2W3EA

Oxidized structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
molecule tags Transferase
source organism Mycobacterium tuberculosis
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3eA00
5TJJA 2W3EA 4ETXA 3MQ0A 5DFYA 2O0YA 1YSPA 2W1RA 2W3FA 3KSGA 3C2WA 4O0PA 1STZA 2G7UA 3W2ZA 4O8GA 2LB5A 4Q0HA 4GW9A 5L8MA 3CITA 4MMNA 4ETZA 3S7PA 3OOVA 2M7VA 1TD5A 4Y2FA 2QYBA 2IA2A 1YSQA 3S7QA 2M7UA 1VHMA 2O9CA 5I5LA 3EEAA 3BJNA 4IJGA 2XRNA 3ZQ5A 4R70A 4RQ9A 4Z1WA 2OOLA 3K2NA 4IUHA 4O01A 3S7OA 3OBFA 2Y79A 5K5BA 2B18A 3MMHA 3G6OA 4E04A 2VKSA 4IUKA 3KO6A 1MC0A 4DN0A 2O9AA 4ME4A 4YNRA 4LRYC 4YOFA 3R4KA 2KLIA 3O5YA 2XSSA 3IBJA 4LRZE 2ZMFA 5DFXA 2W3HA 3NOPC 3LFVA 1TF1A 4Q0IA 2HGVA 5AJGA 1MKMA 3NOTC 2W3DA 3HCYA 4G3WA 1ZTUA 2K2NA 3KSHA 4MN7A 4Y3IA 2VZWA 3MF0A 1YKDA 5HSQA 2Y8HA 3NHQA 3IBRA 2XROA 3NOUC 4DMZA 5HPIA 4Q0JA 2GX5A 3KSFA 4CQHA 3RFBA 2VJWA 4ZRRA 4G3KA 3CI6A 4MDZA 3TRCA 2W3GA 4FOFA 5LBRA 3VV4A 3S7NA 2VEAA 4G3VA 4PAUA 4EUVA 4Y5FA 3E0YA 4R6LA 3D3OA 4GLQA 4BWIA 2LB9A 3DBAA 2W1TA 2KOIA 5C5KA 4QPRA 2K31A 5HL6A 4EU0A 2O99A 4MCWA 2W1TB 3KSIA 3E98A 1F5MA 5HPFA 2O9BA 4LRXC
chains in the Genus database with same CATH superfamily
5HWTA 1OTIA 1L0DA 3FKWA 4E6XA 4KG6A 3M2JA 5EFWA 1IFQA 1ESUA 3P01A 1OTAA 1MXOA 4Y7PA 3ZG9B 1N9OA 5A93A 4HJ4A 1G28A 1S0WA 5IU1A 2IWDA 3NULA 5EM0A 2D02A 1NZUA 3T50A 3ZG8B 1BULA 3C38A 5FQKA 1FCOA 4Y17A 2PU2A 4NETA 4OH0A 3QP4A 1ZG6A 1LSWA 2PBDP 4ME4A 5CECA 3JVVA 3F1OA 2VLGA 1GSWA 5AQAA 3ZYTA 2WKRA 2YKHA 3C4OA 4KZ5A 1PZOA 2HZ5A 4XT2A 5FQJA 5KSHA 3CLOA 2WGIA 3W8KA 3EWKA 3QHYA 5HD3A 5A8BA 2A24A 3Q7ZA 1SDNA 4JXWA 1G6AA 3IXDA 2C5WB 4BMWA 5E2GA 3O88A 4UEYA 4HJ6A 4B4XA 5CEBA 5DKLA 3N7WA 4JXGA 5CXWA 4FUWA 1FR1A 4QY5A 2CMNA 1HLUP 4YFMA 3T4QA 3E98A 5HPFA 3T1RA 1NY0A 3AGFA 3UE6A 1YMSA 1YSPA 1VEUA 3FV7A 1CEGA 4PM5A 1BLPA 2LB5A 4Q0HA 1KGFA 1FOFA 2WKPA 4GJ4A 3VP2A 4HH3A 4JKTA 3TG9A 4DF6A 4GDNA 1YQSA 3LIFA 2X01A 3U4LP 3V5MA 3DTKA 3GR2A 1KOUA 1Q2QA 3B47A 1IELA 2PR5A 3NECA 2QJ7A 4ARZA 4YINA 4EESA 2WUQA 1FCMA 2Y2PA 2WYXA 3D4FA 5DVAA 1K54C 4IUKA 3KO6A 3PBTA 5M19A 4LRYC 1VQQA 1K56D 1T18A 2FFFB 4BLMA 5DFXA 3E2LA 5HX9A 1ES4A 2M1CA 3HCYA 3HLCA 3P7NA 5L2FA 4PMAA 2P74A 3LCEA 3LUQA 3HJIA 2EX8A 1T19A 4EV4A 3CZDA 3PBSA 4MBHA 4DDYA 2Y8HA 1BLSA 3BFGA 3N8RA 1LI0A 4LCMA 4GHIB 1A0KA 4OQ0A 4PKYA 1YLWA 3PAEA 2E8JA 5FAOA 1N9NA 5FDHA 4R6LA 2I9VA 3FZCA 3SH8A 4RA7A 1HZOA 2V1AA 4M4XA 1DJBA 1XJ4A 1EI5A 1PWGA 4MNRA 4ZAMA 5HZHA 1JTGA 3R7WA 2H5SA 4OOMA 5DF8A 3GMWA 1FSWA 5GLBA 5JYPA 4IEDA 3RJUA 5A92A 3IF6A 3LEQA 5EECA 4MBFA 1YSQA 4EETB 3IHBA 3OLOA 3G2YA 2ZM8A 2VGLS 3WRTA 3T12B 3PBRA 3OBFA 4DJ2A 3FPWA 5F82A 4LV3A 2HP6A 1MC0A 1ODVA 5CERA 2Y2KA 4QB8A 5HAPA 2XA7S 4UQIM 3UB9A 2Y59A 1MY8A 3F1OB 4KUOA 1ES3A 3IWOA 3HLFA 3Q82A 5A90A 4FH4A 3WRZA 2VX8A 4HOIA 5F83A 2WADA 4JBFA 3WWXA 4Y3IA 4GD8A 4XT2B 2XFSA 1XJ6A 1OTDA 2X71A 4L9GA 2VV7A 3CJMA 2HJ9C 4JF5A 3CUEC 3N8LA 2GX5A 2A24B 2WZZA 3D72A 4CQHA 3PBOA 4DE0A 4CLCE 3T4OA 3O86A 3TRCA 5LBRA 4S2JA 3E0YA 4GCZA 1OT9A 4LCLA 2EX6A 3UB6A 4R23A 4DXBA 1YLPA 1L2SA 4OOLA 4WL9A 4GKUA 1NYMA 5DTKA 4GZBA 1KE3A 3E2KA 2WKQA 1VEUB 4B88A 3UDIA 4QD4A 1D7EA 3UPOA 4ETZA 4CLCA 1XXMA 2GZAA 1K57C 3MJQA 4BD0A 3TW8A 3UN7A 1YMXA 3N8SA 3Q7VA 3CMZA 4K91A 3K2NA 4ARZB 1V9ZA 4X25A 4B9OA 1NXYA 5EVID 2EXAA 1RP5A 4KUKA 3CPTA 3GRJA 4WUJA 5EOOA 1H0MA 4EERA 4KZAA 3LI8A 4KQDA 5HW3A 4R4RA 5HDCA 4CPKA 1FIKA 5FEFA 2H28A 2A3UA 4DE3A 3NHQA 3E4QA 4Y0TA 3NOUC 3H82A 5HPIA 4Q0JA 4UA7A 2QMIA 2PAVP 2XA7M 3NC8A 4ZRRA 1OJGA 2VV6A 2JE5A 2XEPA 4FOFA 4HHDA 4N9LA 4DXCA 4PAUA 5DF9A 3VOYA 4N1XA 3IXGA 1XX2A 4Y0OA 2ZL1A 3LY4A 3W4QA 4QWOA 1ZHHB 2K31A 5EVIC 1P9RA 5F69A 2JKFA 2HDUA 3PAGA 4LGWA 5CHUA 2WZXA 4WZ5C 4GD6A 2ZLYA 1M6KA 3DTIA 1SKOA 1IYOA 3GSGA 2P7JA 3G4PA 3R7WB 1PWCA 1S1ZA 5HFOA 2VGJA 3SZTA 1L0FA 4Z9QA 2XF3A 1W8QA 3H9WA 4MMNA 1KVMA 1Y28A 4X56A 1KE0A 4NG2A 1N4OA 3S22A 2ZQDA 4S2NA 4RYEA 1UGUA 5I5LA 2Y91A 2I72A 4ESPA 3BQAA 4R70A 4KQRA 4Z1WA 5F1GA 2WGVA 5BOHA 2Y4AA 1QMEA 2HJEA 3BM6A 1K4EA 2XLNA 3UE1A 3WS4A 3OPHA 4BD1A 2PD8A 1RGYA 2J9OA 3TJZC 2Y2LA 3LFVA 4K0WA 1W63M 2YKFA 2ZMAA 1Y54A 1NLYA 5FQMA 3D9YA 1XJ2A 3O87A 2JKGA 4ZTKA 4D60A 2XDMA 4KZ3A 1KGGA 3BYDA 4UA6A 3UO9A 2KDKA 4LV0A 2HF6A 1ERMA 4Y5FA 4GDBA 1PRQA 3DAVA 5HAIA 3UE0A 5IS1A 4HBTA 2O9BA 3Q81A 5TJJA 1H5XA 5FI7A 1STZA 1JNUA 3GQZA 4QJGA 4L9EA 4PM9A 5E2HA 3HVFA 1W63Q 5HDSA 3M6BA 1TDGA 3LI9A 2M7VA 3G35A 4CLCB 3G32A 1MBLA 3EEAA 1W5DA 2J3TD 3GVBA 4H6JA 4RQ9A 2EXBA 3Q7VB 3RTYA 1TS8A 5F6AA 4UA9A 5K5BA 5HWWA 1E3UD 2QKPA 1DP8A 4I3JA 3G6OA 4R3JA 4WLAA 1XPBA 4OQIA 4YNRA 3CPTB 1P97A 4LRZE 3VSKA 4E3MA 1MKMA 1Z6FA 4WEKA 3A3JA 2A2LA 4WELA 2XH9A 2Y2GA 1G6OA 4F94A 