2W3DA

Structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
total genus 39
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3dA00
3KSIA 4Y5FA 4GW9A 3NOPC 4E04A 4RQ9A 2KLIA 3IBRA 3KSGA 3CITA 2M7VA 5C5KA 1YSPA 5HSQA 4O01A 4EUVA 2W3DA 1VHMA 3KSFA 1TD5A 2O9AA 4O0PA 5DFXA 5I5LA 2XROA 2GX5A 4G3WA 4PAUA 1TF1A 1STZA 3W2ZA 3KO6A 2W3EA 3VV4A 4DN0A 3E98A 3E0YA 2VEAA 4DMZA 4CQHA 2W3HA 3NOTC 2B18A 2VJWA 1MKMA 4IJGA 1YKDA 4GLQA 4MDZA 4ETXA 5HPIA 2XRNA 3BJNA 3KSHA 3MQ0A 4Q0HA 4LRYC 2KOIA 2Y79A 3S7NA 2W1RA 3CI6A 3MF0A 5HPFA 3RFBA 3HCYA 4ZRRA 2LB9A 3MMHA 2QYBA 2O0YA 4MMNA 4FOFA 2W3GA 3G6OA 2OOLA 5TJJA 3ZQ5A 3S7QA 2W1TA 4MN7A 5HL6A 5DFYA 4ME4A 2Y8HA 4MCWA 5LBRA 2HGVA 3O5YA 3D3OA 5L8MA 3OOVA 4O8GA 4G3KA 4IUKA 2XSSA 2O99A 1ZTUA 3OBFA 3NHQA 4EU0A 4G3VA 1YSQA 2W1TB 2LB5A 4Q0JA 2K2NA 4IUHA 4Z1WA 4R70A 2G7UA 3S7PA 4BWIA 1MC0A 2K31A 4Y3IA 2VZWA 1F5MA 3C2WA 2IA2A 2W3FA 2O9CA 3IBJA 4LRZE 2O9BA 3NOUC 4QPRA 3DBAA 4LRXC 3TRCA 3R4KA 4YOFA 3S7OA 3EEAA 2M7UA 3K2NA 4Q0IA 4YNRA 3LFVA 5AJGA 5K5BA 2ZMFA 4Y2FA 4R6LA 4ETZA 2VKSA
chains in the Genus database with same CATH superfamily
3K3DA 4HI4A 4LV3A 1CEFA 2Q9MA 3CITA 3UE3A 4OQIA 4GD6A 4RX2A 4XUZA 5C5KA 4H8RA 3UE0A 2R9WA 3S22A 2FFFB 1HD8A 3HLBA 3KSFA 1TD5A 1XFNA 5I5LA 2XROA 1Q2QA 2W0NA 5TFQA 1SKOA 4P6ZS 2HDRA 1OMEA 1VQQA 4PM5A 3IH8A 2VK3A 4I39A 4DE3A 3JYIA 3WS5A 3H7WA 4E3MA 4HNBA 4MN6A 1J3WA 1XJ6A 3M2JA 1AXBA 3S7NA 2H0TA 5EM1A 3HLDA 2QJ7A 3RXWA 1TS7A 4ZDXA 1BYWA 4OP5A 3C7VA 4KG5A 2P7JA 1NYYA 4JXSA 3TG9A 4NK3A 4DE0A 3ITBA 3Q82A 1H8YA 4EXOA 5CXWA 2ZMAA 4PKYA 3ITAA 1SCWA 5F83A 1MC0A 2PU4A 2ZC4B 4BD0A 1MWRA 3UB7A 3NOUC 4P87A 5E2HA 2DCFA 1S66L 5L07A 1DP9A 4YNRA 1BZAA 4FD8A 4I3IA 3PBNA 1XJ4A 4ETZA 1YLWA 3RH8B 1OTEA 4Y17A 3HLEA 4B4ZA 3GV9A 3UE6A 4WYYA 3OCLA 2WGVA 4U3TA 1S1ZA 2Z2MB 3PBSA 4GHIB 3ZCZA 5DFXA 4ID4A 3MKFA 2WKRA 4CJNA 3FPWA 4HQAA 3T1SA 3IXHA 4UHUA 1D1JA 2RCXA 2XD1A 1MPLA 1VEUB 4QY5A 3C4OA 4ETXA 5HX9A 3IS2A 1W8YA 4RYEA 3T4LA 3A3FA 4C75A 4YWZA 4R23A 3C4PA 5DF7A 3FWLA 2VA0A 4ZRRA 4LV2A 3ZYTA 2Y4AA 1P97A 3MXQA 4R38A 3MR0A 4BL2A 4QWOA 4M3KA 1BLSA 5M1AA 2DNSA 2QPNA 3FKWA 3JVUA 4Y13A 4WUJA 3ZG8B 4IUHA 5CHUA 4B93A 1DRMA 3MQQA 2K31A 4HJ6A 5IT5A 3LYXA 3U4LP 2L1MA 4GHIA 2O9CA 5D3OA 1DY6A 1IKIA 2OSUA 2V1ZA 1VM1A 2C5WB 2I72A 5FAOA 1D7EA 5EV0A 3RXXA 3GR2A 4CLCD 4Y5FA 1G5UA 2ZOHA 3F1NA 5J3WA 2PBDP 2EX9A 1KVLA 4X1LA 5HSQA 2GNXA 3WRZA 3M6HA 5EVLA 4NXEA 5FASA 3JVVA 2WKIA 1K54C 4HY8A 4S2MA 4ARZB 5E2EA 3NI9A 3P98A 4WMCA 4KZ7A 3IX4A 5E2FA 3ZG9B 2Z2LB 3HLGA 1WE4A 3FG8A 4R0QA 2ZQ7A 3HUMA 3A0SA 1TS0A 2PRFA 5G18A 2X01A 4EQ1A 1TDLA 1K0KA 2JBFA 3BLMA 4GCZA 5AVEA 3IXDA 5GLAA 5CX7A 1NWZA 3FPVA 2XSSA 3LIBA 3T50A 2HP9A 3VOYA 5TGFA 2XA7M 4JLFA 2FZ0A 2ZQ8A 4I38A 3FZCA 1IYPA 3BRMA 4Y0TA 4NKPA 1K25A 1JVJA 4GJ4A 3IH9A 3T4TA 3BW6A 3TOIA 2INWA 3T1XA 5FDSA 1TEMA 5AJGA 2JC7A 3AGFA 5HAQA 4OLDA 1CI9A 1MKIA 2PR5A 4OPYA 3UB8A 3KSGA 3IF6B 2W27A 2WK0A 1FSYA 3IT9A 2WKHA 4R1GA 2J80A 1BT5A 4Y0OA 4H6JA 3RJUA 2BLSA 3DTMA 1ACFA 4HHDA 3TE8A 3DW0A 3HUNA 3CPTB 3WS2A 1OTIA 5IU1A 2IWCA 3CPTA 3EOIA 2OAP1 3R7WB 1S1YA 3PBRA 2XK1A 3E4PA 4N9LA 5A93A 2Y79A 3LR3A 1PWCA 2E8IA 1FQGA 4JF5A 2VV7A 1T19A 1IYOA 2W3GA 4KQQA 4MN7A 2HP5A 2ZM8A 1TS8A 2JHEA 3IF6A 1KE3A 2V1BA 2ZC5B 1G28A 3VE3A 1GSXA 4EU0A 3VSKA 3HVFA 3HLCA 2NUTC 5HW3A 3SS4A 4QU3A 3MZEA 3GSGA 2PD8A 4X1MA 1K55A 4JXVA 5L2FA 5FL3A 4PPRA 3CLOA 5F69A 1OTDA 4OOMA 4QD4A 3HJIA 4S2LA 4K91A 5F6AA 2JCHA 4OQ0A 1IYQA 3V3SA 3K3CA 4E04A 4P6BA 3OZHA 3F1OB 5HDCA 1ONHA 5CEDA 5FAPA 5FQ9A 4EERA 4K08A 1Q2PA 3PAGA 1XKZA 2PU2A 2QKPA 4I3JA 1F2KA 3C8CA 2VGJA 1L3LA 2GX5A 4KZ5A 1JWPA 3LR0A 3QP8A 2M1CA 3SH9A 1OT9A 1ESUA 1NZUA 1XXMA 1CK3A 4DMZA 1PWGA 4PM8A 5F82A 1MKMA 3EWKA 2GZAA 3H7WB 1KE0A 4E3OA 1BLHA 1BTLA 2Y59A 4D60A 3KSHA 2EWWA 4OQHA 5HWVA 2X71A 2B95A 2JKRI 1XX2A 4BLMA 3Q7ZA 3RFBA 3MKEA 1N4OA 4X69A 5U47A 5A90A 1HTZA 5GLBA 3S7QA 3P09A 5IHVA 2Y8HA 3RTYA 3F1NB 3NC8A 4E3JA 1LL5A 5TBMB 3H82B 2OWHA 2ZL1A 4UA9A 2V0WA 1H3QA 1I5QA 1WA9A 2K2NA 3T1QB 5DKLA 4Z9QA 5EVIC 1Z6FA 3QP4A 1CF0A 1MWTA 1FIKA 4DXCA 1XGIA 2EFUA 2O9BA 2J8YA 2Z6CA 3TRCA 1XA1A 4BQMA 3S7OA 4BBTA 4KUKA 5DTTA 5A92A 4Q8IA 4ESPA 4JGQA 1JTDA 4WBGA 2NUPC 4UQIS 5EVID 2JKTI 3G30A 4HJ3A 1OJ5A 2Q9NA 1T1AA 3Q7VA 2Y91A 5MC7A 2AVXA 4E6XA 3F1OA 2OAQ1 3G34A 4EWFA 3AGEA 3O86A 4O0PA 1YPRA 4R3BA 2EX2A 1IFQA 3IXBA 1EROA 1TF1A 3OPRA 3B33A 3NIAA 2JKTM 4CPKA 3W4PA 4KUOA 2VEAA 3P7NA 1GA9A 2ZQ9A 4X53A 1YKDA 1LSVA 2V8FA 4KZ4A 4CLCE 4KG2A 4B9OA 1ONGA 3PTEA 2J7VA 3CUEA 3IWIA 2X02A 2EX8A 5HDSA 2EWVA 3ZGAB 1K56A 5HAPA 3PXPA 4EEPA 5FEGA 4NG2A 1L2SA 4EW7A 5TBMA 4MCWA 1SDEA 4JPMA 5L8MA 3OPHA 4DXBA 1Y28A 4IUKA 2O99A 