2W3HA

Cyanide bound structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
b'GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
total genus 41
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3hA00
4YOFA 4GLQA 5DFXA 3EEAA 4ME4A 2VJWA 2W3HA 3TRCA 5HPFA 4E04A 3R4KA 1VHMA 5HL6A 3OOVA 5LBRA 4MN7A 2Y79A 3HCYA 4IUHA 3C2WA 4YNRA 4Q0JA 3ZQ5A 2B18A 1F5MA 4GW9A 5TJJA 3IBJA 2O9BA 2O9CA 1MKMA 3BJNA 4LRYC 3S7PA 1YSQA 5DFYA 4O8GA 4MMNA 3O5YA 2GX5A 2K2NA 2HGVA 2M7UA 4QPRA 3S7NA 4PAUA 1TF1A 3MMHA 4O01A 4FOFA 3G6OA 3OBFA 2KOIA 4Y3IA 5HSQA 2K31A 3CI6A 3K2NA 3KSHA 4Y5FA 4LRXC 5L8MA 1YKDA 2O9AA 4MDZA 4DN0A 3CITA 2W1TA 4EU0A 4ETXA 3VV4A 4ETZA 4DMZA 2W3EA 3W2ZA 4G3VA 2VEAA 3LFVA 3S7QA 3NOTC 4Q0IA 5I5LA 1TD5A 3E0YA 3RFBA 5K5BA 2XRNA 2LB5A 4Y2FA 3MF0A 4LRZE 4BWIA 2QYBA 2LB9A 1ZTUA 2G7UA 4EUVA 4G3WA 3KO6A 4G3KA 2OOLA 2VKSA 2W1TB 2ZMFA 2XROA 4ZRRA 3D3OA 4RQ9A 4CQHA 4O0PA 4IUKA 3NHQA 1STZA 2O99A 4R6LA 2W3GA 2W3DA 4IJGA 3MQ0A 5AJGA 3KSIA 2W3FA 5C5KA 2W1RA 3S7OA 1MC0A 2VZWA 3KSGA 1YSPA 2XSSA 4Z1WA 2Y8HA 3KSFA 4MCWA 4Q0HA 3DBAA 2IA2A 3NOUC 5HPIA 2O0YA 3E98A 4R70A 2M7VA 2KLIA 3NOPC 3IBRA
chains in the Genus database with same CATH superfamily
4FSFA 4R3AA 5U47A 1PRQA 3LY4A 2ZOHA 2VK3A 1FILA 2EXAA 3C2WA 3IF6A 3LGOA 3P7NA 1KE3A 1V9ZA 1ZHHB 1H8MA 2Y2HA 4E3JA 4LENA 2GX5A 1OPXA 5J4EA 1XKZA 2X71A 1EI5A 3MMHA 1OTIA 4WM9A 1PI4A 5AQBA 1SCWA 4QWOA 5FQKA 2Y59A 5FQMA 2Y2JA 2OLVA 4E3IA 2EX8A 3PAGA 2JN7A 3TE8A 1GSVA 3NBLA 1BLCA 5G4YA 4UAAA 4LRZE 5L10A 3T12B 2ZQ9A 5A91A 4EBPA 4DE2A 1IYQA 2L4RA 4I38A 2H28A 4O0PA 3LR0A 1KVLA 5CRFA 2I9VA 4WMCA 1Z09A 4PPRA 5C5KA 4Y13A 5AQ9A 1D06A 5EM0A 2VZWA 1KE4A 1T18A 4KG2A 1L3LA 4ZJ1A 3U4LP 1IYSA 2UV0E 5EOOA 4OQ0A 1GCEA 2O0YA 5J3WA 3VE3A 3SZTA 4I3AA 2BLSA 5DF9A 4E04A 1N4OA 1SKFA 4MN7A 4UA9A 1VETB 3V39A 4PMAA 4BBVA 1F5MA 3IBJA 4HJ3A 2J9PA 2BG1A 3NC8A 2PBDP 3UMDA 4GKUA 3O3VA 2CC1A 2K7SA 3G2YA 4XUXA 5AVFA 3ZNTA 1FSWA 1ES3A 4A5RA 3VP3A 2K31A 5EUAA 3CI6A 4II7A 2HDQA 2A2LA 1YLZA 5CHMA 1CF0A 4HHDA 1BLHA 5EV0A 2Z2MB 5DVAA 5J7EA 4JBFA 2W3EA 1P9RA 1D1JA 3BFFA 3LEZA 2HP5A 3ZG5A 3CUEA 4NXEA 4HIAA 1YLPA 3CG5A 3CLOA 5HWWA 1OT9A 2QYBA 3EEHA 5EVIA 4EEUA 4X68A 3KYZA 4MN6A 2ACGA 1DJCA 3VP0A 2J3TD 2WKHA 5DTKA 3A0RA 4HJ4A 3FG8A 1Z6FA 1NLZA 3MS6A 2XH9A 4EEPA 2PR6A 2D02A 4F94A 3NJAA 1ZG4A 5CGSA 4BJPA 1DY6A 4X56A 1YSPA 1L2SA 2GZAA 4Y0TA 3T1SA 3T4QA 2OLUA 5FI7A 1VQQA 2JKTI 5TGFA 2YKFA 3HVFA 4QHCA 1YAXA 3S1YA 2WKQA 3IQAA 2EXBA 2P04A 2FFFB 3FPVA 4X1MA 2HP9A 4DF6A 1O7EA 2JE5A 4KQRA 1G6OA 4OQIA 2BASA 4KZ3A 3BYDA 2P7JA 3WRZA 2HGVA 4WYYA 1CI8A 5FSRA 4O01A 1E3UA 1OTDA 4JXWA 5EECA 4OVDA 1ERQA 1S66L 1BTLA 4M4XA 3LUQA 4OPRA 1UWPX 3CITA 2GNXA 3PBOA 1MKIA 3C30A 1TDGA 4I39A 3LEQA 2ZQAA 1L0DA 1GHMA 4PKYG 3A3IA 3LO7A 2XFSA 4N92A 1TEMA 5E43A 1XFQA 1OTAA 3Q07A 3JPUA 1SKOA 3NDEA 4DE0A 3HLEA 2ZC7A 4S2MA 3KX0X 3CUEC 3VP2A 3HREA 3MJQA 4K08A 3E4PA 3IH8A 2E8IA 2VA0A 1BYWA 2W27A 3IHAA 2WZZA 3EQVA 1K54A 1CEGA 3O87A 3IT9A 3BFEA 4JPMA 5EVLA 3EOIA 1K54C 4LFUA 2V20A 1VB6A 1IYOA 2OWHA 3UDFA 3EEAA 2EA9A 1C3BA 5F68A 3UNWA 1JNUA 3O88A 4WEJA 3WS1A 2C5WB 3IWIA 4NXFA 3ZDJA 4GD8A 2WAEA 3BQ8A 4S2PA 5TJJA 5DTTA 1LI0A 4WN5A 1GSXA 1YSQA 1YMSA 2KDKA 3BFGA 1BUEA 5F1GA 2K2NA 4S2IA 5FAOA 4K91A 4NG2A 3M2JA 5DJTA 4EW7A 4CLCE 4OPQA 1OT6A 1S1YA 3KSHA 4IVKA 2O9AA 2WKIA 4E3KA 3VP4A 3BY8A 4C6YA 1HVBA 1Q2QA 3BFCA 3BRMA 5KMWA 5I5LA 3IHBA 2ZQ7A 3ZVWA 3G31A 3GV9A 3ISGA 3RFBA 5F82A 2V1AA 3HUOA 2IWDA 4OOMA 1K25A 4X25A 4S2LA 1YLYA 4FD8A 2ZM8A 4ZJ3A 3N4IA 3ZG8B 4RQ9A 3UMEA 4AFIA 2C6WB 1ZKJA 1NZUA 3PXPA 1MBLA 4Y0UA 3UPOA 1JTGA 3PBTA 1GA9A 1P97A 2W3FA 2ZC3B 4CLCB 5HZHA 3UDIA 1ES4A 5FI6A 5IS1A 3IWQA 3KSGA 2Y2NA 3GR2A 2GDNA 1X0OA 4HY8A 4L9GA 3ZG7B 2A3UA 1OJGA 3AGDA 4DXBA 3MFXA 1Y4OA 1XJ3A 2XF3A 3B47A 2Y2QA 3LYXA 4GW9A 1IFQA 3PTEA 3OPRA 3DTMA 4O8GA 1N9NA 2Y2PA 1CEFA 3PHYA 4WELA 3VOZA 2V1BA 2ZL1B 1KE0A 4KUKA 3HBRA 3AGFA 3DWZA 4XXRA 4OH0A 4BD1A 2J3WA 4OOYA 5EFWA 1FR6A 3DW0A 2H0YA 4CLCD 1KGGA 1MXOA 4UQIS 4R4RA 4LGWA 5CXWA 5FQQA 2J9OA 3IWOA 2PD7A 1DJAA 4R0QA 5EVID 4OQGA 2YKHA 1NY0A 4HESA 1HLUP 5E2HA 5CHJA 1U60A 2XGNA 3VE4A 4ZJ2A 5IHVA 1MWTA 1RGYA 3NULA 5F1FA 5HPIA 5FA7A 1W8YA 4JF5A 1H0MA 1HZOA 1VETA 2ZM2A 1G28A 2HPBA 3IF6B 4BQMA 4GNUA 1W8QA 4GLQA 5FQJA 1HD8A 4KZ4A 1XGIA 1XFNA 4L9EA 4ME4A 4X69A 3FC7A 3HCYA 3ZQ5A 1H3QA 5HWTA 3JVVA 2NUPC 4WLAA 3K3CA 4HP9A 2Y2MA 4MMNA 3O5YA 3P01A 4DJ3A 4UEYA 4QPRA 4PAUA 1TF1A 3G6OA 3CPTA 2V8CA 2KOIA 3BLMA 2ZQ8A 3MQOA 1PWDA 1JWZA 2Y91A 3FV7A 1K55A 1YM1A 3CMZA 2V2FF 4K0XA 5HDCA 4LV2A 2V1ZA 4P6ZM 3T4SA 3RXXA 2XQZA 3G4PA 5CERA 2ZM0A 3E0YA 3QP2A 4S2NC 1A0KA 2QJ5A 3R7WA 4F3LA 4EUVA 2ZMAA 3IXHA 3KO6A 4R3BA 4R3JA 