2W3EA

Oxidized structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
b'GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3eA00
3KSGA 1VHMA 3MMHA 4G3KA 3W2ZA 5TJJA 2VJWA 4ZRRA 3KSIA 2XRNA 2K31A 2W3GA 5HPIA 4O0PA 4MDZA 2QYBA 4ETZA 2Y8HA 4LRYC 1TD5A 4CQHA 5K5BA 2G7UA 3MQ0A 4BWIA 4LRXC 3K2NA 3CITA 3E98A 5DFYA 2ZMFA 2O9AA 4IUKA 3HCYA 3S7PA 3R4KA 4Q0IA 1MKMA 4FOFA 2O99A 3LFVA 2W1RA 3G6OA 3NOPC 5I5LA 4YOFA 3S7QA 4E04A 2KOIA 5DFXA 4R70A 3TRCA 2O0YA 4RQ9A 1TF1A 4Q0JA 2XSSA 4DN0A 4DMZA 2XROA 2HGVA 5L8MA 4MCWA 3RFBA 3EEAA 4IUHA 4EUVA 3DBAA 1F5MA 2IA2A 2LB9A 4QPRA 3OBFA 4IJGA 5LBRA 5C5KA 4LRZE 1MC0A 1YKDA 4G3VA 2W3EA 3KSFA 1YSQA 2W1TB 1YSPA 4Y2FA 4Y5FA 3NHQA 4O01A 3KSHA 3S7OA 5HSQA 2KLIA 3C2WA 4ETXA 2GX5A 3MF0A 2M7VA 3E0YA 5HPFA 4Z1WA 2W3HA 4MMNA 2VEAA 4GW9A 2LB5A 1ZTUA 4G3WA 4Y3IA 3ZQ5A 5AJGA 4MN7A 2B18A 3OOVA 2VKSA 3O5YA 3S7NA 3KO6A 4O8GA 2O9CA 4PAUA 4Q0HA 2OOLA 3BJNA 2W3FA 5HL6A 2W3DA 2VZWA 3CI6A 3IBRA 2O9BA 2K2NA 4GLQA 3IBJA 2Y79A 3NOUC 2W1TA 3NOTC 3D3OA 4EU0A 4YNRA 2M7UA 3VV4A 4ME4A 4R6LA 1STZA
chains in the Genus database with same CATH superfamily
3KSGA 4WELA 5M19A 3L7HA 4RVAA 1DP9A 4LV2A 4E3NA 5FAOA 4QU3A 3EOIA 3BFFA 1E4DA 4DDYA 3LY4A 1TD5A 2HDUA 1GHMA 4PMAA 2HJ9C 4EUZA 5K5BA 3MSHA 2XK1A 5FQKA 4DKIA 5F1FA 2XGNA 4PM8A 4IUKA 1LSXA 5EPHA 1L2SA 4DE1A 3IF6C 2FH5A 3RXXA 1BLCA 1ES4A 2PU4A 5CEDA 5EV0A 4DMZA 4OPYA 5L09A 4ARZA 4XXRA 2I9VA 3VE4A 4FCFA 4N92A 5A91A 3QNBA 3Q81A 3LYXA 5M1AA 2EXBA 4XUXA 4D60A 3SH8A 2OWHA 3L9KA 4OONA 3JVVA 3LR4A 4O01A 2JCHA 4LV0A 3S1YA 5DF8A 3IS2B 3UY6A 1S6RA 2DCFA 3GTCA 1LL9A 2W3FA 2W3DA 2K2NA 3IBJA 1CJFA 3QP1A 5L10A 3UE0A 3MZDA 3SW1A 2HP6A 5BOHA 3AGEA 4I5SA 4S2NC 4PHTA 1IKGA 1K56A 3IWQA 4MDZA 1HD8A 4QY5A 1XXMA 1KGEA 3UNWA 1JNUA 4FUWA 1ZG4A 1ZG6A 2HV1A 3ULFA 3LR5A 2J7VA 3LCEA 3VFFA 1GHPA 3FYZA 5FASA 4BLMA 4XT2B 1NYMA 4CLCA 1WYCA 5EVIA 2PD8A 3RTYA 4NETA 2W1RA 1KGFA 4R38A 2KOIA 5E2GA 4P85A 5DFXA 3M2JA 4WBGA 5DKKA 2PDRA 2ZC7A 4R0QA 1PI4A 2P9VB 4PM5A 3KX0X 4E3JA 5GHZA 4JGQA 3C4OA 3CZDA 5LBRA 5HD3A 3O86A 4OQGA 2W3EA 4Y17A 4RYEA 3PBRA 1YSPA 4GOGA 2Y2QA 3KYEA 2WGIA 1YLYA 3DW0A 5EVIC 4UQIS 1MY8A 2FZ0A 3FG8A 4MMNA 1X0OA 3C30A 3OCLA 4DJ2A 3O88A 3G2YA 2EFUA 4E3OA 4MBHA 3BJNA 4KZ3A 3MR0A 3ZVWA 5IT5A 3FKVA 1OTBA 3BYDA 3BEBA 5HDCA 1CEFA 1S0WA 2Q9MA 4ME4A 3E4PA 1TDLA 1G68A 4HI4A 4EW7A 5D3OA 4ZBEA 2W27A 5FAQA 3HLGA 3VMAA 3H82A 4GN2A 3TG9A 2ZC3B 3CG5A 2QYBA 4RX3A 3QHYA 2Y8HA 2UWXA 5KZHA 1YT4A 4BWIA 1XA1A 1QMEA 2QHKA 3UPNA 3E98A 3LUQA 5HAPA 4DJ3A 4KZ5A 2NUPC 3N4IA 4PPRA 1DP6A 3CHWP 5IS1A 1XP4A 2P74A 5JYPA 3CAXA 5FDSA 3DTEA 3LEQA 3HL9A 4Q0JA 2XA7M 3OPLA 3UB9A 1ODVA 2ZM2A 3Q82A 5M18A 2A3UA 3T4SA 2IA2A 1YAXA 4IJGA 5GHYA 1NLZA 2ZM0A 4YINA 4GHIA 3C5AA 3LEZA 1LSVA 4LENA 3T4TA 1XPBA 5DVAA 5AQ9A 5HSQA 3HVFA 4WMCA 3WS1A 4LPZA 4F3LB 5HPFA 1ESUA 2LB5A 4Y3IA 5AJGA 4GD8A 3D72A 5J8XA 1T19A 3O5YA 1SCWA 3JYIA 3GMWA 2O9CA 1FSYA 5F6AA 4D2OA 2VZWA 4ZJ1A 2Y2GA 1PNEA 3B33A 1TS7A 3BQAA 1LSWA 3OZHA 1VEUA 5EVID 3QP8A 1MWSA 2G2WA 4P6BA 2OLVA 3N8SA 1AWIA 1CEGA 5FDHA 3LIFA 2XRNA 1UWNX 3V3RA 1SKOA 1S4SA 1IYQA 2EX6A 3B3XA 3SS3A 4X56A 3KYZA 1L0EA 4M4XA 1TDGA 1TEMA 4OOMA 3CITA 2Y59A 5E43A 1BZAA 2PU2A 4IVIA 1JTGA 3S7QA 3C7UA 2Y2MA 2Y91A 3VP0A 1ES3A 3HLEA 4EEUA 4EXOA 5L8MA 4MCWA 1K57C 1NYYA 2HF6A 2V1AA 4L9GA 4QPRA 4CPKA 1FSWA 3LIEA 4OKPA 3LGOA 4E3IA 3LI9A 3DTKA 1EI5A 3DWZA 3HBRA 5A8BA 4WYYA 1P97A 5EVIB 3RH8B 2ZMAA 5KSHA 3OC2A 5HWWA 2D01A 5FI2A 1DJCA 1ES2A 3O3VA 1GSXA 4I3IA 5KSCA 4JGRA 1UWPX 1K6RA 5HL6A 4R3AA 1K0KA 4EETB 5EVLA 2XEPA 1WYBA 3VOYA 2RCXA 3HLBA 4OLGA 3BECA 3UE3A 5F68A 4OPRA 5CGXA 3IH8A 3N7WA 1XFNA 4B9OA 1DJBA 1NZOA 2W0NA 3A3IA 1CF0A 2VGJA 1J3WA 3F1NB 5DFYA 3IF5A 1ZC2A 2IWDA 1XA7A 2EWVA 3EEHA 5FQMA 1CI9A 2A2LA 4WF0A 4WZ5C 3H7WB 1OTIA 4ARZB 4BQMA 3S4XA 4KZAA 1LI0A 3T1RA 4LLOB 4B4ZA 3F1OA 2Z2MB 4FSFA 3VP1A 1K6SA 1W63M 2JBFA 3TE8A 3EQVA 3IHAA 3OBFA 4KZ8A 3A3JA 3O87A 2WKPA 3T4KA 1RCJA 4L9EA 4HNBA 3D9YA 3NI9A 3A0VA 4AFIA 4C6YA 1W7FA 3T4JA 4KQDA 1N9NA 3TJZC 5FATA 4MEZA 3S7OA 4R1GA 1PW8A 4BMWA 1XJ4A 1YLZA 2R78A 3QP2A 5HFOA 3BFCA 3V5MA 4XT2A 3IXDA 3ZQ5A 3OOVA 4UHUA 3V39A 2I72A 2IWBA 1H8ZA 2OOLA 2WKHA 4EWFA 1M6KA 4X1LA 1PI5A 3PBTA 4DDSA 2P9VA 3U4LP 4CLCE 1OTAA 1FOFA 3NIAA 2PRFA 4EU0A 3BFGA 2M7UA 3VV4A 4OOLA 2J3TD 1KDWA 5FEGA 1PRQA 4X1MA 2WK0A 3PR6A 3IH9A 2H5SA 2J9PA 1IEMA 2XF3A 2ZC5B 1NLYA 5EM0A 4BJPA 4BENA 1S67L 1HTZA 4K91A 3ZG9B 3CMZA 3BLMA 3HLFA 4QJGA 4DE3A 2QJ7A 1ALQA 3N6IA 5I5LA 4JGPA 1ES5A 4E3LA 1FR6A 3TRCA 5TBMA 1TF1A 4I39A 4OQHA 4FH2A 3RFBA 5IU1A 5GL9A 1F5MA 1PYYA 1BT5A 4X55A 5TBMB 5L2FA 1W8QA 1PWCA 2JKTI 2A49A 3GQZA 3IWIA 3ZG8B 5HAIA 1YMXA 4OOYA 