3TE8A 2ZQ7A 2Z6DA 2JHEA 5J3WA 1WE4A 4BBTA 3H82B 5G18A 1PW8A 2VJWA 3VMAA 5G4YA 2B95A 3MR0A 3VV4A 3VP1A 1WYCA 2J3TC 2VEAA 3UPNA 1S4SA 1OTEA 5EE8A 3VOZA 2PHYA 4FSFA 4QPRA 1ONHA 2XGNA 2ZL1B 2ZD8A 4OQGA 2Q9MA 4MCWA 1I5QA 4EEPA 2XK1A 2UV0E 4HESA 3QNCA 5MC7A 4GOGA 3DWZA 1GSVA 3FYZA 2RCXA 3W2ZA 1SKOB 2V8CA 2XFTA 4WMCD 4JGOA 4DE1A 4DRTA 5A91A 4LPZA 3HUMA 3C7VA 2OLVA 5CTNA 3SH9A 4HNBA 1LLBA 1S67L 2L4RA 2ZQAA 3UPPA 1K6SA 2IA2A 2H10A 1XFQA 1SZVA 3OZHA 4D2OA 4FCFA 3SS4A 3A0RA 1HD8A 3MXRA 1LSVA 5GLDA 4X6TA 3BLSA 3ICYA 5KMWA 1PW1A 4WYYA 4ZJ3A 1AWIA 4OLGA 4OP5A 3EQUA 4JGQA 1ALQA 4UQIS 5FAPA 1N9LA 2XSSA 1S1YA 3IBJA 2W3HA 3DW0A 3NOTC 1DJCA 1YT4A 4S2OA 2V9AA 1ZTUA 3N6IA 2K2NA 4LFUA 2WGWA 1AXBA 4I3IA 2ZOHA 5DKKA 3SH7A 1PFLA 4P85A 3CI6A 3Q07A 3B42A 2R9WA 4P0MA 1H8MA 3I7JA 1CEFA 2OLUA 1QMFA 4KZ9A 4MLLA 3D3OA 2H0YA 3DBAA 1BLHA 2W1TA 1LI9A 4Y15A 3KYQA 2D01A 5GHYA 4B4ZA 1K54A 3LR4A 4F3LA 4OQHA 3EGXC 3QP1A 1TS6A 3UB8A 3A3IA 2J8YA 4EBNA 1O07A 4GW9A 1GHPA 4XUXA 2ZJ9A 3HREA 2OAP1 3EGDC 5GL9A 1PI5A 4K08A 1NRFA 2XD5A 2QJ5A 4BJPA 3QP5A 4OPQA 5CHJA 1NWZA 4IUHA 4O01A 3ZCZA 4S2LA 4H6JB 1NRJA 2ZC4B 1TS7A 4DDSA 5M1AA 1EW0A 4S2KA 1L0GA 4DKIA 3W4OA 2XR0A 1NYYA 3NDEA 2W0NA 3ZNYA 1DRMA 3ZG0A 3T4LA 5CX7A 4G3WA 1NJ4A 2V1ZA 3LIEA 2PDRA 2VZWA 1FR6A 4ID4A 3MXSA 4E6WA 3UB5P 1G5UA 4YWZA 4P87A 1K56A 3HLGA 5FATA 1ACFA 5HAQA 1OTBA 3VP3A 2J80A 3RXXA 3FWLA 1IKIA 1NLZA 1JTDA 1LSXA 4BWIA 2V2FF 1BZAA 1S4RA 4LV2A 2O99A 1GHIA 4BBVA 4X68A 2Y2MA 3IX4A 1GSXA 1PIOA 4H8RA 4O0PA 1BUEA 3VP4A 3ITAA 4RVAA 1CQAA 3ZG5A 3PXPA 5GHXA 5F68A 2BLSA 5EVLA 4KZBA 5E2EA 1DY6A 4NXFA 1E25A 5L07A 4QU3A 1NZOA 1TVFA 1FILA 1XA7A 3O3VA 3CUEA 4X53A 3B33A 2C6WB 1ES5A 4DE2A 4OPZA 2OV5A 3ZVTA 1PNEA 2BASA 2V20A 2Y2IA 3E4PA 3V67A 1OT6A 4QHCA 3ITBA 1GHMA 4WM9A 1BYWA 4EBLA 4X55A 1OJ5A 4DMZA 3UY6A 2WGWB 4HY8A 2HP9A 2E8IA 1IOUA 4E3KA 3K3CA 4NXBA 2PR6A 2W3GA 1FCNA 4XXRA 5GLCA 4C6YA 4DJ3A 1BTLA 4EUVA 1K57A 4HIAA 1S66L 1W7FA 5HL6A 4EWFA 4R1GA 2INWA 2W1TB 2VA0A 2OAQ1 2EFXA 1ESIA 3A3DA 3C30A 3Q1FA 3C5AA 2V8FA 2W3FA 3HLEA 5EV0A 4F3LB 4NXEA 3U2AA 3EQVA 4KENB 5FI6A 3VOLA 3OCLA 1TD5A 3HBRA 1JWVA 3V50A 3VP0A 2KX6A 2IWCA 4HBUA 4KZ6A 2WK0A 4HH2A 1KGEA 1LHYA 4XUZA 2OOLA 3QP6A 5TGFA 3LIBA 3JVUA 1CI8A 2BTFP 1J3WA 4BL3A 3CHWP 4S2PA 1LT0A 1GA9A 3V39A 5TBMB 2WKIA 3IXHA 2ZC5B 4GS9A 2Q0OA 5EVIA 3MKEA 5FQQA 4WZ5A 3HLDA 3VE4A 5HSQA 3VFFA 5DTTA 3NIAA 3SW1A 1SDEA 3SS3A 4NKPA 5KIZA 3VSLA 1UWNX 2K7SA 3DWKA 3OPRA 3BY9A 3T4SA 3UMDA 4EBPA 3LYXA 3BFDA 3V3RA 2ZBBA 2EFUA 5G4ZA 5F1FA 4ZDXA 3H7WA 3NBLA 3VE3A 1YLYA 4C75A 3KSIA 1IEMA 3SS5A 1KDSA 3FPVA 3WS5A 2R9XA 1ERQA 5AVEA 4R38A 2Z2MB 3UNWA 4Y13A 3NDGA 4ZJ2A 2ZQCA 4KG5A 4BL2A 3S7PA 3L7HA 4O7DA 4WN5A 1K55C 2JKRI 5E43A 1JWPA 1CJFA 3CWFA 2DNSA 2RL3A 5I94A 1O7EA 1FQGA 4LLOB 2JCHA 5EOEA 2Y2QA 3MMHA 3PTEA 4E04A 3BECA 5EUAA 3BW6A 3VFHA 4DN0A 3MZDA 3HLWA 3TSGA 3LR0A 3LY3A 3GTCA 3ZVWA 1JWZA 1DP6A 2ZMFA 2IWBA 5FQIA 1S6RA 2EA9A 5DF7A 2P08A 1SHVA 4OONA 2AVXA 2G2UA 3KYZA 2JBFA 3N4IA 3C4PA 4JGPA 3KSHA 4MN7A 4X1LA 3GDIA 1YKDA 3WS0A 5AVFA 3LICA 1PZPA 4UHUA 2GDNA 3G2ZA 1YLZA 1PYYA 3MQOA 3DTEA 3QNBA 1H8YA 1UWPX 3RXWA 1SKFA 4N1HA 5J4EA 3FG8A 1XGJA 2OWJA 2OWHA 3ZGAB 4RX3A 2LB9A 4I39A 2A49A 3PBQA 1GA0A 2H0TA 1PI4A 4B93A 4JXVA 1F5MA 2FH5A 4K0XA 3MQQA 5CGSA 3IS2A 5DFYA 3MZEA 3C2WA 2JC7A 2WKHA 4NEED 1CK3A 1TS0A 4AFIA 4WBGA 5CEDA 1FSYA 2WAFA 4U0XA 4Y2FA 3IQAA 4I38A 2O9CA 1TEMA 3ZQ5A 3KYEA 4Q8IA 3ZHHA 3K3DA 4IVIA 2GNXA 1K25A 1YAXA 3FKVA 4L9FA 4PPRA 2B5RA 2O9AA 1LL9A 5HARA 3O5YA 1RCJA 1BT5A 1EWZA 1YPRA 4PM7A 1YM1A 2EWWA 1K0KA 2WKEA 1WYBA 1M40A 4GS9B 1E3UA 1T1CA 1F2KA 1I2SA 1OMEA 5EVIB 1PWDA 1Q2PA 4ZBEA 3T1QB 4MN5A 4X1MA 4EEUA 1K4FA 3WS2A 5L09A 3KSFA 3F1PA 1N9BA 2J9PA 2G2WA 4N9KA 1L3LA 3JYIA 4JF4A 4KZ4A 3ZFZA 3BRMA 5AQ7A 4GN2A 4PHTA 3UDXA 2XD1A 4OKPA 3P09A 3A0VA 4X69A 3H7WB 1HTZA 5TFQA 4EQIA 4BQMA 3GECA 4U0TA 2PU4A 3IH9A 5HDDA 5J8XA 4PKYG 5E2FA 5TR7A 2ZMVA 2Y2JA 3TOIA 1IKGA 4II7A 4GB7A 5CTMA 3IF5A 2JKTI 3AGEA 3V3SA 3CG5A 1JVJA 1L0EA 1ONGA 1ES2A 1WA9A 4KQOA 4WMCA 2Y79A 2Q9NA 4E3LA 3LIDA 2X02A 2BG1A 2Y2NA 3PR6A 5FA7A 4BBUA 3IF6C 4C3QA 3MBZA 2J3WA 2HV1A 2W3DA 4FH2A 2VK3A 3S1YA 1D1JA 3WS1A 2XQZA 1T1AA 4E3IA 2JKRM 3NJAA 4P6ZS 3MF0A 3BFEA 5FQ9A 3T4JA 2XROA 3AGDA 1LL5A 2ZOIA 4PM6A 1E4DA 5TBMA 4EW7A 1YLTA 3RFBA 5KZHA 2PD7A 2QWSA 1W8YA 3HL9A 3LR3A 2DRWA 3HUOA 4HQAA 1XA1A 2ZM2A 1F9IA 4KG2A 3IH8A 3W4PA 2HDSA 4FTXA 4JGRA 1VM1A 4WZ4A 3HJKA 5FEGA 5U47A 1IYPA 2QPNA 3LIAA 2KOIA 5FL3A 4CLCD 5JYOA 1XFNA 1VETA 5DTSA 4N92A 3UMEA 3F1NA 2ZQ9A 4ETXA 2ZC7A 3MQ0A 2O0YA 2W1RA 3MSHA 3KSGA 3LR5A 3IS2B 2Z2LB 1BLCA 3PYPA 4O8GA 4GNUA 4HI4A 1GCEA 5L8MA 1MWRA 3OOVA 5DJTA 4IBXA 