4G3KA 3PBNA 1LL8A 4QB8A 2XFTA 4H6JB 3CHWP 2HJEA 3PBSA 1ZG6A 2J7VA 5EVIB 3UE6A 3H82A 1M40A 2L0WA 3ZHHA 4HP4A 4IBXA 1P9WA 5FDSA 4JGRA 3MKEA 3EWKA 4KZ5A 3C7VA 3T4KA 4NETA 2V8FA 2QJ7A 2KLIA 3V50A 3HJKA 1Y28A 3MQQA 1JWPA 3ZNYA 3M2KA 1ALQA 1MWUA 1PW1A 2Y79A 1KDWA 5FASA 3GSGA 3ITBA 1I5QA 4IBRA 5IT5A 1XJ6A 4FUWA 2B95A 3A0VA 4EQIA 5L2FA 2HDRA 4KZ6A 4GOGA 2VV8A 1LI9A 3IX3A 3GECA 5GLDA 1YLTA 4H6JA 3WRTA 4WZ5C 1ES2A 1G5UA 3UE3A 4EV4A 5DTSA 1N9OA 3NOTC 4Q0IA 1NJ4A 1TD5A 4EBNA 1KGFA 2VGJA 5E2FA 1PWCA 4O7DA 1NWZA 1ESUA 4KQDA 5DF8A 5J8XA 3E4OA 1K38A 4JF4A 3IX8A 1RGZA 3LR5A 3UE1A 4CPKA 3QP5A 2QZ6A 1PNEA 3G2ZA 3LR3A 1K4FA 2L1MA 2V0WA 4HOIA 4S2JA 3NOUC 4DKIA 3A0SA 4R70A 1PI5A 2JBFA 1CK3A 5KSCA 1NLYA 3TRCA 5HAIA 2Q9MA 3BEBA 1MWRA 1IYPA 2ZC6B 2Z6CA 1PIOA 3ULFA 4KQQA 3Q7VA 2VLGA 3CJMA 5KIZA 3IF5A 5DFYA 4D60A 2QMIA 3WS2A 3E2KA 2Z6DA 1S6RA 3RXWA 2PDRA 3C7UA 4GD6A 3JVUA 3T50A 5FATA 2Q0OA 1YMXA 3BECA 3WS5A 2WKPA 2ZOIA 1LSXA 4N9LA 3MZDA 4Q8IA 2QPNA 1K4EA 4PM8A 5CEDA 2ZMVA 1SHVA 2R9XA 4LV1A 5K5BA 4LLOB 1W5DA 4BWIA 1TDLA 2G7UA 2VX8A 2VV7A 4HH2A 3QP1A 3Q81A 4K0WA 5F6AA 1W63Q 1STZA 3B33A 3OPHA 1PYYA 1BZAA 3H7WA 2OAQ1 1XX2A 1V9YA 3MXSA 4QY6A 2EFUA 4KENB 3ICYA 4Z1WA 2BTFP 4WUJA 1ONHA 1T1CA 3SH7A 3G30A 2ZC5B 4NXBA 4EQ1A 4PM6A 3VSKA 1J3WA 4KZAA 4GN2A 5L09A 1DP6A 3BFDA 4IHQA 3L9KA 4B4XA 2ZLYA 2V0UA 2P9VA 1L0FA 2H5SA 1K6RA 2VJWA 3SOIA 3ZG9B 1KGEA 4R4SA 1TVFA 2X02A 1I2WA 4Y7PA 2PR5A 4R1GA 4Q0JA 1SDEA 1SZVA 2OV5A 5M19A 2ZC4B 3UB6A 5EE8A 2ZL1A 2O9CA 1XA1A 4BMWA 4KZ9A 3ZCZA 2XDMA 1MPLA 2XLNA 1LL9A 3T4LA 4PM5A 1IKGA 3VFHA 3LIDA 2JC7A 3PAEA 3FWLA 2JKGA 2PD8A 3VOLA 1YKDA 3VV4A 3T1QB 1JTDA 1FQGA 4B4ZA 1F2KA 3V3RA 1QMFA 1JVJA 4G3VA 1UGUA 3HLDA 1VEUA 4UHUA 1CQAA 1EW0A 4HQAA 4Y17A 4JKTA 5AQAA 3LCEA 2XRNA 3D9YA 2ZD8A 4DE1A 3F1PB 4X1LA 3MFDA 5HWVA 4PKYA 3ZVTA 2OOLA 2INWA 2W1TB 3BQAA 1S1ZA 4CQHA 3UB9A 1BULA 2O99A 2HDSA 2JKFA 4MEZA 5HD3A 4XT2B 3C38A 4PM9A 4LCMA 2DNSA 3MR0A 3S7OA 4GJ4A 1G6AA 2V9AA 5DF7A 3T4TA 5HAQA 2WGVA 2Y8HA 4BLMA 1P0ZA 2Y2KA 3GMWA 2EX9A 1EWZA 3B3XA 2IA2A 3N8SA 4EBLA 3MZFA 5M18A 2WKEA 3TJZC 4GDNA 2OWJA 2PRFA 1W79A 3HJIA 3PYPA 1BLPA 3E4QA 4QJGA 4GS9B 5GL9A 4E3OA 3G35A 3R4KA 2QWSA 5KZHA 5TR7A 1H8ZA 2G2WA 4QY5A 3LR4A 3LI8A 3N6IA 3U2AA 3LI9A 3MXRA 3BJNA 3ZYTA 4MBFA 3D4FA 3IXBA 5G4ZA 4UA7A 2FZ0A 4S2NA 3PBRA 5FL3A 4B88A 1GA0A 1S4RA 2J80A 3IF6C 5L07A 3OC2A 1H8YA 5HSQA 4MN5A 5E2GA 1XJ4A 4MBHA 1K0KA 5HDDA 1LT0A 5KSHA 2W1TA 2H0TA 1FCMA 1ODVA 4DMZA 1SDNA 4HBTA 5AVEA 3KYEA 3A3EA 2AVXA 2JKRM 2LB9A 5D3OA 3IXGA 4RVAA 1FIKA 4DXCA 1T19A 1W7FA 1TS7A 2HV1A 2EX2A 4KZ8A 1XXMA 2W3GA 4C3QA 4GB7A 1K55C 1NZOA 5AJGA 1M6KA 5F69A 5JYOA 1MC0A 5CTNA 2B5RA 2ZQDA 5AQ7A 2KX6A 3KSFA 4Q0HA 4IEDA 4ZAMA 3G34A 1AXBA 5HX9A 4LV0A 3UY6A 4EETB 1VM1A 2XD1A 5A90A 2GJ3A 1AWIA 2XK1A 4WEKA 1ESIA 3OCNA 4HH3A 5HL6A 2D01A 5LBRA 2EWWA 3F1OA 4KQOA 2RL3A 1ERMA 3QNBA 1FSYA 3NCKA 4HBUA 3S7PA 1FCOA 2XA7S 3Q82A 3DAVA 3TOIA 2WGWA 1XP4A 4E3LA 3A3JA 4X6TA 3H9WA 2ZJ9A 2HJ9C 4LCLA 5A8BA 4RX3A 3VMAA 4OOLA 4Y5FA 1DP8A 3JYIA 4LPZA 4DN0A 4UA6A 3D72A 3W4PA 4ETZA 2NUTC 3SS4A 3QP8A 3E2LA 3KYQA 4HNBA 2WAFA 2VEAA 4C75A 4E3MA 5GLBA 4EWFA 1XJ2A 4CLCA 1O07A 1ONGA 3L7HA 4UQIM 1TS8A 2B02A 2HZ5A 1XPBA 5EM1A 3P09A 3EGXC 3MF0A 4RA7A 3HLCA 5CGXA 5CECA 5IU1A 2PT7A 2ZMFA 4ZRRA 1GSWA 3HL9A 4R6LA 4FH4A 1NRFA 2G2UA 4ZBEA 3O86A 3QHYA 1FCNA 1LSVA 1MY8A 2P9VB 4L0LA 4OPYA 3LICA 1EROA 2HDUA 1FR1A 1WYBA 1L0GA 3IBRA 3TW8A 2DCFA 5DJUA 2W3HA 1FOFA 1S0WA 1G68A 5HPFA 3M6BA 2W0NA 5HW3A 1GHIA 2P74A 3V67A 1IEMA 4NK3A 1MKMA 3OZHA 5HL1A 3LY3A 4RX2A 3UB7A 3MBZA 3NECA 3P98A 3BW6A 3QP6A 3FKWA 3MZEA 4E6WA 3GQZA 2WUQA 4X55A 3WWXA 1LLBA 3F1OB 3N8LA 3K2NA 2Q9NA 2Z2LB 4MDZA 1PZPA 3N7WA 2QKPA 5GHXA 4KG5A 4KZ7A 4MNRA 5MC7A 4IVIA 3LFVA 4OP5A 3HLBA 1F98A 2DRWA 3S7QA 4XUZA 1D7EA 4N1HA 5FQIA 5GLAA 2OSUA 4WBGA 5HARA 5FI2A 4P85A 2A24A 4L9FA 3H82B 2A49A 5TBMA 5I94A 5EPHA 2PU2A 5HDSA 3A3DA 3VP1A 3HLFA 5GHYA 4IJGA 3MQ0A 4N1XA 1T1BA 1YT4A 3PBQA 4BL3A 3GDIA 1MZUA 4OONA 3LIBA 5CTMA 4NKPA 2R78A 5HD5A 1E4DA 2ZBBA 4M3KA 1JWVA 3EGDC 1PZOA 1ACFA 4LV3A 5EVIC 1VHMA 3Q7VB 4WL9A 3UPNA 2WKRA 4IUHA 1LL5A 4U0XA 2WK0A 4FH2A 4HEFA 4BD0A 4R23A 5EOEA 2O9BA 2P08A 4MLLA 4FCFA 1LSWA 4JXSA 1MWSA 5DKLA 3CAXA 4OPZA 4ARZB 1WYCA 2JHEA 3S7NA 4GCZA 1IELA 3FYZA 3IH9A 4Y3IA 1F9IA 1YQSA 3VSLA 1L0EA 4GZBA 3GVBA 3HUMA 3W4OA 3T1RA 3DTKA 2PU4A 2FH5A 1QMEA 4OP8A 2EX6A 1NXYA 3OPPA 4WZ4A 2Y55A 2RCXA 3QP4A 3SH9A 2IWCA 3WS4A 4OKPA 4OQHA 3GTCA 4RYEA 2PHYA 4P6ZS 4IUKA 5DKKA 4ZTKA 4U0TA 1ES5A 2VGLM 1WE4A 4OLDA 5FEFA 2FFYA 4JF6A 4HJ6A 3NDGA 5GHZA 5BOHA 1NRJA 4H8RA 2PYPA 1BLSA 5CHUA 5GLCA 1S67L 2W1RA 1LHYA 4JGPA 1UWNX 3CPTB 3HUNA 3UPPA 