1C3BA 1K55C 2ZLYA 4X53A 4ZDXA 1BLSA 3MFDA 3MF0A 4EERA 2ZC6B 2M1CA 4ZJ3A 4MBFA 4K0WA 3HJIA 4BBUA 2Y2PA 4JGOA 3Q1FA 3ZFZA 2ZD8A 3QNCA 1K25A 2ZL1A 1KE4A 5GLCA 2QPNA 3G31A 3W4QA 3ZNYA 2L1MA 1XKZA 1STZA 3ZGAB 4DXCA 5GLBA 3T1XA 3KSIA 4N1HA 2K31A 2WGWB 2VA0A 1OTDA 1FILA 2ACGA 2V0WA 3D4FA 3R7WB 4F3LA 1OJGA 2WADA 3BY9A 3HLDA 1K4FA 3NOPC 4YOFA 4E04A 4Y0TA 4HH3A 3Q7ZA 3NULA 4I3AA 3OPPA 4KUKA 3NY4A 2Y2OA 4JXSA 2E8IA 4IBRA 4HJ3A 3EEAA 3BM6A 1KE3A 5MC7A 2J8YA 2LB9A 1K54A 3M6HA 1TS6A 2VX8A 3LIAA 2XFTA 4LRZE 4LV3A 1DY6A 3OCNA 2HJEA 3GSGA 3PBNA 1Q2PA 1EW0A 1S66L 1N9OA 4GS9B 1NZUA 4WZ5A 3VP3A 1LT0A 2VLGA 1ONHA 3ZVTA 1P0ZA 2Z6DA 1KOUA 4P6ZM 4QB8A 2Y2HA 3UB8A 5IHVA 1YQSA 4KG6A 3UB6A 5DJTA 1WE4A 3KYQA 2WUQA 3AGDA 3G4PA 2OWJA 5EECA 5GLAA 4RX2A 1FCMA 2Y2NA 4UA7A 1I2SA 2A24A 2JHEA 1E3UA 4NEED 4E3MA 4OPZA 4UAAA 3T4LA 5HPIA 4O0PA 3LI8A 5A93A 3A0SA 1ESIA 4HJ4A 4N9LA 2P7JA 2OSUA 2V2FF 3ZG5A 3FWLA 3WS0A 2H28A 1OMEA 1H8MA 3HCYA 4S2PA 4FD8A 1Y28A 1IOUA 1GCEA 3WWXA 2B02A 1OPXA 1JWPA 3IHBA 4YWZA 1SKFA 3VFHA 4UQIM 4R70A 3ZNTA 4OH0A 2BASA 4Q8IA 4B88A 2BG1A 1L3LA 2VV6A 3BFEA 2XD5A 5E2HA 3P09A 3DBAA 2R9XA 3PAGA 4R3BA 4IEDA 2EXAA 3CUEA 2W1TB 1F2KA 4R4RA 5I94A 1TS0A 4BBTA 4NXFA 3K3CA 5CEBA 3N8LA 1N9BA 3B47A 3E0YA 2R9WA 4Z1WA 4EBPA 5F69A 3Q7VB 4Y15A 2B18A 3FV7A 2X01A 2OV5A 3UB5P 4Q0HA 1JVJA 5GLDA 4JLFA 2QWSA 3JPUA 1EROA 3SH9A 3EQUA 4JF5A 3VOZA 3B42A 3NBLA 3LO7A 3SS5A 4BL3A 3C4PA 3HUOA 2YKHA 3H82B 2BLSA 3MXRA 1GA9A 4HP4A 1CI8A 3FPWA 3UPOA 3NC8A 4LRXC 3CWFA 3E2KA 4H6JB 2ZC4B 5FQIA 4KG2A 1U60A 2JKTM 4HIAA 1T1BA 2INWA 5L07A 1J9MA 3HREA 1XJ3A 3HJKA 4M3KA 4H6JA 4HH2A 4U3TA 3PBQA 1RGZA 3VSKA 5FI6A 5HAQA 4DN0A 1ACFA 2JKRM 2P08A 4IHQA 3GECA 4BBVA 5AQAA 4KZ4A 5AQBA 3BWLA 1XGJA 2H0TA 3MBZA 2QMIA 3A0RA 4NK3A 1YM1A 3IXBA 2D02A 4Y5FA 2JKGA 4GNUA 5HX9A 4O7DA 3C2WA 3G35A 4JF4A 5FAPA 1FIKA 2W3HA 5HWTA 3H9WA 4JXGA 1ZTUA 1E3UD 1ERMA 2DRWA 2WAFA 4MN7A 5G4ZA 4MN5A 1L0DA 3LIDA 2V1BA 3WRTA 1BUEA 4NXEA 2XR0A 4OQ0A 3ZYTA 3FC7A 3EWKA 4LCMA 1NWZA 1D1JA 4PM9A 2ZQ8A 2WGVA 3IX8A 5CX7A 4WMCD 1DJAA 3W2ZA 4R23A 3SS4A 1ONGA 2PAVP 4P87A 1MWRA 4CLCC 1N4OA 1CQAA 4HEFA 3MS6A 4RA7A 3K2NA 4BL2A 2DNSA 2GJ3A 2H10A 1IKIA 2VGKA 2V20A 1V9YA 5TGFA 1FR1A 4MLLA 1E25A 2B95A 4KQOA 4S2OA 4IBXA 2PR5A 3UB7A 3LICA 2ZBBA 3MQQA 4ZTKA 5J3WA 1FQGA 5FEFA 5EOEA 1VQQA 5FQJA 4GDBA 3TSGA 1YLWA 2FFYA 2HGVA 1PZPA 1MPLA 2ZM8A 5DF9A 4EBLA 4HP9A 3HUNA 1YKDA 1W5DA 3EGXC 5TFQA 4Y2FA 1KE0A 1SHVA 3IQAA 3BRMA 1JTDA 1SDNA 3G32A 4S2IA 1RGYA 3A3EA 2VEAA 3HUMA 3IWOA 2XD1A 2HDSA 3M2KA 3GDIA 1QMFA 3BLSA 3CPTB 3MXSA 4KZ7A 1TVFA 3DTIA 2L4RA 4A5RA 2JKRI 2PBYA 4HBTA 4KQQA 1D06A 1K4EA 3G2ZA 4N1XA 5CHUA 2VJWA 3T4QA 2YKFA 2Y2IA 4EQIA 4CQHA 4BD0A 3ISGA 3Q07A 1NXYA 1HLUP 5AQ7A 2H0YA 1GA0A 5FL3A 2V8CA 1BTLA 4Q0IA 4DE0A 1KGGA 3FZCA 3HLWA 3LIBA 2PYPA 3MFXA 2P04A 2VGLM 1RP5A 1MKIA 4RQ9A 4L9FA 3SH7A 4JF6A 3AGFA 3K3DA 3MXQA 3IX3A 4Y0OA 2UV0E 2AVXA 1EWZA 2WKIA 4B4XA 1V9ZA 2A24B 4OP8A 4KUOA 4DE2A 4S2NA 2ZQ7A 1DRMA 1H0MA 5CXWA 2Q0OA 5HW3A 4YFMA 1G5UA 4HHDA 1SDEA 4KZ6A 5AVFA 1OT9A 2G2UA 4PKYG 3IS2A 1ZHHB 3W8KA 4OQIA 5F1GA 2HP9A 5GHXA 3TOIA 4LCLA 4X69A 3T1SA 2EA9A 4O8GA 1YLTA 1LHYA 2J3WA 1W63Q 5G4YA 2O9BA 5DF7A 1OJ5A 1T1CA 2WYXA 2HZ5A 2KX6A 3D3OA 1GSVA 1LI9A 1AXBA 3FKWA 4Y0UA 1XJ6A 1W8YA 3BQ8A 1NRFA 5TJJA 4WUJA 1Z09A 2L0WA 4GHIB 2Y2LA 3IXHA 3OPHA 3WS5A 4F94A 3IF6B 2Z2LB 3MQ0A 3BFDA 5CTNA 1KVMA 2WZXA 2GNXA 3UDXA 4WEKA 1K54C 3MZFA 4E6XA 1Z6FA 4NG2A 4Z9QA 3PBOA 4IVKA 5EFWA 4WM9A 3BY8A 2XDMA 1W79A 3CUEC 2O0YA 1VB6A 4OPQA 3T1QB 2PT7A 2XSSA 3NECA 4IUHA 3IX4A 3E4QA 4GKUA 1IELA 5HDDA 2OAQ1 5C5KA 4MNRA 3RJUA 2WZZA 4ZJ2A 4CLCD 1MC0A 4HJ6A 4G3VA 1VETB 1SKOB 4CJNA 5A90A 3ZG7B 4S2KA 4WEJA 4XUZA 1Y54A 5J7EA 4KZBA 2WKEA 1G6OA 3MKFA 1N9LA 4X68A 3S22A 4EESA 3S7NA 2VV8A 4EV4A 5U47A 3LR3A 4NXBA 4PAUA 3WRZA 4HQAA 5E2FA 5DKLA 3PBSA 5F5YA 3GV9A 5E2EA 3UMDA 5DTTA 2QKPA 4KQRA 5CHJA 3UDFA 1A0KA 1H3QA 2XQZA 2Q9NA 4GD6A 2GDNA 5TR7A 4WN5A 2ZMVA 4QY6A 4LV1A 1BULA 3VP2A 3MQOA 3ZHHA 2E8JA 5EE8A 1PIOA 2JC7A 2J9OA 4C75A 2ZL1B 1MXOA 3S7PA 2XFSA 2Z6CA 2ZQ9A 4Y7PA 3U2AA 1MKMA 4FOFA 3ZDJA 4MN6A 3WS2A 3G6OA 3HLCA 1XX2A 5FQ9A 5FA7A 3C38A 3TW8A 4JKTA 5CRFA 2HDQA 4L0LA 3CJMA 1GSWA 1MBLA 4P0MA 3DWKA 3VOLA 3MKEA 2QJ5A 4WL9A 2EX2A 4S2MA 2EX9A 2NUTC 1TS8A 4JXVA 5HL1A 1HZOA 1NRJA 4UA9A 5HWVA 2M7VA 1M40A 5FSRA 1K55A 4GW9A 2Y4AA 4S2LA 3BW6A 5FQQA 1L0GA 4WZ4A 1OT6A 2VKSA 2PD7A 5FI7A 3E4OA 4FTXA 4KENB 4EQ1A 3MJQA 3IT9A 2PYRA 4GLQA 3V3SA 4ZAMA 3ICYA 4YNRA 5HDSA 3SZTA 4K08A 2WKRA 2B5RA 2CC1A 4GS9A 4E3KA 5DTSA 3MMHA 4II7A 4G3KA 1KVLA 3NCKA 3VP4A 3G30A 2W3GA 2CMNA 4N9KA 4PM6A 4NKPA 4QHCA 3E2LA 1S1YA 4S2JA 4LRYC 5DJUA 3P01A 