2W3HA

Cyanide bound structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
147
structure length
147
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 41
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3hA00
5AJGA 2XSSA 1STZA 2KOIA 2K31A 3D3OA 2M7VA 2XRNA 1VHMA 3S7NA 3C2WA 2W1RA 3KSGA 1TD5A 1YSPA 2KLIA 2LB9A 2W3GA 3CI6A 2LB5A 1TF1A 2O0YA 3EEAA 4MN7A 4Z1WA 5LBRA 4RQ9A 3S7OA 1YKDA 1F5MA 3OOVA 4GLQA 3NOPC 1ZTUA 2W3EA 4GW9A 5HPFA 4PAUA 4EU0A 2G7UA 4Q0HA 4E04A 2IA2A 4Q0IA 4Y5FA 4YNRA 2W3FA 4LRXC 2Y79A 3E98A 3KO6A 5HPIA 5DFXA 5TJJA 4G3WA 3BJNA 4DMZA 2QYBA 2VEAA 3NOTC 5HL6A 3W2ZA 4YOFA 1MKMA 3CITA 2W1TB 3KSHA 4O01A 4LRYC 4QPRA 3ZQ5A 4IUHA 3G6OA 4R70A 3MQ0A 2O99A 4Y2FA 3O5YA 4FOFA 3RFBA 5K5BA 3R4KA 3LFVA 4Q0JA 3HCYA 4LRZE 4ETXA 4R6LA 5I5LA 2VZWA 2W3HA 1YSQA 2W3DA 3DBAA 3TRCA 3IBJA 4ME4A 2O9AA 4DN0A 2B18A 1MC0A 4EUVA 2O9BA 3MMHA 2OOLA 2GX5A 4MCWA 5HSQA 4ETZA 4MDZA 2HGVA 3IBRA 2M7UA 4IJGA 4O8GA 3MF0A 4Y3IA 3E0YA 3OBFA 2VJWA 2ZMFA 2K2NA 2O9CA 5C5KA 3NOUC 5DFYA 3S7QA 3K2NA 3KSIA 4ZRRA 5L8MA 4G3KA 3NHQA 2Y8HA 4BWIA 3KSFA 4MMNA 2W1TA 3VV4A 2XROA 4CQHA 4O0PA 2VKSA 3S7PA 4IUKA 4G3VA
chains in the Genus database with same CATH superfamily
4X6TA 1STZA 5BOHA 2OV5A 1KVLA 5DF9A 1Z6FA 3IF5A 2JBFA 3BY9A 3PAGA 4CLCD 1PWCA 2J3TC 1N9NA 3O88A 1YLJA 3FWLA 3NECA 3FC7A 3CI6A 4MN7A 3CZDA 2VGLM 4EEPA 1CEGA 3IWQA 4F3LB 3VP3A 2IA2A 3JYIA 3ISGA 5HPIA 3LR4A 1PZPA 2QYBA 1SKOA 2W1TB 2V0WA 3M2KA 1ONGA 3MQ0A 3T4JA 5AVFA 3E4PA 1BLPA 4JXGA 1YSQA 4GD6A 5F1GA 4IEDA 1MPLA 1VEUB 1S6RA 3BFEA 5EUAA 5E2EA 2JE5A 4WM9A 2ZQCA 4MCWA 5L07A 5JYPA 2ZBBA 1MBLA 4ETZA 1W7FA 2EXBA 4HEFA 4O8GA 4ARZA 5FEFA 1U60A 2ZMFA 2WKPA 4KZ5A 5C5KA 1SZVA 5HX9A 4K91A 4PKYG 1K56D 3TSGA 2OAP1 3MJQA 2X01A 4EBNA 4KZ6A 3ZG5A 4KG5A 5AQBA 4PM9A 1LI0A 4JXVA 3A3IA 2WGVA 4Y7PA 3PXPA 2Y55A 4L0LA 3Q7ZA 1XPBA 2W1RA 2ZM8A 4EEUA 1S66L 1Y28A 2V9AA 4PHTA 4WZ4A 2YKFA 3PBOA 4ZDXA 2O0YA 4BBUA 4Z1WA 3M6HA 2VGKA 1BT5A 1LLBA 3ULFA 4OVDA 4II7A 5FATA 4HHDA 2JN7A 2VX8A 1BLHA 2A49A 4E04A 4CJNA 3NIAA 5EECA 5E2GA 3KO6A 4DMZA 3DTMA 4N92A 5J7EA 3PBTA 4GZBA 5HDDA 5HAIA 4D60A 3P7NA 1W8QA 1JTDA 4XT2A 1BLCA 3GRJA 2J9OA 2XA7M 3SH7A 3ZG8B 3DBAA 2ZQAA 2HDUA 1K0KA 3FYZA 2V20A 3WRTA 5EVIB 3PR6A 3HUMA 2L1MA 5HSQA 1OTIA 3DTEA 3HBRA 3HLEA 3V50A 1SKFA 4IJGA 1TS7A 5F6AA 4Y3IA 2ZM2A 4B9OA 1VM1A 1L0GA 4B4XA 4FH2A 1HVBA 2GZAA 3EGXC 1RP5A 