1RP5A 4JGOA 2XA7M 1I2SA 1N9LA 4ID4A 2XD5A 4MCWA 2UWXA 5TBMB 4XT2A 1IOUA 3UDXA 2PYRA 1NYMA 3HLGA 1KOUA 1K56A 3UO9A 4BL2A 2M7VA 3NOPC 2R9WA 4D2OA 3DWKA 2MJ6A 1YLJA 4B93A 5FQ9A 3M6HA 4YNRA 3R7WB 4F3LB 5F83A 2ZQCA 3LIEA 4JGQA 4JXVA 1S4SA 4KUOA 3LIAA 4EERA 1OTBA 3T4JA 2M7UA 2M1CA 5A92A 5CX7A 3IX4A 1Y54A 3UE0A 2WGIA 3BM6A 3C5AA 4S2OA 2WGWB 1RCJA 1PWGA 2HP6A 4ETXA 2J3TC 2JKRI 2VGLS 4S2KA 5F5YA 3NY4A 4E3NA 1XA7A 3DTEA 1J9MA 1SKOB 4DRTA 4EXOA 3BY9A 3VFFA 3EQUA 2LB5A 1PW8A 4Y2FA 1ZTUA 5HFOA 4G3WA 2XR0A 3IS2A 3FKVA 3I7JA 1GHPA 2XROA 3F1NA 3ZFZA 3NIAA 4GHIA 1BSGA 1T1AA 4GDBA 3S22A 5A93A 2XSSA 4Y15A 5EVEA 5FEGA 4NXGA 3C8CA 1H5XA 1TS6A 3CWFA 3QNCA 4P87A 3ZGAB 4P6BA 3E98A 3RH8B 4YOFA 4BBUA 5DFXA 2EFXA 5FAPA 5TFQA 3RJUA 5HAPA 4I3IA 1IKIA 5G18A 2PAVP 4EUZA 4KG6A 2JKTM 3FPWA 4EESA 1NYYA 3SH8A 4PHTA 3TSGA 3F1NB 3UB5P 4LRYC 2WZXA 1K57C 4GHIB 1K57A 3GRJA 3B42A 2HF6A 4WF0A 2H10A 3OLOA 2QHKA 3C4OA 3V5MA 4ESPA 4ARZA 4LRXC 1YPRA 4DJ2A 1OJ5A 4WZ5A 2EWVA 3DTIA 4DDYA 4E6XA 1TS0A 3NI9A 2VV6A 4QD4A 5CGWA 1OMEA 1DJBA 3N8RA 2E8JA 3V3SA 1CJFA 4YWZA 3UB8A 3ITAA 3PR6A 3ZG0A 4P0MA 4ZDXA 1W63M 2Y4AA 3MKFA 1K6SA 3K3DA 2A24B 4MBKA 3AGEA 3W4QA 2XEPA 3IXDA 1DP9A 3OCLA 3SS3A 2X01A 2J8YA 4OLGA 4Y0OA 2Y2LA 3SW1A 4B9OA 4BENA 1WA9A 4CLCC 4GS9A 3RTYA 3WS0A 4WMCD 1KVMA 3T1XA 2WADA 5JYPA 4BBTA 5M1AA 4I3JA 3C4PA 3S4XA 1VEUB 1HTZA 3OOVA 4JLFA 3BLSA 3A3FA 4N9KA 3FZCA 4CJNA 3VOYA 2B18A 3UN7A 2JCHA 4NEED 3H7WB 3HLWA 4R38A 4YFMA 3TG9A 2VGKA 4FOFA 1E3UD 3Q7ZA 4I5SA 3OBFA 3F1PA 5L8MA 3CZDA 5CEBA 4EU0A 1YLWA 4KZBA 3SS5A 3W2ZA 4Z9QA 2DMWA 5FDHA 3G32A 5FAQA 2OAP1 2Y2GA 4QU3A 3OPLA 3MSHA 2I72A 2WYXA 1KDSA 4X53A 2VKSA 1CI9A 4FTXA 3D3OA 2Y2IA 3W8KA 3NHQA 3MXQA 2W3DA 5E2EA 1DRMA 3IS2B 1PFLA 3KSIA 1N9BA 4YINA 2IWBA 1OTEA 1ZC2A 4DDSA 4PM7A 3Q1FA 4U3TA 3DBAA 4DE3A 2Y2OA 3LIFA 4HI4A 1K56D 3BWLA 1BT5A 1XGJA 3T4OA 2CMNA 2PBYA 1Q2PA 1E25A 4JXGA
chains in the Genus database with same CATH topology
2V0UA 4FSFA 4R3AA 2VJWA 2ZOHA 1VHMA 3B47A 4WL9A 2WKRA 4IUHA 3C2WA 2PR5A 3P7NA 4Q0JA 3LYXA 4GW9A 1IFQA 3UB6A 2O9BA 2O9CA 2P08A 1V9ZA 4BMWA 1LSWA 1ZHHB 1H8MA 4O8GA 5DKLA 3CAXA 1N9NA 2GX5A 4ARZB 1OPXA 3PHYA 5J4EA 4WELA 3T4LA 2JHEA 3S7NA 2V1BA 3MMHA 4GCZA 3LIDA 1OTIA 4KUKA 4Y3IA 1F9IA 2J3WA 2PD8A 3VOLA 1YKDA 5EFWA 3VV4A 4CLCD 2JN7A 3TE8A 4G3VA 1GSVA 1UGUA 4UQIS 2FH5A 1EW0A 4HQAA 5G4YA 2PD7A 2XRNA 4LRZE 3F1PB 5HWVA 4PKYA 2YKHA 2OOLA 2PHYA 2INWA 4P6ZS 2W1TB 2L4RA 4I38A 3BQAA 1S1ZA 2H28A 4CQHA 4O0PA 3LR0A 4IUKA 5DKKA 2VGLM 3UB9A 2I9VA 2O99A 3VE4A 4HJ6A 1NRJA 5HD3A 4XT2B 2PYPA 5C5KA 3C38A 1S67L 2W1RA 4JGPA 3MR0A 1UWNX 4GJ4A 3S7OA 1D06A 2V9AA 1T18A 2VZWA 4JGOA 3T4TA 2XA7M 1N9LA 2Y8HA 4MCWA 1P0ZA 5TBMB 4XT2A 2IA2A 5HPIA 1IOUA 2PYRA 1KOUA 3TJZC 2O0YA 5J3WA 3VE3A 1G28A 2M7VA 3NOPC 2OWJA 3PYPA 3HJIA 4I3AA 4GLQA 2MJ6A 3E4QA 1XFNA 4GS9B 4L9EA 4ME4A 5DF9A 4E04A 3R4KA 4B93A 2QWSA 3FC7A 4MN7A 3HCYA 3R7WB 4YNRA 4F3LB 3ZQ5A 4BBVA 1H3QA 1F5MA 3LR4A 3LI8A 3IBJA 3LIEA 3JVVA 5HWTA 3U2AA 4JGQA 3LI9A 4HJ3A 4WLAA 3BJNA 2NUPC 3ZYTA 3K3CA 4HP9A 1S4SA 5G4ZA 4KUOA 4MMNA 2FZ0A 3LIAA 3O5YA 3PBRA 3P01A 4DJ3A 4UEYA 5FL3A 1OTBA 3T4JA 4EERA 2M7UA 4QPRA 3UMDA 4PAUA 1S4RA 1TF1A 2M1CA 2J80A 5CX7A 2K7SA 5AVFA 3G6OA 3OC2A 2KOIA 3MQOA 5HSQA 2K31A 4MN5A 3CI6A 4II7A 1XJ4A 2A2LA 5HDDA 4HHDA 1LT0A 5KSHA 2W1TA 2J3TC 4ETXA 2JKRI 5J7EA 1ODVA 2VGLS 5F5YA 2W3EA 4DMZA 1P9RA 5HDCA 4P6ZM 3T4SA 5AVEA 3CUEA 4NXEA 4HIAA 4EXOA 3BY9A 3CLOA 3E0YA 2JKRM 3EQUA 5HWWA 2LB5A 4Y2FA 1OT9A 2QYBA 3EEHA 2LB9A 2QJ5A 1ZTUA 3R7WA 4EUVA 4EEUA 4G3WA 3KO6A 4F3LA 3KYZA 3IS2A 4MN6A 4G3KA 3PBNA 1LL8A 2J3TD 2XROA 3F1NA 3A0RA 1T19A 4H6JB 3FG8A 4HJ4A 1TS7A 1NLZA 2HV1A 2HJEA 4EEPA 4GHIA 2PR6A 3PBSA 2W3GA 3UE6A 2D02A 1T1AA 3H82A 5AJGA 2L0WA 3NJAA 4HP4A 5F69A 1MC0A 4BJPA 1P9WA 1YSPA 2XSSA 4JGRA 2KX6A 3KSFA 4Q0HA 3EWKA 2GZAA 4NXGA 3T4QA 3C8CA 1TS6A 4EETB 3CWFA 3T4KA 2QJ7A 3E98A 2KLIA 2JKTI 3HJKA 3RH8B 2GJ3A 2YKFA 4YOFA 5DFXA 1Y28A 4WEKA 4BBUA 1YAXA 3OCNA 4I3IA 3MQQA 4HH3A 5HL6A 2D01A 2WKQA 5LBRA 2P04A 2EWWA 2Y79A 3F1OA 3FPVA 2JKTM 3FPWA 4KQOA 5IT5A 1G6OA 1XJ6A 4EESA 4PHTA 3F1NB 3A0VA 2BASA 4LRYC 3S7PA 2P7JA 2XA7S 4GHIB 2HGVA 3H9WA 3B42A 2HF6A 4WF0A 4O01A 2HJ9C 1OTDA 3OLOA 5A8BA 2QHKA 2VV8A 1S66L 4M4XA 4OOLA 3LUQA 4Y5FA 4ARZA 1DP8A 3GECA 4LRXC 4DJ2A 1UWPX 4LPZA 3CITA 4DN0A 2GNXA 3PBOA 3D72A 4ETZA 2NUTC 3C30A 1OJ5A 4H6JA 2EWVA 3KYQA 4I39A 4HNBA 1TS0A 2VV6A 3UE3A 2VEAA 4PKYG 1N9OA 3NOTC 4Q0IA 1XJ2A 1TD5A 4CLCA 4UQIM 1TS8A 2B02A 3EGXC 4YWZA 3UB8A 3MF0A 3PR6A 1XFQA 1OTAA 1NWZA 4KQDA 3E4OA 5IU1A 2PT7A 2ZMFA 1W63M 4ZRRA 1GSWA 3KX0X 3CUEC 4R6LA 3K3DA 3LR5A 2A24B 3MJQA 1DP9A 4K08A 3E4PA 3OCLA 2VA0A 3LR3A 2L1MA 