2W3DA

Structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 39
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3dA00
2VEAA 3NHQA 4EUVA 4MDZA 4G3KA 5HL6A 2LB9A 4GLQA 4Q0HA 1YSPA 3IBJA 2M7UA 3HCYA 4LRYC 4YNRA 5DFYA 3C2WA 4Y5FA 4DMZA 2HGVA 4R6LA 4MMNA 3KO6A 2G7UA 2W3HA 3S7PA 4BWIA 3MQ0A 3KSIA 4ETZA 4GW9A 4MN7A 3S7OA 1TD5A 2W3FA 2W3GA 2XROA 3S7QA 1MC0A 4Z1WA 2W1TA 3D3OA 3CITA 2XSSA 2ZMFA 1STZA 3VV4A 3MMHA 4IUHA 4O01A 2O99A 3K2NA 2IA2A 3MF0A 4FOFA 2KOIA 2K31A 3IBRA 3S7NA 2O9BA 2W3DA 3OBFA 4G3VA 5AJGA 4QPRA 4IJGA 3LFVA 1TF1A 2LB5A 5TJJA 5HSQA 3DBAA 4ME4A 3ZQ5A 4Y3IA 1YSQA 2M7VA 2GX5A 3BJNA 4Q0JA 2W3EA 4LRXC 3NOPC 3NOUC 4CQHA 2W1RA 4Q0IA 4ETXA 4Y2FA 4YOFA 1F5MA 1ZTUA 2QYBA 1VHMA 3RFBA 4PAUA 5K5BA 3E0YA 5HPIA 5HPFA 2O0YA 2Y8HA 5LBRA 2VJWA 4ZRRA 2K2NA 5I5LA 4IUKA 4RQ9A 2O9AA 4O0PA 3CI6A 4O8GA 3KSFA 3KSGA 3R4KA 5L8MA 4E04A 3KSHA 2XRNA 3OOVA 2W1TB 5DFXA 3E98A 5C5KA 2O9CA 4MCWA 2OOLA 2VZWA 3O5YA 1MKMA 2B18A 2KLIA 4LRZE 1YKDA 3EEAA 3TRCA 4EU0A 4G3WA 3G6OA 2VKSA 4DN0A 3NOTC 2Y79A 3W2ZA 4R70A
chains in the Genus database with same CATH superfamily
5DF7A 4LCLA 3V3RA 3WRTA 3IXBA 1BLCA 3HCYA 3ZVTA 4R6LA 2KDKA 3IF6A 5IS1A 2HV1A 4I38A 1WE4A 4X69A 4GW9A 3UMEA 2V2FF 3D3OA 3EGXC 4EBNA 3Q7ZA 4K0XA 4R1GA 3P98A 1V9YA 4OKPA 1BLPA 3DWZA 3MKFA 1ZKJA 2Y55A 5GLBA 3VP3A 4HBTA 4X1MA 1DP6A 1YMXA 4JXSA 4QY6A 3PBRA 3QNBA 5AQAA 4Q0JA 2PT7A 2PR5A 4E3IA 1WYCA 2XGNA 4Q8IA 1G5UA 2JHEA 4CJNA 4QD4A 5HFOA 1S67L 4S2NA 2EX6A 1ONGA 2QPNA 2WKIA 3WS4A 3NBLA 3ZYTA 2ZMVA 4NEED 2Q0OA 1YLWA 3CZDA 3KSHA 3C7UA 2CMNA 4BD1A 2Z2MB 5HAIA 2WAEA 4WEKA 4GNUA 5FA7A 4RYEA 1VM1A 3VOZA 1H8ZA 1XA7A 3CPTB 5GHXA 4XT2B 2ZC7A 4WMCD 1YKDA 3FPWA 3O86A 5FL3A 2WKPA 3U2AA 3UNWA 5HL6A 4BBVA 4LRYC 2OAP1 4UA7A 4R3AA 1PRQA 1YLYA 3H82A 1OT9A 2OWHA 4OPYA 5IT5A 2W3GA 3SS4A 1S6RA 2NUTC 3T4OA 2B95A 2Y91A 3BRMA 1RGYA 4M4XA 5CEDA 2QMIA 1CQAA 1OT6A 4IUHA 2AVXA 3MF0A 1T1AA 2KOIA 2WKEA 3DAVA 3VFFA 3DWKA 3LFVA 4IJGA 1EW0A 4H6JA 3LUQA 1D7EA 1J9MA 1W63M 4LRXC 1DJAA 4ETXA 5DJUA 3OCNA 4LCMA 1FR6A 3ISGA 5EVID 4NKPA 1GSVA 2K2NA 2Y2NA 5I5LA 2WKHA 3CI6A 1XKZA 4X25A 5FSRA 2ZOHA 1LT0A 4A5RA 1YLZA 2EXAA 3MXSA 4CLCE 4DE1A 1IYQA 1NYYA 2KLIA 1BZAA 4KG6A 4G3WA 4HH2A 3DTMA 2Y79A 4NXFA 4KZ8A 2Q9NA 3AGFA 2WGWB 4I3JA 1QMFA 4DXBA 3BY8A 1RGZA 2J9PA 5CGWA 1NLZA 3E2KA 4JPMA 4Y7PA 5FEFA 1LSWA 5FDSA 3ITBA 3UO9A 4ZJ1A 1ES4A 2ZMFA 1YM1A 4KZ4A 4EUZA 2HDQA 2O99A 1LL5A 1PNEA 3BEBA 4JF5A 2JKRI 4YFMA 2K31A 3BFGA 2V8CA 3EEHA 5GLDA 5L09A 5J8XA 4UA9A 2G2WA 5KSCA 1NRFA 4KQQA 1PI5A 4Y0TA 3W4PA 5CECA 3CAXA 5TJJA 5HSQA 3PXPA 3PAEA 4WF0A 1E4DA 1YAXA 2GX5A 1O7EA 3LY3A 4K91A 1GHMA 1KE3A 2V9AA 1ZG6A 4OPZA 4HESA 4KG2A 3FV7A 3FKWA 3LI8A 2QYBA 2GJ3A 1A0KA 5F82A 2R9XA 3HUNA 4OLGA 4OPRA 5IHVA 1K25A 4LV2A 4FCFA 1P0ZA 1V9ZA 3ZCZA 4O8GA 3UE1A 3KSFA 5HWWA 1CF0A 2RCXA 1VEUB 1I2SA 3U4LP 1K55C 3PBNA 2WGVA 2XFSA 4N9KA 3T4QA 3SH7A 5DTKA 3F1OA 4JGRA 4EBLA 1DJBA 3SW1A 3FPVA 3VFHA 3TRCA 3C38A 1S4SA 1P97A 4ZAMA 1K57C 4EUVA 4MDZA 1TS6A 4UEYA 2ZM0A 4L9EA 1Q2PA 3A3JA 4YNRA 3IWIA 5J3WA 3C2WA 4WLAA 3O88A 1XA1A 2HP5A 1PFLA 1TD5A 3S7QA 2PHYA 1XGJA 5CGXA 3BLSA 5AQ7A 5AVEA 3KYEA 4CLCB 2HP9A 4KQDA 3MQQA 3V39A 5FQKA 3G35A 2A49A 5KIZA 5EM1A 4Y0OA 1LHYA 3UB9A 4OP5A 2OLUA 1H0MA 1ESUA 3T1SA 3SS3A 3GSGA 3QHYA 1FR1A 1YSQA 2I9VA 3LICA 1YLPA 1NLYA 2V1AA 2W3EA 1CEFA 2PYRA 4GN2A 5CHUA 4NK3A 4S2PA 3P09A 1NY0A 1OJ5A 3E0YA 4C3QA 5E2EA 4HP9A 4HBUA 3L7HA 1KOUA 1YPRA 1Z09A 2VGLM 3W8KA 1I5QA 4F3LB 4JGQA 4HHDA 5EUAA 2L0WA 5EE8A 3KSGA 1ERMA 2H0TA 4JXGA 1S0WA 2VV7A 2O9CA 1EI5A 3UE3A 4IVIA 4UHUA 4P85A 2V1BA 3SZTA 3WRZA 1P9RA 4DN0A 3ICYA 3E4OA 3F1PB 4JXWA 2EA9A 3H7WA 3GECA 2M7UA 3RXWA 4DMZA 1H3QA 2D01A 3PHYA 1YT4A 4D60A 3MR0A 3S7OA 3ZG5A 4R3JA 3UB6A 5EVEA 1N9NA 3ZNYA 5HX9A 2W1TA 2XFTA 4R3BA 3T12B 3SH8A 2A3UA 4O01A 2V8FA 1MWRA 4BMWA 5FQQA 5U47A 3B42A 3VE4A 4GHIA 1OMEA 4UAAA 1HVBA 3IQAA 2P04A 4LV1A 2DNSA 3VOLA 4O7DA 3ZQ5A 4BQMA 1MPLA 3N8RA 3CUEA 3RTYA 4DF6A 2H5SA 4EWFA 3EOIA 1WA9A 3PBQA 1F5MA 4RX3A 3LIEA 3DW0A 2Y2OA 3UB8A 2ZJ9A 5HPFA 2O0YA 4MLLA 4CLCC 3LR3A 3ZDJA 5HWTA 1YLJA 1G68A 2V1ZA 3Q81A 1VB6A 4E3NA 1SCWA 2GZAA 3Q07A 1S66L 4RQ9A 3MJQA 4E04A 3VE3A 5CEBA 2Q9MA 1IOUA 5E2FA 2Y4AA 4WMCA 2QKPA 5F6AA 4EETB 2I72A 4X56A 2ZBBA 1MKMA 4IVKA 3V3SA 4OQHA 3IXGA 4JBFA 4BENA 1ACFA 3IX8A 3TOIA 5JYOA 2Y2HA 5HL1A 3P7NA 2XLNA 3LEQA 1ESIA 1PI4A 1JWZA 3KSIA 1OTDA 2Y2IA 3OPLA 1MWSA 4X6TA 3LI9A 1LL8A 4PKYG 5L07A 1D06A 2HDUA 5CXWA 3MZEA 5TBMA 2PD8A 5AJGA 3LCEA 4QPRA 5M19A 5GL9A 2PYPA 3D72A 4HJ4A 1N9OA 1MXOA 2QWSA 4B88A 2W27A 2P08A 3NOUC 4GJ4A 2J7VA 2V0UA 4JF6A 3F1NA 5KZHA 4FTXA 2Z6DA 3UDIA 5EVIA 2WKRA 1GA9A 4DE2A 1X0OA 