1SCWA 3T4TA 2VKSA 5DTTA 2Y2JA 2W0NA 4I3IA 2EWVA 4PM8A 4R4RA 1TS6A 4LV3A 2A3UA 1JNUA 1CJFA 1GCEA 1LSWA 3BEBA 1TD5A 4OQGA 1JWVA 5EM1A 2HZ5A 1KOUA 1VETB 2J3WA 5EVID 2B95A 4UA6A 5FA7A 1OPXA 1S0WA 5L09A 4WLAA 4JGRA 2WYXA 3SS5A 4Y5FA 2J8YA 4JLFA 5CERA 2ZC3B 3JVUA 5DTKA 2Y2PA 1T1AA 2VEAA 4D2OA 3GECA 5FDSA 3Q81A 4HI4A 1S1YA 4R38A 2W27A 1H5XA 4OP5A 2BTFP 3B3XA 1QMEA 1AWIA 4FOFA 2D01A 1P9WA 4R6LA 2W3HA 3CPTA 3V67A 5HD3A 2QWSA 5F5YA 1MXOA 2V1ZA 4QB8A 3QP6A 1DP8A 5I94A 3MXQA 3FZCA 2BG1A 3BWLA 1O7EA 4LLOB 3R7WA 1ACFA 3BRMA 3F1NB 5AQ7A 1YM1A 3UDXA 4ZBEA 3B33A 4UHUA 3EEHA 2QHKA 5TFQA 1S1ZA 3K2NA 5L8MA 1JVJA 3LI9A 1T18A 2L0WA 5G18A 2H10A 4LV1A 3QP5A 3F1PB 4M4XA 4GHIB 4DDSA 2J7VA 1YLYA 5GLCA 2XSSA 3CMZA 2PDRA 1Y54A 4OLDA 4HH2A 4S2IA 1H8MA 3F1OA 4HNBA 3IXHA 4DXCA 4MLLA 3T50A 4PKYA 4CLCC 1ERMA 1FR1A 1G68A 3NOPC 3BLMA 5L2FA 5M19A 5TGFA 3C38A 3UPOA 3MKFA 2HPBA 4Q0IA 5FSRA 2Y79A 4OONA 1OJGA 4R23A 3E2LA 5FAQA 1CF0A 3NBLA 5TBMB 4Y0UA 1JWZA 1RGZA 3IXGA 2HP9A 5JYOA 3RFBA 4I38A 4LRZE 3PBQA 5FAOA 4UQIS 3OC2A 5CTNA 2Z6CA 3DTIA 3ZNTA 1CI9A 4HJ6A 2O9BA 4KQOA 4GJ4A 2PAVP 3TE8A 4H6JB 3ZYTA 3ZVWA 5A90A 3I7JA 3IBRA 5EE8A 3OCNA 1ODVA 3HLBA 1K57C 1N9BA 1OTAA 2ZC4B 4S2PA 2ZL1B 3FPWA 4ZRRA 5A92A 3IHBA 3NHQA 4DJ3A 3IH8A 1OTDA 3VV4A 5AQ9A 3ZFZA 3IXBA 4RX2A 4OPYA 3AGFA 3Q7VB 1XFNA 5AJGA 3C7VA 2YKHA 4JPMA 1YLWA 4PM6A 4C6YA 5HD5A 1XA1A 2P9VB 4S2JA 1KVMA 2QJ5A 2WK0A 5J4EA 3HLFA 2G7UA 4OPQA 4B4ZA 3C4OA 2JKTM 3WWXA 1OJ5A 4UA7A 3RH8B 1N9OA 5TJJA 4P6ZM 4G3WA 3PYPA 3QNBA 4R0QA 3C8CA 2V8CA 3LICA 4O01A 3CUEC 5DJUA 2VV6A 1BTLA 1GA0A 5DTSA 3UB7A 2HF6A 4QJGA 5CHMA 2BASA 1MZUA 2XLNA 1NY0A 3UO9A 3V3RA 4DN0A 2DRWA 3M2JA 5CGXA 4BD1A 1J3WA 4EUVA 3BY8A 2JKRI 3IQAA 3DAVA 4GOGA 4HQAA 3VFFA 4KZ3A 1IKGA 1PZOA 2K2NA 5DVAA 3SOIA 2H0TA 3GR2A 4KENB 3KSIA 2EFXA 4QY6A 5FQMA 1PW8A 4F94A 1D1JA 4X56A 2XROA 5EV0A 3ITBA 3H9WA 5F83A 5KSCA 1E3UD 3D3OA 4Q8IA 4CLCA 2XH9A 5FL3A 1XXMA 3MZEA 3C2WA 3W4QA 3PBNA 3T12B 3Q1FA 1OT9A 3EEAA 3MQOA 1XGJA 2XFTA 3UNWA 1V9YA 1F2KA 2Y2IA 2VV7A 1E25A 1K4EA 3E2KA 3FKVA 5EVIC 1MWSA 4E3LA 1YQSA 5FI7A 2D02A 1DRMA 4Y0TA 2BLSA 1MKMA 2A24B 3CITA 2ZOIA 4QPRA 3FKWA 4N9LA 3PBSA 4FCFA 1NYMA 3LFVA 4EXOA 1Z09A 3HCYA 1LL5A 1HLUP 3T4LA 4NETA 2WZZA 1SDNA 4KUOA 2XQZA 3FG8A 4ZJ2A 3W4OA 1IFQA 4QY5A 2IWBA 1K57A 5KIZA 2OLUA 3A0SA 2Y91A 5FQQA 3KYQA 3CWFA 2WAEA 4BENA 3UE1A 2PU4A 4BLMA 1H3QA 5CX7A 4F3LA 