3SW1A 4B9OA 1LSVA 1WA9A 1BYWA 4CLCC 2V0WA 2W27A 4GS9A 3RTYA 4L0LA 4HOIA 3NOUC 3LICA 3EQVA 3A0SA 3EOIA 4R70A 4BBTA 3IBRA 4I3JA 1VB6A 2OWHA 3TW8A 3EEAA 5DJUA 2W3HA 1NLYA 3TRCA 5HPFA 2EA9A 3OOVA 2W0NA 5F68A 1JNUA 4WEJA 3V67A 4NXFA 2Z6CA 2B18A 3BQ8A 5TJJA 3ULFA 1MKMA 2VLGA 4WN5A 5KIZA 1GSXA 1YSQA 5DFYA 2KDKA 4NEED 3UB7A 2K2NA 3H7WB 3BW6A 4R38A 5DJTA 4EW7A 4CLCE 2Z6DA 2PDRA 4FOFA 4I5SA 3OBFA 3JVUA 3T50A 1OT6A 3F1PA 1S1YA 3F1OB 3K2NA 3KSHA 5L8MA 2O9AA 4MDZA 4EU0A 2QKPA 2WKPA 3BY8A 2ZOIA 1LSXA 3W2ZA 5MC7A 3LFVA 1F98A 2DMWA 3S7QA 2ZMVA 5I5LA 1D7EA 3RFBA 5K5BA 4LLOB 2OAP1 2V1AA 4BWIA 4OOMA 2G7UA 2VX8A 2A24A 4L9FA 2VV7A 4HH2A 3H82B 5TBMA 2VKSA 5F6AA 3D3OA 1W63Q 4RQ9A 3UMEA 5HDSA 4AFIA 3NHQA 3PXPA 3MXQA 1STZA 3B33A 2W3DA 4IJGA 3H7WA 1DRMA 3MQ0A 3IS2B 3PBTA 3KSIA 1P97A 2W3FA 4CLCB 5HZHA 2OAQ1 1V9YA 1T1BA 1OTEA 5IS1A 3KSGA 3PBQA 3ICYA 1X0OA 4Z1WA 3GDIA 4HY8A 4WUJA 1MZUA 4L9GA 1T1CA 3LIBA 3DBAA 4EQ1A 4NXBA 3LIFA 2R78A 4HI4A 1OJGA 4NKPA 5HD5A 3MFXA 3BWLA 2ZBBA 1DP6A 1XJ3A 2CMNA 3EGDC 4IHQA 3T4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOF A;  4GLQ A;  5DFX A;  3EEA A;  4ME4 A;  2VJW A;  2W3H A;  3TRC A;  5HPF A;  4E04 A;  3R4K A;  1VHM A;  5HL6 A;  3OOV A;  5LBR A;  4MN7 A;  2Y79 A;  3HCY A;  4IUH A;  3C2W A;  4YNR A;  4Q0J A;  3ZQ5 A;  2B18 A;  1F5M A;  4GW9 A;  5TJJ A;  3IBJ A;  2O9B A;  2O9C A;  1MKM A;  3BJN A;  4LRY C;  3S7P A;  1YSQ A;  5DFY A;  4O8G A;  4MMN A;  3O5Y A;  2GX5 A;  2K2N A;  2HGV A;  2M7U A;  4QPR A;  3S7N A;  4PAU A;  1TF1 A;  3MMH A;  4O01 A;  4FOF A;  3G6O A;  3OBF A;  2KOI A;  4Y3I A;  5HSQ A;  2K31 A;  3CI6 A;  3K2N A;  3KSH A;  4Y5F A;  4LRX C;  5L8M A;  1YKD A;  2O9A A;  4MDZ A;  4DN0 A;  3CIT A;  2W1T A;  4EU0 A;  4ETX A;  3VV4 A;  4ETZ A;  4DMZ A;  2W3E A;  3W2Z A;  4G3V A;  2VEA A;  3LFV A;  3S7Q A;  3NOT C;  4Q0I A;  5I5L A;  1TD5 A;  3E0Y A;  3RFB A;  5K5B A;  2XRN A;  2LB5 A;  4Y2F A;  3MF0 A;  4LRZ E;  4BWI A;  2QYB A;  2LB9 A;  1ZTU A;  2G7U A;  4EUV A;  4G3W A;  3KO6 A;  4G3K A;  2OOL A;  2VKS A;  2W1T B;  2ZMF A;  2XRO A;  4ZRR A;  3D3O A;  4RQ9 A;  4CQH A;  4O0P A;  4IUK A;  3NHQ A;  1STZ A;  2O99 A;  4R6L A;  2W3G A;  2W3D A;  4IJG A;  3MQ0 A;  5AJG A;  3KSI A;  2W3F A;  5C5K A;  2W1R A;  3S7O A;  1MC0 A;  2VZW A;  3KSG A;  1YSP A;  2XSS A;  4Z1W A;  2Y8H A;  3KSF A;  4MCW A;  4Q0H A;  3DBA A;  2IA2 A;  3NOU C;  5HPI A;  2O0Y A;  3E98 A;  4R70 A;  2M7V A;  2KLI A;  3NOP C;  3IBR A; 
#chains in the Genus database with same CATH topology
 4FSF A;  4R3A A;  5U47 A;  1PRQ A;  3LY4 A;  2ZOH A;  2VK3 A;  1FIL A;  2EXA A;  3C2W A;  3IF6 A;  3LGO A;  3P7N A;  1KE3 A;  1V9Z A;  1ZHH B;  1H8M A;  2Y2H A;  4E3J A;  4LEN A;  2GX5 A;  1OPX A;  5J4E A;  1XKZ A;  2X71 A;  1EI5 A;  3MMH A;  1OTI A;  4WM9 A;  1PI4 A;  5AQB A;  1SCW A;  4QWO A;  5FQK A;  2Y59 A;  5FQM A;  2Y2J A;  2OLV A;  4E3I A;  2EX8 A;  3PAG A;  2JN7 A;  3TE8 A;  1GSV A;  3NBL A;  1BLC A;  5G4Y A;  4UAA A;  4LRZ E;  5L10 A;  3T12 B;  2ZQ9 A;  5A91 A;  4EBP A;  4DE2 A;  1IYQ A;  2L4R A;  4I38 A;  2H28 A;  4O0P A;  3LR0 A;  1KVL A;  5CRF A;  2I9V A;  4WMC A;  1Z09 A;  4PPR A;  5C5K A;  4Y13 A;  5AQ9 A;  1D06 A;  5EM0 A;  2VZW A;  1KE4 A;  1T18 A;  4KG2 A;  1L3L A;  4ZJ1 A;  3U4L P;  1IYS A;  2UV0 E;  5EOO A;  4OQ0 A;  1GCE A;  2O0Y A;  5J3W A;  3VE3 A;  3SZT A;  4I3A A;  2BLS A;  5DF9 A;  4E04 A;  1N4O A;  1SKF A;  4MN7 A;  4UA9 A;  1VET B;  3V39 A;  4PMA A;  4BBV A;  1F5M A;  3IBJ A;  4HJ3 A;  2J9P A;  2BG1 A;  3NC8 A;  2PBD P;  3UMD A;  4GKU A;  3O3V A;  2CC1 A;  2K7S A;  3G2Y A;  4XUX A;  5AVF A;  3ZNT A;  1FSW A;  1ES3 A;  4A5R A;  3VP3 A;  2K31 A;  5EUA A;  3CI6 A;  4II7 A;  2HDQ A;  2A2L A;  1YLZ A;  5CHM A;  1CF0 A;  4HHD A;  1BLH A;  5EV0 A;  2Z2M B;  5DVA A;  5J7E A;  4JBF A;  2W3E A;  1P9R A;  1D1J A;  3BFF A;  3LEZ A;  2HP5 A;  3ZG5 A;  3CUE A;  4NXE A;  4HIA A;  1YLP A;  3CG5 A;  3CLO A;  5HWW A;  1OT9 A;  2QYB A;  3EEH A;  5EVI A;  4EEU A;  4X68 A;  3KYZ A;  4MN6 A;  2ACG A;  1DJC A;  3VP0 A;  2J3T D;  2WKH A;  5DTK A;  3A0R A;  4HJ4 A;  3FG8 A;  1Z6F A;  1NLZ A;  3MS6 A;  2XH9 A;  4EEP A;  2PR6 A;  2D02 A;  4F94 A;  3NJA A;  1ZG4 A;  5CGS A;  4BJP A;  1DY6 A;  4X56 A;  1YSP A;  1L2S A;  2GZA A;  4Y0T A;  3T1S A;  3T4Q A;  2OLU A;  5FI7 A;  1VQQ A;  2JKT I;  5TGF A;  2YKF A;  3HVF A;  4QHC A;  1YAX A;  3S1Y A;  2WKQ A;  3IQA A;  2EXB A;  2P04 A;  2FFF B;  3FPV A;  4X1M A;  2HP9 A;  4DF6 A;  1O7E A;  2JE5 A;  4KQR A;  1G6O A;  4OQI A;  2BAS A;  4KZ3 A;  3BYD A;  2P7J A;  3WRZ A;  2HGV A;  4WYY A;  1CI8 A;  5FSR A;  4O01 A;  1E3U A;  1OTD A;  4JXW