4A5RA 4S2MA 3HLBA 3S7QA 4OVDA 1DJAA 3G34A 5FSRA 2VGKA 3T4TA 5IHVA 2DCFA 4LENA 2ACGA 3M2KA 2PBYA 1MPLA 5F5YA 1Y4OA 2B18A 1D06A 4KQQA 3BFFA 3LO7A 5J7EA 3T4KA 2VKSA 2ZC6B 1XGIA 4I5SA 4LV1A 4ZJ1A 3E4OA 2L1MA 4R0QA 1OPXA 4OP8A 2EX2A 3FC7A 4CLCC 1EROA 2V0WA 3OCNA 4U3TA 3T1XA 3MKFA 2V0UA 2ZQ8A 2P9VA 1K38A 3KX0X 2ZC3B 2JN7A 4OLDA 3A3FA 2HDRA 4E3OA 4OPYA 1MWTA 3F1PB 2Y2HA 5AQBA 3S4XA 3P98A 3BY8A 4MN6A 4RX2A 3S7NA 4QY6A 1YLJA 3T1SA 1KVLA 1MZUA 1MWUA 3HUNA 4P6ZM 1G68A 1DP9A 2HPBA 4LRXC 5HWVA 2W27A 2PRFA 3QP2A 2W3EA 4EQ1A 4JXSA 1BSGA 3IXBA 5D3OA 1XJ3A 3OC2A 1T1BA 1ZC2A 3JPUA 4OPRA 1C3BA 2HP5A 2EWVA 3CITA 4KZ7A 1TDLA 2Z6CA 3MFXA 4JPMA 5FDSA 5GHZA 3L9KA 3ZG7B 3C8CA 2R78A 3IHAA 4IJGA 5AQ9A 1K6RA 2QHKA 4CJNA 2VGLM 1HVBA 2DMWA 3S7OA 4P6BA 2GJ3A 1CI9A 4KZ8A 5IT5A 1MWSA 4L0LA 3OPLA 3OPPA 1ZG4A 4HEFA 2Y55A 1LL8A 1KDWA 3IX8A 3MZFA 5L10A 1SCWA 5EPHA 1IYQA 4YOFA 3A3EA 3BEBA 3RH8B 1ZKJA 3UB7A 1TF1A 4JLFA 1H3QA 2HGVA 3EOIA 5AJGA 3ZDJA 4S2NC 5M18A 3LEZA 5FAQA 4MBKA 2JKTM 1MKIA 2QZ6A 2WAEA 3DTMA 3IWQA 4IVKA 2NUPC 4E3JA 1VB6A 2ZM0A 3IBRA 5GLAA 2VV8A 5CGWA 4NXGA 3SOIA 4G3KA 4HP4A 3MS6A 3IT9A 1J9MA 4GLQA 5C5KA 4EU0A 1U60A 1F98A 1X0OA 4EXOA 3IF6B 4E3NA 5CGXA 4S2IA 1VETB 2EX9A 4UAAA 3EEHA 2NUTC 2CC1A 3F1NB 2J7VA 2G7UA 4I3AA 3ISGA 3G30A 2V1BA 1CF0A 4M3KA 2PYPA 1W79A 4HJ3A 1V9YA 2UWXA 2QYBA 1Z09A 3NY4A 1IYSA 2M7UA 1VHMA 1H8ZA 2PT7A 3B3XA 4NK3A 5DJUA 3BJNA 4Y0UA 2XRNA 3UE3A 1KE4A 2HDQA 2FZ0A 3A0SA 3MXQA 5KSCA 1I2WA 2PYRA 2L0WA 5FASA 5EVEA 1P9WA 3CAXA 2Y2OA 3IWIA 1P0ZA 4BENA 3R4KA 2KLIA 4JF6A 5CHMA 5HL1A 3NOPC 4Q0IA 3MFDA 1XP4A 1XKZA 2MJ6A 3ULFA 5EM1A 3IX3A 2OSUA 3M6HA 4IBRA 4OOYA 4HP9A 3G31A 4FD8A 5FI2A 3GV9A 3QP8A 3BFCA 4EUZA 5CRFA 3UDFA 2P9VB 2P04A 3NCKA 5HD5A 1RGZA 3LGOA 4GHIA 4WF0A 4R3AA 3BWLA 2FFYA 4MDZA 4G3VA 4IHQA 4WEJA 4MEZA 4PM8A 3ZNTA 3BLMA 2B02A 1K55A 3C7UA 3BQ8A 3PBNA 4R3BA 4R4SA 3PHYA 3NI9A
chains in the Genus database with same CATH topology
1GSXA 5HWTA 1OTIA 3GECA 4O0PA 2P7JA 3R7WB 5EFWA 1IFQA 5HDDA 1S1ZA 3P01A 4PKYG 1OTAA 2ZMVA 3PXPA 1N9OA 4II7A 3H9WA 4MMNA 5F68A 4HJ4A 1G28A 1Y28A 5IU1A 2JKTI 2D02A 3T50A 3C38A 1UGUA 5I5LA 4NXFA 3BQAA 4R70A 4Z1WA 1WA9A 4KQOA 2Y79A 3CUEA 3LIDA 2HJEA 3B33A 1LSWA 3PR6A 4ME4A 3JVVA 3F1OA 2PD8A 2VLGA 1GSWA 4BBUA 2BASA 3TJZC 3ZYTA 3LFVA 3E4PA 2WKRA 2YKHA 2J3WA 2HV1A 2W3DA 3V67A 1W63M 1OT6A 2YKFA 4XT2A 5KSHA 3CLOA 1T1AA 2JKRM 1NLYA 1BYWA 3NJAA 4P6ZS 3MF0A 3EWKA 3T4JA 2XROA 5HD3A 5A8BA 2A24A 1OJ5A 4DMZA 2ZOIA 1XJ2A 4BMWA 4HY8A 5TBMA 4EW7A 4UEYA 3RFBA 4HJ6A 2PD7A 2QWSA 1IOUA 3K3CA 4NXBA 3LR3A 2PR6A 2W3GA 5DKLA 4HQAA 2KDKA 1F9IA 4DJ3A 2HF6A 4EUVA 4HIAA 4Y5FA 4JGRA 3HJKA 2CMNA 5IS1A 3LIAA 1S66L 2KOIA 3T4QA 5HL6A 5FL3A 4CLCD 1XFNA 2INWA 2W1TB 3E98A 2VA0A 2OAQ1 5HPFA 2O9BA 3UMEA 3F1NA 3C30A 3UE6A 5TJJA 4ETXA 3MQ0A 2O0YA 1YSPA 2W1RA 2W3FA 3KSGA 1STZA 1JNUA 3LR5A 3IS2B 4L9EA 4F3LB 4NXEA 4O8GA 3U2AA 3PYPA 2LB5A 1W63Q 3EQVA 4HI4A 4Q0HA 4GJ4A 2WKPA 5L8MA 4HH3A 5HDSA 3VOLA 3OCLA 3LI9A 3OOVA 2M7VA 5DJTA 1TD5A 3LIFA 1KOUA 4CLCB 3S7QA 3B47A 3EEAA 2KX6A 2PR5A 2QJ7A 2J3TD 3T4TA 4ARZA 4HH2A 4EESA 4H6JA 4RQ9A 2OOLA 3RTYA 1TS8A 5F6AA 5F5YA 5K5BA 2B18A 1D06A 5HWWA 3LIBA 2QKPA 3JVUA 1DP8A 4I3JA 3G6OA 5J7EA 3T4KA 2VKSA 4IUKA 3KO6A 4WLAA 3PBTA 4I5SA 4YNRA 4LRYC 1P97A 3E4OA 2L1MA 1LT0A 1OPXA 4LRZE 1T18A 5DFXA 3FC7A 4CLCC 5TBMB 1MKMA 2V0WA 4WEKA 4GS9A 2A2LA 2M1CA 4WELA 3HCYA 3OCNA 1G6OA 3P7NA 3LUQA 3TE8A 2V0UA 3HJIA 1T19A 3KX0X 3PBSA 2Z6DA 2JHEA 3VE4A 5J3WA 2Y8HA 5HSQA 2JN7A 4BBTA 3H82B 3SW1A 4GHIB 2VJWA 5G4YA 4NKPA 5KIZA 3F1PB 3MR0A 1UWNX 2K7SA 4PKYA 3VV4A 3BY8A 4MN6A 3S7NA 3BY9A 3T4SA 2VEAA 2J3TC 3UMDA 1S4SA 1OTEA 3LYXA 1N9NA 4R6LA 2I9VA 2ZBBA 5G4ZA 1MZUA 2PHYA 4FSFA 4P6ZM 3H7WA 1DP9A 4QPRA 3VE3A 2V1AA 4MCWA 4M4XA 3KSIA 4EEPA 4LRXC 5HWVA 1XJ4A 2W27A 3FPVA 5HZHA 2W3EA 3R7WA 4EQ1A 5AVEA 4R38A 4OOMA 5MC7A 1XJ3A 3OC2A 1GSVA 3W2ZA 1T1BA 4JGOA 4LPZA 2EWVA 3CITA 3S7PA 4HNBA 2Z6CA 3MFXA 1S67L 2L4RA 4WN5A 2IA2A 1YSQA 4EETB 3C8CA 2R78A 1XFQA 2JKRI 3A0RA 3OLOA 4IJGA 2QHKA 2VGLS 1LSVA 3CWFA 2VGLM 2DMWA 3ICYA 3PBRA 3S7OA 2GJ3A 3OBFA 5IT5A 4L0LA 4DJ2A 4LLOB 3MMHA 3FPWA 4E04A 1LL8A 3BW6A 1MC0A 4DN0A 1ODVA 3LR0A 4YOFA 3EQUA 4JGQA 4UQIS 1N9LA 2XSSA 2XA7S 4UQIM 1S1YA 3UB9A 3IBJA 1DP6A 2ZMFA 3F1OB 3RH8B 4KUOA 2W3HA 2EA9A 3UB7A 2P08A 1TF1A 3EOIA 1H3QA 2HGVA 5AJGA 3NOTC 2JKTM 2V9AA 3KYZA 1ZTUA 2VX8A 4JGPA 4HOIA 2K2NA 3KSHA 2NUPC 4MN7A 4Y3IA 1VB6A 3GDIA 4XT2B 1YKDA 1XJ6A 1OTDA 3IBRA 5AVFA 4L9GA 2VV7A 2HJ9C 4I3IA 3CUEC 3LICA 2ZOHA 2VV8A 2GX5A 2A24B 3D72A 5DKKA 4CQHA 3PBOA 4NXGA 4CLCE 4G3KA 3CI6A 3T4OA 3MQOA 3TRCA 3B42A 5LBRA 1UWPX 4HP4A 5J4EA 1H8MA 3FG8A 3E0YA 2OWJA 2OWHA 3D3OA 