2W2XC

Complex of rac2 and plcg2 spph domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
KQQGELYMWDSIDQKWTRHFCAIADAKLSFSDDIEQTMEEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 23
structure length 109
sequence length 109
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2w2xC00
2ADZA 1UPRA 1XKEA 3TW1A 2PZ1A 2I1JA 5DHAB 2RSGA 2IYBA 1N3HA 2N23A 5HE0A 3RCPA 2JP2A 2KCJA 4A6FA 1P6SA 3GYOA 2ROZB 1ZC4B 3AJ4A 2BCJA 2MWNB 4HAWB 4XWXA 5KCVA 2EJ8A 2YVCA 4WSFA 2I5FA 4KHAA 3A8QA 5J3QA 2W2XD 2D9XA 3PZDA 2VKIA 3SYXA 2MFQA 5JHHA 4K2PA 4NY0A 1MIXA 3X23A 1DDWA 3A98B 4HAZB 2YT1A 3FEHA 1PLSA 4CHMA 1MK7B 3ZVRA 2L2IA 2H7EA 3IVFA 1Y19B 1BTNA 3PVUA 1ZVRA 3FM8C 5C79A 4Z2NA 2KUPA 2NMBA 3ODXA 1M7EA 1E5WA 4IOYX 1EF1A 3ODOA 4HAUB 1W1GA 4GPTB 2UZSA 2YT0A 4KAXB 1MIZB 2ELAA 3KRXA 1DROA 5HE2A 3SUZA 1QC6A 1OY2A 3PVWA 1UEFA 3P6AA 3CXBB 1RRPB 2D9WA 2DKQA 2EMSA 1BAKA 4KVGB 5LOPB 3SV1A 3M1IB 4F7UP 1WI1A 1X05A 4NSWA 1NTYA 1WGUA 4A6HA 2EC1A 2D9VA 4CYEA 2DYQA 2LULA 2M14A 3TCAA 3DXDA 3MDBC 2YS1A 4HAYB 3KZ1A 2HE7A 3BINA 1J19A 1TJ6A 2I5CA 2UZRA 4HATB 3OANA 1NI2A 1LW3A 4L6EA 2COFA 2J0KA 2GS0A 2DA0A 2DTCA 2Y8GA 1XR0B 4WJ7A 5L81A 5D3VA 2MDXA 2MKRA 1KZ7A 2QKMA 1NU2A 4P7IA 4C0AA 4GXBA 3FSSA 1MKEA 4HDOA 2RNRB 5J3YA 4HB2B 4KHOA 1ISNA 3KRWA 2G35A 3QBVB 1GC6A 2P0FA 4HHVA 4D0NB 1FAOA 2Y7BA 4B6HA 4A5KA 1FOEA 5LONB 4HAXB 3HQCA 1KI1B 1QQGA 5C5BB 1P3RA 2GCJA 3G9WA 2DX5A 1FGZA 3VIAA 2LOZA 5DI9B 1PMSA 4EJNA 1U29A 2N0YA 1H4RA 1FGYA 2D4QA 1K5DB 1SGHA 3ML4A 3LJUX 2YRYA 4Y94A 3UZTA 1UNQA 3F5RA 5D3WA 1EAZA 2DYNA 3CIKA 2K2UA 4WVFB 4BBKA 3O96A 4ZRJA 1ZM0A 4K81A 1DDVA 1W1HA 1Q67A 2R09A 2Z0OA 4TYZA 2D10A 3D8FA 1WVHA 1XODA 1XX0A 2GJYA 3AU4A 3QWMA 1U5DA 2VSZA 5C16A 2AL6A 2P8VA 1WG7A 5GOWB 5FI0A 2EMTA 4MK0A 5DIFB 2COCA 1WJMA 2Z0PA 4GMXB 1AWEA 3AU5A 1V89A 4DXAB 2J0MA 4EMOA 2XQNM 2M38A 1W1DA 4YL8A 3V5WA 2GCLA 2YS3A 2RLOA 4ZRKA 2CAYA 1BWNA 1X86A 2DHJA 3NSUA 5JLJB 2DX1A 4F7GA 4HDQA 2V76A 1V61A 2CY5A 5C5BA 2X18A 1UPQA 1U5FA 1LB1A 1X11A 1MK9B 1U27A 3MPXA 4TKNA 2FJLA 1OMWA 3WA0A 2D11A 5D27A 3ULCA 2Z0QA 2CODA 2LG1A 1V5MA 1X1GA 4A6KA 5FI1A 1PFJA 2DN6A 2DFKA 2H7DA 2P0HA 3PG7A 3ZDTA 1X1FA 3QIJA 2D2QA 4K2OA 5HE1A 3N7CA 1Y5OA 1DYNA 4HB4B 2QKLA 1FHOA 1U5GA 5D3YA 2J0JA 2LKOA 2IFSA 1RJ2A 1WJ1A 2J59M 5HE3A 1TXDA 2L1CA 3D8DA 1V5PA 1UNRA 4H8SA 4IFSA 3WYFB 2CRFA 5DH9B 3D8EA 2YSZA 3HK0A 1B55A 1MPHA 1EGXA 1EVHA 1GC7A 5JP4A 3T06A 4HAVB 2RVBB 3SNHA 2COAA 2E2XA 4MT7A 1AQCA 1M7RA 1H10A 4ZRIA 5KQ1A 3ODWA 5D3XA 2YF0A 3SO6A 1P5TA 5J3TA 2Y8FA 1XCGA 1U2BA 1NTVA 1XD4A 1FHWA 1GG3A 1K5GB 2VRWB 2K2JA 1KZGA 1WGQA 4CHJA 3KY9A 3A8PA 2I1KA 5JHGA 3PVLA 3TFMA 1UNPA 2D9ZA 3PP2A 4DX90 4EKUA 2DLWA 3TO1A 2R0DA 2DHKA 2K00A 2AEHA 3PSCA 2W2XC 4KHBB 2Q13A 2HTHB 1OQNA 4HB0B 4IAPA 2DHIA 2LYDA 1DDMA 5EFXA 5CLQB 4A6FB 4DX8A 1V88A 2NZ8B 3DXCA 1ZSQA 2RUKB 3U7DA 1V5UA 2W2WA 2ZPYA 4PQ0A 1I2HA 1Z87A 5DHFB 5C6RA 4K17A 1ZC3B 3U8ZA 3P7ZA 4DBBA 2ELBA 1FB8A 3BJIA 3PEGA 1MAIA 2DKPA 3GYPA 2ROVA 5KQ4A 1FHXA 2OQBA 4Z2MB 2YS5A 4F7HA 3HW2B 4HB3B 3F0WA 1TQZA 4YONA 1I7AA 3VOQA 1U5EA 5CLLB 1J0WA 3KSYA 2RGNB 4GZUA 3ULBA 2D9YA 2CY4A 4GN1A 1SHCA 2UVMA 2KGXB 3DXEA 4PNKA 2OTXA 4MY6A 3TVVA 2P0DA 1IRSA 1DBHA 2LOXA 1BTKA 4GMVA