A;  5EEC A;  4OVD A;  1ERQ A;  1S66 L;  1BTL A;  4M4X A;  3LUQ A;  4OPR A;  1UWP X;  3CIT A;  2GNX A;  3PBO A;  1MKI A;  3C30 A;  1TDG A;  4I39 A;  3LEQ A;  2ZQA A;  1L0D A;  1GHM A;  4PKY G;  3A3I A;  3LO7 A;  2XFS A;  4N92 A;  1TEM A;  5E43 A;  1XFQ A;  1OTA A;  3Q07 A;  3JPU A;  1SKO A;  3NDE A;  4DE0 A;  3HLE A;  2ZC7 A;  4S2M A;  3KX0 X;  3CUE C;  3VP2 A;  3HRE A;  3MJQ A;  4K08 A;  3E4P A;  3IH8 A;  2E8I A;  2VA0 A;  1BYW A;  2W27 A;  3IHA A;  2WZZ A;  3EQV A;  1K54 A;  1CEG A;  3O87 A;  3IT9 A;  3BFE A;  4JPM A;  5EVL A;  3EOI A;  1K54 C;  4LFU A;  2V20 A;  1VB6 A;  1IYO A;  2OWH A;  3UDF A;  3EEA A;  2EA9 A;  1C3B A;  5F68 A;  3UNW A;  1JNU A;  3O88 A;  4WEJ A;  3WS1 A;  2C5W B;  3IWI A;  4NXF A;  3ZDJ A;  4GD8 A;  2WAE A;  3BQ8 A;  4S2P A;  5TJJ A;  5DTT A;  1LI0 A;  4WN5 A;  1GSX A;  1YSQ A;  1YMS A;  2KDK A;  3BFG A;  1BUE A;  5F1G A;  2K2N A;  4S2I A;  5FAO A;  4K91 A;  4NG2 A;  3M2J A;  5DJT A;  4EW7 A;  4CLC E;  4OPQ A;  1OT6 A;  1S1Y A;  3KSH A;  4IVK A;  2O9A A;  2WKI A;  4E3K A;  3VP4 A;  3BY8 A;  4C6Y A;  1HVB A;  1Q2Q A;  3BFC A;  3BRM A;  5KMW A;  5I5L A;  3IHB A;  2ZQ7 A;  3ZVW A;  3G31 A;  3GV9 A;  3ISG A;  3RFB A;  5F82 A;  2V1A A;  3HUO A;  2IWD A;  4OOM A;  1K25 A;  4X25 A;  4S2L A;  1YLY A;  4FD8 A;  2ZM8 A;  4ZJ3 A;  3N4I A;  3ZG8 B;  4RQ9 A;  3UME A;  4AFI A;  2C6W B;  1ZKJ A;  1NZU A;  3PXP A;  1MBL A;  4Y0U A;  3UPO A;  1JTG A;  3PBT A;  1GA9 A;  1P97 A;  2W3F A;  2ZC3 B;  4CLC B;  5HZH A;  3UDI A;  1ES4 A;  5FI6 A;  5IS1 A;  3IWQ A;  3KSG A;  2Y2N A;  3GR2 A;  2GDN A;  1X0O A;  4HY8 A;  4L9G A;  3ZG7 B;  2A3U A;  1OJG A;  3AGD A;  4DXB A;  3MFX A;  1Y4O A;  1XJ3 A;  2XF3 A;  3B47 A;  2Y2Q A;  3LYX A;  4GW9 A;  1IFQ A;  3PTE A;  3OPR A;  3DTM A;  4O8G A;  1N9N A;  2Y2P A;  1CEF A;  3PHY A;  4WEL A;  3VOZ A;  2V1B A;  2ZL1 B;  1KE0 A;  4KUK A;  3HBR A;  3AGF A;  3DWZ A;  4XXR A;  4OH0 A;  4BD1 A;  2J3W A;  4OOY A;  5EFW A;  1FR6 A;  3DW0 A;  2H0Y A;  4CLC D;  1KGG A;  1MXO A;  4UQI S;  4R4R A;  4LGW A;  5CXW A;  5FQQ A;  2J9O A;  3IWO A;  2PD7 A;  1DJA A;  4R0Q A;  5EVI D;  4OQG A;  2YKH A;  1NY0 A;  4HES A;  1HLU P;  5E2H A;  5CHJ A;  1U60 A;  2XGN A;  3VE4 A;  4ZJ2 A;  5IHV A;  1MWT A;  1RGY A;  3NUL A;  5F1F A;  5HPI A;  5FA7 A;  1W8Y A;  4JF5 A;  1H0M A;  1HZO A;  1VET A;  2ZM2 A;  1G28 A;  2HPB A;  3IF6 B;  4BQM A;  4GNU A;  1W8Q A;  4GLQ A;  5FQJ A;  1HD8 A;  4KZ4 A;  1XGI A;  1XFN A;  4L9E A;  4ME4 A;  4X69 A;  3FC7 A;  3HCY A;  3ZQ5 A;  1H3Q A;  5HWT A;  3JVV A;  2NUP C;  4WLA A;  3K3C A;  4HP9 A;  2Y2M A;  4MMN A;  3O5Y A;  3P01 A;  4DJ3 A;  4UEY A;  4QPR A;  4PAU A;  1TF1 A;  3G6O A;  3CPT A;  2V8C A;  2KOI A;  3BLM A;  2ZQ8 A;  3MQO A;  1PWD A;  1JWZ A;  2Y91 A;  3FV7 A;  1K55 A;  1YM1 A;  3CMZ A;  2V2F F;  4K0X A;  5HDC A;  4LV2 A;  2V1Z A;  4P6Z M;  3T4S A;  3RXX A;  2XQZ A;  3G4P A;  5CER A;  2ZM0 A;  3E0Y A;  3QP2 A;  4S2N C;  1A0K A;  2QJ5 A;  3R7W A;  4F3L A;  4EUV A;  2ZMA A;  3IXH A;  3KO6 A;  4R3B A;  4R3J A;  4G3K A;  3PBN A;  1LL8 A;  4QB8 A;  2XFT A;  4H6J B;  3CHW P;  2HJE A;  3PBS A;  1ZG6 A;  2J7V A;  5EVI B;  3UE6 A;  3H82 A;  1M40 A;  2L0W A;  3ZHH A;  4HP4 A;  4IBX A;  1P9W A;  5FDS A;  4JGR A;  3MKE A;  3EWK A;  4KZ5 A;  3C7V A;  3T4K A;  4NET A;  2V8F A;  2QJ7 A;  2KLI A;  3V50 A;  3HJK A;  1Y28 A;  3MQQ A;  1JWP A;  3ZNY A;  3M2K A;  1ALQ A;  1MWU A;  1PW1 A;  2Y79 A;  1KDW A;  5FAS A;  3GSG A;  3ITB A;  1I5Q A;  4IBR A;  5IT5 A;  1XJ6 A;  4FUW A;  2B95 A;  3A0V A;  4EQI A;  5L2F A;  2HDR A;  4KZ6 A;  4GOG A;  2VV8 A;  1LI9 A;  3IX3 A;  3GEC A;  5GLD A;  1YLT A;  4H6J A;  3WRT A;  4WZ5 C;  1ES2 A;  1G5U A;  3UE3 A;  4EV4 A;  5DTS A;  1N9O A;  3NOT C;  4Q0I A;  1NJ4 A;  1TD5 A;  4EBN A;  1KGF A;  2VGJ A;  5E2F A;  1PWC A;  4O7D A;  1NWZ A;  1ESU A;  4KQD A;  5DF8 A;  5J8X A;  3E4O A;  1K38 A;  4JF4 A;  3IX8 A;  1RGZ A;  3LR5 A;  3UE1 A;  4CPK A;  3QP5 A;  2QZ6 A;  1PNE A;  3G2Z A;  3LR3 A;  1K4F A;  2L1M A;  2V0W A;  4HOI A;  4S2J A;  3NOU C;  4DKI A;  3A0S A;  4R70 A;  1PI5 A;  2JBF A;  1CK3 A;  5KSC A;  1NLY A;  3TRC A;  5HAI A;  2Q9M A;  3BEB A;  1MWR A;  1IYP A;  2ZC6 B;  2Z6C A;  1PIO A;  3ULF A;  4KQQ A;  3Q7V A;  2VLG A;  3CJM A;  5KIZ A;  3IF5 A;  5DFY A;  4D60 A;  2QMI A;  3WS2 A;  3E2K A;  2Z6D A;  1S6R A;  3RXW A;  2PDR A;  3C7U A;  4GD6 A;  3JVU A;  3T50 A;  5FAT A;  2Q0O A;  1YMX A;  3BEC A;  3WS5 A;  2WKP A;  2ZOI A;  1LSX A;  4N9L A;  3MZD A;  4Q8I A;  2QPN A;  1K4E A;  4PM8 A;  5CED A;  2ZMV A;  1SHV A;  2R9X A;  4LV1 A;  5K5B A;  4LLO B;  1W5D A;  4BWI A;  1TDL A;  