2W3DA

Structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
b'GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 39
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3dA00
2QYBA 1MC0A 5L8MA 3TRCA 3MF0A 2XSSA 4ETZA 4ZRRA 4DMZA 4LRZE 5DFXA 3NOPC 2Y79A 4QPRA 2W3EA 3D3OA 2VJWA 4MMNA 4DN0A 5HL6A 2Y8HA 2O9AA 3KSIA 2K2NA 4O8GA 5HPFA 4ETXA 1YSQA 3G6OA 2O9CA 4GLQA 2LB9A 4Y3IA 4R6LA 1STZA 2W3GA 3S7NA 2K31A 4Y5FA 3KSFA 3O5YA 4MCWA 2W3HA 2O99A 5K5BA 4O01A 3S7PA 1VHMA 3EEAA 4O0PA 4Q0HA 4G3WA 4EUVA 4MN7A 3VV4A 3OOVA 3NOTC 1TD5A 4LRXC 4PAUA 3ZQ5A 5C5KA 3CI6A 3RFBA 1ZTUA 3S7OA 3KSGA 2KLIA 2HGVA 3KO6A 5AJGA 5TJJA 2W1RA 3R4KA 2VEAA 3DBAA 1F5MA 3MQ0A 2ZMFA 2M7VA 2KOIA 3C2WA 4Y2FA 4YNRA 4R70A 2IA2A 3IBRA 4CQHA 2VKSA 2XROA 5HSQA 4BWIA 2W3FA 4FOFA 4IUKA 3S7QA 2M7UA 2LB5A 2VZWA 5DFYA 4GW9A 3BJNA 3NOUC 1YKDA 2G7UA 4LRYC 3K2NA 5I5LA 2O9BA 3CITA 5HPIA 1MKMA 2OOLA 5LBRA 1YSPA 2XRNA 4Q0JA 2B18A 3MMHA 4EU0A 4E04A 4YOFA 4IJGA 4G3VA 4ME4A 3HCYA 4RQ9A 2O0YA 4G3KA 3E98A 2GX5A 2W1TB 3IBJA 3LFVA 4Z1WA 3NHQA 1TF1A 4Q0IA 3KSHA 4MDZA 3W2ZA 3E0YA 3OBFA 2W1TA 2W3DA 4IUHA
chains in the Genus database with same CATH superfamily
3CMZA 3VFFA 4HJ3A 4B93A 1LSXA 3C7VA 3UE0A 2W3EA 1CI8A 3U2AA 3UE6A 4ZJ1A 1KE4A 4RVAA 5DKKA 1LSVA 1E4DA 3G2YA 2P04A 4GJ4A 3BY9A 2XR0A 3FPWA 3S22A 4DDYA 1SDEA 3W4OA 1G28A 5TBMA 1CF0A 4OQGA 1XFQA 1XGIA 1VHMA 1KDWA 3M6BA 1PIOA 2C5WB 4HIAA 3AGDA 2V0WA 2B5RA 2WGVA 3KSGA 4LPZA 4KZ5A 5FL3A 2HGVA 2ZL1A 4B9OA 5EVID 3IXHA 4MBFA 2XROA 1SKFA 4ZTKA 3F1OB 3V3RA 3BLMA 5CRFA 2JKTM 3MR0A 4GW9A 4I3AA 4HOIA 4LENA 1VM1A 2XGNA 4DXBA 4GDNA 3IWIA 4S2JA 2D02A 3GMWA 2WZXA 1BZAA 1MY8A 4EU0A 3ZG9B 3LR4A 4N92A 1SCWA 2Y2JA 3EQUA 5HDCA 3E98A 1L2SA 4Y15A 2P9VB 3NI9A 3SH7A 1S6RA 2X71A 1KVMA 3NBLA 1PI5A 4KG5A 5FASA 3IF6C 2JKRI 3UPNA 3G30A 1ODVA 4ZRRA 5EE8A 3JYIA 2DNSA 1VEUA 2INWA 5FDHA 3WS1A 3NIAA 4OH0A 4KUKA 5HARA 4F3LB 2K2NA 2Z6DA 5DVAA 4D60A 3ZNYA 1WE4A 5F69A 3TJZC 2WKHA 1N4OA 3OC2A 5AQAA 4QWOA 1L0FA 1VB6A 3DAVA 3VP2A 4PM7A 1J9MA 1SKOB 2BASA 3EQVA 1P97A 3NY4A 1IYSA 3OPLA 3G34A 5AQBA 1T19A 4WF0A 1FQGA 4OOMA 4Y0UA 3GSGA 1GA0A 1J3WA 1I5QA 2IA2A 5FEGA 2W3FA 2JBFA 4X69A 1GSXA 3Q7ZA 4GD6A 4EBLA 2WYXA 2ZMAA 5I5LA 5FEFA 5HWVA 3WS5A 5LBRA 3QP8A 5F6AA 5HD3A 1XX2A 2ZQ8A 2R78A 4BBTA 1K54A 1NY0A 4GOGA 3LFVA 4K0XA 2VV8A 4WEKA 3NJAA 1K38A 2WADA 2K7SA 3NHQA 3IS2B 4S2PA 2DMWA 2W3DA 1ZG6A 4OPRA 3WRTA 1N9BA 3UDIA 3QP6A 5DF8A 5F82A 5HDSA 5MC7A 1PWCA 3R7WB 3C38A 4R3JA 2QJ7A 4I5SA 1DP8A 5D3OA 2AVXA 2JN7A 4Z9QA 4XUZA 4E3LA 1TDLA 4EV4A 1P9WA 4K0WA 3HLGA 4KQDA 1FSWA 2M1CA 1AXBA 5KIZA 5K5BA 4S2NC 1ERMA 3ZFZA 5L10A 2J9OA 3VOLA 3C2WA 2WKQA 4Y2FA 4EESA 2ZC4B 1FIKA 4N1HA 2J9PA 3T1RA 2GDNA 1Y4OA 4JXGA 3W4QA 1TDGA 4HH2A 2QPNA 1NYYA 1K55A 3F1OA 2P08A 1G5UA 2OSUA 1WYCA 4WMCA 1D06A 3LEQA 4G3KA 5CGXA 5DTTA 2PBYA 3B47A 5HDDA 1RGZA 2ZQDA 1JTDA 5FAPA 1FSYA 2P9VA 4CJNA 4I3JA 4UQIM 2Q0OA 4E3KA 4JGRA 3MF0A 1IKIA 4PKYA 4XT2B 1LI9A 4U3TA 1D1JA 1OTIA 2YKHA 3A0SA 2XH9A 1PW1A 2Y8HA 3KSIA 1KE0A 2HF6A 2JCHA 1W63M 5HPFA 3TSGA 4RYEA 4H6JB 4F3LA 4UA6A 1TS8A 4WZ4A 2H10A 4S2MA 4WZ5C 1T18A 2OLUA 4MBHA 1S1ZA 2EFXA 5EVIC 4P0MA 4G3WA 2H28A 4MN7A 4NXFA 5U47A 3HBRA 2XA7M 4PM9A 4YWZA 1JWPA 4R0QA 1Z09A 5C5KA 1BT5A 1MXOA 3LIFA 2ZQCA 5DKLA 4WMCD 4R70A 1BULA 2OWHA 3ZG8B 4BWIA 1EW0A 4FOFA 5EVEA 3LR3A 1QMEA 2R9WA 1BLHA 4ESPA 3SW1A 1YKDA 4LRYC 1ZC2A 3GVBA 3IX4A 4IHQA 4HY8A 2PD8A 4ME4A 2EFUA 1FR6A 4R4RA 3P7NA 5I94A 4ID4A 4N1XA 5FI2A 4Y0OA 2Y91A 2Y2MA 1OPXA 2V1AA 3CLOA 3EEHA 1KE3A 4F94A 3N6IA 3B42A 3O87A 3E4QA 2HDSA 3KYQA 3Q1FA 2J3TD 4FSFA 3LI9A 3IS2A 1MC0A 3TRCA 1P9RA 3BFDA 1JWZA 2V2FF 2L0WA 3UNWA 3G31A 2PU4A 1LLBA 3DTMA 2VV6A 1VQQA 3MZDA 3G6OA 3R7WA 2V0UA 3DW0A 3QNCA 4UQIS 3A0VA 3D4FA 1OTAA 5E43A 4E6XA 2V9AA 3IXDA 1RP5A 4EUVA 4IVIA 1IYPA 1ES2A 3NOTC 4Y13A 1NZOA 1DJCA 4KZ8A 4OP5A 3LR0A 3WS0A 3T4TA 1W8QA 5A90A 5TJJA 1X0OA 2IWDA 4IEDA 3U4LP 4MNRA 2M7VA 3HLFA 1TS6A 4CQHA 3L9KA 3N8SA 1MWTA 4DF6A 3IWQA 3S7QA 1LHYA 5F5YA 4LV3A 5HAIA 4X53A 2XA7S 2OOLA 2Y2IA 3M2KA 2HJ9C 1K4EA 4G3VA 3RJUA 1BLCA 1IFQA 3HUMA 4GZBA 5F83A 3V3SA 1XFNA 1ALQA 4QU3A 1NXYA 1IYQA 4Y7PA 1S67L 3ISGA 4MDZA 4QHCA 4KQQA 4P6ZS 5HX9A 1MPLA 3T1QB 5A93A 4KZ7A 4C3QA 1I2WA 1IKGA 4NG2A 5FI6A 4OKPA 3CUEA 2PU2A 3NOPC 5AQ7A 3D3OA 2VLGA 2EWWA 5TFQA 2I9VA 2VA0A 3UPPA 1XA1A 5E2FA 2R9XA 5HFOA 2ZC7A 1PFLA 2W3GA 1DP9A 3DTIA 4HP4A 1JNUA 1GHIA 4H6JA 3O5YA 1UGUA 3S7PA 5AVEA 1K54C 2D01A 1TD5A 4LRXC 3ITAA 3CI6A 4EEPA 2E8IA 3PAGA 3S7OA 3PR6A 2V8FA 2GNXA 4I38A 4OOYA 3NC8A 2UWXA 2KOIA 5J7EA 2XF3A 1BUEA 3MKEA 4KZAA 1E3UA 5EECA 5EOOA 1S1YA 2ZLYA 3B3XA 2VK3A 1H8MA 3LYXA 1YLWA 5F1FA 3BEBA 3MZEA 1XJ6A 2QHKA 