0K A;  2DX1 A;  2EMT A;  4EKU A;  5CLL B;  5LOP B;  3ZDT A;  3QWM A;  2RSG A;  1TJ6 A;  4P7I A;  2D9Y A;  1WGQ A;  2OTX A;  3N7C A;  4WJ7 A;  4YON A;  4A6H A;  1U27 A;  1V5P A;  2FJL A;  1LB1 A;  3ODW A;  5DH9 B;  2YT1 A;  2CAY A;  5C5B B;  2JP2 A;  4XWX A;  3F0W A;  2GS0 A;  4ZRJ A;  3LJU X;  5J3T A;  1V89 A;  2V76 A;  1RJ2 A;  3G9W A;  3DXD A;  4HDQ A;  1MPH A;  4EMO A;  2K2J A;  4HAX B;  4MT7 A;  3MDB C;  2I1J A;  2CRF A;  5D3Y A;  1U29 A;  5JLJ B;  1SGH A;  5HE2 A;  3HK0 A;  2Y7B A;  2M38 A;  1K5D B;  1X1F A;  2ELA A;  5FI1 A;  1WJ1 A;  1WVH A;  1NTY A;  4B6H A;  1UNP A;  1UNR A;  5J3Q A;  1DRO A;  2LOZ A;  5KQ4 A;  1FGY A;  3KRW A;  4HB2 B;  1TQZ A;  2UZS A;  3RCP A;  1UNQ A;  3ML4 A;  1M7R A;  3U7D A;  2BCJ A;  2OQB A;  5D3V A;  4A6K A;  2EJ8 A;  2CY5 A;  4K2P A;  1EF1 A;  2X18 A;  2D9Z A;  1DBH A;  5HE3 A;  3HQC A;  5D3W A;  3UZT A;  2N0Y A;  4DXA B;  1MK7 B;  2XQN M;  4ZRI A;  1B55 A;  2M14 A;  1U5E A;  2I5F A;  2HTH B;  2GCJ A;  5JHH A;  1QC6 A;  1MK9 B;  3KRX A;  2G35 A;  2NMB A;  3D8D A;  4HB0 B;  2LOX A;  3QIJ A;  2P0H A;  1ZSQ A;  5EFX A;  1WJM A;  1GC7 A;  1TXD A;  1W1G A;  1PMS A;  2DFK A;  3OAN A;  5KCV A;  1FB8 A;  1SHC A;  1XCG A;  2EMS A;  1DDM A;  1OMW A;  2KUP A;  1OY2 A;  4NY0 A;  1WG7 A;  2IFS A;  4CHM A;  2QKL A;  1U5G A;  3P7Z A;  3PVW A;  4BBK A;  1U5F A;  3TW1 A;  2H7E A;  2K2U A;  4K81 A;  4WSF A;  3WA0 A;  2VSZ A;  1W1H A;  2ADZ A;  3VIA A;  3TFM A;  2CY4 A;  3FM8 C;  2H7D A;  5DHF B;  2D10 A;  1XKE A;  1XD4 A;  1NU2 A;  3HW2 B;  2Z0O A;  3FSS A;  2MDX A;  3ODX A;  4C0A A;  4GMX B;  5D27 A;  5C6R A;  1X86 A;  1J0W A;  4YL8 A;  1UEF A;  2W2X C;  1GC6 A;  2DHJ A;  3T06 A;  2QKM A;  2YT0 A;  2D4Q A;  3A8Q A;  4KAX B;  1ZVR A;  1NI2 A;  4MY6 A;  2D9X A;  2P0F A;  1X05 A;  2RGN B;  4DX8 A;  2COA A;  3IVF A;  1RRP B;  2D9W A;  2P0D A;  1EGX A;  3WYF B;  1FHO A;  4A5K A;  5DI9 B;  1KI1 B;  3PZD A;  1I7A A;  4F7U P;  4GMV A;  2YSZ A;  2D2Q A;  2GJY A;  3FEH A;  1PFJ A;  1N3H A;  4WVF B;  2GCL A;  2E2X A;  2PZ1 A;  3VOQ A;  4IOY X;  2RVB B;  2W2X D;  2YF0 A;  2COF A;  2J59 M;  1UPR A;  1BTK A;  4GXB A;  2UZR A;  2YVC A;  2Z0P A;  3PP2 A;  3A8P A;  