2W3EA

Oxidized structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
b'GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3eA00
2OOLA 5HSQA 2W3HA 4PAUA 4ETXA 2LB9A 2VJWA 3KSFA 4Q0JA 4G3KA 5HL6A 3E0YA 4DMZA 4R6LA 3KSHA 1STZA 3D3OA 4CQHA 1YSQA 3CI6A 2VKSA 4YOFA 3K2NA 4ZRRA 2QYBA 4MDZA 2M7VA 2M7UA 1TF1A 5L8MA 5LBRA 2O9BA 2O0YA 5TJJA 1F5MA 2XROA 2GX5A 4MN7A 4QPRA 4EUVA 4Y3IA 4FOFA 3NOTC 3HCYA 2K2NA 4O0PA 4EU0A 2W3GA 1MKMA 3KO6A 4LRZE 3S7OA 4Q0IA 3IBRA 4YNRA 3E98A 3LFVA 2O9AA 3NHQA 3EEAA 4GLQA 4RQ9A 2W3EA 3O5YA 5K5BA 2VEAA 3NOUC 4GW9A 4ETZA 2IA2A 4IJGA 2G7UA 3ZQ5A 3CITA 3MF0A 3MQ0A 5AJGA 2W3FA 3OBFA 2W1RA 4R70A 3NOPC 1MC0A 1VHMA 2W3DA 2KLIA 2XSSA 4ME4A 3RFBA 3TRCA 3MMHA 3KSIA 2B18A 4BWIA 3IBJA 3DBAA 4MCWA 3G6OA 4Y2FA 2LB5A 4Q0HA 2Y79A 2ZMFA 1TD5A 2W1TA 4Z1WA 4DN0A 3C2WA 4E04A 4LRXC 3S7NA 1ZTUA 5C5KA 5HPFA 2VZWA 2W1TB 2KOIA 2XRNA 3VV4A 3OOVA 2O99A 4G3VA 2Y8HA 3KSGA 4O8GA 4O01A 2O9CA 3BJNA 4IUHA 4IUKA 5DFYA 4Y5FA 3W2ZA 1YKDA 4G3WA 4LRYC 1YSPA 3R4KA 5I5LA 3S7PA 5HPIA 3S7QA 5DFXA 4MMNA 2K31A 2HGVA
chains in the Genus database with same CATH superfamily
3MXRA 1KOUA 4I5SA 2ZC4B 4OVDA 4EBNA 2OOLA 1KGFA 4S2IA 2L0WA 3UDIA 3IWIA 3OCNA 3VE4A 4QB8A 1FQGA 2G2UA 3QNBA 1LL5A 1VEUB 4PKYG 1STZA 4S2KA 2ZMVA 5EV0A 4HJ4A 5A92A 2W27A 3GQZA 1OTEA 1CI9A 2XFSA 4X69A 4GDBA 3WS4A 2MJ6A 1PZOA 1N9NA 3V3SA 3UE0A 3EGXC 4LLOB 5DVAA 1IYSA 4X1MA 3PYPA 4P0MA 2P7JA 5FA7A 3FV7A 4GLQA 1M6KA 1W5DA 3LR4A 3NDEA 5FAPA 2L4RA 4FTXA 3ZQ5A 2W0NA 3Q07A 1UGUA 1IOUA 3TJZC 2WKRA 5AQ7A 4WN5A 3RFBA 4HESA 4WELA 4BWIA 4OP8A 3K3CA 4EEUA 4Q0HA 4BBVA 4BD1A 2PR5A 1PFLA 1YM1A 4BBTA 2R78A 4KUOA 2DMWA 3CUEA 4LRXC 3S7NA 2KOIA 3LR0A 3LICA 3ZYTA 5EUAA 5CTNA 2V0WA 5M18A 4RX2A 4GKUA 4CPKA 5I5LA 3C5AA 3MZDA 2IWCA 3S7QA 4L9FA 4UQIS 4E6WA 3G32A 3M6BA 3IHBA 2B5RA 2EXBA 3UB9A 3ZG8B 4PAUA 3BFCA 3UB6A 3VP2A 5E2FA 3BLSA 3IS2A 4S2LA 3VFHA 1N9OA 1N9LA 1SKFA 4YOFA 4EEPA 1SDEA 4I3JA 3BWLA 5TJJA 3UMDA 1F5MA 3PTEA 2YKHA 1VQQA 3IX3A 2ZLYA 4MBKA 3Q7ZA 3HLEA 1F98A 3KO6A 4QHCA 3IH9A 4RQ9A 3BLMA 4WF0A 5JYOA 2VEAA 2WKQA 1ZG4A 4GW9A 3QHYA 3G31A 5FQ9A 3F1NB 1WA9A 3IX8A 2H0YA 4GHIB 3NOPC 5CHUA 4HH3A 2PT7A 4KZAA 2VK3A 3QP8A 5CEBA 4HQAA 4MNRA 2X01A 5L07A 4R3AA 4HP4A 4DXBA 2H28A 2V1BA 4BJPA 4R3BA 5HD3A 4OPQA 2XDMA 2W1TB 4OPRA 3VV4A 4RVAA 4G3VA 1DJBA 5DJUA 4IUKA 5GHZA 4KQRA 4JXSA 2NUPC 5HD5A 4DJ3A 4M4XA 3IXDA 2ZC6B 5EVIC 2HGVA 1ERQA 3LO7A 4BQMA 5EFWA 5DTKA 2EFUA 3KSFA 3IF6A 3UB7A 1JWPA 3VOZA 4KZ3A 4L0LA 4LV1A 4E3MA 2XQZA 1LSVA 3PHYA 3LEQA 3TOIA 4OH0A 2WK0A 2M7UA 3NECA 2VA0A 3Q82A 2EX6A 3U4LP 3NDGA 3C38A 2Y2OA 3CJMA 4KZ7A 5GLCA 1ZC2A 3IXBA 4Y0UA 4FOFA 4WMCD 5FEFA 1PZPA 2K2NA 1L0EA 1ES5A 1E25A 2NUTC 3H82A 1OJ5A 4BLMA 4ZBEA 3MBZA 4F3LA 4IJGA 4PM8A 4WEJA 4QY5A 2W3FA 3T4TA 4R70A 4XUZA 5TGFA 3TRCA 5G18A 4EW7A 4KZ5A 5F83A 4XT2A 1LL8A 4OONA 3FKWA 1XJ6A 1ERMA 4NG2A 3VOYA 4R23A 5C5KA 1G6OA 3BFDA 4RA7A 2L1MA 3OOVA 2H5SA 5D3OA 3BJNA 3LIAA 4IBXA 3LIEA 3W2ZA 3G35A 1I5QA 1TEMA 3R4KA 4XXRA 1F9IA 1S67L 5EOOA 2RL3A 1DP6A 2K31A 4JF4A 2HDRA 3NJAA 1L0DA 1RCJA 4KZ4A 3ZG9B 2R9WA 3BQ8A 4EWFA 2WAEA 3OLOA 1L0FA 3MXQA 3PBTA 1OT6A 3K2NA 2OLUA 2QMIA 3NC8A 3GR2A 3IS2B 4RX3A 3ZDJA 1E3UD 1YAXA 1MWUA 1KE0A 3P09A 5HX9A 4BL3A 3CHWP 1WYCA 1VEUA 3ZNYA 2OLVA 3UDXA 4O0PA 4JPMA 4WZ5C 1H8MA 5EE8A 4JF5A 4DDSA 2V1ZA 3L7HA 1TDGA 3V5MA 5DJTA 1XXMA 2W1RA 1T1BA 2KLIA 1YT4A 4FD8A 1XA1A 4R1GA 4HP9A 5HAPA 3GTCA 3IBJA 4DE2A 3BY8A 4DJ2A 3M6HA 2PR6A 4R0QA 1MPLA 2XK1A 5HWWA 2VGLM 1XJ2A 3A3IA 3N8SA 5HDSA 1ESUA 5HAQA 1Q2PA 3QP6A 4C3QA 2V2FF 2Y2QA 2OAP1 1C3BA 1A0KA 4KZ8A 1GSVA 4Z9QA 1K57C 5DF8A 4L9GA 5CGSA 3ISGA 1QMEA 4KUKA 3IF6B 3IH8A 4B4ZA 3A3JA 2HDQA 1YMXA 4D2OA 3BFGA 1YMSA 1O7EA 2O9BA 1BLCA 1EWZA 1WE4A 4CJNA 1PYYA 3CPTB 4HHDA 3FKVA 3EEHA 4LV0A 1GHIA 2XH9A 3LY4A 1K6SA 2A3UA 3O86A 2PAVP 4LRZE 1K56D 4H8RA 5KMWA 4EESA 1FOFA 1W8YA 2HDSA 3ZG7B 1PWDA 2O9AA 3DTIA 1GHPA 5L2FA 3UB8A 1TS0A 5IHVA 1SCWA 1VB6A 4KQOA 2CC1A 4F3LB 3UPNA 4X53A 2ZM2A 4GD8A 4HEFA 4IEDA 2WADA 4JGQA 3BW6A 5FQIA 4JGPA 5E2EA 3F1NA 5L09A 2EX2A 4HIAA 3BRMA 4PM7A 2P08A 1EROA 4D60A 1ES3A 2HV1A 1CQAA 5DFYA 2WUQA 3T4SA 3N6IA 1XJ4A 3VMAA 3N8LA 2A2LA 3N4IA 4NXEA 3VP0A 3L9KA 2G2WA 4HNBA 3FZCA 4QY6A 3VP4A 1J3WA 4JLFA 4K91A 2W3HA 3OPLA 5FQMA 1L2SA 4HH2A 2XEPA 3BEBA 4UAAA 1S6RA 2FH5A 4GNUA 2QYBA 2M7VA 4IVKA 2H10A 4X68A 5DF7A 2XROA 2VV8A 1NJ4A 3E2LA 2XA7S 1PRQA 4S2NC 3HLGA 5KSCA 3QNCA 1ES4A 2XD5A 4X56A 3SH7A 3WS5A 1FCMA 3HBRA 3CLOA 1VM1A 4PKYA 3V3RA 2Y2LA 3C30A 4UEYA 4ETZA 3C8CA 1MWSA 3KYQA 2JBFA 2Y2KA 5DTSA 1MC0A 2GDNA 4EV4A 3B3XA 4Y15A 1MBLA 3MZEA 4P6ZS 3DBAA 4MCWA 3G6OA 3A0SA 3V50A 1XX2A 3CMZA 1AXBA 4PM6A 4OQGA 3C2WA 