4L0LA 1CEFA 4KUOA 2XRNA 2EXAA 3MMHA 3UPOA 1KOUA 4IJGA 4YOFA 4KQRA 2ACGA 3PBOA 2GX5A 3S1YA 1V9ZA 1JVJA 3V50A 1K57A 3ULFA 1S4SA 5M19A 2J8YA 2GZAA 3FYZA 3HVFA 3MXSA 2GJ3A 1KVLA 2PRFA 4WYYA 5L8MA 1OT9A 5E2GA 4WLAA 4E3IA 3BY8A 5FQQA 4N9LA 4DMZA 5HAPA 5KMWA 5EUAA 1DJAA 3EGXC 2ZQ7A 1W7FA 1G68A 2XFTA 4CLCE 5FAQA 4MMNA 3IT9A 2KX6A 3UE3A 4DE0A 1T1CA 3MXRA 3TG9A 3OPHA 4BD1A 1OMEA 4PKYG 5DTKA 1K55C 3NULA 4HH3A 2EX6A 2ZC5B 4JXVA 2W3HA 3G4PA 4K91A 3UO9A 1QMFA 3AGFA 3EEAA 1E3UD 4Q0HA 3ZGAB 3S4XA 2ZD8A 5GHXA 5IU1A 4P6BA 1U60A 1GA9A 4JBFA 1XJ3A 3LIDA 3CJMA 2JE5A 4BL3A 3K3DA 5AJGA 2ZMFA 1FCOA 4YNRA 4DDSA 3TOIA 1PW8A 3RXXA 1IOUA 3WS2A 5GL9A 3JVUA 3HJIA 5J4EA 1O7EA 4CLCA 4LV2A 2PR5A 2J3TC 2O0YA 2J80A 2NUTC 2WUQA 3C4OA 3T4OA 5CERA 1V9YA 4LCLA 1HLUP 3G32A 1ONGA 3CZDA 3W4PA 3BFFA 2V20A 5AQ9A 2HDUA 3A3JA 1Y28A 3FPVA 3KYEA 2L1MA 5A92A 2XSSA 4LRZE 3UB5P 4I3IA 2Y79A 1S4RA 1MBLA 3IXGA 4OPQA 2OAP1 3ZG7B 4PM5A 2O9CA 4JF5A 4JF6A 4EW7A 1YT4A 2RCXA 3HL9A 3VE3A 1RCJA 3PAEA 4M4XA 3DWKA 3KSFA 3SH9A 3HREA 4WELA 4OQ0A 2IWCA 2Y2PA 1VETB 1PNEA 2G2WA 4O0PA 4GCZA 4GKUA 3CG5A 1NZUA 4C75A 2FH5A 5GLBA 1S0WA 2PYRA 4MLLA 2CMNA 4ZJ2A 2Z6CA 2WK0A 4CLCD 4UHUA 1KDSA 4KZ3A 4NXBA 4BL2A 3MFDA 3MZFA 4DXCA 4GNUA 3BQ8A 3BFGA 4P85A 5HSQA 4LLOB 2ZOHA 3TE8A 4WBGA 1G6OA 3OPRA 2OWJA 2O9BA 2PR6A 4QB8A 3TW8A 1CI9A 3K3CA 1LSWA 1HTZA 4X1LA 3VP0A 4BBUA 3LY3A 4OLDA 1GHPA 2HZ5A 3ITBA 5FAOA 4FH2A 5IHVA 3KSHA 5JYOA 4GB7A 2PD7A 3QNBA 5DTSA 3LIEA 3BQAA 4WEJA 3BYDA 4CPKA 2Y55A 2HP5A 3ZG0A 3P09A 1W5DA 1PYYA 2EX2A 5DJUA 5FQIA 1XJ4A 4ZBEA 3OCLA 4DRTA 2DCFA 1TS0A 3BFCA 1YAXA 1EI5A 4EUZA 4JKTA 4HESA 2WKIA 3CPTA 4EBPA 4Y3IA 1EWZA 2DRWA 2K31A 3O88A 4GHIB 4S2LA 3ZG5A 4ZJ3A 1H8ZA 1W8YA 3UY6A 3P98A 3GR2A 4X6TA 4E3NA 3KO6A 3PYPA 4L9FA 1LI0A 3AGEA 3DBAA 3R4KA 1NWZA 2Y2QA 2QZ6A 2PHYA 4OONA 3HLBA 3CUEC 2RL3A 3T50A 5AVFA 4U0TA 3ZVTA 2ZC3B 2VGLM 3E2KA 5HL1A 4JF4A 1OTDA 1YLYA 2JKTI 4Q0JA 4ZAMA 2FFYA 2EA9A 2W27A 3ZDJA 2Y4AA 2XDMA 3IBJA 4NXGA 1N9OA 5EM1A 4Z1WA 3T12B 4Q0IA 1XPBA 1ZG4A 2B02A 2JKRM 3E0YA 3OBFA 4RA7A 3WWXA 2PT7A 3T1SA 3LO7A 1O07A 3A3IA 1D7EA 2ZBBA 3G2ZA 4Y0TA 4Q8IA 3I7JA 5CTMA 2J7VA 4WL9A 4MN5A 4NETA 4EEUA 4O8GA 5A8BA 4OQIA 4O7DA 2MJ6A 2YKFA 1OJGA 4DE2A 3PBSA 4UA9A 2WKPA 1DP6A 4PPRA 5CGWA 3CAXA 1GHMA 1IYOA 1TEMA 1YPRA 1PRQA 1S66L 3OOVA 2Z2MB 2JKGA 1MWUA 1VETA 2NUPC 4DKIA 1ZTUA 1K57C 2G2UA 3BWLA 3C7UA 3SOIA 4P87A 3UE1A 1WYBA 1T1AA 3VMAA 4LGWA 4UEYA 4QY5A 5E2EA 5L07A 4PMAA 5F1GA 2Z2LB 5DFYA 5FSRA 4EETB 5FQJA 3T4JA 3MJQA 1BYWA 3HLDA 4KZ9A 4E04A 4ARZB 3WS4A 3Q7VB 1CEGA 3IXBA 1CJFA 3KX0X 4B4XA 3W8KA 2B95A 1OT6A 3VSLA 5G4ZA 2WAEA 2V1BA 4CLCB 3HLEA 3IX3A 4FH4A 1L0EA 3A3FA 3T4SA 3QP2A 1YLZA 2VGLS 1UWPX 1KGEA 3UMEA 4ETZA 5CHJA 3D9YA 4LV0A 1YLJA 4X1MA 1K56A 2A3UA 5GHYA 4QPRA 4DN0A 3N4IA 1DY6A 1H3QA 2H0TA 5KSCA 4EERA 3IH9A 1SHVA 3FKVA 1TS7A 3NDGA 3QP1A 4EWFA 3ZNTA 2A24A 1MWSA 4PHTA 3VE4A 3BLSA 4B4ZA 3B33A 3N7WA 3FKWA 4B88A 2O99A 3SZTA 3KYZA 5FQ9A 4OLGA 4GHIA 4BENA 2XD5A 3VP1A 4PAUA 4WZ5A 5DJTA 3RFBA 2Y2LA 2EX9A 1Q2QA 3M6HA 4ZDXA 2KLIA 4QD4A 4OPYA 1F5MA 4E3JA 1NYMA 1F9IA 1PZOA 5HWWA 4KZBA 2V1ZA 1YMSA 2LB5A 3PTEA 3BJNA 2G7UA 5HW3A 5G18A 3NCKA 3GRJA 3LIBA 4EXOA 5TGFA 2ZC6B 4R4SA 1ES5A 2C6WB 4R1GA 1P0ZA 4MN6A 1M6KA 1K56D 3LI8A 1E25A 1XP4A 3D72A 3UB6A 3A0RA 1BLSA 3HLCA 3HUOA 3IHAA 5GLDA 4IUHA 2WKRA 3F1NA 2XK1A 1Q2PA 1NJ4A 2OLVA 3E2LA 2HDRA 3GV9A 3RTYA 3RH8B 4LCMA 3SS5A 1BTLA 1YMXA 5A91A 3HUNA 5G4YA 1FILA 3JPUA 4S2KA 4BD0A 1NLZA 2A2LA 3MXQA 5J8XA 1HD8A 3S7NA 4X55A 2HPBA 3VSKA 3RXWA 3PBQA 4N9KA 1F2KA 3VP3A 1N9LA 3PHYA 1KGGA 3IF6B 3VP4A 1EROA 1YQSA 3CPTB 4HBUA 3NDEA 4DE3A 3IQAA 2ZM8A 3BM6A 3IWOA 1HVBA 2V8CA 4HQAA 5IT5A 4RX2A 3MFXA 3JVVA 2W1RA 3SS4A 5FI7A 4PM8A 1UWNX 2VKSA 1MKIA 1LL9A 5M1AA 1GSVA 2Y2OA 3K2NA 4OOLA 1MKMA 1XA7A 4R3AA 4BQMA 3LEZA 4QJGA 4GS9B 4OPZA 4JGOA 3DTKA 3O86A 4WUJA 1FCNA 5FDSA 2VGKA 2ZQAA 4II7A 4ARZA 5CEBA 3BECA 3E4OA 3Q7VA 1JTGA 4GN2A 2H0YA 3LGOA 1ES4A 3Q82A 4OVDA 1RGYA 3O3VA 2P7JA 3HLWA 4HJ6A 4D2OA 2ZMVA 5IS1A 4JGPA 2X01A 3OPPA 2EX8A 2VX8A 1XKZA 4NK3A 4MEZA 5L09A 1F98A 2W0NA 1LL8A 2ZJ9A 3QP4A 1IEMA 4ETXA 4NEED 1STZA 1LL5A 4E3MA 5CECA 4R38A 4E6WA 2WAFA 4R23A 4O01A 4Y17A 3UB9A 4OP8A 1A0KA 2QKPA 3NECA 3OLOA 3PBRA 1C3BA 3MS6A 4K08A 4FD8A 1ONHA 1ES3A 5EFWA 3M2JA 4EBNA 3LY4A 4FUWA 3LIAA 3LICA 3MQ0A 2HP9A 4KZ4A 1OTEA 4X25A 1ZKJA 3C30A 5CEDA 4HJ4A 4XUXA 3H7WA 3H82B 5EVLA 2M7UA 1WA9A 4EQIA 4BBVA 2Q9MA 4BLMA 3BW6A 1H5XA 3SH8A 1ZHHB 2EWVA 1SDNA 5CGSA 1BLPA 1ERQA 1L0GA 3HCYA 2H5SA 4RQ9A 4I39A 5GLAA 4DE1A 3FC7A 2BLSA 1K25A 3V39A 2A49A 1OTBA 1TF1A 1FR1A 2Q9NA 4HEFA 4HBTA 3W2ZA 3VOZA 1NRJA 2HP6A 4KQOA 4RX3A 4WM9A 3ICYA 1BSGA 5CHUA 