2W2XC

Complex of rac2 and plcg2 spph domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
b'KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2xC00
2Z0OA 2M14A 4YONA 4Y94A 2COFA 1RRPB 4A6HA 2YVCA 3IVFA 2D9ZA 1EGXA 3QIJA 2J0JA 2W2XD 1QC6A 2L1CA 1X11A 3HW2B 1TJ6A 2D2QA 1X1GA 1ZVRA 4DBBA 2UZSA 4PNKA 2Z0QA 4Z2NA 5LOPB 4HHVA 3BINA 3TW1A 3PVWA 3QBVB 4KVGB 1DDWA 3MPXA 3PSCA 5LONB 4GPTB 3A8QA 2QKLA 4GZUA 3PZDA 4XWXA 5FI0A 4Z2MB 3CIKA 3SV1A 2ELAA 4HAZB 3T06A 2JP2A 2ZPYA 1J0WA 5HE1A 3HQCA 1MIZB 5HE2A 3SYXA 4DX90 1EAZA 5GOWB 1WG7A 3ULBA 1B55A 1V61A 2HTHB 2P0DA 1MK9B 4HB4B 1Q67A 3BJIA 4IFSA 5KQ4A 3PEGA 1J19A 2Y7BA 2X18A 3CXBB 2I5FA 4CYEA 2LOZA 2EC1A 2MDXA 2VKIA 1LW3A 1UNPA 2GCLA 2LKOA 4HDQA 3ODOA 5JHGA 1WJ1A 4ZRIA 5D3WA 2GS0A 3PP2A 1BTNA 3X23A 2DHIA 4HAXB 2N23A 2RSGA 3ULCA 1NTYA 1V89A 2D9WA 3D8FA 2IFSA 4L6EA 4NY0A 5D3XA 1IRSA 1U5EA 4F7GA 2RGNB 1DYNA 1H10A 5HE0A 4F7UP 3P7ZA 5CLQB 1NTVA 4DXAB 1V5PA 4WSFA 2P8VA 1SHCA 1OQNA 1RJ2A 4K81A 2LULA 2V76A 1WGUA 4C0AA 5DHFB 1BWNA 3ZVRA 1Y5OA 5C5BA 3M1IB 4GXBA 2VRWB 2NMBA 3AJ4A 4A6FA 2G35A 2DLWA 1ZSQA 4HAWB 1U5DA 4TYZA 3KY9A 1P3RA 2RUKB 3KRXA 2P0FA 3DXDA 1ISNA 2GJYA 1XCGA 3GYPA 1I7AA 5C5BB 2RLOA 2ROZB 4A6FB 2N0YA 4KHAA 5D27A 3FSSA 3AU5A 4GMVA 3U8ZA 5C6RA 2H7DA 5DI9B 1V88A 1U5GA 1ZC4B 1OMWA 3TO1A 3ML4A 1LB1A 3O96A 1X86A 1NU2A 2KUPA 3U7DA 1MKEA 2DTCA 4TKNA 3KSYA 4IAPA 2R09A 3NSUA 1P6SA 3OANA 4KHBB 1XKEA 4KAXB 3A98B 4HAYB 2EMTA 3PVUA 1DROA 4WJ7A 2YT0A 3N7CA 2EMSA 1W1HA 1KZGA 1WGQA 4NSWA 2D9YA 3HK0A 4ZRKA 1SGHA 2YSZA 3SUZA 5DIFB 5J3YA 4F7HA 1X1FA 1BTKA 1WVHA 1UPQA 3SNHA 2HE7A 5L81A 4GMXB 4HB3B 4CHJA 1DBHA 1TXDA 2NZ8B 2CAYA 2COAA 2DKQA 2DYNA 2J0KA 2L2IA 2DYQA 2R0DA 5KQ1A 1N3HA 3QWMA 1OY2A 2LOXA 3G9WA 3TFMA 4K2OA 4MT7A 2UZRA 2MFQA 2DA0A 1Y19B 5HE3A 3DXEA 2DX1A 2VSZA 1PMSA 5J3TA 5C79A 2M38A 2ELBA 1GC7A 4HAVB 4IOYX 1K5DB 3DXCA 1XODA 1ZM0A 2D9VA 3PG7A 2Y8FA 3RCPA 2P0HA 5JP4A 2KCJA 1P5TA 1H4RA 2J59M 3FEHA 1QQGA 5J3QA 1GG3A 4H8SA 3ZDTA 2RVBB 2DHKA 5KCVA 1ZC3B 3P6AA 2CY5A 1TQZA 1I2HA 4WVFB 2ROVA 1MAIA 4DX8A 3AU4A 1M7EA 5CLLB 2AL6A 2W2XC 2KGXB 1UNRA 1FAOA 4A5KA 4BBKA 1MK7B 1MIXA 2J0MA 3D8EA 3GYOA 2K2UA 4EMOA 2BCJA 2H7EA 2I1JA 1W1DA 2Z0PA 1WJMA 1KZ7A 5JHHA 2UVMA 5D3YA 2W2WA 1FB8A 3LJUX 1FOEA 2D11A 2EJ8A 2AEHA 3VIAA 3TCAA 1MPHA 2D10A 2Q13A 4GN1A 2YT1A 2CY4A 2MWNB 3TVVA 1UNQA 2COCA 1U2BA 1DDMA 4ZRJA 2DFKA 1PFJA 2LYDA 3ODXA 2LG1A 3PVLA 3KRWA 2DN6A 4P7IA 4HDOA 3WA0A 1FHXA 1U5FA 1V5MA 1U27A 2Y8GA 4B6HA 1PLSA 4HAUB 4MY6A 1UEFA 5D3VA 4K17A 2OTXA 1BAKA 2YS5A 3FM8C 2RNRB 3WYFB 4HB2B 4EKUA 1E5WA 4KHOA 4D0NB 1FHWA 2YS3A 1Z87A 3A8PA 4A6KA 1EVHA 1FGYA 2D4QA 3UZTA 1DDVA 1FGZA 4HB0B 4MK0A 1EF1A 2DKPA 2OQBA 3ODWA 4EJNA 1K5GB 2YF0A 1AWEA 2DHJA 2I5CA 1M7RA 2D9XA 1FHOA 1XR0B 2K00A 4CHMA 3F5RA 4K2PA 4PQ0A 1UPRA 2MKRA 1V5UA 2PZ1A 1W1GA 2GCJA 3MDBC 5JLJB 5FI1A 2IYBA 1AQCA 2ADZA 2I1KA 1NI2A 1XX0A 3V5WA 2FJLA 2DX5A 1X05A 3SO6A 3KZ1A 2K2JA 3F0WA 5EFXA 1GC6A 5DHAB 2XQNM 5DH9B 1WI1A 2E2XA 4YL8A 1XD4A 2CODA 2YRYA 2YS1A 3VOQA 5C16A 2QKMA 1U29A 4HATB 3D8DA 1KI1B 2CRFA