2OWHA 2R78A 1TS8A 3ZG9B 4R3JA 2W1TA 2H5SA 1KDWA 4K08A 3B47A 3A3FA 4DKIA 4KUKA 3VP0A 3UB6A 5G4YA 1M40A 3VP1A 3G34A 3P01A 2CC1A 3A3DA 2E8IA 3N8SA 1VEUA 4EQ1A 3LUQA 3VOYA 4LENA 2V0UA 1F9IA 3V39A 3NJAA 2W3EA 1YLTA 3T1QB 4PAUA 4EW7A 3IWIA 1IEMA 1NLZA 1MWUA 3ZHHA 3LY3A 3CUEA 4MEZA 1G6AA 4RX3A 5DKLA 3UMEA 2OWJA 2L4RA 2PD7A 5HL6A 3IF6B 3D72A 5GLBA 1ES5A 4K0XA 1MWTA 3RJUA 1FCNA 3FV7A 3H82B 3O5YA 2ZC5B 1TEMA 4FSFA 1I2SA 5FI2A 4ETXA 4XUZA 2VZWA 3VFHA 2EX9A 3NI9A 3QHYA 5CGSA 2DNSA 4PM7A 5L10A 4MBFA 1P0ZA 4WN5A 3GV9A 1W8YA 3QP2A 3TG9A 3OPPA 2WKRA 4GDBA 3AGEA 5FDHA 1ES2A 1L3LA 5CEDA 3DWKA 4JGQA 3V3SA 4S2MA 5HW3A 3S7QA 5A8BA 3GQZA 1GHMA 4QWOA 3LIAA 1LL8A 3Q82A 2P04A 1K25A 3IS2B 2JHEA 3C4PA 2Y59A 2VA0A 4IUKA 5GHZA 3JPUA 3CJMA 4UAAA 4Y0OA 4LPZA 2XRNA 1VHMA 5J8XA 3KSGA 4Y13A 3TOIA 2PRFA 5FQ9A 1BZAA 4X1MA 5EVIA 4GNUA 4ESPA 3VOZA 5HAQA 5LBRA 3G32A 3C30A 4CPKA 4RYEA 5IU1A 4N1XA 3VP4A 1P9RA 4LRXC 2PT7A 3C7UA 1YMXA 4JKTA 3HUOA 4BQMA 2Y2HA 4YOFA 3KSHA 1C3BA 2HJ9C 2Q9MA 4L9FA 1K55C 2Y2MA 4OP8A 3KYZA 4LCMA 5FQIA 2Z2LB 3UMDA 3EQUA 3UE6A 3GSGA 4EETB 5EVEA 1Q2QA 3LCEA 5M1AA 2AVXA 5G4ZA 3SH9A 2ZM0A 1TDLA 3P09A 4FD8A 4WYYA 3MF0A 2O9CA 1GHPA 2EFUA 4DE0A 2PYPA 4PPRA 3LYXA 2IWDA 1UWPX 4WZ5C 2V1AA 4U0TA 2ZJ9A 5CRFA 2Y2KA 3P98A 2Y2OA 4X1LA 3EOIA 2R9WA 3G2ZA 3MS6A 3S7NA 5TR7A 1ZC2A 3UB8A 1AXBA 1NWZA 2KDKA 3ZG0A 1FOFA 2VV8A 2PHYA 2KX6A 1ZTUA 1ZHHB 4OQHA 3DW0A 3PAEA 1PWGA 4BL3A 4C3QA 3VSKA 3F1NA 3WS5A 3OPHA 4YNRA 1RCJA 2X71A 2IWCA 1ERQA 4S2KA 1XKZA 3UDIA 3GMWA 3LY4A 4M3KA 3ZCZA 5EOOA 4HP9A 3B42A 2WKEA 4E3JA 3HVFA 2EX8A 1PNEA 3BFDA 1CI8A 3F1PA 3H7WB 4GHIA 5K5BA 5AQAA 2PBYA 3BYDA 5CECA 1HZOA 3HUNA 4ME4A 4FUWA 1G28A 4R4SA 2GX5A 3MZFA 1PRQA 2HGVA 1K54C 1GSWA 1L0FA 4KG2A 1A0KA 2WGIA 1FSYA 3ZVTA 4CLCE 4OQIA 2WGWB 3UN7A 3KYEA 4WMCD 5TBMA 1LT0A 4U3TA 3E4QA 3LR0A 4R3BA 4KZBA 5HWTA 3UPPA 3IWOA 5E2HA 4P85A 2M7VA 1XJ4A 3A3JA 2UV0E 1KGEA 3GDIA 3V5MA 4HJ4A 4MBHA 2H0YA 4DE2A 2XA7S 2G2UA 2ACGA 4I39A 1L2SA 3T4SA 4H6JA 5MC7A 1K55A 4IBRA 2EXAA 2P08A 3E4OA 3BFCA 3HLWA 3TJZC 3L7HA 3LO7A 3BJNA 4IVIA 1OMEA 3NOTC 2ZL1A 5A91A 5AVEA 3LI8A 2XDMA 4E3KA 4RA7A 4ID4A 1OTEA 4NG2A 5CXWA 2QMIA 5DF8A 1F98A 4N1HA 3WS2A 4HBUA 3Q7VA 5F69A 2XK1A 1UGUA 4ZJ1A 2FH5A 1RGYA 3IBJA 1DJBA 2I9VA 3N6IA 4KG6A 4X55A 3G30A 3S4XA 1DP6A 4OQ0A 2X02A 3BQ8A 1NZOA 4QHCA 3RXWA 2P9VA 4P0MA 4N9KA 4JF4A 2PU2A 3O3VA 3WS1A 2R9XA 4QU3A 