4GLQA 2LB9A 3DBAA 4I39A 2W1TA 5C5KA 3PBQA 4GCZA 4EU0A 1OT9A 1F98A 1X0OA 3UB6A 4EXOA 4B93A 1F5MA 2FH5A 3KYQA 3MQQA 2D01A 4OOLA 4WL9A 3EEHA 3IS2A 5DFYA 2NUTC 3LR4A 3F1NB 4F3LA 3C2WA 3EGXC 2G7UA 1TS6A 4I3AA 3UB8A 2WKQA 2V1BA 4NEED 4GW9A 1D7EA 2PYPA 1TS0A 4HJ3A 4AFIA 1V9YA 4ETZA 4CLCA 2GZAA 2OAP1 4Y2FA 2QYBA 3EGDC 3MJQA 3TW8A 4K08A 4I38A 2M7UA 1VHMA 2O9CA 2PT7A 5DJUA 3BJNA 2XRNA 2QJ5A 3UE3A 3ZQ5A 4BJPA 2FZ0A 3A0SA 3MXQA 3K3DA 1NWZA 2GNXA 2PYRA 3K2NA 4IUHA 2L0WA 1V9ZA 4O01A 4ARZB 1YAXA 4H6JB 4B9OA 1NRJA 1P9WA 4L9FA 3CAXA 4KUKA 2O9AA 1TS7A 1P0ZA 3R4KA 4WUJA 2KLIA 3O5YA 1EW0A 2W0NA 4EERA 3NOPC 4Q0IA 1DRMA 3LI8A 2EWWA 2MJ6A 4KQDA 3T4LA 3ULFA 5CX7A 4G3WA 4GS9B 5HDCA 3LIEA 4HP9A 1T1CA 2PDRA 2VZWA 2H28A 2P04A 5HD5A 4MN5A 3NHQA 3E4QA 3NOUC 3H82A 5HPIA 4EEUA 4Q0JA 4GHIA 4WF0A 4YWZA 4R3AA 3BWLA 3KSFA 3F1PA 2XA7M 4ZRRA 1OJGA 2VV6A 4MDZA 1OTBA 4FOFA 2J80A 4HHDA 4G3VA 4IHQA 4WEJA 4PAUA 5DF9A 2B02A 1NLZA 1LSXA 4BWIA 1S4RA 1ZHHB 4PHTA 2K31A 2O99A 3BQ8A 1P9RA 5F69A 3A0VA 4BBVA 3PBNA 3H7WB 3PHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJJ A;  2W3E A;  4ETX A;  3MQ0 A;  5DFY A;  2O0Y A;  1YSP A;  2W1R A;  2W3F A;  3KSG A;  3C2W A;  4O0P A;  1STZ A;  2G7U A;  3W2Z A;  4O8G A;  2LB5 A;  4Q0H A;  4GW9 A;  5L8M A;  3CIT A;  4MMN A;  4ETZ A;  3S7P A;  3OOV A;  2M7V A;  1TD5 A;  4Y2F A;  2QYB A;  2IA2 A;  1YSQ A;  3S7Q A;  2M7U A;  1VHM A;  2O9C A;  5I5L A;  3EEA A;  3BJN A;  4IJG A;  2XRN A;  3ZQ5 A;  4R70 A;  4RQ9 A;  4Z1W A;  2OOL A;  3K2N A;  4IUH A;  4O01 A;  3S7O A;  3OBF A;  2Y79 A;  5K5B A;  2B18 A;  3MMH A;  3G6O A;  4E04 A;  2VKS A;  4IUK A;  3KO6 A;  1MC0 A;  4DN0 A;  2O9A A;  4ME4 A;  4YNR A;  4LRY C;  4YOF A;  3R4K A;  2KLI A;  3O5Y A;  2XSS A;  3IBJ A;  4LRZ E;  2ZMF A;  5DFX A;  2W3H A;  3NOP C;  3LFV A;  1TF1 A;  4Q0I A;  2HGV A;  5AJG A;  1MKM A;  3NOT C;  2W3D A;  3HCY A;  4G3W A;  1ZTU A;  2K2N A;  3KSH A;  4MN7 A;  4Y3I A;  2VZW A;  3MF0 A;  1YKD A;  5HSQ A;  2Y8H A;  3NHQ A;  3IBR A;  2XRO A;  3NOU C;  4DMZ A;  5HPI A;  4Q0J A;  2GX5 A;  3KSF A;  4CQH A;  3RFB A;  2VJW A;  4ZRR A;  4G3K A;  3CI6 A;  4MDZ A;  3TRC A;  2W3G A;  4FOF A;  5LBR A;  3VV4 A;  3S7N A;  2VEA A;  4G3V A;  4PAU A;  4EUV A;  4Y5F A;  3E0Y A;  4R6L A;  3D3O A;  4GLQ A;  4BWI A;  2LB9 A;  3DBA A;  2W1T A;  2KOI A;  5C5K A;  4QPR A;  2K31 A;  5HL6 A;  4EU0 A;  2O99 A;  4MCW A;  2W1T B;  3KSI A;  3E98 A;  1F5M A;  5HPF A;  2O9B A;  4LRX C; 
#chains in the Genus database with same CATH topology
 5HWT A;  1OTI A;  1L0D A;  3FKW A;  4E6X A;  4KG6 A;  3M2J A;  5EFW A;  1IFQ A;  1ESU A;  3P01 A;  1OTA A;  1MXO A;  4Y7P A;  3ZG9 B;  1N9O A;  5A93 A;  4HJ4 A;  1G28 A;  1S0W A;  5IU1 A;  2IWD A;  3NUL A;  5EM0 A;  2D02 A;  1NZU A;  3T50 A;  3ZG8 B;  1BUL A;  3C38 A;  5FQK A;  1FCO A;  4Y17 A;  2PU2 A;  4NET A;  4OH0 A;  3QP4 A;  1ZG6 A;  1LSW A;  2PBD P;  4ME4 A;  5CEC A;  3JVV A;  3F1O A;  2VLG A;  1GSW A;  5AQA A;  3ZYT A;  2WKR A;  2YKH A;  3C4O A;  4KZ5 A;  1PZO A;  2HZ5 A;  4XT2 A;  5FQJ A;  5KSH A;  3CLO A;  2WGI A;  3W8K A;  3EWK A;  3QHY A;  5HD3 A;  5A8B A;  2A24 A;  3Q7Z A;  1SDN A;  4JXW A;  1G6A A;  3IXD A;  2C5W B;  4BMW A;  5E2G A;  3O88 A;  4UEY A;  4HJ6 A;  4B4X A;  5CEB A;  5DKL A;  3N7W A;  4JXG A;  5CXW A;  4FUW A;  1FR1 A;  4QY5 A;  2CMN A;  1HLU P;  4YFM A;  3T4Q A;  3E98 A;  5HPF A;  3T1R A;  1NY0 A;  3AGF A;  3UE6 A;  1YMS A;  1YSP A;  1VEU A;  3FV7 A;  1CEG A;  4PM5 A;  1BLP A;  2LB5 A;  4Q0H A;  1KGF A;  1FOF A;  2WKP A;  4GJ4 A;  3VP2 A;  4HH3 A;  4JKT A;  3TG9 A;  4DF6 A;  4GDN A;  1YQS A;  3LIF A;  2X01 A;  3U4L P;  3V5M A;  3DTK A;  3GR2 A;  1KOU A;  1Q2Q A;  3B47 A;  1IEL A;  2PR5 A;  3NEC A;  2QJ7 A;  4ARZ A;  4YIN A;  4EES A;  2WUQ A;  1FCM A;  2Y2P A;  2WYX A;  3D4F A;  5DVA A;  1K54 C;  4IUK A;  3KO6 A;  3PBT A;  5M19 A;  4LRY C;  1VQQ A;  1K56 D;  1T18 A;  2FFF B;  4BLM A;  5DFX A;  3E2L A;  5HX9 A;  1ES4 A;  2M1C A;  3HCY A;  3HLC A;  3P7N A;  5L2F A;  4PMA A;  2P74 A;  3LCE A;  3LUQ A;  3HJI A;  2EX8 A;  1T19 A;  4EV4 A;  3CZD A;  3PBS A;  4MBH A;  4DDY A;  2Y8H A;  1BLS A;  3BFG A;  3N8R A;  1LI0 A;  4LCM A;  4GHI B;  1A0K A;  4OQ0 A;  4PKY A;  1YLW A;  3PAE A;  2E8J A;  5FAO A;  1N9N A;  5FDH A;  4R6L A;  2I9V A;  3FZC A;  3SH8 A;  4RA7 A;  1HZO A;  2V1A A;  4M4X A;  1DJB A;  1XJ4 A;  1EI5 A;  1PWG A;  4MNR A;  4ZAM A;  5HZH A;  1JTG A;  3R7W A;  2H5S A;  4OOM A;  5DF8 A;  3GMW A;  1FSW A;  5GLB A;  5JYP A;  4IED A;  3RJU A;  5A92 A;  3IF6 A;  3LEQ A;  5EEC A;  4MBF A;  1YSQ A;  4EET B;  3IHB A;  3OLO A;  3G2Y A;  2ZM8 A;  2VGL S;  3WRT A;  