4LFUA 3Q81A 3UDFA 2JC7A 2VJWA 5KSHA 5HAQA 4QY6A 1H8YA 4JLFA 3F1PB 1L0DA 5JYPA 4GLQA 4S2IA 2WKEA 3PBNA 3LUQA 3E4PA 4UAAA 2VV7A 4IVKA 4Y5FA 4JXWA 2XQZA 2PYPA 5FQKA 5GHZA 5L2FA 4OQHA 2JKFA 4YFMA 1K0KA 3FZCA 3ZYTA 3N8LA 4JGQA 3EWKA 3IF6A 1L3LA 2A24B 5DF7A 3MQQA 4NKPA 2WZZA 1ESIA 4IBRA 1W63Q 4XXRA 4R3BA 1K6RA 3VFHA 3V67A 3N8RA 4GD8A 2XEPA 4BJPA 4A5RA 3C8CA 2QMIA 2OAQ1 5EVIB 4UA7A 3NOUC 2WGWB 2J3WA 5FQMA 5BOHA 3GTCA 2CC1A 5M18A 3ZVWA 4KENB 1YSPA 3CHWP 1M40A 3GDIA 3UMDA 2HJEA 2P74A 4HNBA 3OZHA 1H0MA 5CHMA 1Y54A 3EOIA 2W1TB 3MKFA 4GS9A 5HZHA 2UV0E 5HD5A 4KG2A 3C5AA 2PBDP 3DTEA 4DJ3A 2PAVP 1SZVA 5FATA 1ACFA 3PXPA 1YLTA 3EGDC 3L7HA 4JXSA 2Y2NA 3IX8A 3ZCZA 2ZM0A 1JWVA 2O9AA 3UDXA 1DRMA 3IF5A 2EXBA 3F1NB 1SKOA 3QP5A 3T1XA 4L9EA 1YSQA 4NXEA 5TBMB 1Z6FA 3ZHHA 2OV5A 2ZOIA 3IH8A 5CTNA 1NLYA 3FWLA 3T4LA 1MWRA 4P6ZM 1K4FA 1AWIA 2FZ0A 1TVFA 2ZL1B 4E3OA 1NRFA 1PWDA 3IHBA 3MSHA 1DJBA 2XD1A 2XFSA 3H9WA 1CK3A 4KG6A 3A3EA 2L4RA 5FA7A 3SS3A 4GDBA 4FCFA 1N9NA 1XGJA 3C4PA 4IUKA 4S2OA 1MZUA 4JPMA 1W79A 5KZHA 1K6SA 2VZWA 3BFEA 5F68A 2Y59A 4X68A 2BG1A 1HZOA 3VOYA 2BTFP 4BMWA 4HI4A 4MBKA 3CITA 4FTXA 5HPIA 3H82A 1FOFA 2B18A 2Y2HA 3CWFA 2KDKA 5E2HA 1YLPA 3UB8A 4S2NA 5EM0A 1FCMA 1XXMA 4L9GA 3MQOA 2Y2KA 3GECA 4EQ1A 5HWTA 3P01A 1KGFA 4KZ6A 5GLCA 3MBZA 4H8RA 3OCNA 2QYBA 1VEUB 3DWZA 2PDRA 2Y2GA 2ZQ9A 3G35A 3UN7A 2HV1A 2VGJA 4U0XA 5J3WA 4DJ2A 5DFXA 2ZM2A 1IELA 2HDQA 1ESUA 5HL6A 4YINA 3Q07A 2QJ5A 5EOEA 1G6AA 1PI4A 3T4KA 5EV0A 3T4QA 2LB9A 4PM6A 4R6LA 4IBXA 5EPHA 3F1PA 3HJKA 4MCWA 3A3DA 3FV7A 5DF9A 2X02A 2QWSA 3UB7A 4WN5A 3GQZA 3VV4A 3ZQ5A 2WGIA 1LT0A 2JHEA 2I72A 3LR5A 4AFIA 2IWBA 3BRMA 3QHYA 2VEAA 1GSWA 4CLCC 4HP9A 4HHDA 4C6YA 3FG8A 3IBRA 3V5MA 3PBTA 5TR7A 5CXWA 4X56A 5CX7A 1T1BA 2FFFB 2XLNA 3LCEA 5EVIA 2WGWA 1I2SA 3H7WB 3WRZA 1YM1A 1GCEA 1PWGA 2E8JA 1CQAA 4XT2A 1XJ2A 1OJ5A 2W1TA 1PZPA 4LV1A 4M3KA
chains in the Genus database with same CATH topology
4FSFA 3LI9A 3IS2A 1MC0A 4HJ3A 2P7JA 1LSXA 3TRCA 4B93A 4HJ6A 5IS1A 2ZMVA 4JGPA 1P9RA 2L0WA 2W3EA 2VX8A 5DJUA 3U2AA 3UE6A 1XJ4A 3OCLA 1F98A 2W0NA 5DKKA 1LSVA 1LL8A 1TS0A 1YAXA 2VV6A 4ETXA 4NEED 2P04A 3G6OA 4GJ4A 3R7WA 4Y3IA 2V0UA 1STZA 3BY9A 3FPWA 2K31A 4GHIB 4UQIS 3A0VA 4R38A 1G28A 5TBMA 4O01A 1XFQA 1VHMA 1OTAA 3UB9A 2V9AA 4EUVA 2QKPA 3NOTC 3OLOA 3PBRA 4HIAA 4K08A 2V0WA 5EFWA 3KSGA 3LR0A 4LPZA 5FL3A 3T4TA 2HGVA 3KO6A 3LIAA 3PYPA 5TJJA 1X0OA 3LICA 4L9FA 3DBAA 3R4KA 4B9OA 1NWZA 3MQ0A 2M7VA 1OTEA 1TS6A 2PHYA 4CQHA 2XROA 3C30A 4HJ4A 3CUEC 3S7QA 3F1OB 3H7WA 2JKTM 3H82B 2M7UA 3T50A 3MR0A 5F5YA 4GW9A 5AVFA 1WA9A 4I3AA 4HOIA 4BBVA 2VGLM 3BW6A 1OTDA 1ZHHB 2D02A 2EWVA 2XA7S 2OOLA 2JKTI 4Q0JA 2HJ9C 4EU0A 4G3VA 3HCYA 4RQ9A 2EA9A 3LR4A 4I39A 2W27A 3FC7A 1IFQA 3EQUA 5HDCA 3E98A 3IBJA 4NXGA 1N9OA 1XFNA 1OTBA 4Z1WA 1TF1A 4Q0IA 2B02A 2JKRM 4MDZA 3W2ZA 3E0YA 1NRJA 3OBFA 4P6ZS 2PT7A 4KQOA 1D7EA 2JKRI 2ZBBA 3ICYA 3CUEA 1ODVA 4ZRRA 3NOPC 2INWA 3D3OA 2VLGA 2VJWA 5KSHA 2EWWA 4KUKA 4WL9A 4F3LB 4MN5A 2I9VA 2VA0A 4EEUA 2K2NA 4O8GA 2Z6DA 3F1PB 5A8BA 2MJ6A 2YKFA 1OJGA 4GLQA 5F69A 3TJZC 3PBNA 3PBSA 3LUQA 2W3GA 3E4PA 1DP9A 4HP4A 2VV7A 2WKPA 3OC2A 1JNUA 4Y5FA 1DP6A 3CAXA 2PYPA 4H6JA 1VB6A 3O5YA 2BASA 1UGUA 3S7PA 5AVEA 3EQVA 1P97A 3ZYTA 1S66L 4JGQA 3EWKA 2D01A 3OOVA 1TD5A 4LRXC 2A24B 1T19A 3CI6A 4WF0A 2NUPC 3MQQA 4EEPA 1ZTUA 4OOMA 3S7OA 4NKPA 3BWLA 3PR6A 2GNXA 4I38A 1W63Q 5J7EA 2KOIA 1T1AA 2IA2A 4UEYA 3V67A 2W3FA 1S1YA 4BJPA 3C8CA 5DFYA 2OAQ1 1GSXA 3NOUC 1H8MA 2J3WA 3LYXA 4EETB 1XJ6A 5I5LA 2QHKA 4L0LA 5HWVA 4KUOA 5LBRA 3T4JA 1YSPA 2XRNA 3MJQA 1BYWA 5F6AA 3MMHA 3GDIA 1KOUA 4IJGA 4YOFA 5HD3A 4ARZB 4E04A 3UMDA 2HJEA 4HNBA 3PBOA 2R78A 3KX0X 4BBTA 1OT6A 2GX5A 2W1TB 3EOIA 4GS9A 5HZHA 1V9ZA 3LFVA 2VV8A 4WEKA 5HD5A 3NJAA 3NHQA 5G4ZA 2K7SA 2V1BA 4CLCB 3IS2B 3ULFA 1S4SA 2DMWA 2W3DA 2GZAA 3T4SA 2GJ3A 2VGLS 1UWPX 5L8MA 1OT9A 4WLAA 3UMEA 4DJ3A 3BY8A 4ETZA 4DMZA 3PXPA 3EGXC 3EGDC 4QPRA 5HDSA 4CLCE 4MMNA 4DN0A 5MC7A 3R7WB 2KX6A 3UE3A 3C38A 2O9AA 1DRMA 1T1CA 3F1NB 2QJ7A 1H3QA 4I5SA 1DP8A 4L9EA 1YSQA 4NXEA 2JN7A 4EERA 5TBMB 4PKYG 1TS7A 2ZOIA 1P9WA 2A24A 4PHTA 3VE4A 4HH3A 4KQDA 3B33A 2M1CA 2W3HA 5KIZA 2O99A 1NLYA 5K5BA 3T4LA 3KYZA 4P6ZM 3EEAA 4Q0HA 4GHIA 2FZ0A 5IU1A 4PAUA 5DJTA 3RFBA 1XJ3A 3LIDA 2KLIA 3K3DA 5AJGA 1F5MA 3VOLA 2ZMFA 3H9WA 3C2WA 2WKQA 4Y2FA 4YNRA 1F9IA 5HWWA 2L4RA 4EESA 1IOUA 1N9NA 4IUKA 1MZUA 2LB5A 2VZWA 5F68A 3BJNA 3JVUA 3HJIA 2G7UA 4HH2A 5J4EA 4BMWA 4HI4A 3CITA 5HPIA 3F1OA 4CLCA 3H82A 2P08A 2PR5A 2J3TC 2B18A 3CWFA 2KDKA 3LIBA 4EXOA 1D06A 2O0YA 4G3KA 2J80A 2NUTC 3UB8A 1P0ZA 4MN6A 3T4OA 4L9GA 3MQOA 3GECA 1V9YA 3B47A 5HDDA 4EQ1A 3LI8A 3D72A 5HWTA 3UB6A 3A0RA 3P01A 4IUHA 