3U2AA 4GS9A 5EVLA 3SW1A 5FSRA 1V9ZA 3TSGA 2PD8A 2PBDP 3ULFA 2Y8HA 3KSGA 4JXGA 4B93A 2XR0A 3UDFA 4Y5FA 3H9WA 2HP9A 4X1LA 4MMNA 3P7NA 5TBMA 5M1AA 2WKEA 4GD6A 1ZKJA 1PNEA 2VJWA 4FUWA 3LUQA 2D02A 3EWKA 4R6LA 1H5XA 5FQJA 5J3WA 1XA7A 2VKSA 1T1CA 1K54A 4YWZA 2IWDA 4MDZA 3HLWA 3W4OA 4JKTA 3ZG0A 1BLHA 2BTFP 2JKRI 3JPUA 5BOHA 1GSWA 4QD4A 4BD0A 2IWBA 3I7JA 4EBPA 1GCEA 2ZM8A 2DNSA 2W3EA 3T1XA 2J7VA 1IYOA 4ZJ3A 1YPRA 2VV7A 3NY4A 3SS3A 1OTIA 5FATA 4HJ3A 2XSSA 1T1AA 1XFNA 1ONHA 3PR6A 2VV6A 1HTZA 2Y2NA 5HWTA 2ZQ8A 5FAQA 2XD1A 5FDHA 1G5UA 2V8CA 4I38A 1CI8A 3OPHA 4DN0A 3LGOA 2JKRM 3EOIA 4NXGA 1M40A 3T4QA 1H8ZA 4IHQA 1GA0A 3D4FA 3VSKA 4EERA 1SKOA 5GL9A 3T4JA 3T1RA 4ZAMA 4O01A 4GZBA 3RXWA 3HLFA 5FEGA 1OTBA 3BFEA 2JCHA 4KZ9A 1YKDA 3GDIA 3W4QA 1J9MA 1XJ3A 5IU1A 2ZQAA 1K4FA 4K08A 2J9OA 2P9VA 3DWKA 4ARZB 5IS1A 5CHJA 1IELA 3G30A 4UA6A 4WL9A 1W63M 3E0YA 1IFQA 1SDNA 2A24A 1TS8A 1OT9A 3KSHA 4E3JA 3D3OA 1RP5A 3AGFA 3E4OA 4LV2A 4MLLA 4I3IA 4LFUA 2GX5A 4RYEA 3C4OA 4R4SA 4N9KA 5EVIB 1ZG6A 1K57A 1JTGA 1K4EA 3LFVA 1GHMA 4CLCA 3CPTA 4JGRA 5K5BA 3NOUC 3R7WA 2IA2A 2PU4A 2FZ0A 2J3TD 5AJGA 3S4XA 1W79A 5HDDA 5F1FA 1VHMA 3A0RA 4MBHA 3T4OA 4E3IA 3MMHA 3LR3A 1MY8A 3M2JA 4DRTA 3RXXA 3T1QB 2ZMFA 4IBRA 1Z09A 1NLZA 1Y28A 4B88A 4P6BA 4GS9B 2O99A 5HAIA 4WBGA 4CLCE 3RH8B 5GHYA 3HVFA 1BTLA 1Y4OA 4LRYC 2R9XA 1P0ZA 4AFIA 4XUXA 2BASA 2JKTI 3GRJA 1HLUP 4U3TA 1FR6A 3E4PA 3NI9A 4A5RA 1NLYA 1XP4A 3DTEA 5TBMB 3NCKA 1NZUA 4BBUA 2ACGA 1PWGA 1YLWA 2ZQ7A 3EQUA 4WM9A 3PXPA 1K55A 1FR1A 3MFDA 2J80A 1F2KA 2ZMAA 1XPBA 2V9AA 2Y4AA 3LR5A 4S2MA 3FG8A 3RJUA 3LIDA 4KZ6A 1H8YA 3B33A 1Z6FA 4Q0IA 2Y2GA 3GECA 1K0KA 3E98A 3SOIA 3IWQA 3O3VA 3WS1A 1PW1A 4QWOA 1PI4A 2WZXA 5FI2A 3Q81A 4S2JA 1KE4A 3LY3A 2AVXA 3EQVA 1IYPA 2WAFA 4S2NA 3AGEA 4KQQA 2UWXA 2B02A 1CEFA 1PIOA 2I9VA 3N8RA 2WGWA 1DP8A 1UWNX 2JKFA 5FQKA 3PBRA 4Y2FA 4KZBA 5DTTA 4FCFA 1H3QA 1N9BA 2EXAA 1L0GA 5HWVA 1P9WA 2QKPA 4NK3A 4O8GA 1JVJA 5E43A 1O07A 1SKOB 4EQ1A 4FH4A 3WRTA 1YSPA 4OP5A 1G28A 5AQ9A 2HF6A 4OQIA 2VGJA 5DKKA 3VSLA 1Y54A 4UHUA 1G68A 5HSQA 1T19A 4LCMA 4Q8IA 2P9VB 2WZZA 2QHKA 4GOGA 3OCLA 1NWZA 1YQSA 2J8YA 3C7UA 2PHYA 3IXHA 3EGDC 2HP6A 2A24B 1TF1A 3C7VA 2QWSA 4I39A 2EFXA 4NEED 4CLCD 1IEMA 4GB7A 3G2ZA 3QP5A 2INWA 2Y55A 1RGYA 3HUOA 3A3EA 5CTMA 2XGNA 5L10A 4HY8A 4EBLA 2VX8A 3IX4A 2XFTA 3KYZA 3IF6C 5TFQA 1S1YA 3NBLA 3MQ0A 4CLCB 1PI5A 4O7DA 3MFXA 3FYZA 3PAGA 3R7WB 3E2KA 1DJCA 1W63Q 1K6RA 4ME4A 1K38A 4U0TA 5A91A 1JTDA 2B18A 2ZC3B 2Y2JA 2ZBBA 1DY6A 3UPPA 1LSWA 3VOLA 4HBTA 2BLSA 2JE5A 1FSYA 3PBSA 1BYWA 2OAQ1 1ES2A 4NXBA 3MR0A 3MSHA 3Q7VA 1JNUA 1BUEA 1BZAA 3DTMA 5G4ZA 2JC7A 4EETB 1LT0A 4DE0A 3FC7A 3LI9A 4JBFA 3VP1A 4HOIA 4JGOA 2ZQCA 1G6AA 4P87A 3UY6A 5AVFA 3ITBA 4PM9A 4E6XA 4DMZA 2Q0OA 1H0MA 4OPYA 3T4KA 3CI6A 4UQIM 1I2WA 2J9PA 1IKGA 4ARZA 4LPZA 4BL2A 1P97A 5CGWA 3M2KA 1W8QA 3G4PA 3BM6A 3V67A 4Y3IA 1VETA 3NOTC 5F5YA 3MQOA 3Q1FA 5G4YA 3LIFA 5HDCA 2W3GA 3GMWA 1MWTA 3UNWA 4N1XA 5KIZA 4UA9A 3O5YA 1V9YA 3HLCA 4KQDA 1TS6A 3HUNA 4DXCA 5EVIA 1GSXA 3MF0A 2QJ5A 1BT5A 1LI9A 5FASA 1LL9A 4N1HA 4K0WA 1FSWA 5J8XA 2VGLS 2Q9NA 2ZM0A 5E2GA 1WYBA 1YLPA 5CGXA 2JHEA 3F1OA 2E8JA 2WGWB 2PDRA 4R38A 3ZVWA 2ZOHA 3OZHA 4B4XA 3T4LA 1S66L 4S2OA 3G34A 3V39A 1ACFA 3D9YA 3IXGA 3TW8A 2PD7A 1L3LA 4WEKA 2O9CA 3SS5A 3F1PA 5A93A 3WRZA 4X6TA 5FI7A 4Y7PA 1OTAA 5CERA 3ICYA 4ZJ1A 5DFXA 4E3LA 3C4PA 5AQAA 3P01A 1UWPX 1KDWA 1EW0A 1PW8A 4NETA 4ETXA 4Q0JA 1BULA 5CEDA 4NXFA 1CEGA 2ZQ9A 3N7WA 5I94A 1AWIA 1PWCA 2VLGA 2ZL1A 3PBNA 4OLGA 4NKPA 3ITAA 5LBRA 4WMCA 2WGIA 1K25A 4KENB 1NRJA 5F69A 3NIAA 1ALQA 2O0YA 5F1GA 3O88A 1GA9A 4EXOA 2P04A 1QMFA 3UN7A 4EUVA 3HCYA 4QU3A 1XGIA 2WYXA 3OPRA 4R3JA 2FFYA 2V1AA 3S7OA 5HW3A 4F94A 5EVEA 3W4PA 4M3KA 3UE1A 2I72A 3PBQA 1IKIA 5AVEA 4QJGA 1KGEA 2XLNA 3QP2A 5IT5A 3IQAA 4JF6A 2GNXA 4Z1WA 5CECA 4MN5A 3IWOA 3WS0A 5HPFA 3BFFA 5CXWA 1ESIA 2K7SA 3LIBA 1NXYA 3S22A 4Y0TA 2JKGA 3WS2A 3VE3A 3IF5A 2Y59A 4PM5A 2BG1A 3Q7VB 3CZDA 4WZ5A 1OTDA 2X71A 4OOMA 3SH8A 3UE3A 3D72A 3DW0A 5FAOA 2CMNA 2LB9A 5A90A 4WLAA 2Z2MB 2V0UA 3WWXA 1E3UA 4DE3A 2PU2A 4LCLA 4K0XA 3HUMA 5J7EA 2HPBA 2B95A 5GLBA 4EUZA 4UA7A 4JXVA 5JYPA 1Q2QA 2ZC7A 1MZUA 2HP5A 1XFQA 3GVBA 2HJEA 3HLDA 2ZOIA 4GN2A 5EVID 4ZDXA 5DKLA 3RTYA 2Z6DA 3T12B 1KE3A 1VETB 3CWFA 4ESPA 4YNRA 3HREA 4B9OA 1TS7A 3HJKA 1YLJA 4KG2A 4OKPA 1ZHHB 4DKIA 5AQBA 3LI8A 3FWLA 1MXOA 3OBFA 3T1SA 1YLTA 3A3FA 2ZQDA 3A0VA 4PHTA 4N9LA 5CX7A 3B47A 1JWZA 2LB5A 5GLDA 1DP9A 3F1OB 4Y0OA 2Z6CA 4KG5A 2VZWA 5M19A 2Q9MA 2XRNA 1S4SA 1FCNA 2QZ6A 3QP4A 4OQHA 5DF9A 3TG9A 3CG5A 3BECA 1KGGA 2J3WA 2M1CA 4P85A 5FDSA 4C75A 3DTKA 3JVUA 3F1PB 3OPPA 2OV5A 2EWVA 4S2PA 3UPOA 2QJ7A 1HVBA 5HZHA 