1MKE A;  1AWE A;  2L2I A;  1GG3 A;  1Q67 A;  4HAV B;  4KVG B;  1MIZ B;  2YS3 A;  4PQ0 A;  3ODO A;  3DXE A;  2J0J A;  3U8Z A;  4HAW B;  2KGX B;  3O96 A;  2MKR A;  2LUL A;  2R0D A;  1UPQ A;  3SNH A;  5DHA B;  2Y8G A;  2RNR B;  4D0N B;  5FI0 A;  1OQN A;  2IYB A;  4Y94 A;  1V5U A;  2D11 A;  2DYQ A;  1P6S A;  2ROV A;  3AU4 A;  1XR0 B;  2DKQ A;  1X1G A;  4TKN A;  3GYP A;  2COC A;  2L1C A;  2UVM A;  5GOW B;  1XOD A;  4Z2N A;  3BJI A;  4KHA A;  4A6F A;  2D9V A;  1V61 A;  1FOE A;  1XX0 A;  2ELB A;  1W1D A;  3F5R A;  4KHO A;  1ZC3 B;  3SV1 A;  2NZ8 B;  2K00 A;  4HAZ B;  3ZVR A;  1DYN A;  1KZ7 A;  1QQG A;  2ZPY A;  2AL6 A;  5J3Y A;  1KZG A;  1AQC A;  5DIF B;  2EC1 A;  3PEG A;  2P8V A;  1P5T A;  2DX5 A;  1DDV A;  5L81 A;  3GYO A;  5JHG A;  4GN1 A;  4HHV A;  2DHK A;  5LON B;  1H4R A;  3PSC A;  4ZRK A;  1J19 A;  2DA0 A;  3CIK A;  4DBB A;  2MFQ A;  3NSU A;  3AU5 A;  1NTV A;  2RUK B;  3TVV A;  3SYX A;  1MAI A;  2MWN B;  2AEH A;  2COD A;  4IFS A;  2RLO A;  4K17 A;  4F7G A;  1ZC4 B;  2DN6 A;  5KQ1 A;  1FHW A;  5JP4 A;  1LW3 A;  2I1K A;  3MPX A;  3V5W A;  3D8E A;  3ULB A;  3A98 B;  2ROZ B;  3KY9 A;  1FAO A;  3DXC A;  2YS5 A;  1PLS A;  1BTN A;  1FHX A;  1DDW A;  2R09 A;  1ZM0 A;  3TCA A;  1BWN A;  2DTC A;  2KCJ A;  1WI1 A;  2W2W A;  3SUZ A;  4MK0 A;  1U2B A;  3CXB B;  2LYD A;  4EJN A;  3BIN A;  4HAU B;  5HE0 A;  3D8F A;  1ISN A;  1EVH A;  5D3X A;  4A6F B;  2HE7 A;  3PVL A;  4CYE A;  4HAY B;  4Z2M B;  3AJ4 A;  4HDO A;  2I5C A;  5C79 A;  2Z0Q A;  3ULC A;  4GPT B;  1Y19 B;  1H10 A;  3TO1 A;  4TYZ A;  2DKP A;  2LG1 A;  1EAZ A;  2LKO A;  3KSY A;  4DX9 0;  2Q13 A;  5C5B A;  1V5M A;  4HB3 B;  1WGU A;  1FGZ A;  5HE1 A;  4KHB B; 
#chains in the Genus database with same CATH topology
 4IAP A;  3P6A A;  2J0M A;  2Y8F A;  3NW8 A;  4F7H A;  2VKI A;  4CHJ A;  3M1I B;  3SO6 A;  4HB4 B;  1X11 A;  4H8S A;  1P3R A;  3NWF A;  1IRS A;  2DYN A;  3QBV B;  1E5W A;  1I2H A;  1Y5O A;  2N23 A;  2YRY A;  2DHI A;  3A58 A;  1U5D A;  4L6E A;  4NSW A;  4PNK A;  3PG7 A;  4HAT B;  4K2O A;  2DLW A;  2VRW B;  3KZ1 A;  1K5G B;  1V88 A;  1BAK A;  1M7E A;  3PVU A;  5CLQ B;  1Z87 A;  1MIX A;  2YS1 A;  2R2Y A;  5C16 A;  4GZU