3T12 B;  3PBR A;  3OBF A;  4DJ2 A;  3FPW A;  5F82 A;  4LV3 A;  2HP6 A;  1MC0 A;  1ODV A;  5CER A;  2Y2K A;  4QB8 A;  5HAP A;  2XA7 S;  4UQI M;  3UB9 A;  2Y59 A;  1MY8 A;  3F1O B;  4KUO A;  1ES3 A;  3IWO A;  3HLF A;  3Q82 A;  5A90 A;  4FH4 A;  3WRZ A;  2VX8 A;  4HOI A;  5F83 A;  2WAD A;  4JBF A;  3WWX A;  4Y3I A;  4GD8 A;  4XT2 B;  2XFS A;  1XJ6 A;  1OTD A;  2X71 A;  4L9G A;  2VV7 A;  3CJM A;  2HJ9 C;  4JF5 A;  3CUE C;  3N8L A;  2GX5 A;  2A24 B;  2WZZ A;  3D72 A;  4CQH A;  3PBO A;  4DE0 A;  4CLC E;  3T4O A;  3O86 A;  3TRC A;  5LBR A;  4S2J A;  3E0Y A;  4GCZ A;  1OT9 A;  4LCL A;  2EX6 A;  3UB6 A;  4R23 A;  4DXB A;  1YLP A;  1L2S A;  4OOL A;  4WL9 A;  4GKU A;  1NYM A;  5DTK A;  4GZB A;  1KE3 A;  3E2K A;  2WKQ A;  1VEU B;  4B88 A;  3UDI A;  4QD4 A;  1D7E A;  3UPO A;  4ETZ A;  4CLC A;  1XXM A;  2GZA A;  1K57 C;  3MJQ A;  4BD0 A;  3TW8 A;  3UN7 A;  1YMX A;  3N8S A;  3Q7V A;  3CMZ A;  4K91 A;  3K2N A;  4ARZ B;  1V9Z A;  4X25 A;  4B9O A;  1NXY A;  5EVI D;  2EXA A;  1RP5 A;  4KUK A;  3CPT A;  3GRJ A;  4WUJ A;  5EOO A;  1H0M A;  4EER A;  4KZA A;  3LI8 A;  4KQD A;  5HW3 A;  4R4R A;  5HDC A;  4CPK A;  1FIK A;  5FEF A;  2H28 A;  2A3U A;  4DE3 A;  3NHQ A;  3E4Q A;  4Y0T A;  3NOU C;  3H82 A;  5HPI A;  4Q0J A;  4UA7 A;  2QMI A;  2PAV P;  2XA7 M;  3NC8 A;  4ZRR A;  1OJG A;  2VV6 A;  2JE5 A;  2XEP A;  4FOF A;  4HHD A;  4N9L A;  4DXC A;  4PAU A;  5DF9 A;  3VOY A;  4N1X A;  3IXG A;  1XX2 A;  4Y0O A;  2ZL1 A;  3LY4 A;  3W4Q A;  4QWO A;  1ZHH B;  2K31 A;  5EVI C;  1P9R A;  5F69 A;  2JKF A;  2HDU A;  3PAG A;  4LGW A;  5CHU A;  2WZX A;  4WZ5 C;  4GD6 A;  2ZLY A;  1M6K A;  3DTI A;  1SKO A;  1IYO A;  3GSG A;  2P7J A;  3G4P A;  3R7W B;  1PWC A;  1S1Z A;  5HFO A;  2VGJ A;  3SZT A;  1L0F A;  4Z9Q A;  2XF3 A;  1W8Q A;  3H9W A;  4MMN A;  1KVM A;  1Y28 A;  4X56 A;  1KE0 A;  4NG2 A;  1N4O A;  3S22 A;  2ZQD A;  4S2N A;  4RYE A;  1UGU A;  5I5L A;  2Y91 A;  2I72 A;  4ESP A;  3BQA A;  4R70 A;  4KQR A;  4Z1W A;  5F1G A;  2WGV A;  5BOH A;  2Y4A A;  1QME A;  2HJE A;  3BM6 A;  1K4E A;  2XLN A;  3UE1 A;  3WS4 A;  3OPH A;  4BD1 A;  2PD8 A;  1RGY A;  2J9O A;  3TJZ C;  2Y2L A;  3LFV A;  4K0W A;  1W63 M;  2YKF A;  2ZMA A;  1Y54 A;  1NLY A;  5FQM A;  3D9Y A;  1XJ2 A;  3O87 A;  2JKG A;  4ZTK A;  4D60 A;  2XDM A;  4KZ3 A;  1KGG A;  3BYD A;  4UA6 A;  3UO9 A;  2KDK A;  4LV0 A;  2HF6 A;  1ERM A;  4Y5F A;  4GDB A;  1PRQ A;  3DAV A;  5HAI A;  3UE0 A;  5IS1 A;  4HBT A;  2O9B A;  3Q81 A;  5TJJ A;  1H5X A;  5FI7 A;  1STZ A;  1JNU A;  3GQZ A;  4QJG A;  4L9E A;  4PM9 A;  5E2H A;  3HVF A;  1W63 Q;  5HDS A;  3M6B A;  1TDG A;  3LI9 A;  2M7V A;  3G35 A;  4CLC B;  3G32 A;  1MBL A;  3EEA A;  1W5D A;  2J3T D;  3GVB A;  4H6J A;  4RQ9 A;  2EXB A;  3Q7V B;  3RTY A;  1TS8 A;  5F6A A;  4UA9 A;  5K5B A;  5HWW A;  1E3U D;  2QKP A;  1DP8 A;  4I3J A;  3G6O A;  4R3J A;  4WLA A;  1XPB A;  4OQI A;  4YNR A;  3CPT B;  1P97 A;  4LRZ E;  3VSK A;  4E3M A;  1MKM A;  1Z6F A;  4WEK A;  3A3J A;  2A2L A;  4WEL A;  2XH9 A;  2Y2G A;  1G6O A;  4F94 A;  3TE8 A;  2ZQ7 A;  2Z6D A;  2JHE A;  5J3W A;  1WE4 A;  4BBT A;  3H82 B;  5G18 A;  1PW8 A;  2VJW A;  3VMA A;  5G4Y A;  2B95 A;  3MR0 A;  3VV4 A;  3VP1 A;  1WYC A;  2J3T C;  2VEA A;  3UPN A;  1S4S A;  1OTE A;  5EE8 A;  3VOZ A;  2PHY A;  4FSF A;  4QPR A;  1ONH A;  2XGN A;  2ZL1 B;  2ZD8 A;  4OQG A;  2Q9M A;  4MCW A;  1I5Q A;  4EEP A;  2XK1 A;  2UV0 E;  4HES A;  3QNC A;  5MC7 A;  4GOG A;  3DWZ A;  1GSV A;  3FYZ A;  2RCX A;  3W2Z A;  1SKO B;  2V8C A;  2XFT A;  4WMC D;  4JGO A;  4DE1 A;  4DRT A;  5A91 A;  4LPZ A;  3HUM A;  3C7V A;  2OLV A;  5CTN A;  3SH9 A;  4HNB A;  1LLB A;  1S67 L;  2L4R A;  2ZQA A;  3UPP A;  1K6S A;  2IA2 A;  2H10 A;  1XFQ A;  1SZV A;  3OZH A;  4D2O A;  4FCF A;  3SS4 A;  3A0R A;  1HD8 A;  3MXR A;  1LSV A;  5GLD A;  4X6T A;  3BLS A;  3ICY A;  5KMW A;  1PW1 A;  4WYY A;  4ZJ3 A;  1AWI A;  4OLG A;  4OP5 A;  3EQU A;  4JGQ A;  1ALQ A;  4UQI S;  5FAP A;  1N9L A;  2XSS A;  1S1Y A;  3IBJ A;  2W3H A;  3DW0 A;  3NOT C;  1DJC A;  1YT4 A;  4S2O A;  2V9A A;  1ZTU A;  3N6I A;  2K2N A;  4LFU A;  2WGW A;  1AXB A;  4I3I A;  2ZOH A;  5DKK A;  3SH7 A;  1PFL A;  4P85 A;  3CI6 A;  3Q07 A;  3B42 A;  2R9W A;  4P0M A;  1H8M A;  3I7J A;  1CEF A;  2OLU A;  1QMF A;  4KZ9 A;  4MLL A;  3D3O A;  2H0Y A;  3DBA A;  1BLH A;  2W1T A;  1LI9 A;  4Y15 A;  3KYQ A;  2D01 A;  5GHY A;  4B4Z A;  1K54 A;  3LR4 A;  4F3L A;  4OQH A;  3EGX C;  3QP1 A;  1TS6 A;  3UB8 A;  3A3I A;  2J8Y A;  4EBN A;  1O07 A;  4GW9 A;  1GHP A;  4XUX A;  2ZJ9 A;  3HRE A;  2OAP 1;  3EGD C;  5GL9 A;  1PI5 A;  4K08 A;  1NRF A;  2XD5 A;  2QJ5 