2A49A 2J9PA 3BLSA 2P9VB 3BEBA 4DRTA 1S4SA 4NXFA 1NY0A 1E25A 4KZ9A 2HDSA 3BQ8A 4X25A 4S2NA 3IX8A 1YQSA 5EM0A 5E2GA 5DJTA 2ZC3B 4HH2A 1Y54A 4U0TA 2A24B 5A91A 3T1RA 1K56D 3V50A 1W7FA 3I7JA 4KQOA 4UQIM 3F1PB 5EFWA 4KZ6A 3GDIA 2XD5A 1VETB 5CHMA 4EETB 3HBRA 1FCNA 1H8ZA 3LCEA 1H5XA 4LFUA 3PR6A 1TDGA 2B02A 4DDYA 3BFCA 1T1BA 3E0YA 2ACGA 1A0KA 1ERQA 3BM6A 3JPUA 4DJ3A 5FI7A 1NZOA 4EESA 3FV7A 3OPLA 3IF5A 3W8KA 3ZG0A 5HPIA 4LCLA 4IBRA 3SZTA 3ZVTA 3G31A 4WLAA 4LRYC 1VB6A 2HDUA 1SZVA 1K54A 3A0VA 4WZ5C 3B42A 3LO7A 4FOFA 2HJEA 3PAEA 4ZJ2A 4ME4A 5HWWA 1PRQA 3IWQA 4FH2A 3MBZA 3GQZA 3C38A 2J3TC 4Z1WA 3HJKA 3T12B 1UWNX 4ZTKA 3P01A 1ODVA 3ZG5A 4EQIA 2V9AA 2OLVA 4WZ5A 2EFXA 1C3BA 4LRZE 4BBVA 3UPPA 1YT4A 2M7UA 2XDMA 1YMSA 3D72A 2Y2QA 2H5SA 5K5BA 2ZMFA 1YLPA 2L0WA 3E4OA 1PW8A 2VKSA 1L0DA 4WL9A 5F5YA 4XXRA 2KLIA 4KENB 1EI5A 2WKPA 5GLDA 1IYSA 4P0MA 1BLPA 4I3AA 3VOZA 1ZKJA 4FH4A 3LICA 4X68A 4HP9A 3QNCA 1AWIA 3ISGA 5EOOA 1NJ4A 1O07A 1E3UD 5HWTA 1KGFA 1OPXA 2IWDA 1J9MA 5AVFA 1PYYA 3TSGA 1ZHHB 2Y2IA 5L10A 5M19A 3QHYA 4A5RA 3ULFA 3KX0X 1RCJA 3MZFA 3G32A 2R9XA 2WZZA 3N4IA 4BD1A 1IEMA 2LB9A 2OOLA 3PBQA 3ZQ5A 3UDXA 1K57A 2PYRA 2BG1A 5LBRA 1RGYA 2HGVA 5J4EA 3VFFA 1XA7A 2JKGA 5FATA 3OBFA 2W1TB 3B3XA 2G7UA 2Y2NA 4UA6A 5FEFA 3T4OA 3LIFA 5M18A 3DTEA 3E4QA 2QWSA 1VEUA 2R78A 5KSCA 1DP6A 3QP1A 3R4KA 4HESA 2V1AA 2UWXA 2P08A 3ZNTA 1KE4A 3C30A 2J3TD 1Y4OA 4QJGA 2ZOIA 1D06A 3UPNA 5BOHA 2L4RA 4JXWA 4F94A 1XP4A 3VP4A 1N9LA 1S67L 1GHPA 3UDIA 1BULA 2PDRA 4N9KA 2WGIA 3ZDJA 5FA7A 2WYXA 5HDDA 1N9BA 3WS4A 4PKYG 2YKFA 3UMDA 5JYOA 3SH8A 3VV4A 2E8JA 3NJAA 4E3IA 1WYBA 2QJ5A 3EQVA 5DKKA 2FH5A 3CMZA 1OJGA 4BJPA 5FQQA 4L9GA 4IEDA 4MDZA 1LHYA 1DJCA 1JWZA 4X56A 3O88A 1VETA 1S0WA 1W8QA 1JTGA 3H9WA 1RP5A 2K7SA 2H28A 1YLTA 4BBUA 5EVIB 3OLOA 4OH0A 3VOLA 4O8GA 2ZQCA 2P04A 1K4FA 2WGWB 1K55C 4NXGA 1PNEA 2A24A 3S1YA 4X55A 5J8XA 2MJ6A 2Y2PA 5KZHA 1OTAA 4NEED 5KSHA 3EEAA 4HBUA 3K2NA 4IBXA 4OONA 4F3LB 4S2OA 1ALQA 4HIAA 5FQJA 3MXRA 3GVBA 1PZOA 2XA7S 3MS6A 1BLCA 5I94A 3CJMA 3MZDA 4LV0A 1YSPA 5F1GA 3LI8A 2JE5A 3IWOA 4PMAA 1STZA 1T18A 3WS0A 2D02A 2ZM2A 2HDQA 2Z6DA 4E3LA 1XFQA 3VE4A 4XUXA 1YM1A 3GMWA 4EV4A 2VJWA 4GLQA 4MBKA 5HL1A 4LLOB 4S2JA 1ES3A 3GECA 4UA7A 3LEZA 3A3JA 5EUAA 3LGOA 3IS2B 1M6KA 3Q7VB 2O0YA 4ZAMA 3HL9A 3KYZA 4JF4A 3LR4A 4GN2A 3GRJA 1FR6A 3LIAA 4GOGA 4RVAA 3OOVA 4OPRA 1ZTUA 3NHQA 1LSXA 4Y15A 4EBLA 4R3AA 1LL9A 3PBTA 3LY4A 3SOIA 1N9OA 3QNBA 4Y3IA 5AQ9A 4X6TA 2XR0A 1RGZA 4OOYA 1E4DA 1G6OA 5G4YA 4N92A 2GDNA 1PI5A 1FCMA 3LI9A 4KZ3A 4LPZA 4YFMA 4GD8A 2ZC7A 1CQAA 3NDGA 1F98A 2IWBA 2PAVP 2M7VA 1NRFA 4KQRA 5AQBA 1H0MA 4O01A 3MFDA 2O9AA 1GSWA 5FQIA 4OOLA 2A2LA 2HZ5A 4OPQA 2V2FF 4S2NC 1BSGA 2PHYA 4GS9A 4CLCC 1MWUA 3DWZA 1NXYA 3CZDA 4CLCB 4DN0A 4RX3A 2ZJ9A 3LY3A 3EGDC 1DP8A 3UB5P 1W79A 1PI4A 5CHJA 4L9EA 3WWXA 1GCEA 3UNWA 1GSVA 2KDKA 4KZBA 1S6RA 3Q1FA 1NLZA 4Q0HA 3UB9A 4ARZA 3IXGA 4CLCA 2Y2KA 1FSWA 3V39A 3A3IA 4RA7A 2W1TA 4MNRA 1YLZA 4Y7PA 1CJFA 1MWSA 3VFHA 4OVDA 2V8CA 1G68A 3DTIA 1NYMA 2PR6A 2UV0E 4GZBA 1SKOB 4IHQA 3IF6C 3EQUA 4K0WA 3S7PA 2PYPA 1YLYA 1JNUA 3HREA 4EEUA 3SW1A 3BFFA 1YAXA 4QPRA 4N1XA 4EBPA 3VP2A 2HF6A 1GA0A 3BQAA 1ESIA 3UE1A 3KSIA 1S4RA 3NULA 1ES4A 1X0OA 1DJAA 5A8BA 3SS3A 3UMEA 4XT2A 5EE8A 4JGRA 5CGSA 4OQGA 3DTKA 3S4XA 2Q0OA 3IX3A 4JXGA 2H10A 1XPBA 1V9YA 4PHTA 2ZQDA 3T4SA 2B18A 2H0YA 4IJGA 1FR1A 1IOUA 2GJ3A 2HPBA 1NLYA 5CGWA 5HD3A 4C3QA 5GHYA 4L0LA 5AQ7A 1EWZA 2XRNA 3BJNA 2WGWA 4FSFA 2XLNA 4H6JB 3DWKA 2OV5A 2XQZA 4MBFA 1TS6A 1EW0A 2W1RA 2CMNA 5AQAA 4QHCA 5FQMA 5KIZA 1SKFA 5GHXA 2VLGA 5EECA 4WF0A 2G2UA 3LEQA 4UEYA 1YMXA 4JF6A 3T4KA 3EGXC 4Y0UA 1T1CA 4FUWA 3BYDA 4Q0JA 3EEHA 4R4RA 4GB7A 2VV8A 4BWIA 4DKIA 3ZHHA 2W3FA 3A3DA 3CWFA 4O7DA 1KGGA 1MXOA 4LRXC 3MFXA 1L0GA 1K57C 2XGNA 1ES2A 4E6WA 2Y2HA 4LCMA 4OKPA 2XH9A 3IHAA 5JYPA 2BASA 3NDEA 2WKQA 4WZ4A 5E43A 1P0ZA 3TJZC 2ZD8A 2ZQAA 3A0RA 3GTCA 4EUVA 2W3DA 1VHMA 1ZG6A 2OLUA 3BFEA 3FYZA 4GDNA 2WUQA 1CEGA 1I2SA 3LIEA 3KO6A 4K0XA 2Y2GA 1KOUA 3F1PA 2Y55A 5J7EA 4HBTA 2PD7A 4CQHA 3L7HA 1P9RA 1MY8A 3M6BA 4EUZA 4HOIA 2PT7A 4E3KA 1V9ZA 3H82A 3MQ0A 4GS9B 1CI8A 1HLUP 1QMFA 2DMWA 1HVBA 2WAFA 3G4PA 3MMHA 2I9VA 2BTFP 4N1HA 2P9VA 5HL6A 3V5MA 5G4ZA 4DJ2A 3UY6A 4P6ZM 3A3EA 3PHYA 4OLGA 2WKEA 3MJQA 3C5AA 4G3VA 1O7EA 2ZC6B 5DF9A 4AFIA 1QMEA 4DF6A 4BMWA 3G2ZA 4MEZA 4KZ8A 4R70A 3SS5A 5KMWA 3V67A 4R4SA 3V3RA 3ZG7B 3DAVA 3HLFA 2WAEA 1U60A 3G2YA 2VZWA 1F5MA 1ZC2A 3HLWA 3C2WA 4QY6A 2G2WA 5CECA 4P85A 4FCFA 2C6WB 5HAIA 4MLLA 1PIOA 4IVIA 3W4OA 2Y2LA 1MBLA 5FDHA 4UAAA 5EPHA 3C7UA 3BFGA 3E2LA 3NOPC 4PM7A 2V0UA 3M2KA 2ZMVA 5F1FA 1LL8A 2EA9A 1XJ2A 2VGLM 2V20A 1Z09A 3T4QA 3Q81A 4WEKA 3VP0A 