4I3JA 3OCNA 2QYBA 4UQIM 1Y28A 2WKRA 3F1NA 3FPVA 4JGRA 3MF0A 2L1MA 2PDRA 2XSSA 2HV1A 4PKYA 5J3WA 4DJ2A 4LRZE 4XT2B 5DFXA 4I3IA 2Y79A 3RTYA 1OTIA 3RH8B 2YKHA 3A0SA 1S4RA 5HL6A 5G4YA 2Y8HA 3KSIA 2HF6A 1W63M 2OAP1 1NLZA 5HPFA 2A2LA 3MXQA 2QJ5A 4H6JB 2O9CA 3T4KA 4EW7A 3T4QA 4F3LA 2LB9A 4R6LA 1TS8A 3S7NA 3PBQA 3VE3A 1T18A 4M4XA 3F1PA 3KSFA 1N9LA 1S1ZA 3PHYA 3HJKA 4WELA 4MCWA 5DF9A 2QWSA 3UB7A 4O0PA 4GCZA 4WN5A 4G3WA 2H28A 4MN7A 4NXFA 3VV4A 2XA7M 4YWZA 3ZQ5A 2FH5A 5C5KA 1LT0A 2JHEA 4HQAA 5IT5A 3LR5A 4AFIA 2PYRA 2CMNA 3MFXA 2Z6CA 4CLCD 3JVVA 2W1RA 3LIFA 4NXBA 2VEAA 1GSWA 5DKLA 4CLCC 4HP9A 4HHDA 4R70A 2OWHA 3FG8A 3IBRA 1UWNX 2VKSA 3BQ8A 3PBTA 5HSQA 4LLOB 4BWIA 1EW0A 4FOFA 2ZOHA 3LR3A 3TE8A 5CX7A 1T1BA 1G6OA 1GSVA 1YKDA 2OWJA 3SW1A 4LRYC 3K2NA 2O9BA 4OOLA 1MKMA 4IHQA 4R3AA 2PR6A 4HY8A 4GS9B 3TW8A 4JGOA 3K3CA 2PD8A 4ME4A 1LSWA 3H7WB 3P7NA 4WUJA 4BBUA 4II7A 1OPXA 4ARZA 3E4OA 2V1AA 3CLOA 3EEHA 3KSHA 4XT2A 1XJ2A 1OJ5A 2PD7A 3B42A 2W1TA 3LIEA 3BQAA 3E4QA 3KYQA 1S67L 2J3TD 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYB A;  1MC0 A;  5L8M A;  3TRC A;  3MF0 A;  2XSS A;  4ETZ A;  4ZRR A;  4DMZ A;  4LRZ E;  5DFX A;  3NOP C;  2Y79 A;  4QPR A;  2W3E A;  3D3O A;  2VJW A;  4MMN A;  4DN0 A;  5HL6 A;  2Y8H A;  2O9A A;  3KSI A;  2K2N A;  4O8G A;  5HPF A;  4ETX A;  1YSQ A;  3G6O A;  2O9C A;  4GLQ A;  2LB9 A;  4Y3I A;  4R6L A;  1STZ A;  2W3G A;  3S7N A;  2K31 A;  4Y5F A;  3KSF A;  3O5Y A;  4MCW A;  2W3H A;  2O99 A;  5K5B A;  4O01 A;  3S7P A;  1VHM A;  3EEA A;  4O0P A;  4Q0H A;  4G3W A;  4EUV A;  4MN7 A;  3VV4 A;  3OOV A;  3NOT C;  1TD5 A;  4LRX C;  4PAU A;  3ZQ5 A;  5C5K A;  3CI6 A;  3RFB A;  1ZTU A;  3S7O A;  3KSG A;  2KLI A;  2HGV A;  3KO6 A;  5AJG A;  5TJJ A;  2W1R A;  3R4K A;  2VEA A;  3DBA A;  1F5M A;  3MQ0 A;  2ZMF A;  2M7V A;  2KOI A;  3C2W A;  4Y2F A;  4YNR A;  4R70 A;  2IA2 A;  3IBR A;  4CQH A;  2VKS A;  2XRO A;  5HSQ A;  4BWI A;  2W3F A;  4FOF A;  4IUK A;  3S7Q A;  2M7U A;  2LB5 A;  2VZW A;  5DFY A;  4GW9 A;  3BJN A;  3NOU C;  1YKD A;  2G7U A;  4LRY C;  3K2N A;  5I5L A;  2O9B A;  3CIT A;  5HPI A;  1MKM A;  2OOL A;  5LBR A;  1YSP A;  2XRN A;  4Q0J A;  2B18 A;  3MMH A;  4EU0 A;  4E04 A;  4YOF A;  4IJG A;  4G3V A;  4ME4 A;  3HCY A;  4RQ9 A;  2O0Y A;  4G3K A;  3E98 A;  2GX5 A;  2W1T B;  3IBJ A;  3LFV A;  4Z1W A;  3NHQ A;  1TF1 A;  4Q0I A;  3KSH A;  4MDZ A;  3W2Z A;  3E0Y A;  3OBF A;  2W1T A;  2W3D A;  4IUH A; 
#chains in the Genus database with same CATH topology
 3CMZ A;  3VFF A;  4HJ3 A;  4B93 A;  1LSX A;  3C7V A;  3UE0 A;  2W3E A;  1CI8 A;  3U2A A;  3UE6 A;  4ZJ1 A;  1KE4 A;  4RVA A;  5DKK A;  1LSV A;  1E4D A;  3G2Y A;  2P04 A;  4GJ4 A;  3BY9 A;  2XR0 A;  3FPW A;  3S22 A;  4DDY A;  1SDE A;  3W4O A;  1G28 A;  5TBM A;  1CF0 A;  4OQG A;  1XFQ A;  1XGI A;  1VHM A;  1KDW A;  3M6B A;  1PIO A;  2C5W B;  4HIA A;  3AGD A;  2V0W A;  2B5R A;  2WGV A;  3KSG A;  4LPZ A;  4KZ5 A;  5FL3 A;  2HGV A;  2ZL1 A;  4B9O A;  5EVI D;  3IXH A;  4MBF A;  2XRO A;  1SKF A;  4ZTK A;  3F1O B;  3V3R A;  3BLM A;  5CRF A;  2JKT M;  3MR0 A;  4GW9 A;  4I3A A;  4HOI A;  4LEN A;  1VM1 A;  2XGN A;  4DXB A;  4GDN A;  3IWI A;  4S2J A;  2D02 A;  3GMW A;  2WZX A;  1BZA A;  1MY8 A;  4EU0 A;  3ZG9 B;  3LR4 A;  4N92 A;  1SCW A;  2Y2J A;  3EQU A;  5HDC A;  3E98 A;  1L2S A;  4Y15 A;  2P9V B;  3NI9 A;  3SH7 A;  1S6R A;  2X71 A;  1KVM A;  3NBL A;  1PI5 A;  4KG5 A;  5FAS A;  3IF6 C;  2JKR I;  3UPN A;  3G30 A;  1ODV A;  4ZRR A;  5EE8 A;  3JYI A;  2DNS A;  1VEU A;  2INW A;  5FDH A;  3WS1 A;  3NIA A;  4OH0 A;  4KUK A;  5HAR A;  4F3L B;  2K2N A;  2Z6D A;  5DVA A;  4D60 A;  3ZNY A;  1WE4 A;  5F69 A;  3TJZ C;  2WKH A;  1N4O A;  3OC2 A;  5AQA A;  4QWO A;  1L0F A;  1VB6 A;  3DAV A;  3VP2 A;  4PM7 A;  1J9M A;  1SKO B;  2BAS A;  3EQV A;  1P97 A;  3NY4 A;  1IYS A;  3OPL A;  3G34 A;  5AQB A;  1T19 A;  4WF0 A;  1FQG A;  4OOM A;  4Y0U A;  3GSG A;  1GA0 A;  1J3W A;  1I5Q A;  2IA2 A;  5FEG A;  2W3F A;  2JBF A;  4X69 A;  1GSX A;  3Q7Z A;  4GD6 A;  4EBL A;  2WYX A;  2ZMA A;  5I5L A;  5FEF A;  5HWV A;  3WS5 A;  5LBR A;  3QP8 A;  5F6A A;  5HD3 A;  1XX2 A;  2ZQ8 A;  2R78 A;  4BBT A;  1K54 A;  1NY0 A;  4GOG A;  3LFV A;  4K0X A;  2VV8 A;  4WEK A;  3NJA A;  1K38 A;  2WAD A;  2K7S A;  3NHQ A;  3IS2 B;  4S2P A;  2DMW A;  2W3D A;  1ZG6 A;  4OPR A;  3WRT A;  1N9B A;  3UDI A;  3QP6 A;  5DF8 A;  5F82 A;  5HDS A;  5MC7 A;  1PWC A;  3R7W B;  3C38 A;  4R3J A;  2QJ7 A;  4I5S A;  1DP8 A;  5D3O A;  2AVX A;  2JN7 A;  4Z9Q A;  4XUZ A;  4E3L A;  1TDL A;  4EV4 A;  1P9W A;  4K0W A;  3HLG A;  4KQD A;  1FSW A;  2M1C A;  1AXB A;  5KIZ A;  