chains in the Genus database with same CATH superfamily
2ADZA 1UPRA 1XKEA 3TW1A 2PZ1A 2I1JA 4KHBA 5DHAB 2KIGA 2RSGA 2IYBA 1N3HA 2N23A 5HE0A 3RCPA 2JP2A 2KCJA 4A6FA 1P6SA 3GYOA 2ROZB 1ZC4B 3AJ4A 2BCJA 2MWNB 4HAWB 4XWXA 5KCVA 2EJ8A 2YVCA 4WSFA 2I5FA 4KHAA 3A8QA 5J3QA 2W2XD 2D9XA 2NBVA 3PZDA 2VKIA 3SYXA 5I2SA 2MFQA 5JHHA 4K2PA 4NY0A 1MIXA 3X23A 1DDWA 3NWAA 3A98B 4HAZB 2YT1A 3FEHA 1PLSA 4CHMA 1MK7B 3ZVRA 2L2IA 2H7EA 3IVFA 1Y19B 1BTNA 3PVUA 1ZVRA 3FM8C 5C79A 4Z2NA 2RRFA 2KUPA 2NMBA 2FJUB 3ODXA 1M7EA 1E5WA 4IOYX 1EF1A 3ODOA 4HAUB 1W1GA 4GPTB 2UZSA 2YT0A 4KAXB 1MIZB 2ELAA 3KRXA 1DROA 5HE2A 3SUZA 1QC6A 1OY2A 3PVWA 1UEFA 3P6AA 3CXBB 1RRPB 2D9WA 2DKQA 2EMSA 1BAKA 4KVGB 5LOPB 3SV1A 3M1IB 4F7UP 1WI1A 1X05A 4NSWA 1NTYA 1WGUA 4A6HA 3NW8A 2EC1A 2D9VA 4CYEA 2DYQA 2LULA 2M14A 3TCAA 3DXDA 3MDBC 2YS1A 2YT2A 4HAYB 3KZ1A 2HE7A 3BINA 4L1RA 1J19A 1TJ6A 2I5CA 2UZRA 4HATB 4D6WA 3FVCA 3OANA 1NI2A 2K49A 1LW3A 3HIEA 4L6EA 2COFA 2J0KA 2GS0A 2DA0A 2DTCA 2Y8GA 1XR0B 4WJ7A 2ZKMX 5L81A 5D3VA 2MDXA 2MKRA 1KZ7A 2QKMA 1NU2A 4P7IA 4C0AA 4GXBA 3FSSA 1MKEA 4HDOA 2RNRB 5J3YA 4HB2B 4KHOA 1ISNA 3KRWA 2G35A 3QBVB 1GC6A 2P0FA 4HHVA 4D0NB 1FAOA 2Y7BA 2GUMA 4B6HA 4A5KA 1FOEA 5LONB 4HAXB 3HQCA 1KI1B 1QQGA 1ZYIA 5C5BB 1P3RA 2GCJA 3G9WA 2DX5A 1FGZA 3VIAA 2LOZA 5DI9B 1PMSA 4EJNA 1U29A 2N0YA 2KIEA 1H4RA 4GNKB 1FGYA 2D4QA 1K5DB 1SGHA 3ML4A 3LJUX 2YRYA 3HSAA 4Y94A 3UZTA 1UNQA 3F5RA 5D3WA 1EAZA 2DYNA 3CIKA 2K2UA 4WVFB 4BBKA 3O96A 4ZRJA 1ZM0A 4K81A 1DDVA 1W1HA 1Q67A 2R09A 2Z0OA 4TYZA 2D10A 2Z59A 3D8FA 1WVHA 1XODA 1XX0A 2GJYA 3AU4A 3QWMA 1U5DA 3DCXA 2VSZA 5C16A 2AL6A 2P8VA 1WG7A 5GOWB 5FI0A 2EMTA 4MK0A 5DIFB 2COCA 1WJMA 2Z0PA 4GMXB 1AWEA 3AU5A 1V89A 4DXAB 2J0MA 4EMOA 2XQNM 2M38A 1W1DA 4YL8A 5M4YB 3V5WA 3OHMB 3U12A 2GCLA 2YS3A 2RLOA 4ZRKA 2CAYA 1BWNA 1X86A 2DHJA 3NSUA 5JLJB 5IRSA 2DX1A 4F7GA 4HDQA 2V76A 1V61A 2CY5A 5C5BA 2X18A 1UPQA 1U5FA 1LB1A 1X11A 1MK9B 1U27A 3MPXA 4TKNA 2FJLA 1OMWA 3WA0A 2D11A 5D27A 3ULCA 2Z0QA 2CODA 2LG1A 1V5MA 1X1GA 4OT1A 4A6KA 5FI1A 1PFJA 2DN6A 2DFKA 2H7DA 2P0HA 3PG7A 4QXAB 3ZDTA 1X1FA 3QIJA 5I2MA 2D2QA 4K2OA 3NWFA 5HE1A 3N7CA 1Y5OA 1DYNA 2KUQA 4HB4B 4QJ5B 3B77A 4GOUA 4OSNA 2QKLA 1FHOA 1U5GA 5D3YA 4QJ4B 2Z14A 2J0JA 2LKOA 2Z13A 2IFSA 1RJ2A 1WJ1A 2J59M 5HE3A 1TXDA 2L1CA 3D8DA 1V5PA 1UNRA 4H8SA 4IFSA 3WYFB 2CRFA 5DH9B 3D8EA 2YSZA 3HK0A 1B55A 1MPHA 1EGXA 1EVHA 1GC7A 5JP4A 3T06A 4HAVB 2RVBB 3SNHA 2COAA 2E2XA 4MT7A 1AQCA 1M7RA 1H10A 5LG4B 4ZRIA 4CSQA 5KQ1A 3ODWA 5D3XA 2YF0A 3SO6A 1P5TA 5J3TA 2Y8FA 1T77A 1XCGA 1U2BA 1NTVA 4DIXA 1XD4A 1FHWA 3NWDA 1GG3A 1K5GB 