4C6YA 4E3OA 5KZHA 4PPRA 4G3KA 5MC7A 3E4QA 4YFMA 5HL6A 4LENA 1HD8A 3BYDA 3G2YA 2EWWA 1U60A 2J3TC 3KX0X 1YSQA 3MQQA 1S4RA 1BLPA 4H6JA 3O87A 5L8MA 2ZL1B 3UE6A 1OJGA 1K56A 4FSFA 4MN7A 3TE8A 2OWHA 2HDUA 1KDSA 1RGZA 4EU0A 1I2SA 4LV3A 1MKMA 2WKIA 3HLBA 3GSGA 1DJAA 3DAVA 4X55A 2PYRA 4HI4A 3NHQA 1LSXA 1X0OA 3EEAA 3KYEA 3FPWA 2KDKA 5U47A 4EQIA 3CUEC 3SH9A 2Y91A 3LCEA 3H7WA 3UMEA 2OWJA 4II7A 2A49A 3ZGAB 2W3DA 3S1YA 1K54C 3KSIA 3HJIA 3OC2A 1D1JA 2C6WB 2JKTM 3ZNTA 1D7EA 2GZAA 1ZTUA 2Y2PA 1CF0A 3PBOA 3IHAA 1NY0A 2P74A 3VFFA 1KVMA 2Y2HA 3JVVA 2XF3A 3S7PA 2C5WB 3UB5P 5EM0A 2PRFA 5A8BA 2V20A 5CRFA 2UV0E 5EPHA 1NRFA 3CAXA 3P98A 5EM1A 3BY9A 3T50A 4L9EA 5FL3A 3VP3A 4CQHA 2ZD8A 3SS4A 4BMWA 4Y17A 4ZRRA 2DCFA 2ZJ9A 3ZFZA 1MWRA 5E2HA 1BSGA 3MZFA 4IVIA 2FFFB 4WUJA 4DE1A 2WKPA 1NYYA 1EI5A 4ID4A 2ZC5B 2HJ9C 4WZ4A 1S0WA 2V8FA 2Z2LB 1NYMA 3MKFA 1LLBA 4KG6A 1FIKA 4FH2A 5HARA 5TR7A 1P9RA 2XA7M 1DRMA 3B42A 2KX6A 3CITA 1LHYA 5GHXA 1LI0A 1OPXA 3PAEA 4E3NA 2QPNA 2Y79A 3ZG5A 1TD5A 3W8KA 3ZCZA 1JWVA 3QP1A 5FQQA 3FPVA 1KVLA 5EOEA 3LYXA 4R4RA 3HL9A 1OMEA 3AGDA 1E4DA 1MKIA 4P6ZM 4E3KA 4IUHA 5F6AA 4DF6A 2Y2MA 5HL1A 1CJFA 3LEZA 2PBYA 4CLCC 4OLDA 2HZ5A 3UO9A 1YLZA 2EX8A 4HJ6A 4OQ0A 2D01A 2PYPA 1YLYA 2WKHA 3ZVTA 3JYIA 3MS6A 3SZTA 4GDNA 2X02A 3GV9A 2EA9A 4HBUA 2OSUA 5KSHA 3MJQA 5F68A 1TDLA 3BQAA 5CHMA 1ODVA 3H82B 4N92A 5FI6A 2E8IA 1N4OA 4H6JB 3K3DA 4BENA 1IYQA 5J4EA 4DDYA 4QPRA 1FCOA 1T18A 1CK3A 3MKEA 2Y2IA 2GJ3A 3IBRA 4PMAA 4OOLA 2RCXA 5GLAA 4XT2B 3A3DA 4OPZA 4GHIA 2DRWA 4WYYA 5HFOA 2WGVA 2G7UA 1ONGA 1D06A 4Y13A 2YKFA 4JXWA 2H0TA 2EX9A 3ZHHA 3H7WB 2VGKA 4GCZA 1BLSA 4U0XA 1HZOA 4GJ4A 4I3AA 4X25A 1TVFA 1FILA 1K55C 1W7FA 1XKZA 3DWZA 1SHVA 4MEZA 2W1TA 4E04A 1XGJA 3NULA 4MBFA 3MXSA 4ZJ2A 5F82A 4OOYA 4ZTKA 1SZVA 4YINA 1S1ZA 1NZOA 2JN7A 5EECA 3IT9A 4G3WA 5HPIA 4LGWA 4MN6A
chains in the Genus database with same CATH topology
2BASA 1KOUA 2JKTI 4I5SA 3UE3A 3D72A 2OOLA 1GSVA 3E4PA 2CMNA 2L0WA 2LB9A 3OCNA 1NLYA 3VE4A 5TBMB 4L9GA 4WLAA 4BBUA 2V0UA 4KUKA 4PKYG 1STZA 5J7EA 2ZMVA 3EQUA 4HJ4A 3PXPA 2J80A 2O9BA 2W27A 1OTEA 2V9AA 3LR5A 4HHDA 3FG8A 3EEHA 1MZUA 1XFQA 2HJEA 2MJ6A 2ZOIA 3LIDA 1N9NA 3B33A 5DKLA 3RTYA 3EGXC 2Z6DA 4LLOB 4LRZE 3CWFA 4Q0IA 4EESA 3GECA 3E98A 4YNRA 2O9AA 4B9OA 1TS7A 3PYPA 2P7JA 4GLQA 3LR4A 3HJKA 1ZHHB 3UB8A 1TS0A 3LI8A 2L4RA 3ZQ5A 2W0NA 1VB6A 3OBFA 1UGUA 4KQOA 1IOUA 3EQVA 3TJZC 4F3LB 2WKRA 4WN5A 3A0VA 3RFBA 2B02A 2I9VA 4WELA 4PHTA 4BWIA 1DP8A 5CX7A 3B47A 1UWNX 3PBRA 3K3CA 4Y2FA 4EEUA 2LB5A 4Q0HA 4JGQA 4BBVA 3BW6A 2PR5A 4JGPA 1DP9A 3F1NA 4BBTA 2R78A 4KUOA 2DMWA 1H3QA 3F1OB 3CUEA 4LRXC 2Z6CA 3S7NA 2VZWA 4HIAA 2KOIA 2XRNA 5HWVA 1P9WA 2QKPA 3LICA 3LR0A 3ZYTA 1S4SA 2P08A 5DF9A 4O8GA 2V0WA 2J3WA 2M1CA 2HV1A 5DFYA 4EQ1A 3T4SA 1YSPA 5I5LA 1XJ4A 1G28A 3JVUA 2HF6A 2A2LA 3F1PB 4NXEA 3S7QA 2EWVA 4L9FA 4UQIS 5DKKA 4HNBA 2QJ7A 5HSQA 2W3HA 1T19A 3UB9A 5HZHA 4PAUA 2QHKA 4G3KA 5MC7A 4HH2A 3UB6A 3E4QA 5HL6A 3OCLA 1NWZA 2EWWA 3IS2A 2J3TC 3KX0X 1N9OA 1N9LA 1YSQA 2PHYA 3MQQA 4YOFA 4EEPA 3EGDC 2A24B 1S4RA 2FH5A 2QYBA 2M7VA 1TF1A 2QWSA 4H6JA 5L8MA 4I3JA 3BWLA 5TJJA 3UE6A 4I39A 1F5MA 3UMDA 1OJGA 4NEED 2XROA 2VV8A 4FSFA 2YKHA 2XA7S 4MN7A 4CLCD 3TE8A 2OWHA 2INWA 4EU0A 1F98A 1MKMA 3KO6A 2PYRA 4HI4A 3NHQA 1LSXA 1X0OA 3CLOA 3EEAA 4RQ9A 3FPWA 2KDKA 4HY8A 4PKYA 4WF0A 2VX8A 2VEAA 2WKQA 3C30A 3CUEC 4GW9A 4UEYA 4ETZA 3KYZA 3H7WA 3C8CA 3KYQA 3UMEA 1S1YA 3MQ0A 3F1NB 4CLCB 1WA9A 3MFXA 2OWJA 4II7A 4GHIB 3NOPC 1MC0A 3R7WB 4HH3A 1W63Q 2W3DA 2PT7A 4ME4A 4HQAA 3KSIA 2B18A 2ZBBA 4R3AA 3HJIA 1LSWA 4P6ZS 3VOLA 3DBAA 4MCWA 4HP4A 3G6OA 3A0SA 3OC2A 2H28A 2V1BA 2JKTM 4BJPA 1D7EA 3PBSA 1BYWA 2OAQ1 5HD3A 2GZAA 3SW1A 3C2WA 3U2AA 4GS9A 1OTDA 1ZTUA 4NXBA 1V9ZA 2W1TB 2PD8A 3VV4A 3MR0A 3PBOA 1JNUA 4G3VA 2Y8HA 3ULFA 3KSGA 5G4ZA 4B93A 5DJUA 4IUKA 4EETB 1LT0A 4Y5FA 3H9WA 3JVVA 2NUPC 4DJ3A 5HD5A 3FC7A 3S7PA 3LI9A 4M4XA 4MMNA 2HGVA 4HOIA 4JGOA 5A8BA 3P7NA 5EFWA 5TBMA 3CAXA 3BY9A 5AVFA 3KSFA 2VJWA 3UB7A 3LUQA 2D02A 3T50A 4L0LA 4DMZA 4L9EA 3EWKA 4R6LA 5J3WA 5FL3A 3T4KA 1LSVA 3PHYA 3CI6A 4CQHA 2VKSA 4UQIM 1T1CA 4YWZA 4BMWA 4ZRRA 4ARZA 4MDZA 2M7UA 2VA0A 4LPZA 1P97A 3C38A 4WUJA 2WKPA 3V67A 2JKRI 4Y3IA 4FOFA 3NOTC 5F5YA 3MQOA 2K2NA 5G4YA 3LIFA 5HDCA 2W3GA 1GSWA 2HJ9C 5KIZA 2NUTC 3H82A 2W3EA 1OJ5A 3O5YA 1V9YA 4KQDA 1P9RA 1TS6A 2XA7M 4F3LA 1DRMA 3B42A 4IJGA 4WEJA 2KX6A 1GSXA 2VV7A 3CITA 2QJ5A 3MF0A 2W3FA 1OTIA 3T4TA 4R70A 4HJ3A 2XSSA 1T1AA 3TRCA 1XFNA 1OPXA 2VGLS 4EW7A 3PR6A 2VV6A 4XT2A 1LL8A 5HWTA 2JHEA 3F1OA 1XJ6A 2Y79A 1TD5A 2PDRA 4R38A 3FPVA 4I38A 4DN0A 2JKRM 3EOIA 3LYXA 2ZOHA 4NXGA 3T4QA 5C5KA 3T4LA 1S66L 4IHQA 1G6OA 4EERA 3T4JA 2L1MA 