A;  3X23 A;  2J0K A;  2DX1 A;  2EMT A;  4EKU A;  3OHM B;  5CLL B;  5LOP B;  4OSN A;  3ZDT A;  3QWM A;  2RSG A;  4HSI A;  1TJ6 A;  4P7I A;  2D9Y A;  1WGQ A;  2OTX A;  3N7C A;  4WJ7 A;  4YON A;  4A6H A;  1U27 A;  3FVC A;  1V5P A;  2FJL A;  1LB1 A;  3ODW A;  5DH9 B;  2YT1 A;  2YT2 A;  2CAY A;  5C5B B;  2JP2 A;  4XWX A;  3F0W A;  2GS0 A;  4ZRJ A;  3LJU X;  5J3T A;  1V89 A;  2V76 A;  4KHB A;  1RJ2 A;  3G9W A;  3DXD A;  4HDQ A;  1MPH A;  2KIG A;  4EMO A;  2K2J A;  4HAX B;  4MT7 A;  3MDB C;  2I1J A;  2CRF A;  5D3Y A;  1U29 A;  5JLJ B;  1SGH A;  5HE2 A;  3HK0 A;  3NWA A;  2Y7B A;  2M38 A;  1K5D B;  1X1F A;  2ELA A;  5FI1 A;  1WJ1 A;  1WVH A;  1NTY A;  4B6H A;  1UNP A;  1UNR A;  5J3Q A;  1DRO A;  2LOZ A;  5KQ4 A;  1FGY A;  3KRW A;  4HB2 B;  5LG4 B;  3HSA A;  2KIE A;  1TQZ A;  2UZS A;  3RCP A;  1UNQ A;  3ML4 A;  1M7R A;  5IRS A;  3U7D A;  2BCJ A;  2OQB A;  3DCX A;  5D3V A;  4A6K A;  2EJ8 A;  2CY5 A;  4K2P A;  1EF1 A;  2X18 A;  2D9Z A;  1DBH A;  2Z59 A;  5HE3 A;  3HQC A;  5D3W A;  3UZT A;  2N0Y A;  4DXA B;  1MK7 B;  2XQN M;  4ZRI A;  1B55 A;  2M14 A;  1U5E A;  2I5F A;  2HTH B;  2GCJ A;  5JHH A;  1QC6 A;  1MK9 B;  3KRX A;  2G35 A;  2NMB A;  3D8D A;  4HB0 B;  2LOX A;  3HIE A;  3QIJ A;  2P0H A;  1ZSQ A;  5EFX A;  1WJM A;  1GC7 A;  2KR0 A;  1TXD A;  1W1G A;  1PMS A;  2DFK A;  3OAN A;  5KCV A;  1FB8 A;  1SHC A;  1XCG A;  2EMS A;  1DDM A;  1OMW A;  2KUP A;  1OY2 A;  4NY0 A;  1WG7 A;  2IFS A;  4CHM A;  2QKL A;  1U5G A;  3P7Z A;  3PVW A;  4BBK A;  1U5F A;  3TW1 A;  2H7E A;  2K2U A;  4K81 A;  4WSF A;  3WA0 A;  2VSZ A;  3U12 A;  1W1H A;  2ADZ A;  3VIA A;  3TFM A;  2CY4 A;  3FM8 C;  2H7D A;  5DHF B;  2D10 A;  1XKE A;  1XD4 A;  1NU2 A;  3HW2 B;  2Z0O A;  3FSS A;  2MDX A;  3ODX A;  4C0A A;  4GMX B;  5D27 A;  2Z4D A;  1X86 A;  1J0W A;  5C6R A;  4YL8 A;  1MI1 A;  1UEF A;  2W2X C;  2FJU B;  1GC6 A;  2DHJ A;  3T06 A;  2QKM A;  2YT0 A;  2ZKM X;  2D4Q A;  3A8Q A;  4KAX B;  1ZVR A;  1NI2 A;  4MY6 A;  2D9X A;  1T77 A;  2P0F A;  1X05 A;  3NWD A;  2RGN B;  4DX8 A;  2COA A;  3IVF A;  1RRP B;  4L1R A;  2D9W A;  2P0D A;  1EGX A;  3WYF B;  1FHO A;  4A5K A;  5DI9 B;  1KI1 B;  3PZD A;  1I7A A;  4F7U P;  