2W3EA

Oxidized structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3eA00
5I5LA 2O9AA 2B18A 2M7VA 3BJNA 1TF1A 4O01A 5DFYA 4O0PA 3TRCA 2ZMFA 4YNRA 4MDZA 2W3GA 3EEAA 4R70A 4IUKA 2W3FA 4Q0IA 2K2NA 1YSQA 2VZWA 3KSGA 3KSIA 2W1TB 5TJJA 4O8GA 4PAUA 3KSFA 4BWIA 3VV4A 3MMHA 4G3KA 3DBAA 3RFBA 3G6OA 2O9BA 3KO6A 2XRNA 1STZA 3O5YA 4GW9A 2W3HA 3CI6A 5HPFA 2W1RA 1YKDA 2VKSA 3MF0A 1MC0A 4RQ9A 4FOFA 3CITA 3S7QA 2O0YA 2HGVA 2KOIA 2Y8HA 2K31A 5C5KA 4ME4A 4EUVA 2Y79A 4Y3IA 3KSHA 2O9CA 1YSPA 4QPRA 3LFVA 4DMZA 4GLQA 2IA2A 5HL6A 5LBRA 2VJWA 3OOVA 2VEAA 4MCWA 4E04A 4R6LA 3NHQA 3D3OA 2KLIA 3NOPC 4DN0A 3R4KA 4Q0JA 4Y2FA 5AJGA 3W2ZA 2G7UA 3IBRA 5L8MA 4G3VA 4IUHA 1VHMA 3C2WA 2M7UA 3HCYA 4Z1WA 4CQHA 2OOLA 4Q0HA 4ETXA 3K2NA 2XSSA 1MKMA 5HPIA 3NOUC 3OBFA 2QYBA 4YOFA 4LRZE 4LRXC 1TD5A 5DFXA 5K5BA 2O99A 3NOTC 3S7OA 3S7PA 4ETZA 3E98A 5HSQA 3MQ0A 2W3DA 4LRYC 4MMNA 3S7NA 2W3EA 4ZRRA 3E0YA 3IBJA 4Y5FA 4EU0A 2LB5A 4IJGA 1ZTUA 2XROA 4G3WA 1F5MA 2LB9A 2GX5A 2W1TA 3ZQ5A 4MN7A
chains in the Genus database with same CATH superfamily
4OH0A 1C3BA 3IQAA 4OOLA 3HLCA 1IKIA 3SH9A 3BFEA 4R70A 4U3TA 2P7JA 4GDNA 1K57C 2H0TA 4UQIS 3IHAA 4P6BA 1KOUA 1BZAA 3QP1A 3EEHA 1K54A 3Q81A 2WUQA 1YLTA 4KUOA 3FKVA 3M6BA 1MWSA 1YMSA 1TS0A 3G32A 1NY0A 3GDIA 5A90A 3LGOA 4EUVA 2PD7A 2O9CA 4BBTA 3ZVWA 4JPMA 1W7FA 4GLQA 2P04A 2VJWA 4E6XA 4EUZA 2GJ3A 1GHIA 1KE3A 4CLCE 1H0MA 4Y2FA 1OPXA 2ZOHA 4I38A 4NXEA 4NETA 4E3KA 1OTEA 3K2NA 4GOGA 2J3WA 1XJ4A 2EWVA 2H28A 2M1CA 5M19A 1NYYA 1LL9A 2A2LA 1DJAA 3Q7ZA 4P85A 3PYPA 2J8YA 4I5SA 2ZBBA 3PTEA 1NXYA 3IF6A 1JTDA 1ZG4A 3IXDA 5AQ9A 4C3QA 4EBLA 2UWXA 3BW6A 2HJ9C 1XJ3A 4MNRA 5DFYA 3VE3A 1LSWA 1K0KA 4OP5A 4QD4A 4HBUA 2CMNA 4U0XA 3BLMA 2W3FA 4GN2A 1YSQA 3KSGA 3JVVA 1T1AA 1EROA 3TJZC 5EOEA 2PT7A 3MMHA 5AVEA 5EVLA 2XLNA 4EESA 2XK1A 4S2NA 2J7VA 3NY4A 1K6RA 3BLSA 1LI0A 5GLAA 4WEJA 2WKRA 1V9YA 3SZTA 3PAGA 4F3LB 2P08A 3CITA 1XJ2A 1FOFA 1NRFA 4M4XA 3KSHA 2HDSA 4HH3A 5F69A 2NUPC 2Y2QA 3CG5A 5HL6A 4B4XA 3LY4A 1SCWA 2FH5A 2OWHA 3LR0A 3OOVA 4N9KA 4BENA 5IT5A 1TS6A 5TR7A 1AXBA 3CMZA 2ZM2A 3EGDC 3A3IA 2XD5A 3B3XA 4L9GA 1VETA 3NIAA 2Z6CA 4XT2B 5EOOA 4Q0HA 4YFMA 1GHPA 2H0YA 1K56A 2I9VA 2QYBA 3C8CA 4LRXC 3WRZA 3F1NB 3BYDA 5A91A 3E98A 5G18A 4EQ1A 4LRYC 3S7NA 1D7EA 3LO7A 3NECA 3LR5A 5M18A 1ES5A 5J4EA 2A24B 3HREA 3V39A 1CI9A 4PM6A 2HPBA 1N9NA 3TE8A 1OTDA 4Y13A 3IS2B 1E3UD 2O9AA 4JGRA 1S67L 2H10A 5G4YA 3PBRA 2P9VA 4WZ4A 1KE0A 3F1PB 3U4LP 3T1XA 3ZG8B 3QNBA 2UV0E 1IYOA 3GQZA 3HLGA 4PKYA 3IWQA 1NZUA 3A3DA 3RH8B 1ALQA 2Z6DA 3MZDA 1STZA 4OP8A 5HAPA 4WMCD 4H6JB 4D2OA 4Y0TA 2W3HA 1ERMA 4NXFA 4Q8IA 4P87A 2H5SA 3QP8A 3NDEA 2Y91A 3E4QA 4ZTKA 3UDFA 3NDGA 2K31A 4IHQA 1U60A 1S1ZA 3GECA 4N1HA 1E25A 3SS3A 3IX8A 3MJQA 4DE0A 4EEUA 1FIKA 5AJGA 1MZUA 5CHJA 4CLCB 1OT9A 5AQBA 4L9FA 4WZ5A 3CUEA 3LICA 3NOUC 3UMEA 2JKGA 5FEGA 4Y15A 2Y2PA 4HJ6A 4LFUA 2V1AA 1S1YA 2Y2LA 3DTKA 3PBNA 5CRFA 4DE1A 3ZNYA 1G68A 1GSWA 3ULFA 4OPZA 5GHYA 2IWDA 1PNEA 1K4FA 3JYIA 4WLAA 3LIFA 3QP5A 5G4ZA 4WELA 1N4OA 4IUKA 3VE4A 1JVJA 3LUQA 2FFYA 3E4PA 2VGLM 3W4QA 3GMWA 2EA9A 3BECA 2XA7S 4UA7A 2VK3A 4LPZA 1DP9A 2PHYA 1KGFA 2WKPA 5AQ7A 5U47A 4HESA 4WN5A 3ZFZA 2W0NA 1EI5A 3UO9A 3SH7A 4EEPA 4GHIA 3F1OB 3Q7VB 4R4SA 3OC2A 3LIDA 4DF6A 1MWTA 3NJAA 3UPNA 5EM0A 1XP4A 2BG1A 3ZHHA 1K6SA 4HJ4A 1XPBA 3M2KA 3NOPC 3UE0A 2A49A 1K55A 1KVLA 4OQHA 2PD8A 1MY8A 3C2WA 5FQKA 2WGIA 3QP6A 3FWLA 4I3AA 2OOLA 2DMWA 3OPRA 5HPIA 3ZNTA 3HLDA 3IXBA 4YOFA 2X02A 4HP4A 4MBHA 3ZG7B 1HTZA 2O99A 3ISGA 4ARZB 1DP8A 3HLFA 1ZHHB 2XH9A 5HZHA 3ZCZA 4HEFA 4MEZA 1YLJA 1F98A 2DRWA 4PM8A 3MKEA 5AVFA 1OMEA 4UQIM 4G3WA 2JKRI 3MS6A 4BBVA 3OPHA 2OV5A 2WADA 1M40A 1WYBA 2PR6A 4X6TA 5TGFA 2J3TD 2HP5A 2ACGA 5FA7A 1W8YA 1OJGA 2ZJ9A 3T1SA 2D02A 4EXOA 3A0SA 1MWUA 1VB6A 3G6OA 3SOIA 4R1GA 1LLBA 4HNBA 3LIAA 5CHMA 4N9LA 4R0QA 1DP6A 1LT0A 1JTGA 3LR3A 2JBFA 3LI9A 5CGXA 3S7QA 4OPQA 1PI5A 2Y8HA 3NC8A 3S4XA 4KG2A 1G6AA 3P98A 3LFVA 3OCLA 3DWKA 2VEAA 4QHCA 2B5RA 3DTIA 3BFCA 4E3MA 5FEFA 3IBRA 1NLZA 2Y59A 1NLYA 4S2MA 3A0VA 4GS9A 4ZJ1A 4C75A 5GLBA 1MPLA 5MC7A 5EVID 3IF6B 4WBGA 2XF3A 4KZ3A 4KZAA 3WS1A 3EOIA 4EU0A 4KZ8A 2QKPA 4S2IA 4R38A 5FDHA 1IKGA 4ID4A 1ACFA 2B18A 2M7VA 5F5YA 2PYRA 4LGWA 2GZAA 4EBNA 2ZC5B 2GNXA 1KGEA 1IFQA 2DNSA 4JBFA 1PRQA 3GR2A 1L2SA 3PAEA 4K91A 2B02A 4IVKA 3RFBA 3WS5A 2ZC3B 3N8LA 5CERA 3CI6A 2HDUA 4R23A 3BRMA 2JKFA 2HP6A 1HZOA 4XUXA 4LV1A 5C5KA 4NG2A 2EX8A 4H8RA 2EFUA 2DCFA 5FQQA 4OOYA 1DJBA 1JWZA 1KDWA 4HBTA 4FSFA 1KVMA 4MCWA 2Y2KA 4HHDA 1NWZA 3M6HA 3R4KA 2XGNA 4PM7A 2PYPA 3B33A 4KZ9A 1XFQA 2B95A 3MZFA 2EXBA 3BQAA 1SHVA 3C7UA 3L7HA 4PPRA 2WGVA 3VOLA 3H7WA 3OBFA 5FDSA 4JXGA 3S7OA 1XA1A 