chains in the Genus database with same CATH superfamily
2Z0OA 2M14A 4YONA 4Y94A 2COFA 1RRPB 5M4YB 4A6HA 2YVCA 3IVFA 2D9ZA 1EGXA 3QIJA 2J0JA 2W2XD 1QC6A 2L1CA 1X11A 2KR0A 3HW2B 1TJ6A 2D2QA 1X1GA 1ZVRA 4DBBA 2UZSA 4PNKA 2Z0QA 4Z2NA 3NWDA 4QJ5B 5LOPB 4HHVA 4CSQA 3BINA 3TW1A 4OT1A 3PVWA 3QBVB 4KVGB 1DDWA 3MPXA 3PSCA 5LONB 4GPTB 3A8QA 4QJ4B 2QKLA 4GZUA 3PZDA 4XWXA 5FI0A 3NWFA 3CIKA 4Z2MB 3SV1A 2ELAA 4HAZB 3T06A 2JP2A 2ZPYA 1J0WA 5HE1A 3HQCA 1MIZB 5HE2A 3SYXA 4DX90 1EAZA 5GOWB 1WG7A 3ULBA 1B55A 1V61A 2HTHB 2P0DA 1MK9B 4HB4B 1Q67A 3BJIA 4IFSA 5KQ4A 3PEGA 1J19A 2Y7BA 4L1RA 2X18A 3HIEA 3CXBB 2I5FA 4CYEA 2LOZA 2EC1A 2K8EA 2MDXA 2VKIA 2K49A 1LW3A 1UNPA 2GCLA 2LKOA 4HDQA 3ODOA 5JHGA 1WJ1A 4ZRIA 5D3WA 2GS0A 3PP2A 1BTNA 3X23A 2DHIA 4HAXB 2N23A 2RSGA 3ULCA 1NTYA 1V89A 2D9WA 3D8FA 2IFSA 4L6EA 4NY0A 5D3XA 1IRSA 1U5EA 4F7GA 2RRFA 2RGNB 1DYNA 1H10A 5HE0A 4F7UP 3P7ZA 5CLQB 1NTVA 4DXAB 1V5PA 4WSFA 2P8VA 1SHCA 1OQNA 1RJ2A 4K81A 2LULA 2Z14A 2KIEA 2V76A 1WGUA 4C0AA 5DHFB 1BWNA 3ZVRA 1Y5OA 5C5BA 3M1IB 4GXBA 2VRWB 3OHMB 2NMBA 3AJ4A 4A6FA 2G35A 2DLWA 1ZSQA 4HAWB 1U5DA 4TYZA 3KY9A 1P3RA 2RUKB 3KRXA 2P0FA 3U12A 3DXDA 1ISNA 2GJYA 1XCGA 3GYPA 1I7AA 5C5BB 2RLOA 2ROZB 4KHBA 4A6FB 2N0YA 4KHAA 5D27A 2Z13A 3FSSA 3AU5A 4GMVA 3U8ZA 5C6RA 2H7DA 5DI9B 1V88A 1U5GA 1ZC4B 1OMWA 3TO1A 3ML4A 1LB1A 3O96A 1X86A 1NU2A 2KUPA 3U7DA 1MKEA 5I2MA 2DTCA 4TKNA 3KSYA 4IAPA 2R09A 3NSUA 1P6SA 3OANA 4KHBB 1XKEA 4KAXB 3A98B 4HAYB 2EMTA 3PVUA 1DROA 4WJ7A 2YT0A 3N7CA 2EMSA 1W1HA 1KZGA 1WGQA 4NSWA 2D9YA 3HK0A 4ZRKA 1SGHA 2YSZA 3SUZA 5DIFB 5J3YA 4F7HA 1X1FA 1BTKA 1WVHA 1UPQA 4GNKB 3SNHA 2HE7A 5L81A 4GMXB 4HB3B 4CHJA 1DBHA 1TXDA 2NZ8B 2CAYA 2COAA 2DKQA 2DYNA 3A58A 2J0KA 2L2IA 2DYQA 2R0DA 5KQ1A 1N3HA 3QWMA 1OY2A 2LOXA 3G9WA 3TFMA 4K2OA 2YT2A 4MT7A 4GOUA 2UZRA 2MFQA 2DA0A 3NW8A 2Z4DA 1Y19B 5HE3A 3DXEA 2DX1A 2VSZA 1PMSA 5J3TA 5C79A 2M38A 2ELBA 1GC7A 4HAVB 4IOYX 1K5DB 3DXCA 1XODA 1ZM0A 2D9VA 3FVCA 4QXAB 3PG7A 2Y8FA 3RCPA 2P0HA 5JP4A 2KCJA 1P5TA 1H4RA 2J59M 3FEHA 1QQGA 5J3QA 1GG3A 4H8SA 3ZDTA 2RVBB 2DHKA 5KCVA 1ZC3B 3P6AA 2CY5A 1TQZA 1I2HA 1MI1A 3B77A 4WVFB 2ROVA 1MAIA 4DX8A 3AU4A 1M7EA 5CLLB 2AL6A 2W2XC 2KUQA 2KGXB 1UNRA 1FAOA 4A5KA 4BBKA 1MK7B 1MIXA 2J0MA 3D8EA 3GYOA 2K2UA 4EMOA 2BCJA 2H7EA 2I1JA 1W1DA 2Z0PA 1WJMA 1KZ7A 5JHHA 2Z59A 2UVMA 5D3YA 4DIXA 2W2WA 1FB8A 3LJUX 1FOEA 4OSNA 2D11A 2EJ8A 2AEHA 3VIAA 3TCAA 1MPHA 2D10A 2Q13A 4GN1A 2YT1A 2CY4A 4QJ3B 2MWNB 3TVVA 1UNQA 2COCA 1U2BA 1DDMA 2GUMA 4ZRJA 2DFKA 1PFJA 4HSIA 2LYDA 3ODXA 2LG1A 3PVLA 3KRWA 2R2YA 2DN6A 4P7IA 4HDOA 3WA0A 1FHXA 5LG4B 1U5FA 1V5MA 1U27A 2Y8GA 4B6HA 1PLSA 4HAUB 4MY6A 1UEFA 5D3VA 4K17A 2OTXA 1BAKA 2YS5A 3DCXA 3FM8C 2RNRB 