1L0FA 5CGXA 5CTMA 4G3WA 1KVMA 3OPPA 3W2ZA 4WMCD 4WELA 1F9IA 3QP6A 2KX6A 2A3UA 2W3EA 3UPOA 4ZJ3A 2VV6A 4HP4A 3KYEA 3KYQA 2ZM0A 5HZHA 1IKGA 5TR7A 4S2PA 4NETA 1TVFA 4GDBA 4JGOA 1PWDA 3HUOA 1GHIA 2JKFA 3VSLA 4ZJ1A 4HEFA 4OPZA 2XF3A 5DJUA 2OWJA 3MF0A 2HP6A 5HPFA 4KZAA 2QYBA 2HJ9C 3Q07A 3G6OA 4MMNA 3SH7A 5TJJA 2ZL1B 4E3NA 3UB6A 3NY4A 2HV1A 4LGWA 4EBNA 4F3LA 3O5YA 3D3OA 1LI9A 4G3KA 2B5RA 3BECA 5DTSA 4L9FA 1JWVA 3NECA 2QZ6A 4S2IA 1BUEA 3IHBA 2PBYA 4HH3A 2Y2OA 3UN7A 2XEPA 5L09A 2EX6A 3O3VA 1LT0A 4WN5A 4II7A 3MXSA 4YOFA 1K6SA 3PYPA 5FI6A 4GNUA 3LFVA 2ZLYA 3ZVWA 5HARA 2Y2MA 1ERMA 4MBHA 4GW9A 2J3WA 3VMAA 3AGDA 1L0EA 2WZXA 3PBOA 4XT2B 5DF8A 5HD5A 4HJ4A 2VGLS 3G35A 1OT6A 4JKTA 4D2OA 3OC2A 1ES5A 4PAUA 1OTBA 5EVEA 4PM9A 2YKHA 4DE2A 2DRWA 1IELA 3L9KA 4I5SA 3CUEC 2QMIA 1P9WA 3D4FA 2VX8A 1DJBA 1FCOA 4BL3A 2RL3A 5FI2A 4OP8A 1PW1A 3NBLA 3UO9A 5GL9A 3LIDA 4IVKA 5GLCA 3VP3A 5CEBA 2KOIA 4GKUA 4B4XA 3BWLA 5FAQA 1FILA 3U2AA 3HCYA 1W5DA 5FSRA 1GHMA 4JBFA 3MSHA 2ZBBA 3T4JA 3BY9A 5DTKA 4B88A 2Y2JA 2LB5A 3ZFZA 3N7WA 4KQDA 3BFDA 3IQAA 3QP2A 1M40A 2EXAA 5F68A 2IA2A 3FC7A 3IBJA 1HZOA 2XFSA 1XGJA 3DBAA 3UDFA 3R7WA 1I2WA 1KDWA 3CG5A 1W63Q 1UGUA 5HFOA 3N8SA 4R3JA 1YLJA 4R6LA 3LR5A 1KDSA 1N9NA 2XFTA 4RQ9A 3TW8A 3IBRA 3N8RA 3N6IA 3D9YA 5CTNA 4U0XA 1PFLA 2D01A 2CC1A 4KG6A 4NXBA 3VP1A 1K38A 5GHZA 5EOEA 1XJ3A 4DE1A 3NCKA 1FOFA 3CAXA 3E98A 3MQOA 1K4EA 3W4QA 2W3HA 3NOTC 3N8LA 3WS1A 1G6AA 2WADA 1WYCA 3QP5A 5CERA 1LLBA 4ZBEA 5DVAA 3B47A 2JN7A 1W63M 5FQKA 1KGEA 1LSWA 3WRTA 1H8MA 3CI6A 1SHVA 1SDNA 4WM9A 1MZUA 4MN5A 3OCNA 1ZG4A 4LV1A 5DFYA 2EXBA 3E2KA 4S2KA 3BY8A 4BENA 1PZPA 2VGKA 4M4XA 4FTXA 3ICYA 4C6YA 3FKVA 1YSQA 1K6RA 3LUQA 2FFYA 1UWPX 1NRJA 2JKRM 4JGPA 1LI0A 3ZNYA 4QB8A 5IS1A 1E3UA 5EVIA 3CHWP 3O87A 4PM6A 4Q0IA 4LENA 4DDSA 4WEJA 2J9OA 4YINA 2QHKA 2P74A 4Y2FA 5CRFA
chains in the Genus database with same CATH topology
2L4RA 3K3DA 4HI4A 2BASA 3K3CA 4E04A 2WKQA 1N9LA 1S67L 3CITA 3UE3A 3F1OB 5HDCA 1P0ZA 5C5KA 3TJZC 3A0RA 2PDRA 2W3DA 4EERA 1VHMA 3KSFA 4EUVA 1TD5A 1XFNA 4K08A 2QKPA 4I3JA 5I5LA 3C8CA 2XROA 2GX5A 2W0NA 3LIEA 5HDDA 4PKYG 3KO6A 2YKFA 3UMDA 4P6ZS 1KOUA 3VV4A 3LR0A 3NJAA 2M1CA 2QJ5A 3F1PA 5J7EA 1OT9A 3EQVA 5DKKA 2FH5A 2PD7A 4DMZA 4CQHA 1OJGA 4BJPA 1MKMA 1P9RA 3EWKA 4I39A 2GZAA 4HOIA 4L9GA 2PT7A 3H7WB 3H7WA 4MDZA 4HNBA 4MN6A 1V9ZA 1XJ6A 3H82A 3KSHA 2EWWA 5HWVA 3MQ0A 2JKRI 4GS9B 3S7NA 3H9WA 2K7SA 3RFBA 2QJ7A 1TS7A 2DMWA 3MMHA 2H28A 1BYWA 2I9VA 3S7QA 2P7JA 5HL6A 5G4ZA 4BBUA 2Y8HA 3OLOA 3VOLA 3RTYA 4DJ2A 4P6ZM 3F1NB 4O8GA 3PHYA 2P04A 3MJQA 5TBMB 3H82B 4G3VA 4NXGA 5DF9A 4AFIA 2A24A 2OWHA 4BMWA 2V0WA 1H3QA 1WA9A 4EXOA 2K2NA 4R70A 4PKYA 2MJ6A 5DKLA 3V67A 1MC0A 1OTAA 2VZWA 1F5MA 4NEED 3C2WA 3UB7A 5KSHA 2O9BA 3NOUC 2Z6CA 3TRCA 3S7OA 4BBTA 4KUKA 3EEAA 1S66L 3K2NA 1DP9A 4YNRA 4F3LB 4JGQA 4I3IA 3PBNA 1XJ4A 4ETZA 4HIAA 2NUPC 3RH8B 1OTEA 4UQIS 2XA7S 2JKTI 4HJ3A 3NOPC 1OJ5A 1T1AA 3UE6A 2V0UA 2ZMVA 5MC7A 1LL8A 2EA9A 1XJ2A 2VGLM 3F1OA 3OCLA 2OAQ1 1YSPA 1S1ZA 3T4QA 3PBSA 4GHIB 3LI8A 4WEKA 4O0PA 5DFXA 2WKRA 3FPWA 1IFQA 4G3WA 4HQAA 1TF1A 1STZA 3W2ZA 1T18A 1F9IA 2D02A 4WELA 2KX6A 3B33A 2JKTM 2W3EA 2Z6DA 2VV6A 4HP4A 4KUOA 1XFQA 3KYQA 3VE4A 2VEAA 3P7NA 5HZHA 2VJWA 1YKDA 4GLQA 1LSVA 4JGOA 4CLCE 4ETXA 4B9OA 4LLOB 3CUEA 3IS2A 5HDSA 3GECA 3T4LA 2EWVA 5DJUA 2OWJA 3PXPA 4YWZA 4EEPA 3IS2B 3MF0A 5HPFA 2VA0A 4ZRRA 3ZYTA 2QYBA 2O0YA 4EW7A 2HJ9C 4MMNA 3G6OA 3KYZA 5TJJA 1P97A 3LR4A 3MXQA 4R38A 3MR0A 3UB6A 5TBMA 2HV1A 3LIAA 4MCWA 4F3LA 3O5YA 3D3OA 5L8MA 3OOVA 4G3KA 1Y28A 4IUKA 2O99A 1ZTUA 4L9FA 3NHQA 3JVUA 1LSXA 4WUJA 1S4SA 4IUHA 4B93A 4HH3A 1DRMA 4NXFA 4R3AA 3MQQA 2K31A 3PBTA 4HJ6A 5IT5A 1N9OA 3LYXA 4Y3IA 2L1MA 4GHIA 1LT0A 2O9CA 3BQ8A 4WN5A 4II7A 4YOFA 1G6OA 5G4YA 3PYPA 5DJTA 3LFVA 4HH2A 3LI9A 2A24B 4LPZA 1D7EA 4CLCD 4Y5FA 4GW9A 4KQOA 4UQIM 2ZOHA 3F1NA 3F1PB 5J3WA 2J3WA 1F98A 5EFWA 2M7VA 3GDIA 3PBOA 4XT2B 5HD5A 4HJ4A 2GNXA 4O01A 5HSQA 2VGLS 4EETB 1OT6A 2O9AA 1GSWA 1D06A 4OOLA 2A2LA 3OC2A 4NXEA 3PR6A 2PHYA 4PAUA 1OTBA 4GS9A 3JVVA 2B02A 4CLCC 4CLCB 2YKHA 4HY8A 4DN0A 1T1BA 3E0YA 4ARZB 3EGDC 4I5SA 3CUEC 1DP8A 1P9WA 2VX8A 4DJ3A 4EESA 4L9EA 1GSVA 5HPIA 2KDKA 3FG8A 4WLAA 1NLZA 4Q0HA 3UB9A 3LIDA 4ARZA 4LRYC 1VB6A 2KOIA 3A0SA 1TS0A 3BWLA 4CLCA 4EQ1A 3U2AA 3A0VA 3HCYA 3B42A 4GCZA 4FOFA 2HJEA 5AVEA 2W1TA 4ME4A 5CX7A 5HWWA 1NWZA 2ZBBA 3BY9A 3T4JA 3FPVA 2XSSA 3LIBA 2PR6A 3C38A 2LB5A 4IHQA 3T50A 2J3TC 3EQUA 4Z1WA 4KQDA 3HJKA 3S7PA 2PYPA 2XA7M 1JNUA 1UWNX 2FZ0A 3P01A 1ODVA 4I38A 2V9AA 5F68A 2IA2A 4NKPA 4EEUA 3SW1A 3FC7A 3IBJA 4GJ4A 4LRZE 4BBVA 3T4TA 1YAXA 3DBAA 4QPRA 3BW6A 2INWA 2M7UA 3R7WA 3D72A 2HF6A 5AJGA 3BQAA 5K5BA 