2VRWB 2K2JA 1KZGA 1WGQA 4CHJA 3KY9A 3A8PA 2I1KA 5JHGA 3PVLA 3TFMA 1UNPA 2D9ZA 3PP2A 4DX90 4EKUA 2DLWA 3TO1A 2R0DA 2DHKA 2K00A 2AEHA 3PSCA 2W2XC 4HSIA 4KHBB 2Q13A 2HTHB 1OQNA 4HB0B 4IAPA 2DHIA 2LYDA 1DDMA 5EFXA 5CLQB 4A6FB 4DX8A 1V88A 2NZ8B 3DXCA 1ZSQA 2RUKB 3U7DA 2KR0A 1V5UA 2W2WA 2ZPYA 4PQ0A 1I2HA 1Z87A 5DHFB 5C6RA 4K17A 1ZC3B 2K8EA 3U8ZA 3A58A 3P7ZA 4DBBA 1MI1A 2ELBA 4QJ3B 1FB8A 3BJIA 3PEGA 1MAIA 2DKPA 3GYPA 2ROVA 5KQ4A 1FHXA 2OQBA 4Z2MB 2YS5A 4F7HA 3HW2B 4HB3B 3F0WA 1TQZA 4YONA 1I7AA 3VOQA 1U5EA 5CLLB 1J0WA 3KSYA 2RGNB 4GZUA 3ULBA 2D9YA 2CY4A 2R2YA 4GN1A 1SHCA 2UVMA 2KGXB 3DXEA 4PNKA 2OTXA 4MY6A 3TVVA 2P0DA 1IRSA 1DBHA 2LOXA 1BTKA 2Z4DA 4GMVA
chains in the Genus database with same CATH topology
2ADZA 1UPRA 1XKEA 3TW1A 2PZ1A 2I1JA 5DHAB 2RSGA 2IYBA 1N3HA 2N23A 5HE0A 3RCPA 2JP2A 2KCJA 4A6FA 1P6SA 3GYOA 2ROZB 1ZC4B 3AJ4A 2BCJA 2MWNB 4HAWB 4XWXA 5KCVA 2EJ8A 2YVCA 4WSFA 2I5FA 4KHAA 3A8QA 5J3QA 2W2XD 2D9XA 3PZDA 2VKIA 3SYXA 2MFQA 5JHHA 4K2PA 4NY0A 1MIXA 3X23A 1DDWA 3A98B 4HAZB 2YT1A 3FEHA 1PLSA 4CHMA 1MK7B 3ZVRA 2L2IA 2H7EA 3IVFA 1Y19B 1BTNA 3PVUA 1ZVRA 3FM8C 5C79A 4Z2NA 2KUPA 2NMBA 3ODXA 1M7EA 1E5WA 4IOYX 1EF1A 3ODOA 4HAUB 1W1GA 4GPTB 2UZSA 2YT0A 4KAXB 1MIZB 2ELAA 3KRXA 1DROA 5HE2A 3SUZA 1QC6A 1OY2A 3PVWA 1UEFA 3P6AA 3CXBB 1RRPB 2D9WA 2DKQA 2EMSA 1BAKA 4KVGB 5LOPB 3SV1A 3M1IB 4F7UP 1WI1A 1X05A 4NSWA 1NTYA 1WGUA 4A6HA 2EC1A 2D9VA 4CYEA 2DYQA 2LULA 2M14A 3TCAA 3DXDA 3MDBC 2YS1A 4HAYB 3KZ1A 2HE7A 3BINA 1J19A 1TJ6A 2I5CA 2UZRA 4HATB 3OANA 1NI2A 1LW3A 4L6EA 2COFA 2J0KA 2GS0A 2DA0A 2DTCA 2Y8GA 1XR0B 4WJ7A 5L81A 5D3VA 2MDXA 2MKRA 1KZ7A 2QKMA 1NU2A 4P7IA 4C0AA 4GXBA 3FSSA 1MKEA 4HDOA 2RNRB 5J3YA 4HB2B 4KHOA 1ISNA 3KRWA 2G35A 3QBVB 1GC6A 2P0FA 4HHVA 4D0NB 1FAOA 2Y7BA 4B6HA 4A5KA 1FOEA 5LONB 4HAXB 3HQCA 1KI1B 1QQGA 5C5BB 1P3RA 2GCJA 3G9WA 2DX5A 1FGZA 3VIAA 2LOZA 5DI9B 1PMSA 4EJNA 1U29A 2N0YA 1H4RA 1FGYA 2D4QA 1K5DB 1SGHA 3ML4A 3LJUX 2YRYA 4Y94A 3UZTA 1UNQA 3F5RA 5D3WA 1EAZA 2DYNA 3CIKA 2K2UA 4WVFB 4BBKA 3O96A 4ZRJA 1ZM0A 4K81A 1DDVA 1W1HA 1Q67A 2R09A 2Z0OA 4TYZA 2D10A 3D8FA 1WVHA 1XODA 1XX0A 2GJYA 3AU4A 3QWMA 1U5DA 2VSZA 5C16A 2AL6A 2P8VA 1WG7A 5GOWB 5FI0A 2EMTA 4MK0A 5DIFB 2COCA 1WJMA 2Z0PA 4GMXB 1AWEA 3AU5A 1V89A 4DXAB 2J0MA 4EMOA 2XQNM 2M38A 1W1DA 4YL8A 3V5WA 2GCLA 2YS3A 2RLOA 4ZRKA 2CAYA 1BWNA 1X86A 2DHJA 3NSUA 5JLJB 2DX1A 4F7GA 4HDQA 2V76A 1V61A 2CY5A 5C5BA 2X18A 1UPQA 1U5FA 1LB1A 1X11A 1MK9B 1U27A 3MPXA 4TKNA 2FJLA 1OMWA 3WA0A 2D11A 5D27A 3ULCA 2Z0QA 2CODA 2LG1A 1V5MA 1X1GA 4A6KA 5FI1A 1PFJA 2DN6A 2DFKA 2H7DA 2P0HA 3PG7A 3ZDTA 1X1FA 3QIJA 2D2QA 4K2OA 5HE1A 3N7CA 1Y5OA 1DYNA 4HB4B 2QKLA 1FHOA 1U5GA 5D3YA 2J0JA 2LKOA 2IFSA 1RJ2A 1WJ1A 2J59M 5HE3A 1TXDA 2L1CA 3D8DA 1V5PA 1UNRA 4H8SA 4IFSA 3WYFB 2CRFA 5DH9B 3D8EA 2YSZA 3HK0A 1B55A 1MPHA 1EGXA 1EVHA 1GC7A 5JP4A 3T06A 4HAVB 2RVBB 3SNHA 2COAA 2E2XA 4MT7A 1AQCA 1M7RA 