3WYFB 4HB2B 4EKUA 1E5WA 4KHOA 4D0NB 1FHWA 2NBVA 2YS3A 2KIGA 1Z87A 3A8PA 4A6KA 1EVHA 1FGYA 2D4QA 4D6WA 3UZTA 1DDVA 1FGZA 4HB0B 4MK0A 1EF1A 2DKPA 2OQBA 3ODWA 4EJNA 1K5GB 2FJUB 2YF0A 1AWEA 2DHJA 1ZYIA 2I5CA 1M7RA 1T77A 2D9XA 1FHOA 1XR0B 2K00A 4CHMA 3F5RA 4K2PA 4PQ0A 1UPRA 2MKRA 1V5UA 2PZ1A 1W1GA 2GCJA 3NWAA 3MDBC 5JLJB 5FI1A 2IYBA 1AQCA 2ADZA 2I1KA 1NI2A 1XX0A 5I2SA 3V5WA 2FJLA 2DX5A 1X05A 3SO6A 3KZ1A 2K2JA 3F0WA 3HSAA 5EFXA 1GC6A 5DHAB 2XQNM 5DH9B 1WI1A 5IRSA 2E2XA 4YL8A 1XD4A 2CODA 2YRYA 2YS1A 3VOQA 5C16A 2QKMA 1U29A 4HATB 3D8DA 2ZKMX 1KI1B 2CRFA
chains in the Genus database with same CATH topology
2Z0OA 2M14A 4YONA 4Y94A 2COFA 1RRPB 4A6HA 2YVCA 3IVFA 2D9ZA 1EGXA 3QIJA 2J0JA 2W2XD 1QC6A 2L1CA 1X11A 3HW2B 1TJ6A 2D2QA 1X1GA 1ZVRA 4DBBA 2UZSA 4PNKA 2Z0QA 4Z2NA 5LOPB 4HHVA 3BINA 3TW1A 3PVWA 3QBVB 4KVGB 1DDWA 3MPXA 3PSCA 5LONB 4GPTB 3A8QA 2QKLA 4GZUA 3PZDA 4XWXA 5FI0A 4Z2MB 3CIKA 3SV1A 2ELAA 4HAZB 3T06A 2JP2A 2ZPYA 1J0WA 5HE1A 3HQCA 1MIZB 5HE2A 3SYXA 4DX90 1EAZA 5GOWB 1WG7A 3ULBA 1B55A 1V61A 2HTHB 2P0DA 1MK9B 4HB4B 1Q67A 3BJIA 4IFSA 5KQ4A 3PEGA 1J19A 2Y7BA 2X18A 3CXBB 2I5FA 4CYEA 2LOZA 2EC1A 2MDXA 2VKIA 1LW3A 1UNPA 2GCLA 2LKOA 4HDQA 3ODOA 5JHGA 1WJ1A 4ZRIA 5D3WA 2GS0A 3PP2A 1BTNA 3X23A 2DHIA 4HAXB 2N23A 2RSGA 3ULCA 1NTYA 1V89A 2D9WA 3D8FA 2IFSA 4L6EA 4NY0A 5D3XA 1IRSA 1U5EA 4F7GA 2RGNB 1DYNA 1H10A 5HE0A 4F7UP 3P7ZA 5CLQB 1NTVA 4DXAB 1V5PA 4WSFA 2P8VA 1SHCA 1OQNA 1RJ2A 4K81A 2LULA 2V76A 1WGUA 4C0AA 5DHFB 1BWNA 3ZVRA 1Y5OA 5C5BA 3M1IB 4GXBA 2VRWB 2NMBA 3AJ4A 4A6FA 2G35A 2DLWA 1ZSQA 4HAWB 1U5DA 4TYZA 3KY9A 1P3RA 2RUKB 3KRXA 2P0FA 3DXDA 1ISNA 2GJYA 1XCGA 3GYPA 1I7AA 5C5BB 2RLOA 2ROZB 4A6FB 2N0YA 4KHAA 5D27A 3FSSA 3AU5A 4GMVA 3U8ZA 5C6RA 2H7DA 5DI9B 1V88A 1U5GA 1ZC4B 1OMWA 3TO1A 3ML4A 1LB1A 3O96A 1X86A 1NU2A 2KUPA 3U7DA 1MKEA 2DTCA 4TKNA 3KSYA 4IAPA 2R09A 3NSUA 1P6SA 3OANA 4KHBB 1XKEA 4KAXB 3A98B 4HAYB 2EMTA 3PVUA 1DROA 4WJ7A 2YT0A 3N7CA 2EMSA 1W1HA 1KZGA 1WGQA 4NSWA 2D9YA 3HK0A 4ZRKA 1SGHA 2YSZA 3SUZA 5DIFB 5J3YA 4F7HA 1X1FA 1BTKA 1WVHA 1UPQA 3SNHA 2HE7A 5L81A 4GMXB 4HB3B 4CHJA 1DBHA 1TXDA 2NZ8B 2CAYA 2COAA 2DKQA 2DYNA 2J0KA 2L2IA 2DYQA 2R0DA 5KQ1A 1N3HA 3QWMA 1OY2A 2LOXA 3G9WA 3TFMA 4K2OA 4MT7A 2UZRA 2MFQA 2DA0A 1Y19B 5HE3A 3DXEA 2DX1A 2VSZA 1PMSA 5J3TA 5C79A 2M38A 2ELBA 1GC7A 4HAVB 4IOYX 1K5DB 3DXCA 1XODA 1ZM0A 2D9VA 3PG7A 2Y8FA 3RCPA 2P0HA 5JP4A 2KCJA 1P5TA 1H4RA 2J59M 3FEHA 1QQGA 5J3QA 1GG3A 4H8SA 3ZDTA 2RVBB 2DHKA 5KCVA 1ZC3B 3P6AA 2CY5A 1TQZA 1I2HA 4WVFB 2ROVA 1MAIA 4DX8A 3AU4A 1M7EA 5CLLB 2AL6A 2W2XC 2KGXB 1UNRA 1FAOA 4A5KA 4BBKA 1MK7B 1MIXA 2J0MA 3D8EA 3GYOA 2K2UA 4EMOA 2BCJA 2H7EA 2I1JA 1W1DA 2Z0PA 1WJMA 1KZ7A 5JHHA 2UVMA 5D3YA 2W2WA 1FB8A 3LJUX 1FOEA 2D11A 2EJ8A 2AEHA 3VIAA 3TCAA 1MPHA 2D10A 2Q13A 4GN1A 2YT1A 2CY4A 2MWNB 3TVVA 1UNQA 2COCA 1U2BA 1DDMA 4ZRJA 2DFKA 1PFJA 2LYDA 3ODXA 2LG1A 