5EUAA 4GB7A 3A3DA 1YPRA 2J3TC 3VE3A 2X02A 5CERA 4GDNA 3GRJA 3PYPA 2O99A 4GZBA 2HP5A 2BTFP 3I7JA 3FPVA 3VSLA 1K38A 3WS4A 3UPPA 4LFUA 1Q2QA 2KDKA 4PM7A 5CGWA 4ESPA 1H5XA 3P98A 2J80A 3IF6A 3PAEA 4JXWA 3UN7A 4ID4A 4GCZA 4MBKA 4K0XA 2WAEA 3JVUA 1XJ2A 3LY3A 2Y55A 3NHQA 3ITBA 4EBNA 4OLDA 2GX5A 4X25A 5F83A 2MJ6A 2ZOHA 2PHYA 3QP5A 1T18A 3NJAA 4G3WA 4CLCB 1H8YA 2JN7A 4JBFA 3NDEA 4HOIA 2V1ZA 3NDGA 3ZCZA 3CI6A 3IBRA 4EEPA 3ZG0A 2IWCA 3NOUC 3W4OA 2W1TA 3NOTC 4OP5A 2GZAA 2HPBA 4DF6A 5A92A 2OLUA 3H7WA 4BD1A 1P9WA 1PWGA 1VHMA 4KG5A 1MWTA 1ERQA 4ZRRA 1LL8A 3UMEA 3LR0A 4B93A 2WKQA 4Y13A 2JKFA 1K56D 3F1NA 2DMWA 1UGUA 4P6ZS 4ETZA 4UEYA 2G7UA 4U0TA 3DAVA 1FCOA 4R3JA 2ZMFA 2O9AA 4WLAA 1FCNA 1K57A 4GJ4A 1JWZA 3F1PB 4KZ9A 1OTEA 2Y2JA 3OLOA 4LGWA 5CECA 3F1OB 4EUVA 3F1PA 2EWWA 2VGLS 3W4PA 2ZQCA 4FH4A 1BYWA 1P9RA 3KSFA 1WA9A 2C6WB 1YSQA 2WGWA 1IYPA 2K7SA 1DP8A 1PZOA 1F98A 3KSHA 4DRTA 1SZVA 1YMSA 4C3QA 1IYSA 2PBDP 3R7WA 1L0FA 1PWDA 4JPMA 4HY8A 5EM1A 3PTEA 5F82A 3M6BA 4I3JA 1BLHA 5EOOA 4PKYA 3UE6A 4DXBA 1S1ZA 2ZJ9A 3UO9A 3QP6A 2Y2KA 3C7VA 5JYOA 1XFQA 1YLJA 2ZQAA 4H8RA 5AVEA 5KMWA 5HARA 1D7EA 3C8CA 2ZOIA 2JE5A 5EVEA 1GHIA 4UA6A 1VEUB 3V50A 3T4OA 2V0UA 2V8FA 3PXPA 1NJ4A 2V9AA 1LLBA 5DTKA 3UE1A 1I2WA 3DTMA 3GVBA 1VM1A 2HDRA 2OAP1 3UDIA 3MZEA 3Q7VA 3R4KA 3CLOA 3LFVA 2XA7S 5HZHA 2RL3A 3P7NA 1O07A 1KDSA 3RXWA 5KIZA 3ITAA 1NY0A 1F9IA 2EFXA 1S4RA 3QP4A 3N8RA 1MZUA 1IYOA 1JWVA 1BSGA 3A3FA 2XROA 2ZQDA 1PW1A 1VETA 3GR2A 4OVDA 1MWUA 2EX8A 5G18A 5CTMA 1YLPA 3SOIA 2XLNA 1T1AA 1CK3A 5HD5A 4QD4A 4U0XA 3OPRA 1HVBA 5CGSA 2XH9A 2PR6A 2VK3A 1I5QA 3V67A 2QZ6A 3T50A 3PHYA 1BLPA 1G28A 2C5WB 2KLIA 4NXGA 4ETXA 1G6AA 2VV7A 2X71A 4E6WA 4HBUA 5J4EA 1ZKJA 1PFLA 1LL5A 3KO6A 1XGIA 3CPTA 3EGDC 3IXGA 4I38A 1O7EA 1Y4OA 4X6TA 4QWOA 2Y79A 1IFQA 2FFFB 4R4SA 5CHMA 3G34A 4HESA 4R6LA 3T12B
chains in the Genus database with same CATH topology
3KSGA 4WELA 1DP9A 1H3QA 1XFNA 4B9OA 2YKHA 4WN5A 3EOIA 2W0NA 3H82B 2ZMVA 4HP4A 3FPWA 1TD5A 5K5BA 2HJ9C 3MQOA 3F1NB 4LRXC 3CWFA 4H6JB 5DFYA 4IUKA 2JKTM 4HIAA 3S7PA 2Z6CA 2EWVA 3EEHA 1LSXA 1T1BA 2INWA 3U2AA 1MKMA 2A2LA 4WF0A 4FOFA 3H7WB 1OTIA 1XJ3A 4MN6A 3G6OA 3HJKA 2FH5A 4ARZB 4H6JA 4HH2A 4LLOB 3F1OA 3PBQA 3C38A 3TW8A 4FSFA 4DN0A 4DMZA 2JKRM 2P08A 4L0LA 1GSWA 4IHQA 4ARZA 1W63M 2I9VA 3GECA 3VE4A 3TE8A 3EQVA 4BBVA 3OBFA 3VOLA 2QJ5A 3LYXA 3BWLA 2WKPA 4WL9A 3T4KA 4L9EA 2OWHA 4HNBA 3A0RA 3JVVA 3A0VA 4AFIA 2D02A 4Y5FA 3LR4A 2NUTC 1TS8A 1N9NA 4KQDA 4O01A 3T4JA 3TJZC 3S7OA 1NRJA 5HWVA 4BMWA 3C2WA 1XJ4A 2M7VA 2W3HA 5HWTA 2R78A 4GW9A 3H9WA 3BW6A 4XT2A 1ZTUA 3ZQ5A 4MN7A 1OT6A 3OOVA 2VKSA 4MN5A 5G4ZA 3IS2B 2PD7A 3LIDA 3E4OA 2OOLA 2V1BA 4EQ1A 2W3FA 3MJQA 2W3DA 4NXEA 3PBTA 2K2NA 3ZYTA 2PYRA 3FC7A 4GLQA 3EWKA 4CLCE 1OTAA 3IBJA 3ICYA 1NWZA 4EU0A 4YNRA 2M7UA 3VV4A 4OOLA 5HDSA 4K08A 2J3TD 3SW1A 2WKRA 4GS9A 4I5SA 3MMHA 4II7A 4PHTA 4G3KA 5CX7A 3W2ZA 3PR6A 2W3GA 2CMNA 4MDZA 4NKPA 4CLCC 1NLYA 1S1YA 4LRYC 1JNUA 5DJUA 4BJPA 3P01A 1S67L 2HV1A 3K2NA 3ULFA 3LR5A 2GJ3A 2J3TC 3VE3A 1V9YA 4XT2B 4CLCA 3PYPA 4KQOA 2O99A 2PD8A 2QJ7A 3RTYA 2W1RA 2PR5A 5I5LA 4JGPA 3UB7A 3FPVA 3LICA 4R38A 2KOIA 2ZBBA 5DFXA 3MQQA 5J3WA 2KDKA 5DKKA 2PDRA 3TRCA 5TBMA 1TF1A 4I39A 3KX0X 2HGVA 3RFBA 2J80A 5IU1A 4JGQA 1F5MA 4GCZA 5LBRA 5TBMB 5HD3A 5DF9A 2JKTI 4HP9A 1YKDA 2W3EA 3JVUA 1XJ2A 3EGXC 3PBRA 1YSPA 4Y2FA 3NHQA 4UQIS 2GX5A 2FZ0A 3MF0A 3FG8A 4EERA 2MJ6A 2ZOHA 4MMNA 1X0OA 2M1CA 2VEAA 2PHYA 3C30A 1T18A 3NJAA 3OCLA 4G3WA 4CLCB 4DJ2A 2JN7A 4HOIA 3HJIA 4BBUA 3GDIA 3BJNA 3CI6A 3IBRA 4JGOA 3MR0A 5IT5A 4EEPA 1OTBA 3NOUC 2W1TA 3NOTC 2GZAA 5HDCA 2L1MA 2L4RA 4ME4A 3E4PA 3H7WA 1STZA 2JKRI 1P9WA 4HI4A 4EW7A 1VHMA 2W27A 1D06A 2VJWA 3H82A 3KSIA 1LL8A 4ZRRA 2K31A 2YKFA 3LR0A 3T4QA 3UMEA 4B93A 2WKQA 2VA0A 2QYBA 3F1NA 1OTDA 2DMWA 1UGUA 4P6ZS 4ETZA 4UEYA 2Y8HA 4CQHA 2G7UA 2V0WA 4BWIA 2QHKA 3E98A 3LUQA 3R7WB 4F3LA 1OJGA 4DJ3A 2ZMFA 2O9AA 2NUPC 3BY9A 4WLAA 5FL3A 4Q0IA 1DP6A 3NOPC 4GJ4A 4YOFA 4E04A 3LIBA 5IS1A 3F1PB 2PYPA 3MFXA 2P04A 4HH3A 3CAXA 2VGLM 4I3AA 1OTEA 4L9FA 4RQ9A 4KUKA 3K3DA 4Q0JA 2XA7M 3OLOA 3UB9A 3MXQA 4HJ3A 1ODVA 3F1OB 3EEAA 3T4SA 4EUVA 3F1PA 5MC7A 2IA2A 2LB9A 2EWWA 1YAXA 2VGLS 4IJGA 1TS6A 1V9ZA 2VX8A 1NLZA 2A24B 1BYWA 4KUOA 3LIAA 4LRZE 4GHIA 1P9RA 3KSFA 1LSVA 1WA9A 3OCNA 1YSQA 2HJEA 3PBNA 3T4TA 2K7SA 1EW0A 1DRMA 1DP8A 1F98A 1S66L 3KSHA 1N9OA 4GS9B 4HHDA 5HSQA 5AVFA 4LPZA 3R7WA 4F3LB 5HPFA 1OT9A 1LT0A 4PKYG 4HY8A 3IS2A 2LB5A 1ZHHB 2VLGA 4Y3IA 1P0ZA 2Z6DA 5AJGA 1KOUA 3D72A 4I3JA 4P6ZM 1T19A 3O5YA 2EA9A 4O8GA 3UB8A 2O9CA 5F6AA 2J3WA 1W63Q 4PKYA 2VZWA 5G4YA 3UE6A 2O9BA 1OJ5A 1S1ZA 1T1CA 3UB6A 2KX6A 3B33A 5DJTA 3KYQA 1TS7A 3BQAA 