3OPRA 5D3OA 4HJ3A 2P9VB 4MNRA 1K57A 1OPXA 3PBSA 3C4PA 3ZG8B 1RCJA 1XJ3A 3VOYA 1EROA 4FH4A 3R7WB 3DTIA 5FASA 5JYPA 2ZQDA 1PYYA 3CWFA 3CHWP 2XR0A 3MSHA 3ZVWA 3MKEA 4ARZB 1OJGA 4XXRA 3QP8A 1XPBA 3C7VA 3OLOA 3DTKA 3K3DA 5CGSA 3NDEA 3N8SA 2A24A 5FAPA 2VKSA 3CJMA 2E8JA 2XD1A 4S2KA 3BLMA 2ZD8A 3UB7A 4KZ5A 2FFFB 4DJ3A 4Y5FA 1WYBA 1GHIA 3UPNA 3GTCA 2Y2QA 1K4FA 2WKQA 1NJ4A 2HZ5A 1FCOA 4BBUA 4MN5A 1K4EA 1JTDA 2PAVP 4FOFA 4OOYA 2JC7A 4DDSA 3VSKA 2K7SA 2Z2LB 4KZAA 2VGLS 4MEZA 3RXXA 1TF1A 4JF4A 1XP4A 3T1RA 4BJPA 3V50A 2J80A 2BLSA 3QP1A 3VP1A 3Q1FA 2PDRA 4FSFA 1U60A 3GVBA 4I3AA 3O87A 5HAPA 5HDCA 1VETA 1O07A 3BYDA 5F83A 2WAFA 4P87A 4N9LA 5EOEA 3D4FA 4C75A 5E43A 4E3MA 1CK3A 1W79A 4GDNA 1ES5A 3IF6B 1DY6A 4K08A 3A3IA 4EXOA 2EWWA 4JKTA 5L10A 4UQIS 1YQSA 1SDEA 3RJUA 3GV9A 4DJ2A 1ZG4A 1DRMA 3Q7VA 3ZGAB 4GS9A 3M2KA 1GSXA 3OOVA 4BL3A 3IF5A 2JKFA 2J8YA 2VK3A 5HWVA 5HD3A 1Y54A 4NG2A 1G6AA 4HOIA 5I94A 4R4RA 4WEJA 1L0FA 4WZ4A 1IKGA 2WYXA 3PBTA 2Z6CA 3KO6A 1K54A 3FYZA 3QP2A 1FCMA 2XQZA 4R4SA 2Y2MA 4N1HA 5EPHA 1F9IA 3N7WA 3BM6A 4Z1WA 2Y59A 2Y2JA 3FWLA 4EERA 3MMHA 3T1QB 3BFEA 2ACGA 3HREA 4JGPA 4JLFA 2JKRM 3IHBA 5M18A 1IKIA 2ZL1A 2KX6A 4P0MA 4MN6A 2LB5A 1KVLA 4ZDXA 3IS2A 3TJZC 1LSVA 3E2LA 1PWCA 1N4OA 3T4LA 4MBFA 1ALQA 4LFUA 1CEGA 1T18A 1KE0A 1HD8A 3ZNTA 1SDNA 4R23A 1S4RA 3T4SA 1MWUA 3IH9A 2JKTI 4NXGA 1LSXA 2VJWA 3HBRA 3H82B 2HJEA 2FFYA 2BTFP 1YLTA 3R4KA 5L8MA 1PW1A 2X01A 3FKVA 3E98A 5DVAA 1Q2QA 4I3IA 4QHCA 2HJ9C 1T1BA 2OOLA 5A8BA 4LRZE 2UWXA 5DTTA 4H6JB 1KGGA 3MBZA 5DFYA 1OTBA 1JWVA 1Z6FA 2FH5A 4WN5A 3OPHA 1H8YA 1FCNA 2EXBA 4WBGA 3IF6C 4BL2A 2PR6A 2L4RA 5E2GA 4F94A 3MXQA 3NULA 2P7JA 4ESPA 4WL9A 4OQ0A 5DKKA 3BQAA 2DRWA 3ULFA 1OTAA 4N1XA 3P01A 1CI9A 4EEPA 2ZQCA 3BW6A 1JTGA 3N6IA 1NXYA 4IBRA 3IT9A 4PM7A 4Y2FA 1K56D 4FUWA 4MBKA 4HNBA 3IX3A 4OQIA 3RFBA 3CMZA 1K0KA 3HLBA 3WS0A 5FQIA 3I7JA 1QMEA 4CLCD 4HP4A 4ZRRA 5DF9A 4GB7A 5TGFA 1BLHA 2VV8A 4I5SA 3AGDA 1SKOA 3C8CA 1XXMA 2ZQ8A 3O5YA 3UE0A 4B93A 2OAQ1 4EU0A 5AQ9A 3W2ZA 2L1MA 2ZC4B 4HEFA 2EFXA 3EWKA 1YSPA 1NYMA 3NY4A 4HH3A 1F98A 3A0SA 3MQ0A 2OWJA 4MN7A 4X1LA 3S22A 4II7A 3AGEA 3GR2A 3LIAA 2Y2GA 1PWDA 1IYOA 3HJIA 4GDBA 3LGOA 3BWLA 2EX8A 4EQ1A 1CJFA 4E6WA 2ZQ7A 2EWVA 3S7NA 3MXRA 3OBFA 2QJ7A 3NCKA 1JVJA 2PD7A 5HAQA 2INWA 4HJ6A 4U0XA 4RX2A 3HUOA 3NI9A 2B5RA 1IFQA 2ZC3B 1IYSA 3SOIA 1E25A 3F1OB 4GCZA 4FD8A 2R78A 5EVLA 1TEMA 5FI2A 4S2OA 2GNXA 1K6SA 3N4IA 4B4XA 1W8YA 1LLBA 3E4PA 4BBTA 4Z9QA 5FI7A 3LR5A 2XEPA 3NJAA 5F68A 2X71A 1SKFA 3UMDA 5F69A 3PAGA 5FI6A 1PWGA 1AXBA 4EW7A 4PM9A 3HLEA 5KSHA 3MZDA 2WZXA 3JVUA 3LO7A 4KZ6A 3LIFA 5C5KA 1KVMA 2MJ6A 4HY8A 1BLSA 5TR7A 5J7EA 4DE0A 3G2YA 4H8RA 4K0WA 4QJGA 3HVFA 1L3LA 1DP8A 5FQMA 2VX8A 4G3KA 1S1YA 5EOOA 3ZG7B 1XFQA 3PR6A 4OH0A 4ZJ2A 2BG1A 2W3HA 4WZ5C 4KQOA 3B33A 3EGDC 4EEUA 2IWBA 2PBDP 4WUJA 3A3EA 3QP4A 4OLDA 3CLOA 3VV4A 4B9OA 1TVFA 4UA6A 2HP6A 3VP4A 1NWZA 5HW3A 3NDGA 4DDYA 2VGJA 3CPTA 4XT2A 1H5XA 2O9BA 5AVFA 2C5WB 4LENA 4XUZA 2WADA 3A3FA 2B02A 3KYQA 5DJTA 4LPZA 4R38A 1HLUP 3TW8A 2XF3A 3PTEA 4KQRA 5EECA 1PZPA 1FSYA 4E3KA 1C3BA 3LIBA 1ZTUA 1Y4OA 2M1CA 2DCFA 4E3LA 3G31A 2XH9A 3H7WB 4HIAA 3WWXA 3G34A 3ZFZA 3IXHA 3D9YA 4LV3A 4NETA 5LBRA 1K55A 4Y13A 2O9AA 4O0PA 3ITAA 1UWPX 5DF8A 2WUQA 2XRNA 1OTEA 2JCHA 2JBFA 2W1TB 4X53A 2JE5A 1XX2A 4L0LA 1TS7A 2V20A 2V0WA 1ZHHB 4ID4A 1N9LA 3MQOA 5HARA 3C30A 3G6OA 3NOTC 4GHIB 1BUEA 4KUKA 2C6WB 4OVDA 3OPPA 3MFXA 4PPRA 3GQZA 2XDMA 2LB9A 3HJKA 4GLQA 3TG9A 1NRJA 4Q0HA 4B4ZA 2QZ6A 3B47A 4PHTA 3UPOA 5BOHA 1F2KA 3T4TA 4ETZA 1XJ2A 3UE6A 3HUMA 4OOMA 5CTMA 2H28A 1N9BA 1G6OA 3OCLA 4NXBA 1TDLA 1L2SA 3K2NA 4P6BA 3BECA 3FZCA 3K3CA 4P6ZM 2ZC6B 4WYYA 4WM9A 2QHKA 4ZJ3A 3NC8A 3T50A 2WGWA 4QWOA 5G4YA 2QJ5A 2XA7M 2J3TC 2Y2LA 2JN7A 1AWIA 3NOPC 2RL3A 5HDSA 4S2MA 1XJ6A 1UGUA 4IEDA 3ZHHA 4JGOA 4KUOA 1KGFA 3QP6A 1LL9A 4KZ7A 2CC1A 1KDSA 5AQBA 5DTSA 2ZM8A 3HL9A 3WS2A 3Q82A 1E3UD 4DE3A 4N92A 2XD5A 2PRFA 4MCWA 3HLFA 3N8LA 3OC2A 3M2JA 4AFIA 3IHAA 3KYZA 3LY4A 3TE8A 2G2UA 4QU3A 5TBMB 3B3XA 2ZQAA 1FSWA 1PW8A 3NHQA 3SS5A 1ES2A 2FZ0A 2HGVA 3HLCA 3ZG0A 5A91A 5CX7A 4BWIA 5CRFA 1ODVA 2D02A 2XROA 4KZ9A 4Y0UA 1YMSA 1VEUA 3F1NB 1TS0A 3M6HA 3WS1A 1STZA 5EVIB 4L9FA 2WGIA 2ZMAA 2IA2A 3C5AA 4PM5A 2PU4A 1TS8A 2J9OA 2OSUA 4PM8A 1M6KA 4OQGA 3FG8A 4NXEA 4U3TA 2HDSA 4RVAA 3GDIA 4ME4A 1FIKA 1SHVA 1H8MA 1FILA 3C4OA 2M7VA 1G28A 1SZVA 1CI8A 3MS6A 1K56A 1JWPA 4OOLA 3NECA 4Q0IA 5FATA 2A24B 3CUEC 1VQQA 2OV5A 3LR0A 4CLCA 5A90A 1LI0A 3VSLA 2JKTM 1MBLA 3OZHA 4KENB 3QP5A 4M3KA 3W4OA 4EV4A 4WZ5A 2P74A 5CHMA 3IWOA 2IWDA 4DRTA 3LR4A 4GD8A 2UV0E 1BULA 4D2OA 3H9WA 1UWNX 3L9KA 4U0TA 3UB5P 2VZWA 3VMAA 3GRJA 5F1FA 3E4QA 4YWZA 1L0GA 