3S22A 3E0YA 1V9ZA 4WZ5A 1NRJA 5GLDA 1EROA 4NEED 1GA9A 3MQQA 3IX8A 1ESIA 5CHJA 3CLOA 2ZC7A 5F82A 4G3KA 5E43A 4IBXA 3KSFA 1ES3A 3IH9A 4NXFA 2VGJA 3T1RA 3MXSA 4P6BA 1P97A 5EVLA 2P7JA 4GS9B 1IYQA 3D9YA 2XGNA 1PW1A 1NJ4A 3IF6C 1OTBA 1ZG6A 1YPRA 2FFFB 4AFIA 2JKTI 4EUZA 1LHYA 1NLYA 4XXRA 2LB5A 3EQVA 3BLSA 4S2OA 5CTMA 3HLCA 3QP8A 1SHVA 1TVFA 2G2WA 4Q0HA 1KGGA 1LL9A 4Y15A 2QZ6A 2ZQ8A 5M18A 4KZAA 1FCOA 3SS4A 1KE3A 4LGWA 4R1GA 2XEPA 3E98A 3JVVA 2JC7A 5DFXA 1N4OA 1KDSA 1IYSA 1CQAA 1GSXA 4GN2A 1ALQA 3MSHA 2ZC6B 3VP2A 2ZMVA 1FSWA 4LRYC 5EOEA 4LFUA 4S2NC 4O7DA 2QJ7A 2P74A 1DJCA 4OPZA 5U47A 3K3DA 2C6WB 2W3DA 1N9LA 4EQIA 4I5SA 1EWZA 3BQAA 1K54A 4EESA 4EV4A 1LSXA 2V2FF 4MDZA 1XJ2A 4WUJA 1S4RA 2C5WB 3IT9A 5CEBA 2PBDP 1EI5A 1SKOB 1VQQA 3VSLA 2EX2A 2A24A 4MMNA 1WYCA 3LGOA 3UY6A 5GLAA 2Y4AA 2Z2MB 4NXBA 4YWZA 3VOLA 4G3VA 3O87A 3OLOA 3T1XA 2K31A 1FR6A 4OOMA 4A5RA 1E4DA 5IS1A 1K4FA 3UB5P 1K56A 1YSPA 2V8FA 3NDGA 4HY8A 2PR6A 1YKDA 1X0OA 3OOVA 4GW9A 3VMAA 4ARZB 5FQJA 3U4LP 3RTYA 5FI6A 1K38A 4HP4A 2Y2GA 3A3EA 5IT5A 2WUQA 4I3AA 2ZD8A 5DF7A 2JCHA 1W79A 2MJ6A 4PMAA 3W2ZA 4U0XA 4HJ3A 4YINA 4DRTA 2GDNA 4MNRA 3W8KA 3CG5A 3T1SA 4OLGA 3ZDJA 4UEYA 4Q0JA 4H8RA 5GHXA 4E6XA 1XX2A 1FILA 2O9AA 3G4PA 4ZAMA 1W63M 3UB9A 2EA9A 4HESA 4HOIA 3LIEA 5GL9A 4EWFA 3WRZA 4JXSA 4DJ2A 3QP4A 3OBFA 5KZHA 1XGIA 1G5UA 5IHVA 1ONHA 4IVKA 4OOLA 3BFFA 4BWIA 4DE1A 3QP1A 1PWDA 1BULA 3IF6A 4XT2B 4P6ZS 1FQGA 4UQIM 4WELA 3N8LA 2ZQ9A 3OPLA 1WE4A 2KOIA 3H82A 1IOUA 1MY8A 3A0VA 1JTGA 3LIDA 4LCLA 1PI5A 2OSUA 5FEGA 4S2LA 5EM0A 1TF1A 3UDFA 4R3AA 3MFDA 1IKIA 2HP5A 2NUPC 4OKPA 1NRFA 4P87A 1J9MA 4S2NA 2B5RA 2W3FA 1YLZA 4MN5A 3WS4A 1BUEA 3ZG7B 1KE0A 3HL9A 1LSVA 4B88A 3N4IA 3WS0A 2B02A 2GNXA 5J3WA 1ESUA 4IUHA 3OCLA 3IS2A 5GHYA 4GDNA 2O99A 4JGOA 1ES4A 1GHIA 1MKIA 4NXEA 4GCZA 1KE4A 5EFWA 5I5LA 2JKGA 2J80A 1T19A 4EBLA 1IYOA 5F68A 2B18A 4KZ7A 2EX6A 5DJTA 3NULA 1D7EA 4KQDA 2FZ0A 2Y2LA 4NK3A 5CGWA 2Z6DA 2A2LA 4YFMA 1DP9A 3ICYA 3GVBA 5DKKA 3CHWP 1I5QA 3VE3A 3HLDA 5HAPA 4BMWA 1O07A 3AGDA 3ITAA 4L9EA 1BYWA 1NXYA 3HJIA 1TDGA 1T1CA 1VETA 3S7PA 2PD8A 3LR3A 1GSVA 4Y17A 2J3TD 4OH0A 2XR0A 4MN6A 3CPTB 3D4FA 4KZ4A 4X69A 3C5AA 4WF0A 2ZQDA 3S1YA 2Y2QA 1OT6A 2VGLS 2RL3A 1IELA 4E3NA 1FIKA 5A93A 4LV2A 1Q2PA 2LB9A 2W3GA 2NUTC 4NXGA 1PIOA 3R7WB 4JBFA 4GLQA 4OOYA 5HDCA 4JF6A 4EU0A 1DJAA 3K3CA 2ZQ7A 1H0MA 4HIAA 4GD8A 4LV0A 3OPRA 2INWA 