3D3OA 1LSWA 1GSVA 2OWJA 1XJ6A 1XFQA 3BQ8A 5AVEA 1D7EA 2A24A 2JHEA 3C8CA 4NEED 4WUJA 2ZOIA 5TJJA 3LIFA 2XRNA 3T4LA 1UWNX 2L0WA 5HPIA 4GHIB 4O0PA 3LI8A 1S4SA 3T4OA 2V0UA 3PXPA 3A0SA 3KYZA 4HJ4A 2V9AA 2P7JA 4M4XA 3MQ0A 4OOMA 3CITA 2GNXA 4WEKA 2H28A 2OAP1 1H8MA 3HCYA 1Y28A 1IOUA 3R4KA 3CLOA 2B02A 3LFVA 1OPXA 2XA7S 3PBOA 4YWZA 5HZHA 5EFWA 3S7QA 3P7NA 3BY8A 4UQIM 4R70A 5KIZA 1F9IA 2BASA 3CUEC 2O0YA 1VB6A 1S4RA 1MZUA 2PT7A 4EEUA 2XSSA 4EXOA 2XROA 2VV6A 4MCWA 5L8MA 4IUHA 2HF6A 2V1AA 3E4QA 4L9GA 3DBAA 4QPRA 5HDDA 3LIEA 2OAQ1 5C5KA 1T1AA 5HD5A 4CLCD 3LI9A 1MC0A 4HJ6A 4G3VA 5A8BA 1P97A 3CUEA 2PR6A 2W1TB 3V67A 3RH8B 5KSHA 3OC2A 3T50A 3PHYA 1G28A 1TS0A 4BBTA 4WEJA 2D01A 5HWWA 4NXFA 3K3CA 2KLIA 4NXGA 4ETXA 3B47A 2VV7A 5J7EA 3E0YA 1G6OA 4Z1WA 5J4EA 5F69A 1GSXA 1N9LA 4I3IA 4EESA 2B18A 3S7NA 2VV8A 3KO6A 4JGRA 3LR3A 4NXBA 3EGDC 4PAUA 4Q0HA 1UWPX 4HQAA 4I38A 5HL6A 4R3AA 2QWSA 5DKLA 3PBSA 5F5YA 4EETB 2Y79A 1IFQA 3UMDA 3EQUA 2QKPA 3B42A 4R6LA 3UE3A 5F68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSG A;  1VHM A;  3MMH A;  4G3K A;  3W2Z A;  5TJJ A;  2VJW A;  4ZRR A;  3KSI A;  2XRN A;  2K31 A;  2W3G A;  5HPI A;  4O0P A;  4MDZ A;  2QYB A;  4ETZ A;  2Y8H A;  4LRY C;  1TD5 A;  4CQH A;  5K5B A;  2G7U A;  3MQ0 A;  4BWI A;  4LRX C;  3K2N A;  3CIT A;  3E98 A;  5DFY A;  2ZMF A;  2O9A A;  4IUK A;  3HCY A;  3S7P A;  3R4K A;  4Q0I A;  1MKM A;  4FOF A;  2O99 A;  3LFV A;  2W1R A;  3G6O A;  3NOP C;  5I5L A;  4YOF A;  3S7Q A;  4E04 A;  2KOI A;  5DFX A;  4R70 A;  3TRC A;  2O0Y A;  4RQ9 A;  1TF1 A;  4Q0J A;  2XSS A;  4DN0 A;  4DMZ A;  2XRO A;  2HGV A;  5L8M A;  4MCW A;  3RFB A;  3EEA A;  4IUH A;  4EUV A;  3DBA A;  1F5M A;  2IA2 A;  2LB9 A;  4QPR A;  3OBF A;  4IJG A;  5LBR A;  5C5K A;  4LRZ E;  1MC0 A;  1YKD A;  4G3V A;  2W3E A;  3KSF A;  1YSQ A;  2W1T B;  1YSP A;  4Y2F A;  4Y5F A;  3NHQ A;  4O01 A;  3KSH A;  3S7O A;  5HSQ A;  2KLI A;  3C2W A;  4ETX A;  2GX5 A;  3MF0 A;  2M7V A;  3E0Y A;  5HPF A;  4Z1W A;  2W3H A;  4MMN A;  2VEA A;  4GW9 A;  2LB5 A;  1ZTU A;  4G3W A;  4Y3I A;  3ZQ5 A;  5AJG A;  4MN7 A;  2B18 A;  3OOV A;  2VKS A;  3O5Y A;  3S7N A;  3KO6 A;  4O8G A;  2O9C A;  4PAU A;  4Q0H A;  2OOL A;  3BJN A;  2W3F A;  5HL6 A;  2W3D A;  2VZW A;  3CI6 A;  3IBR A;  2O9B A;  2K2N A;  4GLQ A;  3IBJ A;  2Y79 A;  3NOU C;  2W1T A;  3NOT C;  3D3O A;  4EU0 A;  4YNR A;  2M7U A;  3VV4 A;  4ME4 A;  4R6L A;  1STZ A; 
#chains in the Genus database with same CATH topology
 3KSG A;  4WEL A;  5M19 A;  3L7H A;  4RVA A;  1DP9 A;  4LV2 A;  4E3N A;  5FAO A;  4QU3 A;  3EOI A;  3BFF A;  1E4D A;  4DDY A;  3LY4 A;  1TD5 A;  2HDU A;  1GHM A;  4PMA A;  2HJ9 C;  4EUZ A;  5K5B A;  3MSH A;  2XK1 A;  5FQK A;  4DKI A;  5F1F A;  2XGN A;  4PM8 A;  4IUK A;  1LSX A;  5EPH A;  1L2S A;  4DE1 A;  3IF6 C;  2FH5 A;  3RXX A;  1BLC A;  1ES4 A;  2PU4 A;  5CED A;  5EV0 A;  4DMZ A;  4OPY A;  5L09 A;  4ARZ A;  4XXR A;  2I9V A;  3VE4 A;  4FCF A;  4N92 A;  5A91 A;  3QNB A;  3Q81 A;  3LYX A;  5M1A A;  2EXB A;  4XUX A;  4D60 A;  3SH8 A;  2OWH A;  3L9K A;  4OON A;  3JVV A;  3LR4 A;  4O01 A;  2JCH A;  4LV0 A;  3S1Y A;  5DF8 A;  3IS2 B;  3UY6 A;  1S6R A;  2DCF A;  3GTC A;  1LL9 A;  2W3F A;  2W3D A;  2K2N A;  3IBJ A;  1CJF A;  3QP1 A;  5L10 A;  3UE0 A;  3MZD A;  3SW1 A;  2HP6 A;  5BOH A;  3AGE A;  4I5S A;  4S2N C;  4PHT A;  1IKG A;  1K56 A;  3IWQ A;  4MDZ A;  1HD8 A;  4QY5 A;  1XXM A;  1KGE A;  3UNW A;  1JNU A;  4FUW A;  1ZG4 A;  1ZG6 A;  2HV1 A;  3ULF A;  3LR5 A;  2J7V A;  3LCE A;  3VFF A;  1GHP A;  3FYZ A;  5FAS A;  4BLM A;  4XT2 B;  1NYM A;  4CLC A;  1WYC A;  5EVI A;  2PD8 A;  3RTY A;  4NET A;  2W1R A;  1KGF A;  4R38 A;  2KOI A;  5E2G A;  4P85 A;  5DFX A;  3M2J A;  4WBG A;  5DKK A;  2PDR A;  2ZC7 A;  4R0Q A;  1PI4 A;  2P9V B;  4PM5 A;  3KX0 X;  4E3J A;  5GHZ A;  4JGQ A;  3C4O A;  3CZD A;  5LBR A;  5HD3 A;  3O86 A;  4OQG A;  2W3E A;  4Y17 A;  4RYE A;  3PBR A;  1YSP A;  4GOG A;  2Y2Q A;  3KYE A;  2WGI A;  1YLY A;  3DW0 A;  5EVI C;  4UQI S;  1MY8 A;  2FZ0 A;  3FG8 A;  4MMN A;  1X0O A;  3C30 A;  3OCL A;  4DJ2 A;  3O88 A;  3G2Y A;  2EFU A;  4E3O A;  4MBH A;  3BJN A;  4KZ3 A;  3MR0 A;  3ZVW A;  5IT5 A;  3FKV A;  1OTB A;  3BYD A;  3BEB A;  5HDC A;  1CEF A;  1S0W A;  2Q9M A;  4ME4 A;  3E4P A;  1TDL A;  1G68 A;  4HI4 A;  4EW7 A;  5D3O A;  4ZBE A;  2W27 A;  5FAQ A;  3HLG A;  3VMA A;  3H82 A;  4GN2 A;  3TG9 A;  2ZC3 B;  3CG5 A;  2QYB A;  4RX3 A;  3QHY A;  2Y8H A;  2UWX A;  5KZH A;  1YT4 A;  4BWI A;  1XA1 A;  1QME A;  2QHK A;  3UPN A;  3E98 A;  3LUQ A;  5HAP A;  4DJ3 A;  4KZ5 A;  2NUP C;  3N4I A;  4PPR A;  1DP6 A;  3CHW P;  5IS1 