1IEMA 5EV0A 3A3DA 3RH8B 2DMWA 5FEGA 3IBJA 3HLGA 2OLVA 4ZTKA 5J4EA 1RP5A 1I2WA 3PYPA 4MMNA 2WK0A 2G7UA 5M1AA 2H10A 4LGWA 4PM6A 4L9GA 1M40A 3HLDA 2W0NA 4F3LA 1VETB 1T19A 1J3WA 4S2IA 5F1GA 3IBRA 1W63Q 4G3VA 4X68A 4CPKA 3A0RA 3BQ8A 3T1XA 3F1PA 4LLOB 3Q7VB 1ONHA 4GS9B 3CG5A 5F5YA 3DBAA 4EESA 3JPUA 5GLAA 2HPBA 4DKIA 3BJNA 3G30A 4RA7A 4HQAA 4OPQA 3HLWA 2H0YA 1OTIA 2X02A 1ERQA 2XK1A 4Y15A 3VP2A 1TDGA 1VHMA 5GHZA 5A93A 3QNCA 4PAUA 5K5BA 3G2ZA 1W5DA 3UN7A 1MWTA 3DTEA 5GHYA 5EVIC 2Y8HA 5FQ9A 3T4KA 1DP9A 2Y2KA 1IELA 3UDXA 4OP8A 4BD0A 3IX4A 1NZOA 3EQVA 4KZBA 5DFXA 5FDHA 2VA0A 2ZOIA 4EBPA 5DKLA 4P6ZS 3EEAA 1LI9A 2ZL1B 4DXCA 3FC7A 4BLMA 2VGKA 3UY6A 2PBYA 1BTLA 4S2NC 5FAOA 3SH9A 2XA7S 3IS2B 5HDDA 2YKFA 1GA0A 3LIDA 4QB8A 3JYIA 3MFDA 3S7PA 2BASA 3W4QA 3KX0X 5IU1A 1NZUA 2W3FA 2HF6A 4IHQA 1ZC2A 5MC7A 4HI4A 4GKUA 3UDFA 2R9WA 3WS5A 3EQUA 5HZHA 3ZG9B 3UPPA 1HZOA 1K6RA 1S1ZA 4R0QA 5A92A 5G18A 2W3DA 3G4PA 1JNUA 3JVVA 5EM0A 1K38A 4GZBA 4EQIA 4C6YA 2J3WA 4GD6A 3GMWA 4E3OA 3A0VA 4JXVA 2W1RA 5HD5A 3S4XA 4S2LA 1KDWA 3PBOA 4ZBEA 4KG5A 1PZOA 2VLGA 1Y28A 5HPIA 3NIAA 5KMWA 4E6XA 1XJ4A 3VP0A 1D1JA 4Y17A 4MBHA 4IUKA 1DJCA 1MZUA 4I39A 3BY9A 2GDNA 1IYPA 1BT5A 1FOFA 5E2HA 3TSGA 4UQIM 1HTZA 1W8QA 1ES3A 4GOGA 2IWCA 2JKGA 4R70A 2EX9A 4PMAA 2VEAA 5FAQA 2P9VA 3BFCA 2ZQ9A 1L0DA 4FH2A 5CTNA 2NUPC 5CERA 4XUXA 1GSWA 3R7WA 1K54C 2PU2A 1BYWA 3M6BA 2EX2A 5TFQA 1MC0A 3CITA 1BSGA 2XSSA 1KE4A 4ARZA 1XFNA 4QY5A 5G4ZA 2ZLYA 3LYXA 2ZM2A 3IXDA 4WELA 3IH8A 4YINA 1GCEA 3T4JA 4Y3IA 5EFWA 3V67A 2J3TD 5FQJA 5L2FA 1SKOB 2EFUA 1P9WA 4OONA 4CQHA 1FQGA 2ZC5B 3O3VA 4YOFA 1PIOA 3V5MA 1W7FA 1L0EA 3IWQA 2A2LA 1GHPA 2VV6A 1E3UA 4LV0A 3BFDA 1XGIA 3S1YA 2YKHA 4X55A 5GLCA 3G32A 1EWZA 1KGEA 3BFFA 3MZFA 4E3JA 4KZ3A 2E8IA 4PKYA 1T1CA 2HDRA 1MY8A 1MKIA 4S2JA 5CHJA 3LEZA 2B18A 4IBXA 2Y2PA 2WZZA
chains in the Genus database with same CATH topology
3NHQA 3F1PB 4H6JB 2EA9A 3H7WA 3GECA 2M7UA 3HCYA 2FZ0A 5DFYA 1OTBA 4DMZA 2HGVA 4R6LA 2KDKA 1H3QA 2FH5A 4WN5A 5IS1A 2D01A 5CX7A 2HV1A 4BWIA 3PHYA 4I38A 3MR0A 4GW9A 1ODVA 2D02A 3S7OA 3UMEA 2XROA 3UB6A 1N9NA 3F1NB 1TS0A 2W1TA 3D3OA 3EGXC 1STZA 2PR6A 4L9FA 4O01A 2IA2A 1V9YA 2L4RA 3MXQA 4BMWA 1TS8A 2P7JA 3B42A 3VE4A 4GHIA 4WL9A 5DKKA 3FG8A 2P04A 4NXEA 3BQAA 3VOLA 3GDIA 4ME4A 3ULFA 1H8MA 3ZQ5A 1OTAA 1DP6A 2M7VA 3PBRA 1G28A 3P01A 4EEPA 3CUEA 3RTYA 4Q0JA 2PT7A 2PR5A 3BW6A 4OOLA 3E4OA 4Q0IA 3EOIA 4Y2FA 2A24B 3CUEC 1WA9A 3PBQA 1F5MA 4HNBA 3LIEA 3LR0A 4CLCA 3RFBA 2JHEA 3UB8A 5HPFA 4CLCD 2JKTM 1S67L 2O0YA 4CLCC 4HP4A 3LR3A 5HWTA 3ZYTA 4ZRRA 1VB6A 2ZMVA 5DF9A 2GZAA 4NEED 4RQ9A 1S66L 3MJQA 4E04A 3VE3A 3KSHA 3LR4A 2CMNA 4WEKA 1IOUA 2VV8A 4I5SA 2QKPA 1UWNX 3H9WA 5F6AA 4EETB 3C8CA 2ZBBA 2VZWA 3O5YA 1MKMA 4XT2B 4B93A 2OAQ1 1YKDA 4EU0A 3FPWA 3E4QA 4YWZA 5FL3A 2WKPA 3W2ZA 3U2AA 2L1MA 5HL6A 3RH8B 2DMWA 3EWKA 3P7NA 4BBVA 1YSPA 3IBJA 4LRYC 5J4EA 2OAP1 3PYPA 4MMNA 2G7UA 4HH3A 4R3AA 1F98A 3A0SA 3H82A 3MQ0A 3KSIA 1OTDA 1OT9A 2OWHA 2OWJA 4L9GA 4MN7A 5IT5A 2W3GA 2W0NA 2NUTC 3T4OA 4F3LA 4II7A 3LI9A 3LIAA 1LL8A 3HJIA 4M4XA 4PKYG 4IUHA 1OT6A 3BWLA 1D06A 1T19A 4EQ1A 3MF0A 1T1AA 2KOIA 3IBRA 1W63Q 2EWVA 3S7NA 3OBFA 4G3VA 2QJ7A 3A0RA 5TBMA 2PD8A 3BQ8A 5AJGA 2PD7A 4QPRA 4IJGA 3LFVA 2PYPA 3D72A 3F1PA 2INWA 4LLOB 1EW0A 4HJ6A 4GS9B 4H6JA 5F5YA 3DBAA 3LUQA 4EESA 4HJ4A 1N9OA 1D7EA 2QWSA 1IFQA 1W63M 3BJNA 2W27A 2P08A 4LRXC 3F1OB 3NOUC 4HQAA 4GJ4A 2V0UA 4GCZA 2R78A 1OTIA 4ETXA 2GNXA 5DJUA 3E4PA 3F1NA 3OCNA 1VHMA 4BBTA 2Z6DA 4PAUA 2WKRA 1X0OA 5K5BA 3LR5A 4HJ3A 3NJAA 5F68A 1OPXA 3UMDA 5F69A 2Y8HA 3PBSA 4EW7A 3T4KA 1DP9A 4NKPA 5KSHA 1XJ3A 1GSVA 2K2NA 5I5LA 3R7WB 3CI6A 3CWFA 2ZOHA 3EQVA 1LT0A 3JVUA 5DFXA 3LIFA 5C5KA 4ARZB 1OJGA 2VA0A 4CLCE 2ZOIA 2MJ6A 4HY8A 5DKLA 5J7EA 4P6ZS 2KLIA 3OLOA 3EEAA 3K3DA 2A24A 4G3WA 4HH2A 2VKSA 2Y79A 3FC7A 1DP8A 4NXFA 2VX8A 4G3KA 1S1YA 3UB7A 2XA7S 3IS2B 1XFQA 3PR6A 4I3JA 2YKFA 5HDDA 4DJ3A 4Y5FA 3LIDA 3BY8A 2W3HA 3S7PA 4KQOA 2BASA 3KX0X 5IU1A 1NLZA 3B33A 3EGDC 2WKQA 2W3FA 4EEUA 2HF6A 4BBUA 4WUJA 4IHQA 1LSWA 5MC7A 4HI4A 4MN5A 3CLOA 2ZMFA 3VV4A 4B9OA 3EQUA 5HZHA 2O99A 1NWZA 2JKRI 4FOFA 2K31A 1S1ZA 4XT2A 3EEHA 2K7SA 2O9BA 2W3DA 5AVFA 2VGLS 1JNUA 3JVVA 1TF1A 4BJPA 3CAXA 5TJJA 5HSQA 3PXPA 2B02A 2J80A 2J3WA 3KYQA 4WF0A 5DJTA 1YAXA 4LPZA 4R38A 2GX5A 3A0VA 3TW8A 2V9AA 2PDRA 4FSFA 2W1RA 5HD5A 4I3AA 3LIBA 3LI8A 3PBOA 1ZTUA 5HDCA 2QYBA 2M1CA 2GJ3A 2VLGA 3H7WB 1Y28A 4HIAA 5HPIA 1XJ4A 4K08A 5LBRA 4EXOA 2EWWA 1P0ZA 4UQIS 4DJ2A 4IUKA 1V9ZA 1DRMA 1MZUA 2O9AA 4GS9A 4O0PA 4O8GA 3KSFA 1UWPX 5HWWA 2XRNA 1OTEA 1GSXA 3OOVA 4I39A 2W1TB 3BY9A 3PBNA 5HWVA 4L0LA 5HD3A 3T4QA 1TS7A 3F1OA 4JGRA 2V0WA 4UQIM 1ZHHB 