1W63Q 2ZMFA 1UGUA 2L0WA 3E4OA 4R6LA 3LR5A 2VKSA 2PR5A 4WL9A 5F5YA 3KSIA 1S4RA 1N9NA 1X0OA 4RQ9A 3UB8A 2KLIA 3UMEA 3TW8A 3IBRA 3KSGA 5A8BA 2W27A 4XT2A 2J80A 2WKPA 4JGRA 4H6JA 4I3AA 2D01A 4NXBA 4HHDA 3TE8A 3LICA 1XJ3A 4HP9A 1OTIA 3CAXA 3E98A 5IU1A 1V9YA 3MQOA 4PHTA 2W3HA 3T4SA 3NOTC 2B18A 3EOIA 5HWTA 4IJGA 1OPXA 1IOUA 2GJ3A 1NLYA 2OAP1 5AVFA 5HD3A 4L0LA 3R7WB 1ZHHB 2XRNA 3BJNA 1S1YA 4FSFA 3B47A 3PBRA 2JN7A 3E4PA 4H6JB 1W63M 1TS6A 1EW0A 1LSWA 3ULFA 3KX0X 2Y79A 2W1RA 1H8MA 3CI6A 3LR3A 2CMNA 5KIZA 2LB9A 2VV7A 1T19A 2W3GA 1MZUA 2OOLA 4MN5A 3PBQA 2VLGA 3ZQ5A 3OCNA 4MN7A 5DFYA 4WF0A 2PYRA 4UEYA 5LBRA 3T4KA 2HGVA 3EGXC 1TS8A 2JHEA 3BY8A 1T1CA 5J4EA 2V1BA 4M4XA 1G28A 3ICYA 3VE3A 3OBFA 1GSXA 4EU0A 1YSQA 2W1TB 4Q0JA 3EEHA 2NUTC 3LUQA 2G7UA 1UWPX 2VV8A 4BWIA 2PD8A 1NRJA 2JKRM 4JGPA 3T4OA 3LIFA 3E4QA 5IS1A 2QWSA 2R78A 2W3FA 3CWFA 4LRXC 5FL3A 1DP6A 3R4KA 3MFXA 3CLOA 2V1AA 5F69A 2P08A 1OTDA 4OOMA 4Q0IA 3HJIA 4WEJA 3C30A 5F6AA 2QHKA 2J3TD 4Y2FA 2ZOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSI A;  4Y5F A;  4GW9 A;  3NOP C;  4E04 A;  4RQ9 A;  2KLI A;  3IBR A;  3KSG A;  3CIT A;  2M7V A;  5C5K A;  1YSP A;  5HSQ A;  4O01 A;  4EUV A;  2W3D A;  1VHM A;  3KSF A;  1TD5 A;  2O9A A;  4O0P A;  5DFX A;  5I5L A;  2XRO A;  2GX5 A;  4G3W A;  4PAU A;  1TF1 A;  1STZ A;  3W2Z A;  3KO6 A;  2W3E A;  3VV4 A;  4DN0 A;  3E98 A;  3E0Y A;  2VEA A;  4DMZ A;  4CQH A;  2W3H A;  3NOT C;  2B18 A;  2VJW A;  1MKM A;  4IJG A;  1YKD A;  4GLQ A;  4MDZ A;  4ETX A;  5HPI A;  2XRN A;  3BJN A;  3KSH A;  3MQ0 A;  4Q0H A;  4LRY C;  2KOI A;  2Y79 A;  3S7N A;  2W1R A;  3CI6 A;  3MF0 A;  5HPF A;  3RFB A;  3HCY A;  4ZRR A;  2LB9 A;  3MMH A;  2QYB A;  2O0Y A;  4MMN A;  4FOF A;  2W3G A;  3G6O A;  2OOL A;  5TJJ A;  3ZQ5 A;  3S7Q A;  2W1T A;  4MN7 A;  5HL6 A;  5DFY A;  4ME4 A;  2Y8H A;  4MCW A;  5LBR A;  2HGV A;  3O5Y A;  3D3O A;  5L8M A;  3OOV A;  4O8G A;  4G3K A;  4IUK A;  2XSS A;  2O99 A;  1ZTU A;  3OBF A;  3NHQ A;  4EU0 A;  4G3V A;  1YSQ A;  2W1T B;  2LB5 A;  4Q0J A;  2K2N A;  4IUH A;  4Z1W A;  4R70 A;  2G7U A;  3S7P A;  4BWI A;  1MC0 A;  2K31 A;  4Y3I A;  2VZW A;  1F5M A;  3C2W A;  2IA2 A;  2W3F A;  2O9C A;  3IBJ A;  4LRZ E;  2O9B A;  3NOU C;  4QPR A;  3DBA A;  4LRX C;  3TRC A;  3R4K A;  4YOF A;  3S7O A;  3EEA A;  2M7U A;  3K2N A;  4Q0I A;  4YNR A;  3LFV A;  5AJG A;  5K5B A;  2ZMF A;  4Y2F A;  4R6L A;  4ETZ A;  2VKS A; 
#chains in the Genus database with same CATH topology
 3K3D A;  4HI4 A;  4LV3 A;  1CEF A;  2Q9M A;  3CIT A;  3UE3 A;  4OQI A;  4GD6 A;  4RX2 A;  4XUZ A;  5C5K A;  4H8R A;  3UE0 A;  2R9W A;  3S22 A;  2FFF B;  1HD8 A;  3HLB A;  3KSF A;  1TD5 A;  1XFN A;  5I5L A;  2XRO A;  1Q2Q A;  2W0N A;  5TFQ A;  1SKO A;  4P6Z S;  2HDR A;  1OME A;  1VQQ A;  4PM5 A;  3IH8 A;  2VK3 A;  4I39 A;  4DE3 A;  3JYI A;  3WS5 A;  3H7W A;  4E3M A;  4HNB A;  4MN6 A;  1J3W A;  1XJ6 A;  3M2J A;  1AXB A;  3S7N A;  2H0T A;  5EM1 A;  3HLD A;  2QJ7 A;  3RXW A;  1TS7 A;  4ZDX A;  1BYW A;  4OP5 A;  3C7V A;  4KG5 A;  2P7J A;  1NYY A;  4JXS A;  3TG9 A;  4NK3 A;  4DE0 A;  3ITB A;  3Q82 A;  1H8Y A;  4EXO A;  5CXW A;  2ZMA A;  4PKY A;  3ITA A;  1SCW A;  5F83 A;  1MC0 A;  2PU4 A;  2ZC4 B;  4BD0 A;  1MWR A;  3UB7 A;  3NOU C;  4P87 A;  5E2H A;  2DCF A;  1S66 L;  5L07 A;  1DP9 A;  4YNR A;  1BZA A;  4FD8 A;  4I3I A;  3PBN A;  1XJ4 A;  4ETZ A;  1YLW A;  3RH8 B;  1OTE A;  4Y17 A;  3HLE A;  4B4Z A;  3GV9 A;  3UE6 A;  4WYY A;  3OCL A;  2WGV A;  4U3T A;  1S1Z A;  2Z2M B;  3PBS A;  4GHI B;  3ZCZ A;  5DFX A;  4ID4 A;  3MKF A;  2WKR A;  4CJN A;  3FPW A;  4HQA A;  3T1S A;  3IXH A;  4UHU A;  1D1J A;  2RCX A;  2XD1 A;  1MPL A;  1VEU B;  4QY5 A;  3C4O A;  4ETX A;  5HX9 A;  3IS2 A;  1W8Y A;  4RYE A;  3T4L A;  3A3F A;  4C75 A;  4YWZ A;  4R23 A;  3C4P A;  5DF7 A;  3FWL A;  2VA0 A;  4ZRR A;  4LV2 A;  3ZYT A;  2Y4A A;  1P97 A;  3MXQ A;  4R38 A;  3MR0 A;  4BL2 A;  4QWO A;  4M3K A;  1BLS A;  5M1A A;  2DNS A;  2QPN A;  3FKW A;  3JVU A;  4Y13 A;  4WUJ A;  3ZG8 B;  4IUH A;  5CHU A;  4B93 A;  1DRM A;  3MQQ A;  2K31 A;  4HJ6 A;  5IT5 A;  3LYX A;  3U4L P;  2L1M A;  4GHI A;  2O9C A;  5D3O A;  1DY6 A;  1IKI A;  2OSU A;  2V1Z A;  1VM1 A;  2C5W B;  2I72 A;  5FAO A;  1D7E A;  5EV0 A;  3RXX A;  3GR2 A;  4CLC D;  4Y5F A;  1G5U A;  2ZOH A;  3F1N A;  5J3W A;  2PBD P;  2EX9 A;  1KVL A;  4X1L A;  5HSQ A;  2GNX A;  3WRZ A;  3M6H A;  5EVL A;  4NXE A;  5FAS A;  3JVV A;  2WKI A;  1K54 C;  4HY8 A;  4S2M A;  4ARZ B;  5E2E A;  3NI9 A;  3P98 A;  4WMC A;  4KZ7 A;  3IX4 A;  5E2F A;  3ZG9 B;  2Z2L B;  3HLG A;  1WE4 A;  3FG8 A;  4R0Q A;  2ZQ7 A;  3HUM A;  3A0S A;  1TS0 A;  2PRF A;  5G18 A;  2X01 A;  4EQ1 A;  1TDL A;  1K0K A;  2JBF A;  3BLM A;  4GCZ A;  5AVE A;  3IXD A;  5GLA A;  5CX7 A;  1NWZ A;  3FPV A;  2XSS A;  3LIB A;  3T50 A;  2HP9 A;  3VOY A;  5TGF A;  2XA7 M;  4JLF A;  2FZ0 A;  2ZQ8 A;  4I38 A;  3FZC A;  1IYP A;  3BRM A;  4Y0T A;  4NKP A;  1K25 A;  1JVJ A;  4GJ4 A;  3IH9 A;  3T4T A;  3BW6 A;  3TOI A;  2INW A;  3T1X A;  5FDS A;  1TEM A;  5AJG A;  2JC7 A;  3AGF A;  5HAQ A;  4OLD A;  1CI9 A;  1MKI A;  2PR5 A;  4OPY A;  3UB8 A;  3KSG A;  3IF6 B;  2W27 A;  2WK0 A;  1FSY A;  3IT9 A;  2WKH A;  4R1G A;  2J80 A;  1BT5 A;  4Y0O A;  4H6J A;  3RJU A;  2BLS A;  3DTM A;  1ACF A;  4HHD A;  3TE8 A;  3DW0 A;  3HUN A;  3CPT B;  3WS2 A;  1OTI A;  5IU1 A;  2IWC A;  3CPT A;  3EOI A;  2OAP 1;  3R7W B;  1S1Y A;  3PBR A;  2XK1 A;  3E4P A;  4N9L A;  5A93 A;  2Y79 A;  3LR3 A;  1PWC A;  2E8I A;  1FQG A;  4JF5 A;  2VV7 A;  1T19 A;  1IYO A;  2W3G A;  4KQQ A;  4MN7 A;  2HP5 A;  2ZM8 A;  1TS8 A;  2JHE A;  3IF6 A;  1KE3 A;  2V1B A;  2ZC5 B;  1G28 A;  3VE3 A;  1GSX A;  4EU0 A;  3VSK A;  3HVF A;  3HLC A;  2NUT C;  5HW3 A;  3SS4 A;  4QU3 A;  3MZE A;  3GSG A;  2PD8 A;  4X1M A;  1K55 A;  4JXV A;  5L2F A;  5FL3 A;  4PPR A;  3CLO A;  5F69 A;  1OTD A;  4OOM A;  4QD4 A;  3HJI A;  4S2L A;  4K91 A;  5F6A A;  2JCH A;  4OQ0 A;  1IYQ A;  3V3S A;  3K3C A;  4E04 A;  4P6B A;  3OZH A;  3F1O B;  5HDC A;  1ONH A;  5CED A;  5FAP A;  5FQ9 A;  4EER A;  4K08 A;  1Q2P A;  3PAG A;  1XKZ A;  2PU2 A;  2QKP A;  4I3J A;  1F2K A;  3C8C A;  2VGJ A;  1L3L A;  2GX5 A;  4KZ5 A;  1JWP A;  3LR0 A;  3QP8 A;  2M1C A;  3SH9 A;  1OT9 A;  1ESU A;  1NZU A;  1XXM A;  1CK3 A;  4DMZ A;  1PWG A;  4PM8 A;  5F82 A;  1MKM A;  3EWK A;  2GZA A;  3H7W B;  1KE0 A;  4E3O A;  1BLH A;  1BTL A;  2Y59 A;  4D60 A;  3KSH A;  2EWW A;  4OQH A;  5HWV A;  2X71 A;  2B95 A;  2JKR I;  1XX2 A;  4BLM A;  3Q7Z A;  3RFB A;  3MKE A;  1N4O A;  4X69 A;  5U47 A;  5A90 A;  1HTZ A;  5GLB A;  3S7Q A;  3P09 A;  5IHV A;  2Y8H A;  3RTY A;  3F1N B;  3NC8 A;  4E3J A;  1LL5 A;  5TBM B;  3H82 B;  2OWH A;  2ZL1 A;  4UA9 A;  2V0W A;  1H3Q A;  1I5Q A;  1WA9 A;  2K2N A;  3T1Q B;  5DKL A;  4Z9Q A;  5EVI C;  1Z6F A;  3QP4 A;  1CF0 A;  1MWT A;  1FIK A;  4DXC A;  1XGI A;  2EFU A;  2O9B A;  2J8Y A;  2Z6C A;  3TRC A;  1XA1 A;  4BQM A;  3S7O A;  4BBT A;  4KUK A;  5DTT A;  5A92 A;  4Q8I A;  4ESP A;  4JGQ A;  1JTD A;  4WBG A;  2NUP C;  4UQI S;  5EVI D;  2JKT I;  3G30 A;  4HJ3 A;  1OJ5 A;  2Q9N A;  1T1A A;  3Q7V A;  2Y91 A;  5MC7 A;  2AVX A;  4E6X A;  3F1O A;  2OAQ 1;  3G34 A;  4EWF A;  3AGE A;  3O86 A;  4O0P A;  1YPR A;  4R3B A;  2EX2 A;  1IFQ A;  3IXB A;  1ERO A;  1TF1 A;  3OPR A;  3B33 A;  3NIA A;  2JKT M;  4CPK A;  3W4P A;  4KUO A;  2VEA A;  3P7N A;  1GA9 A;  2ZQ9 A;  4X53 A;  1YKD A;  1LSV A;  2V8F A;  4KZ4 A;  4CLC E;  4KG2 A;  4B9O A;  1ONG A;  3PTE A;  2J7V A;  3CUE A;  3IWI A;  2X02 A;  2EX8 A;  5HDS A;  2EWV A;  3ZGA B;  1K56 A;  5HAP A;  3PXP A;  4EEP A;  5FEG A;  4NG2 A;  1L2S A;  4EW7 A;  5TBM A;  4MCW A;  1SDE A;  4JPM A;  5L8M A;  3OPH A;  4DXB A;  1Y28 A;  4IUK A;  2O99 A;  2A49 A;  2J9P A;  3BLS A;  2P9V B;  3BEB A;  4DRT A;  1S4S A;  4NXF A;  1NY0 A;  1E25 A;  4KZ9 A;  2HDS A;  3BQ8 A;  4X25 A;  4S2N A;  3IX8 A;  1YQS A;  5EM0 A;  5E2G A;  5DJT A;  2ZC3 B;  4HH2 A;  1Y54 A;  4U0T A;  2A24 B;  5A91 A;  3T1R A;  1K56 D;  3V50 A;  1W7F A;  3I7J A;  4KQO A;  4UQI M;  3F1P B;  5EFW A;  4KZ6 A;  3GDI A;  2XD5 A;  1VET B;  5CHM A;  4EET B;  3HBR A;  1FCN A;  1H8Z A;  3LCE A;  1H5X A;  4LFU A;  3PR6 A;  1TDG A;  2B02 A;  4DDY A;  3BFC A;  1T1B A;  3E0Y A;  2ACG A;  1A0K A;  1ERQ A;  3BM6 A;  3JPU A;  4DJ3 A;  5FI7 A;  1NZO A;  4EES A;  3FV7 A;  3OPL A;  3IF5 A;  3W8K A;  3ZG0 A;  5HPI A;  4LCL A;  4IBR A;  3SZT A;  3ZVT A;  3G31 A;  4WLA A;  4LRY C;  1VB6 A;  2HDU A;  1SZV A;  1K54 A;  3A0V A;  4WZ5 C;  3B42 A;  3LO7 A;  4FOF A;  2HJE A;  3PAE A;  4ZJ2 A;  4ME4 A;  5HWW A;  1PRQ A;  3IWQ A;  4FH2 A;  3MBZ A;  3GQZ A;  3C38 A;  2J3T C;  4Z1W A;  3HJK A;  3T12 B;  1UWN X;  4ZTK A;  3P01 A;  1ODV A;  3ZG5 A;  4EQI A;  2V9A A;  2OLV A;  4WZ5 A;  2EFX A;  1C3B A;  4LRZ E;  4BBV A;  3UPP A;  1YT4 A;  2M7U A;  2XDM A;  1YMS A;  3D72 A;  2Y2Q A;  2H5S A;  5K5B A;  2ZMF A;  1YLP A;  2L0W A;  3E4O A;  1PW8 A;  2VKS A;  1L0D A;  4WL9 A;  5F5Y A;  4XXR A;  2KLI A;  4KEN B;  1EI5 A;  2WKP A;  5GLD A;  1IYS A;  4P0M A;  1BLP A;  4I3A A;  3VOZ A;  1ZKJ A;  4FH4 A;  3LIC A;  4X68 A;  4HP9 A;  3QNC A;  1AWI A;  3ISG A;  5EOO A;  1NJ4 A;  1O07 A;  1E3U D;  5HWT A;  1KGF A;  1OPX A;  2IWD A;  1J9M A;  5AVF A;  1PYY A;  