5HL1A 4IHQA 4ZJ3A 1G6OA 4DE3A 5E2FA 2EWWA 4NKPA 1S4SA 3N7WA 3ZQ5A 3G6OA 3RXXA 4KZ8A 3MZDA 4BBVA 2WADA 2HDSA 3F1OB 3M6BA 4I3JA 2HDRA 3T4KA 1JWPA 1H8YA 1PFLA 1K6RA 2DCFA 2OOLA 3BW6A 4DDYA 5HZHA 1SDEA 1XJ3A 3LR5A 5EPHA 3ZNYA 2M7UA 1XP4A 2ZMAA 2E8JA 1I2WA 3LIFA 2VJWA 4MBKA 4WL9A 2HV1A 4PM5A 3UE3A 2PR5A 2V1BA 2J9PA 4C75A 1XFQA 1PYYA 4WMCA 3T4OA 3BFGA 2OLVA 4JGPA 4CQHA 1WYBA 1LI9A 1EW0A 3H7WA 4KQRA 3VE4A 1XJ6A 3HLGA 3TW8A 1CK3A 3EGDC 1ZG4A 5HFOA 3GTCA 5FAPA 3DWZA 4E3IA 2WAFA 1BSGA 2RCXA 1NZUA 4L9GA 1HD8A 3A0RA 3HJKA 2CMNA 4BJPA 4JXWA 3NDEA 4JF5A 5F1FA 4Z9QA 2Q0OA 3FPVA 3L9KA 2I72A 1ZKJA 4GB7A 3G35A 4GKUA 2WGWA 4R70A 2WKHA 2XFSA 3LIBA 3IHAA 3MXRA 4Y2FA 4UA9A 2XD5A 5HARA 3R4KA 5CHUA 3TRCA 4KQQA 3LEQA 2PYRA 2H28A 4FTXA 1MC0A 3T4QA 3MMHA 2OAQ1 2XF3A 5D3OA 3OZHA 2ZLYA 1YMSA 3BM6A 4E6WA 3ZGAB 3Q07A 3KX0X 1Y4OA 5FQKA 5HDSA 3O86A 3LEZA 3NOUC 4RVAA 2JKRM 5DFYA 3EWKA 2WKQA 1M6KA 3MBZA 4DF6A 2XD1A 3NC8A 2FFYA 2Y8HA 4E3MA 3HREA 2JKFA 4WEJA 1L0DA 4OPRA 4O0PA 3IXDA 3MKEA 2QPNA 2M1CA 2WKIA 3PHYA 3SW1A 4X68A 4E3OA 4QD4A 3QNCA 3MFXA 2UWXA 4BD0A 5FASA 3U2AA 4EBPA 3DTKA 1QMFA 4X53A 3IX3A 2KLIA 2ZOHA 1TS0A 3SZTA 4WBGA 4RQ9A 3S7OA 1HTZA 1PI4A 1F5MA 4K0WA 1YT4A 5HPFA 2HDQA 1E3UA 4WEKA 3SH8A 4X25A 1XA7A 3CAXA 4BBTA 2Q9NA 5HWWA 3NCKA 1CEFA 1W5DA 1YLPA 1NYYA 2K7SA 2DMWA 3PBRA 3N8RA 4BL2A 4ZTKA 3W4PA 1L0EA 3UPNA 1FCMA 3MR0A 1K6SA 1D06A 1H8ZA 4CLCB 2VK3A 2WZXA 2VLGA 4GS9A 1BLSA 3BECA 1YAXA 4FH4A 1VB6A 4KZ9A 2Y2NA 1WA9A 2HP6A 1T1BA 1W63Q 3NY4A 1S67L 1KGFA 4HBTA 1IYPA 1MWRA 1UWNX 5KSHA 2GJ3A 4DXBA 4EERA 1DY6A 2QKPA 3PTEA 5HWVA 3IX4A 3G31A 3SS3A 4XUXA 4B93A 2HJEA 3G2YA 5KMWA 4HH3A 3UE0A
chains in the Genus database with same CATH topology
1XFNA 5AJGA 1STZA 2KOIA 3EOIA 3H82A 1IOUA 2YKHA 3A0VA 3S7NA 5DF9A 3BY9A 4CLCD 3UB8A 3LIDA 2J3TC 5HD5A 1N9NA 1NWZA 2KDKA 3FC7A 3CI6A 1TF1A 4MN7A 2VV8A 2PHYA 2KX6A 2VGLM 2QJ5A 4R3AA 4EEPA 5J4EA 1ZTUA 2NUPC 1ZHHB 2G7UA 3F1NA 4F3LB 2IA2A 4YNRA 2JKTM 2W3FA 4MN5A 1OJ5A 3RH8B 1N9OA 5HPIA 5TJJA 3LR4A 4G3WA 4P6ZM 3PYPA 2QYBA 3C8CA 1LSVA 2W1TB 2V0WA 3LICA 4O01A 2B02A 2GNXA 5J3WA 3CUEC 4HP9A 5DJUA 3B42A 4IUHA 2VV6A 3MQ0A 3OCLA 3IS2A 3T4JA 4JGOA 2O99A 5AVFA 4NXEA 3E4PA 3F1PA 3H7WB 4GHIA 5K5BA 4GCZA 3UB7A 2HF6A 5EFWA 5I5LA 2BASA 1MZUA 1YSQA 2J80A 4ME4A 1T19A 4DN0A 5F68A 2B18A 5DJTA 4EUVA 1D7EA 1G28A 3BY8A 4KQDA 2JKRI 2FZ0A 4MCWA 2GX5A 2ZBBA 2Z6DA 