A;  4BJP A;  3QP5 A;  4OPQ A;  5CHJ A;  1NWZ A;  4IUH A;  4O01 A;  3ZCZ A;  4S2L A;  4H6J B;  1NRJ A;  2ZC4 B;  1TS7 A;  4DDS A;  5M1A A;  1EW0 A;  4S2K A;  1L0G A;  4DKI A;  3W4O A;  2XR0 A;  1NYY A;  3NDE A;  2W0N A;  3ZNY A;  1DRM A;  3ZG0 A;  3T4L A;  5CX7 A;  4G3W A;  1NJ4 A;  2V1Z A;  3LIE A;  2PDR A;  2VZW A;  1FR6 A;  4ID4 A;  3MXS A;  4E6W A;  3UB5 P;  1G5U A;  4YWZ A;  4P87 A;  1K56 A;  3HLG A;  5FAT A;  1ACF A;  5HAQ A;  1OTB A;  3VP3 A;  2J80 A;  3RXX A;  3FWL A;  1IKI A;  1NLZ A;  1JTD A;  1LSX A;  4BWI A;  2V2F F;  1BZA A;  1S4R A;  4LV2 A;  2O99 A;  1GHI A;  4BBV A;  4X68 A;  2Y2M A;  3IX4 A;  1GSX A;  1PIO A;  4H8R A;  4O0P A;  1BUE A;  3VP4 A;  3ITA A;  4RVA A;  1CQA A;  3ZG5 A;  3PXP A;  5GHX A;  5F68 A;  2BLS A;  5EVL A;  4KZB A;  5E2E A;  1DY6 A;  4NXF A;  1E25 A;  5L07 A;  4QU3 A;  1NZO A;  1TVF A;  1FIL A;  1XA7 A;  3O3V A;  3CUE A;  4X53 A;  3B33 A;  2C6W B;  1ES5 A;  4DE2 A;  4OPZ A;  2OV5 A;  3ZVT A;  1PNE A;  2BAS A;  2V20 A;  2Y2I A;  3E4P A;  3V67 A;  1OT6 A;  4QHC A;  3ITB A;  1GHM A;  4WM9 A;  1BYW A;  4EBL A;  4X55 A;  1OJ5 A;  4DMZ A;  3UY6 A;  2WGW B;  4HY8 A;  2HP9 A;  2E8I A;  1IOU A;  4E3K A;  3K3C A;  4NXB A;  2PR6 A;  2W3G A;  1FCN A;  4XXR A;  5GLC A;  4C6Y A;  4DJ3 A;  1BTL A;  4EUV A;  1K57 A;  4HIA A;  1S66 L;  1W7F A;  5HL6 A;  4EWF A;  4R1G A;  2INW A;  2W1T B;  2VA0 A;  2OAQ 1;  2EFX A;  1ESI A;  3A3D A;  3C30 A;  3Q1F A;  3C5A A;  2V8F A;  2W3F A;  3HLE A;  5EV0 A;  4F3L B;  4NXE A;  3U2A A;  3EQV A;  4KEN B;  5FI6 A;  3VOL A;  3OCL A;  1TD5 A;  3HBR A;  1JWV A;  3V50 A;  3VP0 A;  2KX6 A;  2IWC A;  4HBU A;  4KZ6 A;  2WK0 A;  4HH2 A;  1KGE A;  1LHY A;  4XUZ A;  2OOL A;  3QP6 A;  5TGF A;  3LIB A;  3JVU A;  1CI8 A;  2BTF P;  1J3W A;  4BL3 A;  3CHW P;  4S2P A;  1LT0 A;  1GA9 A;  3V39 A;  5TBM B;  2WKI A;  3IXH A;  2ZC5 B;  4GS9 A;  2Q0O A;  5EVI A;  3MKE A;  5FQQ A;  4WZ5 A;  3HLD A;  3VE4 A;  5HSQ A;  3VFF A;  5DTT A;  3NIA A;  3SW1 A;  1SDE A;  3SS3 A;  4NKP A;  5KIZ A;  3VSL A;  1UWN X;  2K7S A;  3DWK A;  3OPR A;  3BY9 A;  3T4S A;  3UMD A;  4EBP A;  3LYX A;  3BFD A;  3V3R A;  2ZBB A;  2EFU A;  5G4Z A;  5F1F A;  4ZDX A;  3H7W A;  3NBL A;  3VE3 A;  1YLY A;  4C75 A;  3KSI A;  1IEM A;  3SS5 A;  1KDS A;  3FPV A;  3WS5 A;  2R9X A;  1ERQ A;  5AVE A;  4R38 A;  2Z2M B;  3UNW A;  4Y13 A;  3NDG A;  4ZJ2 A;  2ZQC A;  4KG5 A;  4BL2 A;  3S7P A;  3L7H A;  4O7D A;  4WN5 A;  1K55 C;  2JKR I;  5E43 A;  1JWP A;  1CJF A;  3CWF A;  2DNS A;  2RL3 A;  5I94 A;  1O7E A;  1FQG A;  4LLO B;  2JCH A;  5EOE A;  2Y2Q A;  3MMH A;  3PTE A;  4E04 A;  3BEC A;  5EUA A;  3BW6 A;  3VFH A;  4DN0 A;  3MZD A;  3HLW A;  3TSG A;  3LR0 A;  3LY3 A;  3GTC A;  3ZVW A;  1JWZ A;  1DP6 A;  2ZMF A;  2IWB A;  5FQI A;  1S6R A;  2EA9 A;  5DF7 A;  2P08 A;  1SHV A;  4OON A;  2AVX A;  2G2U A;  3KYZ A;  2JBF A;  3N4I A;  3C4P A;  4JGP A;  3KSH A;  4MN7 A;  4X1L A;  3GDI A;  1YKD A;  3WS0 A;  5AVF A;  3LIC A;  1PZP A;  4UHU A;  2GDN A;  3G2Z A;  1YLZ A;  1PYY A;  3MQO A;  3DTE A;  3QNB A;  1H8Y A;  1UWP X;  3RXW A;  1SKF A;  4N1H A;  5J4E A;  3FG8 A;  1XGJ A;  2OWJ A;  2OWH A;  3ZGA B;  4RX3 A;  2LB9 A;  4I39 A;  2A49 A;  3PBQ A;  1GA0 A;  2H0T A;  1PI4 A;  4B93 A;  4JXV A;  1F5M A;  2FH5 A;  4K0X A;  3MQQ A;  5CGS A;  3IS2 A;  5DFY A;  3MZE A;  3C2W A;  2JC7 A;  2WKH A;  4NEE D;  1CK3 A;  1TS0 A;  4AFI A;  4WBG A;  5CED A;  1FSY A;  2WAF A;  4U0X A;  4Y2F A;  3IQA A;  4I38 A;  2O9C A;  1TEM A;  3ZQ5 A;  3KYE A;  4Q8I A;  3ZHH A;  3K3D A;  4IVI A;  2GNX A;  1K25 A;  1YAX A;  3FKV A;  4L9F A;  4PPR A;  2B5R A;  2O9A A;  1LL9 A;  5HAR A;  3O5Y A;  1RCJ A;  1BT5 A;  1EWZ A;  1YPR A;  4PM7 A;  1YM1 A;  2EWW A;  1K0K A;  2WKE A;  1WYB A;  1M40 A;  4GS9 B;  1E3U A;  1T1C A;  1F2K A;  1I2S A;  1OME A;  5EVI B;  1PWD A;  1Q2P A;  4ZBE A;  3T1Q B;  4MN5 A;  4X1M A;  4EEU A;  1K4F A;  3WS2 A;  5L09 A;  3KSF A;  3F1P A;  1N9B A;  2J9P A;  2G2W A;  4N9K A;  1L3L A;  3JYI A;  4JF4 A;  4KZ4 A;  3ZFZ A;  3BRM A;  5AQ7 A;  4GN2 A;  4PHT A;  3UDX A;  2XD1 A;  4OKP A;  3P09 A;  3A0V A;  4X69 A;  3H7W B;  1HTZ A;  5TFQ A;  4EQI A;  4BQM A;  3GEC A;  4U0T A;  2PU4 A;  3IH9 A;  5HDD A;  5J8X A;  4PKY G;  5E2F A;  5TR7 A;  2ZMV A;  2Y2J A;  3TOI A;  1IKG A;  4II7 A;  4GB7 A;  5CTM A;  3IF5 A;  2JKT I;  3AGE A;  3V3S A;  3CG5 A;  1JVJ A;  1L0E A;  1ONG A;  1ES2 A;  1WA9 A;  4KQO A;  4WMC A;  2Y79 A;  2Q9N A;  4E3L A;  3LID A;  2X02 A;  2BG1 A;  2Y2N A;  3PR6 A;  5FA7 A;  4BBU A;  3IF6 C;  4C3Q A;  3MBZ A;  2J3W A;  2HV1 A;  2W3D A;  4FH2 A;  2VK3 A;  3S1Y A;  1D1J A;  3WS1 A;  