3PVLA 3KRWA 2DN6A 4P7IA 4HDOA 3WA0A 1FHXA 1U5FA 1V5MA 1U27A 2Y8GA 4B6HA 1PLSA 4HAUB 4MY6A 1UEFA 5D3VA 4K17A 2OTXA 1BAKA 2YS5A 3FM8C 2RNRB 3WYFB 4HB2B 4EKUA 1E5WA 4KHOA 4D0NB 1FHWA 2YS3A 1Z87A 3A8PA 4A6KA 1EVHA 1FGYA 2D4QA 3UZTA 1DDVA 1FGZA 4HB0B 4MK0A 1EF1A 2DKPA 2OQBA 3ODWA 4EJNA 1K5GB 2YF0A 1AWEA 2DHJA 2I5CA 1M7RA 2D9XA 1FHOA 1XR0B 2K00A 4CHMA 3F5RA 4K2PA 4PQ0A 1UPRA 2MKRA 1V5UA 2PZ1A 1W1GA 2GCJA 3MDBC 5JLJB 5FI1A 2IYBA 1AQCA 2ADZA 2I1KA 1NI2A 1XX0A 3V5WA 2FJLA 2DX5A 1X05A 3SO6A 3KZ1A 2K2JA 3F0WA 5EFXA 1GC6A 5DHAB 2XQNM 5DH9B 1WI1A 2E2XA 4YL8A 1XD4A 2CODA 2YRYA 2YS1A 3VOQA 5C16A 2QKMA 1U29A 4HATB 3D8DA 1KI1B 2CRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0O A;  2M14 A;  4YON A;  4Y94 A;  2COF A;  1RRP B;  4A6H A;  2YVC A;  3IVF A;  2D9Z A;  1EGX A;  3QIJ A;  2J0J A;  2W2X D;  1QC6 A;  2L1C A;  1X11 A;  3HW2 B;  1TJ6 A;  2D2Q A;  1X1G A;  1ZVR A;  4DBB A;  2UZS A;  4PNK A;  2Z0Q A;  4Z2N A;  5LOP B;  4HHV A;  3BIN A;  3TW1 A;  3PVW A;  3QBV B;  4KVG B;  1DDW A;  3MPX A;  3PSC A;  5LON B;  4GPT B;  3A8Q A;  2QKL A;  4GZU A;  3PZD A;  4XWX A;  5FI0 A;  4Z2M B;  3CIK A;  3SV1 A;  2ELA A;  4HAZ B;  3T06 A;  2JP2 A;  2ZPY A;  1J0W A;  5HE1 A;  3HQC A;  1MIZ B;  5HE2 A;  3SYX A;  4DX9 0;  1EAZ A;  5GOW B;  1WG7 A;  3ULB A;  1B55 A;  1V61 A;  2HTH B;  2P0D A;  1MK9 B;  4HB4 B;  1Q67 A;  3BJI A;  4IFS A;  5KQ4 A;  3PEG A;  1J19 A;  2Y7B A;  2X18 A;  3CXB B;  2I5F A;  4CYE A;  2LOZ A;  2EC1 A;  2MDX A;  2VKI A;  1LW3 A;  1UNP A;  2GCL A;  2LKO A;  4HDQ A;  3ODO A;  5JHG A;  1WJ1 A;  4ZRI A;  5D3W A;  2GS0 A;  3PP2 A;  1BTN A;  3X23 A;  2DHI A;  4HAX B;  2N23 A;  2RSG A;  3ULC A;  1NTY A;  1V89 A;  2D9W A;  3D8F A;  2IFS A;  4L6E A;  4NY0 A;  5D3X A;  1IRS A;  1U5E A;  4F7G A;  2RGN B;  1DYN A;  1H10 A;  5HE0 A;  4F7U P;  3P7Z A;  5CLQ B;  1NTV A;  4DXA B;  1V5P A;  4WSF A;  2P8V A;  1SHC A;  1OQN A;  1RJ2 A;  4K81 A;  2LUL A;  2V76 A;  1WGU A;  4C0A A;  5DHF B;  1BWN A;  3ZVR A;  1Y5O A;  5C5B A;  3M1I B;  4GXB A;  2VRW B;  2NMB A;  3AJ4 A;  4A6F A;  2G35 A;  2DLW A;  1ZSQ A;  4HAW B;  1U5D A;  4TYZ A;  3KY9 A;  1P3R A;  2RUK B;  3KRX A;  2P0F A;  3DXD A;  1ISN A;  2GJY A;  1XCG A;  3GYP A;  1I7A A;  5C5B B;  2RLO A;  2ROZ B;  4A6F B;  2N0Y A;  4KHA A;  5D27 A;  3FSS A;  3AU5 A;  4GMV A;  3U8Z A;  5C6R A;  2H7D A;  5DI9 B;  1V88 A;  1U5G A;  1ZC4 B;  1OMW A;  3TO1 A;  3ML4 A;  1LB1 A;  3O96 A;  1X86 A;  1NU2 A;  2KUP A;  3U7D A;  1MKE A;  2DTC A;  4TKN A;  3KSY A;  4IAP A;  2R09 A;  3NSU A;  1P6S A;  3OAN A;  4KHB B;  1XKE A;  4KAX B;  3A98 B;  4HAY B;  2EMT A;  3PVU A;  1DRO A;  4WJ7 A;  2YT0 A;  3N7C A;  2EMS A;  1W1H A;  1KZG A;  1WGQ A;  4NSW A;  2D9Y A;  3HK0 A;  4ZRK A;  1SGH A;  2YSZ A;  3SUZ A;  5DIF B;  5J3Y A;  4F7H A;  1X1F A;  1BTK A;  1WVH A;  1UPQ A;  3SNH A;  2HE7 A;  5L81 