1H10A 4ZRIA 5KQ1A 3ODWA 5D3XA 2YF0A 3SO6A 1P5TA 5J3TA 2Y8FA 1XCGA 1U2BA 1NTVA 1XD4A 1FHWA 1GG3A 1K5GB 2VRWB 2K2JA 1KZGA 1WGQA 4CHJA 3KY9A 3A8PA 2I1KA 5JHGA 3PVLA 3TFMA 1UNPA 2D9ZA 3PP2A 4DX90 4EKUA 2DLWA 3TO1A 2R0DA 2DHKA 2K00A 2AEHA 3PSCA 2W2XC 4KHBB 2Q13A 2HTHB 1OQNA 4HB0B 4IAPA 2DHIA 2LYDA 1DDMA 5EFXA 5CLQB 4A6FB 4DX8A 1V88A 2NZ8B 3DXCA 1ZSQA 2RUKB 3U7DA 1V5UA 2W2WA 2ZPYA 4PQ0A 1I2HA 1Z87A 5DHFB 5C6RA 4K17A 1ZC3B 3U8ZA 3P7ZA 4DBBA 2ELBA 1FB8A 3BJIA 3PEGA 1MAIA 2DKPA 3GYPA 2ROVA 5KQ4A 1FHXA 2OQBA 4Z2MB 2YS5A 4F7HA 3HW2B 4HB3B 3F0WA 1TQZA 4YONA 1I7AA 3VOQA 1U5EA 5CLLB 1J0WA 3KSYA 2RGNB 4GZUA 3ULBA 2D9YA 2CY4A 4GN1A 1SHCA 2UVMA 2KGXB 3DXEA 4PNKA 2OTXA 4MY6A 3TVVA 2P0DA 1IRSA 1DBHA 2LOXA 1BTKA 4GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADZ A;  1UPR A;  1XKE A;  3TW1 A;  2PZ1 A;  2I1J A;  5DHA B;  2RSG A;  2IYB A;  1N3H A;  2N23 A;  5HE0 A;  3RCP A;  2JP2 A;  2KCJ A;  4A6F A;  1P6S A;  3GYO A;  2ROZ B;  1ZC4 B;  3AJ4 A;  2BCJ A;  2MWN B;  4HAW B;  4XWX A;  5KCV A;  2EJ8 A;  2YVC A;  4WSF A;  2I5F A;  4KHA A;  3A8Q A;  5J3Q A;  2W2X D;  2D9X A;  3PZD A;  2VKI A;  3SYX A;  2MFQ A;  5JHH A;  4K2P A;  4NY0 A;  1MIX A;  3X23 A;  1DDW A;  3A98 B;  4HAZ B;  2YT1 A;  3FEH A;  1PLS A;  4CHM A;  1MK7 B;  3ZVR A;  2L2I A;  2H7E A;  3IVF A;  1Y19 B;  1BTN A;  3PVU A;  1ZVR A;  3FM8 C;  5C79 A;  4Z2N A;  2KUP A;  2NMB A;  3ODX A;  1M7E A;  1E5W A;  4IOY X;  1EF1 A;  3ODO A;  4HAU B;  1W1G A;  4GPT B;  2UZS A;  2YT0 A;  4KAX B;  1MIZ B;  2ELA A;  3KRX A;  1DRO A;  5HE2 A;  3SUZ A;  1QC6 A;  1OY2 A;  3PVW A;  1UEF A;  3P6A A;  3CXB B;  1RRP B;  2D9W A;  2DKQ A;  2EMS A;  1BAK A;  4KVG B;  5LOP B;  3SV1 A;  3M1I B;  4F7U P;  1WI1 A;  1X05 A;  4NSW A;  1NTY A;  1WGU A;  4A6H A;  2EC1 A;  2D9V A;  4CYE A;  2DYQ A;  2LUL A;  2M14 A;  3TCA A;  3DXD A;  3MDB C;  2YS1 A;  4HAY B;  3KZ1 A;  2HE7 A;  3BIN A;  1J19 A;  1TJ6 A;  2I5C A;  2UZR A;  4HAT B;  3OAN A;  1NI2 A;  1LW3 A;  4L6E A;  2COF A;  2J0K A;  2GS0 A;  2DA0 A;  2DTC A;  2Y8G A;  1XR0 B;  4WJ7 A;  5L81 A;  5D3V A;  2MDX A;  2MKR A;  1KZ7 A;  2QKM A;  1NU2 A;  4P7I A;  4C0A A;  4GXB A;  3FSS A;  1MKE A;  4HDO A;  2RNR B;  5J3Y A;  4HB2 B;  4KHO A;  1ISN A;  3KRW A;  2G35 A;  3QBV B;  1GC6 A;  2P0F A;  4HHV A;  4D0N B;  1FAO A;  2Y7B A;  4B6H A;  4A5K A;  1FOE A;  5LON B;  4HAX B;  3HQC A;  1KI1 B;  1QQG A;  5C5B B;  1P3R A;  2GCJ A;  3G9W A;  2DX5 A;  1FGZ A;  3VIA A;  2LOZ A;  5DI9 B;  1PMS A;  4EJN A;  1U29 A;  2N0Y A;  1H4R A;  1FGY A;  2D4Q A;  1K5D B;  1SGH A;  3ML4 A;  3LJU X;  2YRY A;  4Y94 A;  3UZT A;  1UNQ A;  3F5R A;  5D3W A;  1EAZ A;  2DYN A;  3CIK A;  2K2U A;  4WVF B;  4BBK A;  3O96 A;  4ZRJ A;  1ZM0 A;  4K81 A;  1DDV A;  1W1H A;  1Q67 A;  2R09 A;  2Z0O A;  4TYZ A;  2D10 A;  3D8F A;  1WVH A;  1XOD A;  1XX0 A;  2GJY A;  3AU4 A;  3QWM A;  1U5D