3TSG A;  1ZHH B;  2Y2I A;  5L10 A;  5M19 A;  3QHY A;  4A5R A;  3ULF A;  3KX0 X;  1RCJ A;  3MZF A;  3G32 A;  2R9X A;  2WZZ A;  3N4I A;  4BD1 A;  1IEM A;  2LB9 A;  2OOL A;  3PBQ A;  3ZQ5 A;  3UDX A;  1K57 A;  2PYR A;  2BG1 A;  5LBR A;  1RGY A;  2HGV A;  5J4E A;  3VFF A;  1XA7 A;  2JKG A;  5FAT A;  3OBF A;  2W1T B;  3B3X A;  2G7U A;  2Y2N A;  4UA6 A;  5FEF A;  3T4O A;  3LIF A;  5M18 A;  3DTE A;  3E4Q A;  2QWS A;  1VEU A;  2R78 A;  5KSC A;  1DP6 A;  3QP1 A;  3R4K A;  4HES A;  2V1A A;  2UWX A;  2P08 A;  3ZNT A;  1KE4 A;  3C30 A;  2J3T D;  1Y4O A;  4QJG A;  2ZOI A;  1D06 A;  3UPN A;  5BOH A;  2L4R A;  4JXW A;  4F94 A;  1XP4 A;  3VP4 A;  1N9L A;  1S67 L;  1GHP A;  3UDI A;  1BUL A;  2PDR A;  4N9K A;  2WGI A;  3ZDJ A;  5FA7 A;  2WYX A;  5HDD A;  1N9B A;  3WS4 A;  4PKY G;  2YKF A;  3UMD A;  5JYO A;  3SH8 A;  3VV4 A;  2E8J A;  3NJA A;  4E3I A;  1WYB A;  2QJ5 A;  3EQV A;  5DKK A;  2FH5 A;  3CMZ A;  1OJG A;  4BJP A;  5FQQ A;  4L9G A;  4IED A;  4MDZ A;  1LHY A;  1DJC A;  1JWZ A;  4X56 A;  3O88 A;  1VET A;  1S0W A;  1W8Q A;  1JTG A;  3H9W A;  1RP5 A;  2K7S A;  2H28 A;  1YLT A;  4BBU A;  5EVI B;  3OLO A;  4OH0 A;  3VOL A;  4O8G A;  2ZQC A;  2P04 A;  1K4F A;  2WGW B;  1K55 C;  4NXG A;  1PNE A;  2A24 A;  3S1Y A;  4X55 A;  5J8X A;  2MJ6 A;  2Y2P A;  5KZH A;  1OTA A;  4NEE D;  5KSH A;  3EEA A;  4HBU A;  3K2N A;  4IBX A;  4OON A;  4F3L B;  4S2O A;  1ALQ A;  4HIA A;  5FQJ A;  3MXR A;  3GVB A;  1PZO A;  2XA7 S;  3MS6 A;  1BLC A;  5I94 A;  3CJM A;  3MZD A;  4LV0 A;  1YSP A;  5F1G A;  3LI8 A;  2JE5 A;  3IWO A;  4PMA A;  1STZ A;  1T18 A;  3WS0 A;  2D02 A;  2ZM2 A;  2HDQ A;  2Z6D A;  4E3L A;  1XFQ A;  3VE4 A;  4XUX A;  1YM1 A;  3GMW A;  4EV4 A;  2VJW A;  4GLQ A;  4MBK A;  5HL1 A;  4LLO B;  4S2J A;  1ES3 A;  3GEC A;  4UA7 A;  3LEZ A;  3A3J A;  5EUA A;  3LGO A;  3IS2 B;  1M6K A;  3Q7V B;  2O0Y A;  4ZAM A;  3HL9 A;  3KYZ A;  4JF4 A;  3LR4 A;  4GN2 A;  3GRJ A;  1FR6 A;  3LIA A;  4GOG A;  4RVA A;  3OOV A;  4OPR A;  1ZTU A;  3NHQ A;  1LSX A;  4Y15 A;  4EBL A;  4R3A A;  1LL9 A;  3PBT A;  3LY4 A;  3SOI A;  1N9O A;  3QNB A;  4Y3I A;  5AQ9 A;  4X6T A;  2XR0 A;  1RGZ A;  4OOY A;  1E4D A;  1G6O A;  5G4Y A;  4N92 A;  2GDN A;  1PI5 A;  1FCM A;  3LI9 A;  4KZ3 A;  4LPZ A;  4YFM A;  4GD8 A;  2ZC7 A;  1CQA A;  3NDG A;  1F98 A;  2IWB A;  2PAV P;  2M7V A;  1NRF A;  4KQR A;  5AQB A;  1H0M A;  4O01 A;  3MFD A;  2O9A A;  1GSW A;  5FQI A;  4OOL A;  2A2L A;  2HZ5 A;  4OPQ A;  2V2F F;  4S2N C;  1BSG A;  2PHY A;  4GS9 A;  4CLC C;  1MWU A;  3DWZ A;  1NXY A;  3CZD A;  4CLC B;  4DN0 A;  4RX3 A;  2ZJ9 A;  3LY3 A;  3EGD C;  1DP8 A;  3UB5 P;  1W79 A;  1PI4 A;  5CHJ A;  4L9E A;  3WWX A;  1GCE A;  3UNW A;  1GSV A;  2KDK A;  4KZB A;  1S6R A;  3Q1F A;  1NLZ A;  4Q0H A;  3UB9 A;  4ARZ A;  3IXG A;  4CLC A;  2Y2K A;  1FSW A;  3V39 A;  3A3I A;  4RA7 A;  2W1T A;  4MNR A;  1YLZ A;  4Y7P A;  1CJF A;  1MWS A;  3VFH A;  4OVD A;  2V8C A;  1G68 A;  3DTI A;  1NYM A;  2PR6 A;  2UV0 E;  4GZB A;  1SKO B;  4IHQ A;  3IF6 C;  3EQU A;  4K0W A;  3S7P A;  2PYP A;  1YLY A;  1JNU A;  3HRE A;  4EEU A;  3SW1 A;  3BFF A;  1YAX A;  4QPR A;  4N1X A;  4EBP A;  3VP2 A;  2HF6 A;  1GA0 A;  3BQA A;  1ESI A;  3UE1 A;  3KSI A;  1S4R A;  3NUL A;  1ES4 A;  1X0O A;  1DJA A;  5A8B A;  3SS3 A;  3UME A;  4XT2 A;  5EE8 A;  4JGR A;  5CGS A;  4OQG A;  3DTK A;  3S4X A;  2Q0O A;  3IX3 A;  4JXG A;  2H10 A;  1XPB A;  1V9Y A;  4PHT A;  2ZQD A;  3T4S A;  2B18 A;  2H0Y A;  4IJG A;  1FR1 A;  1IOU A;  2GJ3 A;  2HPB A;  1NLY A;  5CGW A;  5HD3 A;  4C3Q A;  5GHY A;  4L0L A;  5AQ7 A;  1EWZ A;  2XRN A;  3BJN A;  2WGW A;  4FSF A;  2XLN A;  4H6J B;  3DWK A;  2OV5 A;  2XQZ A;  4MBF A;  1TS6 A;  1EW0 A;  2W1R A;  2CMN A;  5AQA A;  4QHC A;  5FQM A;  5KIZ A;  1SKF A;  5GHX A;  2VLG A;  5EEC A;  4WF0 A;  2G2U A;  3LEQ A;  4UEY A;  1YMX A;  4JF6 A;  3T4K A;  3EGX C;  4Y0U A;  1T1C A;  4FUW A;  3BYD A;  4Q0J A;  3EEH A;  4R4R A;  4GB7 A;  2VV8 A;  4BWI A;  4DKI A;  3ZHH A;  2W3F A;  3A3D A;  3CWF A;  4O7D A;  1KGG A;  1MXO A;  4LRX C;  3MFX A;  1L0G A;  1K57 C;  2XGN A;  1ES2 A;  4E6W A;  2Y2H A;  4LCM A;  4OKP A;  2XH9 A;  3IHA A;  5JYP A;  2BAS A;  3NDE A;  2WKQ A;  4WZ4 A;  5E43 A;  1P0Z A;  3TJZ C;  2ZD8 A;  2ZQA A;  3A0R A;  3GTC A;  4EUV A;  2W3D A;  1VHM A;  1ZG6 A;  2OLU A;  3BFE A;  3FYZ A;  4GDN A;  2WUQ A;  1CEG A;  1I2S A;  3LIE A;  3KO6 A;  4K0X A;  2Y2G A;  1KOU A;  3F1P A;  2Y55 A;  5J7E A;  4HBT A;  2PD7 A;  4CQH A;  3L7H A;  1P9R A;  1MY8 A;  3M6B A;  4EUZ A;  4HOI A;  2PT7 A;  4E3K A;  1V9Z A;  3H82 A;  3MQ0 A;  4GS9 B;  1CI8 A;  1HLU P;  1QMF