A;  4GMX B;  4HB3 B;  4CHJ A;  1DBH A;  1TXD A;  2NZ8 B;  2CAY A;  2COA A;  2DKQ A;  2DYN A;  2J0K A;  2L2I A;  2DYQ A;  2R0D A;  5KQ1 A;  1N3H A;  3QWM A;  1OY2 A;  2LOX A;  3G9W A;  3TFM A;  4K2O A;  4MT7 A;  2UZR A;  2MFQ A;  2DA0 A;  1Y19 B;  5HE3 A;  3DXE A;  2DX1 A;  2VSZ A;  1PMS A;  5J3T A;  5C79 A;  2M38 A;  2ELB A;  1GC7 A;  4HAV B;  4IOY X;  1K5D B;  3DXC A;  1XOD A;  1ZM0 A;  2D9V A;  3PG7 A;  2Y8F A;  3RCP A;  2P0H A;  5JP4 A;  2KCJ A;  1P5T A;  1H4R A;  2J59 M;  3FEH A;  1QQG A;  5J3Q A;  1GG3 A;  4H8S A;  3ZDT A;  2RVB B;  2DHK A;  5KCV A;  1ZC3 B;  3P6A A;  2CY5 A;  1TQZ A;  1I2H A;  4WVF B;  2ROV A;  1MAI A;  4DX8 A;  3AU4 A;  1M7E A;  5CLL B;  2AL6 A;  2W2X C;  2KGX B;  1UNR A;  1FAO A;  4A5K A;  4BBK A;  1MK7 B;  1MIX A;  2J0M A;  3D8E A;  3GYO A;  2K2U A;  4EMO A;  2BCJ A;  2H7E A;  2I1J A;  1W1D A;  2Z0P A;  1WJM A;  1KZ7 A;  5JHH A;  2UVM A;  5D3Y A;  2W2W A;  1FB8 A;  3LJU X;  1FOE A;  2D11 A;  2EJ8 A;  2AEH A;  3VIA A;  3TCA A;  1MPH A;  2D10 A;  2Q13 A;  4GN1 A;  2YT1 A;  2CY4 A;  2MWN B;  3TVV A;  1UNQ A;  2COC A;  1U2B A;  1DDM A;  4ZRJ A;  2DFK A;  1PFJ A;  2LYD A;  3ODX A;  2LG1 A;  3PVL A;  3KRW A;  2DN6 A;  4P7I A;  4HDO A;  3WA0 A;  1FHX A;  1U5F A;  1V5M A;  1U27 A;  2Y8G A;  4B6H A;  1PLS A;  4HAU B;  4MY6 A;  1UEF A;  5D3V A;  4K17 A;  2OTX A;  1BAK A;  2YS5 A;  3FM8 C;  2RNR B;  3WYF B;  4HB2 B;  4EKU A;  1E5W A;  4KHO A;  4D0N B;  1FHW A;  2YS3 A;  1Z87 A;  3A8P A;  4A6K A;  1EVH A;  1FGY A;  2D4Q A;  3UZT A;  1DDV A;  1FGZ A;  4HB0 B;  4MK0 A;  1EF1 A;  2DKP A;  2OQB A;  3ODW A;  4EJN A;  1K5G B;  2YF0 A;  1AWE A;  2DHJ A;  2I5C A;  1M7R A;  2D9X A;  1FHO A;  1XR0 B;  2K00 A;  4CHM A;  3F5R A;  4K2P A;  4PQ0 A;  1UPR A;  2MKR A;  1V5U A;  2PZ1 A;  1W1G A;  2GCJ A;  3MDB C;  5JLJ B;  5FI1 A;  2IYB A;  1AQC A;  2ADZ A;  2I1K A;  1NI2 A;  1XX0 A;  3V5W A;  2FJL A;  2DX5 A;  1X05 A;  3SO6 A;  3KZ1 A;  2K2J A;  3F0W A;  5EFX A;  1GC6 A;  5DHA B;  2XQN M;  5DH9 B;  1WI1 A;  2E2X A;  4YL8 A;  1XD4 A;  2COD A;  2YRY A;  2YS1 A;  3VOQ A;  5C16 A;  2QKM A;  1U29 A;  4HAT B;  3D8D A;  1KI1 B;  2CRF A; 
#chains in the Genus database with same CATH topology
 2Z0O A;  2M14 A;  4YON A;  4Y94 A;  2COF A;  1RRP B;  5M4Y B;  4A6H A;  2YVC A;  3IVF A;  2D9Z A;  1EGX A;  3QIJ A;  2J0J A;  2W2X D;  1QC6 A;  2L1C A;  1X11 A;  2KR0 A;  3HW2 B;  1TJ6 A;  2D2Q A;  1X1G A;  1ZVR A;  4DBB A;  2UZS A;  4PNK A;  2Z0Q A;  4Z2N A;  3NWD A;  4QJ5 B;  5LOP B;  4HHV A;  4CSQ A;  3BIN A;  3TW1 A;  4OT1 A;  3PVW A;  3QBV B;  4KVG B;  1DDW A;  3MPX A;  3PSC A;  5LON B;  4GPT B;  3A8Q A;  4QJ4 B;  2QKL A;  4GZU A;  3PZD A;  4XWX A;  5FI0 A;  3NWF A;  3CIK A;  4Z2M B;  3SV1 A;  2ELA A;  4HAZ B;  3T06 A;  2JP2 A;  2ZPY A;  1J0W A;  5HE1 A;  3HQC A;  1MIZ B;  5HE2 A;  3SYX A;  4DX9 0;  1EAZ A;  5GOW B;  1WG7 A;  3ULB A;  1B55 A;  1V61 A;  2HTH B;  2P0D A;  1MK9 B;  4HB4 B;  1Q67 A;  3BJI A;  4IFS A;  5KQ4 A;  3PEG A;  1J19 A;  2Y7B A;  4L1R A;  2X18 A;  3HIE A;  3CXB B;  2I5F A;  4CYE A;  2LOZ A;  2EC1 A;  2K8E A;  2MDX A;  2VKI A;  2K49 A;  1LW3 A;  1UNP A;  2GCL A;  2LKO A;  4HDQ A;  3ODO A;  5JHG A;  1WJ1 A;  4ZRI A;  5D3W A;  2GS0 A;  3PP2 A;  1BTN A;  3X23 A;  2DHI A;  4HAX B;  2N23 A;  2RSG A;  3ULC A;  1NTY A;  1V89 A;  2D9W A;  3D8F A;  2IFS A;  4L6E A;  4NY0 A;  5D3X A;  1IRS A;  1U5E A;  4F7G A;  2RRF A;  2RGN B;  1DYN A;  1H10 A;  5HE0 A;  4F7U P;  3P7Z A;  5CLQ B;  1NTV A;  4DXA B;  1V5P A;  4WSF A;  2P8V A;  1SHC A;  1OQN A;  1RJ2 A;  4K81 A;  2LUL A;  2Z14 A;  2KIE A;  2V76 A;  1WGU A;  4C0A A;  5DHF B;  1BWN A;  3ZVR A;  1Y5O A;  5C5B A;  3M1I B;  4GXB A;  2VRW B;  3OHM B;  2NMB A;  3AJ4 A;  4A6F A;  2G35 A;  2DLW A;  1ZSQ A;  4HAW B;  1U5D A;  4TYZ A;  3KY9 A;  1P3R A;  2RUK B;  3KRX A;  2P0F A;  3U12 A;  3DXD A;  1ISN A;  2GJY A;  1XCG A;  3GYP A;  1I7A A;  5C5B B;  2RLO A;  2ROZ B;  4KHB A;  4A6F B;  2N0Y A;  4KHA A;  5D27 A;  2Z13 A;  3FSS A;  3AU5 A;  4GMV A;  3U8Z A;  5C6R A;  2H7D A;  5DI9 B;  1V88 A;  1U5G A;  1ZC4 B;  1OMW A;  3TO1 A;  3ML4 A;  1LB1 A;  3O96 A;  1X86 A;  1NU2 A;  2KUP A;  3U7D A;  1MKE A;  5I2M A;  2DTC A;  4TKN A;  3KSY A;  4IAP A;  2R09 A;  3NSU A;  1P6S A;  3OAN A;  4KHB B;  1XKE A;  4KAX B;  3A98 B;  4HAY B;  2EMT A;  3PVU A;  1DRO A;  4WJ7 A;  2YT0 A;  3N7C A;  2EMS A;  1W1H A;  1KZG A;  1WGQ A;  4NSW A;  2D9Y A;  3HK0 A;  4ZRK A;  1SGH A;  2YSZ A;  3SUZ A;  5DIF B;  5J3Y A;  4F7H A;  1X1F A;  1BTK A;  1WVH A;  1UPQ A;  4GNK B;  3SNH A;  2HE7 A;  5L81 A;  4GMX B;  4HB3 B;  4CHJ A;  1DBH A;  1TXD A;  2NZ8 B;  2CAY A;  2COA A;  2DKQ A;  2DYN A;  3A58 A;  2J0K A;  2L2I A;  2DYQ A;  2R0D A;  5KQ1 A;  1N3H A;  3QWM A;  1OY2 A;  2LOX A;  3G9W A;  3TFM A;  4K2O A;  2YT2 A;  4MT7 A;  4GOU A;  2UZR A;  2MFQ A;  2DA0 A;  3NW8 A;  2Z4D A;  1Y19 B;  5HE3 A;  3DXE A;  2DX1 A;  2VSZ A;  1PMS A;  5J3T A;  5C79 A;  2M38 A;  2ELB A;  1GC7 A;  4HAV B;  4IOY X;  1K5D B;  3DXC A;  1XOD A;  1ZM0 A;  2D9V A;  3FVC A;  4QXA B;  3PG7 A;  2Y8F A;  3RCP A;  2P0H A;  5JP4 A;  2KCJ A;  1P5T A;  1H4R A;  2J59 M;  3FEH A;  1QQG A;  5J3Q A;  1GG3 A;  4H8S A;  3ZDT A;  2RVB B;  2DHK A;  5KCV A;  1ZC3 B;  3P6A A;  2CY5 A;  1TQZ A;  1I2H A;  1MI1 A;  3B77 A;  4WVF B;  2ROV A;  1MAI A;  4DX8 A;  3AU4 A;  1M7E A;  5CLL B;  2AL6 A;  2W2X C;  2KUQ A;  2KGX B;  1UNR A;  1FAO A;  4A5K A;  4BBK A;  1MK7 B;  1MIX A;  2J0M A;  3D8E A;  3GYO A;  2K2U A;  4EMO A;  2BCJ A;  2H7E A;  2I1J A;  1W1D A;  2Z0P A;  1WJM A;  1KZ7 A;  5JHH A;  2Z59 A;  2UVM A;  5D3Y A;  4DIX A;  2W2W A;  1FB8 A;  3LJU X;  1FOE A;  4OSN A;  2D11 A;  2EJ8 A;  2AEH A;  3VIA A;  3TCA A;  1MPH A;  2D10 