2G7U A;  2VX8 A;  2VV7 A;  4HH2 A;  3QP1 A;  3Q81 A;  4K0W A;  5F6A A;  1W63 Q;  1STZ A;  3B33 A;  3OPH A;  1PYY A;  1BZA A;  3H7W A;  2OAQ 1;  1XX2 A;  1V9Y A;  3MXS A;  4QY6 A;  2EFU A;  4KEN B;  3ICY A;  4Z1W A;  2BTF P;  4WUJ A;  1ONH A;  1T1C A;  3SH7 A;  3G30 A;  2ZC5 B;  4NXB A;  4EQ1 A;  4PM6 A;  3VSK A;  1J3W A;  4KZA A;  4GN2 A;  5L09 A;  1DP6 A;  3BFD A;  4IHQ A;  3L9K A;  4B4X A;  2ZLY A;  2V0U A;  2P9V A;  1L0F A;  2H5S A;  1K6R A;  2VJW A;  3SOI A;  3ZG9 B;  1KGE A;  4R4S A;  1TVF A;  2X02 A;  1I2W A;  4Y7P A;  2PR5 A;  4R1G A;  4Q0J A;  1SDE A;  1SZV A;  2OV5 A;  5M19 A;  2ZC4 B;  3UB6 A;  5EE8 A;  2ZL1 A;  2O9C A;  1XA1 A;  4BMW A;  4KZ9 A;  3ZCZ A;  2XDM A;  1MPL A;  2XLN A;  1LL9 A;  3T4L A;  4PM5 A;  1IKG A;  3VFH A;  3LID A;  2JC7 A;  3PAE A;  3FWL A;  2JKG A;  2PD8 A;  3VOL A;  1YKD A;  3VV4 A;  3T1Q B;  1JTD A;  1FQG A;  4B4Z A;  1F2K A;  3V3R A;  1QMF A;  1JVJ A;  4G3V A;  1UGU A;  3HLD A;  1VEU A;  4UHU A;  1CQA A;  1EW0 A;  4HQA A;  4Y17 A;  4JKT A;  5AQA A;  3LCE A;  2XRN A;  3D9Y A;  2ZD8 A;  4DE1 A;  3F1P B;  4X1L A;  3MFD A;  5HWV A;  4PKY A;  3ZVT A;  2OOL A;  2INW A;  2W1T B;  3BQA A;  1S1Z A;  4CQH A;  3UB9 A;  1BUL A;  2O99 A;  2HDS A;  2JKF A;  4MEZ A;  5HD3 A;  4XT2 B;  3C38 A;  4PM9 A;  4LCM A;  2DNS A;  3MR0 A;  3S7O A;  4GJ4 A;  1G6A A;  2V9A A;  5DF7 A;  3T4T A;  5HAQ A;  2WGV A;  2Y8H A;  4BLM A;  1P0Z A;  2Y2K A;  3GMW A;  2EX9 A;  1EWZ A;  3B3X A;  2IA2 A;  3N8S A;  4EBL A;  3MZF A;  5M18 A;  2WKE A;  3TJZ C;  4GDN A;  2OWJ A;  2PRF A;  1W79 A;  3HJI A;  3PYP A;  1BLP A;  3E4Q A;  4QJG A;  4GS9 B;  5GL9 A;  4E3O A;  3G35 A;  3R4K A;  2QWS A;  5KZH A;  5TR7 A;  1H8Z A;  2G2W A;  4QY5 A;  3LR4 A;  3LI8 A;  3N6I A;  3U2A A;  3LI9 A;  3MXR A;  3BJN A;  3ZYT A;  4MBF A;  3D4F A;  3IXB A;  5G4Z A;  4UA7 A;  2FZ0 A;  4S2N A;  3PBR A;  5FL3 A;  4B88 A;  1GA0 A;  1S4R A;  2J80 A;  3IF6 C;  5L07 A;  3OC2 A;  1H8Y A;  5HSQ A;  4MN5 A;  5E2G A;  1XJ4 A;  4MBH A;  1K0K A;  5HDD A;  1LT0 A;  5KSH A;  2W1T A;  2H0T A;  1FCM A;  1ODV A;  4DMZ A;  1SDN A;  4HBT A;  5AVE A;  3KYE A;  3A3E A;  2AVX A;  2JKR M;  2LB9 A;  5D3O A;  3IXG A;  4RVA A;  1FIK A;  4DXC A;  1T19 A;  1W7F A;  1TS7 A;  2HV1 A;  2EX2 A;  4KZ8 A;  1XXM A;  2W3G A;  4C3Q A;  4GB7 A;  1K55 C;  1NZO A;  5AJG A;  1M6K A;  5F69 A;  5JYO A;  1MC0 A;  5CTN A;  2B5R A;  2ZQD A;  5AQ7 A;  2KX6 A;  3KSF A;  4Q0H A;  4IED A;  4ZAM A;  3G34 A;  1AXB A;  5HX9 A;  4LV0 A;  3UY6 A;  4EET B;  1VM1 A;  2XD1 A;  5A90 A;  2GJ3 A;  1AWI A;  2XK1 A;  4WEK A;  1ESI A;  3OCN A;  4HH3 A;  5HL6 A;  2D01 A;  5LBR A;  2EWW A;  3F1O A;  4KQO A;  2RL3 A;  1ERM A;  3QNB A;  1FSY A;  3NCK A;  4HBU A;  3S7P A;  1FCO A;  2XA7 S;  3Q82 A;  3DAV A;  3TOI A;  2WGW A;  1XP4 A;  4E3L A;  3A3J A;  4X6T A;  3H9W A;  2ZJ9 A;  2HJ9 C;  4LCL A;  5A8B A;  4RX3 A;  3VMA A;  4OOL A;  4Y5F A;  1DP8 A;  3JYI A;  4LPZ A;  4DN0 A;  4UA6 A;  3D72 A;  3W4P A;  4ETZ A;  2NUT C;  3SS4 A;  3QP8 A;  3E2L A;  3KYQ A;  4HNB A;  2WAF A;  2VEA A;  4C75 A;  4E3M A;  5GLB A;  4EWF A;  1XJ2 A;  4CLC A;  1O07 A;  1ONG A;  3L7H A;  4UQI M;  1TS8 A;  2B02 A;  2HZ5 A;  1XPB A;  5EM1 A;  3P09 A;  3EGX C;  3MF0 A;  4RA7 A;  3HLC A;  5CGX A;  5CEC A;  5IU1 A;  2PT7 A;  2ZMF A;  4ZRR A;  1GSW A;  3HL9 A;  4R6L A;  4FH4 A;  1NRF A;  2G2U A;  4ZBE A;  3O86 A;  3QHY A;  1FCN A;  1LSV A;  1MY8 A;  2P9V B;  4L0L A;  4OPY A;  3LIC A;  1ERO A;  2HDU A;  1FR1 A;  1WYB A;  1L0G A;  3IBR A;  3TW8 A;  2DCF A;  5DJU A;  2W3H A;  1FOF A;  1S0W A;  1G68 A;  5HPF A;  3M6B A;  2W0N A;  5HW3 A;  1GHI A;  2P74 A;  3V67 A;  1IEM A;  4NK3 A;  1MKM A;  3OZH A;  5HL1 A;  3LY3 A;  4RX2 A;  3UB7 A;  3MBZ A;  3NEC A;  3P98 A;  3BW6 A;  3QP6 A;  3FKW A;  3MZE A;  4E6W A;  3GQZ A;  2WUQ A;  4X55 A;  3WWX A;  1LLB A;  3F1O B;  3N8L A;  3K2N A;  2Q9N A;  2Z2L B;  4MDZ A;  1PZP A;  3N7W A;  2QKP A;  5GHX A;  4KG5 A;  4KZ7 A;  4MNR A;  5MC7 A;  4IVI A;  3LFV A;  4OP5 A;  3HLB A;  1F98 A;  2DRW A;  3S7Q A;  4XUZ A;  1D7E A;  4N1H A;  5FQI A;  5GLA A;  2OSU A;  4WBG A;  5HAR A;  5FI2 A;  4P85 A;  2A24 A;  4L9F A;  3H82 B;  2A49 A;  5TBM A;  5I94 A;  5EPH A;  2PU2 A;  5HDS A;  3A3D A;  3VP1 A;  3HLF A;  5GHY A;  4IJG A;  3MQ0 A;  4N1X A;  1T1B A;  1YT4 A;  3PBQ A;  4BL3 A;  3GDI A;  1MZU A;  4OON A;  3LIB A;  5CTM A;  4NKP A;  2R78 A;  5HD5 A;  1E4D A;  2ZBB A;  4M3K A;  1JWV A;  3EGD C;  1PZO A;  1ACF A;  4LV3 A;  5EVI C;  1VHM A;  3Q7V B;  4WL9 A;  3UPN A;  2WKR A;  4IUH A;  1LL5 A;  4U0X A;  2WK0 A;  4FH2 A;  4HEF A;  4BD0 A;  4R23 A;  5EOE A;  2O9B