5K5B A;  4S2N C;  1ERM A;  3ZFZ A;  5L10 A;  2J9O A;  3VOL A;  3C2W A;  2WKQ A;  4Y2F A;  4EES A;  2ZC4 B;  1FIK A;  4N1H A;  2J9P A;  3T1R A;  2GDN A;  1Y4O A;  4JXG A;  3W4Q A;  1TDG A;  4HH2 A;  2QPN A;  1NYY A;  1K55 A;  3F1O A;  2P08 A;  1G5U A;  2OSU A;  1WYC A;  4WMC A;  1D06 A;  3LEQ A;  4G3K A;  5CGX A;  5DTT A;  2PBY A;  3B47 A;  5HDD A;  1RGZ A;  2ZQD A;  1JTD A;  5FAP A;  1FSY A;  2P9V A;  4CJN A;  4I3J A;  4UQI M;  2Q0O A;  4E3K A;  4JGR A;  3MF0 A;  1IKI A;  4PKY A;  4XT2 B;  1LI9 A;  4U3T A;  1D1J A;  1OTI A;  2YKH A;  3A0S A;  2XH9 A;  1PW1 A;  2Y8H A;  3KSI A;  1KE0 A;  2HF6 A;  2JCH A;  1W63 M;  5HPF A;  3TSG A;  4RYE A;  4H6J B;  4F3L A;  4UA6 A;  1TS8 A;  4WZ4 A;  2H10 A;  4S2M A;  4WZ5 C;  1T18 A;  2OLU A;  4MBH A;  1S1Z A;  2EFX A;  5EVI C;  4P0M A;  4G3W A;  2H28 A;  4MN7 A;  4NXF A;  5U47 A;  3HBR A;  2XA7 M;  4PM9 A;  4YWZ A;  1JWP A;  4R0Q A;  1Z09 A;  5C5K A;  1BT5 A;  1MXO A;  3LIF A;  2ZQC A;  5DKL A;  4WMC D;  4R70 A;  1BUL A;  2OWH A;  3ZG8 B;  4BWI A;  1EW0 A;  4FOF A;  5EVE A;  3LR3 A;  1QME A;  2R9W A;  1BLH A;  4ESP A;  3SW1 A;  1YKD A;  4LRY C;  1ZC2 A;  3GVB A;  3IX4 A;  4IHQ A;  4HY8 A;  2PD8 A;  4ME4 A;  2EFU A;  1FR6 A;  4R4R A;  3P7N A;  5I94 A;  4ID4 A;  4N1X A;  5FI2 A;  4Y0O A;  2Y91 A;  2Y2M A;  1OPX A;  2V1A A;  3CLO A;  3EEH A;  1KE3 A;  4F94 A;  3N6I A;  3B42 A;  3O87 A;  3E4Q A;  2HDS A;  3KYQ A;  3Q1F A;  2J3T D;  4FSF A;  3LI9 A;  3IS2 A;  1MC0 A;  3TRC A;  1P9R A;  3BFD A;  1JWZ A;  2V2F F;  2L0W A;  3UNW A;  3G31 A;  2PU4 A;  1LLB A;  3DTM A;  2VV6 A;  1VQQ A;  3MZD A;  3G6O A;  3R7W A;  2V0U A;  3DW0 A;  3QNC A;  4UQI S;  3A0V A;  3D4F A;  1OTA A;  5E43 A;  4E6X A;  2V9A A;  3IXD A;  1RP5 A;  4EUV A;  4IVI A;  1IYP A;  1ES2 A;  3NOT C;  4Y13 A;  1NZO A;  1DJC A;  4KZ8 A;  4OP5 A;  3LR0 A;  3WS0 A;  3T4T A;  1W8Q A;  5A90 A;  5TJJ A;  1X0O A;  2IWD A;  4IED A;  3U4L P;  4MNR A;  2M7V A;  3HLF A;  1TS6 A;  4CQH A;  3L9K A;  3N8S A;  1MWT A;  4DF6 A;  3IWQ A;  3S7Q A;  1LHY A;  5F5Y A;  4LV3 A;  5HAI A;  4X53 A;  2XA7 S;  2OOL A;  2Y2I A;  3M2K A;  2HJ9 C;  1K4E A;  4G3V A;  3RJU A;  1BLC A;  1IFQ A;  3HUM A;  4GZB A;  5F83 A;  3V3S A;  1XFN A;  1ALQ A;  4QU3 A;  1NXY A;  1IYQ A;  4Y7P A;  1S67 L;  3ISG A;  4MDZ A;  4QHC A;  4KQQ A;  4P6Z S;  5HX9 A;  1MPL A;  3T1Q B;  5A93 A;  4KZ7 A;  4C3Q A;  1I2W A;  1IKG A;  4NG2 A;  5FI6 A;  4OKP A;  3CUE A;  2PU2 A;  3NOP C;  5AQ7 A;  3D3O A;  2VLG A;  2EWW A;  5TFQ A;  2I9V A;  2VA0 A;  3UPP A;  1XA1 A;  5E2F A;  2R9X A;  5HFO A;  2ZC7 A;  1PFL A;  2W3G A;  1DP9 A;  3DTI A;  4HP4 A;  1JNU A;  1GHI A;  4H6J A;  3O5Y A;  1UGU A;  3S7P A;  5AVE A;  1K54 C;  2D01 A;  1TD5 A;  4LRX C;  3ITA A;  3CI6 A;  4EEP A;  2E8I A;  3PAG A;  3S7O A;  3PR6 A;  2V8F A;  2GNX A;  4I38 A;  4OOY A;  3NC8 A;  2UWX A;  2KOI A;  5J7E A;  2XF3 A;  1BUE A;  3MKE A;  4KZA A;  1E3U A;  5EEC A;  5EOO A;  1S1Y A;  2ZLY A;  3B3X A;  2VK3 A;  1H8M A;  3LYX A;  1YLW A;  5F1F A;  3BEB A;  3MZE A;  1XJ6 A;  2QHK A;  4L0L A;  1CEF A;  4KUO A;  2XRN A;  2EXA A;  3MMH A;  3UPO A;  1KOU A;  4IJG A;  4YOF A;  4KQR A;  2ACG A;  3PBO A;  2GX5 A;  3S1Y A;  1V9Z A;  1JVJ A;  3V50 A;  1K57 A;  3ULF A;  1S4S A;  5M19 A;  2J8Y A;  2GZA A;  3FYZ A;  3HVF A;  3MXS A;  2GJ3 A;  1KVL A;  2PRF A;  4WYY A;  5L8M A;  1OT9 A;  5E2G A;  4WLA A;  4E3I A;  3BY8 A;  5FQQ A;  4N9L A;  4DMZ A;  5HAP A;  5KMW A;  5EUA A;  1DJA A;  3EGX C;  2ZQ7 A;  1W7F A;  1G68 A;  2XFT A;  4CLC E;  5FAQ A;  4MMN A;  3IT9 A;  2KX6 A;  3UE3 A;  4DE0 A;  1T1C A;  3MXR A;  3TG9 A;  3OPH A;  4BD1 A;  1OME A;  4PKY G;  5DTK A;  1K55 C;  3NUL A;  4HH3 A;  2EX6 A;  2ZC5 B;  4JXV A;  2W3H A;  3G4P A;  4K91 A;  3UO9 A;  1QMF A;  3AGF A;  3EEA A;  1E3U D;  4Q0H A;  3ZGA B;  3S4X A;  2ZD8 A;  5GHX A;  5IU1 A;  4P6B A;  1U60 A;  1GA9 A;  4JBF A;  1XJ3 A;  3LID A;  3CJM A;  2JE5 A;  4BL3 A;  3K3D A;  5AJG A;  2ZMF A;  1FCO A;  4YNR A;  4DDS A;  3TOI A;  1PW8 A;  3RXX A;  1IOU A;  3WS2 A;  5GL9 A;  3JVU A;  3HJI A;  5J4E A;  1O7E A;  4CLC A;  4LV2 A;  2PR5 A;  2J3T C;  2O0Y A;  2J80 A;  2NUT C;  2WUQ A;  3C4O A;  3T4O A;  5CER A;  1V9Y A;  4LCL A;  1HLU P;  3G32 A;  1ONG A;  3CZD A;  3W4P A;  3BFF A;  2V20 A;  5AQ9 A;  2HDU A;  3A3J A;  1Y28 A;  3FPV A;  3KYE A;  2L1M A;  5A92 A;  2XSS A;  4LRZ E;  3UB5 P;  4I3I A;  2Y79 A;  1S4R A;  1MBL A;  3IXG A;  4OPQ A;  2OAP 1;  3ZG7 B;  4PM5 A;  2O9C A;  4JF5 A;  4JF6 A;  4EW7 A;  1YT4 A;  2RCX A;  3HL9 A;  3VE3 A;  1RCJ A;  3PAE A;  4M4X A;  3DWK A;  3KSF A;  3SH9 A;  3HRE A;  4WEL A;  4OQ0 A;  