A;  2Q13 A;  4GN1 A;  2YT1 A;  2CY4 A;  4QJ3 B;  2MWN B;  3TVV A;  1UNQ A;  2COC A;  1U2B A;  1DDM A;  2GUM A;  4ZRJ A;  2DFK A;  1PFJ A;  4HSI A;  2LYD A;  3ODX A;  2LG1 A;  3PVL A;  3KRW A;  2R2Y A;  2DN6 A;  4P7I A;  4HDO A;  3WA0 A;  1FHX A;  5LG4 B;  1U5F A;  1V5M A;  1U27 A;  2Y8G A;  4B6H A;  1PLS A;  4HAU B;  4MY6 A;  1UEF A;  5D3V A;  4K17 A;  2OTX A;  1BAK A;  2YS5 A;  3DCX A;  3FM8 C;  2RNR B;  3WYF B;  4HB2 B;  4EKU A;  1E5W A;  4KHO A;  4D0N B;  1FHW A;  2NBV A;  2YS3 A;  2KIG A;  1Z87 A;  3A8P A;  4A6K A;  1EVH A;  1FGY A;  2D4Q A;  4D6W A;  3UZT A;  1DDV A;  1FGZ A;  4HB0 B;  4MK0 A;  1EF1 A;  2DKP A;  2OQB A;  3ODW A;  4EJN A;  1K5G B;  2FJU B;  2YF0 A;  1AWE A;  2DHJ A;  1ZYI A;  2I5C A;  1M7R A;  1T77 A;  2D9X A;  1FHO A;  1XR0 B;  2K00 A;  4CHM A;  3F5R A;  4K2P A;  4PQ0 A;  1UPR A;  2MKR A;  1V5U A;  2PZ1 A;  1W1G A;  2GCJ A;  3NWA A;  3MDB C;  5JLJ B;  5FI1 A;  2IYB A;  1AQC A;  2ADZ A;  2I1K A;  1NI2 A;  1XX0 A;  5I2S A;  3V5W A;  2FJL A;  2DX5 A;  1X05 A;  3SO6 A;  3KZ1 A;  2K2J A;  3F0W A;  3HSA A;  5EFX A;  1GC6 A;  5DHA B;  2XQN M;  5DH9 B;  1WI1 A;  5IRS A;  2E2X A;  4YL8 A;  1XD4 A;  2COD A;  2YRY A;  2YS1 A;  3VOQ A;  5C16 A;  2QKM A;  1U29 A;  4HAT B;  3D8D A;  2ZKM X;  1KI1 B;  2CRF A; 
#chains in the Genus database with same CATH homology
 2Z0O A;  2M14 A;  4YON A;  4Y94 A;  2COF A;  1RRP B;  4A6H A;  2YVC A;  3IVF A;  2D9Z A;  1EGX A;  3QIJ A;  2J0J A;  2W2X D;  1QC6 A;  2L1C A;  1X11 A;  3HW2 B;  1TJ6 A;  2D2Q A;  1X1G A;  1ZVR A;  4DBB A;  2UZS A;  4PNK A;  2Z0Q A;  4Z2N A;  5LOP B;  4HHV A;  3BIN A;  3TW1 A;  3PVW A;  3QBV B;  4KVG B;  1DDW A;  3MPX A;  3PSC A;  5LON B;  4GPT B;  3A8Q A;  2QKL A;  4GZU A;  3PZD A;  4XWX A;  5FI0 A;  4Z2M B;  3CIK A;  3SV1 A;  2ELA A;  4HAZ B;  3T06 A;  2JP2 A;  2ZPY A;  1J0W A;  5HE1 A;  3HQC A;  1MIZ B;  5HE2 A;  3SYX A;  4DX9 0;  1EAZ A;  5GOW B;  1WG7 A;  3ULB A;  1B55 A;  1V61 A;  2HTH B;  2P0D A;  1MK9 B;  4HB4 B;  1Q67 A;  3BJI A;  4IFS A;  5KQ4 A;  3PEG A;  1J19 A;  2Y7B A;  2X18 A;  3CXB B;  2I5F A;  4CYE A;  2LOZ A;  2EC1 A;  2MDX A;  2VKI A;  1LW3 A;  1UNP A;  2GCL A;  2LKO A;  4HDQ A;  3ODO A;  5JHG A;  1WJ1 A;  4ZRI A;  5D3W A;  2GS0 A;  3PP2 A;  1BTN A;  3X23 A;  2DHI A;  4HAX B;  2N23 A;  2RSG A;  3ULC A;  1NTY A;  1V89 A;  2D9W A;  3D8F A;  2IFS A;  4L6E A;  4NY0 A;  5D3X A;  1IRS A;  1U5E A;  4F7G A;  2RGN B;  1DYN A;  1H10 A;  5HE0 A;  4F7U P;  3P7Z A;  5CLQ B;  1NTV A;  4DXA B;  1V5P A;  4WSF A;  2P8V A;  1SHC A;  1OQN A;  1RJ2 A;  4K81 A;  2LUL A;  2V76 A;  1WGU A;  4C0A A;  5DHF B;  1BWN A;  3ZVR A;  1Y5O A;  5C5B A;  3M1I B;  4GXB A;  2VRW B;  2NMB A;  3AJ4 A;  4A6F A;  2G35 A;  2DLW A;  1ZSQ A;  4HAW B;  1U5D A;  4TYZ A;  3KY9 A;  1P3R A;  2RUK B;  3KRX A;  2P0F A;  3DXD A;  1ISN A;  2GJY A;  1XCG