3OOVA 3TW8A 2PD7A 4O01A 4WEKA 2O9CA 3BJNA 3F1PA 4P6ZM 4IUHA 5F6AA 1OTBA 3LIAA 3W2ZA 3LIEA 1YKDA 3GDIA 1OTAA 4CLCC 3ICYA 3R4KA 1F9IA 1S67L 1XJ3A 5IU1A 5DFXA 4K08A 1DP6A 4HJ6A 2K31A 3P01A 4ARZB 1UWPX 2D01A 2PYPA 5IS1A 1EW0A 3NJAA 4WL9A 4ETXA 1W63M 4Q0JA 3E0YA 1IFQA 2A24A 4NXFA 1TS8A 3BQ8A 1OT9A 3OLOA 3KSHA 3MXQA 3PBTA 3D3OA 2VLGA 2EA9A 1OT6A 3PBNA 3K2NA 3E4OA 5KSHA 4NKPA 3IS2B 3MJQA 5LBRA 5F68A 1YAXA 3BQAA 1NRJA 5F69A 1ODVA 2O0YA 3H82B 4I3IA 2GX5A 4H6JB 4EXOA 2P04A 3K3DA 5J4EA 4QPRA 4EUVA 1T18A 3HCYA 4O0PA 2GJ3A 2V1AA 3S7OA 1H8MA 3IBRA 3LFVA 4OOLA 4CLCA 4XT2B 4JGRA 5K5BA 4GHIA 3NOUC 3R7WA 2IA2A 2FZ0A 2G7UA 2J3TD 5DJTA 5AJGA 1D06A 2YKFA 2W1RA 3PBQA 5HDDA 1VHMA 3A0RA 5AVEA 3H7WB 1T1BA 2KLIA 4GCZA 3T4OA 3MMHA 4GJ4A 4I3AA 4HP9A 3LR3A 3IBJA 5IT5A 2ZMFA 3BY8A 2GNXA 2W1TA 4DJ2A 4Z1WA 1NLZA 4MN5A 1Y28A 4E04A 2PR6A 5HPFA 5HWWA 2VGLM 2K7SA 3LIBA 4GS9B 2O99A 1XJ2A 4CLCE 3RH8B 1S1ZA 5HDSA 3VE3A 2JN7A 4G3WA 4LRYC 5HPIA 1P0ZA 4AFIA 2OAP1 4MN6A 4OOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOL A;  5HSQ A;  2W3H A;  4PAU A;  4ETX A;  2LB9 A;  2VJW A;  3KSF A;  4Q0J A;  4G3K A;  5HL6 A;  3E0Y A;  4DMZ A;  4R6L A;  3KSH A;  1STZ A;  3D3O A;  4CQH A;  1YSQ A;  3CI6 A;  2VKS A;  4YOF A;  3K2N A;  4ZRR A;  2QYB A;  4MDZ A;  2M7V A;  2M7U A;  1TF1 A;  5L8M A;  5LBR A;  2O9B A;  2O0Y A;  5TJJ A;  1F5M A;  2XRO A;  2GX5 A;  4MN7 A;  4QPR A;  4EUV A;  4Y3I A;  4FOF A;  3NOT C;  3HCY A;  2K2N A;  4O0P A;  4EU0 A;  2W3G A;  1MKM A;  3KO6 A;  4LRZ E;  3S7O A;  4Q0I A;  3IBR A;  4YNR A;  3E98 A;  3LFV A;  2O9A A;  3NHQ A;  3EEA A;  4GLQ A;  4RQ9 A;  2W3E A;  3O5Y A;  5K5B A;  2VEA A;  3NOU C;  4GW9 A;  4ETZ A;  2IA2 A;  4IJG A;  2G7U A;  3ZQ5 A;  3CIT A;  3MF0 A;  3MQ0 A;  5AJG A;  2W3F A;  3OBF A;  2W1R A;  4R70 A;  3NOP C;  1MC0 A;  1VHM A;  2W3D A;  2KLI A;  2XSS A;  4ME4 A;  3RFB A;  3TRC A;  3MMH A;  3KSI A;  2B18 A;  4BWI A;  3IBJ A;  3DBA A;  4MCW A;  3G6O A;  4Y2F A;  2LB5 A;  4Q0H A;  2Y79 A;  2ZMF A;  1TD5 A;  2W1T A;  4Z1W A;  4DN0 A;  3C2W A;  4E04 A;  4LRX C;  3S7N A;  1ZTU A;  5C5K A;  5HPF A;  2VZW A;  2W1T B;  2KOI A;  2XRN A;  3VV4 A;  3OOV A;  2O99 A;  4G3V A;  2Y8H A;  3KSG A;  4O8G A;  4O01 A;  2O9C A;  3BJN A;  4IUH A;  4IUK A;  5DFY A;  4Y5F A;  3W2Z A;  1YKD A;  4G3W A;  4LRY C;  1YSP A;  3R4K A;  5I5L A;  3S7P A;  5HPI A;  3S7Q A;  5DFX A;  4MMN A;  2K31 A;  2HGV A; 
#chains in the Genus database with same CATH topology
 3MXR A;  1KOU A;  4I5S A;  2ZC4 B;  4OVD A;  4EBN A;  2OOL A;  1KGF A;  4S2I A;  2L0W A;  3UDI A;  3IWI A;  3OCN A;  3VE4 A;  4QB8 A;  1FQG A;  2G2U A;  3QNB A;  1LL5 A;  1VEU B;  4PKY G;  1STZ A;  4S2K A;  2ZMV A;  5EV0 A;  4HJ4 A;  5A92 A;  2W27 A;  3GQZ A;  1OTE A;  1CI9 A;  2XFS A;  4X69 A;  4GDB A;  3WS4 A;  2MJ6 A;  1PZO A;  1N9N A;  3V3S A;  3UE0 A;  3EGX C;  4LLO B;  5DVA A;  1IYS A;  4X1M A;  3PYP A;  4P0M A;  2P7J A;  5FA7 A;  3FV7 A;  4GLQ A;  1M6K A;  1W5D A;  3LR4 A;  3NDE A;  5FAP A;  2L4R A;  4FTX A;  3ZQ5 A;  2W0N A;  3Q07 A;  1UGU A;  1IOU A;  3TJZ C;  2WKR A;  5AQ7 A;  4WN5 A;  3RFB A;  4HES A;  4WEL A;  4BWI A;  4OP8 A;  3K3C A;  4EEU A;  4Q0H A;  4BBV A;  4BD1 A;  2PR5 A;  1PFL A;  1YM1 A;  4BBT A;  2R78 A;  4KUO A;  2DMW A;  3CUE A;  4LRX C;  3S7N A;  2KOI A;  3LR0 A;  3LIC A;  3ZYT A;  5EUA A;  5CTN A;  2V0W A;  5M18 A;  4RX2 A;  4GKU A;  4CPK A;  5I5L A;  3C5A A;  3MZD A;  2IWC A;  3S7Q A;  4L9F A;  4UQI S;  4E6W A;  3G32 A;  3M6B A;  3IHB A;  2B5R A;  2EXB A;  3UB9 A;  3ZG8 B;  4PAU A;  3BFC A;  3UB6 A;  3VP2 A;  5E2F A;  3BLS A;  3IS2 A;  4S2L A;  3VFH A;  1N9O A;  1N9L A;  1SKF A;  4YOF A;  4EEP A;  1SDE A;  4I3J A;  3BWL A;  5TJJ A;  3UMD A;  1F5M A;  3PTE A;  2YKH A;  1VQQ A;  3IX3 A;  2ZLY A;  4MBK A;  3Q7Z A;  3HLE A;  1F98 A;  3KO6 A;  4QHC A;  3IH9 A;  4RQ9 A;  3BLM A;  4WF0 A;  5JYO A;  2VEA A;  2WKQ A;  1ZG4 A;  4GW9 A;  3QHY A;  3G31 A;  5FQ9 A;  3F1N B;  1WA9 A;  3IX8 A;  2H0Y A;  4GHI B;  3NOP C;  5CHU A;  4HH3 A;  2PT7 A;  4KZA A;  2VK3 A;  3QP8 A;  5CEB A;  4HQA A;  4MNR A;  2X01 A;  5L07 A;  4R3A A;  4HP4 A;  4DXB A;  2H28 A;  2V1B A;  4BJP A;  4R3B A;  5HD3 A;  4OPQ A;  2XDM A;  2W1T B;  4OPR A;  3VV4 A;  4RVA A;  4G3V A;  1DJB A;  5DJU A;  4IUK A;  5GHZ A;  4KQR A;  4JXS A;  2NUP C;  5HD5 A;  4DJ3 A;  4M4X A;  3IXD A;  2ZC6 B;  5EVI C;  2HGV A;  1ERQ A;  3LO7 A;  4BQM A;  5EFW A;  5DTK A;  2EFU A;  3KSF A;  3IF6 A;  3UB7 A;  1JWP A;  3VOZ A;  4KZ3 A;  4L0L A;  4LV1 A;  4E3M A;  2XQZ A;  1LSV A;  3PHY A;  3LEQ A;  3TOI A;  4OH0 A;  2WK0 A;  2M7U A;  3NEC A;  2VA0 A;  3Q82 