A;  2VSZ A;  5C16 A;  2AL6 A;  2P8V A;  1WG7 A;  5GOW B;  5FI0 A;  2EMT A;  4MK0 A;  5DIF B;  2COC A;  1WJM A;  2Z0P A;  4GMX B;  1AWE A;  3AU5 A;  1V89 A;  4DXA B;  2J0M A;  4EMO A;  2XQN M;  2M38 A;  1W1D A;  4YL8 A;  3V5W A;  2GCL A;  2YS3 A;  2RLO A;  4ZRK A;  2CAY A;  1BWN A;  1X86 A;  2DHJ A;  3NSU A;  5JLJ B;  2DX1 A;  4F7G A;  4HDQ A;  2V76 A;  1V61 A;  2CY5 A;  5C5B A;  2X18 A;  1UPQ A;  1U5F A;  1LB1 A;  1X11 A;  1MK9 B;  1U27 A;  3MPX A;  4TKN A;  2FJL A;  1OMW A;  3WA0 A;  2D11 A;  5D27 A;  3ULC A;  2Z0Q A;  2COD A;  2LG1 A;  1V5M A;  1X1G A;  4A6K A;  5FI1 A;  1PFJ A;  2DN6 A;  2DFK A;  2H7D A;  2P0H A;  3PG7 A;  3ZDT A;  1X1F A;  3QIJ A;  2D2Q A;  4K2O A;  5HE1 A;  3N7C A;  1Y5O A;  1DYN A;  4HB4 B;  2QKL A;  1FHO A;  1U5G A;  5D3Y A;  2J0J A;  2LKO A;  2IFS A;  1RJ2 A;  1WJ1 A;  2J59 M;  5HE3 A;  1TXD A;  2L1C A;  3D8D A;  1V5P A;  1UNR A;  4H8S A;  4IFS A;  3WYF B;  2CRF A;  5DH9 B;  3D8E A;  2YSZ A;  3HK0 A;  1B55 A;  1MPH A;  1EGX A;  1EVH A;  1GC7 A;  5JP4 A;  3T06 A;  4HAV B;  2RVB B;  3SNH A;  2COA A;  2E2X A;  4MT7 A;  1AQC A;  1M7R A;  1H10 A;  4ZRI A;  5KQ1 A;  3ODW A;  5D3X A;  2YF0 A;  3SO6 A;  1P5T A;  5J3T A;  2Y8F A;  1XCG A;  1U2B A;  1NTV A;  1XD4 A;  1FHW A;  1GG3 A;  1K5G B;  2VRW B;  2K2J A;  1KZG A;  1WGQ A;  4CHJ A;  3KY9 A;  3A8P A;  2I1K A;  5JHG A;  3PVL A;  3TFM A;  1UNP A;  2D9Z A;  3PP2 A;  4DX9 0;  4EKU A;  2DLW A;  3TO1 A;  2R0D A;  2DHK A;  2K00 A;  2AEH A;  3PSC A;  2W2X C;  4KHB B;  2Q13 A;  2HTH B;  1OQN A;  4HB0 B;  4IAP A;  2DHI A;  2LYD A;  1DDM A;  5EFX A;  5CLQ B;  4A6F B;  4DX8 A;  1V88 A;  2NZ8 B;  3DXC A;  1ZSQ A;  2RUK B;  3U7D A;  1V5U A;  2W2W A;  2ZPY A;  4PQ0 A;  1I2H A;  1Z87 A;  5DHF B;  5C6R A;  4K17 A;  1ZC3 B;  3U8Z A;  3P7Z A;  4DBB A;  2ELB A;  1FB8 A;  3BJI A;  3PEG A;  1MAI A;  2DKP A;  3GYP A;  2ROV A;  5KQ4 A;  1FHX A;  2OQB A;  4Z2M B;  2YS5 A;  4F7H A;  3HW2 B;  4HB3 B;  3F0W A;  1TQZ A;  4YON A;  1I7A A;  3VOQ A;  1U5E A;  5CLL B;  1J0W A;  3KSY A;  2RGN B;  4GZU A;  3ULB A;  2D9Y A;  2CY4 A;  4GN1 A;  1SHC A;  2UVM A;  2KGX B;  3DXE A;  4PNK A;  2OTX A;  4MY6 A;  3TVV A;  2P0D A;  1IRS A;  1DBH A;  2LOX A;  1BTK A;  4GMV A; 
#chains in the Genus database with same CATH topology
 2ADZ A;  1UPR A;  1XKE A;  3TW1 A;  2PZ1 A;  2I1J A;  4KHB A;  5DHA B;  2KIG A;  2RSG A;  2IYB A;  1N3H A;  2N23 A;  5HE0 A;  3RCP A;  2JP2 A;  2KCJ A;  4A6F A;  1P6S A;  3GYO A;  2ROZ B;  1ZC4 B;  3AJ4 A;  2BCJ A;  2MWN B;  4HAW B;  4XWX A;  5KCV A;  2EJ8 A;  2YVC A;  4WSF A;  2I5F A;  4KHA A;  3A8Q A;  5J3Q A;  2W2X D;  2D9X A;  2NBV A;  3PZD A;  2VKI A;  3SYX A;  5I2S A;  2MFQ A;  5JHH A;  4K2P A;  4NY0 A;  1MIX A;  3X23 A;  1DDW A;  3NWA A;  3A98 B;  4HAZ B;  2YT1 A;  3FEH A;  1PLS A;  4CHM A;  1MK7 B;  3ZVR A;  2L2I A;  2H7E A;  3IVF A;  1Y19 B;  1BTN