A;  3GYP A;  1I7A A;  5C5B B;  2RLO A;  2ROZ B;  4A6F B;  2N0Y A;  4KHA A;  5D27 A;  3FSS A;  3AU5 A;  4GMV A;  3U8Z A;  5C6R A;  2H7D A;  5DI9 B;  1V88 A;  1U5G A;  1ZC4 B;  1OMW A;  3TO1 A;  3ML4 A;  1LB1 A;  3O96 A;  1X86 A;  1NU2 A;  2KUP A;  3U7D A;  1MKE A;  2DTC A;  4TKN A;  3KSY A;  4IAP A;  2R09 A;  3NSU A;  1P6S A;  3OAN A;  4KHB B;  1XKE A;  4KAX B;  3A98 B;  4HAY B;  2EMT A;  3PVU A;  1DRO A;  4WJ7 A;  2YT0 A;  3N7C A;  2EMS A;  1W1H A;  1KZG A;  1WGQ A;  4NSW A;  2D9Y A;  3HK0 A;  4ZRK A;  1SGH A;  2YSZ A;  3SUZ A;  5DIF B;  5J3Y A;  4F7H A;  1X1F A;  1BTK A;  1WVH A;  1UPQ A;  3SNH A;  2HE7 A;  5L81 A;  4GMX B;  4HB3 B;  4CHJ A;  1DBH A;  1TXD A;  2NZ8 B;  2CAY A;  2COA A;  2DKQ A;  2DYN A;  2J0K A;  2L2I A;  2DYQ A;  2R0D A;  5KQ1 A;  1N3H A;  3QWM A;  1OY2 A;  2LOX A;  3G9W A;  3TFM A;  4K2O A;  4MT7 A;  2UZR A;  2MFQ A;  2DA0 A;  1Y19 B;  5HE3 A;  3DXE A;  2DX1 A;  2VSZ A;  1PMS A;  5J3T A;  5C79 A;  2M38 A;  2ELB A;  1GC7 A;  4HAV B;  4IOY X;  1K5D B;  3DXC A;  1XOD A;  1ZM0 A;  2D9V A;  3PG7 A;  2Y8F A;  3RCP A;  2P0H A;  5JP4 A;  2KCJ A;  1P5T A;  1H4R A;  2J59 M;  3FEH A;  1QQG A;  5J3Q A;  1GG3 A;  4H8S A;  3ZDT A;  2RVB B;  2DHK A;  5KCV A;  1ZC3 B;  3P6A A;  2CY5 A;  1TQZ A;  1I2H A;  4WVF B;  2ROV A;  1MAI A;  4DX8 A;  3AU4 A;  1M7E A;  5CLL B;  2AL6 A;  2W2X C;  2KGX B;  1UNR A;  1FAO A;  4A5K A;  4BBK A;  1MK7 B;  1MIX A;  2J0M A;  3D8E A;  3GYO A;  2K2U A;  4EMO A;  2BCJ A;  2H7E A;  2I1J A;  1W1D A;  2Z0P A;  1WJM A;  1KZ7 A;  5JHH A;  2UVM A;  5D3Y A;  2W2W A;  1FB8 A;  3LJU X;  1FOE A;  2D11 A;  2EJ8 A;  2AEH A;  3VIA A;  3TCA A;  1MPH A;  2D10 A;  2Q13 A;  4GN1 A;  2YT1 A;  2CY4 A;  2MWN B;  3TVV A;  1UNQ A;  2COC A;  1U2B A;  1DDM A;  4ZRJ A;  2DFK A;  1PFJ A;  2LYD A;  3ODX A;  2LG1 A;  3PVL A;  3KRW A;  2DN6 A;  4P7I A;  4HDO A;  3WA0 A;  1FHX A;  1U5F A;  1V5M A;  1U27 A;  2Y8G A;  4B6H A;  1PLS A;  4HAU B;  4MY6 A;  1UEF A;  5D3V A;  4K17 A;  2OTX A;  1BAK A;  2YS5 A;  3FM8 C;  2RNR B;  3WYF B;  4HB2 B;  4EKU A;  1E5W A;  4KHO A;  4D0N B;  1FHW A;  2YS3 A;  1Z87 A;  3A8P A;  4A6K A;  1EVH A;  1FGY A;  2D4Q A;  3UZT A;  1DDV A;  1FGZ A;  4HB0 B;  4MK0 A;  1EF1 A;  2DKP A;  2OQB A;  3ODW A;  4EJN A;  1K5G B;  2YF0 A;  1AWE A;  2DHJ A;  2I5C A;  1M7R A;  2D9X A;  1FHO A;  1XR0 B;  2K00 A;  4CHM A;  3F5R A;  4K2P A;  4PQ0 A;  1UPR A;  2MKR A;  1V5U A;  2PZ1 A;  1W1G A;  2GCJ A;  3MDB C;  5JLJ B;  5FI1 A;  2IYB A;  1AQC A;  2ADZ A;  2I1K A;  1NI2 A;  1XX0 A;  3V5W A;  2FJL A;  2DX5 A;  1X05 A;  3SO6 A;  3KZ1 A;  2K2J A;  3F0W A;  5EFX A;  1GC6 A;  5DHA B;  2XQN M;  5DH9 B;  1WI1 A;  2E2X A;  4YL8 A;  1XD4 A;  2COD A;  2YRY A;  2YS1 A;  3VOQ A;  5C16 A;  2QKM A;  1U29 A;  4HAT B;  3D8D A;  1KI1 B;  2CRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...