4HOIA 3SW1A 3FPVA 3TRCA 1N9LA 3C38A 3MQOA 3C30A 3G6OA 1S4SA 3NOTC 4GHIB 1P97A 4WEJA 4KUKA 4R70A 2VEAA 3MFXA 4EUVA 4MDZA 1TS6A 2LB9A 4UEYA 3HJKA 4GLQA 1NRJA 4L9EA 4Q0HA 4YNRA 5J3WA 3C2WA 3PBTA 4WLAA 3B47A 4PHTA 2Z6CA 3KO6A 2NUPC 3T4TA 4ETZA 1XJ2A 3UE6A 1GSWA 1TD5A 3R7WA 3S7QA 4OOMA 2H28A 2PHYA 1BYWA 1G6OA 1F9IA 1MC0A 4Z1WA 3CITA 5AVEA 4CLCB 3OCLA 2XSSA 4NXBA 4EERA 3MMHA 4ARZA 1XFNA 4KQDA 3MQQA 3K2NA 5G4ZA 3LYXA 4JGPA 2JKRM 5KIZA 3K3CA 2KX6A 4P6ZM 3UB9A 4MN6A 4WELA 2LB5A 2QHKA 3T50A 3IS2A 3TJZC 5G4YA 1LSVA 3T4JA 4Y3IA 1YSQA 5EFWA 2I9VA 2QJ5A 3LICA 2XA7M 3V67A 3T4LA 2J3TD 1NLYA 2J3TC 2V1AA 2JN7A 2W3EA 3NOPC 1P9WA 4CQHA 2PYRA 1T18A 5HDSA 4YOFA 1XJ6A 1UGUA 4JGOA 4KUOA 2A2LA 2VV6A 1OJ5A 3E0YA 1S4RA 3T4SA 2JKTI 4NXGA 4HP9A 1LSXA 1KOUA 2VJWA 3H82B 2YKHA 2HJEA 2VGLM 4F3LB 4JGQA 4HHDA 2L0WA 3KSGA 3R4KA 5L8MA 3E98A 2VV7A 4I3IA 2O9CA 4MCWA 1T1CA 4PKYA 3UE3A 3OC2A 4AFIA 2HJ9C 1T1BA 2OOLA 5A8BA 2V1BA 2B18A 3KYZA 4LRZE 3TE8A 5TBMB 1P9RA 4DN0A 3ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VEA A;  3NHQ A;  4EUV A;  4MDZ A;  4G3K A;  5HL6 A;  2LB9 A;  4GLQ A;  4Q0H A;  1YSP A;  3IBJ A;  2M7U A;  3HCY A;  4LRY C;  4YNR A;  5DFY A;  3C2W A;  4Y5F A;  4DMZ A;  2HGV A;  4R6L A;  4MMN A;  3KO6 A;  2G7U A;  2W3H A;  3S7P A;  4BWI A;  3MQ0 A;  3KSI A;  4ETZ A;  4GW9 A;  4MN7 A;  3S7O A;  1TD5 A;  2W3F A;  2W3G A;  2XRO A;  3S7Q A;  1MC0 A;  4Z1W A;  2W1T A;  3D3O A;  3CIT A;  2XSS A;  2ZMF A;  1STZ A;  3VV4 A;  3MMH A;  4IUH A;  4O01 A;  2O99 A;  3K2N A;  2IA2 A;  3MF0 A;  4FOF A;  2KOI A;  2K31 A;  3IBR A;  3S7N A;  2O9B A;  2W3D A;  3OBF A;  4G3V A;  5AJG A;  4QPR A;  4IJG A;  3LFV A;  1TF1 A;  2LB5 A;  5TJJ A;  5HSQ A;  3DBA A;  4ME4 A;  3ZQ5 A;  4Y3I A;  1YSQ A;  2M7V A;  2GX5 A;  3BJN A;  4Q0J A;  2W3E A;  4LRX C;  3NOP C;  3NOU C;  4CQH A;  2W1R A;  4Q0I A;  4ETX A;  4Y2F A;  4YOF A;  1F5M A;  1ZTU A;  2QYB A;  1VHM A;  3RFB A;  4PAU A;  5K5B A;  3E0Y A;  5HPI A;  5HPF A;  2O0Y A;  2Y8H A;  5LBR A;  2VJW A;  4ZRR A;  2K2N A;  5I5L A;  4IUK A;  4RQ9 A;  2O9A A;  4O0P A;  3CI6 A;  4O8G A;  3KSF A;  3KSG A;  3R4K A;  5L8M A;  4E04 A;  3KSH A;  2XRN A;  3OOV A;  2W1T B;  5DFX A;  3E98 A;  5C5K A;  2O9C A;  4MCW A;  2OOL A;  2VZW A;  3O5Y A;  1MKM A;  2B18 A;  2KLI A;  4LRZ E;  1YKD A;  3EEA A;  3TRC A;  4EU0 A;  4G3W A;  3G6O A;  2VKS A;  4DN0 A;  3NOT C;  2Y79 A;  3W2Z A;  4R70 A; 
#chains in the Genus database with same CATH topology
 5DF7 A;  4LCL A;  3V3R A;  3WRT A;  3IXB A;  1BLC A;  3HCY A;  3ZVT A;  4R6L A;  2KDK A;  3IF6 A;  5IS1 A;  2HV1 A;  4I38 A;  1WE4 A;  4X69 A;  4GW9 A;  3UME A;  2V2F F;  3D3O A;  3EGX C;  4EBN A;  3Q7Z A;  4K0X A;  4R1G A;  3P98 A;  1V9Y A;  4OKP A;  1BLP A;  3DWZ A;  3MKF A;  1ZKJ A;  2Y55 A;  5GLB A;  3VP3 A;  4HBT A;  4X1M A;  1DP6 A;  1YMX A;  4JXS A;  4QY6 A;  3PBR A;  3QNB A;  5AQA A;  4Q0J A;  2PT7 A;  2PR5 A;  4E3I A;  1WYC A;  2XGN A;  4Q8I A;  1G5U A;  2JHE A;  4CJN A;  4QD4 A;  5HFO A;  1S67 L;  4S2N A;  2EX6 A;  1ONG A;  2QPN A;  2WKI A;  3WS4 A;  3NBL A;  3ZYT A;  2ZMV A;  4NEE D;  2Q0O A;  1YLW A;  3CZD A;  3KSH A;  3C7U A;  2CMN A;  4BD1 A;  2Z2M B;  5HAI A;  2WAE A;  4WEK A;  4GNU A;  5FA7 A;  4RYE A;  1VM1 A;  3VOZ A;  1H8Z A;  1XA7 A;  3CPT B;  5GHX A;  4XT2 B;  2ZC7 A;  4WMC D;  1YKD A;  3FPW A;  3O86 A;  5FL3 A;  2WKP A;  3U2A A;  3UNW A;  5HL6 A;  4BBV A;  4LRY C;  2OAP 1;  4UA7 A;  4R3A A;  1PRQ A;  1YLY A;  3H82 A;  1OT9 A;  2OWH A;  4OPY A;  5IT5 A;  2W3G A;  3SS4 A;  1S6R A;  2NUT C;  3T4O A;  2B95 A;  2Y91 A;  3BRM A;  1RGY A;  4M4X A;  5CED A;  2QMI A;  1CQA A;  1OT6 A;  4IUH A;  2AVX A;  3MF0 A;  1T1A A;  2KOI A;  2WKE A;  3DAV A;  3VFF A;  3DWK A;  3LFV A;  4IJG A;  1EW0 A;  4H6J A;  3LUQ A;  1D7E A;  1J9M A;  1W63 M;  4LRX C;  1DJA A;  4ETX A;  5DJU A;  3OCN A;  4LCM A;  1FR6 A;  3ISG A;  5EVI D;  4NKP A;  1GSV A;  2K2N A;  2Y2N A;  5I5L A;  2WKH A;  3CI6 A;  1XKZ A;  4X25 A;  5FSR A;  2ZOH A;  1LT0 A;  4A5R A;  1YLZ A;  2EXA A;  3MXS A;  4CLC E;  4DE1 A;  1IYQ A;  1NYY A;  2KLI A;  1BZA A;  4KG6 A;  4G3W A;  4HH2 A;  3DTM A;  2Y79 A;  4NXF A;  4KZ8 A;  2Q9N A;  3AGF A;  2WGW B;  4I3J A;  1QMF A;  4DXB A;  3BY8 A;  1RGZ A;  2J9P A;  5CGW A;  1NLZ A;  3E2K A;  4JPM A;  4Y7P A;  5FEF A;  1LSW A;  5FDS A;  3ITB A;  3UO9 A;  4ZJ1 A;  1ES4 A;  2ZMF A;  1YM1 A;  4KZ4 A;  4EUZ A;  2HDQ A;  2O99 A;  1LL5 A;  1PNE A;  3BEB A;  4JF5 A;  2JKR I;  4YFM A;  2K31 A;  3BFG A;  2V8C A;  3EEH A;  5GLD A;  5L09 A;  5J8X A;  4UA9 A;  2G2W A;  5KSC A;  1NRF A;  4KQQ A;  1PI5 A;  4Y0T A;  3W4P A;  5CEC