4EERA 5EPHA 5M1AA 3A3JA 5GL9A 5HX9A 5F82A 1H8ZA 1ES3A 5A93A 1QMFA 3NI9A 4X53A 4RX3A 2ZQ7A 3IF5A 2W1TA 1BYWA 2P9VB 3LY3A 2QJ7A 1YAXA 1G5UA 2L4RA 5DJTA 2RL3A 2G2UA 3CJMA 4S2PA 3W4OA 4YNRA 2ZL1A 4QU3A 3N7WA 2JC7A 1J9MA 3UPPA 4X55A 4BWIA 3RXWA 3HLEA 2Z2MB 5F1GA 3FPVA 3DWZA 1GHMA 2JHEA 5CECA 4GW9A 2OLUA 3D4FA 3IXGA 4WUJA 3MF0A 5IU1A 4QY5A 2O0YA 3VMAA 5FAPA 3R7WB 1IYPA 4UEYA 3DAVA 3QP2A 2ZLYA 4GJ4A 2IA2A 1G6OA 2ZQ8A 1E3UA 1OTIA 2YKHA 3IT9A 4S2KA 3C4PA 1CK3A 2ZMVA 4Q0JA 4HP9A 2WKQA 1K54C 4LV2A 4OLDA 4FCFA 1T1CA 1LL8A 1XFNA 1BULA 2RCXA 2J80A 2V20A 3LEQA 2WAFA 1BLHA 1TEMA 3U2AA 4RVAA 2E8JA 5E2GA 2Y2IA 1H3QA 4WMCA 2Q9NA 3S1YA 3H82B 4LCMA 5CTMA 3UN7A 2QMIA 3HJIA 4PHTA 2OLVA 3T1QB 3QP4A 4WF0A 2XA7M 4PMAA 1PIOA 1YLWA 1KE4A 5E2FA 4MN7A 1TS7A 2INWA 3L9KA 3OPLA 5F6AA 4DKIA 4DE3A 2D01A 3WRTA 5HAQA 1S6RA 2VZWA 3GSGA 2XDMA 4PAUA 2JE5A 4OOMA 2O9BA 3W4PA 3FZCA 2K7SA 4GHIB 2ZMAA 3IF6C 3D72A 3E2KA 2QJ5A 1PZPA 3T4KA 2V0UA 4QB8A 1QMEA 5HDCA 5E43A 2A3UA 3KYZA 2WK0A 2WGWA 5DF9A 3DTMA 1WYCA 3VSKA 4OQGA 3RTYA 1W63M 3OLOA 4Y0OA 4HJ3A 4CPKA 4S2LA 4DJ2A 3PHYA 5FSRA 4UAAA 2ZQ9A 4E04A 3N4IA 2ZM8A 4XXRA 1Z09A 3N6IA 4S2NC 1H8MA 4R3AA 1Z6FA 5HDDA 1KDSA 4IUHA 1VHMA 1PWDA 3UPOA 3T4TA 3VFHA 2WZXA 2V9AA 1TDGA 4L0LA 3E2LA 5FQMA 1BLSA 2PAVP 1CQAA 4OKPA 1BSGA 4P0MA 4X1LA 1FR6A 1VM1A 3NULA 4FH4A 3ITBA 1OTAA 2V8FA 1PYYA 1ZTUA 1SDEA 5A92A 3V3SA 2LB9A 3FKWA 4DE2A 2C5WB 2ZQAA 4RA7A 1Q2PA 4HQAA 1PWCA 4LV0A 4GKUA 3MSHA 2ZMFA 3BM6A 1L3LA 3N8SA 3T4QA 2HF6A 4R3JA 2EXAA 2VV6A 1JNUA 2CC1A 3VOZA 2BASA 2VX8A 1W79A 1GSVA 5DJUA 3O5YA 2XFSA 3QHYA 1N9LA 1OJ5A 1K25A 3LCEA 2QWSA 1MBLA 3UDIA 2KOIA 3VOYA 4ME4A 3VFFA 3EQVA 3OPPA 3MXRA 1W5DA 1FCMA 1TVFA 4MBKA 5L10A 3WS2A 3CLOA 4E3IA 3SH8A 3CHWP 4JXVA 5FASA 3D3OA 5GLDA 4JGOA 1ONHA 5CEDA 2Z2LB 2M7UA 4HI4A 2KX6A 3GV9A 4GS9B 4JGQA 4E3LA 3V67A 4ZAMA 2VA0A 3C4OA 4OLGA 4LRZE 5FI6A 1XX2A 3NCKA 2ZC6B 3VP3A 3T4JA 5EM1A 3MFXA 1L0FA 1MWRA 3CPTA 3BWLA 2LB5A 5HD3A 1PW1A 2V1BA 4WZ5C 2VGKA 5F68A 4BD1A 3CUEC 1LSVA 2ZQDA 1P9WA 3S22A 4OVDA 3BJNA 5GHZA 4DDSA 2ZQCA 1PFLA 1YT4A 4ESPA 2ZOIA 4GZBA 4L9EA 4BJPA 4Q0IA 3JVUA 4PM5A 5TJJA 5L09A 3H9WA 3Q82A 5EV0A 3M2JA 3PBOA 2ZM0A 2Q0OA 4BMWA 1S4RA 2VLGA 3MR0A 4OPRA 3VSLA 3HUNA 1YKDA 5EVIA 4I39A 4HIAA 1MC0A 1VQQA 5GHXA 3O86A 5JYOA 5IS1A 3ZGAB 4KQDA 1WA9A 5JYPA 2X71A 5E2HA 2I72A 4M3KA 3WWXA 1RGYA 3PBSA 4WL9A 5FQIA 3UMDA 4MN6A 5KZHA 3NHQA 3D9YA 3EGXC 5DTKA 3IH9A 3VP4A 3H7WB 5IHVA 2HV1A 4K08A 5GLCA 3G30A 1K4EA 1V9ZA 3ZYTA 5F83A 1HD8A 4GB7A 1P0ZA 4WEKA 4HH2A 1FR1A 5HFOA 3KX0X 3V5MA 4QJGA 2Q9MA 3NOTC 3S7PA 1K57A 2L1MA 4KQOA 2W3EA 1JWVA 5EVEA 4KZ5A 3VP0A 3PBQA 1K55C 4EETB 1HLUP 4NXBA 4EQIA 1M6KA 2ZL1B 2L0WA 4BLMA 4I3JA 4MDZA 1LHYA 4FTXA 3T12B 2PU2A 1YLZA 3DTEA 4UHUA 4CLCD 3P09A 5EECA 3RXXA 3RJUA 4MBFA 2QZ6A 4NK3A 5CHUA 2HZ5A 3BEBA 5FL3A 3UB9A 5EE8A 3DW0A 2ZC4B 4KZ7A 2W1RA 1NRJA 2JN7A 2KDKA 5E2EA 4JXSA 3GVBA 5CGSA 3SS5A 4E3NA 2EFXA 4ZJ3A 3CAXA 3TSGA 4Y0UA 5BOHA 3ZG9B 3ITAA 5LBRA 4LENA 3MXQA 3UY6A 3MQQA 4IBRA 3HUMA 4OQ0A 5FAOA 1VEUA 1L0GA 1YLPA 4PKYG 1XJ6A 1UWPX 3BFFA 5HAIA 3AGEA 5L8MA 1IYQA 4JXWA 4YWZA 1L0EA 4HY8A 3EWKA 1SKFA 1RGZA 5J3WA 2W27A 1K38A 4B88A 5TBMA 1XKZA 2EWWA 2Y2OA 3B42A 5HD5A 3LIEA 1VETB 4I3IA 3G2YA 1ZG6A 4KG6A 1NZOA 4CJNA 3PR6A 3IBJA 1SZVA 1PI4A 4K0WA 2R9XA 4IJGA 3B47A 1CJFA 4ZJ2A 1ES4A 3ZG5A 1PZOA 3AGDA 2V8CA 3C30A 2XR0A 2P74A 2XQZA 4O01A 3CZDA 2WAEA 4X1MA 4OPYA 4MLLA 4DJ3A 4FUWA 4X68A 4HOIA 4C6YA 1A0KA 3KSFA 3V3RA 4G3KA 1OTBA 2FFFB 2XRNA 2WGWB 2PR5A 1W63Q 1UWNX 5J7EA 3UE1A 3UB6A 4JLFA 4R3BA 3LI8A 3A3FA 5HDSA 2WYXA 1CEFA 4E6WA 3KYEA 1H5XA 1ODVA 3K3CA 4JF4A 2WKIA 1ZKJA 5DTTA 4R6LA 4KZ4A 1TS8A 3A3EA 1D06A 4BD0A 1P97A 2Y2HA 2GDNA 4FH2A 3HCYA 1IELA 4ETXA 5DF7A 1ESUA 1XGJA 4B93A 4DRTA 2C6WB 4ETZA 4K0XA 3QNCA 2MJ6A 2W3DA 4MMNA 3O3VA 4ZRRA 1DRMA 4AFIA 2Y4AA 4XUZA 2IWBA 1I2WA 3AGFA 1S0WA 1SKOA 4B4ZA 3BY9A 2JCHA 2E8IA 1KGGA 4Y7PA 2YKFA 2R78A 3LEZA 1ES2A 5I94A 3KYQA 1FILA 1T18A 4KQRA 2W3GA 3EEAA 4IEDA 1F2KA 3K3DA 3MQOA 4IBXA 1GSXA 3IX3A 3ZG0A 1Y28A 3T1RA 3C7VA 4NKPA 1Q2QA 3KO6A 1AWIA 4UA6A 3UB7A 5HPFA 3VP2A 2VKSA 3IWIA 4FOFA 1LI9A 2ZC7A 3JPUA 5KSCA 4LCLA 3TOIA 3PBTA 4Y3IA 4E3JA 2HP9A 1YSPA 2FZ0A 2XFTA 3HVFA 5AQAA 3HL9A 4DMZA 1T19A 2R9WA 3T4OA 2VV7A 2KLIA 2XEPA 4LLOB 4MN5A 3G31A 1F9IA 1IYSA 5TFQA 4G3VA 1DJCA 3Q07A 3G4PA 4Z1WA 4CQHA 3NBLA 5D3OA 1BUEA 5CEBA 3BY8A 2OSUA 4JF6A 1XA7A 1GA0A 3CPTB 1E4DA 4RX2A 1FCOA 2IWCA 5EUAA 4FD8A 4DXBA 1BT5A 2OWJA 2V1ZA 1N9OA 3FG8A 1DY6A 1IEMA 4IVIA 1GCEA 4GCZA 2Y2GA 4NEED 4UA9A 1RCJA 2PU4A 1BTLA 1WE4A 4JF5A 2BLSA 1HVBA 2EX2A 1Y4OA 2K2NA 1CEGA 3FYZA 3KSIA 1YQSA 5HW3A 4S2JA 5DKLA 2PBYA 1K56D 