A;  1XP4 A;  2P74 A;  5JYP A;  3CAX A;  5FDS A;  3DTE A;  3LEQ A;  3HL9 A;  4Q0J A;  2XA7 M;  3OPL A;  3UB9 A;  1ODV A;  2ZM2 A;  3Q82 A;  5M18 A;  2A3U A;  3T4S A;  2IA2 A;  1YAX A;  4IJG A;  5GHY A;  1NLZ A;  2ZM0 A;  4YIN A;  4GHI A;  3C5A A;  3LEZ A;  1LSV A;  4LEN A;  3T4T A;  1XPB A;  5DVA A;  5AQ9 A;  5HSQ A;  3HVF A;  4WMC A;  3WS1 A;  4LPZ A;  4F3L B;  5HPF A;  1ESU A;  2LB5 A;  4Y3I A;  5AJG A;  4GD8 A;  3D72 A;  5J8X A;  1T19 A;  3O5Y A;  1SCW A;  3JYI A;  3GMW A;  2O9C A;  1FSY A;  5F6A A;  4D2O A;  2VZW A;  4ZJ1 A;  2Y2G A;  1PNE A;  3B33 A;  1TS7 A;  3BQA A;  1LSW A;  3OZH A;  1VEU A;  5EVI D;  3QP8 A;  1MWS A;  2G2W A;  4P6B A;  2OLV A;  3N8S A;  1AWI A;  1CEG A;  5FDH A;  3LIF A;  2XRN A;  1UWN X;  3V3R A;  1SKO A;  1S4S A;  1IYQ A;  2EX6 A;  3B3X A;  3SS3 A;  4X56 A;  3KYZ A;  1L0E A;  4M4X A;  1TDG A;  1TEM A;  4OOM A;  3CIT A;  2Y59 A;  5E43 A;  1BZA A;  2PU2 A;  4IVI A;  1JTG A;  3S7Q A;  3C7U A;  2Y2M A;  2Y91 A;  3VP0 A;  1ES3 A;  3HLE A;  4EEU A;  4EXO A;  5L8M A;  4MCW A;  1K57 C;  1NYY A;  2HF6 A;  2V1A A;  4L9G A;  4QPR A;  4CPK A;  1FSW A;  3LIE A;  4OKP A;  3LGO A;  4E3I A;  3LI9 A;  3DTK A;  1EI5 A;  3DWZ A;  3HBR A;  5A8B A;  4WYY A;  1P97 A;  5EVI B;  3RH8 B;  2ZMA A;  5KSH A;  3OC2 A;  5HWW A;  2D01 A;  5FI2 A;  1DJC A;  1ES2 A;  3O3V A;  1GSX A;  4I3I A;  5KSC A;  4JGR A;  1UWP X;  1K6R A;  5HL6 A;  4R3A A;  1K0K A;  4EET B;  5EVL A;  2XEP A;  1WYB A;  3VOY A;  2RCX A;  3HLB A;  4OLG A;  3BEC A;  3UE3 A;  5F68 A;  4OPR A;  5CGX A;  3IH8 A;  3N7W A;  1XFN A;  4B9O A;  1DJB A;  1NZO A;  2W0N A;  3A3I A;  1CF0 A;  2VGJ A;  1J3W A;  3F1N B;  5DFY A;  3IF5 A;  1ZC2 A;  2IWD A;  1XA7 A;  2EWV A;  3EEH A;  5FQM A;  1CI9 A;  2A2L A;  4WF0 A;  4WZ5 C;  3H7W B;  1OTI A;  4ARZ B;  4BQM A;  3S4X A;  4KZA A;  1LI0 A;  3T1R A;  4LLO B;  4B4Z A;  3F1O A;  2Z2M B;  4FSF A;  3VP1 A;  1K6S A;  1W63 M;  2JBF A;  3TE8 A;  3EQV A;  3IHA A;  3OBF A;  4KZ8 A;  3A3J A;  3O87 A;  2WKP A;  3T4K A;  1RCJ A;  4L9E A;  4HNB A;  3D9Y A;  3NI9 A;  3A0V A;  4AFI A;  4C6Y A;  1W7F A;  3T4J A;  4KQD A;  1N9N A;  3TJZ C;  5FAT A;  4MEZ A;  3S7O A;  4R1G A;  1PW8 A;  4BMW A;  1XJ4 A;  1YLZ A;  2R78 A;  3QP2 A;  5HFO A;  3BFC A;  3V5M A;  4XT2 A;  3IXD A;  3ZQ5 A;  3OOV A;  4UHU A;  3V39 A;  2I72 A;  2IWB A;  1H8Z A;  2OOL A;  2WKH A;  4EWF A;  1M6K A;  4X1L A;  1PI5 A;  3PBT A;  4DDS A;  2P9V A;  3U4L P;  4CLC E;  1OTA A;  1FOF A;  3NIA A;  2PRF A;  4EU0 A;  3BFG A;  2M7U A;  3VV4 A;  4OOL A;  2J3T D;  1KDW A;  5FEG A;  1PRQ A;  4X1M A;  2WK0 A;  3PR6 A;  3IH9 A;  2H5S A;  2J9P A;  1IEM A;  2XF3 A;  2ZC5 B;  1NLY A;  5EM0 A;  4BJP A;  4BEN A;  1S67 L;  1HTZ A;  4K91 A;  3ZG9 B;  3CMZ A;  3BLM A;  3HLF A;  4QJG A;  4DE3 A;  2QJ7 A;  1ALQ A;  3N6I A;  5I5L A;  4JGP A;  1ES5 A;  4E3L A;  1FR6 A;  3TRC A;  5TBM A;  1TF1 A;  4I39 A;  4OQH A;  4FH2 A;  3RFB A;  5IU1 A;  5GL9 A;  1F5M A;  1PYY A;  1BT5 A;  4X55 A;  5TBM B;  5L2F A;  1W8Q A;  1PWC A;  2JKT I;  2A49 A;  3GQZ A;  3IWI A;  3ZG8 B;  5HAI A;  1YMX A;  4OOY A;  1C3B A;  1K55 C;  2ZLY A;  4X53 A;  4ZDX A;  1BLS A;  3MFD A;  3MF0 A;  4EER A;  2ZC6 B;  2M1C A;  4ZJ3 A;  4MBF A;  4K0W A;  3HJI A;  4BBU A;  2Y2P A;  4JGO A;  3Q1F A;  3ZFZ A;  2ZD8 A;  3QNC A;  1K25 A;  2ZL1 A;  1KE4 A;  5GLC A;  2QPN A;  3G31 A;  3W4Q A;  3ZNY A;  2L1M A;  1XKZ A;  1STZ A;  3ZGA B;  4DXC A;  5GLB A;  3T1X A;  3KSI A;  4N1H A;  2K31 A;  2WGW B;  2VA0 A;  1OTD A;  1FIL A;  2ACG A;  2V0W A;  3D4F A;  3R7W B;  4F3L A;  1OJG A;  2WAD A;  3BY9 A;  3HLD A;  1K4F A;  3NOP C;  4YOF A;  4E04 A;  4Y0T A;  4HH3 A;  3Q7Z A;  3NUL A;  4I3A A;  3OPP A;  4KUK A;  3NY4 A;  2Y2O A;  4JXS A;  2E8I A;  4IBR A;  4HJ3 A;  3EEA A;  3BM6 A;  1KE3 A;  5MC7 A;  2J8Y A;  2LB9 A;  1K54 A;  3M6H A;  1TS6 A;  2VX8 A;  3LIA A;  2XFT A;  4LRZ E;  4LV3 A;  1DY6 A;  3OCN A;  2HJE A;  3GSG A;  3PBN A;  1Q2P A;  1EW0 A;  1S66 L;  1N9O A;  4GS9 B;  1NZU A;  4WZ5 A;  3VP3 A;  1LT0 A;  2VLG A;  1ONH A;  3ZVT A;  1P0Z A;  2Z6D A;  1KOU A;  4P6Z M;  4QB8 A;  2Y2H A;  3UB8 A;  5IHV A;  1YQS A;  4KG6 A;  3UB6 A;  5DJT A;  1WE4 A;  3KYQ A;  2WUQ A;  3AGD A;  3G4P A;  2OWJ A;  5EEC A;  5GLA A;  4RX2 A;  1FCM A;  2Y2N A;  4UA7 A;  1I2S A;  2A24 A;  2JHE A;  1E3U A;  4NEE D;  4E3M A;  4OPZ A;  4UAA A;  3T4L A;  5HPI A;  4O0P A;  3LI8 A;  5A93 A;  3A0S A;  1ESI A;  4HJ4 A;  4N9L A;  2P7J A;  2OSU A;  2V2F F;  3ZG5 A;  3FWL A;  3WS0 A;  2H28 A;  1OME A;  1H8M A;  3HCY A;  4S2P A;  4FD8 A;  1Y28 A;  1IOU A;  1GCE A;  3WWX A;  2B02 A;  1OPX A;  1JWP A;  