2IWC A;  2Y2P A;  1VET B;  1PNE A;  2G2W A;  4O0P A;  4GCZ A;  4GKU A;  3CG5 A;  1NZU A;  4C75 A;  2FH5 A;  5GLB A;  1S0W A;  2PYR A;  4MLL A;  2CMN A;  4ZJ2 A;  2Z6C A;  2WK0 A;  4CLC D;  4UHU A;  1KDS A;  4KZ3 A;  4NXB A;  4BL2 A;  3MFD A;  3MZF A;  4DXC A;  4GNU A;  3BQ8 A;  3BFG A;  4P85 A;  5HSQ A;  4LLO B;  2ZOH A;  3TE8 A;  4WBG A;  1G6O A;  3OPR A;  2OWJ A;  2O9B A;  2PR6 A;  4QB8 A;  3TW8 A;  1CI9 A;  3K3C A;  1LSW A;  1HTZ A;  4X1L A;  3VP0 A;  4BBU A;  3LY3 A;  4OLD A;  1GHP A;  2HZ5 A;  3ITB A;  5FAO A;  4FH2 A;  5IHV A;  3KSH A;  5JYO A;  4GB7 A;  2PD7 A;  3QNB A;  5DTS A;  3LIE A;  3BQA A;  4WEJ A;  3BYD A;  4CPK A;  2Y55 A;  2HP5 A;  3ZG0 A;  3P09 A;  1W5D A;  1PYY A;  2EX2 A;  5DJU A;  5FQI A;  1XJ4 A;  4ZBE A;  3OCL A;  4DRT A;  2DCF A;  1TS0 A;  3BFC A;  1YAX A;  1EI5 A;  4EUZ A;  4JKT A;  4HES A;  2WKI A;  3CPT A;  4EBP A;  4Y3I A;  1EWZ A;  2DRW A;  2K31 A;  3O88 A;  4GHI B;  4S2L A;  3ZG5 A;  4ZJ3 A;  1H8Z A;  1W8Y A;  3UY6 A;  3P98 A;  3GR2 A;  4X6T A;  4E3N A;  3KO6 A;  3PYP A;  4L9F A;  1LI0 A;  3AGE A;  3DBA A;  3R4K A;  1NWZ A;  2Y2Q A;  2QZ6 A;  2PHY A;  4OON A;  3HLB A;  3CUE C;  2RL3 A;  3T50 A;  5AVF A;  4U0T A;  3ZVT A;  2ZC3 B;  2VGL M;  3E2K A;  5HL1 A;  4JF4 A;  1OTD A;  1YLY A;  2JKT I;  4Q0J A;  4ZAM A;  2FFY A;  2EA9 A;  2W27 A;  3ZDJ A;  2Y4A A;  2XDM A;  3IBJ A;  4NXG A;  1N9O A;  5EM1 A;  4Z1W A;  3T12 B;  4Q0I A;  1XPB A;  1ZG4 A;  2B02 A;  2JKR M;  3E0Y A;  3OBF A;  4RA7 A;  3WWX A;  2PT7 A;  3T1S A;  3LO7 A;  1O07 A;  3A3I A;  1D7E A;  2ZBB A;  3G2Z A;  4Y0T A;  4Q8I A;  3I7J A;  5CTM A;  2J7V A;  4WL9 A;  4MN5 A;  4NET A;  4EEU A;  4O8G A;  5A8B A;  4OQI A;  4O7D A;  2MJ6 A;  2YKF A;  1OJG A;  4DE2 A;  3PBS A;  4UA9 A;  2WKP A;  1DP6 A;  4PPR A;  5CGW A;  3CAX A;  1GHM A;  1IYO A;  1TEM A;  1YPR A;  1PRQ A;  1S66 L;  3OOV A;  2Z2M B;  2JKG A;  1MWU A;  1VET A;  2NUP C;  4DKI A;  1ZTU A;  1K57 C;  2G2U A;  3BWL A;  3C7U A;  3SOI A;  4P87 A;  3UE1 A;  1WYB A;  1T1A A;  3VMA A;  4LGW A;  4UEY A;  4QY5 A;  5E2E A;  5L07 A;  4PMA A;  5F1G A;  2Z2L B;  5DFY A;  5FSR A;  4EET B;  5FQJ A;  3T4J A;  3MJQ A;  1BYW A;  3HLD A;  4KZ9 A;  4E04 A;  4ARZ B;  3WS4 A;  3Q7V B;  1CEG A;  3IXB A;  1CJF A;  3KX0 X;  4B4X A;  3W8K A;  2B95 A;  1OT6 A;  3VSL A;  5G4Z A;  2WAE A;  2V1B A;  4CLC B;  3HLE A;  3IX3 A;  4FH4 A;  1L0E A;  3A3F A;  3T4S A;  3QP2 A;  1YLZ A;  2VGL S;  1UWP X;  1KGE A;  3UME A;  4ETZ A;  5CHJ A;  3D9Y A;  4LV0 A;  1YLJ A;  4X1M A;  1K56 A;  2A3U A;  5GHY A;  4QPR A;  4DN0 A;  3N4I A;  1DY6 A;  1H3Q A;  2H0T A;  5KSC A;  4EER A;  3IH9 A;  1SHV A;  3FKV A;  1TS7 A;  3NDG A;  3QP1 A;  4EWF A;  3ZNT A;  2A24 A;  1MWS A;  4PHT A;  3VE4 A;  3BLS A;  4B4Z A;  3B33 A;  3N7W A;  3FKW A;  4B88 A;  2O99 A;  3SZT A;  3KYZ A;  5FQ9 A;  4OLG A;  4GHI A;  4BEN A;  2XD5 A;  3VP1 A;  4PAU A;  4WZ5 A;  5DJT A;  3RFB A;  2Y2L A;  2EX9 A;  1Q2Q A;  3M6H A;  4ZDX A;  2KLI A;  4QD4 A;  4OPY A;  1F5M A;  4E3J A;  1NYM A;  1F9I A;  1PZO A;  5HWW A;  4KZB A;  2V1Z A;  1YMS A;  2LB5 A;  3PTE A;  3BJN A;  2G7U A;  5HW3 A;  5G18 A;  3NCK A;  3GRJ A;  3LIB A;  4EXO A;  5TGF A;  2ZC6 B;  4R4S A;  1ES5 A;  2C6W B;  4R1G A;  1P0Z A;  4MN6 A;  1M6K A;  1K56 D;  3LI8 A;  1E25 A;  1XP4 A;  3D72 A;  3UB6 A;  3A0R A;  1BLS A;  3HLC A;  3HUO A;  3IHA A;  5GLD A;  4IUH A;  2WKR A;  3F1N A;  2XK1 A;  1Q2P A;  1NJ4 A;  2OLV A;  3E2L A;  2HDR A;  3GV9 A;  3RTY A;  3RH8 B;  4LCM A;  3SS5 A;  1BTL A;  1YMX A;  5A91 A;  3HUN A;  5G4Y A;  1FIL A;  3JPU A;  4S2K A;  4BD0 A;  1NLZ A;  2A2L A;  3MXQ A;  5J8X A;  1HD8 A;  3S7N A;  4X55 A;  2HPB A;  3VSK A;  3RXW A;  3PBQ A;  4N9K A;  1F2K A;  3VP3 A;  1N9L A;  3PHY A;  1KGG A;  3IF6 B;  3VP4 A;  1ERO A;  1YQS A;  3CPT B;  4HBU A;  3NDE A;  4DE3 A;  3IQA A;  2ZM8 A;  3BM6 A;  3IWO A;  1HVB A;  2V8C A;  4HQA A;  5IT5 A;  4RX2 A;  3MFX A;  3JVV A;  2W1R A;  3SS4 A;  5FI7 A;  4PM8 A;  1UWN X;  2VKS A;  1MKI A;  1LL9 A;  5M1A A;  1GSV A;  2Y2O A;  3K2N A;  4OOL A;  1MKM A;  1XA7 A;  4R3A A;  4BQM A;  3LEZ A;  4QJG A;  4GS9 B;  4OPZ A;  4JGO A;  3DTK A;  3O86 A;  4WUJ A;  1FCN A;  5FDS A;  2VGK A;  2ZQA A;  4II7 A;  4ARZ A;  5CEB A;  3BEC A;  3E4O A;  3Q7V A;  1JTG A;  4GN2 A;  2H0Y A;  3LGO A;  1ES4 A;  3Q82 A;  4OVD A;  1RGY A;  3O3V A;  2P7J A;  3HLW A;  4HJ6 A;  4D2O A;  2ZMV A;  5IS1 A;  4JGP A;  2X01 A;  3OPP A;  2EX8 A;  2VX8 A;  1XKZ A;  4NK3 A;  4MEZ A;  5L09 A;  1F98 A;  2W0N A;  1LL8 A;  2ZJ9 A;  3QP4 A;  1IEM A;  4ETX A;  4NEE D;  1STZ A;  1LL5 A;  4E3M A;  5CEC A;  4R38 A;  4E6W A;  