A;  2DMW A;  1HVB A;  2WAF A;  3G4P A;  3MMH A;  2I9V A;  2BTF P;  4N1H A;  2P9V A;  5HL6 A;  3V5M A;  5G4Z A;  4DJ2 A;  3UY6 A;  4P6Z M;  3A3E A;  3PHY A;  4OLG A;  2WKE A;  3MJQ A;  3C5A A;  4G3V A;  1O7E A;  2ZC6 B;  5DF9 A;  4AFI A;  1QME A;  4DF6 A;  4BMW A;  3G2Z A;  4MEZ A;  4KZ8 A;  4R70 A;  3SS5 A;  5KMW A;  3V67 A;  4R4S A;  3V3R A;  3ZG7 B;  3DAV A;  3HLF A;  2WAE A;  1U60 A;  3G2Y A;  2VZW A;  1F5M A;  1ZC2 A;  3HLW A;  3C2W A;  4QY6 A;  2G2W A;  5CEC A;  4P85 A;  4FCF A;  2C6W B;  5HAI A;  4MLL A;  1PIO A;  4IVI A;  3W4O A;  2Y2L A;  1MBL A;  5FDH A;  4UAA A;  5EPH A;  3C7U A;  3BFG A;  3E2L A;  3NOP C;  4PM7 A;  2V0U A;  3M2K A;  2ZMV A;  5F1F A;  1LL8 A;  2EA9 A;  1XJ2 A;  2VGL M;  2V20 A;  1Z09 A;  3T4Q A;  3Q81 A;  4WEK A;  3VP0 A;  1L0F A;  5CGX A;  5CTM A;  4G3W A;  1KVM A;  3OPP A;  3W2Z A;  4WMC D;  4WEL A;  1F9I A;  3QP6 A;  2KX6 A;  2A3U A;  2W3E A;  3UPO A;  4ZJ3 A;  2VV6 A;  4HP4 A;  3KYE A;  3KYQ A;  2ZM0 A;  5HZH A;  1IKG A;  5TR7 A;  4S2P A;  4NET A;  1TVF A;  4GDB A;  4JGO A;  1PWD A;  3HUO A;  1GHI A;  2JKF A;  3VSL A;  4ZJ1 A;  4HEF A;  4OPZ A;  2XF3 A;  5DJU A;  2OWJ A;  3MF0 A;  2HP6 A;  5HPF A;  4KZA A;  2QYB A;  2HJ9 C;  3Q07 A;  3G6O A;  4MMN A;  3SH7 A;  5TJJ A;  2ZL1 B;  4E3N A;  3UB6 A;  3NY4 A;  2HV1 A;  4LGW A;  4EBN A;  4F3L A;  3O5Y A;  3D3O A;  1LI9 A;  4G3K A;  2B5R A;  3BEC A;  5DTS A;  4L9F A;  1JWV A;  3NEC A;  2QZ6 A;  4S2I A;  1BUE A;  3IHB A;  2PBY A;  4HH3 A;  2Y2O A;  3UN7 A;  2XEP A;  5L09 A;  2EX6 A;  3O3V A;  1LT0 A;  4WN5 A;  4II7 A;  3MXS A;  4YOF A;  1K6S A;  3PYP A;  5FI6 A;  4GNU A;  3LFV A;  2ZLY A;  3ZVW A;  5HAR A;  2Y2M A;  1ERM A;  4MBH A;  4GW9 A;  2J3W A;  3VMA A;  3AGD A;  1L0E A;  2WZX A;  3PBO A;  4XT2 B;  5DF8 A;  5HD5 A;  4HJ4 A;  2VGL S;  3G35 A;  1OT6 A;  4JKT A;  4D2O A;  3OC2 A;  1ES5 A;  4PAU A;  1OTB A;  5EVE A;  4PM9 A;  2YKH A;  4DE2 A;  2DRW A;  1IEL A;  3L9K A;  4I5S A;  3CUE C;  2QMI A;  1P9W A;  3D4F A;  2VX8 A;  1DJB A;  1FCO A;  4BL3 A;  2RL3 A;  5FI2 A;  4OP8 A;  1PW1 A;  3NBL A;  3UO9 A;  5GL9 A;  3LID A;  4IVK A;  5GLC A;  3VP3 A;  5CEB A;  2KOI A;  4GKU A;  4B4X A;  3BWL A;  5FAQ A;  1FIL A;  3U2A A;  3HCY A;  1W5D A;  5FSR A;  1GHM A;  4JBF A;  3MSH A;  2ZBB A;  3T4J A;  3BY9 A;  5DTK A;  4B88 A;  2Y2J A;  2LB5 A;  3ZFZ A;  3N7W A;  4KQD A;  3BFD A;  3IQA A;  3QP2 A;  1M40 A;  2EXA A;  5F68 A;  2IA2 A;  3FC7 A;  3IBJ A;  1HZO A;  2XFS A;  1XGJ A;  3DBA A;  3UDF A;  3R7W A;  1I2W A;  1KDW A;  3CG5 A;  1W63 Q;  1UGU A;  5HFO A;  3N8S A;  4R3J A;  1YLJ A;  4R6L A;  3LR5 A;  1KDS A;  1N9N A;  2XFT A;  4RQ9 A;  3TW8 A;  3IBR A;  3N8R A;  3N6I A;  3D9Y A;  5CTN A;  4U0X A;  1PFL A;  2D01 A;  2CC1 A;  4KG6 A;  4NXB A;  3VP1 A;  1K38 A;  5GHZ A;  5EOE A;  1XJ3 A;  4DE1 A;  3NCK A;  1FOF A;  3CAX A;  3E98 A;  3MQO A;  1K4E A;  3W4Q A;  2W3H A;  3NOT C;  3N8L A;  3WS1 A;  1G6A A;  2WAD A;  1WYC A;  3QP5 A;  5CER A;  1LLB A;  4ZBE A;  5DVA A;  3B47 A;  2JN7 A;  1W63 M;  5FQK A;  1KGE A;  1LSW A;  3WRT A;  1H8M A;  3CI6 A;  1SHV A;  1SDN A;  4WM9 A;  1MZU A;  4MN5 A;  3OCN A;  1ZG4 A;  4LV1 A;  5DFY A;  2EXB A;  3E2K A;  4S2K A;  3BY8 A;  4BEN A;  1PZP A;  2VGK A;  4M4X A;  4FTX A;  3ICY A;  4C6Y A;  3FKV A;  1YSQ A;  1K6R A;  3LUQ A;  2FFY A;  1UWP X;  1NRJ A;  2JKR M;  4JGP A;  1LI0 A;  3ZNY A;  4QB8 A;  5IS1 A;  1E3U A;  5EVI A;  3CHW P;  3O87 A;  4PM6 A;  4Q0I A;  4LEN A;  4DDS A;  4WEJ A;  2J9O A;  4YIN A;  2QHK A;  2P74 A;  4Y2F A;  5CRF A; 
#chains in the Genus database with same CATH homology
 2L4R A;  3K3D A;  4HI4 A;  2BAS A;  3K3C A;  4E04 A;  2WKQ A;  1N9L A;  1S67 L;  3CIT A;  3UE3 A;  3F1O B;  5HDC A;  1P0Z A;  5C5K A;  3TJZ C;  3A0R A;  2PDR A;  2W3D A;  4EER A;  1VHM A;  3KSF A;  4EUV A;  1TD5 A;  1XFN A;  4K08 A;  2QKP A;  4I3J A;  5I5L A;  3C8C A;  2XRO A;  2GX5 A;  2W0N A;  3LIE A;  5HDD A;  4PKY G;  3KO6 A;  2YKF A;  3UMD A;  4P6Z S;  1KOU A;  3VV4 A;  3LR0 A;  3NJA A;  2M1C A;  2QJ5 A;  3F1P A;  5J7E A;  1OT9 A;  3EQV A;  5DKK A;  2FH5 A;  2PD7 A;  4DMZ A;  4CQH A;  1OJG A;  4BJP A;  1MKM A;  1P9R A;  3EWK A;  4I39 A;  2GZA A;  4HOI A;  4L9G A;  2PT7 A;  3H7W B;  3H7W A;  4MDZ A;  4HNB A;  4MN6 A;  1V9Z A;  1XJ6 A;  3H82 A;  3KSH A;  2EWW A;  5HWV A;  3MQ0 A;  2JKR I;  4GS9 B;  3S7N A;  3H9W A;  2K7S A;  3RFB A;  2QJ7 A;  1TS7 A;  2DMW A;  3MMH A;  2H28 A;  1BYW A;  2I9V A;  3S7Q A;  2P7J A;  5HL6 A;  5G4Z A;  4BBU A;  2Y8H A;  3OLO A;  3VOL A;  3RTY A;  4DJ2 A;  4P6Z M;  3F1N B;  4O8G A;  3PHY A;  2P04 A;  3MJQ A;  5TBM B;  3H82 B;  