3IHB A;  4YWZ A;  1SKF A;  3VFH A;  4UQI M;  4R70 A;  3ZNT A;  4OH0 A;  2BAS A;  4Q8I A;  4B88 A;  2BG1 A;  1L3L A;  2VV6 A;  3BFE A;  2XD5 A;  5E2H A;  3P09 A;  3DBA A;  2R9X A;  3PAG A;  4R3B A;  4IED A;  2EXA A;  3CUE A;  2W1T B;  1F2K A;  4R4R A;  5I94 A;  1TS0 A;  4BBT A;  4NXF A;  3K3C A;  5CEB A;  3N8L A;  1N9B A;  3B47 A;  3E0Y A;  2R9W A;  4Z1W A;  4EBP A;  5F69 A;  3Q7V B;  4Y15 A;  2B18 A;  3FV7 A;  2X01 A;  2OV5 A;  3UB5 P;  4Q0H A;  1JVJ A;  5GLD A;  4JLF A;  2QWS A;  3JPU A;  1ERO A;  3SH9 A;  3EQU A;  4JF5 A;  3VOZ A;  3B42 A;  3NBL A;  3LO7 A;  3SS5 A;  4BL3 A;  3C4P A;  3HUO A;  2YKH A;  3H82 B;  2BLS A;  3MXR A;  1GA9 A;  4HP4 A;  1CI8 A;  3FPW A;  3UPO A;  3NC8 A;  4LRX C;  3CWF A;  3E2K A;  4H6J B;  2ZC4 B;  5FQI A;  4KG2 A;  1U60 A;  2JKT M;  4HIA A;  1T1B A;  2INW A;  5L07 A;  1J9M A;  3HRE A;  1XJ3 A;  3HJK A;  4M3K A;  4H6J A;  4HH2 A;  4U3T A;  3PBQ A;  1RGZ A;  3VSK A;  5FI6 A;  5HAQ A;  4DN0 A;  1ACF A;  2JKR M;  2P08 A;  4IHQ A;  3GEC A;  4BBV A;  5AQA A;  4KZ4 A;  5AQB A;  3BWL A;  1XGJ A;  2H0T A;  3MBZ A;  2QMI A;  3A0R A;  4NK3 A;  1YM1 A;  3IXB A;  2D02 A;  4Y5F A;  2JKG A;  4GNU A;  5HX9 A;  4O7D A;  3C2W A;  3G35 A;  4JF4 A;  5FAP A;  1FIK A;  2W3H A;  5HWT A;  3H9W A;  4JXG A;  1ZTU A;  1E3U D;  1ERM A;  2DRW A;  2WAF A;  4MN7 A;  5G4Z A;  4MN5 A;  1L0D A;  3LID A;  2V1B A;  3WRT A;  1BUE A;  4NXE A;  2XR0 A;  4OQ0 A;  3ZYT A;  3FC7 A;  3EWK A;  4LCM A;  1NWZ A;  1D1J A;  4PM9 A;  2ZQ8 A;  2WGV A;  3IX8 A;  5CX7 A;  4WMC D;  1DJA A;  3W2Z A;  4R23 A;  3SS4 A;  1ONG A;  2PAV P;  4P87 A;  1MWR A;  4CLC C;  1N4O A;  1CQA A;  4HEF A;  3MS6 A;  4RA7 A;  3K2N A;  4BL2 A;  2DNS A;  2GJ3 A;  2H10 A;  1IKI A;  2VGK A;  2V20 A;  1V9Y A;  5TGF A;  1FR1 A;  4MLL A;  1E25 A;  2B95 A;  4KQO A;  4S2O A;  4IBX A;  2PR5 A;  3UB7 A;  3LIC A;  2ZBB A;  3MQQ A;  4ZTK A;  5J3W A;  1FQG A;  5FEF A;  5EOE A;  1VQQ A;  5FQJ A;  4GDB A;  3TSG A;  1YLW A;  2FFY A;  2HGV A;  1PZP A;  1MPL A;  2ZM8 A;  5DF9 A;  4EBL A;  4HP9 A;  3HUN A;  1YKD A;  1W5D A;  3EGX C;  5TFQ A;  4Y2F A;  1KE0 A;  1SHV A;  3IQA A;  3BRM A;  1JTD A;  1SDN A;  3G32 A;  4S2I A;  1RGY A;  3A3E A;  2VEA A;  3HUM A;  3IWO A;  2XD1 A;  2HDS A;  3M2K A;  3GDI A;  1QMF A;  3BLS A;  3CPT B;  3MXS A;  4KZ7 A;  1TVF A;  3DTI A;  2L4R A;  4A5R A;  2JKR I;  2PBY A;  4HBT A;  4KQQ A;  1D06 A;  1K4E A;  3G2Z A;  4N1X A;  5CHU A;  2VJW A;  3T4Q A;  2YKF A;  2Y2I A;  4EQI A;  4CQH A;  4BD0 A;  3ISG A;  3Q07 A;  1NXY A;  1HLU P;  5AQ7 A;  2H0Y A;  1GA0 A;  5FL3 A;  2V8C A;  1BTL A;  4Q0I A;  4DE0 A;  1KGG A;  3FZC A;  3HLW A;  3LIB A;  2PYP A;  3MFX A;  2P04 A;  2VGL M;  1RP5 A;  1MKI A;  4RQ9 A;  4L9F A;  3SH7 A;  4JF6 A;  3AGF A;  3K3D A;  3MXQ A;  3IX3 A;  4Y0O A;  2UV0 E;  2AVX A;  1EWZ A;  2WKI A;  4B4X A;  1V9Z A;  2A24 B;  4OP8 A;  4KUO A;  4DE2 A;  4S2N A;  2ZQ7 A;  1DRM A;  1H0M A;  5CXW A;  2Q0O A;  5HW3 A;  4YFM A;  1G5U A;  4HHD A;  1SDE A;  4KZ6 A;  5AVF A;  1OT9 A;  2G2U A;  4PKY G;  3IS2 A;  1ZHH B;  3W8K A;  4OQI A;  5F1G A;  2HP9 A;  5GHX A;  3TOI A;  4LCL A;  4X69 A;  3T1S A;  2EA9 A;  4O8G A;  1YLT A;  1LHY A;  2J3W A;  1W63 Q;  5G4Y A;  2O9B A;  5DF7 A;  1OJ5 A;  1T1C A;  2WYX A;  2HZ5 A;  2KX6 A;  3D3O A;  1GSV A;  1LI9 A;  1AXB A;  3FKW A;  4Y0U A;  1XJ6 A;  1W8Y A;  3BQ8 A;  1NRF A;  5TJJ A;  4WUJ A;  1Z09 A;  2L0W A;  4GHI B;  2Y2L A;  3IXH A;  3OPH A;  3WS5 A;  4F94 A;  3IF6 B;  2Z2L B;  3MQ0 A;  3BFD A;  5CTN A;  1KVM A;  2WZX A;  2GNX A;  3UDX A;  4WEK A;  1K54 C;  3MZF A;  4E6X A;  1Z6F A;  4NG2 A;  4Z9Q A;  3PBO A;  4IVK A;  5EFW A;  4WM9 A;  3BY8 A;  2XDM A;  1W79 A;  3CUE C;  2O0Y A;  1VB6 A;  4OPQ A;  3T1Q B;  2PT7 A;  2XSS A;  3NEC A;  4IUH A;  3IX4 A;  3E4Q A;  4GKU A;  1IEL A;  5HDD A;  2OAQ 1;  5C5K A;  4MNR A;  3RJU A;  2WZZ A;  4ZJ2 A;  4CLC D;  1MC0 A;  4HJ6 A;  4G3V A;  1VET B;  1SKO B;  4CJN A;  5A90 A;  3ZG7 B;  4S2K A;  4WEJ A;  4XUZ A;  1Y54 A;  5J7E A;  4KZB A;  2WKE A;  1G6O A;  3MKF A;  1N9L A;  4X68 A;  3S22 A;  4EES A;  3S7N A;  2VV8 A;  4EV4 A;  5U47 A;  3LR3 A;  4NXB A;  4PAU A;  3WRZ A;  4HQA A;  5E2F A;  5DKL A;  3PBS A;  5F5Y A;  3GV9 A;  5E2E A;  3UMD A;  5DTT A;  2QKP A;  4KQR A;  5CHJ A;  3UDF A;  1A0K A;  1H3Q A;  2XQZ A;  2Q9N A;  4GD6 A;  2GDN A;  5TR7 A;  4WN5 A;  2ZMV A;  4QY6 A;  4LV1 A;  1BUL A;  3VP2 A;  3MQO A;  3ZHH A;  2E8J A;  5EE8 A;  1PIO A;  2JC7 A;  2J9O A;  4C75 A;  2ZL1 B;  1MXO A;  3S7P A;  2XFS A;  2Z6C A;  2ZQ9 A;  4Y7P A;  3U2A A;  1MKM A;  4FOF A;  3ZDJ A;  4MN6 A;  3WS2 A;  3G6O A;  3HLC