1S66L 3R7WA 3C38A 4X69A 5EVIB 2HDRA 2HJEA 2X01A 1YMXA 3IH8A 3PXPA 4Y17A 3WS4A 5L07A 4R4RA 2JKRM 4LV3A 3HLWA 3UNWA 1RP5A 2Y79A 2V0WA 4F3LA 3I7JA 3EQUA 4QPRA 4BQMA 4JGPA 3BFDA 5KIZA 3GTCA 2EX6A 2JKTM 3SW1A 4WYYA 5CGWA 2QHKA 3HLBA 1O07A 3UDXA 4X56A 3H82A 1YPRA 4WM9A 3UB5P 2Y55A 3IX4A 4OONA 3V50A 1MKMA 1T1BA 4U0TA 5DKKA 4XT2A 1NJ4A 5DFXA 5K5BA 4N1XA 3T4SA 4PM9A 5FAQA 3T4LA 3UB8A 4GD6A 5DF8A 3UE3A 3IXHA 3F1NA 5HWWA 4O7DA 5FQ9A 2VV8A 1BLCA 1FSYA 3W8KA 1ONGA 5DVAA 2A24A 5I5LA 4P6ZM 5A8BA 1TF1A 2G2WA 4B9OA 4O0PA 2J9OA 3TRCA 1CF0A 3IS2A 3ZDJA 5HL1A 3IHBA 4EW7A 4EV4A 3E4OA 4GD8A 4BBUA 1S4SA 2V2FF 4KQQA 3F1PA 3WS0A 5DTSA 3IWOA 3VV4A 5L2FA 5FI7A 3CWFA 4F94A 3OZHA 3MFDA 2HDQA 1YM1A 3MZEA 1ESIA 1OT6A 1W8QA 5HWVA 4H6JA 1TDLA 2XD1A 3FC7A 3G2ZA 5CXWA 1FSWA 2Y2JA 3O87A 1UGUA 1VEUB 3G35A 2OAQ1 3P01A 2PBDP 1SDNA 4BL3A 3FV7A 2VGJA 3TG9A 4GNUA 3MKFA 5HWTA 3W2ZA 2PDRA 5F1FA 3UE6A 1BLPA 2G7UA 3BFGA 5CTNA 4KENB 4GDBA 1FQGA 3HBRA 3LIBA 3ICYA 4A5RA 2EX9A 3C5AA 5TBMB 4DXCA 4CLCA 2XSSA 5J8XA 5EFWA 1J3WA 2AVXA 1PW8A 2ZD8A 1I5QA 4DDYA 3MQ0A 3O88A 5KMWA 2JKTI 4KG5A 2WKHA 3E0YA 4Y5FA 1H8YA 1L0DA 2J3TC 1XXMA 2XROA 4Z9QA 4OQIA 2Y2MA 3ZQ5A 3LR4A 4JKTA 1EWZA 1N9BA 3VP1A 4RYEA 5KSHA 1GA9A 1MXOA 3SS4A 2W1TB 1FCNA 3P7NA 4N92A 4O8GA 5FI2A 1MKIA 1G28A 3DBAA 1LSXA 2BTFP 5CX7A 4ZBEA 3BQ8A 1IOUA 5HARA 1D1JA 3A0RA 5FATA 4RQ9A 4KUKA 2HGVA 2VGLS 3HJKA 3F1OA 1XGIA 3GRJA 3Q7VA 1JWPA 2NUTC 1LL5A 3LYXA 3MXSA 1P9RA 4P6ZS 2Y2NA 3Q1FA 4DN0A 2QPNA 3T50A 4S2OA 4QY6A 1ZC2A 4KZ6A 4YINA 3HUOA 3OCNA 4D60A 5EVIC 1O7EA 1EW0A 3FPWA 1NYMA 4KZBA 4II7A 4CLCC 4NXGA 4E3OA 1TD5A 1CI8A 4X25A 3ZVTA 1Y54A 3G34A 5HSQA 1SKOB 1YLYA 2WKEA 2WZZA 3N8RA 1X0OA 2J9PA 3MBZA 4ARZA 4BL2A 2OAP1 2PRFA 1PWGA 4ZDXA 3TW8A 1I2SA 1F5MA 5FQJA 2GX5A 4QWOA 4EBPA 1ERQA 4EWFA
chains in the Genus database with same CATH topology
2R78A 4HQAA 4OOLA 3KYQA 2PR6A 2ZMFA 1T18A 2W3GA 3EEAA 4R70A 2J3TD 3T4QA 2HF6A 3K3DA 3MQOA 2P7JA 1GSXA 1OJGA 2VV6A 1Y28A 2D02A 4UQIS 4EXOA 3A0SA 1JNUA 1VB6A 2BASA 3G6OA 4NKPA 2VX8A 1KOUA 1GSVA 4HNBA 3KO6A 3LIAA 3EEHA 5DJUA 3O5YA 1N9LA 1OJ5A 4KUOA 3UB7A 5HPFA 2QWSA 1TS0A 1DP6A 1LT0A 2VKSA 3LR3A 3LI9A 3GDIA 4FOFA 3S7QA 2KOIA 2Y8HA 4ME4A 3PBTA 4EUVA 2PD7A 3EQVA 4Y3IA 2O9CA 4BBTA 1YSPA 2FZ0A 3LFVA 4DMZA 4GLQA 3OCLA 1T19A 2P04A 3CLOA 2VJWA 3T4OA 2VEAA 2GJ3A 2VV7A 3D3OA 2KLIA 4LLOB 4MN5A 4CLCE 1F9IA 4JGOA 4Y2FA 1OPXA 3IBRA 2ZOHA 4G3VA 4I38A 2M7UA 4HI4A 2KX6A 4NXEA 4GS9B 4JGQA 4Z1WA 1NLZA 4CQHA 1OTEA 1NLYA 3K2NA 3V67A 3A0VA 4GS9A 2VA0A 2J3WA 4LRZE 3BY8A 1XJ4A 2EWVA 2H28A 2M1CA 5MC7A 3T4JA 2A2LA 3MFXA 3PYPA 4I5SA 2ZBBA 3EOIA 4EU0A 2OWJA 1N9OA 2QKPA 3BWLA 2LB5A 3FG8A 5HD3A 4R38A 2V1BA 5F68A 3CUEC 1LSVA 1P9WA 3BW6A 2HJ9C 4GCZA 1XJ3A 2B18A 2M7VA 3BJNA 4NEED 5DFYA 5F5YA 2PYRA 3VE3A 2GZAA 1LSWA 2GNXA 2ZOIA 2CMNA 4L9EA 4BJPA 2W3FA 4Q0IA 1IFQA 2K2NA 3JVUA 1YSQA 3KSGA 3KSIA 3JVVA 5TJJA 1T1AA 5DKLA 3H9WA 3TJZC 2PT7A 2B02A 3MMHA 5AVEA 3RFBA 3PBOA 1S66L 4EESA 3R7WA 4BMWA 3C38A 1S4RA 2VLGA 3MR0A 2HJEA 3PXPA 3CI6A 4WEJA 2WKRA 1V9YA 1YKDA 4I39A 4F3LB 2JKRM 1MC0A 4HIAA 2P08A 3CITA 1XJ2A 5IS1A 5C5KA 4KQDA 2Y79A 1WA9A 4M4XA 3KSHA 4HH3A 2V0WA 5F69A 2NUPC 4F3LA 4QPRA 3EQUA 4JGPA 5HL6A 2FH5A 2OWHA 3LR0A 3OOVA 3PBSA 4FSFA 4WL9A 1TS6A 4MCWA 5IT5A 3UMDA 4MN6A 4HHDA 3NHQA 5KIZA 3EGXC 1NWZA 3R4KA 2JKTM 3SW1A 3EGDC 2PYPA 2QHKA 3B33A 1XFQA 3H7WB 3H82A 4L9GA 2HV1A 2Z6CA 4XT2B 4K08A 3BQAA 4Q0HA 1V9ZA 3ZYTA 1MKMA 1T1BA 3VOLA 3H7WA 4WEKA 1P0ZA 4HH2A 2I9VA 3OBFA 2QYBA 5DKKA 3C8CA 4XT2A 3KX0X 4LRXC 5DFXA 5K5BA 3T4SA 3T4LA 3UB8A 3NOTC 3F1NB 3S7OA 3S7PA 4EERA 3E98A 4EQ1A 3UE3A 4LRYC 2L1MA 4KQOA 3S7NA 2W3EA 1D7EA 3F1NA 5HWWA 3PBQA 3LR5A 5J4EA 4EETB 2A24B 2VV8A 4NXBA 2W1TA 1N9NA 1BYWA 3TE8A 2QJ7A 1OTDA 3IS2B 1YAXA 2A24A 5I5LA 2L0WA 2O9AA 4P6ZM 2L4RA 4JGRA 5DJTA 5A8BA 1S67L 1TF1A 4B9OA 4O0PA 5G4YA 3PBRA 3TRCA 4YNRA 4I3JA 3IS2A 4MDZA 3F1PB 4EW7A 3E4OA 4BBUA 1S4SA 4PKYA 3F1PA 3RH8B 4BWIA 4CLCD 3VV4A 3CWFA 2Z6DA 3FPVA 2JHEA 5FL3A 3UB9A 1STZA 4GW9A 4H6JB 1OT6A 2W3HA 4NXFA 2W1RA 1NRJA 2JN7A 2KDKA 4WUJA 3MF0A 5IU1A 5HWVA 3E4QA 4H6JA 2O0YA 2K31A 4IHQA 3FC7A 3R7WB 1S1ZA 1UGUA 3GECA 4UEYA 2OAQ1 3CAXA 3P01A 4GJ4A 2IA2A 1G6OA 5LBRA 3MXQA 3MQQA 1OTIA 3MJQA 2YKHA 2ZMVA 4EEUA 4PKYG 1XJ6A 4Q0JA 1UWPX 5AJGA 5HWTA 3W2ZA 1MZUA 2PDRA 4HP9A 3UE6A 2G7UA 2WKQA 5L8MA 4CLCB 1OT9A 4L9FA 4YWZA 4HY8A 3CUEA 3LIBA 3ICYA 1T1CA 3EWKA 1LL8A 1XFNA 3LICA 5TBMB 4CLCA 2J80A 2XSSA 5J3WA 2W27A 3NOUC 5EFWA 3UMEA 3U2AA 5TBMA 2EWWA 1H3QA 3B42A 5HD5A 3H82B 3LIEA 4I3IA 4HJ6A 3MQ0A 3HJIA 2JKTI 2V1AA 3PR6A 1S1YA 3E0YA 4PHTA 3IBJA 4Y5FA 2J3TC 4IJGA 3B47A 2XROA 3PBNA 4WF0A 2XA7M 3ZQ5A 3LR4A 