2XQZ A;  1T1A A;  4E3I A;  2JKR M;  3NJA A;  4P6Z S;  3MF0 A;  3BFE A;  5FQ9 A;  3T4J A;  2XRO A;  3AGD A;  1LL5 A;  2ZOI A;  4PM6 A;  1E4D A;  5TBM A;  4EW7 A;  1YLT A;  3RFB A;  5KZH A;  2PD7 A;  2QWS A;  1W8Y A;  3HL9 A;  3LR3 A;  2DRW A;  3HUO A;  4HQA A;  1XA1 A;  2ZM2 A;  1F9I A;  4KG2 A;  3IH8 A;  3W4P A;  2HDS A;  4FTX A;  4JGR A;  1VM1 A;  4WZ4 A;  3HJK A;  5FEG A;  5U47 A;  1IYP A;  2QPN A;  3LIA A;  2KOI A;  5FL3 A;  4CLC D;  5JYO A;  1XFN A;  1VET A;  5DTS A;  4N92 A;  3UME A;  3F1N A;  2ZQ9 A;  4ETX A;  2ZC7 A;  3MQ0 A;  2O0Y A;  2W1R A;  3MSH A;  3KSG A;  3LR5 A;  3IS2 B;  2Z2L B;  1BLC A;  3PYP A;  4O8G A;  4GNU A;  4HI4 A;  1GCE A;  5L8M A;  1MWR A;  3OOV A;  5DJT A;  4IBX A;  4A5R A;  4S2M A;  3HLB A;  3S7Q A;  4OVD A;  1DJA A;  3G34 A;  5FSR A;  2VGK A;  3T4T A;  5IHV A;  2DCF A;  4LEN A;  2ACG A;  3M2K A;  2PBY A;  1MPL A;  5F5Y A;  1Y4O A;  2B18 A;  1D06 A;  4KQQ A;  3BFF A;  3LO7 A;  5J7E A;  3T4K A;  2VKS A;  2ZC6 B;  1XGI A;  4I5S A;  4LV1 A;  4ZJ1 A;  3E4O A;  2L1M A;  4R0Q A;  1OPX A;  4OP8 A;  2EX2 A;  3FC7 A;  4CLC C;  1ERO A;  2V0W A;  3OCN A;  4U3T A;  3T1X A;  3MKF A;  2V0U A;  2ZQ8 A;  2P9V A;  1K38 A;  3KX0 X;  2ZC3 B;  2JN7 A;  4OLD A;  3A3F A;  2HDR A;  4E3O A;  4OPY A;  1MWT A;  3F1P B;  2Y2H A;  5AQB A;  3S4X A;  3P98 A;  3BY8 A;  4MN6 A;  4RX2 A;  3S7N A;  4QY6 A;  1YLJ A;  3T1S A;  1KVL A;  1MZU A;  1MWU A;  3HUN A;  4P6Z M;  1G68 A;  1DP9 A;  2HPB A;  4LRX C;  5HWV A;  2W27 A;  2PRF A;  3QP2 A;  2W3E A;  4EQ1 A;  4JXS A;  1BSG A;  3IXB A;  5D3O A;  1XJ3 A;  3OC2 A;  1T1B A;  1ZC2 A;  3JPU A;  4OPR A;  1C3B A;  2HP5 A;  2EWV A;  3CIT A;  4KZ7 A;  1TDL A;  2Z6C A;  3MFX A;  4JPM A;  5FDS A;  5GHZ A;  3L9K A;  3ZG7 B;  3C8C A;  2R78 A;  3IHA A;  4IJG A;  5AQ9 A;  1K6R A;  2QHK A;  4CJN A;  2VGL M;  1HVB A;  2DMW A;  3S7O A;  4P6B A;  2GJ3 A;  1CI9 A;  4KZ8 A;  5IT5 A;  1MWS A;  4L0L A;  3OPL A;  3OPP A;  1ZG4 A;  4HEF A;  2Y55 A;  1LL8 A;  1KDW A;  3IX8 A;  3MZF A;  5L10 A;  1SCW A;  5EPH A;  1IYQ A;  4YOF A;  3A3E A;  3BEB A;  3RH8 B;  1ZKJ A;  3UB7 A;  1TF1 A;  4JLF A;  1H3Q A;  2HGV A;  3EOI A;  5AJG A;  3ZDJ A;  4S2N C;  5M18 A;  3LEZ A;  5FAQ A;  4MBK A;  2JKT M;  1MKI A;  2QZ6 A;  2WAE A;  3DTM A;  3IWQ A;  4IVK A;  2NUP C;  4E3J A;  1VB6 A;  2ZM0 A;  3IBR A;  5GLA A;  2VV8 A;  5CGW A;  4NXG A;  3SOI A;  4G3K A;  4HP4 A;  3MS6 A;  3IT9 A;  1J9M A;  4GLQ A;  5C5K A;  4EU0 A;  1U60 A;  1F98 A;  1X0O A;  4EXO A;  3IF6 B;  4E3N A;  5CGX A;  4S2I A;  1VET B;  2EX9 A;  4UAA A;  3EEH A;  2NUT C;  2CC1 A;  3F1N B;  2J7V A;  2G7U A;  4I3A A;  3ISG A;  3G30 A;  2V1B A;  1CF0 A;  4M3K A;  2PYP A;  1W79 A;  4HJ3 A;  1V9Y A;  2UWX A;  2QYB A;  1Z09 A;  3NY4 A;  1IYS A;  2M7U A;  1VHM A;  1H8Z A;  2PT7 A;  3B3X A;  4NK3 A;  5DJU A;  3BJN A;  4Y0U A;  2XRN A;  3UE3 A;  1KE4 A;  2HDQ A;  2FZ0 A;  3A0S A;  3MXQ A;  5KSC A;  1I2W A;  2PYR A;  2L0W A;  5FAS A;  5EVE A;  1P9W A;  3CAX A;  2Y2O A;  3IWI A;  1P0Z A;  4BEN A;  3R4K A;  2KLI A;  4JF6 A;  5CHM A;  5HL1 A;  3NOP C;  4Q0I A;  3MFD A;  1XP4 A;  1XKZ A;  2MJ6 A;  3ULF A;  5EM1 A;  3IX3 A;  2OSU A;  3M6H A;  4IBR A;  4OOY A;  4HP9 A;  3G31 A;  4FD8 A;  5FI2 A;  3GV9 A;  3QP8 A;  3BFC A;  4EUZ A;  5CRF A;  3UDF A;  2P9V B;  2P04 A;  3NCK A;  5HD5 A;  1RGZ A;  3LGO A;  4GHI A;  4WF0 A;  4R3A A;  3BWL A;  2FFY A;  4MDZ A;  4G3V A;  4IHQ A;  4WEJ A;  4MEZ A;  4PM8 A;  3ZNT A;  3BLM A;  2B02 A;  1K55 A;  3C7U A;  3BQ8 A;  3PBN A;  4R3B A;  4R4S A;  3PHY A;  3NI9 A; 
#chains in the Genus database with same CATH homology
 1GSX A;  5HWT A;  1OTI A;  3GEC A;  4O0P A;  2P7J A;  3R7W B;  5EFW A;  1IFQ A;  5HDD A;  1S1Z A;  3P01 A;  4PKY G;  1OTA A;  2ZMV A;  3PXP A;  1N9O A;  4II7 A;  3H9W A;  4MMN A;  5F68 A;  4HJ4 A;  1G28 A;  1Y28 A;  5IU1 A;  2JKT I;  2D02 A;  3T50 A;  3C38 A;  1UGU A;  5I5L A;  4NXF A;  3BQA A;  4R70 A;  4Z1W A;  1WA9 A;  4KQO A;  2Y79 A;  3CUE A;  3LID A;  2HJE A;  3B33 A;  1LSW A;  3PR6 A;  4ME4 A;  3JVV A;  3F1O A;  2PD8 A;  2VLG A;  1GSW A;  4BBU A;  2BAS A;  3TJZ C;  3ZYT A;  3LFV A;  3E4P A;  2WKR A;  2YKH A;  2J3W A;  2HV1 A;  2W3D A;  3V67 A;  1W63 M;  1OT6 A;  2YKF A;  4XT2 A;  5KSH A;  3CLO A;  1T1A A;  2JKR M;  1NLY A;  1BYW A;  3NJA A;  4P6Z S;  3MF0 A;  3EWK A;  3T4J A;  2XRO A;  5HD3 A;  5A8B A;  2A24 A;  1OJ5 A;  4DMZ A;  2ZOI A;  1XJ2 A;  4BMW A;  4HY8 A;  5TBM A;  4EW7 A;  4UEY A;  3RFB A;  4HJ6 A;  2PD7 A;  2QWS A;  1IOU A;  3K3C A;  4NXB A;  3LR3 A;  2PR6 A;  2W3G A;  5DKL A;  4HQA A;  2KDK A;  1F9I A;  4DJ3 A;  2HF6 A;  4EUV A;  