A;  3CAX A;  5TJJ A;  5HSQ A;  3PXP A;  3PAE A;  4WF0 A;  1E4D A;  1YAX A;  2GX5 A;  1O7E A;  3LY3 A;  4K91 A;  1GHM A;  1KE3 A;  2V9A A;  1ZG6 A;  4OPZ A;  4HES A;  4KG2 A;  3FV7 A;  3FKW A;  3LI8 A;  2QYB A;  2GJ3 A;  1A0K A;  5F82 A;  2R9X A;  3HUN A;  4OLG A;  4OPR A;  5IHV A;  1K25 A;  4LV2 A;  4FCF A;  1P0Z A;  1V9Z A;  3ZCZ A;  4O8G A;  3UE1 A;  3KSF A;  5HWW A;  1CF0 A;  2RCX A;  1VEU B;  1I2S A;  3U4L P;  1K55 C;  3PBN A;  2WGV A;  2XFS A;  4N9K A;  3T4Q A;  3SH7 A;  5DTK A;  3F1O A;  4JGR A;  4EBL A;  1DJB A;  3SW1 A;  3FPV A;  3VFH A;  3TRC A;  3C38 A;  1S4S A;  1P97 A;  4ZAM A;  1K57 C;  4EUV A;  4MDZ A;  1TS6 A;  4UEY A;  2ZM0 A;  4L9E A;  1Q2P A;  3A3J A;  4YNR A;  3IWI A;  5J3W A;  3C2W A;  4WLA A;  3O88 A;  1XA1 A;  2HP5 A;  1PFL A;  1TD5 A;  3S7Q A;  2PHY A;  1XGJ A;  5CGX A;  3BLS A;  5AQ7 A;  5AVE A;  3KYE A;  4CLC B;  2HP9 A;  4KQD A;  3MQQ A;  3V39 A;  5FQK A;  3G35 A;  2A49 A;  5KIZ A;  5EM1 A;  4Y0O A;  1LHY A;  3UB9 A;  4OP5 A;  2OLU A;  1H0M A;  1ESU A;  3T1S A;  3SS3 A;  3GSG A;  3QHY A;  1FR1 A;  1YSQ A;  2I9V A;  3LIC A;  1YLP A;  1NLY A;  2V1A A;  2W3E A;  1CEF A;  2PYR A;  4GN2 A;  5CHU A;  4NK3 A;  4S2P A;  3P09 A;  1NY0 A;  1OJ5 A;  3E0Y A;  4C3Q A;  5E2E A;  4HP9 A;  4HBU A;  3L7H A;  1KOU A;  1YPR A;  1Z09 A;  2VGL M;  3W8K A;  1I5Q A;  4F3L B;  4JGQ A;  4HHD A;  5EUA A;  2L0W A;  5EE8 A;  3KSG A;  1ERM A;  2H0T A;  4JXG A;  1S0W A;  2VV7 A;  2O9C A;  1EI5 A;  3UE3 A;  4IVI A;  4UHU A;  4P85 A;  2V1B A;  3SZT A;  3WRZ A;  1P9R A;  4DN0 A;  3ICY A;  3E4O A;  3F1P B;  4JXW A;  2EA9 A;  3H7W A;  3GEC A;  2M7U A;  3RXW A;  4DMZ A;  1H3Q A;  2D01 A;  3PHY A;  1YT4 A;  4D60 A;  3MR0 A;  3S7O A;  3ZG5 A;  4R3J A;  3UB6 A;  5EVE A;  1N9N A;  3ZNY A;  5HX9 A;  2W1T A;  2XFT A;  4R3B A;  3T12 B;  3SH8 A;  2A3U A;  4O01 A;  2V8F A;  1MWR A;  4BMW A;  5FQQ A;  5U47 A;  3B42 A;  3VE4 A;  4GHI A;  1OME A;  4UAA A;  1HVB A;  3IQA A;  2P04 A;  4LV1 A;  2DNS A;  3VOL A;  4O7D A;  3ZQ5 A;  4BQM A;  1MPL A;  3N8R A;  3CUE A;  3RTY A;  4DF6 A;  2H5S A;  4EWF A;  3EOI A;  1WA9 A;  3PBQ A;  1F5M A;  4RX3 A;  3LIE A;  3DW0 A;  2Y2O A;  3UB8 A;  2ZJ9 A;  5HPF A;  2O0Y A;  4MLL A;  4CLC C;  3LR3 A;  3ZDJ A;  5HWT A;  1YLJ A;  1G68 A;  2V1Z A;  3Q81 A;  1VB6 A;  4E3N A;  1SCW A;  2GZA A;  3Q07 A;  1S66 L;  4RQ9 A;  3MJQ A;  4E04 A;  3VE3 A;  5CEB A;  2Q9M A;  1IOU A;  5E2F A;  2Y4A A;  4WMC A;  2QKP A;  5F6A A;  4EET B;  2I72 A;  4X56 A;  2ZBB A;  1MKM A;  4IVK A;  3V3S A;  4OQH A;  3IXG A;  4JBF A;  4BEN A;  1ACF A;  3IX8 A;  3TOI A;  5JYO A;  2Y2H A;  5HL1 A;  3P7N A;  2XLN A;  3LEQ A;  1ESI A;  1PI4 A;  1JWZ A;  3KSI A;  1OTD A;  2Y2I A;  3OPL A;  1MWS A;  4X6T A;  3LI9 A;  1LL8 A;  4PKY G;  5L07 A;  1D06 A;  2HDU A;  5CXW A;  3MZE A;  5TBM A;  2PD8 A;  5AJG A;  3LCE A;  4QPR A;  5M19 A;  5GL9 A;  2PYP A;  3D72 A;  4HJ4 A;  1N9O A;  1MXO A;  2QWS A;  4B88 A;  2W27 A;  2P08 A;  3NOU C;  4GJ4 A;  2J7V A;  2V0U A;  4JF6 A;  3F1N A;  5KZH A;  4FTX A;  2Z6D A;  3UDI A;  5EVI A;  2WKR A;  1GA9 A;  4DE2 A;  1X0O A;  3OPR A;  5D3O A;  4HJ3 A;  2P9V B;  4MNR A;  1K57 A;  1OPX A;  3PBS A;  3C4P A;  3ZG8 B;  1RCJ A;  1XJ3 A;  3VOY A;  1ERO A;  4FH4 A;  3R7W B;  3DTI A;  5FAS A;  5JYP A;  2ZQD A;  1PYY A;  3CWF A;  3CHW P;  2XR0 A;  3MSH A;  3ZVW A;  3MKE A;  4ARZ B;  1OJG A;  4XXR A;  3QP8 A;  1XPB A;  3C7V A;  3OLO A;  3DTK A;  3K3D A;  5CGS A;  3NDE A;  3N8S A;  2A24 A;  5FAP A;  2VKS A;  3CJM A;  2E8J A;  2XD1 A;  4S2K A;  3BLM A;  2ZD8 A;  3UB7 A;  4KZ5 A;  2FFF B;  4DJ3 A;  4Y5F A;  1WYB A;  1GHI A;  3UPN A;  3GTC A;  2Y2Q A;  1K4F A;  2WKQ A;  1NJ4 A;  2HZ5 A;  1FCO A;  4BBU A;  4MN5 A;  1K4E A;  1JTD A;  2PAV P;  4FOF A;  4OOY A;  2JC7 A;  4DDS A;  3VSK A;  2K7S A;  2Z2L B;  4KZA A;  2VGL S;  4MEZ A;  3RXX A;  1TF1 A;  4JF4 A;  1XP4 A;  3T1R A;  4BJP A;  3V50 A;  2J80 A;  2BLS A;  3QP1 A;  3VP1 A;  3Q1F A;  2PDR A;  4FSF A;  1U60 A;  3GVB A;  4I3A A;  3O87 A;  5HAP A;  5HDC A;  1VET A;  1O07 A;  3BYD A;  5F83 A;  2WAF A;  4P87 A;  4N9L A;  5EOE A;  3D4F A;  4C75 A;  5E43 A;  4E3M A;  1CK3 A;  1W79 A;  4GDN A;  1ES5 A;  3IF6 B;  1DY6 A;  4K08 A;  3A3I A;  4EXO A;  2EWW A;  4JKT A;  5L10 A;  4UQI S;  1YQS A;  1SDE A;  3RJU A;  3GV9 A;  4DJ2 A;  1ZG4 A;  1DRM A;  3Q7V A;  3ZGA B;  4GS9 A;  3M2K A;  1GSX A;  3OOV A;  4BL3 A;  3IF5 A;  2JKF A;  2J8Y A;  2VK3 A;  5HWV A;  5HD3 A;  1Y54 A;  4NG2 A;  1G6A A;  4HOI A;  5I94 A;  4R4R A;  4WEJ A;  1L0F A;  4WZ4 A;  1IKG A;  2WYX A;  3PBT A;  2Z6C A;  3KO6 A;  1K54 A;  3FYZ A;  3QP2 