4MN7A 1GSWA 3ULFA 3C30A 1TS7A 2INWA 4O01A 5F6AA 4WLAA 3LIFA 5G4ZA 5KSHA 4WELA 4DJ3A 2D01A 4IUKA 3VE4A 2VZWA 2W1TB 3P7NA 3LUQA 4HOIA 3E4PA 2VGLM 4O8GA 4PAUA 2EA9A 3KSFA 1G28A 2XA7S 4OOMA 4G3KA 3DBAA 1LSXA 1OTBA 4LPZA 2O9BA 1DP9A 2PHYA 5CX7A 2K7SA 2WKPA 4GHIB 3BQ8A 1IOUA 3D72A 2XRNA 4WN5A 2QJ5A 3A0RA 2PR5A 1W63Q 2W0NA 1UWNX 5J7EA 3T4KA 4EEPA 4GHIA 3UB6A 3F1OB 2V0UA 3LI8A 5HDCA 4RQ9A 5HDSA 3KYZA 3OC2A 3LIDA 4KUKA 2HGVA 5DF9A 2VGLS 3HJKA 3F1OA 3NJAA 1ODVA 3K3CA 3RTYA 1W63M 3OLOA 4HJ3A 2NUTC 3LYXA 4DJ2A 3PHYA 4HJ4A 1P9RA 4P6ZS 4E04A 4R6LA 3NOPC 1TS8A 4DN0A 1H8MA 4R3AA 3T50A 1D06A 5HDDA 4IUHA 2PD8A 1VHMA 1P97A 3C2WA 3OCNA 3HCYA 4I3AA 2OOLA 2DMWA 3T4TA 4ETXA 1EW0A 3FPWA 5HPIA 4II7A 4YOFA 2V9AA 4HP4A 4L0LA 4NXGA 4B93A 4CLCC 1TD5A 2O99A 4ETZA 4ARZB 1DP8A 5HSQA 1ZHHB 2MJ6A 2W3DA 4MMNA 4ZRRA 1DRMA 4AFIA 5HZHA 1X0OA 4ARZA 1F98A 2OAP1 1OTAA 3BY9A 3TW8A 5AVFA 1ZTUA 4UQIM 4G3WA 2JKRI 1F5MA 2LB9A 2GX5A 2YKFA 4BBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5L A;  2O9A A;  2B18 A;  2M7V A;  3BJN A;  1TF1 A;  4O01 A;  5DFY A;  4O0P A;  3TRC A;  2ZMF A;  4YNR A;  4MDZ A;  2W3G A;  3EEA A;  4R70 A;  4IUK A;  2W3F A;  4Q0I A;  2K2N A;  1YSQ A;  2VZW A;  3KSG A;  3KSI A;  2W1T B;  5TJJ A;  4O8G A;  4PAU A;  3KSF A;  4BWI A;  3VV4 A;  3MMH A;  4G3K A;  3DBA A;  3RFB A;  3G6O A;  2O9B A;  3KO6 A;  2XRN A;  1STZ A;  3O5Y A;  4GW9 A;  2W3H A;  3CI6 A;  5HPF A;  2W1R A;  1YKD A;  2VKS A;  3MF0 A;  1MC0 A;  4RQ9 A;  4FOF A;  3CIT A;  3S7Q A;  2O0Y A;  2HGV A;  2KOI A;  2Y8H A;  2K31 A;  5C5K A;  4ME4 A;  4EUV A;  2Y79 A;  4Y3I A;  3KSH A;  2O9C A;  1YSP A;  4QPR A;  3LFV A;  4DMZ A;  4GLQ A;  2IA2 A;  5HL6 A;  5LBR A;  2VJW A;  3OOV A;  2VEA A;  4MCW A;  4E04 A;  4R6L A;  3NHQ A;  3D3O A;  2KLI A;  3NOP C;  4DN0 A;  3R4K A;  4Q0J A;  4Y2F A;  5AJG A;  3W2Z A;  2G7U A;  3IBR A;  5L8M A;  4G3V A;  4IUH A;  1VHM A;  3C2W A;  2M7U A;  3HCY A;  4Z1W A;  4CQH A;  2OOL A;  4Q0H A;  4ETX A;  3K2N A;  2XSS A;  1MKM A;  5HPI A;  3NOU C;  3OBF A;  2QYB A;  4YOF A;  4LRZ E;  4LRX C;  1TD5 A;  5DFX A;  5K5B A;  2O99 A;  3NOT C;  3S7O A;  3S7P A;  4ETZ A;  3E98 A;  5HSQ A;  3MQ0 A;  2W3D A;  4LRY C;  4MMN A;  3S7N A;  2W3E A;  4ZRR A;  3E0Y A;  3IBJ A;  4Y5F A;  4EU0 A;  2LB5 A;  4IJG A;  1ZTU A;  2XRO A;  4G3W A;  1F5M A;  2LB9 A;  2GX5 A;  2W1T A;  3ZQ5 A;  4MN7 A; 
#chains in the Genus database with same CATH topology
 4OH0 A;  1C3B A;  3IQA A;  4OOL A;  3HLC A;  1IKI A;  3SH9 A;  3BFE A;  4R70 A;  4U3T A;  2P7J A;  4GDN A;  1K57 C;  2H0T A;  4UQI S;  3IHA A;  4P6B A;  1KOU A;  1BZA A;  3QP1 A;  3EEH A;  1K54 A;  3Q81 A;  2WUQ A;  1YLT A;  4KUO A;  3FKV A;  3M6B A;  1MWS A;  1YMS A;  1TS0 A;  3G32 A;  1NY0 A;  3GDI A;  5A90 A;  3LGO A;  4EUV A;  2PD7 A;  2O9C A;  4BBT A;  3ZVW A;  4JPM A;  1W7F A;  4GLQ A;  2P04 A;  2VJW A;  4E6X A;  4EUZ A;  2GJ3 A;  1GHI A;  1KE3 A;  4CLC E;  1H0M A;  4Y2F A;  1OPX A;  2ZOH A;  4I38 A;  4NXE A;  4NET A;  4E3K A;  1OTE A;  3K2N A;  4GOG A;  2J3W A;  1XJ4 A;  2EWV A;  2H28 A;  2M1C A;  5M19 A;  1NYY A;  1LL9 A;  2A2L A;  1DJA A;  3Q7Z A;  4P85 A;  3PYP A;  2J8Y A;  4I5S A;  2ZBB A;  3PTE A;  1NXY A;  3IF6 A;  1JTD A;  1ZG4 A;  3IXD A;  5AQ9 A;  4C3Q A;  4EBL A;  2UWX A;  3BW6 A;  2HJ9 C;  1XJ3 A;  4MNR A;  5DFY A;  3VE3 A;  1LSW A;  1K0K A;  4OP5 A;  4QD4 A;  4HBU A;  2CMN A;  4U0X A;  3BLM A;  2W3F A;  4GN2 A;  1YSQ A;  3KSG A;  3JVV A;  1T1A A;  1ERO A;  3TJZ C;  5EOE A;  2PT7 A;  3MMH A;  5AVE A;  5EVL A;  2XLN A;  4EES A;  2XK1 A;  4S2N A;  2J7V A;  3NY4 A;  1K6R A;  3BLS A;  1LI0 A;  5GLA A;  4WEJ A;  2WKR A;  1V9Y A;  3SZT A;  3PAG A;  4F3L B;  2P08 A;  3CIT A;  1XJ2 A;  1FOF A;  1NRF A;  4M4X A;  3KSH A;  2HDS A;  4HH3 A;  5F69 A;  2NUP C;  2Y2Q A;  3CG5 A;  5HL6 A;  4B4X A;  3LY4 A;  1SCW A;  2FH5 A;  2OWH A;  3LR0 A;  3OOV A;  4N9K A;  4BEN A;  5IT5 A;  1TS6 A;  5TR7 A;  1AXB A;  3CMZ A;  2ZM2 A;  3EGD C;  3A3I A;  2XD5 A;  3B3X A;  4L9G A;  1VET A;  3NIA A;  2Z6C A;  4XT2 B;  5EOO A;  4Q0H A;  4YFM A;  1GHP A;  2H0Y A;  1K56 A;  2I9V A;  2QYB A;  3C8C A;  4LRX C;  3WRZ A;  3F1N B;  3BYD A;  5A91 A;  3E98 A;  5G18 A;  4EQ1 A;  4LRY C;  3S7N A;  1D7E A;  3LO7 A;  3NEC A;  3LR5 A;  5M18 A;  1ES5 A;  5J4E A;  2A24 B;  3HRE A;  3V39 A;  1CI9 A;  4PM6 A;  2HPB A;  1N9N A;  3TE8 A;  1OTD A;  4Y13 A;  3IS2 B;  1E3U D;  2O9A A;  4JGR A;  1S67 L;  2H10 A;  5G4Y A;  3PBR A;  2P9V A;  4WZ4 A;  1KE0 A;  3F1P B;  3U4L P;  3T1X A;  3ZG8 B;  3QNB A;  2UV0 E;  1IYO A;  3GQZ A;  3HLG A;  4PKY A;  3IWQ A;  1NZU A;  3A3D A;  3RH8 B;  