A;  2EX6 A;  3U4L P;  3NDG A;  3C38 A;  2Y2O A;  3CJM A;  4KZ7 A;  5GLC A;  1ZC2 A;  3IXB A;  4Y0U A;  4FOF A;  4WMC D;  5FEF A;  1PZP A;  2K2N A;  1L0E A;  1ES5 A;  1E25 A;  2NUT C;  3H82 A;  1OJ5 A;  4BLM A;  4ZBE A;  3MBZ A;  4F3L A;  4IJG A;  4PM8 A;  4WEJ A;  4QY5 A;  2W3F A;  3T4T A;  4R70 A;  4XUZ A;  5TGF A;  3TRC A;  5G18 A;  4EW7 A;  4KZ5 A;  5F83 A;  4XT2 A;  1LL8 A;  4OON A;  3FKW A;  1XJ6 A;  1ERM A;  4NG2 A;  3VOY A;  4R23 A;  5C5K A;  1G6O A;  3BFD A;  4RA7 A;  2L1M A;  3OOV A;  2H5S A;  5D3O A;  3BJN A;  3LIA A;  4IBX A;  3LIE A;  3W2Z A;  3G35 A;  1I5Q A;  1TEM A;  3R4K A;  4XXR A;  1F9I A;  1S67 L;  5EOO A;  2RL3 A;  1DP6 A;  2K31 A;  4JF4 A;  2HDR A;  3NJA A;  1L0D A;  1RCJ A;  4KZ4 A;  3ZG9 B;  2R9W A;  3BQ8 A;  4EWF A;  2WAE A;  3OLO A;  1L0F A;  3MXQ A;  3PBT A;  1OT6 A;  3K2N A;  2OLU A;  2QMI A;  3NC8 A;  3GR2 A;  3IS2 B;  4RX3 A;  3ZDJ A;  1E3U D;  1YAX A;  1MWU A;  1KE0 A;  3P09 A;  5HX9 A;  4BL3 A;  3CHW P;  1WYC A;  1VEU A;  3ZNY A;  2OLV A;  3UDX A;  4O0P A;  4JPM A;  4WZ5 C;  1H8M A;  5EE8 A;  4JF5 A;  4DDS A;  2V1Z A;  3L7H A;  1TDG A;  3V5M A;  5DJT A;  1XXM A;  2W1R A;  1T1B A;  2KLI A;  1YT4 A;  4FD8 A;  1XA1 A;  4R1G A;  4HP9 A;  5HAP A;  3GTC A;  3IBJ A;  4DE2 A;  3BY8 A;  4DJ2 A;  3M6H A;  2PR6 A;  4R0Q A;  1MPL A;  2XK1 A;  5HWW A;  2VGL M;  1XJ2 A;  3A3I A;  3N8S A;  5HDS A;  1ESU A;  5HAQ A;  1Q2P A;  3QP6 A;  4C3Q A;  2V2F F;  2Y2Q A;  2OAP 1;  1C3B A;  1A0K A;  4KZ8 A;  1GSV A;  4Z9Q A;  1K57 C;  5DF8 A;  4L9G A;  5CGS A;  3ISG A;  1QME A;  4KUK A;  3IF6 B;  3IH8 A;  4B4Z A;  3A3J A;  2HDQ A;  1YMX A;  4D2O A;  3BFG A;  1YMS A;  1O7E A;  2O9B A;  1BLC A;  1EWZ A;  1WE4 A;  4CJN A;  1PYY A;  3CPT B;  4HHD A;  3FKV A;  3EEH A;  4LV0 A;  1GHI A;  2XH9 A;  3LY4 A;  1K6S A;  2A3U A;  3O86 A;  2PAV P;  4LRZ E;  1K56 D;  4H8R A;  5KMW A;  4EES A;  1FOF A;  1W8Y A;  2HDS A;  3ZG7 B;  1PWD A;  2O9A A;  3DTI A;  1GHP A;  5L2F A;  3UB8 A;  1TS0 A;  5IHV A;  1SCW A;  1VB6 A;  4KQO A;  2CC1 A;  4F3L B;  3UPN A;  4X53 A;  2ZM2 A;  4GD8 A;  4HEF A;  4IED A;  2WAD A;  4JGQ A;  3BW6 A;  5FQI A;  4JGP A;  5E2E A;  3F1N A;  5L09 A;  2EX2 A;  4HIA A;  3BRM A;  4PM7 A;  2P08 A;  1ERO A;  4D60 A;  1ES3 A;  2HV1 A;  1CQA A;  5DFY A;  2WUQ A;  3T4S A;  3N6I A;  1XJ4 A;  3VMA A;  3N8L A;  2A2L A;  3N4I A;  4NXE A;  3VP0 A;  3L9K A;  2G2W A;  4HNB A;  3FZC A;  4QY6 A;  3VP4 A;  1J3W A;  4JLF A;  4K91 A;  2W3H A;  3OPL A;  5FQM A;  1L2S A;  4HH2 A;  2XEP A;  3BEB A;  4UAA A;  1S6R A;  2FH5 A;  4GNU A;  2QYB A;  2M7V A;  4IVK A;  2H10 A;  4X68 A;  5DF7 A;  2XRO A;  2VV8 A;  1NJ4 A;  3E2L A;  2XA7 S;  1PRQ A;  4S2N C;  3HLG A;  5KSC A;  3QNC A;  1ES4 A;  2XD5 A;  4X56 A;  3SH7 A;  3WS5 A;  1FCM A;  3HBR A;  3CLO A;  1VM1 A;  4PKY A;  3V3R A;  2Y2L A;  3C30 A;  4UEY A;  4ETZ A;  3C8C A;  1MWS A;  3KYQ A;  2JBF A;  2Y2K A;  5DTS A;  1MC0 A;  2GDN A;  4EV4 A;  3B3X A;  4Y15 A;  1MBL A;  3MZE A;  4P6Z S;  3DBA A;  4MCW A;  3G6O A;  3A0S A;  3V50 A;  1XX2 A;  3CMZ A;  1AXB A;  4PM6 A;  4OQG A;  3C2W A;  3U2A A;  4GS9 A;  5EVL A;  3SW1 A;  5FSR A;  1V9Z A;  3TSG A;  2PD8 A;  2PBD P;  3ULF A;  2Y8H A;  3KSG A;  4JXG A;  4B93 A;  2XR0 A;  3UDF A;  4Y5F A;  3H9W A;  2HP9 A;  4X1L A;  4MMN A;  3P7N A;  5TBM A;  5M1A A;  2WKE A;  4GD6 A;  1ZKJ A;  1PNE A;  2VJW A;  4FUW A;  3LUQ A;  2D02 A;  3EWK A;  4R6L A;  1H5X A;  5FQJ A;  5J3W A;  1XA7 A;  2VKS A;  1T1C A;  1K54 A;  4YWZ A;  2IWD A;  4MDZ A;  3HLW A;  3W4O A;  4JKT A;  3ZG0 A;  1BLH A;  2BTF P;  2JKR I;  3JPU A;  5BOH A;  1GSW A;  4QD4 A;  4BD0 A;  2IWB A;  3I7J A;  4EBP A;  1GCE A;  2ZM8 A;  2DNS A;  2W3E A;  3T1X A;  2J7V A;  1IYO A;  4ZJ3 A;  1YPR A;  2VV7 A;  3NY4 A;  3SS3 A;  1OTI A;  5FAT A;  4HJ3 A;  2XSS A;  1T1A A;  1XFN A;  1ONH A;  3PR6 A;  2VV6 A;  1HTZ A;  2Y2N A;  5HWT A;  2ZQ8 A;  5FAQ A;  2XD1 A;  5FDH A;  1G5U A;  2V8C A;  4I38 A;  1CI8 A;  3OPH A;  4DN0 A;  3LGO A;  2JKR M;  3EOI A;  4NXG A;  1M40 A;  3T4Q A;  1H8Z A;  4IHQ A;  1GA0 A;  3D4F A;  3VSK A;  4EER A;  1SKO A;  5GL9 A;  3T4J A;  3T1R A;  4ZAM A;  4O01 A;  4GZB A;  3RXW A;  3HLF A;  5FEG A;  1OTB A;  3BFE A;  2JCH A;  4KZ9 A;  1YKD A;  3GDI A;  3W4Q A;  1J9M A;  1XJ3 A;  5IU1 A;  2ZQA A;  1K4F A;  4K08 A;  2J9O A;  2P9V A;  3DWK A;  4ARZ B;  5IS1 A;  5CHJ A;  1IEL A;  3G30 A;  4UA6 A;  4WL9 A;  1W63 M;  3E0Y A;  1IFQ A;  1SDN A;  2A24 A;  1TS8 A;  1OT9 A;  3KSH A;  4E3J A;  3D3O A;  1RP5 A;  3AGF A;  3E4O A;  4LV2 A;  4MLL A;  4I3I A;  4LFU A;  2GX5 A;  4RYE A;  3C4O A;  4R4S A;  4N9K A;  5EVI B;  