A;  1FCM A;  2XQZ A;  4R4S A;  2Y2M A;  4N1H A;  5EPH A;  1F9I A;  3N7W A;  3BM6 A;  4Z1W A;  2Y59 A;  2Y2J A;  3FWL A;  4EER A;  3MMH A;  3T1Q B;  3BFE A;  2ACG A;  3HRE A;  4JGP A;  4JLF A;  2JKR M;  3IHB A;  5M18 A;  1IKI A;  2ZL1 A;  2KX6 A;  4P0M A;  4MN6 A;  2LB5 A;  1KVL A;  4ZDX A;  3IS2 A;  3TJZ C;  1LSV A;  3E2L A;  1PWC A;  1N4O A;  3T4L A;  4MBF A;  1ALQ A;  4LFU A;  1CEG A;  1T18 A;  1KE0 A;  1HD8 A;  3ZNT A;  1SDN A;  4R23 A;  1S4R A;  3T4S A;  1MWU A;  3IH9 A;  2JKT I;  4NXG A;  1LSX A;  2VJW A;  3HBR A;  3H82 B;  2HJE A;  2FFY A;  2BTF P;  1YLT A;  3R4K A;  5L8M A;  1PW1 A;  2X01 A;  3FKV A;  3E98 A;  5DVA A;  1Q2Q A;  4I3I A;  4QHC A;  2HJ9 C;  1T1B A;  2OOL A;  5A8B A;  4LRZ E;  2UWX A;  5DTT A;  4H6J B;  1KGG A;  3MBZ A;  5DFY A;  1OTB A;  1JWV A;  1Z6F A;  2FH5 A;  4WN5 A;  3OPH A;  1H8Y A;  1FCN A;  2EXB A;  4WBG A;  3IF6 C;  4BL2 A;  2PR6 A;  2L4R A;  5E2G A;  4F94 A;  3MXQ A;  3NUL A;  2P7J A;  4ESP A;  4WL9 A;  4OQ0 A;  5DKK A;  3BQA A;  2DRW A;  3ULF A;  1OTA A;  4N1X A;  3P01 A;  1CI9 A;  4EEP A;  2ZQC A;  3BW6 A;  1JTG A;  3N6I A;  1NXY A;  4IBR A;  3IT9 A;  4PM7 A;  4Y2F A;  1K56 D;  4FUW A;  4MBK A;  4HNB A;  3IX3 A;  4OQI A;  3RFB A;  3CMZ A;  1K0K A;  3HLB A;  3WS0 A;  5FQI A;  3I7J A;  1QME A;  4CLC D;  4HP4 A;  4ZRR A;  5DF9 A;  4GB7 A;  5TGF A;  1BLH A;  2VV8 A;  4I5S A;  3AGD A;  1SKO A;  3C8C A;  1XXM A;  2ZQ8 A;  3O5Y A;  3UE0 A;  4B93 A;  2OAQ 1;  4EU0 A;  5AQ9 A;  3W2Z A;  2L1M A;  2ZC4 B;  4HEF A;  2EFX A;  3EWK A;  1YSP A;  1NYM A;  3NY4 A;  4HH3 A;  1F98 A;  3A0S A;  3MQ0 A;  2OWJ A;  4MN7 A;  4X1L A;  3S22 A;  4II7 A;  3AGE A;  3GR2 A;  3LIA A;  2Y2G A;  1PWD A;  1IYO A;  3HJI A;  4GDB A;  3LGO A;  3BWL A;  2EX8 A;  4EQ1 A;  1CJF A;  4E6W A;  2ZQ7 A;  2EWV A;  3S7N A;  3MXR A;  3OBF A;  2QJ7 A;  3NCK A;  1JVJ A;  2PD7 A;  5HAQ A;  2INW A;  4HJ6 A;  4U0X A;  4RX2 A;  3HUO A;  3NI9 A;  2B5R A;  1IFQ A;  2ZC3 B;  1IYS A;  3SOI A;  1E25 A;  3F1O B;  4GCZ A;  4FD8 A;  2R78 A;  5EVL A;  1TEM A;  5FI2 A;  4S2O A;  2GNX A;  1K6S A;  3N4I A;  4B4X A;  1W8Y A;  1LLB A;  3E4P A;  4BBT A;  4Z9Q A;  5FI7 A;  3LR5 A;  2XEP A;  3NJA A;  5F68 A;  2X71 A;  1SKF A;  3UMD A;  5F69 A;  3PAG A;  5FI6 A;  1PWG A;  1AXB A;  4EW7 A;  4PM9 A;  3HLE A;  5KSH A;  3MZD A;  2WZX A;  3JVU A;  3LO7 A;  4KZ6 A;  3LIF A;  5C5K A;  1KVM A;  2MJ6 A;  4HY8 A;  1BLS A;  5TR7 A;  5J7E A;  4DE0 A;  3G2Y A;  4H8R A;  4K0W A;  4QJG A;  3HVF A;  1L3L A;  1DP8 A;  5FQM A;  2VX8 A;  4G3K A;  1S1Y A;  5EOO A;  3ZG7 B;  1XFQ A;  3PR6 A;  4OH0 A;  4ZJ2 A;  2BG1 A;  2W3H A;  4WZ5 C;  4KQO A;  3B33 A;  3EGD C;  4EEU A;  2IWB A;  2PBD P;  4WUJ A;  3A3E A;  3QP4 A;  4OLD A;  3CLO A;  3VV4 A;  4B9O A;  1TVF A;  4UA6 A;  2HP6 A;  3VP4 A;  1NWZ A;  5HW3 A;  3NDG A;  4DDY A;  2VGJ A;  3CPT A;  4XT2 A;  1H5X A;  2O9B A;  5AVF A;  2C5W B;  4LEN A;  4XUZ A;  2WAD A;  3A3F A;  2B02 A;  3KYQ A;  5DJT A;  4LPZ A;  4R38 A;  1HLU P;  3TW8 A;  2XF3 A;  3PTE A;  4KQR A;  5EEC A;  1PZP A;  1FSY A;  4E3K A;  1C3B A;  3LIB A;  1ZTU A;  1Y4O A;  2M1C A;  2DCF A;  4E3L A;  3G31 A;  2XH9 A;  3H7W B;  4HIA A;  3WWX A;  3G34 A;  3ZFZ A;  3IXH A;  3D9Y A;  4LV3 A;  4NET A;  5LBR A;  1K55 A;  4Y13 A;  2O9A A;  4O0P A;  3ITA A;  1UWP X;  5DF8 A;  2WUQ A;  2XRN A;  1OTE A;  2JCH A;  2JBF A;  2W1T B;  4X53 A;  2JE5 A;  1XX2 A;  4L0L A;  1TS7 A;  2V20 A;  2V0W A;  1ZHH B;  4ID4 A;  1N9L A;  3MQO A;  5HAR A;  3C30 A;  3G6O A;  3NOT C;  4GHI B;  1BUE A;  4KUK A;  2C6W B;  4OVD A;  3OPP A;  3MFX A;  4PPR A;  3GQZ A;  2XDM A;  2LB9 A;  3HJK A;  4GLQ A;  3TG9 A;  1NRJ A;  4Q0H A;  4B4Z A;  2QZ6 A;  3B47 A;  4PHT A;  3UPO A;  5BOH A;  1F2K A;  3T4T A;  4ETZ A;  1XJ2 A;  3UE6 A;  3HUM A;  4OOM A;  5CTM A;  2H28 A;  1N9B A;  1G6O A;  3OCL A;  4NXB A;  1TDL A;  1L2S A;  3K2N A;  4P6B A;  3BEC A;  3FZC A;  3K3C A;  4P6Z M;  2ZC6 B;  4WYY A;  4WM9 A;  2QHK A;  4ZJ3 A;  3NC8 A;  3T50 A;  2WGW A;  4QWO A;  5G4Y A;  2QJ5 A;  2XA7 M;  2J3T C;  2Y2L A;  2JN7 A;  1AWI A;  3NOP C;  2RL3 A;  5HDS A;  4S2M A;  1XJ6 A;  1UGU A;  4IED A;  3ZHH A;  4JGO A;  4KUO A;  1KGF A;  3QP6 A;  1LL9 A;  4KZ7 A;  2CC1 A;  1KDS A;  5AQB A;  5DTS A;  2ZM8 A;  3HL9 A;  3WS2 A;  3Q82 A;  1E3U D;  4DE3 A;  4N92 A;  2XD5 A;  2PRF A;  4MCW A;  3HLF A;  3N8L A;  3OC2 A;  3M2J A;  4AFI A;  3IHA A;  3KYZ A;  3LY4 A;  3TE8 A;  2G2U A;  4QU3 A;  5TBM B;  3B3X A;  2ZQA A;  1FSW A;  1PW8 A;  3NHQ A;  3SS5 A;  1ES2 A;  2FZ0 A;  2HGV A;  3HLC A;  3ZG0 A;  5A91 A;  5CX7 A;  4BWI A;  5CRF A;  1ODV A;  2D02 A;  2XRO A;  