A;  1XX2 A;  5FQ9 A;  5FA7 A;  3C38 A;  3TW8 A;  4JKT A;  5CRF A;  2HDQ A;  4L0L A;  3CJM A;  1GSW A;  1MBL A;  4P0M A;  3DWK A;  3VOL A;  3MKE A;  2QJ5 A;  4WL9 A;  2EX2 A;  4S2M A;  2EX9 A;  2NUT C;  1TS8 A;  4JXV A;  5HL1 A;  1HZO A;  1NRJ A;  4UA9 A;  5HWV A;  2M7V A;  1M40 A;  5FSR A;  1K55 A;  4GW9 A;  2Y4A A;  4S2L A;  3BW6 A;  5FQQ A;  1L0G A;  4WZ4 A;  1OT6 A;  2VKS A;  2PD7 A;  5FI7 A;  3E4O A;  4FTX A;  4KEN B;  4EQ1 A;  3MJQ A;  3IT9 A;  2PYR A;  4GLQ A;  3V3S A;  4ZAM A;  3ICY A;  4YNR A;  5HDS A;  3SZT A;  4K08 A;  2WKR A;  2B5R A;  2CC1 A;  4GS9 A;  4E3K A;  5DTS A;  3MMH A;  4II7 A;  4G3K A;  1KVL A;  3NCK A;  3VP4 A;  3G30 A;  2W3G A;  2CMN A;  4N9K A;  4PM6 A;  4NKP A;  4QHC A;  3E2L A;  1S1Y A;  4S2J A;  4LRY C;  5DJU A;  3P01 A;  5EUA A;  4GB7 A;  3A3D A;  1YPR A;  2J3T C;  3VE3 A;  2X02 A;  5CER A;  4GDN A;  3GRJ A;  3PYP A;  2O99 A;  4GZB A;  2HP5 A;  2BTF P;  3I7J A;  3FPV A;  3VSL A;  1K38 A;  3WS4 A;  3UPP A;  4LFU A;  1Q2Q A;  2KDK A;  4PM7 A;  5CGW A;  4ESP A;  1H5X A;  3P98 A;  2J80 A;  3IF6 A;  3PAE A;  4JXW A;  3UN7 A;  4ID4 A;  4GCZ A;  4MBK A;  4K0X A;  2WAE A;  3JVU A;  1XJ2 A;  3LY3 A;  2Y55 A;  3NHQ A;  3ITB A;  4EBN A;  4OLD A;  2GX5 A;  4X25 A;  5F83 A;  2MJ6 A;  2ZOH A;  2PHY A;  3QP5 A;  1T18 A;  3NJA A;  4G3W A;  4CLC B;  1H8Y A;  2JN7 A;  4JBF A;  3NDE A;  4HOI A;  2V1Z A;  3NDG A;  3ZCZ A;  3CI6 A;  3IBR A;  4EEP A;  3ZG0 A;  2IWC A;  3NOU C;  3W4O A;  2W1T A;  3NOT C;  4OP5 A;  2GZA A;  2HPB A;  4DF6 A;  5A92 A;  2OLU A;  3H7W A;  4BD1 A;  1P9W A;  1PWG A;  1VHM A;  4KG5 A;  1MWT A;  1ERQ A;  4ZRR A;  1LL8 A;  3UME A;  3LR0 A;  4B93 A;  2WKQ A;  4Y13 A;  2JKF A;  1K56 D;  3F1N A;  2DMW A;  1UGU A;  4P6Z S;  4ETZ A;  4UEY A;  2G7U A;  4U0T A;  3DAV A;  1FCO A;  4R3J A;  2ZMF A;  2O9A A;  4WLA A;  1FCN A;  1K57 A;  4GJ4 A;  1JWZ A;  3F1P B;  4KZ9 A;  1OTE A;  2Y2J A;  3OLO A;  4LGW A;  5CEC A;  3F1O B;  4EUV A;  3F1P A;  2EWW A;  2VGL S;  3W4P A;  2ZQC A;  4FH4 A;  1BYW A;  1P9R A;  3KSF A;  1WA9 A;  2C6W B;  1YSQ A;  2WGW A;  1IYP A;  2K7S A;  1DP8 A;  1PZO A;  1F98 A;  3KSH A;  4DRT A;  1SZV A;  1YMS A;  4C3Q A;  1IYS A;  2PBD P;  3R7W A;  1L0F A;  1PWD A;  4JPM A;  4HY8 A;  5EM1 A;  3PTE A;  5F82 A;  3M6B A;  4I3J A;  1BLH A;  5EOO A;  4PKY A;  3UE6 A;  4DXB A;  1S1Z A;  2ZJ9 A;  3UO9 A;  3QP6 A;  2Y2K A;  3C7V A;  5JYO A;  1XFQ A;  1YLJ A;  2ZQA A;  4H8R A;  5AVE A;  5KMW A;  5HAR A;  1D7E A;  3C8C A;  2ZOI A;  2JE5 A;  5EVE A;  1GHI A;  4UA6 A;  1VEU B;  3V50 A;  3T4O A;  2V0U A;  2V8F A;  3PXP A;  1NJ4 A;  2V9A A;  1LLB A;  5DTK A;  3UE1 A;  1I2W A;  3DTM A;  3GVB A;  1VM1 A;  2HDR A;  2OAP 1;  3UDI A;  3MZE A;  3Q7V A;  3R4K A;  3CLO A;  3LFV A;  2XA7 S;  5HZH A;  2RL3 A;  3P7N A;  1O07 A;  1KDS A;  3RXW A;  5KIZ A;  3ITA A;  1NY0 A;  1F9I A;  2EFX A;  1S4R A;  3QP4 A;  3N8R A;  1MZU A;  1IYO A;  1JWV A;  1BSG A;  3A3F A;  2XRO A;  2ZQD A;  1PW1 A;  1VET A;  3GR2 A;  4OVD A;  1MWU A;  2EX8 A;  5G18 A;  5CTM A;  1YLP A;  3SOI A;  2XLN A;  1T1A A;  1CK3 A;  5HD5 A;  4QD4 A;  4U0X A;  3OPR A;  1HVB A;  5CGS A;  2XH9 A;  2PR6 A;  2VK3 A;  1I5Q A;  3V67 A;  2QZ6 A;  3T50 A;  3PHY A;  1BLP A;  1G28 A;  2C5W B;  2KLI A;  4NXG A;  4ETX A;  1G6A A;  2VV7 A;  2X71 A;  4E6W A;  4HBU A;  5J4E A;  1ZKJ A;  1PFL A;  1LL5 A;  3KO6 A;  1XGI A;  3CPT A;  3EGD C;  3IXG A;  4I38 A;  1O7E A;  1Y4O A;  4X6T A;  4QWO A;  2Y79 A;  1IFQ A;  2FFF B;  4R4S A;  5CHM A;  3G34 A;  4HES A;  4R6L A;  3T12 B; 
#chains in the Genus database with same CATH homology
 3KSG A;  4WEL A;  1DP9 A;  1H3Q A;  1XFN A;  4B9O A;  2YKH A;  4WN5 A;  3EOI A;  2W0N A;  3H82 B;  2ZMV A;  4HP4 A;  3FPW A;  1TD5 A;  5K5B A;  2HJ9 C;  3MQO A;  3F1N B;  4LRX C;  3CWF A;  4H6J B;  5DFY A;  4IUK A;  2JKT M;  4HIA A;  3S7P A;  2Z6C A;  2EWV A;  3EEH A;  1LSX A;  1T1B A;  2INW A;  3U2A A;  1MKM A;  2A2L A;  4WF0 A;  4FOF A;  3H7W B;  1OTI A;  1XJ3 A;  4MN6 A;  3G6O A;  3HJK A;  2FH5 A;  4ARZ B;  4H6J A;  4HH2 A;  4LLO B;  3F1O A;  3PBQ A;  3C38 A;  3TW8 A;  4FSF A;  4DN0 A;  4DMZ A;  2JKR M;  2P08 A;  4L0L A;  1GSW A;  4IHQ A;  4ARZ A;  1W63 M;  2I9V A;  3GEC A;  3VE4 A;  3TE8 A;  3EQV A;  4BBV A;  3OBF A;  3VOL A;  2QJ5 A;  3LYX A;  3BWL A;  2WKP A;  4WL9 A;  3T4K A;  4L9E A;  2OWH A;  4HNB A;  3A0R A;  3JVV A;  3A0V A;  4AFI A;  2D02 A;  4Y5F A;  3LR4 A;  2NUT C;  1TS8 A;  1N9N A;  4KQD A;  4O01 A;  3T4J A;  3TJZ C;  3S7O A;  1NRJ A;  5HWV A;  4BMW A;  3C2W A;  1XJ4 A;  2M7V A;  2W3H A;  5HWT A;  2R78 A;  4GW9 A;  3H9W A;  3BW6 A;  4XT2 A;  