4GMV A;  2YSZ A;  2D2Q A;  2GJY A;  3FEH A;  1PFJ A;  1N3H A;  4WVF B;  2GCL A;  2E2X A;  2PZ1 A;  3VOQ A;  4IOY X;  4CSQ A;  2RVB B;  2W2X D;  4GOU A;  2YF0 A;  2COF A;  4GNK B;  4DIX A;  2J59 M;  1UPR A;  2GUM A;  1BTK A;  4GXB A;  2UZR A;  2YVC A;  2Z0P A;  3PP2 A;  2Z14 A;  2KUQ A;  3A8P A;  1MKE A;  1AWE A;  2L2I A;  1GG3 A;  1Q67 A;  4HAV B;  4KVG B;  3B77 A;  1MIZ B;  2YS3 A;  4PQ0 A;  3ODO A;  3DXE A;  2J0J A;  3U8Z A;  4D6W A;  4HAW B;  2KGX B;  3O96 A;  2MKR A;  2LUL A;  2R0D A;  1UPQ A;  3SNH A;  5DHA B;  2Y8G A;  2RNR B;  4D0N B;  5FI0 A;  1OQN A;  2IYB A;  4Y94 A;  1V5U A;  2D11 A;  2DYQ A;  1P6S A;  2ROV A;  3AU4 A;  1XR0 B;  2DKQ A;  1X1G A;  4TKN A;  3GYP A;  2COC A;  2L1C A;  4QJ3 B;  2UVM A;  5GOW B;  1XOD A;  4Z2N A;  3BJI A;  4OT1 A;  4KHA A;  4A6F A;  2D9V A;  1V61 A;  1FOE A;  4QJ5 B;  2Z13 A;  1XX0 A;  2ELB A;  1W1D A;  3F5R A;  4KHO A;  1ZC3 B;  3SV1 A;  5I2S A;  2NZ8 B;  4QXA B;  2K00 A;  4HAZ B;  3ZVR A;  1DYN A;  1KZ7 A;  1QQG A;  2ZPY A;  2AL6 A;  5J3Y A;  1KZG A;  2RRF A;  1AQC A;  5DIF B;  2EC1 A;  3PEG A;  2K49 A;  2P8V A;  1P5T A;  2DX5 A;  1DDV A;  5L81 A;  3GYO A;  5JHG A;  4GN1 A;  4QJ4 B;  4HHV A;  2DHK A;  5LON B;  1H4R A;  3PSC A;  4ZRK A;  1J19 A;  2DA0 A;  3CIK A;  4DBB A;  2MFQ A;  3NSU A;  3AU5 A;  1NTV A;  2RUK B;  3TVV A;  3SYX A;  1MAI A;  2MWN B;  2AEH A;  2COD A;  4IFS A;  2RLO A;  4K17 A;  4F7G A;  1ZC4 B;  2DN6 A;  5KQ1 A;  1FHW A;  5JP4 A;  1LW3 A;  2I1K A;  3MPX A;  3V5W A;  3D8E A;  3ULB A;  3A98 B;  2ROZ B;  3KY9 A;  1FAO A;  3DXC A;  2YS5 A;  1PLS A;  1BTN A;  1FHX A;  5M4Y B;  1DDW A;  2R09 A;  1ZM0 A;  5I2M A;  1BWN A;  2DTC A;  3TCA A;  2KCJ A;  1WI1 A;  2W2W A;  3SUZ A;  4MK0 A;  1U2B A;  3CXB B;  1ZYI A;  2LYD A;  4EJN A;  3BIN A;  4HAU B;  5HE0 A;  3D8F A;  1ISN A;  1EVH A;  5D3X A;  4A6F B;  2HE7 A;  3PVL A;  4CYE A;  4HAY B;  2K8E A;  4Z2M B;  3AJ4 A;  4HDO A;  2I5C A;  5C79 A;  2Z0Q A;  3ULC A;  4GPT B;  1Y19 B;  1H10 A;  3TO1 A;  4TYZ A;  2DKP A;  2LG1 A;  1EAZ A;  2LKO A;  3KSY A;  4DX9 0;  2Q13 A;  5C5B A;  1V5M A;  4HB3 B;  1WGU A;  1FGZ A;  5HE1 A;  4KHB B;  2NBV A; 
#chains in the Genus database with same CATH homology