1ALQ A;  2Z6D A;  3MZD A;  1STZ A;  4OP8 A;  5HAP A;  4WMC D;  4H6J B;  4D2O A;  4Y0T A;  2W3H A;  1ERM A;  4NXF A;  4Q8I A;  4P87 A;  2H5S A;  3QP8 A;  3NDE A;  2Y91 A;  3E4Q A;  4ZTK A;  3UDF A;  3NDG A;  2K31 A;  4IHQ A;  1U60 A;  1S1Z A;  3GEC A;  4N1H A;  1E25 A;  3SS3 A;  3IX8 A;  3MJQ A;  4DE0 A;  4EEU A;  1FIK A;  5AJG A;  1MZU A;  5CHJ A;  4CLC B;  1OT9 A;  5AQB A;  4L9F A;  4WZ5 A;  3CUE A;  3LIC A;  3NOU C;  3UME A;  2JKG A;  5FEG A;  4Y15 A;  2Y2P A;  4HJ6 A;  4LFU A;  2V1A A;  1S1Y A;  2Y2L A;  3DTK A;  3PBN A;  5CRF A;  4DE1 A;  3ZNY A;  1G68 A;  1GSW A;  3ULF A;  4OPZ A;  5GHY A;  2IWD A;  1PNE A;  1K4F A;  3JYI A;  4WLA A;  3LIF A;  3QP5 A;  5G4Z A;  4WEL A;  1N4O A;  4IUK A;  3VE4 A;  1JVJ A;  3LUQ A;  2FFY A;  3E4P A;  2VGL M;  3W4Q A;  3GMW A;  2EA9 A;  3BEC A;  2XA7 S;  4UA7 A;  2VK3 A;  4LPZ A;  1DP9 A;  2PHY A;  1KGF A;  2WKP A;  5AQ7 A;  5U47 A;  4HES A;  4WN5 A;  3ZFZ A;  2W0N A;  1EI5 A;  3UO9 A;  3SH7 A;  4EEP A;  4GHI A;  3F1O B;  3Q7V B;  4R4S A;  3OC2 A;  3LID A;  4DF6 A;  1MWT A;  3NJA A;  3UPN A;  5EM0 A;  1XP4 A;  2BG1 A;  3ZHH A;  1K6S A;  4HJ4 A;  1XPB A;  3M2K A;  3NOP C;  3UE0 A;  2A49 A;  1K55 A;  1KVL A;  4OQH A;  2PD8 A;  1MY8 A;  3C2W A;  5FQK A;  2WGI A;  3QP6 A;  3FWL A;  4I3A A;  2OOL A;  2DMW A;  3OPR A;  5HPI A;  3ZNT A;  3HLD A;  3IXB A;  4YOF A;  2X02 A;  4HP4 A;  4MBH A;  3ZG7 B;  1HTZ A;  2O99 A;  3ISG A;  4ARZ B;  1DP8 A;  3HLF A;  1ZHH B;  2XH9 A;  5HZH A;  3ZCZ A;  4HEF A;  4MEZ A;  1YLJ A;  1F98 A;  2DRW A;  4PM8 A;  3MKE A;  5AVF A;  1OME A;  4UQI M;  4G3W A;  2JKR I;  3MS6 A;  4BBV A;  3OPH A;  2OV5 A;  2WAD A;  1M40 A;  1WYB A;  2PR6 A;  4X6T A;  5TGF A;  2J3T D;  2HP5 A;  2ACG A;  5FA7 A;  1W8Y A;  1OJG A;  2ZJ9 A;  3T1S A;  2D02 A;  4EXO A;  3A0S A;  1MWU A;  1VB6 A;  3G6O A;  3SOI A;  4R1G A;  1LLB A;  4HNB A;  3LIA A;  5CHM A;  4N9L A;  4R0Q A;  1DP6 A;  1LT0 A;  1JTG A;  3LR3 A;  2JBF A;  3LI9 A;  5CGX A;  3S7Q A;  4OPQ A;  1PI5 A;  2Y8H A;  3NC8 A;  3S4X A;  4KG2 A;  1G6A A;  3P98 A;  3LFV A;  3OCL A;  3DWK A;  2VEA A;  4QHC A;  2B5R A;  3DTI A;  3BFC A;  4E3M A;  5FEF A;  3IBR A;  1NLZ A;  2Y59 A;  1NLY A;  4S2M A;  3A0V A;  4GS9 A;  4ZJ1 A;  4C75 A;  5GLB A;  1MPL A;  5MC7 A;  5EVI D;  3IF6 B;  4WBG A;  2XF3 A;  4KZ3 A;  4KZA A;  3WS1 A;  3EOI A;  4EU0 A;  4KZ8 A;  2QKP A;  4S2I A;  4R38 A;  5FDH A;  1IKG A;  4ID4 A;  1ACF A;  2B18 A;  2M7V A;  5F5Y A;  2PYR A;  4LGW A;  2GZA A;  4EBN A;  2ZC5 B;  2GNX A;  1KGE A;  1IFQ A;  2DNS A;  4JBF A;  1PRQ A;  3GR2 A;  1L2S A;  3PAE A;  4K91 A;  2B02 A;  4IVK A;  3RFB A;  3WS5 A;  2ZC3 B;  3N8L A;  5CER A;  3CI6 A;  2HDU A;  4R23 A;  3BRM A;  2JKF A;  2HP6 A;  1HZO A;  4XUX A;  4LV1 A;  5C5K A;  4NG2 A;  2EX8 A;  4H8R A;  2EFU A;  2DCF A;  5FQQ A;  4OOY A;  1DJB A;  1JWZ A;  1KDW A;  4HBT A;  4FSF A;  1KVM A;  4MCW A;  2Y2K A;  4HHD A;  1NWZ A;  3M6H A;  3R4K A;  2XGN A;  4PM7 A;  2PYP A;  3B33 A;  4KZ9 A;  1XFQ A;  2B95 A;  3MZF A;  2EXB A;  3BQA A;  1SHV A;  3C7U A;  3L7H A;  4PPR A;  2WGV A;  3VOL A;  3H7W A;  3OBF A;  5FDS A;  4JXG A;  3S7O A;  1XA1 A;  4EER A;  5EPH A;  5M1A A;  3A3J A;  5GL9 A;  5HX9 A;  5F82 A;  1H8Z A;  1ES3 A;  5A93 A;  1QMF A;  3NI9 A;  4X53 A;  4RX3 A;  2ZQ7 A;  3IF5 A;  2W1T A;  1BYW A;  2P9V B;  3LY3 A;  2QJ7 A;  1YAX A;  1G5U A;  2L4R A;  5DJT A;  2RL3 A;  2G2U A;  3CJM A;  4S2P A;  3W4O A;  4YNR A;  2ZL1 A;  4QU3 A;  3N7W A;  2JC7 A;  1J9M A;  3UPP A;  4X55 A;  4BWI A;  3RXW A;  3HLE A;  2Z2M B;  5F1G A;  3FPV A;  3DWZ A;  1GHM A;  2JHE A;  5CEC A;  4GW9 A;  2OLU A;  3D4F A;  3IXG A;  4WUJ A;  3MF0 A;  5IU1 A;  4QY5 A;  2O0Y A;  3VMA A;  5FAP A;  3R7W B;  1IYP A;  4UEY A;  3DAV A;  3QP2 A;  2ZLY A;  4GJ4 A;  2IA2 A;  1G6O A;  2ZQ8 A;  1E3U A;  1OTI A;  2YKH A;  3IT9 A;  4S2K A;  3C4P A;  1CK3 A;  2ZMV A;  4Q0J A;  4HP9 A;  2WKQ A;  1K54 C;  4LV2 A;  4OLD A;  4FCF A;  1T1C A;  1LL8 A;  1XFN A;  1BUL A;  2RCX A;  2J80 A;  2V20 A;  3LEQ A;  2WAF A;  1BLH A;  1TEM A;  3U2A A;  4RVA A;  2E8J A;  5E2G A;  2Y2I A;  1H3Q A;  4WMC A;  2Q9N A;  3S1Y A;  3H82 B;  4LCM A;  5CTM A;  3UN7 A;  2QMI A;  3HJI A;  4PHT A;  2OLV A;  3T1Q B;  3QP4 A;  4WF0 A;  2XA7 M;  4PMA A;  1PIO A;  1YLW A;  1KE4 A;  5E2F A;  4MN7 A;  1TS7 A;  2INW A;  3L9K A;  3OPL A;  5F6A A;  4DKI A;  4DE3 A;  2D01 A;  3WRT A;  5HAQ A;  1S6R A;  2VZW A;  3GSG A;  2XDM A;  4PAU A;  2JE5 A;  4OOM A;  2O9B A;  3W4P A;  3FZC A;  2K7S A;  4GHI B;  2ZMA A;  3IF6 C;  3D72 A;  3E2K A;  2QJ5 A;  1PZP A;  3T4K A;  2V0U A;  4QB8 A;  1QME A;  5HDC