4KZ9 A;  4Y0U A;  1YMS A;  1VEU A;  3F1N B;  1TS0 A;  3M6H A;  3WS1 A;  1STZ A;  5EVI B;  4L9F A;  2WGI A;  2ZMA A;  2IA2 A;  3C5A A;  4PM5 A;  2PU4 A;  1TS8 A;  2J9O A;  2OSU A;  4PM8 A;  1M6K A;  4OQG A;  3FG8 A;  4NXE A;  4U3T A;  2HDS A;  4RVA A;  3GDI A;  4ME4 A;  1FIK A;  1SHV A;  1H8M A;  1FIL A;  3C4O A;  2M7V A;  1G28 A;  1SZV A;  1CI8 A;  3MS6 A;  1K56 A;  1JWP A;  4OOL A;  3NEC A;  4Q0I A;  5FAT A;  2A24 B;  3CUE C;  1VQQ A;  2OV5 A;  3LR0 A;  4CLC A;  5A90 A;  1LI0 A;  3VSL A;  2JKT M;  1MBL A;  3OZH A;  4KEN B;  3QP5 A;  4M3K A;  3W4O A;  4EV4 A;  4WZ5 A;  2P74 A;  5CHM A;  3IWO A;  2IWD A;  4DRT A;  3LR4 A;  4GD8 A;  2UV0 E;  1BUL A;  4D2O A;  3H9W A;  1UWN X;  3L9K A;  4U0T A;  3UB5 P;  2VZW A;  3VMA A;  3GRJ A;  5F1F A;  3E4Q A;  4YWZ A;  1L0G A;  1IEM A;  5EV0 A;  3A3D A;  3RH8 B;  2DMW A;  5FEG A;  3IBJ A;  3HLG A;  2OLV A;  4ZTK A;  5J4E A;  1RP5 A;  1I2W A;  3PYP A;  4MMN A;  2WK0 A;  2G7U A;  5M1A A;  2H10 A;  4LGW A;  4PM6 A;  4L9G A;  1M40 A;  3HLD A;  2W0N A;  4F3L A;  1VET B;  1T19 A;  1J3W A;  4S2I A;  5F1G A;  3IBR A;  1W63 Q;  4G3V A;  4X68 A;  4CPK A;  3A0R A;  3BQ8 A;  3T1X A;  3F1P A;  4LLO B;  3Q7V B;  1ONH A;  4GS9 B;  3CG5 A;  5F5Y A;  3DBA A;  4EES A;  3JPU A;  5GLA A;  2HPB A;  4DKI A;  3BJN A;  3G30 A;  4RA7 A;  4HQA A;  4OPQ A;  3HLW A;  2H0Y A;  1OTI A;  2X02 A;  1ERQ A;  2XK1 A;  4Y15 A;  3VP2 A;  1TDG A;  1VHM A;  5GHZ A;  5A93 A;  3QNC A;  4PAU A;  5K5B A;  3G2Z A;  1W5D A;  3UN7 A;  1MWT A;  3DTE A;  5GHY A;  5EVI C;  2Y8H A;  5FQ9 A;  3T4K A;  1DP9 A;  2Y2K A;  1IEL A;  3UDX A;  4OP8 A;  4BD0 A;  3IX4 A;  1NZO A;  3EQV A;  4KZB A;  5DFX A;  5FDH A;  2VA0 A;  2ZOI A;  4EBP A;  5DKL A;  4P6Z S;  3EEA A;  1LI9 A;  2ZL1 B;  4DXC A;  3FC7 A;  4BLM A;  2VGK A;  3UY6 A;  2PBY A;  1BTL A;  4S2N C;  5FAO A;  3SH9 A;  2XA7 S;  3IS2 B;  5HDD A;  2YKF A;  1GA0 A;  3LID A;  4QB8 A;  3JYI A;  3MFD A;  3S7P A;  2BAS A;  3W4Q A;  3KX0 X;  5IU1 A;  1NZU A;  2W3F A;  2HF6 A;  4IHQ A;  1ZC2 A;  5MC7 A;  4HI4 A;  4GKU A;  3UDF A;  2R9W A;  3WS5 A;  3EQU A;  5HZH A;  3ZG9 B;  3UPP A;  1HZO A;  1K6R A;  1S1Z A;  4R0Q A;  5A92 A;  5G18 A;  2W3D A;  3G4P A;  1JNU A;  3JVV A;  5EM0 A;  1K38 A;  4GZB A;  4EQI A;  4C6Y A;  2J3W A;  4GD6 A;  3GMW A;  4E3O A;  3A0V A;  4JXV A;  2W1R A;  5HD5 A;  3S4X A;  4S2L A;  1KDW A;  3PBO A;  4ZBE A;  4KG5 A;  1PZO A;  2VLG A;  1Y28 A;  5HPI A;  3NIA A;  5KMW A;  4E6X A;  1XJ4 A;  3VP0 A;  1D1J A;  4Y17 A;  4MBH A;  4IUK A;  1DJC A;  1MZU A;  4I39 A;  3BY9 A;  2GDN A;  1IYP A;  1BT5 A;  1FOF A;  5E2H A;  3TSG A;  4UQI M;  1HTZ A;  1W8Q A;  1ES3 A;  4GOG A;  2IWC A;  2JKG A;  4R70 A;  2EX9 A;  4PMA A;  2VEA A;  5FAQ A;  2P9V A;  3BFC A;  2ZQ9 A;  1L0D A;  4FH2 A;  5CTN A;  2NUP C;  5CER A;  4XUX A;  1GSW A;  3R7W A;  1K54 C;  2PU2 A;  1BYW A;  3M6B A;  2EX2 A;  5TFQ A;  1MC0 A;  3CIT A;  1BSG A;  2XSS A;  1KE4 A;  4ARZ A;  1XFN A;  4QY5 A;  5G4Z A;  2ZLY A;  3LYX A;  2ZM2 A;  3IXD A;  4WEL A;  3IH8 A;  4YIN A;  1GCE A;  3T4J A;  4Y3I A;  5EFW A;  3V67 A;  2J3T D;  5FQJ A;  5L2F A;  1SKO B;  2EFU A;  1P9W A;  4OON A;  4CQH A;  1FQG A;  2ZC5 B;  3O3V A;  4YOF A;  1PIO A;  3V5M A;  1W7F A;  1L0E A;  3IWQ A;  2A2L A;  1GHP A;  2VV6 A;  1E3U A;  4LV0 A;  3BFD A;  1XGI A;  3S1Y A;  2YKH A;  4X55 A;  5GLC A;  3G32 A;  1EWZ A;  1KGE A;  3BFF A;  3MZF A;  4E3J A;  4KZ3 A;  2E8I A;  4PKY A;  1T1C A;  2HDR A;  1MY8 A;  1MKI A;  4S2J A;  5CHJ A;  3LEZ A;  2B18 A;  4IBX A;  2Y2P A;  2WZZ A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  3F1P B;  4H6J B;  2EA9 A;  3H7W A;  3GEC A;  2M7U A;  3HCY A;  2FZ0 A;  5DFY A;  1OTB A;  4DMZ A;  2HGV A;  4R6L A;  2KDK A;  1H3Q A;  2FH5 A;  4WN5 A;  5IS1 A;  2D01 A;  5CX7 A;  2HV1 A;  4BWI A;  3PHY A;  4I38 A;  3MR0 A;  4GW9 A;  1ODV A;  2D02 A;  3S7O A;  3UME A;  2XRO A;  3UB6 A;  1N9N A;  3F1N B;  1TS0 A;  2W1T A;  3D3O A;  3EGX C;  1STZ A;  2PR6 A;  4L9F A;  4O01 A;  2IA2 A;  1V9Y A;  2L4R A;  3MXQ A;  4BMW A;  1TS8 A;  2P7J A;  3B42 A;  3VE4 A;  4GHI A;  4WL9 A;  5DKK A;  3FG8 A;  2P04 A;  4NXE A;  3BQA A;  3VOL A;  3GDI A;  4ME4 A;  3ULF A;  1H8M A;  3ZQ5 A;  1OTA A;  1DP6 A;  2M7V A;  3PBR A;  1G28 A;  3P01 A;  4EEP A;  3CUE A;  3RTY A;  4Q0J A;  2PT7 A;  2PR5 A;  3BW6 A;  4OOL A;  3E4O A;  4Q0I A;  3EOI A;  4Y2F A;  2A24 B;  3CUE C;  1WA9 A;  3PBQ A;  1F5M A;  4HNB A;  3LIE A;  3LR0 A;  4CLC A;  3RFB A;  2JHE A;  3UB8 A;  5HPF A;  4CLC D;  2JKT M;  1S67 L;  2O0Y A;  4CLC C;  4HP4 A;  3LR3 A;  5HWT A;  3ZYT A;  4ZRR A;  1VB6 A;  2ZMV A;  