 4IAP A;  3P6A A;  2J0M A;  2Y8F A;  4F7H A;  2VKI A;  4CHJ A;  3M1I B;  3SO6 A;  4HB4 B;  1X11 A;  4H8S A;  1P3R A;  1IRS A;  2DYN A;  3QBV B;  1E5W A;  1I2H A;  1Y5O A;  2N23 A;  2YRY A;  2DHI A;  1U5D A;  4L6E A;  4NSW A;  4PNK A;  3PG7 A;  4HAT B;  4K2O A;  2DLW A;  2VRW B;  3KZ1 A;  1K5G B;  1V88 A;  1BAK A;  1M7E A;  3PVU A;  5CLQ B;  1Z87 A;  1MIX A;  2YS1 A;  5C16 A;  4GZU A;  3X23 A;  2J0K A;  2DX1 A;  2EMT A;  4EKU A;  5CLL B;  5LOP B;  3ZDT A;  3QWM A;  2RSG A;  1TJ6 A;  4P7I A;  2D9Y A;  1WGQ A;  2OTX A;  3N7C A;  4WJ7 A;  4YON A;  4A6H A;  1U27 A;  1V5P A;  2FJL A;  1LB1 A;  3ODW A;  5DH9 B;  2YT1 A;  2CAY A;  5C5B B;  2JP2 A;  4XWX A;  3F0W A;  2GS0 A;  4ZRJ A;  3LJU X;  5J3T A;  1V89 A;  2V76 A;  1RJ2 A;  3G9W A;  3DXD A;  4HDQ A;  1MPH A;  4EMO A;  2K2J A;  4HAX B;  4MT7 A;  3MDB C;  2I1J A;  2CRF A;  5D3Y A;  1U29 A;  5JLJ B;  1SGH A;  5HE2 A;  3HK0 A;  2Y7B A;  2M38 A;  1K5D B;  1X1F A;  2ELA A;  5FI1 A;  1WJ1 A;  1WVH A;  1NTY A;  4B6H A;  1UNP A;  1UNR A;  5J3Q A;  1DRO A;  2LOZ A;  5KQ4 A;  1FGY A;  3KRW A;  4HB2 B;  1TQZ A;  2UZS A;  3RCP A;  1UNQ A;  3ML4 A;  1M7R A;  3U7D A;  2BCJ A;  2OQB A;  5D3V A;  4A6K A;  2EJ8 A;  2CY5 A;  4K2P A;  1EF1 A;  2X18 A;  2D9Z A;  1DBH A;  5HE3 A;  3HQC A;  5D3W A;  3UZT A;  2N0Y A;  4DXA B;  1MK7 B;  2XQN M;  4ZRI A;  1B55 A;  2M14 A;  1U5E A;  2I5F A;  2HTH B;  2GCJ A;  5JHH A;  1QC6 A;  1MK9 B;  3KRX A;  2G35 A;  2NMB A;  3D8D A;  4HB0 B;  2LOX A;  3QIJ A;  2P0H A;  1ZSQ A;  5EFX A;  1WJM A;  1GC7 A;  1TXD A;  1W1G A;  1PMS A;  2DFK A;  3OAN A;  5KCV A;  1FB8 A;  1SHC A;  1XCG A;  2EMS A;  1DDM A;  1OMW A;  2KUP A;  1OY2 A;  4NY0 A;  1WG7 A;  2IFS A;  4CHM A;  2QKL A;  1U5G A;  3P7Z A;  3PVW A;  4BBK A;  1U5F A;  3TW1 A;  2H7E A;  2K2U A;  4K81 A;  4WSF A;  3WA0 A;  2VSZ A;  1W1H A;  2ADZ A;  3VIA A;  3TFM A;  2CY4 A;  3FM8 C;  2H7D A;  5DHF B;  2D10 A;  1XKE A;  1XD4 A;  1NU2 A;  3HW2 B;  2Z0O A;  3FSS A;  2MDX A;  3ODX A;  4C0A A;  4GMX B;  5D27 A;  5C6R A;  1X86 A;  1J0W A;  4YL8 A;  1UEF A;  2W2X C;  1GC6 A;  2DHJ A;  3T06 A;  2QKM A;  2YT0 A;  2D4Q A;  3A8Q A;  4KAX B;  1ZVR A;  