A;  5E43 A;  2A3U A;  3KYZ A;  2WK0 A;  2WGW A;  5DF9 A;  3DTM A;  1WYC A;  3VSK A;  4OQG A;  3RTY A;  1W63 M;  3OLO A;  4Y0O A;  4HJ3 A;  4CPK A;  4S2L A;  4DJ2 A;  3PHY A;  5FSR A;  4UAA A;  2ZQ9 A;  4E04 A;  3N4I A;  2ZM8 A;  4XXR A;  1Z09 A;  3N6I A;  4S2N C;  1H8M A;  4R3A A;  1Z6F A;  5HDD A;  1KDS A;  4IUH A;  1VHM A;  1PWD A;  3UPO A;  3T4T A;  3VFH A;  2WZX A;  2V9A A;  1TDG A;  4L0L A;  3E2L A;  5FQM A;  1BLS A;  2PAV P;  1CQA A;  4OKP A;  1BSG A;  4P0M A;  4X1L A;  1FR6 A;  1VM1 A;  3NUL A;  4FH4 A;  3ITB A;  1OTA A;  2V8F A;  1PYY A;  1ZTU A;  1SDE A;  5A92 A;  3V3S A;  2LB9 A;  3FKW A;  4DE2 A;  2C5W B;  2ZQA A;  4RA7 A;  1Q2P A;  4HQA A;  1PWC A;  4LV0 A;  4GKU A;  3MSH A;  2ZMF A;  3BM6 A;  1L3L A;  3N8S A;  3T4Q A;  2HF6 A;  4R3J A;  2EXA A;  2VV6 A;  1JNU A;  2CC1 A;  3VOZ A;  2BAS A;  2VX8 A;  1W79 A;  1GSV A;  5DJU A;  3O5Y A;  2XFS A;  3QHY A;  1N9L A;  1OJ5 A;  1K25 A;  3LCE A;  2QWS A;  1MBL A;  3UDI A;  2KOI A;  3VOY A;  4ME4 A;  3VFF A;  3EQV A;  3OPP A;  3MXR A;  1W5D A;  1FCM A;  1TVF A;  4MBK A;  5L10 A;  3WS2 A;  3CLO A;  4E3I A;  3SH8 A;  3CHW P;  4JXV A;  5FAS A;  3D3O A;  5GLD A;  4JGO A;  1ONH A;  5CED A;  2Z2L B;  2M7U A;  4HI4 A;  2KX6 A;  3GV9 A;  4GS9 B;  4JGQ A;  4E3L A;  3V67 A;  4ZAM A;  2VA0 A;  3C4O A;  4OLG A;  4LRZ E;  5FI6 A;  1XX2 A;  3NCK A;  2ZC6 B;  3VP3 A;  3T4J A;  5EM1 A;  3MFX A;  1L0F A;  1MWR A;  3CPT A;  3BWL A;  2LB5 A;  5HD3 A;  1PW1 A;  2V1B A;  4WZ5 C;  2VGK A;  5F68 A;  4BD1 A;  3CUE C;  1LSV A;  2ZQD A;  1P9W A;  3S22 A;  4OVD A;  3BJN A;  5GHZ A;  4DDS A;  2ZQC A;  1PFL A;  1YT4 A;  4ESP A;  2ZOI A;  4GZB A;  4L9E A;  4BJP A;  4Q0I A;  3JVU A;  4PM5 A;  5TJJ A;  5L09 A;  3H9W A;  3Q82 A;  5EV0 A;  3M2J A;  3PBO A;  2ZM0 A;  2Q0O A;  4BMW A;  1S4R A;  2VLG A;  3MR0 A;  4OPR A;  3VSL A;  3HUN A;  1YKD A;  5EVI A;  4I39 A;  4HIA A;  1MC0 A;  1VQQ A;  5GHX A;  3O86 A;  5JYO A;  5IS1 A;  3ZGA B;  4KQD A;  1WA9 A;  5JYP A;  2X71 A;  5E2H A;  2I72 A;  4M3K A;  3WWX A;  1RGY A;  3PBS A;  4WL9 A;  5FQI A;  3UMD A;  4MN6 A;  5KZH A;  3NHQ A;  3D9Y A;  3EGX C;  5DTK A;  3IH9 A;  3VP4 A;  3H7W B;  5IHV A;  2HV1 A;  4K08 A;  5GLC A;  3G30 A;  1K4E A;  1V9Z A;  3ZYT A;  5F83 A;  1HD8 A;  4GB7 A;  1P0Z A;  4WEK A;  4HH2 A;  1FR1 A;  5HFO A;  3KX0 X;  3V5M A;  4QJG A;  2Q9M A;  3NOT C;  3S7P A;  1K57 A;  2L1M A;  4KQO A;  2W3E A;  1JWV A;  5EVE A;  4KZ5 A;  3VP0 A;  3PBQ A;  1K55 C;  4EET B;  1HLU P;  4NXB A;  4EQI A;  1M6K A;  2ZL1 B;  2L0W A;  4BLM A;  4I3J A;  4MDZ A;  1LHY A;  4FTX A;  3T12 B;  2PU2 A;  1YLZ A;  3DTE A;  4UHU A;  4CLC D;  3P09 A;  5EEC A;  3RXX A;  3RJU A;  4MBF A;  2QZ6 A;  4NK3 A;  5CHU A;  2HZ5 A;  3BEB A;  5FL3 A;  3UB9 A;  5EE8 A;  3DW0 A;  2ZC4 B;  4KZ7 A;  2W1R A;  1NRJ A;  2JN7 A;  2KDK A;  5E2E A;  4JXS A;  3GVB A;  5CGS A;  3SS5 A;  4E3N A;  2EFX A;  4ZJ3 A;  3CAX A;  3TSG A;  4Y0U A;  5BOH A;  3ZG9 B;  3ITA A;  5LBR A;  4LEN A;  3MXQ A;  3UY6 A;  3MQQ A;  4IBR A;  3HUM A;  4OQ0 A;  5FAO A;  1VEU A;  1L0G A;  1YLP A;  4PKY G;  1XJ6 A;  1UWP X;  3BFF A;  5HAI A;  3AGE A;  5L8M A;  1IYQ A;  4JXW A;  4YWZ A;  1L0E A;  4HY8 A;  3EWK A;  1SKF A;  1RGZ A;  5J3W A;  2W27 A;  1K38 A;  4B88 A;  5TBM A;  1XKZ A;  2EWW A;  2Y2O A;  3B42 A;  5HD5 A;  3LIE A;  1VET B;  4I3I A;  3G2Y A;  1ZG6 A;  4KG6 A;  1NZO A;  4CJN A;  3PR6 A;  3IBJ A;  1SZV A;  1PI4 A;  4K0W A;  2R9X A;  4IJG A;  3B47 A;  1CJF A;  4ZJ2 A;  1ES4 A;  3ZG5 A;  1PZO A;  3AGD A;  2V8C A;  3C30 A;  2XR0 A;  2P74 A;  2XQZ A;  4O01 A;  3CZD A;  2WAE A;  4X1M A;  4OPY A;  4MLL A;  4DJ3 A;  4FUW A;  4X68 A;  4HOI A;  4C6Y A;  1A0K A;  3KSF A;  3V3R A;  4G3K A;  1OTB A;  2FFF B;  2XRN A;  2WGW B;  2PR5 A;  1W63 Q;  1UWN X;  5J7E A;  3UE1 A;  3UB6 A;  4JLF A;  4R3B A;  3LI8 A;  3A3F A;  5HDS A;  2WYX A;  1CEF A;  4E6W A;  3KYE A;  1H5X A;  1ODV A;  3K3C A;  4JF4 A;  2WKI A;  1ZKJ A;  5DTT A;  4R6L A;  4KZ4 A;  1TS8 A;  3A3E A;  1D06 A;  4BD0 A;  1P97 A;  2Y2H A;  2GDN A;  4FH2 A;  3HCY A;  1IEL A;  4ETX A;  5DF7 A;  1ESU A;  1XGJ A;  4B93 A;  4DRT A;  2C6W B;  4ETZ A;  4K0X A;  3QNC A;  2MJ6 A;  2W3D A;  4MMN A;  3O3V A;  4ZRR A;  1DRM A;  4AFI A;  2Y4A A;  4XUZ A;  2IWB A;  1I2W A;  3AGF A;  1S0W A;  1SKO A;  4B4Z A;  3BY9 A;  2JCH A;  2E8I A;  1KGG A;  4Y7P A;  2YKF A;  2R78 A;  3LEZ A;  1ES2 A;  5I94 A;  3KYQ A;  1FIL A;  1T18 A;  4KQR A;  2W3G A;  3EEA A;  4IED A;  1F2K A;  3K3D A;  3MQO A;  4IBX A;  1GSX A;  3IX3 A;  3ZG0 A;  1Y28 A;  3T1R A;  3C7V A;  4NKP A;  1Q2Q A;  3KO6 A;  1AWI A;  4UA6 A;  