4HIA A;  4Y5F A;  4JGR A;  3HJK A;  2CMN A;  5IS1 A;  3LIA A;  1S66 L;  2KOI A;  3T4Q A;  5HL6 A;  5FL3 A;  4CLC D;  1XFN A;  2INW A;  2W1T B;  3E98 A;  2VA0 A;  2OAQ 1;  5HPF A;  2O9B A;  3UME A;  3F1N A;  3C30 A;  3UE6 A;  5TJJ A;  4ETX A;  3MQ0 A;  2O0Y A;  1YSP A;  2W1R A;  2W3F A;  3KSG A;  1STZ A;  1JNU A;  3LR5 A;  3IS2 B;  4L9E A;  4F3L B;  4NXE A;  4O8G A;  3U2A A;  3PYP A;  2LB5 A;  1W63 Q;  3EQV A;  4HI4 A;  4Q0H A;  4GJ4 A;  2WKP A;  5L8M A;  4HH3 A;  5HDS A;  3VOL A;  3OCL A;  3LI9 A;  3OOV A;  2M7V A;  5DJT A;  1TD5 A;  3LIF A;  1KOU A;  4CLC B;  3S7Q A;  3B47 A;  3EEA A;  2KX6 A;  2PR5 A;  2QJ7 A;  2J3T D;  3T4T A;  4ARZ A;  4HH2 A;  4EES A;  4H6J A;  4RQ9 A;  2OOL A;  3RTY A;  1TS8 A;  5F6A A;  5F5Y A;  5K5B A;  2B18 A;  1D06 A;  5HWW A;  3LIB A;  2QKP A;  3JVU A;  1DP8 A;  4I3J A;  3G6O A;  5J7E A;  3T4K A;  2VKS A;  4IUK A;  3KO6 A;  4WLA A;  3PBT A;  4I5S A;  4YNR A;  4LRY C;  1P97 A;  3E4O A;  2L1M A;  1LT0 A;  1OPX A;  4LRZ E;  1T18 A;  5DFX A;  3FC7 A;  4CLC C;  5TBM B;  1MKM A;  2V0W A;  4WEK A;  4GS9 A;  2A2L A;  2M1C A;  4WEL A;  3HCY A;  3OCN A;  1G6O A;  3P7N A;  3LUQ A;  3TE8 A;  2V0U A;  3HJI A;  1T19 A;  3KX0 X;  3PBS A;  2Z6D A;  2JHE A;  3VE4 A;  5J3W A;  2Y8H A;  5HSQ A;  2JN7 A;  4BBT A;  3H82 B;  3SW1 A;  4GHI B;  2VJW A;  5G4Y A;  4NKP A;  5KIZ A;  3F1P B;  3MR0 A;  1UWN X;  2K7S A;  4PKY A;  3VV4 A;  3BY8 A;  4MN6 A;  3S7N A;  3BY9 A;  3T4S A;  2VEA A;  2J3T C;  3UMD A;  1S4S A;  1OTE A;  3LYX A;  1N9N A;  4R6L A;  2I9V A;  2ZBB A;  5G4Z A;  1MZU A;  2PHY A;  4FSF A;  4P6Z M;  3H7W A;  1DP9 A;  4QPR A;  3VE3 A;  2V1A A;  4MCW A;  4M4X A;  3KSI A;  4EEP A;  4LRX C;  5HWV A;  1XJ4 A;  2W27 A;  3FPV A;  5HZH A;  2W3E A;  3R7W A;  4EQ1 A;  5AVE A;  4R38 A;  4OOM A;  5MC7 A;  1XJ3 A;  3OC2 A;  1GSV A;  3W2Z A;  1T1B A;  4JGO A;  4LPZ A;  2EWV A;  3CIT A;  3S7P A;  4HNB A;  2Z6C A;  3MFX A;  1S67 L;  2L4R A;  4WN5 A;  2IA2 A;  1YSQ A;  4EET B;  3C8C A;  2R78 A;  1XFQ A;  2JKR I;  3A0R A;  3OLO A;  4IJG A;  2QHK A;  2VGL S;  1LSV A;  3CWF A;  2VGL M;  2DMW A;  3ICY A;  3PBR A;  3S7O A;  2GJ3 A;  3OBF A;  5IT5 A;  4L0L A;  4DJ2 A;  4LLO B;  3MMH A;  3FPW A;  4E04 A;  1LL8 A;  3BW6 A;  1MC0 A;  4DN0 A;  1ODV A;  3LR0 A;  4YOF A;  3EQU A;  4JGQ A;  4UQI S;  1N9L A;  2XSS A;  2XA7 S;  4UQI M;  1S1Y A;  3UB9 A;  3IBJ A;  1DP6 A;  2ZMF A;  3F1O B;  3RH8 B;  4KUO A;  2W3H A;  2EA9 A;  3UB7 A;  2P08 A;  1TF1 A;  3EOI A;  1H3Q A;  2HGV A;  5AJG A;  3NOT C;  2JKT M;  2V9A A;  3KYZ A;  1ZTU A;  2VX8 A;  4JGP A;  4HOI A;  2K2N A;  3KSH A;  2NUP C;  4MN7 A;  4Y3I A;  1VB6 A;  3GDI A;  4XT2 B;  1YKD A;  1XJ6 A;  1OTD A;  3IBR A;  5AVF A;  4L9G A;  2VV7 A;  2HJ9 C;  4I3I A;  3CUE C;  3LIC A;  2ZOH A;  2VV8 A;  2GX5 A;  2A24 B;  3D72 A;  5DKK A;  4CQH A;  3PBO A;  4NXG A;  4CLC E;  4G3K A;  3CI6 A;  3T4O A;  3MQO A;  3TRC A;  3B42 A;  5LBR A;  1UWP X;  4HP4 A;  5J4E A;  1H8M A;  3FG8 A;  3E0Y A;  2OWJ A;  2OWH A;  3D3O A;  4GLQ A;  2LB9 A;  3DBA A;  4I39 A;  2W1T A;  5C5K A;  3PBQ A;  4GCZ A;  4EU0 A;  1OT9 A;  1F98 A;  1X0O A;  3UB6 A;  4EXO A;  4B93 A;  1F5M A;  2FH5 A;  3KYQ A;  3MQQ A;  2D01 A;  4OOL A;  4WL9 A;  3EEH A;  3IS2 A;  5DFY A;  2NUT C;  3LR4 A;  3F1N B;  4F3L A;  3C2W A;  3EGX C;  2G7U A;  1TS6 A;  4I3A A;  3UB8 A;  2WKQ A;  2V1B A;  4NEE D;  4GW9 A;  1D7E A;  2PYP A;  1TS0 A;  4HJ3 A;  4AFI A;  1V9Y A;  4ETZ A;  4CLC A;  2GZA A;  2OAP 1;  4Y2F A;  2QYB A;  3EGD C;  3MJQ A;  3TW8 A;  4K08 A;  4I38 A;  2M7U A;  1VHM A;  2O9C A;  2PT7 A;  5DJU A;  3BJN A;  2XRN A;  2QJ5 A;  3UE3 A;  3ZQ5 A;  4BJP A;  2FZ0 A;  3A0S A;  3MXQ A;  3K3D A;  1NWZ A;  2GNX A;  2PYR A;  3K2N A;  4IUH A;  2L0W A;  1V9Z A;  4O01 A;  4ARZ B;  1YAX A;  4H6J B;  4B9O A;  1NRJ A;  1P9W A;  4L9F A;  3CAX A;  4KUK A;  2O9A A;  1TS7 A;  1P0Z A;  3R4K A;  4WUJ A;  2KLI A;  3O5Y A;  1EW0 A;  2W0N A;  4EER A;  3NOP C;  4Q0I A;  1DRM A;  3LI8 A;  2EWW A;  2MJ6 A;  4KQD A;  3T4L A;  3ULF A;  5CX7 A;  4G3W A;  4GS9 B;  5HDC A;  3LIE A;  4HP9 A;  1T1C A;  2PDR A;  2VZW A;  2H28 A;  2P04 A;  5HD5 A;  4MN5 A;  3NHQ A;  3E4Q A;  3NOU C;  3H82 A;  5HPI A;  4EEU A;  4Q0J A;  4GHI A;  4WF0 A;  4YWZ A;  4R3A A;  3BWL A;  3KSF A;  3F1P A;  2XA7 M;  4ZRR A;  1OJG A;  2VV6 A;  4MDZ A;  1OTB A;  4FOF A;  2J80 A;  4HHD A;  4G3V A;  4IHQ A;  4WEJ A;  4PAU A;  5DF9 A;  2B02 A;  1NLZ A;  1LSX A;  4BWI A;  1S4R A;  1ZHH B;  4PHT A;  2K31 A;  2O99 A;  3BQ8 A;  1P9R A;  5F69 A;  3A0V A;  4BBV A;  3PBN A;  3H7W B;  3PHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...