2WAF A;  4R23 A;  4O01 A;  4Y17 A;  3UB9 A;  4OP8 A;  1A0K A;  2QKP A;  3NEC A;  3OLO A;  3PBR A;  1C3B A;  3MS6 A;  4K08 A;  4FD8 A;  1ONH A;  1ES3 A;  5EFW A;  3M2J A;  4EBN A;  3LY4 A;  4FUW A;  3LIA A;  3LIC A;  3MQ0 A;  2HP9 A;  4KZ4 A;  1OTE A;  4X25 A;  1ZKJ A;  3C30 A;  5CED A;  4HJ4 A;  4XUX A;  3H7W A;  3H82 B;  5EVL A;  2M7U A;  1WA9 A;  4EQI A;  4BBV A;  2Q9M A;  4BLM A;  3BW6 A;  1H5X A;  3SH8 A;  1ZHH B;  2EWV A;  1SDN A;  5CGS A;  1BLP A;  1ERQ A;  1L0G A;  3HCY A;  2H5S A;  4RQ9 A;  4I39 A;  5GLA A;  4DE1 A;  3FC7 A;  2BLS A;  1K25 A;  3V39 A;  2A49 A;  1OTB A;  1TF1 A;  1FR1 A;  2Q9N A;  4HEF A;  4HBT A;  3W2Z A;  3VOZ A;  1NRJ A;  2HP6 A;  4KQO A;  4RX3 A;  4WM9 A;  3ICY A;  1BSG A;  5CHU A;  4LFU A;  3Q81 A;  3UDF A;  2JC7 A;  2VJW A;  5KSH A;  5HAQ A;  4QY6 A;  1H8Y A;  4JLF A;  3F1P B;  1L0D A;  5JYP A;  4GLQ A;  4S2I A;  2WKE A;  3PBN A;  3LUQ A;  3E4P A;  4UAA A;  2VV7 A;  4IVK A;  4Y5F A;  4JXW A;  2XQZ A;  2PYP A;  5FQK A;  5GHZ A;  5L2F A;  4OQH A;  2JKF A;  4YFM A;  1K0K A;  3FZC A;  3ZYT A;  3N8L A;  4JGQ A;  3EWK A;  3IF6 A;  1L3L A;  2A24 B;  5DF7 A;  3MQQ A;  4NKP A;  2WZZ A;  1ESI A;  4IBR A;  1W63 Q;  4XXR A;  4R3B A;  1K6R A;  3VFH A;  3V67 A;  3N8R A;  4GD8 A;  2XEP A;  4BJP A;  4A5R A;  3C8C A;  2QMI A;  2OAQ 1;  5EVI B;  4UA7 A;  3NOU C;  2WGW B;  2J3W A;  5FQM A;  5BOH A;  3GTC A;  2CC1 A;  5M18 A;  3ZVW A;  4KEN B;  1YSP A;  3CHW P;  1M40 A;  3GDI A;  3UMD A;  2HJE A;  2P74 A;  4HNB A;  3OZH A;  1H0M A;  5CHM A;  1Y54 A;  3EOI A;  2W1T B;  3MKF A;  4GS9 A;  5HZH A;  2UV0 E;  5HD5 A;  4KG2 A;  3C5A A;  2PBD P;  3DTE A;  4DJ3 A;  2PAV P;  1SZV A;  5FAT A;  1ACF A;  3PXP A;  1YLT A;  3EGD C;  3L7H A;  4JXS A;  2Y2N A;  3IX8 A;  3ZCZ A;  2ZM0 A;  1JWV A;  2O9A A;  3UDX A;  1DRM A;  3IF5 A;  2EXB A;  3F1N B;  1SKO A;  3QP5 A;  3T1X A;  4L9E A;  1YSQ A;  4NXE A;  5TBM B;  1Z6F A;  3ZHH A;  2OV5 A;  2ZOI A;  3IH8 A;  5CTN A;  1NLY A;  3FWL A;  3T4L A;  1MWR A;  4P6Z M;  1K4F A;  1AWI A;  2FZ0 A;  1TVF A;  2ZL1 B;  4E3O A;  1NRF A;  1PWD A;  3IHB A;  3MSH A;  1DJB A;  2XD1 A;  2XFS A;  3H9W A;  1CK3 A;  4KG6 A;  3A3E A;  2L4R A;  5FA7 A;  3SS3 A;  4GDB A;  4FCF A;  1N9N A;  1XGJ A;  3C4P A;  4IUK A;  4S2O A;  1MZU A;  4JPM A;  1W79 A;  5KZH A;  1K6S A;  2VZW A;  3BFE A;  5F68 A;  2Y59 A;  4X68 A;  2BG1 A;  1HZO A;  3VOY A;  2BTF P;  4BMW A;  4HI4 A;  4MBK A;  3CIT A;  4FTX A;  5HPI A;  3H82 A;  1FOF A;  2B18 A;  2Y2H A;  3CWF A;  2KDK A;  5E2H A;  1YLP A;  3UB8 A;  4S2N A;  5EM0 A;  1FCM A;  1XXM A;  4L9G A;  3MQO A;  2Y2K A;  3GEC A;  4EQ1 A;  5HWT A;  3P01 A;  1KGF A;  4KZ6 A;  5GLC A;  3MBZ A;  4H8R A;  3OCN A;  2QYB A;  1VEU B;  3DWZ A;  2PDR A;  2Y2G A;  2ZQ9 A;  3G35 A;  3UN7 A;  2HV1 A;  2VGJ A;  4U0X A;  5J3W A;  4DJ2 A;  5DFX A;  2ZM2 A;  1IEL A;  2HDQ A;  1ESU A;  5HL6 A;  4YIN A;  3Q07 A;  2QJ5 A;  5EOE A;  1G6A A;  1PI4 A;  3T4K A;  5EV0 A;  3T4Q A;  2LB9 A;  4PM6 A;  4R6L A;  4IBX A;  5EPH A;  3F1P A;  3HJK A;  4MCW A;  3A3D A;  3FV7 A;  5DF9 A;  2X02 A;  2QWS A;  3UB7 A;  4WN5 A;  3GQZ A;  3VV4 A;  3ZQ5 A;  2WGI A;  1LT0 A;  2JHE A;  2I72 A;  3LR5 A;  4AFI A;  2IWB A;  3BRM A;  3QHY A;  2VEA A;  1GSW A;  4CLC C;  4HP9 A;  4HHD A;  4C6Y A;  3FG8 A;  3IBR A;  3V5M A;  3PBT A;  5TR7 A;  5CXW A;  4X56 A;  5CX7 A;  1T1B A;  2FFF B;  2XLN A;  3LCE A;  5EVI A;  2WGW A;  1I2S A;  3H7W B;  3WRZ A;  1YM1 A;  1GCE A;  1PWG A;  2E8J A;  1CQA A;  4XT2 A;  1XJ2 A;  1OJ5 A;  2W1T A;  1PZP A;  4LV1 A;  4M3K A; 
#chains in the Genus database with same CATH homology
 4FSF A;  3LI9 A;  3IS2 A;  1MC0 A;  4HJ3 A;  2P7J A;  1LSX A;  3TRC A;  4B93 A;  4HJ6 A;  5IS1 A;  2ZMV A;  4JGP A;  1P9R A;  2L0W A;  2W3E A;  2VX8 A;  5DJU A;  3U2A A;  3UE6 A;  1XJ4 A;  3OCL A;  1F98 A;  2W0N A;  5DKK A;  1LSV A;  1LL8 A;  1TS0 A;  1YAX A;  2VV6 A;  4ETX A;  4NEE D;  2P04 A;  3G6O A;  4GJ4 A;  3R7W A;  4Y3I A;  2V0U A;  1STZ A;  3BY9 A;  3FPW A;  2K31 A;  4GHI B;  4UQI S;  3A0V A;  4R38 A;  1G28 A;  5TBM A;  4O01 A;  1XFQ A;  1VHM A;  1OTA A;  3UB9 A;  2V9A A;  4EUV A;  2QKP A;  3NOT C;  3OLO A;  3PBR A;  4HIA A;  4K08 A;  2V0W A;  5EFW A;  3KSG A;  3LR0 A;  4LPZ A;  5FL3 A;  3T4T A;  2HGV A;  3KO6 A;  3LIA A;  3PYP A;  5TJJ A;  1X0O A;  3LIC A;  4L9F A;  3DBA A;  3R4K A;  4B9O A;  1NWZ A;  3MQ0 A;  2M7V A;  1OTE A;  1TS6 A;  2PHY A;  4CQH A;  2XRO A;  3C30 A;  4HJ4 A;  3CUE C;  3S7Q A;  3F1O B;  3H7W A;  2JKT M;  3H82 B;  2M7U A;  3T50 A;  3MR0 A;  5F5Y A;  4GW9 A;  5AVF A;  1WA9 A;  4I3A A;  4HOI A;  4BBV A;  2VGL M;  3BW6 A;  