1ZG6 A;  1K57 A;  1JTG A;  1K4E A;  3LFV A;  1GHM A;  4CLC A;  3CPT A;  4JGR A;  5K5B A;  3NOU C;  3R7W A;  2IA2 A;  2PU4 A;  2FZ0 A;  2J3T D;  5AJG A;  3S4X A;  1W79 A;  5HDD A;  5F1F A;  1VHM A;  3A0R A;  4MBH A;  3T4O A;  4E3I A;  3MMH A;  3LR3 A;  1MY8 A;  3M2J A;  4DRT A;  3RXX A;  3T1Q B;  2ZMF A;  4IBR A;  1Z09 A;  1NLZ A;  1Y28 A;  4B88 A;  4P6B A;  4GS9 B;  2O99 A;  5HAI A;  4WBG A;  4CLC E;  3RH8 B;  5GHY A;  3HVF A;  1BTL A;  1Y4O A;  4LRY C;  2R9X A;  1P0Z A;  4AFI A;  4XUX A;  2BAS A;  2JKT I;  3GRJ A;  1HLU P;  4U3T A;  1FR6 A;  3E4P A;  3NI9 A;  4A5R A;  1NLY A;  1XP4 A;  3DTE A;  5TBM B;  3NCK A;  1NZU A;  4BBU A;  2ACG A;  1PWG A;  1YLW A;  2ZQ7 A;  3EQU A;  4WM9 A;  3PXP A;  1K55 A;  1FR1 A;  3MFD A;  2J80 A;  1F2K A;  2ZMA A;  1XPB A;  2V9A A;  2Y4A A;  3LR5 A;  4S2M A;  3FG8 A;  3RJU A;  3LID A;  4KZ6 A;  1H8Y A;  3B33 A;  1Z6F A;  4Q0I A;  2Y2G A;  3GEC A;  1K0K A;  3E98 A;  3SOI A;  3IWQ A;  3O3V A;  3WS1 A;  1PW1 A;  4QWO A;  1PI4 A;  2WZX A;  5FI2 A;  3Q81 A;  4S2J A;  1KE4 A;  3LY3 A;  2AVX A;  3EQV A;  1IYP A;  2WAF A;  4S2N A;  3AGE A;  4KQQ A;  2UWX A;  2B02 A;  1CEF A;  1PIO A;  2I9V A;  3N8R A;  2WGW A;  1DP8 A;  1UWN X;  2JKF A;  5FQK A;  3PBR A;  4Y2F A;  4KZB A;  5DTT A;  4FCF A;  1H3Q A;  1N9B A;  2EXA A;  1L0G A;  5HWV A;  1P9W A;  2QKP A;  4NK3 A;  4O8G A;  1JVJ A;  5E43 A;  1O07 A;  1SKO B;  4EQ1 A;  4FH4 A;  3WRT A;  1YSP A;  4OP5 A;  1G28 A;  5AQ9 A;  2HF6 A;  4OQI A;  2VGJ A;  5DKK A;  3VSL A;  1Y54 A;  4UHU A;  1G68 A;  5HSQ A;  1T19 A;  4LCM A;  4Q8I A;  2P9V B;  2WZZ A;  2QHK A;  4GOG A;  3OCL A;  1NWZ A;  1YQS A;  2J8Y A;  3C7U A;  2PHY A;  3IXH A;  3EGD C;  2HP6 A;  2A24 B;  1TF1 A;  3C7V A;  2QWS A;  4I39 A;  2EFX A;  4NEE D;  4CLC D;  1IEM A;  4GB7 A;  3G2Z A;  3QP5 A;  2INW A;  2Y55 A;  1RGY A;  3HUO A;  3A3E A;  5CTM A;  2XGN A;  5L10 A;  4HY8 A;  4EBL A;  2VX8 A;  3IX4 A;  2XFT A;  3KYZ A;  3IF6 C;  5TFQ A;  1S1Y A;  3NBL A;  3MQ0 A;  4CLC B;  1PI5 A;  4O7D A;  3MFX A;  3FYZ A;  3PAG A;  3R7W B;  3E2K A;  1DJC A;  1W63 Q;  1K6R A;  4ME4 A;  1K38 A;  4U0T A;  5A91 A;  1JTD A;  2B18 A;  2ZC3 B;  2Y2J A;  2ZBB A;  1DY6 A;  3UPP A;  1LSW A;  3VOL A;  4HBT A;  2BLS A;  2JE5 A;  1FSY A;  3PBS A;  1BYW A;  2OAQ 1;  1ES2 A;  4NXB A;  3MR0 A;  3MSH A;  3Q7V A;  1JNU A;  1BUE A;  1BZA A;  3DTM A;  5G4Z A;  2JC7 A;  4EET B;  1LT0 A;  4DE0 A;  3FC7 A;  3LI9 A;  4JBF A;  3VP1 A;  4HOI A;  4JGO A;  2ZQC A;  1G6A A;  4P87 A;  3UY6 A;  5AVF A;  3ITB A;  4PM9 A;  4E6X A;  4DMZ A;  2Q0O A;  1H0M A;  4OPY A;  3T4K A;  3CI6 A;  4UQI M;  1I2W A;  2J9P A;  1IKG A;  4ARZ A;  4LPZ A;  4BL2 A;  1P97 A;  5CGW A;  3M2K A;  1W8Q A;  3G4P A;  3BM6 A;  3V67 A;  4Y3I A;  1VET A;  3NOT C;  5F5Y A;  3MQO A;  3Q1F A;  5G4Y A;  3LIF A;  5HDC A;  2W3G A;  3GMW A;  1MWT A;  3UNW A;  4N1X A;  5KIZ A;  4UA9 A;  3O5Y A;  1V9Y A;  3HLC A;  4KQD A;  1TS6 A;  3HUN A;  4DXC A;  5EVI A;  1GSX A;  3MF0 A;  2QJ5 A;  1BT5 A;  1LI9 A;  5FAS A;  1LL9 A;  4N1H A;  4K0W A;  1FSW A;  5J8X A;  2VGL S;  2Q9N A;  2ZM0 A;  5E2G A;  1WYB A;  1YLP A;  5CGX A;  2JHE A;  3F1O A;  2E8J A;  2WGW B;  2PDR A;  4R38 A;  3ZVW A;  2ZOH A;  3OZH A;  4B4X A;  3T4L A;  1S66 L;  4S2O A;  3G34 A;  3V39 A;  1ACF A;  3D9Y A;  3IXG A;  3TW8 A;  2PD7 A;  1L3L A;  4WEK A;  2O9C A;  3SS5 A;  3F1P A;  5A93 A;  3WRZ A;  4X6T A;  5FI7 A;  4Y7P A;  1OTA A;  5CER A;  3ICY A;  4ZJ1 A;  5DFX A;  4E3L A;  3C4P A;  5AQA A;  3P01 A;  1UWP X;  1KDW A;  1EW0 A;  1PW8 A;  4NET A;  4ETX A;  4Q0J A;  1BUL A;  5CED A;  4NXF A;  1CEG A;  2ZQ9 A;  3N7W A;  5I94 A;  1AWI A;  1PWC A;  2VLG A;  2ZL1 A;  3PBN A;  4OLG A;  4NKP A;  3ITA A;  5LBR A;  4WMC A;  2WGI A;  1K25 A;  4KEN B;  1NRJ A;  5F69 A;  3NIA A;  1ALQ A;  2O0Y A;  5F1G A;  3O88 A;  1GA9 A;  4EXO A;  2P04 A;  1QMF A;  3UN7 A;  4EUV A;  3HCY A;  4QU3 A;  1XGI A;  2WYX A;  3OPR A;  4R3J A;  2FFY A;  2V1A A;  3S7O A;  5HW3 A;  4F94 A;  5EVE A;  3W4P A;  4M3K A;  3UE1 A;  2I72 A;  3PBQ A;  1IKI A;  5AVE A;  4QJG A;  1KGE A;  2XLN A;  3QP2 A;  5IT5 A;  3IQA A;  4JF6 A;  2GNX A;  4Z1W A;  5CEC A;  4MN5 A;  3IWO A;  3WS0 A;  5HPF A;  3BFF A;  5CXW A;  1ESI A;  2K7S A;  3LIB A;  1NXY A;  3S22 A;  4Y0T A;  2JKG A;  3WS2 A;  3VE3 A;  3IF5 A;  2Y59 A;  4PM5 A;  2BG1 A;  3Q7V B;  3CZD A;  4WZ5 A;  1OTD A;  2X71 A;  4OOM A;  3SH8 A;  3UE3 A;  3D72 A;  3DW0 A;  5FAO A;  2CMN A;  2LB9 A;  5A90 A;  4WLA A;  2Z2M B;  2V0U A;  3WWX A;  1E3U A;  4DE3 A;  2PU2 A;  4LCL A;  4K0X A;  3HUM A;  5J7E A;  2HPB A;  2B95 A;  5GLB A;  4EUZ A;  4UA7 