4G3V A;  4NXG A;  5DF9 A;  4AFI A;  2A24 A;  2OWH A;  4BMW A;  2V0W A;  1H3Q A;  1WA9 A;  4EXO A;  2K2N A;  4R70 A;  4PKY A;  2MJ6 A;  5DKL A;  3V67 A;  1MC0 A;  1OTA A;  2VZW A;  1F5M A;  4NEE D;  3C2W A;  3UB7 A;  5KSH A;  2O9B A;  3NOU C;  2Z6C A;  3TRC A;  3S7O A;  4BBT A;  4KUK A;  3EEA A;  1S66 L;  3K2N A;  1DP9 A;  4YNR A;  4F3L B;  4JGQ A;  4I3I A;  3PBN A;  1XJ4 A;  4ETZ A;  4HIA A;  2NUP C;  3RH8 B;  1OTE A;  4UQI S;  2XA7 S;  2JKT I;  4HJ3 A;  3NOP C;  1OJ5 A;  1T1A A;  3UE6 A;  2V0U A;  2ZMV A;  5MC7 A;  1LL8 A;  2EA9 A;  1XJ2 A;  2VGL M;  3F1O A;  3OCL A;  2OAQ 1;  1YSP A;  1S1Z A;  3T4Q A;  3PBS A;  4GHI B;  3LI8 A;  4WEK A;  4O0P A;  5DFX A;  2WKR A;  3FPW A;  1IFQ A;  4G3W A;  4HQA A;  1TF1 A;  1STZ A;  3W2Z A;  1T18 A;  1F9I A;  2D02 A;  4WEL A;  2KX6 A;  3B33 A;  2JKT M;  2W3E A;  2Z6D A;  2VV6 A;  4HP4 A;  4KUO A;  1XFQ A;  3KYQ A;  3VE4 A;  2VEA A;  3P7N A;  5HZH A;  2VJW A;  1YKD A;  4GLQ A;  1LSV A;  4JGO A;  4CLC E;  4ETX A;  4B9O A;  4LLO B;  3CUE A;  3IS2 A;  5HDS A;  3GEC A;  3T4L A;  2EWV A;  5DJU A;  2OWJ A;  3PXP A;  4YWZ A;  4EEP A;  3IS2 B;  3MF0 A;  5HPF A;  2VA0 A;  4ZRR A;  3ZYT A;  2QYB A;  2O0Y A;  4EW7 A;  2HJ9 C;  4MMN A;  3G6O A;  3KYZ A;  5TJJ A;  1P97 A;  3LR4 A;  3MXQ A;  4R38 A;  3MR0 A;  3UB6 A;  5TBM A;  2HV1 A;  3LIA A;  4MCW A;  4F3L A;  3O5Y A;  3D3O A;  5L8M A;  3OOV A;  4G3K A;  1Y28 A;  4IUK A;  2O99 A;  1ZTU A;  4L9F A;  3NHQ A;  3JVU A;  1LSX A;  4WUJ A;  1S4S A;  4IUH A;  4B93 A;  4HH3 A;  1DRM A;  4NXF A;  4R3A A;  3MQQ A;  2K31 A;  3PBT A;  4HJ6 A;  5IT5 A;  1N9O A;  3LYX A;  4Y3I A;  2L1M A;  4GHI A;  1LT0 A;  2O9C A;  3BQ8 A;  4WN5 A;  4II7 A;  4YOF A;  1G6O A;  5G4Y A;  3PYP A;  5DJT A;  3LFV A;  4HH2 A;  3LI9 A;  2A24 B;  4LPZ A;  1D7E A;  4CLC D;  4Y5F A;  4GW9 A;  4KQO A;  4UQI M;  2ZOH A;  3F1N A;  3F1P B;  5J3W A;  2J3W A;  1F98 A;  5EFW A;  2M7V A;  3GDI A;  3PBO A;  4XT2 B;  5HD5 A;  4HJ4 A;  2GNX A;  4O01 A;  5HSQ A;  2VGL S;  4EET B;  1OT6 A;  2O9A A;  1GSW A;  1D06 A;  4OOL A;  2A2L A;  3OC2 A;  4NXE A;  3PR6 A;  2PHY A;  4PAU A;  1OTB A;  4GS9 A;  3JVV A;  2B02 A;  4CLC C;  4CLC B;  2YKH A;  4HY8 A;  4DN0 A;  1T1B A;  3E0Y A;  4ARZ B;  3EGD C;  4I5S A;  3CUE C;  1DP8 A;  1P9W A;  2VX8 A;  4DJ3 A;  4EES A;  4L9E A;  1GSV A;  5HPI A;  2KDK A;  3FG8 A;  4WLA A;  1NLZ A;  4Q0H A;  3UB9 A;  3LID A;  4ARZ A;  4LRY C;  1VB6 A;  2KOI A;  3A0S A;  1TS0 A;  3BWL A;  4CLC A;  4EQ1 A;  3U2A A;  3A0V A;  3HCY A;  3B42 A;  4GCZ A;  4FOF A;  2HJE A;  5AVE A;  2W1T A;  4ME4 A;  5CX7 A;  5HWW A;  1NWZ A;  2ZBB A;  3BY9 A;  3T4J A;  3FPV A;  2XSS A;  3LIB A;  2PR6 A;  3C38 A;  2LB5 A;  4IHQ A;  3T50 A;  2J3T C;  3EQU A;  4Z1W A;  4KQD A;  3HJK A;  3S7P A;  2PYP A;  2XA7 M;  1JNU A;  1UWN X;  2FZ0 A;  3P01 A;  1ODV A;  4I38 A;  2V9A A;  5F68 A;  2IA2 A;  4NKP A;  4EEU A;  3SW1 A;  3FC7 A;  3IBJ A;  4GJ4 A;  4LRZ E;  4BBV A;  3T4T A;  1YAX A;  3DBA A;  4QPR A;  3BW6 A;  2INW A;  2M7U A;  3R7W A;  3D72 A;  2HF6 A;  5AJG A;  3BQA A;  5K5B A;  1W63 Q;  2ZMF A;  1UGU A;  2L0W A;  3E4O A;  4R6L A;  3LR5 A;  2VKS A;  2PR5 A;  4WL9 A;  5F5Y A;  3KSI A;  1S4R A;  1N9N A;  1X0O A;  4RQ9 A;  3UB8 A;  2KLI A;  3UME A;  3TW8 A;  3IBR A;  3KSG A;  5A8B A;  2W27 A;  4XT2 A;  2J80 A;  2WKP A;  4JGR A;  4H6J A;  4I3A A;  2D01 A;  4NXB A;  4HHD A;  3TE8 A;  3LIC A;  1XJ3 A;  4HP9 A;  1OTI A;  3CAX A;  3E98 A;  5IU1 A;  1V9Y A;  3MQO A;  4PHT A;  2W3H A;  3T4S A;  3NOT C;  2B18 A;  3EOI A;  5HWT A;  4IJG A;  1OPX A;  1IOU A;  2GJ3 A;  1NLY A;  2OAP 1;  5AVF A;  5HD3 A;  4L0L A;  3R7W B;  1ZHH B;  2XRN A;  3BJN A;  1S1Y A;  4FSF A;  3B47 A;  3PBR A;  2JN7 A;  3E4P A;  4H6J B;  1W63 M;  1TS6 A;  1EW0 A;  1LSW A;  3ULF A;  3KX0 X;  2Y79 A;  2W1R A;  1H8M A;  3CI6 A;  3LR3 A;  2CMN A;  5KIZ A;  2LB9 A;  2VV7 A;  1T19 A;  2W3G A;  1MZU A;  2OOL A;  4MN5 A;  3PBQ A;  2VLG A;  3ZQ5 A;  3OCN A;  4MN7 A;  5DFY A;  4WF0 A;  2PYR A;  4UEY A;  5LBR A;  3T4K A;  2HGV A;  3EGX C;  1TS8 A;  2JHE A;  3BY8 A;  1T1C A;  5J4E A;  2V1B A;  4M4X A;  1G28 A;  3ICY A;  3VE3 A;  3OBF A;  1GSX A;  4EU0 A;  1YSQ A;  2W1T B;  4Q0J A;  3EEH A;  2NUT C;  3LUQ A;  2G7U A;  1UWP X;  2VV8 A;  4BWI A;  2PD8 A;  1NRJ A;  2JKR M;  4JGP A;  3T4O A;  3LIF A;  3E4Q A;  5IS1 A;  2QWS A;  2R78 A;  2W3F A;  3CWF A;  4LRX C;  5FL3 A;  1DP6 A;  3R4K A;  3MFX A;  3CLO A;  2V1A A;  5F69 A;  2P08 A;  1OTD A;  4OOM A;  4Q0I A;  3HJI A;  4WEJ A;  3C30 A;  5F6A A;  2QHK A;  2J3T D;  4Y2F A;  2ZOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...