3UB7 A;  5HPF A;  3VP2 A;  2VKS A;  3IWI A;  4FOF A;  1LI9 A;  2ZC7 A;  3JPU A;  5KSC A;  4LCL A;  3TOI A;  3PBT A;  4Y3I A;  4E3J A;  2HP9 A;  1YSP A;  2FZ0 A;  2XFT A;  3HVF A;  5AQA A;  3HL9 A;  4DMZ A;  1T19 A;  2R9W A;  3T4O A;  2VV7 A;  2KLI A;  2XEP A;  4LLO B;  4MN5 A;  3G31 A;  1F9I A;  1IYS A;  5TFQ A;  4G3V A;  1DJC A;  3Q07 A;  3G4P A;  4Z1W A;  4CQH A;  3NBL A;  5D3O A;  1BUE A;  5CEB A;  3BY8 A;  2OSU A;  4JF6 A;  1XA7 A;  1GA0 A;  3CPT B;  1E4D A;  4RX2 A;  1FCO A;  2IWC A;  5EUA A;  4FD8 A;  4DXB A;  1BT5 A;  2OWJ A;  2V1Z A;  1N9O A;  3FG8 A;  1DY6 A;  1IEM A;  4IVI A;  1GCE A;  4GCZ A;  2Y2G A;  4NEE D;  4UA9 A;  1RCJ A;  2PU4 A;  1BTL A;  1WE4 A;  4JF5 A;  2BLS A;  1HVB A;  2EX2 A;  1Y4O A;  2K2N A;  1CEG A;  3FYZ A;  3KSI A;  1YQS A;  5HW3 A;  4S2J A;  5DKL A;  2PBY A;  1K56 D;  1S66 L;  3R7W A;  3C38 A;  4X69 A;  5EVI B;  2HDR A;  2HJE A;  2X01 A;  1YMX A;  3IH8 A;  3PXP A;  4Y17 A;  3WS4 A;  5L07 A;  4R4R A;  2JKR M;  4LV3 A;  3HLW A;  3UNW A;  1RP5 A;  2Y79 A;  2V0W A;  4F3L A;  3I7J A;  3EQU A;  4QPR A;  4BQM A;  4JGP A;  3BFD A;  5KIZ A;  3GTC A;  2EX6 A;  2JKT M;  3SW1 A;  4WYY A;  5CGW A;  2QHK A;  3HLB A;  1O07 A;  3UDX A;  4X56 A;  3H82 A;  1YPR A;  4WM9 A;  3UB5 P;  2Y55 A;  3IX4 A;  4OON A;  3V50 A;  1MKM A;  1T1B A;  4U0T A;  5DKK A;  4XT2 A;  1NJ4 A;  5DFX A;  5K5B A;  4N1X A;  3T4S A;  4PM9 A;  5FAQ A;  3T4L A;  3UB8 A;  4GD6 A;  5DF8 A;  3UE3 A;  3IXH A;  3F1N A;  5HWW A;  4O7D A;  5FQ9 A;  2VV8 A;  1BLC A;  1FSY A;  3W8K A;  1ONG A;  5DVA A;  2A24 A;  5I5L A;  4P6Z M;  5A8B A;  1TF1 A;  2G2W A;  4B9O A;  4O0P A;  2J9O A;  3TRC A;  1CF0 A;  3IS2 A;  3ZDJ A;  5HL1 A;  3IHB A;  4EW7 A;  4EV4 A;  3E4O A;  4GD8 A;  4BBU A;  1S4S A;  2V2F F;  4KQQ A;  3F1P A;  3WS0 A;  5DTS A;  3IWO A;  3VV4 A;  5L2F A;  5FI7 A;  3CWF A;  4F94 A;  3OZH A;  3MFD A;  2HDQ A;  1YM1 A;  3MZE A;  1ESI A;  1OT6 A;  1W8Q A;  5HWV A;  4H6J A;  1TDL A;  2XD1 A;  3FC7 A;  3G2Z A;  5CXW A;  1FSW A;  2Y2J A;  3O87 A;  1UGU A;  1VEU B;  3G35 A;  2OAQ 1;  3P01 A;  2PBD P;  1SDN A;  4BL3 A;  3FV7 A;  2VGJ A;  3TG9 A;  4GNU A;  3MKF A;  5HWT A;  3W2Z A;  2PDR A;  5F1F A;  3UE6 A;  1BLP A;  2G7U A;  3BFG A;  5CTN A;  4KEN B;  4GDB A;  1FQG A;  3HBR A;  3LIB A;  3ICY A;  4A5R A;  2EX9 A;  3C5A A;  5TBM B;  4DXC A;  4CLC A;  2XSS A;  5J8X A;  5EFW A;  1J3W A;  2AVX A;  1PW8 A;  2ZD8 A;  1I5Q A;  4DDY A;  3MQ0 A;  3O88 A;  5KMW A;  2JKT I;  4KG5 A;  2WKH A;  3E0Y A;  4Y5F A;  1H8Y A;  1L0D A;  2J3T C;  1XXM A;  2XRO A;  4Z9Q A;  4OQI A;  2Y2M A;  3ZQ5 A;  3LR4 A;  4JKT A;  1EWZ A;  1N9B A;  3VP1 A;  4RYE A;  5KSH A;  1GA9 A;  1MXO A;  3SS4 A;  2W1T B;  1FCN A;  3P7N A;  4N92 A;  4O8G A;  5FI2 A;  1MKI A;  1G28 A;  3DBA A;  1LSX A;  2BTF P;  5CX7 A;  4ZBE A;  3BQ8 A;  1IOU A;  5HAR A;  1D1J A;  3A0R A;  5FAT A;  4RQ9 A;  4KUK A;  2HGV A;  2VGL S;  3HJK A;  3F1O A;  1XGI A;  3GRJ A;  3Q7V A;  1JWP A;  2NUT C;  1LL5 A;  3LYX A;  3MXS A;  1P9R A;  4P6Z S;  2Y2N A;  3Q1F A;  4DN0 A;  2QPN A;  3T50 A;  4S2O A;  4QY6 A;  1ZC2 A;  4KZ6 A;  4YIN A;  3HUO A;  3OCN A;  4D60 A;  5EVI C;  1O7E A;  1EW0 A;  3FPW A;  1NYM A;  4KZB A;  4II7 A;  4CLC C;  4NXG A;  4E3O A;  1TD5 A;  1CI8 A;  4X25 A;  3ZVT A;  1Y54 A;  3G34 A;  5HSQ A;  1SKO B;  1YLY A;  2WKE A;  2WZZ A;  3N8R A;  1X0O A;  2J9P A;  3MBZ A;  4ARZ A;  4BL2 A;  2OAP 1;  2PRF A;  1PWG A;  4ZDX A;  3TW8 A;  1I2S A;  1F5M A;  5FQJ A;  2GX5 A;  4QWO A;  4EBP A;  1ERQ A;  4EWF A; 
#chains in the Genus database with same CATH homology
 2R78 A;  4HQA A;  4OOL A;  3KYQ A;  2PR6 A;  2ZMF A;  1T18 A;  2W3G A;  3EEA A;  4R70 A;  2J3T D;  3T4Q A;  2HF6 A;  3K3D A;  3MQO A;  2P7J A;  1GSX A;  1OJG A;  2VV6 A;  1Y28 A;  2D02 A;  4UQI S;  4EXO A;  3A0S A;  1JNU A;  1VB6 A;  2BAS A;  3G6O A;  4NKP A;  2VX8 A;  1KOU A;  1GSV A;  4HNB A;  3KO6 A;  3LIA A;  3EEH A;  5DJU A;  3O5Y A;  1N9L A;  1OJ5 A;  4KUO A;  3UB7 A;  5HPF A;  2QWS A;  1TS0 A;  1DP6 A;  1LT0 A;  2VKS A;  3LR3 A;  3LI9 A;  3GDI A;  4FOF A;  3S7Q A;  2KOI A;  2Y8H A;  4ME4 A;  3PBT A;  4EUV A;  2PD7 A;  3EQV A;  4Y3I A;  2O9C A;  4BBT A;  1YSP A;  2FZ0 A;  3LFV A;  4DMZ A;  4GLQ A;  3OCL A;  1T19 A;  2P04 A;  3CLO A;  2VJW A;  3T4O A;  2VEA A;  2GJ3 A;  2VV7 A;  3D3O A;  2KLI A;  4LLO B;  4MN5 A;  4CLC E;  1F9I A;  4JGO A;  4Y2F A;  1OPX A;  3IBR A;  2ZOH A;  4G3V A;  4I38 A;  2M7U A;  4HI4 A;  2KX6 A;  4NXE A;  4GS9 B;  4JGQ A;  4Z1W A;  1NLZ A;  4CQH A;  1OTE A;  1NLY A;  3K2N A;  3V67 A;  3A0V A;  4GS9 A;  2VA0 A;  2J3W A;  4LRZ E;  3BY8 A;  