A;  4JXV A;  5JYP A;  1Q2Q A;  2ZC7 A;  1MZU A;  2HP5 A;  1XFQ A;  3GVB A;  2HJE A;  3HLD A;  2ZOI A;  4GN2 A;  5EVI D;  4ZDX A;  5DKL A;  3RTY A;  2Z6D A;  3T12 B;  1KE3 A;  1VET B;  3CWF A;  4ESP A;  4YNR A;  3HRE A;  4B9O A;  1TS7 A;  3HJK A;  1YLJ A;  4KG2 A;  4OKP A;  1ZHH B;  4DKI A;  5AQB A;  3LI8 A;  3FWL A;  1MXO A;  3OBF A;  3T1S A;  1YLT A;  3A3F A;  2ZQD A;  3A0V A;  4PHT A;  4N9L A;  5CX7 A;  3B47 A;  1JWZ A;  2LB5 A;  5GLD A;  1DP9 A;  3F1O B;  4Y0O A;  2Z6C A;  4KG5 A;  2VZW A;  5M19 A;  2Q9M A;  2XRN A;  1S4S A;  1FCN A;  2QZ6 A;  3QP4 A;  4OQH A;  5DF9 A;  3TG9 A;  3CG5 A;  3BEC A;  1KGG A;  2J3W A;  2M1C A;  4P85 A;  5FDS A;  4C75 A;  3DTK A;  3JVU A;  3F1P B;  3OPP A;  2OV5 A;  2EWV A;  4S2P A;  3UPO A;  2QJ7 A;  1HVB A;  5HZH A;  4C6Y A;  4E3O A;  5KZH A;  4PPR A;  4G3K A;  5MC7 A;  3E4Q A;  4YFM A;  5HL6 A;  4LEN A;  1HD8 A;  3BYD A;  3G2Y A;  2EWW A;  1U60 A;  2J3T C;  3KX0 X;  1YSQ A;  3MQQ A;  1S4R A;  1BLP A;  4H6J A;  3O87 A;  5L8M A;  2ZL1 B;  3UE6 A;  1OJG A;  1K56 A;  4FSF A;  4MN7 A;  3TE8 A;  2OWH A;  2HDU A;  1KDS A;  1RGZ A;  4EU0 A;  1I2S A;  4LV3 A;  1MKM A;  2WKI A;  3HLB A;  3GSG A;  1DJA A;  3DAV A;  4X55 A;  2PYR A;  4HI4 A;  3NHQ A;  1LSX A;  1X0O A;  3EEA A;  3KYE A;  3FPW A;  2KDK A;  5U47 A;  4EQI A;  3CUE C;  3SH9 A;  2Y91 A;  3LCE A;  3H7W A;  3UME A;  2OWJ A;  4II7 A;  2A49 A;  3ZGA B;  2W3D A;  3S1Y A;  1K54 C;  3KSI A;  3HJI A;  3OC2 A;  1D1J A;  2C6W B;  2JKT M;  3ZNT A;  1D7E A;  2GZA A;  1ZTU A;  2Y2P A;  1CF0 A;  3PBO A;  3IHA A;  1NY0 A;  2P74 A;  3VFF A;  1KVM A;  2Y2H A;  3JVV A;  2XF3 A;  3S7P A;  2C5W B;  3UB5 P;  5EM0 A;  2PRF A;  5A8B A;  2V20 A;  5CRF A;  2UV0 E;  5EPH A;  1NRF A;  3CAX A;  3P98 A;  5EM1 A;  3BY9 A;  3T50 A;  4L9E A;  5FL3 A;  3VP3 A;  4CQH A;  2ZD8 A;  3SS4 A;  4BMW A;  4Y17 A;  4ZRR A;  2DCF A;  2ZJ9 A;  3ZFZ A;  1MWR A;  5E2H A;  1BSG A;  3MZF A;  4IVI A;  2FFF B;  4WUJ A;  4DE1 A;  2WKP A;  1NYY A;  1EI5 A;  4ID4 A;  2ZC5 B;  2HJ9 C;  4WZ4 A;  1S0W A;  2V8F A;  2Z2L B;  1NYM A;  3MKF A;  1LLB A;  4KG6 A;  1FIK A;  4FH2 A;  5HAR A;  5TR7 A;  1P9R A;  2XA7 M;  1DRM A;  3B42 A;  2KX6 A;  3CIT A;  1LHY A;  5GHX A;  1LI0 A;  1OPX A;  3PAE A;  4E3N A;  2QPN A;  2Y79 A;  3ZG5 A;  1TD5 A;  3W8K A;  3ZCZ A;  1JWV A;  3QP1 A;  5FQQ A;  3FPV A;  1KVL A;  5EOE A;  3LYX A;  4R4R A;  3HL9 A;  1OME A;  3AGD A;  1E4D A;  1MKI A;  4P6Z M;  4E3K A;  4IUH A;  5F6A A;  4DF6 A;  2Y2M A;  5HL1 A;  1CJF A;  3LEZ A;  2PBY A;  4CLC C;  4OLD A;  2HZ5 A;  3UO9 A;  1YLZ A;  2EX8 A;  4HJ6 A;  4OQ0 A;  2D01 A;  2PYP A;  1YLY A;  2WKH A;  3ZVT A;  3JYI A;  3MS6 A;  3SZT A;  4GDN A;  2X02 A;  3GV9 A;  2EA9 A;  4HBU A;  2OSU A;  5KSH A;  3MJQ A;  5F68 A;  1TDL A;  3BQA A;  5CHM A;  1ODV A;  3H82 B;  4N92 A;  5FI6 A;  2E8I A;  1N4O A;  4H6J B;  3K3D A;  4BEN A;  1IYQ A;  5J4E A;  4DDY A;  4QPR A;  1FCO A;  1T18 A;  1CK3 A;  3MKE A;  2Y2I A;  2GJ3 A;  3IBR A;  4PMA A;  4OOL A;  2RCX A;  5GLA A;  4XT2 B;  3A3D A;  4OPZ A;  4GHI A;  2DRW A;  4WYY A;  5HFO A;  2WGV A;  2G7U A;  1ONG A;  1D06 A;  4Y13 A;  2YKF A;  4JXW A;  2H0T A;  2EX9 A;  3ZHH A;  3H7W B;  2VGK A;  4GCZ A;  1BLS A;  4U0X A;  1HZO A;  4GJ4 A;  4I3A A;  4X25 A;  1TVF A;  1FIL A;  1K55 C;  1W7F A;  1XKZ A;  3DWZ A;  1SHV A;  4MEZ A;  2W1T A;  4E04 A;  1XGJ A;  3NUL A;  4MBF A;  3MXS A;  4ZJ2 A;  5F82 A;  4OOY A;  4ZTK A;  1SZV A;  4YIN A;  1S1Z A;  1NZO A;  2JN7 A;  5EEC A;  3IT9 A;  4G3W A;  5HPI A;  4LGW A;  4MN6 A; 
#chains in the Genus database with same CATH homology
 2BAS A;  1KOU A;  2JKT I;  4I5S A;  3UE3 A;  3D72 A;  2OOL A;  1GSV A;  3E4P A;  2CMN A;  2L0W A;  2LB9 A;  3OCN A;  1NLY A;  3VE4 A;  5TBM B;  4L9G A;  4WLA A;  4BBU A;  2V0U A;  4KUK A;  4PKY G;  1STZ A;  5J7E A;  2ZMV A;  3EQU A;  4HJ4 A;  3PXP A;  2J80 A;  2O9B A;  2W27 A;  1OTE A;  2V9A A;  3LR5 A;  4HHD A;  3FG8 A;  3EEH A;  1MZU A;  1XFQ A;  2HJE A;  2MJ6 A;  2ZOI A;  3LID A;  1N9N A;  3B33 A;  5DKL A;  3RTY A;  3EGX C;  2Z6D A;  4LLO B;  4LRZ E;  3CWF A;  4Q0I A;  4EES A;  3GEC A;  3E98 A;  4YNR A;  2O9A A;  4B9O A;  1TS7 A;  3PYP A;  2P7J A;  4GLQ A;  3LR4 A;  3HJK A;  1ZHH B;  3UB8 A;  1TS0 A;  3LI8 A;  2L4R A;  3ZQ5 A;  2W0N A;  1VB6 A;  3OBF A;  1UGU A;  4KQO A;  1IOU A;  3EQV A;  3TJZ C;  4F3L B;  2WKR A;  4WN5 A;  3A0V A;  3RFB A;  2B02 A;  2I9V A;  4WEL A;  4PHT A;  4BWI A;  1DP8 A;  5CX7 A;  3B47 A;  1UWN X;  3PBR A;  3K3C A;  4Y2F A;  4EEU A;  2LB5 A;  4Q0H A;  4JGQ A;  4BBV A;  3BW6 A;  2PR5 A;  4JGP A;  1DP9 A;  3F1N A;  4BBT A;  2R78 A;  