4HQAA 2A2LA 4ETZA 1DP9A 2HGVA 3ICYA 4O8GA 1GSWA 4ARZA 2ZMFA 2WKPA 5DKKA 2K2NA 5C5KA 3VE3A 3KSIA 4CLCE 4PKYG 2OAP1 3MJQA 4BMWA 2XROA 5TBMA 1LT0A 4L9EA 3H9WA 3E4QA 1BYWA 3LR0A 3HJIA 3S7PA 1T1CA 2PD8A 5HWTA 3LR3A 1GSVA 2J3TD 4MN6A 3D3OA 2M7VA 4WF0A 4CLCA 1XJ4A 5FL3A 3PXPA 4L0LA 1OT6A 2VGLS 3C2WA 2W1RA 4EEUA 1S66L 1Y28A 2V9AA 3PBNA 4PHTA 3GDIA 2YKFA 3PBOA 4HJ4A 2LB9A 2W3GA 2NUTC 2XA7S 1OT9A 4NXGA 2O0YA 4BBUA 3EEAA 3MQOA 3R7WB 4Z1WA 1V9YA 4GLQA 5HDCA 2VV7A 4I39A 3ULFA 3T4SA 4EU0A 4II7A 4H6JA 4HHDA 2JN7A 2VX8A 3K3CA 5MC7A 4HIAA 4E04A 2P08A 3E4OA 3TJZC 2INWA 3KO6A 4DMZA 3BJNA 4IHQA 3NOTC 2D02A 5J7EA 1DRMA 5AVEA 1MKMA 2A24B 3CITA 3LI8A 3PBTA 1G6OA 2EWWA 4NKPA 2ZOIA 1S4SA 4QPRA 5HDDA 3ZQ5A 1OTEA 3G6OA 3PBSA 3P7NA 4XT2A 4BBVA 1F98A 3LFVA 5F69A 4EXOA 3HCYA 3F1OB 1UGUA 2XA7M 4I3JA 3T4KA 2FH5A 3T4LA 3DBAA 3IBJA 2I9VA 4KUOA 3FG8A 1DP6A 1IFQA 2OOLA 3BQ8A 5KIZA 3BW6A 3PR6A 2L1MA 5HSQA 5HZHA 1XJ3A 3A0SA 3LR5A 1OTIA 3KYQA 2M7UA 3CWFA 4IJGA 1TS7A 5F6AA 4Y3IA 3LIFA 3E0YA 1V9ZA 4B9OA 2VJWA 1H3QA 1NRJA 5CX7A 4WL9A 2HV1A 4F3LA 3UE3A 2OWHA 2PR5A 4NEED 3MQQA 2V1BA 3CLOA 2R78A 1TS8A 1XFQA 4G3KA 2GZAA 3EGXC 3T4OA 3KSFA 2W1TA 4JGPA 4CQHA 3T4TA 4K08A 4NXFA 3B47A 2VKSA 4KUKA 1P97A 2P7JA 2W0NA 4GS9B 4I3IA 2EWVA 5G4YA 3UB6A 1EW0A 1TS6A 3H7WA 3VE4A 1OTBA 1XJ6A 1JNUA 1LSWA 3TW8A 3P01A 1TD5A 3EGDC 4AFIA 2JKTI 4EQ1A 1NLYA 3LUQA 2LB5A 3EQVA 2V0UA 1KOUA 2J3WA 1F9IA 3NJAA 2W3EA 4L9GA 4PAUA 4EW7A 1OPXA 3A0RA 2CMNA 3HJKA 4Q0HA 4BJPA 1NLZA 4WLAA 4JGRA 4Y5FA 3CUEA 5DKLA 3UMEA 3JVVA 3E98A 2OWJA 3JVUA 3FPVA 5DFXA 2L4RA 2PD7A 1T1AA 2VEAA 5HL6A 1GSXA 3GECA 4HI4A 1S1YA 2ZMVA 3D72A 4R38A 2W27A 4LRYC 2QJ7A 4R70A 3LIBA 4Y2FA 3H82B 3O5YA 4FOFA 2D01A 3R4KA 1P9WA 4FSFA 4ETXA 3K3DA 4R6LA 2VZWA 2W3HA 3TRCA 2W3DA 1N9LA 4I5SA 2PYRA 3V67A 5HD3A 2H28A 1MC0A 1P0ZA 3BQAA 2QWSA 5F5YA 3T4QA 4WN5A 4EESA 1DP8A 3MMHA 3MXQA 1LSXA 2OAQ1 3BWLA 2WKRA 3R7WA 4LLOB 4MDZA 1XJ2A 4WUJA 1S4RA 3F1NB 3KX0X 5HDSA 3B33A 4JGQA 3EEHA 2QHKA 3NOUC 2JKRM 5DFYA 3EWKA 1S1ZA 3S7QA 5A8BA 3K2NA 2WKQA 3LIAA 1LL8A 5L8MA 2P04A 2Y8HA 3LI9A 1T18A 2A24A 4MMNA 2L0WA 3IS2B 4WEJA 4NXBA 2JHEA 4O0PA 4YWZA 3F1PB 4M4XA 4GHIB 2VA0A 4IUKA 3VOLA 4G3VA 2M1CA 3OLOA 3PHYA 2XSSA 2PDRA 3SW1A 2K31A 4HH2A 4LPZA 2XRNA 3MFXA 4OOMA 1H8MA 1VHMA 3F1OA 5IS1A 4HNBA 3KSGA 1YSPA 3U2AA 4HY8A 3T50A 4PKYA 2KLIA 2ZOHA 1TS0A 2PR6A 4CLCC 5LBRA 4RQ9A 3S7OA 1YKDA 