1XJ4 A;  2EWV A;  2H28 A;  2M1C A;  5MC7 A;  3T4J A;  2A2L A;  3MFX A;  3PYP A;  4I5S A;  2ZBB A;  3EOI A;  4EU0 A;  2OWJ A;  1N9O A;  2QKP A;  3BWL A;  2LB5 A;  3FG8 A;  5HD3 A;  4R38 A;  2V1B A;  5F68 A;  3CUE C;  1LSV A;  1P9W A;  3BW6 A;  2HJ9 C;  4GCZ A;  1XJ3 A;  2B18 A;  2M7V A;  3BJN A;  4NEE D;  5DFY A;  5F5Y A;  2PYR A;  3VE3 A;  2GZA A;  1LSW A;  2GNX A;  2ZOI A;  2CMN A;  4L9E A;  4BJP A;  2W3F A;  4Q0I A;  1IFQ A;  2K2N A;  3JVU A;  1YSQ A;  3KSG A;  3KSI A;  3JVV A;  5TJJ A;  1T1A A;  5DKL A;  3H9W A;  3TJZ C;  2PT7 A;  2B02 A;  3MMH A;  5AVE A;  3RFB A;  3PBO A;  1S66 L;  4EES A;  3R7W A;  4BMW A;  3C38 A;  1S4R A;  2VLG A;  3MR0 A;  2HJE A;  3PXP A;  3CI6 A;  4WEJ A;  2WKR A;  1V9Y A;  1YKD A;  4I39 A;  4F3L B;  2JKR M;  1MC0 A;  4HIA A;  2P08 A;  3CIT A;  1XJ2 A;  5IS1 A;  5C5K A;  4KQD A;  2Y79 A;  1WA9 A;  4M4X A;  3KSH A;  4HH3 A;  2V0W A;  5F69 A;  2NUP C;  4F3L A;  4QPR A;  3EQU A;  4JGP A;  5HL6 A;  2FH5 A;  2OWH A;  3LR0 A;  3OOV A;  3PBS A;  4FSF A;  4WL9 A;  1TS6 A;  4MCW A;  5IT5 A;  3UMD A;  4MN6 A;  4HHD A;  3NHQ A;  5KIZ A;  3EGX C;  1NWZ A;  3R4K A;  2JKT M;  3SW1 A;  3EGD C;  2PYP A;  2QHK A;  3B33 A;  1XFQ A;  3H7W B;  3H82 A;  4L9G A;  2HV1 A;  2Z6C A;  4XT2 B;  4K08 A;  3BQA A;  4Q0H A;  1V9Z A;  3ZYT A;  1MKM A;  1T1B A;  3VOL A;  3H7W A;  4WEK A;  1P0Z A;  4HH2 A;  2I9V A;  3OBF A;  2QYB A;  5DKK A;  3C8C A;  4XT2 A;  3KX0 X;  4LRX C;  5DFX A;  5K5B A;  3T4S A;  3T4L A;  3UB8 A;  3NOT C;  3F1N B;  3S7O A;  3S7P A;  4EER A;  3E98 A;  4EQ1 A;  3UE3 A;  4LRY C;  2L1M A;  4KQO A;  3S7N A;  2W3E A;  1D7E A;  3F1N A;  5HWW A;  3PBQ A;  3LR5 A;  5J4E A;  4EET B;  2A24 B;  2VV8 A;  4NXB A;  2W1T A;  1N9N A;  1BYW A;  3TE8 A;  2QJ7 A;  1OTD A;  3IS2 B;  1YAX A;  2A24 A;  5I5L A;  2L0W A;  2O9A A;  4P6Z M;  2L4R A;  4JGR A;  5DJT A;  5A8B A;  1S67 L;  1TF1 A;  4B9O A;  4O0P A;  5G4Y A;  3PBR A;  3TRC A;  4YNR A;  4I3J A;  3IS2 A;  4MDZ A;  3F1P B;  4EW7 A;  3E4O A;  4BBU A;  1S4S A;  4PKY A;  3F1P A;  3RH8 B;  4BWI A;  4CLC D;  3VV4 A;  3CWF A;  2Z6D A;  3FPV A;  2JHE A;  5FL3 A;  3UB9 A;  1STZ A;  4GW9 A;  4H6J B;  1OT6 A;  2W3H A;  4NXF A;  2W1R A;  1NRJ A;  2JN7 A;  2KDK A;  4WUJ A;  3MF0 A;  5IU1 A;  5HWV A;  3E4Q A;  4H6J A;  2O0Y A;  2K31 A;  4IHQ A;  3FC7 A;  3R7W B;  1S1Z A;  1UGU A;  3GEC A;  4UEY A;  2OAQ 1;  3CAX A;  3P01 A;  4GJ4 A;  2IA2 A;  1G6O A;  5LBR A;  3MXQ A;  3MQQ A;  1OTI A;  3MJQ A;  2YKH A;  2ZMV A;  4EEU A;  4PKY G;  1XJ6 A;  4Q0J A;  1UWP X;  5AJG A;  5HWT A;  3W2Z A;  1MZU A;  2PDR A;  4HP9 A;  3UE6 A;  2G7U A;  2WKQ A;  5L8M A;  4CLC B;  1OT9 A;  4L9F A;  4YWZ A;  4HY8 A;  3CUE A;  3LIB A;  3ICY A;  1T1C A;  3EWK A;  1LL8 A;  1XFN A;  3LIC A;  5TBM B;  4CLC A;  2J80 A;  2XSS A;  5J3W A;  2W27 A;  3NOU C;  5EFW A;  3UME A;  3U2A A;  5TBM A;  2EWW A;  1H3Q A;  3B42 A;  5HD5 A;  3H82 B;  3LIE A;  4I3I A;  4HJ6 A;  3MQ0 A;  3HJI A;  2JKT I;  2V1A A;  3PR6 A;  1S1Y A;  3E0Y A;  4PHT A;  3IBJ A;  4Y5F A;  2J3T C;  4IJG A;  3B47 A;  2XRO A;  3PBN A;  4WF0 A;  2XA7 M;  3ZQ5 A;  3LR4 A;  4MN7 A;  1GSW A;  3ULF A;  3C30 A;  1TS7 A;  2INW A;  4O01 A;  5F6A A;  4WLA A;  3LIF A;  5G4Z A;  5KSH A;  4WEL A;  4DJ3 A;  2D01 A;  4IUK A;  3VE4 A;  2VZW A;  2W1T B;  3P7N A;  3LUQ A;  4HOI A;  3E4P A;  2VGL M;  4O8G A;  4PAU A;  2EA9 A;  3KSF A;  1G28 A;  2XA7 S;  4OOM A;  4G3K A;  3DBA A;  1LSX A;  1OTB A;  4LPZ A;  2O9B A;  1DP9 A;  2PHY A;  5CX7 A;  2K7S A;  2WKP A;  4GHI B;  3BQ8 A;  1IOU A;  3D72 A;  2XRN A;  4WN5 A;  2QJ5 A;  3A0R A;  2PR5 A;  1W63 Q;  2W0N A;  1UWN X;  5J7E A;  3T4K A;  4EEP A;  4GHI A;  3UB6 A;  3F1O B;  2V0U A;  3LI8 A;  5HDC A;  4RQ9 A;  5HDS A;  3KYZ A;  3OC2 A;  3LID A;  4KUK A;  2HGV A;  5DF9 A;  2VGL S;  3HJK A;  3F1O A;  3NJA A;  1ODV A;  3K3C A;  3RTY A;  1W63 M;  3OLO A;  4HJ3 A;  2NUT C;  3LYX A;  4DJ2 A;  3PHY A;  4HJ4 A;  1P9R A;  4P6Z S;  4E04 A;  4R6L A;  3NOP C;  1TS8 A;  4DN0 A;  1H8M A;  4R3A A;  3T50 A;  1D06 A;  5HDD A;  4IUH A;  2PD8 A;  1VHM A;  1P97 A;  3C2W A;  3OCN A;  3HCY A;  4I3A A;  2OOL A;  2DMW A;  3T4T A;  4ETX A;  1EW0 A;  3FPW A;  5HPI A;  4II7 A;  4YOF A;  2V9A A;  4HP4 A;  4L0L A;  4NXG A;  4B93 A;  4CLC C;  1TD5 A;  2O99 A;  4ETZ A;  4ARZ B;  1DP8 A;  5HSQ A;  1ZHH B;  2MJ6 A;  2W3D A;  4MMN A;  4ZRR A;  1DRM A;  4AFI A;  5HZH A;  1X0O A;  4ARZ A;  1F98 A;  2OAP 1;  1OTA A;  3BY9 A;  3TW8 A;  5AVF A;  1ZTU A;  4UQI M;  4G3W A;  2JKR I;  1F5M A;  2LB9 A;  2GX5 A;  2YKF A;  4BBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...