5DF9 A;  2GZA A;  4NEE D;  4RQ9 A;  1S66 L;  3MJQ A;  4E04 A;  3VE3 A;  3KSH A;  3LR4 A;  2CMN A;  4WEK A;  1IOU A;  2VV8 A;  4I5S A;  2QKP A;  1UWN X;  3H9W A;  5F6A A;  4EET B;  3C8C A;  2ZBB A;  2VZW A;  3O5Y A;  1MKM A;  4XT2 B;  4B93 A;  2OAQ 1;  1YKD A;  4EU0 A;  3FPW A;  3E4Q A;  4YWZ A;  5FL3 A;  2WKP A;  3W2Z A;  3U2A A;  2L1M A;  5HL6 A;  3RH8 B;  2DMW A;  3EWK A;  3P7N A;  4BBV A;  1YSP A;  3IBJ A;  4LRY C;  5J4E A;  2OAP 1;  3PYP A;  4MMN A;  2G7U A;  4HH3 A;  4R3A A;  1F98 A;  3A0S A;  3H82 A;  3MQ0 A;  3KSI A;  1OTD A;  1OT9 A;  2OWH A;  2OWJ A;  4L9G A;  4MN7 A;  5IT5 A;  2W3G A;  2W0N A;  2NUT C;  3T4O A;  4F3L A;  4II7 A;  3LI9 A;  3LIA A;  1LL8 A;  3HJI A;  4M4X A;  4PKY G;  4IUH A;  1OT6 A;  3BWL A;  1D06 A;  1T19 A;  4EQ1 A;  3MF0 A;  1T1A A;  2KOI A;  3IBR A;  1W63 Q;  2EWV A;  3S7N A;  3OBF A;  4G3V A;  2QJ7 A;  3A0R A;  5TBM A;  2PD8 A;  3BQ8 A;  5AJG A;  2PD7 A;  4QPR A;  4IJG A;  3LFV A;  2PYP A;  3D72 A;  3F1P A;  2INW A;  4LLO B;  1EW0 A;  4HJ6 A;  4GS9 B;  4H6J A;  5F5Y A;  3DBA A;  3LUQ A;  4EES A;  4HJ4 A;  1N9O A;  1D7E A;  2QWS A;  1IFQ A;  1W63 M;  3BJN A;  2W27 A;  2P08 A;  4LRX C;  3F1O B;  3NOU C;  4HQA A;  4GJ4 A;  2V0U A;  4GCZ A;  2R78 A;  1OTI A;  4ETX A;  2GNX A;  5DJU A;  3E4P A;  3F1N A;  3OCN A;  1VHM A;  4BBT A;  2Z6D A;  4PAU A;  2WKR A;  1X0O A;  5K5B A;  3LR5 A;  4HJ3 A;  3NJA A;  5F68 A;  1OPX A;  3UMD A;  5F69 A;  2Y8H A;  3PBS A;  4EW7 A;  3T4K A;  1DP9 A;  4NKP A;  5KSH A;  1XJ3 A;  1GSV A;  2K2N A;  5I5L A;  3R7W B;  3CI6 A;  3CWF A;  2ZOH A;  3EQV A;  1LT0 A;  3JVU A;  5DFX A;  3LIF A;  5C5K A;  4ARZ B;  1OJG A;  2VA0 A;  4CLC E;  2ZOI A;  2MJ6 A;  4HY8 A;  5DKL A;  5J7E A;  4P6Z S;  2KLI A;  3OLO A;  3EEA A;  3K3D A;  2A24 A;  4G3W A;  4HH2 A;  2VKS A;  2Y79 A;  3FC7 A;  1DP8 A;  4NXF A;  2VX8 A;  4G3K A;  1S1Y A;  3UB7 A;  2XA7 S;  3IS2 B;  1XFQ A;  3PR6 A;  4I3J A;  2YKF A;  5HDD A;  4DJ3 A;  4Y5F A;  3LID A;  3BY8 A;  2W3H A;  3S7P A;  4KQO A;  2BAS A;  3KX0 X;  5IU1 A;  1NLZ A;  3B33 A;  3EGD C;  2WKQ A;  2W3F A;  4EEU A;  2HF6 A;  4BBU A;  4WUJ A;  4IHQ A;  1LSW A;  5MC7 A;  4HI4 A;  4MN5 A;  3CLO A;  2ZMF A;  3VV4 A;  4B9O A;  3EQU A;  5HZH A;  2O99 A;  1NWZ A;  2JKR I;  4FOF A;  2K31 A;  1S1Z A;  4XT2 A;  3EEH A;  2K7S A;  2O9B A;  2W3D A;  5AVF A;  2VGL S;  1JNU A;  3JVV A;  1TF1 A;  4BJP A;  3CAX A;  5TJJ A;  5HSQ A;  3PXP A;  2B02 A;  2J80 A;  2J3W A;  3KYQ A;  4WF0 A;  5DJT A;  1YAX A;  4LPZ A;  4R38 A;  2GX5 A;  3A0V A;  3TW8 A;  2V9A A;  2PDR A;  4FSF A;  2W1R A;  5HD5 A;  4I3A A;  3LIB A;  3LI8 A;  3PBO A;  1ZTU A;  5HDC A;  2QYB A;  2M1C A;  2GJ3 A;  2VLG A;  3H7W B;  1Y28 A;  4HIA A;  5HPI A;  1XJ4 A;  4K08 A;  5LBR A;  4EXO A;  2EWW A;  1P0Z A;  4UQI S;  4DJ2 A;  4IUK A;  1V9Z A;  1DRM A;  1MZU A;  2O9A A;  4GS9 A;  4O0P A;  4O8G A;  3KSF A;  1UWP X;  5HWW A;  2XRN A;  1OTE A;  1GSX A;  3OOV A;  4I39 A;  2W1T B;  3BY9 A;  3PBN A;  5HWV A;  4L0L A;  5HD3 A;  3T4Q A;  1TS7 A;  3F1O A;  4JGR A;  2V0W A;  4UQI M;  1ZHH B;  4HOI A;  3SW1 A;  3FPV A;  3TRC A;  1N9L A;  3C38 A;  3MQO A;  3C30 A;  3G6O A;  1S4S A;  3NOT C;  4GHI B;  1P97 A;  4WEJ A;  4KUK A;  4R70 A;  2VEA A;  3MFX A;  4EUV A;  4MDZ A;  1TS6 A;  2LB9 A;  4UEY A;  3HJK A;  4GLQ A;  1NRJ A;  4L9E A;  4Q0H A;  4YNR A;  5J3W A;  3C2W A;  3PBT A;  4WLA A;  3B47 A;  4PHT A;  2Z6C A;  3KO6 A;  2NUP C;  3T4T A;  4ETZ A;  1XJ2 A;  3UE6 A;  1GSW A;  1TD5 A;  3R7W A;  3S7Q A;  4OOM A;  2H28 A;  2PHY A;  1BYW A;  1G6O A;  1F9I A;  1MC0 A;  4Z1W A;  3CIT A;  5AVE A;  4CLC B;  3OCL A;  2XSS A;  4NXB A;  4EER A;  3MMH A;  4ARZ A;  1XFN A;  4KQD A;  3MQQ A;  3K2N A;  5G4Z A;  3LYX A;  4JGP A;  2JKR M;  5KIZ A;  3K3C A;  2KX6 A;  4P6Z M;  3UB9 A;  4MN6 A;  4WEL A;  2LB5 A;  2QHK A;  3T50 A;  3IS2 A;  3TJZ C;  5G4Y A;  1LSV A;  3T4J A;  4Y3I A;  1YSQ A;  5EFW A;  2I9V A;  2QJ5 A;  3LIC A;  2XA7 M;  3V67 A;  3T4L A;  2J3T D;  1NLY A;  2J3T C;  2V1A A;  2JN7 A;  2W3E A;  3NOP C;  1P9W A;  4CQH A;  2PYR A;  1T18 A;  5HDS A;  4YOF A;  1XJ6 A;  1UGU A;  4JGO A;  4KUO A;  2A2L A;  2VV6 A;  1OJ5 A;  3E0Y A;  1S4R A;  3T4S A;  2JKT I;  4NXG A;  4HP9 A;  1LSX A;  1KOU A;  2VJW A;  3H82 B;  2YKH A;  2HJE A;  2VGL M;  4F3L B;  4JGQ A;  4HHD A;  2L0W A;  3KSG A;  3R4K A;  5L8M A;  3E98 A;  2VV7 A;  4I3I A;  2O9C A;  4MCW A;  1T1C A;  4PKY A;  3UE3 A;  3OC2 A;  4AFI A;  2HJ9 C;  1T1B A;  2OOL A;  5A8B A;  2V1B A;  2B18 A;  3KYZ A;  4LRZ E;  3TE8 A;  5TBM B;  1P9R A;  4DN0 A;  3ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...