4KUO A;  2DMW A;  1H3Q A;  3F1O B;  3CUE A;  4LRX C;  2Z6C A;  3S7N A;  2VZW A;  4HIA A;  2KOI A;  2XRN A;  5HWV A;  1P9W A;  2QKP A;  3LIC A;  3LR0 A;  3ZYT A;  1S4S A;  2P08 A;  5DF9 A;  4O8G A;  2V0W A;  2J3W A;  2M1C A;  2HV1 A;  5DFY A;  4EQ1 A;  3T4S A;  1YSP A;  5I5L A;  1XJ4 A;  1G28 A;  3JVU A;  2HF6 A;  2A2L A;  3F1P B;  4NXE A;  3S7Q A;  2EWV A;  4L9F A;  4UQI S;  5DKK A;  4HNB A;  2QJ7 A;  5HSQ A;  2W3H A;  1T19 A;  3UB9 A;  5HZH A;  4PAU A;  2QHK A;  4G3K A;  5MC7 A;  4HH2 A;  3UB6 A;  3E4Q A;  5HL6 A;  3OCL A;  1NWZ A;  2EWW A;  3IS2 A;  2J3T C;  3KX0 X;  1N9O A;  1N9L A;  1YSQ A;  2PHY A;  3MQQ A;  4YOF A;  4EEP A;  3EGD C;  2A24 B;  1S4R A;  2FH5 A;  2QYB A;  2M7V A;  1TF1 A;  2QWS A;  4H6J A;  5L8M A;  4I3J A;  3BWL A;  5TJJ A;  3UE6 A;  4I39 A;  1F5M A;  3UMD A;  1OJG A;  4NEE D;  2XRO A;  2VV8 A;  4FSF A;  2YKH A;  2XA7 S;  4MN7 A;  4CLC D;  3TE8 A;  2OWH A;  2INW A;  4EU0 A;  1F98 A;  1MKM A;  3KO6 A;  2PYR A;  4HI4 A;  3NHQ A;  1LSX A;  1X0O A;  3CLO A;  3EEA A;  4RQ9 A;  3FPW A;  2KDK A;  4HY8 A;  4PKY A;  4WF0 A;  2VX8 A;  2VEA A;  2WKQ A;  3C30 A;  3CUE C;  4GW9 A;  4UEY A;  4ETZ A;  3KYZ A;  3H7W A;  3C8C A;  3KYQ A;  3UME A;  1S1Y A;  3MQ0 A;  3F1N B;  4CLC B;  1WA9 A;  3MFX A;  2OWJ A;  4II7 A;  4GHI B;  3NOP C;  1MC0 A;  3R7W B;  4HH3 A;  1W63 Q;  2W3D A;  2PT7 A;  4ME4 A;  4HQA A;  3KSI A;  2B18 A;  2ZBB A;  4R3A A;  3HJI A;  1LSW A;  4P6Z S;  3VOL A;  3DBA A;  4MCW A;  4HP4 A;  3G6O A;  3A0S A;  3OC2 A;  2H28 A;  2V1B A;  2JKT M;  4BJP A;  1D7E A;  3PBS A;  1BYW A;  2OAQ 1;  5HD3 A;  2GZA A;  3SW1 A;  3C2W A;  3U2A A;  4GS9 A;  1OTD A;  1ZTU A;  4NXB A;  1V9Z A;  2W1T B;  2PD8 A;  3VV4 A;  3MR0 A;  3PBO A;  1JNU A;  4G3V A;  2Y8H A;  3ULF A;  3KSG A;  5G4Z A;  4B93 A;  5DJU A;  4IUK A;  4EET B;  1LT0 A;  4Y5F A;  3H9W A;  3JVV A;  2NUP C;  4DJ3 A;  5HD5 A;  3FC7 A;  3S7P A;  3LI9 A;  4M4X A;  4MMN A;  2HGV A;  4HOI A;  4JGO A;  5A8B A;  3P7N A;  5EFW A;  5TBM A;  3CAX A;  3BY9 A;  5AVF A;  3KSF A;  2VJW A;  3UB7 A;  3LUQ A;  2D02 A;  3T50 A;  4L0L A;  4DMZ A;  4L9E A;  3EWK A;  4R6L A;  5J3W A;  5FL3 A;  3T4K A;  1LSV A;  3PHY A;  3CI6 A;  4CQH A;  2VKS A;  4UQI M;  1T1C A;  4YWZ A;  4BMW A;  4ZRR A;  4ARZ A;  4MDZ A;  2M7U A;  2VA0 A;  4LPZ A;  1P97 A;  3C38 A;  4WUJ A;  2WKP A;  3V67 A;  2JKR I;  4Y3I A;  4FOF A;  3NOT C;  5F5Y A;  3MQO A;  2K2N A;  5G4Y A;  3LIF A;  5HDC A;  2W3G A;  1GSW A;  2HJ9 C;  5KIZ A;  2NUT C;  3H82 A;  2W3E A;  1OJ5 A;  3O5Y A;  1V9Y A;  4KQD A;  1P9R A;  1TS6 A;  2XA7 M;  4F3L A;  1DRM A;  3B42 A;  4IJG A;  4WEJ A;  2KX6 A;  1GSX A;  2VV7 A;  3CIT A;  2QJ5 A;  3MF0 A;  2W3F A;  1OTI A;  3T4T A;  4R70 A;  4HJ3 A;  2XSS A;  1T1A A;  3TRC A;  1XFN A;  1OPX A;  2VGL S;  4EW7 A;  3PR6 A;  2VV6 A;  4XT2 A;  1LL8 A;  5HWT A;  2JHE A;  3F1O A;  1XJ6 A;  2Y79 A;  1TD5 A;  2PDR A;  4R38 A;  3FPV A;  4I38 A;  4DN0 A;  2JKR M;  3EOI A;  3LYX A;  2ZOH A;  4NXG A;  3T4Q A;  5C5K A;  3T4L A;  1S66 L;  4IHQ A;  1G6O A;  4EER A;  3T4J A;  2L1M A;  3OOV A;  3TW8 A;  2PD7 A;  4O01 A;  4WEK A;  2O9C A;  3BJN A;  3F1P A;  4P6Z M;  4IUH A;  5F6A A;  1OTB A;  3LIA A;  3W2Z A;  3LIE A;  1YKD A;  3GDI A;  1OTA A;  4CLC C;  3ICY A;  3R4K A;  1F9I A;  1S67 L;  1XJ3 A;  5IU1 A;  5DFX A;  4K08 A;  1DP6 A;  4HJ6 A;  2K31 A;  3P01 A;  4ARZ B;  1UWP X;  2D01 A;  2PYP A;  5IS1 A;  1EW0 A;  3NJA A;  4WL9 A;  4ETX A;  1W63 M;  4Q0J A;  3E0Y A;  1IFQ A;  2A24 A;  4NXF A;  1TS8 A;  3BQ8 A;  1OT9 A;  3OLO A;  3KSH A;  3MXQ A;  3PBT A;  3D3O A;  2VLG A;  2EA9 A;  1OT6 A;  3PBN A;  3K2N A;  3E4O A;  5KSH A;  4NKP A;  3IS2 B;  3MJQ A;  5LBR A;  5F68 A;  1YAX A;  3BQA A;  1NRJ A;  5F69 A;  1ODV A;  2O0Y A;  3H82 B;  4I3I A;  2GX5 A;  4H6J B;  4EXO A;  2P04 A;  3K3D A;  5J4E A;  4QPR A;  4EUV A;  1T18 A;  3HCY A;  4O0P A;  2GJ3 A;  2V1A A;  3S7O A;  1H8M A;  3IBR A;  3LFV A;  4OOL A;  4CLC A;  4XT2 B;  4JGR A;  5K5B A;  4GHI A;  3NOU C;  3R7W A;  2IA2 A;  2FZ0 A;  2G7U A;  2J3T D;  5DJT A;  5AJG A;  1D06 A;  2YKF A;  2W1R A;  3PBQ A;  5HDD A;  1VHM A;  3A0R A;  5AVE A;  3H7W B;  1T1B A;  2KLI A;  4GCZ A;  3T4O A;  3MMH A;  4GJ4 A;  4I3A A;  4HP9 A;  3LR3 A;  3IBJ A;  5IT5 A;  2ZMF A;  3BY8 A;  2GNX A;  2W1T A;  4DJ2 A;  4Z1W A;  1NLZ A;  4MN5 A;  1Y28 A;  4E04 A;  2PR6 A;  5HPF A;  5HWW A;  2VGL M;  2K7S A;  3LIB A;  4GS9 B;  2O99 A;  1XJ2 A;  4CLC E;  3RH8 B;  1S1Z A;  5HDS A;  3VE3 A;  2JN7 A;  4G3W A;  4LRY C;  5HPI A;  1P0Z A;  4AFI A;  2OAP 1;  4MN6 A;  4OOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...