A;  2P08 A;  4MLL A;  4FCF A;  1LSW A;  4JXS A;  1MWS A;  5DKL A;  3CAX A;  4OPZ A;  4ARZ B;  1WYC A;  2JHE A;  3S7N A;  4GCZ A;  1IEL A;  3FYZ A;  3IH9 A;  4Y3I A;  1F9I A;  1YQS A;  3VSL A;  1L0E A;  4GZB A;  3GVB A;  3HUM A;  3W4O A;  3T1R A;  3DTK A;  2PU4 A;  2FH5 A;  1QME A;  4OP8 A;  2EX6 A;  1NXY A;  3OPP A;  4WZ4 A;  2Y55 A;  2RCX A;  3QP4 A;  3SH9 A;  2IWC A;  3WS4 A;  4OKP A;  4OQH A;  3GTC A;  4RYE A;  2PHY A;  4P6Z S;  4IUK A;  5DKK A;  4ZTK A;  4U0T A;  1ES5 A;  2VGL M;  1WE4 A;  4OLD A;  5FEF A;  2FFY A;  4JF6 A;  4HJ6 A;  3NDG A;  5GHZ A;  5BOH A;  1NRJ A;  4H8R A;  2PYP A;  1BLS A;  5CHU A;  5GLC A;  1S67 L;  2W1R A;  1LHY A;  4JGP A;  1UWN X;  3CPT B;  3HUN A;  3UPP A;  1RP5 A;  4JGO A;  2XA7 M;  1I2S A;  1N9L A;  4ID4 A;  2XD5 A;  4MCW A;  2UWX A;  5TBM B;  4XT2 A;  1IOU A;  3UDX A;  2PYR A;  1NYM A;  3HLG A;  1KOU A;  1K56 A;  3UO9 A;  4BL2 A;  2M7V A;  3NOP C;  2R9W A;  4D2O A;  3DWK A;  2MJ6 A;  1YLJ A;  4B93 A;  5FQ9 A;  3M6H A;  4YNR A;  3R7W B;  4F3L B;  5F83 A;  2ZQC A;  3LIE A;  4JGQ A;  4JXV A;  1S4S A;  4KUO A;  3LIA A;  4EER A;  1OTB A;  3T4J A;  2M7U A;  2M1C A;  5A92 A;  5CX7 A;  3IX4 A;  1Y54 A;  3UE0 A;  2WGI A;  3BM6 A;  3C5A A;  4S2O A;  2WGW B;  1RCJ A;  1PWG A;  2HP6 A;  4ETX A;  2J3T C;  2JKR I;  2VGL S;  4S2K A;  5F5Y A;  3NY4 A;  4E3N A;  1XA7 A;  3DTE A;  1J9M A;  1SKO B;  4DRT A;  4EXO A;  3BY9 A;  3VFF A;  3EQU A;  2LB5 A;  1PW8 A;  4Y2F A;  1ZTU A;  5HFO A;  4G3W A;  2XR0 A;  3IS2 A;  3FKV A;  3I7J A;  1GHP A;  2XRO A;  3F1N A;  3ZFZ A;  3NIA A;  4GHI A;  1BSG A;  1T1A A;  4GDB A;  3S22 A;  5A93 A;  2XSS A;  4Y15 A;  5EVE A;  5FEG A;  4NXG A;  3C8C A;  1H5X A;  1TS6 A;  3CWF A;  3QNC A;  4P87 A;  3ZGA B;  4P6B A;  3E98 A;  3RH8 B;  4YOF A;  4BBU A;  5DFX A;  2EFX A;  5FAP A;  5TFQ A;  3RJU A;  5HAP A;  4I3I A;  1IKI A;  5G18 A;  2PAV P;  4EUZ A;  4KG6 A;  2JKT M;  3FPW A;  4EES A;  1NYY A;  3SH8 A;  4PHT A;  3TSG A;  3F1N B;  3UB5 P;  4LRY C;  2WZX A;  1K57 C;  4GHI B;  1K57 A;  3GRJ A;  3B42 A;  2HF6 A;  4WF0 A;  2H10 A;  3OLO A;  2QHK A;  3C4O A;  3V5M A;  4ESP A;  4ARZ A;  4LRX C;  1YPR A;  4DJ2 A;  1OJ5 A;  4WZ5 A;  2EWV A;  3DTI A;  4DDY A;  4E6X A;  1TS0 A;  3NI9 A;  2VV6 A;  4QD4 A;  5CGW A;  1OME A;  1DJB A;  3N8R A;  2E8J A;  3V3S A;  1CJF A;  4YWZ A;  3UB8 A;  3ITA A;  3PR6 A;  3ZG0 A;  4P0M A;  4ZDX A;  1W63 M;  2Y4A A;  3MKF A;  1K6S A;  3K3D A;  2A24 B;  4MBK A;  3AGE A;  3W4Q A;  2XEP A;  3IXD A;  1DP9 A;  3OCL A;  3SS3 A;  2X01 A;  2J8Y A;  4OLG A;  4Y0O A;  2Y2L A;  3SW1 A;  4B9O A;  4BEN A;  1WA9 A;  4CLC C;  4GS9 A;  3RTY A;  3WS0 A;  4WMC D;  1KVM A;  3T1X A;  2WAD A;  5JYP A;  4BBT A;  5M1A A;  4I3J A;  3C4P A;  3S4X A;  1VEU B;  1HTZ A;  3OOV A;  4JLF A;  3BLS A;  3A3F A;  4N9K A;  3FZC A;  4CJN A;  3VOY A;  2B18 A;  3UN7 A;  2JCH A;  4NEE D;  3H7W B;  3HLW A;  4R38 A;  4YFM A;  3TG9 A;  2VGK A;  4FOF A;  1E3U D;  3Q7Z A;  4I5S A;  3OBF A;  3F1P A;  5L8M A;  3CZD A;  5CEB A;  4EU0 A;  1YLW A;  4KZB A;  3SS5 A;  3W2Z A;  4Z9Q A;  2DMW A;  5FDH A;  3G32 A;  5FAQ A;  2OAP 1;  2Y2G A;  4QU3 A;  3OPL A;  3MSH A;  2I72 A;  2WYX A;  1KDS A;  4X53 A;  2VKS A;  1CI9 A;  4FTX A;  3D3O A;  2Y2I A;  3W8K A;  3NHQ A;  3MXQ A;  2W3D A;  5E2E A;  1DRM A;  3IS2 B;  1PFL A;  3KSI A;  1N9B A;  4YIN A;  2IWB A;  1OTE A;  1ZC2 A;  4DDS A;  4PM7 A;  3Q1F A;  4U3T A;  3DBA A;  4DE3 A;  2Y2O A;  3LIF A;  4HI4 A;  1K56 D;  3BWL A;  1BT5 A;  1XGJ A;  3T4O A;  2CMN A;  2PBY A;  1Q2P A;  1E25 A;  4JXG A; 
#chains in the Genus database with same CATH homology
 2V0U A;  4FSF A;  4R3A A;  2VJW A;  2ZOH A;  1VHM A;  3B47 A;  4WL9 A;  2WKR A;  4IUH A;  3C2W A;  2PR5 A;  3P7N A;  4Q0J A;  3LYX A;  4GW9 A;  1IFQ A;  3UB6 A;  2O9B A;  2O9C A;  2P08 A;  1V9Z A;  4BMW A;  1LSW A;  1ZHH B;  1H8M A;  4O8G A;  5DKL A;  3CAX A;  1N9N A;  2GX5 A;  4ARZ B;  1OPX A;  3PHY A;  5J4E A;  4WEL A;  3T4L A;  2JHE A;  3S7N A;  2V1B A;  3MMH A;  4GCZ A;  3LID A;  1OTI A;  4KUK A;  4Y3I A;  1F9I A;  2J3W A;  2PD8 A;  3VOL A;  1YKD A;  5EFW A;  3VV4 A;  4CLC D;  2JN7 A;  3TE8 A;  4G3V A;  1GSV A;  1UGU A;  4UQI S;  2FH5 A;  1EW0 A;  4HQA A;  5G4Y A;  2PD7 A;  2XRN A;  4LRZ E;  3F1P B;  5HWV A;  4PKY A;  2YKH A;  2OOL A;  2PHY A;  2INW A;  4P6Z S;  2W1T B;  2L4R A;  4I38 A;  3BQA A;  1S1Z A;  2H28 A;  4CQH A;  4O0P A;  3LR0 A;  4IUK A;  5DKK A;  2VGL M;  3UB9 A;  2I9V A;  2O99 A;  3VE4 A;  4HJ6 A;  1NRJ A;  5HD3 A;  4XT2 B;  2PYP A;  5C5K A;  3C38 A;  1S67 L;  2W1R A;  4JGP A;  3MR0 A;  1UWN X;  4GJ4 A;  3S7O A;  1D06 A;  2V9A A;  