1NI2 A;  4MY6 A;  2D9X A;  2P0F A;  1X05 A;  2RGN B;  4DX8 A;  2COA A;  3IVF A;  1RRP B;  2D9W A;  2P0D A;  1EGX A;  3WYF B;  1FHO A;  4A5K A;  5DI9 B;  1KI1 B;  3PZD A;  1I7A A;  4F7U P;  4GMV A;  2YSZ A;  2D2Q A;  2GJY A;  3FEH A;  1PFJ A;  1N3H A;  4WVF B;  2GCL A;  2E2X A;  2PZ1 A;  3VOQ A;  4IOY X;  2RVB B;  2W2X D;  2YF0 A;  2COF A;  2J59 M;  1UPR A;  1BTK A;  4GXB A;  2UZR A;  2YVC A;  2Z0P A;  3PP2 A;  3A8P A;  1MKE A;  1AWE A;  2L2I A;  1GG3 A;  1Q67 A;  4HAV B;  4KVG B;  1MIZ B;  2YS3 A;  4PQ0 A;  3ODO A;  3DXE A;  2J0J A;  3U8Z A;  4HAW B;  2KGX B;  3O96 A;  2MKR A;  2LUL A;  2R0D A;  1UPQ A;  3SNH A;  5DHA B;  2Y8G A;  2RNR B;  4D0N B;  5FI0 A;  1OQN A;  2IYB A;  4Y94 A;  1V5U A;  2D11 A;  2DYQ A;  1P6S A;  2ROV A;  3AU4 A;  1XR0 B;  2DKQ A;  1X1G A;  4TKN A;  3GYP A;  2COC A;  2L1C A;  2UVM A;  5GOW B;  1XOD A;  4Z2N A;  3BJI A;  4KHA A;  4A6F A;  2D9V A;  1V61 A;  1FOE A;  1XX0 A;  2ELB A;  1W1D A;  3F5R A;  4KHO A;  1ZC3 B;  3SV1 A;  2NZ8 B;  2K00 A;  4HAZ B;  3ZVR A;  1DYN A;  1KZ7 A;  1QQG A;  2ZPY A;  2AL6 A;  5J3Y A;  1KZG A;  1AQC A;  5DIF B;  2EC1 A;  3PEG A;  2P8V A;  1P5T A;  2DX5 A;  1DDV A;  5L81 A;  3GYO A;  5JHG A;  4GN1 A;  4HHV A;  2DHK A;  5LON B;  1H4R A;  3PSC A;  4ZRK A;  1J19 A;  2DA0 A;  3CIK A;  4DBB A;  2MFQ A;  3NSU A;  3AU5 A;  1NTV A;  2RUK B;  3TVV A;  3SYX A;  1MAI A;  2MWN B;  2AEH A;  2COD A;  4IFS A;  2RLO A;  4K17 A;  4F7G A;  1ZC4 B;  2DN6 A;  5KQ1 A;  1FHW A;  5JP4 A;  1LW3 A;  2I1K A;  3MPX A;  3V5W A;  3D8E A;  3ULB A;  3A98 B;  2ROZ B;  3KY9 A;  1FAO A;  3DXC A;  2YS5 A;  1PLS A;  1BTN A;  1FHX A;  1DDW A;  2R09 A;  1ZM0 A;  3TCA A;  1BWN A;  2DTC A;  2KCJ A;  1WI1 A;  2W2W A;  3SUZ A;  4MK0 A;  1U2B A;  3CXB B;  2LYD A;  4EJN A;  3BIN A;  4HAU B;  5HE0 A;  3D8F A;  1ISN A;  1EVH A;  5D3X A;  4A6F B;  2HE7 A;  3PVL A;  4CYE A;  4HAY B;  4Z2M B;  3AJ4 A;  4HDO A;  2I5C A;  5C79 A;  2Z0Q A;  3ULC A;  4GPT B;  1Y19 B;  1H10 A;  3TO1 A;  4TYZ A;  2DKP A;  2LG1 A;  1EAZ A;  2LKO A;  3KSY A;  4DX9 0;  2Q13 A;  5C5B A;  1V5M A;  4HB3 B;  1WGU A;  1FGZ A;  5HE1 A;  4KHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...