1ZTU A;  3ZQ5 A;  4MN7 A;  1OT6 A;  3OOV A;  2VKS A;  4MN5 A;  5G4Z A;  3IS2 B;  2PD7 A;  3LID A;  3E4O A;  2OOL A;  2V1B A;  4EQ1 A;  2W3F A;  3MJQ A;  2W3D A;  4NXE A;  3PBT A;  2K2N A;  3ZYT A;  2PYR A;  3FC7 A;  4GLQ A;  3EWK A;  4CLC E;  1OTA A;  3IBJ A;  3ICY A;  1NWZ A;  4EU0 A;  4YNR A;  2M7U A;  3VV4 A;  4OOL A;  5HDS A;  4K08 A;  2J3T D;  3SW1 A;  2WKR A;  4GS9 A;  4I5S A;  3MMH A;  4II7 A;  4PHT A;  4G3K A;  5CX7 A;  3W2Z A;  3PR6 A;  2W3G A;  2CMN A;  4MDZ A;  4NKP A;  4CLC C;  1NLY A;  1S1Y A;  4LRY C;  1JNU A;  5DJU A;  4BJP A;  3P01 A;  1S67 L;  2HV1 A;  3K2N A;  3ULF A;  3LR5 A;  2GJ3 A;  2J3T C;  3VE3 A;  1V9Y A;  4XT2 B;  4CLC A;  3PYP A;  4KQO A;  2O99 A;  2PD8 A;  2QJ7 A;  3RTY A;  2W1R A;  2PR5 A;  5I5L A;  4JGP A;  3UB7 A;  3FPV A;  3LIC A;  4R38 A;  2KOI A;  2ZBB A;  5DFX A;  3MQQ A;  5J3W A;  2KDK A;  5DKK A;  2PDR A;  3TRC A;  5TBM A;  1TF1 A;  4I39 A;  3KX0 X;  2HGV A;  3RFB A;  2J80 A;  5IU1 A;  4JGQ A;  1F5M A;  4GCZ A;  5LBR A;  5TBM B;  5HD3 A;  5DF9 A;  2JKT I;  4HP9 A;  1YKD A;  2W3E A;  3JVU A;  1XJ2 A;  3EGX C;  3PBR A;  1YSP A;  4Y2F A;  3NHQ A;  4UQI S;  2GX5 A;  2FZ0 A;  3MF0 A;  3FG8 A;  4EER A;  2MJ6 A;  2ZOH A;  4MMN A;  1X0O A;  2M1C A;  2VEA A;  2PHY A;  3C30 A;  1T18 A;  3NJA A;  3OCL A;  4G3W A;  4CLC B;  4DJ2 A;  2JN7 A;  4HOI A;  3HJI A;  4BBU A;  3GDI A;  3BJN A;  3CI6 A;  3IBR A;  4JGO A;  3MR0 A;  5IT5 A;  4EEP A;  1OTB A;  3NOU C;  2W1T A;  3NOT C;  2GZA A;  5HDC A;  2L1M A;  2L4R A;  4ME4 A;  3E4P A;  3H7W A;  1STZ A;  2JKR I;  1P9W A;  4HI4 A;  4EW7 A;  1VHM A;  2W27 A;  1D06 A;  2VJW A;  3H82 A;  3KSI A;  1LL8 A;  4ZRR A;  2K31 A;  2YKF A;  3LR0 A;  3T4Q A;  3UME A;  4B93 A;  2WKQ A;  2VA0 A;  2QYB A;  3F1N A;  1OTD A;  2DMW A;  1UGU A;  4P6Z S;  4ETZ A;  4UEY A;  2Y8H A;  4CQH A;  2G7U A;  2V0W A;  4BWI A;  2QHK A;  3E98 A;  3LUQ A;  3R7W B;  4F3L A;  1OJG A;  4DJ3 A;  2ZMF A;  2O9A A;  2NUP C;  3BY9 A;  4WLA A;  5FL3 A;  4Q0I A;  1DP6 A;  3NOP C;  4GJ4 A;  4YOF A;  4E04 A;  3LIB A;  5IS1 A;  3F1P B;  2PYP A;  3MFX A;  2P04 A;  4HH3 A;  3CAX A;  2VGL M;  4I3A A;  1OTE A;  4L9F A;  4RQ9 A;  4KUK A;  3K3D A;  4Q0J A;  2XA7 M;  3OLO A;  3UB9 A;  3MXQ A;  4HJ3 A;  1ODV A;  3F1O B;  3EEA A;  3T4S A;  4EUV A;  3F1P A;  5MC7 A;  2IA2 A;  2LB9 A;  2EWW A;  1YAX A;  2VGL S;  4IJG A;  1TS6 A;  1V9Z A;  2VX8 A;  1NLZ A;  2A24 B;  1BYW A;  4KUO A;  3LIA A;  4LRZ E;  4GHI A;  1P9R A;  3KSF A;  1LSV A;  1WA9 A;  3OCN A;  1YSQ A;  2HJE A;  3PBN A;  3T4T A;  2K7S A;  1EW0 A;  1DRM A;  1DP8 A;  1F98 A;  1S66 L;  3KSH A;  1N9O A;  4GS9 B;  4HHD A;  5HSQ A;  5AVF A;  4LPZ A;  3R7W A;  4F3L B;  5HPF A;  1OT9 A;  1LT0 A;  4PKY G;  4HY8 A;  3IS2 A;  2LB5 A;  1ZHH B;  2VLG A;  4Y3I A;  1P0Z A;  2Z6D A;  5AJG A;  1KOU A;  3D72 A;  4I3J A;  4P6Z M;  1T19 A;  3O5Y A;  2EA9 A;  4O8G A;  3UB8 A;  2O9C A;  5F6A A;  2J3W A;  1W63 Q;  4PKY A;  2VZW A;  5G4Y A;  3UE6 A;  2O9B A;  1OJ5 A;  1S1Z A;  1T1C A;  3UB6 A;  2KX6 A;  3B33 A;  5DJT A;  3KYQ A;  1TS7 A;  3BQA A;  3D3O A;  1LSW A;  1GSV A;  2OWJ A;  1XJ6 A;  1XFQ A;  3BQ8 A;  5AVE A;  1D7E A;  2A24 A;  2JHE A;  3C8C A;  4NEE D;  4WUJ A;  2ZOI A;  5TJJ A;  3LIF A;  2XRN A;  3T4L A;  1UWN X;  2L0W A;  5HPI A;  4GHI B;  4O0P A;  3LI8 A;  1S4S A;  3T4O A;  2V0U A;  3PXP A;  3A0S A;  3KYZ A;  4HJ4 A;  2V9A A;  2P7J A;  4M4X A;  3MQ0 A;  4OOM A;  3CIT A;  2GNX A;  4WEK A;  2H28 A;  2OAP 1;  1H8M A;  3HCY A;  1Y28 A;  1IOU A;  3R4K A;  3CLO A;  2B02 A;  3LFV A;  1OPX A;  2XA7 S;  3PBO A;  4YWZ A;  5HZH A;  5EFW A;  3S7Q A;  3P7N A;  3BY8 A;  4UQI M;  4R70 A;  5KIZ A;  1F9I A;  2BAS A;  3CUE C;  2O0Y A;  1VB6 A;  1S4R A;  1MZU A;  2PT7 A;  4EEU A;  2XSS A;  4EXO A;  2XRO A;  2VV6 A;  4MCW A;  5L8M A;  4IUH A;  2HF6 A;  2V1A A;  3E4Q A;  4L9G A;  3DBA A;  4QPR A;  5HDD A;  3LIE A;  2OAQ 1;  5C5K A;  1T1A A;  5HD5 A;  4CLC D;  3LI9 A;  1MC0 A;  4HJ6 A;  4G3V A;  5A8B A;  1P97 A;  3CUE A;  2PR6 A;  2W1T B;  3V67 A;  3RH8 B;  5KSH A;  3OC2 A;  3T50 A;  3PHY A;  1G28 A;  1TS0 A;  4BBT A;  4WEJ A;  2D01 A;  5HWW A;  4NXF A;  3K3C A;  2KLI A;  4NXG A;  4ETX A;  3B47 A;  2VV7 A;  5J7E A;  3E0Y A;  1G6O A;  4Z1W A;  5J4E A;  5F69 A;  1GSX A;  1N9L A;  4I3I A;  4EES A;  2B18 A;  3S7N A;  2VV8 A;  3KO6 A;  4JGR A;  3LR3 A;  4NXB A;  3EGD C;  4PAU A;  4Q0H A;  1UWP X;  4HQA A;  4I38 A;  5HL6 A;  4R3A A;  2QWS A;  5DKL A;  3PBS A;  5F5Y A;  4EET B;  2Y79 A;  1IFQ A;  3UMD A;  3EQU A;  2QKP A;  3B42 A;  4R6L A;  3UE3 A;  5F68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...