1T18 A;  2VZW A;  4JGO A;  3T4T A;  2XA7 M;  1N9L A;  2Y8H A;  4MCW A;  1P0Z A;  5TBM B;  4XT2 A;  2IA2 A;  5HPI A;  1IOU A;  2PYR A;  1KOU A;  3TJZ C;  2O0Y A;  5J3W A;  3VE3 A;  1G28 A;  2M7V A;  3NOP C;  2OWJ A;  3PYP A;  3HJI A;  4I3A A;  4GLQ A;  2MJ6 A;  3E4Q A;  1XFN A;  4GS9 B;  4L9E A;  4ME4 A;  5DF9 A;  4E04 A;  3R4K A;  4B93 A;  2QWS A;  3FC7 A;  4MN7 A;  3HCY A;  3R7W B;  4YNR A;  4F3L B;  3ZQ5 A;  4BBV A;  1H3Q A;  1F5M A;  3LR4 A;  3LI8 A;  3IBJ A;  3LIE A;  3JVV A;  5HWT A;  3U2A A;  4JGQ A;  3LI9 A;  4HJ3 A;  4WLA A;  3BJN A;  2NUP C;  3ZYT A;  3K3C A;  4HP9 A;  1S4S A;  5G4Z A;  4KUO A;  4MMN A;  2FZ0 A;  3LIA A;  3O5Y A;  3PBR A;  3P01 A;  4DJ3 A;  4UEY A;  5FL3 A;  1OTB A;  3T4J A;  4EER A;  2M7U A;  4QPR A;  3UMD A;  4PAU A;  1S4R A;  1TF1 A;  2M1C A;  2J80 A;  5CX7 A;  2K7S A;  5AVF A;  3G6O A;  3OC2 A;  2KOI A;  3MQO A;  5HSQ A;  2K31 A;  4MN5 A;  3CI6 A;  4II7 A;  1XJ4 A;  2A2L A;  5HDD A;  4HHD A;  1LT0 A;  5KSH A;  2W1T A;  2J3T C;  4ETX A;  2JKR I;  5J7E A;  1ODV A;  2VGL S;  5F5Y A;  2W3E A;  4DMZ A;  1P9R A;  5HDC A;  4P6Z M;  3T4S A;  5AVE A;  3CUE A;  4NXE A;  4HIA A;  4EXO A;  3BY9 A;  3CLO A;  3E0Y A;  2JKR M;  3EQU A;  5HWW A;  2LB5 A;  4Y2F A;  1OT9 A;  2QYB A;  3EEH A;  2LB9 A;  2QJ5 A;  1ZTU A;  3R7W A;  4EUV A;  4EEU A;  4G3W A;  3KO6 A;  4F3L A;  3KYZ A;  3IS2 A;  4MN6 A;  4G3K A;  3PBN A;  1LL8 A;  2J3T D;  2XRO A;  3F1N A;  3A0R A;  1T19 A;  4H6J B;  3FG8 A;  4HJ4 A;  1TS7 A;  1NLZ A;  2HV1 A;  2HJE A;  4EEP A;  4GHI A;  2PR6 A;  3PBS A;  2W3G A;  3UE6 A;  2D02 A;  1T1A A;  3H82 A;  5AJG A;  2L0W A;  3NJA A;  4HP4 A;  5F69 A;  1MC0 A;  4BJP A;  1P9W A;  1YSP A;  2XSS A;  4JGR A;  2KX6 A;  3KSF A;  4Q0H A;  3EWK A;  2GZA A;  4NXG A;  3T4Q A;  3C8C A;  1TS6 A;  4EET B;  3CWF A;  3T4K A;  2QJ7 A;  3E98 A;  2KLI A;  2JKT I;  3HJK A;  3RH8 B;  2GJ3 A;  2YKF A;  4YOF A;  5DFX A;  1Y28 A;  4WEK A;  4BBU A;  1YAX A;  3OCN A;  4I3I A;  3MQQ A;  4HH3 A;  5HL6 A;  2D01 A;  2WKQ A;  5LBR A;  2P04 A;  2EWW A;  2Y79 A;  3F1O A;  3FPV A;  2JKT M;  3FPW A;  4KQO A;  5IT5 A;  1G6O A;  1XJ6 A;  4EES A;  4PHT A;  3F1N B;  3A0V A;  2BAS A;  4LRY C;  3S7P A;  2P7J A;  2XA7 S;  4GHI B;  2HGV A;  3H9W A;  3B42 A;  2HF6 A;  4WF0 A;  4O01 A;  2HJ9 C;  1OTD A;  3OLO A;  5A8B A;  2QHK A;  2VV8 A;  1S66 L;  4M4X A;  4OOL A;  3LUQ A;  4Y5F A;  4ARZ A;  1DP8 A;  3GEC A;  4LRX C;  4DJ2 A;  1UWP X;  4LPZ A;  3CIT A;  4DN0 A;  2GNX A;  3PBO A;  3D72 A;  4ETZ A;  2NUT C;  3C30 A;  1OJ5 A;  4H6J A;  2EWV A;  3KYQ A;  4I39 A;  4HNB A;  1TS0 A;  2VV6 A;  3UE3 A;  2VEA A;  4PKY G;  1N9O A;  3NOT C;  4Q0I A;  1XJ2 A;  1TD5 A;  4CLC A;  4UQI M;  1TS8 A;  2B02 A;  3EGX C;  4YWZ A;  3UB8 A;  3MF0 A;  3PR6 A;  1XFQ A;  1OTA A;  1NWZ A;  4KQD A;  3E4O A;  5IU1 A;  2PT7 A;  2ZMF A;  1W63 M;  4ZRR A;  1GSW A;  3KX0 X;  3CUE C;  4R6L A;  3K3D A;  3LR5 A;  2A24 B;  3MJQ A;  1DP9 A;  4K08 A;  3E4P A;  3OCL A;  2VA0 A;  3LR3 A;  2L1M A;  3SW1 A;  4B9O A;  1LSV A;  1WA9 A;  1BYW A;  4CLC C;  2V0W A;  2W27 A;  4GS9 A;  3RTY A;  4L0L A;  4HOI A;  3NOU C;  3LIC A;  3EQV A;  3A0S A;  3EOI A;  4R70 A;  4BBT A;  3IBR A;  4I3J A;  1VB6 A;  2OWH A;  3TW8 A;  3EEA A;  5DJU A;  2W3H A;  1NLY A;  3TRC A;  5HPF A;  2EA9 A;  3OOV A;  2W0N A;  5F68 A;  1JNU A;  4WEJ A;  3V67 A;  4NXF A;  2Z6C A;  2B18 A;  3BQ8 A;  5TJJ A;  3ULF A;  1MKM A;  2VLG A;  4WN5 A;  5KIZ A;  1GSX A;  1YSQ A;  5DFY A;  2KDK A;  4NEE D;  3UB7 A;  2K2N A;  3H7W B;  3BW6 A;  4R38 A;  5DJT A;  4EW7 A;  4CLC E;  2Z6D A;  2PDR A;  4FOF A;  4I5S A;  3OBF A;  3JVU A;  3T50 A;  1OT6 A;  3F1P A;  1S1Y A;  3F1O B;  3K2N A;  3KSH A;  5L8M A;  2O9A A;  4MDZ A;  4EU0 A;  2QKP A;  2WKP A;  3BY8 A;  2ZOI A;  1LSX A;  3W2Z A;  5MC7 A;  3LFV A;  1F98 A;  2DMW A;  3S7Q A;  2ZMV A;  5I5L A;  1D7E A;  3RFB A;  5K5B A;  4LLO B;  2OAP 1;  2V1A A;  4BWI A;  4OOM A;  2G7U A;  2VX8 A;  2A24 A;  4L9F A;  2VV7 A;  4HH2 A;  3H82 B;  5TBM A;  2VKS A;  5F6A A;  3D3O A;  1W63 Q;  4RQ9 A;  3UME A;  5HDS A;  4AFI A;  3NHQ A;  3PXP A;  3MXQ A;  1STZ A;  3B33 A;  2W3D A;  4IJG A;  3H7W A;  1DRM A;  3MQ0 A;  3IS2 B;  3PBT A;  3KSI A;  1P97 A;  2W3F A;  4CLC B;  5HZH A;  2OAQ 1;  1V9Y A;  1T1B A;  1OTE A;  5IS1 A;  3KSG A;  3PBQ A;  3ICY A;  1X0O A;  4Z1W A;  3GDI A;  4HY8 A;  4WUJ A;  1MZU A;  4L9G A;  1T1C A;  3LIB A;  3DBA A;  4EQ1 A;  4NXB A;  3LIF A;  2R78 A;  4HI4 A;  1OJG A;  4NKP A;  5HD5 A;  3MFX A;  3BWL A;  2ZBB A;  1DP6 A;  1XJ3 A;  2CMN A;  3EGD C;  4IHQ A;  3T4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...