A;  3PVU A;  1ZVR A;  3FM8 C;  5C79 A;  4Z2N A;  2RRF A;  2KUP A;  2NMB A;  2FJU B;  3ODX A;  1M7E A;  1E5W A;  4IOY X;  1EF1 A;  3ODO A;  4HAU B;  1W1G A;  4GPT B;  2UZS A;  2YT0 A;  4KAX B;  1MIZ B;  2ELA A;  3KRX A;  1DRO A;  5HE2 A;  3SUZ A;  1QC6 A;  1OY2 A;  3PVW A;  1UEF A;  3P6A A;  3CXB B;  1RRP B;  2D9W A;  2DKQ A;  2EMS A;  1BAK A;  4KVG B;  5LOP B;  3SV1 A;  3M1I B;  4F7U P;  1WI1 A;  1X05 A;  4NSW A;  1NTY A;  1WGU A;  4A6H A;  3NW8 A;  2EC1 A;  2D9V A;  4CYE A;  2DYQ A;  2LUL A;  2M14 A;  3TCA A;  3DXD A;  3MDB C;  2YS1 A;  2YT2 A;  4HAY B;  3KZ1 A;  2HE7 A;  3BIN A;  4L1R A;  1J19 A;  1TJ6 A;  2I5C A;  2UZR A;  4HAT B;  4D6W A;  3FVC A;  3OAN A;  1NI2 A;  2K49 A;  1LW3 A;  3HIE A;  4L6E A;  2COF A;  2J0K A;  2GS0 A;  2DA0 A;  2DTC A;  2Y8G A;  1XR0 B;  4WJ7 A;  2ZKM X;  5L81 A;  5D3V A;  2MDX A;  2MKR A;  1KZ7 A;  2QKM A;  1NU2 A;  4P7I A;  4C0A A;  4GXB A;  3FSS A;  1MKE A;  4HDO A;  2RNR B;  5J3Y A;  4HB2 B;  4KHO A;  1ISN A;  3KRW A;  2G35 A;  3QBV B;  1GC6 A;  2P0F A;  4HHV A;  4D0N B;  1FAO A;  2Y7B A;  2GUM A;  4B6H A;  4A5K A;  1FOE A;  5LON B;  4HAX B;  3HQC A;  1KI1 B;  1QQG A;  1ZYI A;  5C5B B;  1P3R A;  2GCJ A;  3G9W A;  2DX5 A;  1FGZ A;  3VIA A;  2LOZ A;  5DI9 B;  1PMS A;  4EJN A;  1U29 A;  2N0Y A;  2KIE A;  1H4R A;  4GNK B;  1FGY A;  2D4Q A;  1K5D B;  1SGH A;  3ML4 A;  3LJU X;  2YRY A;  3HSA A;  4Y94 A;  3UZT A;  1UNQ A;  3F5R A;  5D3W A;  1EAZ A;  2DYN A;  3CIK A;  2K2U A;  4WVF B;  4BBK A;  3O96 A;  4ZRJ A;  1ZM0 A;  4K81 A;  1DDV A;  1W1H A;  1Q67 A;  2R09 A;  2Z0O A;  4TYZ A;  2D10 A;  2Z59 A;  3D8F A;  1WVH A;  1XOD A;  1XX0 A;  2GJY A;  3AU4 A;  3QWM A;  1U5D A;  3DCX A;  2VSZ A;  5C16 A;  2AL6 A;  2P8V A;  1WG7 A;  5GOW B;  5FI0 A;  2EMT A;  4MK0 A;  5DIF B;  2COC A;  1WJM A;  2Z0P A;  4GMX B;  1AWE A;  3AU5 A;  1V89 A;  4DXA B;  2J0M A;  4EMO A;  2XQN M;  2M38 A;  1W1D A;  4YL8 A;  5M4Y B;  3V5W A;  3OHM B;  3U12 A;  2GCL A;  2YS3 A;  2RLO A;  4ZRK A;  2CAY A;  1BWN A;  1X86 A;  2DHJ A;  3NSU A;  5JLJ B;  5IRS A;  2DX1 A;  4F7G A;  4HDQ A;  2V76 A;  1V61 A;  2CY5 A;  5C5B A;  2X18 A;  1UPQ A;  1U5F A;  1LB1 A;  1X11 A;  1MK9 B;  1U27 A;  3MPX A;  4TKN A;  2FJL A;  1OMW A;  3WA0 A;  2D11 A;  5D27 A;  3ULC A;  2Z0Q A;  2COD A;  2LG1 A;  1V5M A;  1X1G A;  4OT1 A;  4A6K A;  5FI1 A;  1PFJ A;  2DN6 A;  2DFK A;  2H7D A;  2P0H A;  3PG7 A;  4QXA B;  3ZDT A;  1X1F A;  3QIJ A;  5I2M A;  2D2Q A;  4K2O A;  3NWF A;  5HE1 A;  3N7C A;  1Y5O A;  1DYN A;  2KUQ A;  4HB4 B;  4QJ5 B;  3B77 A;  4GOU A;  4OSN A;  2QKL A;  1FHO A;  1U5G A;  5D3Y A;  4QJ4 B;  2Z14 A;  2J0J A;  2LKO A;  2Z13 A;  2IFS A;  1RJ2 A;  1WJ1 A;  2J59 M;  5HE3 A;  1TXD A;  2L1C A;  3D8D A;  1V5P A;  1UNR A;  4H8S A;  4IFS A;  3WYF B;  2CRF A;  5DH9 B;  3D8E A;  2YSZ A;  3HK0 A;  1B55 A;  1MPH A;  1EGX A;  1EVH A;  1GC7 