1F5MA 1X0OA 3OOVA 3NOPC 4GW9A 3C30A 5HPFA 4ARZB 4WEKA 3C38A 5IU1A 3RTYA 4Q0IA 1P9RA 4HP4A 4LRXC 5IT5A 2PT7A 2Y79A 4I3AA 3CAXA 4BBTA 1OJGA 5HWWA 2K7SA 2MJ6A 2DMWA 3W2ZA 3PBRA 4YOFA 3KSHA 2HJ9C 4HJ3A 4L9FA 5TBMB 3MR0A 1D06A 3KYZA 3RFBA 4UEYA 4CLCB 4Q0JA 4I38A 4LRZE 2VLGA 4GS9A 3PBQA 3UMDA 2O9AA 4UQIS 1YAXA 1VB6A 3OC2A 3EQUA 3UE6A 4EETB 1WA9A 2Z6CA 1T1BA 1W63Q 4HJ6A 1W63M 2O9BA 4KQOA 4GJ4A 3UB9A 1S67L 5G4ZA 3TE8A 2EA9A 4HOIA 4H6JB 3LIEA 3ZYTA 3IBRA 3OCNA 1UWNX 3MF0A 1ODVA 4DJ2A 5KSHA 3OBFA 2GJ3A 2O9CA 1OTAA 4EERA 2PYPA 2QKPA 3LYXA 3FPWA 1UWPX 4ZRRA 4OOLA 5HWVA 3NHQA 4BWIA 4DJ3A 2V1AA 4B93A 1OTDA 2HJEA 3VV4A 4XT2B 4P6ZS 4UQIM 4HH3A 4WELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJG A;  2XSS A;  1STZ A;  2KOI A;  2K31 A;  3D3O A;  2M7V A;  2XRN A;  1VHM A;  3S7N A;  3C2W A;  2W1R A;  3KSG A;  1TD5 A;  1YSP A;  2KLI A;  2LB9 A;  2W3G A;  3CI6 A;  2LB5 A;  1TF1 A;  2O0Y A;  3EEA A;  4MN7 A;  4Z1W A;  5LBR A;  4RQ9 A;  3S7O A;  1YKD A;  1F5M A;  3OOV A;  4GLQ A;  3NOP C;  1ZTU A;  2W3E A;  4GW9 A;  5HPF A;  4PAU A;  4EU0 A;  2G7U A;  4Q0H A;  4E04 A;  2IA2 A;  4Q0I A;  4Y5F A;  4YNR A;  2W3F A;  4LRX C;  2Y79 A;  3E98 A;  3KO6 A;  5HPI A;  5DFX A;  5TJJ A;  4G3W A;  3BJN A;  4DMZ A;  2QYB A;  2VEA A;  3NOT C;  5HL6 A;  3W2Z A;  4YOF A;  1MKM A;  3CIT A;  2W1T B;  3KSH A;  4O01 A;  4LRY C;  4QPR A;  3ZQ5 A;  4IUH A;  3G6O A;  4R70 A;  3MQ0 A;  2O99 A;  4Y2F A;  3O5Y A;  4FOF A;  3RFB A;  5K5B A;  3R4K A;  3LFV A;  4Q0J A;  3HCY A;  4LRZ E;  4ETX A;  4R6L A;  5I5L A;  2VZW A;  2W3H A;  1YSQ A;  2W3D A;  3DBA A;  3TRC A;  3IBJ A;  4ME4 A;  2O9A A;  4DN0 A;  2B18 A;  1MC0 A;  4EUV A;  2O9B A;  3MMH A;  2OOL A;  2GX5 A;  4MCW A;  5HSQ A;  4ETZ A;  4MDZ A;  2HGV A;  3IBR A;  2M7U A;  4IJG A;  4O8G A;  3MF0 A;  4Y3I A;  3E0Y A;  3OBF A;  2VJW A;  2ZMF A;  2K2N A;  2O9C A;  5C5K A;  3NOU C;  5DFY A;  3S7Q A;  3K2N A;  3KSI A;  4ZRR A;  5L8M A;  4G3K A;  3NHQ A;  2Y8H A;  4BWI A;  3KSF A;  4MMN A;  2W1T A;  3VV4 A;  2XRO A;  4CQH A;  4O0P A;  2VKS A;  3S7P A;  4IUK A;  4G3V A; 
#chains in the Genus database with same CATH topology