1OTD A;  1ZHH B;  2D02 A;  2EWV A;  2XA7 S;  2OOL A;  2JKT I;  4Q0J A;  2HJ9 C;  4EU0 A;  4G3V A;  3HCY A;  4RQ9 A;  2EA9 A;  3LR4 A;  4I39 A;  2W27 A;  3FC7 A;  1IFQ A;  3EQU A;  5HDC A;  3E98 A;  3IBJ A;  4NXG A;  1N9O A;  1XFN A;  1OTB A;  4Z1W A;  1TF1 A;  4Q0I A;  2B02 A;  2JKR M;  4MDZ A;  3W2Z A;  3E0Y A;  1NRJ A;  3OBF A;  4P6Z S;  2PT7 A;  4KQO A;  1D7E A;  2JKR I;  2ZBB A;  3ICY A;  3CUE A;  1ODV A;  4ZRR A;  3NOP C;  2INW A;  3D3O A;  2VLG A;  2VJW A;  5KSH A;  2EWW A;  4KUK A;  4WL9 A;  4F3L B;  4MN5 A;  2I9V A;  2VA0 A;  4EEU A;  2K2N A;  4O8G A;  2Z6D A;  3F1P B;  5A8B A;  2MJ6 A;  2YKF A;  1OJG A;  4GLQ A;  5F69 A;  3TJZ C;  3PBN A;  3PBS A;  3LUQ A;  2W3G A;  3E4P A;  1DP9 A;  4HP4 A;  2VV7 A;  2WKP A;  3OC2 A;  1JNU A;  4Y5F A;  1DP6 A;  3CAX A;  2PYP A;  4H6J A;  1VB6 A;  3O5Y A;  2BAS A;  1UGU A;  3S7P A;  5AVE A;  3EQV A;  1P97 A;  3ZYT A;  1S66 L;  4JGQ A;  3EWK A;  2D01 A;  3OOV A;  1TD5 A;  4LRX C;  2A24 B;  1T19 A;  3CI6 A;  4WF0 A;  2NUP C;  3MQQ A;  4EEP A;  1ZTU A;  4OOM A;  3S7O A;  4NKP A;  3BWL A;  3PR6 A;  2GNX A;  4I38 A;  1W63 Q;  5J7E A;  2KOI A;  1T1A A;  2IA2 A;  4UEY A;  3V67 A;  2W3F A;  1S1Y A;  4BJP A;  3C8C A;  5DFY A;  2OAQ 1;  1GSX A;  3NOU C;  1H8M A;  2J3W A;  3LYX A;  4EET B;  1XJ6 A;  5I5L A;  2QHK A;  4L0L A;  5HWV A;  4KUO A;  5LBR A;  3T4J A;  1YSP A;  2XRN A;  3MJQ A;  1BYW A;  5F6A A;  3MMH A;  3GDI A;  1KOU A;  4IJG A;  4YOF A;  5HD3 A;  4ARZ B;  4E04 A;  3UMD A;  2HJE A;  4HNB A;  3PBO A;  2R78 A;  3KX0 X;  4BBT A;  1OT6 A;  2GX5 A;  2W1T B;  3EOI A;  4GS9 A;  5HZH A;  1V9Z A;  3LFV A;  2VV8 A;  4WEK A;  5HD5 A;  3NJA A;  3NHQ A;  5G4Z A;  2K7S A;  2V1B A;  4CLC B;  3IS2 B;  3ULF A;  1S4S A;  2DMW A;  2W3D A;  2GZA A;  3T4S A;  2GJ3 A;  2VGL S;  1UWP X;  5L8M A;  1OT9 A;  4WLA A;  3UME A;  4DJ3 A;  3BY8 A;  4ETZ A;  4DMZ A;  3PXP A;  3EGX C;  3EGD C;  4QPR A;  5HDS A;  4CLC E;  4MMN A;  4DN0 A;  5MC7 A;  3R7W B;  2KX6 A;  3UE3 A;  3C38 A;  2O9A A;  1DRM A;  1T1C A;  3F1N B;  2QJ7 A;  1H3Q A;  4I5S A;  1DP8 A;  4L9E A;  1YSQ A;  4NXE A;  2JN7 A;  4EER A;  5TBM B;  4PKY G;  1TS7 A;  2ZOI A;  1P9W A;  2A24 A;  4PHT A;  3VE4 A;  4HH3 A;  4KQD A;  3B33 A;  2M1C A;  2W3H A;  5KIZ A;  2O99 A;  1NLY A;  5K5B A;  3T4L A;  3KYZ A;  4P6Z M;  3EEA A;  4Q0H A;  4GHI A;  2FZ0 A;  5IU1 A;  4PAU A;  5DJT A;  3RFB A;  1XJ3 A;  3LID A;  2KLI A;  3K3D A;  5AJG A;  1F5M A;  3VOL A;  2ZMF A;  3H9W A;  3C2W A;  2WKQ A;  4Y2F A;  4YNR A;  1F9I A;  5HWW A;  2L4R A;  4EES A;  1IOU A;  1N9N A;  4IUK A;  1MZU A;  2LB5 A;  2VZW A;  5F68 A;  3BJN A;  3JVU A;  3HJI A;  2G7U A;  4HH2 A;  5J4E A;  4BMW A;  4HI4 A;  3CIT A;  5HPI A;  3F1O A;  4CLC A;  3H82 A;  2P08 A;  2PR5 A;  2J3T C;  2B18 A;  3CWF A;  2KDK A;  3LIB A;  4EXO A;  1D06 A;  2O0Y A;  4G3K A;  2J80 A;  2NUT C;  3UB8 A;  1P0Z A;  4MN6 A;  3T4O A;  4L9G A;  3MQO A;  3GEC A;  1V9Y A;  3B47 A;  5HDD A;  4EQ1 A;  3LI8 A;  3D72 A;  5HWT A;  3UB6 A;  3A0R A;  3P01 A;  4IUH A;  4I3J A;  3OCN A;  2QYB A;  4UQI M;  1Y28 A;  2WKR A;  3F1N A;  3FPV A;  4JGR A;  3MF0 A;  2L1M A;  2PDR A;  2XSS A;  2HV1 A;  4PKY A;  5J3W A;  4DJ2 A;  4LRZ E;  4XT2 B;  5DFX A;  4I3I A;  2Y79 A;  3RTY A;  1OTI A;  3RH8 B;  2YKH A;  3A0S A;  1S4R A;  5HL6 A;  5G4Y A;  2Y8H A;  3KSI A;  2HF6 A;  1W63 M;  2OAP 1;  1NLZ A;  5HPF A;  2A2L A;  3MXQ A;  2QJ5 A;  4H6J B;  2O9C A;  3T4K A;  4EW7 A;  3T4Q A;  4F3L A;  2LB9 A;  4R6L A;  1TS8 A;  3S7N A;  3PBQ A;  3VE3 A;  1T18 A;  4M4X A;  3F1P A;  3KSF A;  1N9L A;  1S1Z A;  3PHY A;  3HJK A;  4WEL A;  4MCW A;  5DF9 A;  2QWS A;  3UB7 A;  4O0P A;  4GCZ A;  4WN5 A;  4G3W A;  2H28 A;  4MN7 A;  4NXF A;  3VV4 A;  2XA7 M;  4YWZ A;  3ZQ5 A;  2FH5 A;  5C5K A;  1LT0 A;  2JHE A;  4HQA A;  5IT5 A;  3LR5 A;  4AFI A;  2PYR A;  2CMN A;  3MFX A;  2Z6C A;  4CLC D;  3JVV A;  2W1R A;  3LIF A;  4NXB A;  2VEA A;  1GSW A;  5DKL A;  4CLC C;  4HP9 A;  4HHD A;  4R70 A;  2OWH A;  3FG8 A;  3IBR A;  1UWN X;  2VKS A;  3BQ8 A;  3PBT A;  5HSQ A;  4LLO B;  4BWI A;  1EW0 A;  4FOF A;  2ZOH A;  3LR3 A;  3TE8 A;  5CX7 A;  1T1B A;  1G6O A;  1GSV A;  1YKD A;  2OWJ A;  3SW1 A;  4LRY C;  3K2N A;  2O9B A;  4OOL A;  1MKM A;  4IHQ A;  4R3A A;  2PR6 A;  4HY8 A;  4GS9 B;  3TW8 A;  4JGO A;  3K3C A;  2PD8 A;  4ME4 A;  1LSW A;  3H7W B;  3P7N A;  4WUJ A;  4BBU A;  4II7 A;  1OPX A;  4ARZ A;  3E4O A;  2V1A A;  3CLO A;  3EEH A;  3KSH A;  4XT2 A;  1XJ2 A;  1OJ5 A;  2PD7 A;  3B42 A;  2W1T A;  3LIE A;  3BQA A;  3E4Q A;  3KYQ A;  1S67 L;  2J3T D;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...