A;  5JP4 A;  3T06 A;  4HAV B;  2RVB B;  3SNH A;  2COA A;  2E2X A;  4MT7 A;  1AQC A;  1M7R A;  1H10 A;  5LG4 B;  4ZRI A;  4CSQ A;  5KQ1 A;  3ODW A;  5D3X A;  2YF0 A;  3SO6 A;  1P5T A;  5J3T A;  2Y8F A;  1T77 A;  1XCG A;  1U2B A;  1NTV A;  4DIX A;  1XD4 A;  1FHW A;  3NWD A;  1GG3 A;  1K5G B;  2VRW B;  2K2J A;  1KZG A;  1WGQ A;  4CHJ A;  3KY9 A;  3A8P A;  2I1K A;  5JHG A;  3PVL A;  3TFM A;  1UNP A;  2D9Z A;  3PP2 A;  4DX9 0;  4EKU A;  2DLW A;  3TO1 A;  2R0D A;  2DHK A;  2K00 A;  2AEH A;  3PSC A;  2W2X C;  4HSI A;  4KHB B;  2Q13 A;  2HTH B;  1OQN A;  4HB0 B;  4IAP A;  2DHI A;  2LYD A;  1DDM A;  5EFX A;  5CLQ B;  4A6F B;  4DX8 A;  1V88 A;  2NZ8 B;  3DXC A;  1ZSQ A;  2RUK B;  3U7D A;  2KR0 A;  1V5U A;  2W2W A;  2ZPY A;  4PQ0 A;  1I2H A;  1Z87 A;  5DHF B;  5C6R A;  4K17 A;  1ZC3 B;  2K8E A;  3U8Z A;  3A58 A;  3P7Z A;  4DBB A;  1MI1 A;  2ELB A;  4QJ3 B;  1FB8 A;  3BJI A;  3PEG A;  1MAI A;  2DKP A;  3GYP A;  2ROV A;  5KQ4 A;  1FHX A;  2OQB A;  4Z2M B;  2YS5 A;  4F7H A;  3HW2 B;  4HB3 B;  3F0W A;  1TQZ A;  4YON A;  1I7A A;  3VOQ A;  1U5E A;  5CLL B;  1J0W A;  3KSY A;  2RGN B;  4GZU A;  3ULB A;  2D9Y A;  2CY4 A;  2R2Y A;  4GN1 A;  1SHC A;  2UVM A;  2KGX B;  3DXE A;  4PNK A;  2OTX A;  4MY6 A;  3TVV A;  2P0D A;  1IRS A;  1DBH A;  2LOX A;  1BTK A;  2Z4D A;  4GMV A; 
#chains in the Genus database with same CATH homology
 2ADZ A;  1UPR A;  1XKE A;  3TW1 A;  2PZ1 A;  2I1J A;  5DHA B;  2RSG A;  2IYB A;  1N3H A;  2N23 A;  5HE0 A;  3RCP A;  2JP2 A;  2KCJ A;  4A6F A;  1P6S A;  3GYO A;  2ROZ B;  1ZC4 B;  3AJ4 A;  2BCJ A;  2MWN B;  4HAW B;  4XWX A;  5KCV A;  2EJ8 A;  2YVC A;  4WSF A;  2I5F A;  4KHA A;  3A8Q A;  5J3Q A;  2W2X D;  2D9X A;  3PZD A;  2VKI A;  3SYX A;  2MFQ A;  5JHH A;  4K2P A;  4NY0 A;  1MIX A;  3X23 A;  1DDW A;  3A98 B;  4HAZ B;  2YT1 A;  3FEH A;  1PLS A;  4CHM A;  1MK7 B;  3ZVR A;  2L2I A;  2H7E A;  3IVF A;  1Y19 B;  1BTN A;  3PVU A;  1ZVR A;  3FM8 C;  5C79 A;  4Z2N A;  2KUP A;  2NMB A;  3ODX A;  1M7E A;  1E5W A;  4IOY X;  1EF1 A;  3ODO A;  4HAU B;  1W1G A;  4GPT B;  2UZS A;  2YT0 A;  4KAX B;  1MIZ B;  2ELA A;  3KRX A;  1DRO A;  5HE2 A;  3SUZ A;  1QC6 A;  1OY2 A;  3PVW A;  1UEF A;  3P6A A;  3CXB B;  1RRP B;  2D9W A;  2DKQ A;  2EMS A;  1BAK A;  4KVG B;  5LOP B;  3SV1 A;  3M1I B;  4F7U P;  1WI1 A;  1X05 A;  4NSW A;  1NTY A;  1WGU A;  4A6H A;  2EC1 A;  2D9V A;  4CYE A;  2DYQ A;  2LUL A;  2M14 A;  3TCA A;  3DXD A;  3MDB C;  2YS1 A;  4HAY B;  3KZ1 A;  2HE7 A;  3BIN A;  1J19 A;  1TJ6 A;  2I5C A;  2UZR A;  4HAT B;  3OAN A;  1NI2 A;  1LW3 A;  4L6E A;  2COF A;  2J0K A;  2GS0 A;  2DA0 A;  2DTC A;  2Y8G A;  1XR0 B;  4WJ7 A;  5L81 A;  5D3V A;  2MDX A;  2MKR A;  1KZ7 A;  2QKM A;  1NU2 A;  4P7I A;  4C0A A;  4GXB A;  3FSS A;  1MKE A;  4HDO A;  2RNR B;  5J3Y A;  4HB2 B;  4KHO A;  1ISN A;  3KRW A;  2G35 A;  3QBV B;  1GC6 A;  2P0F A;  4HHV A;  4D0N B;  1FAO A;  2Y7B A;  4B6H A;  4A5K A;  1FOE A;  5LON B;  4HAX B;  3HQC A;  1KI1 B;  1QQG A;  5C5B B;  1P3R A;  2GCJ A;  3G9W A;  2DX5 A;  1FGZ A;  3VIA A;  2LOZ A;  5DI9 B;  1PMS A;  4EJN A;  1U29 A;  2N0Y A;  1H4R A;  1FGY A;  2D4Q A;  1K5D B;  1SGH A;  3ML4 A;  3LJU X;  2YRY A;  4Y94 A;  3UZT A;  1UNQ A;  3F5R A;  5D3W A;  1EAZ A;  2DYN A;  3CIK A;  2K2U A;  4WVF B;  4BBK A;  3O96 A;  4ZRJ A;  1ZM0 A;  4K81 A;  1DDV A;  1W1H A;  1Q67 A;  2R09 A;  2Z0O A;  4TYZ A;  2D10 A;  3D8F A;  1WVH A;  1XOD A;  1XX0 A;  2GJY A;  3AU4 A;  3QWM A;  1U5D A;  2VSZ A;  5C16 A;  2AL6 A;  2P8V A;  1WG7 A;  5GOW B;  5FI0 A;  2EMT A;  4MK0 A;  5DIF B;  2COC A;  1WJM A;  2Z0P A;  4GMX B;  1AWE A;  3AU5 A;  1V89 A;  4DXA B;  2J0M A;  4EMO A;  2XQN M;  2M38 A;  1W1D A;  4YL8 A;  3V5W A;  2GCL A;  2YS3 A;  2RLO A;  4ZRK A;  2CAY A;  1BWN A;  1X86 A;  2DHJ A;  3NSU A;  5JLJ B;  2DX1 A;  4F7G A;  4HDQ A;  2V76 A;  1V61 A;  2CY5 A;  5C5B A;  2X18 A;  1UPQ A;  1U5F A;  1LB1 A;  1X11 A;  1MK9 B;  1U27 A;  3MPX A;  4TKN A;  2FJL A;  1OMW A;  3WA0 A;  2D11 A;  5D27 A;  3ULC A;  2Z0Q A;  2COD A;  2LG1 A;  1V5M A;  1X1G A;  4A6K A;  5FI1 A;  1PFJ A;  2DN6 A;  2DFK A;  2H7D A;  2P0H A;  3PG7 A;  3ZDT A;  1X1F A;  3QIJ A;  2D2Q A;  4K2O A;  5HE1 A;  3N7C A;  1Y5O A;  1DYN A;  4HB4 B;  2QKL A;  1FHO A;  1U5G A;  5D3Y A;  2J0J A;  2LKO A;  2IFS A;  1RJ2 A;  1WJ1 A;  2J59 M;  5HE3 A;  1TXD A;  2L1C A;  3D8D A;  1V5P A;  1UNR A;  4H8S A;  4IFS A;  3WYF B;  2CRF A;  5DH9 B;  3D8E A;  2YSZ A;  3HK0 A;  1B55 A;  1MPH A;  1EGX A;  1EVH A;  1GC7 A;  5JP4 A;  3T06 A;  4HAV B;  2RVB B;  3SNH A;  2COA A;  2E2X A;  4MT7 A;  1AQC A;  1M7R A;  1H10 A;  4ZRI A;  5KQ1 A;  3ODW A;  5D3X A;  2YF0 A;  3SO6 A;  1P5T A;  5J3T A;  2Y8F A;  1XCG A;  1U2B A;  1NTV A;  1XD4 A;  1FHW A;  1GG3 A;  1K5G B;  2VRW B;  2K2J A;  1KZG A;  1WGQ A;  4CHJ A;  3KY9 A;  3A8P A;  2I1K A;  5JHG A;  3PVL A;  3TFM A;  1UNP A;  2D9Z A;  3PP2 A;  4DX9 0;  4EKU A;  2DLW A;  3TO1 A;  2R0D A;  2DHK A;  2K00 A;  2AEH A;  3PSC A;  2W2X C;  4KHB B;  2Q13 A;  2HTH B;  1OQN A;  4HB0 B;  4IAP A;  2DHI A;  2LYD A;  1DDM A;  5EFX A;  5CLQ B;  4A6F B;  4DX8 A;  1V88 A;  2NZ8 B;  3DXC A;  1ZSQ A;  2RUK B;  3U7D A;  1V5U A;  2W2W A;  2ZPY A;  4PQ0 A;  1I2H A;  1Z87 A;  5DHF B;  5C6R A;  4K17 A;  1ZC3 B;  3U8Z A;  3P7Z A;  4DBB A;  2ELB A;  1FB8 A;  3BJI A;  3PEG A;  1MAI A;  2DKP A;  3GYP A;  2ROV A;  5KQ4 A;  1FHX A;  2OQB A;  4Z2M B;  2YS5 A;  4F7H A;  3HW2 B;  4HB3 B;  3F0W A;  1TQZ A;  4YON A;  1I7A A;  3VOQ A;  1U5E A;  5CLL B;  1J0W A;  3KSY A;  2RGN B;  4GZU A;  3ULB A;  2D9Y A;  2CY4 A;  4GN1 A;  1SHC A;  2UVM A;  2KGX B;  3DXE A;  4PNK A;  2OTX A;  4MY6 A;  3TVV A;  2P0D A;  1IRS A;  1DBH A;  2LOX A;  1BTK A;  4GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...