 4X6T A;  1STZ A;  5BOH A;  2OV5 A;  1KVL A;  5DF9 A;  1Z6F A;  3IF5 A;  2JBF A;  3BY9 A;  3PAG A;  4CLC D;  1PWC A;  2J3T C;  1N9N A;  3O88 A;  1YLJ A;  3FWL A;  3NEC A;  3FC7 A;  3CI6 A;  4MN7 A;  3CZD A;  2VGL M;  4EEP A;  1CEG A;  3IWQ A;  4F3L B;  3VP3 A;  2IA2 A;  3JYI A;  3ISG A;  5HPI A;  3LR4 A;  1PZP A;  2QYB A;  1SKO A;  2W1T B;  2V0W A;  3M2K A;  1ONG A;  3MQ0 A;  3T4J A;  5AVF A;  3E4P A;  1BLP A;  4JXG A;  1YSQ A;  4GD6 A;  5F1G A;  4IED A;  1MPL A;  1VEU B;  1S6R A;  3BFE A;  5EUA A;  5E2E A;  2JE5 A;  4WM9 A;  2ZQC A;  4MCW A;  5L07 A;  5JYP A;  2ZBB A;  1MBL A;  4ETZ A;  1W7F A;  2EXB A;  4HEF A;  4O8G A;  4ARZ A;  5FEF A;  1U60 A;  2ZMF A;  2WKP A;  4KZ5 A;  5C5K A;  1SZV A;  5HX9 A;  4K91 A;  4PKY G;  1K56 D;  3TSG A;  2OAP 1;  3MJQ A;  2X01 A;  4EBN A;  4KZ6 A;  3ZG5 A;  4KG5 A;  5AQB A;  4PM9 A;  1LI0 A;  4JXV A;  3A3I A;  2WGV A;  4Y7P A;  3PXP A;  2Y55 A;  4L0L A;  3Q7Z A;  1XPB A;  2W1R A;  2ZM8 A;  4EEU A;  1S66 L;  1Y28 A;  2V9A A;  4PHT A;  4WZ4 A;  2YKF A;  3PBO A;  4ZDX A;  2O0Y A;  4BBU A;  4Z1W A;  3M6H A;  2VGK A;  1BT5 A;  1LLB A;  3ULF A;  4OVD A;  4II7 A;  5FAT A;  4HHD A;  2JN7 A;  2VX8 A;  1BLH A;  2A49 A;  4E04 A;  4CJN A;  3NIA A;  5EEC A;  5E2G A;  3KO6 A;  4DMZ A;  3DTM A;  4N92 A;  5J7E A;  3PBT A;  4GZB A;  5HDD A;  5HAI A;  4D60 A;  3P7N A;  1W8Q A;  1JTD A;  4XT2 A;  1BLC A;  3GRJ A;  2J9O A;  2XA7 M;  3SH7 A;  3ZG8 B;  3DBA A;  2ZQA A;  2HDU A;  1K0K A;  3FYZ A;  2V20 A;  3WRT A;  5EVI B;  3PR6 A;  3HUM A;  2L1M A;  5HSQ A;  1OTI A;  3DTE A;  3HBR A;  3HLE A;  3V50 A;  1SKF A;  4IJG A;  1TS7 A;  5F6A A;  4Y3I A;  2ZM2 A;  4B9O A;  1VM1 A;  1L0G A;  4B4X A;  4FH2 A;  1HVB A;  2GZA A;  3EGX C;  1RP5 A;  1SCW A;  3T4T A;  2VKS A;  5DTT A;  2Y2J A;  2W0N A;  4I3I A;  2EWV A;  4PM8 A;  4R4R A;  1TS6 A;  4LV3 A;  2A3U A;  1JNU A;  1CJF A;  1GCE A;  1LSW A;  3BEB A;  1TD5 A;  4OQG A;  1JWV A;  5EM1 A;  2HZ5 A;  1KOU A;  1VET B;  2J3W A;  5EVI D;  2B95 A;  4UA6 A;  5FA7 A;  1OPX A;  1S0W A;  5L09 A;  4WLA A;  4JGR A;  2WYX A;  3SS5 A;  4Y5F A;  2J8Y A;  4JLF A;  5CER A;  2ZC3 B;  3JVU A;  5DTK A;  2Y2P A;  1T1A A;  2VEA A;  4D2O A;  3GEC A;  5FDS A;  3Q81 A;  4HI4 A;  1S1Y A;  4R38 A;  2W27 A;  1H5X A;  4OP5 A;  2BTF P;  3B3X A;  1QME A;  1AWI A;  4FOF A;  2D01 A;  1P9W A;  4R6L A;  2W3H A;  3CPT A;  3V67 A;  5HD3 A;  2QWS A;  5F5Y A;  1MXO A;  2V1Z A;  4QB8 A;  3QP6 A;  1DP8 A;  5I94 A;  3MXQ A;  3FZC A;  2BG1 A;  3BWL A;  1O7E A;  4LLO B;  3R7W A;  1ACF A;  3BRM A;  3F1N B;  5AQ7 A;  1YM1 A;  3UDX A;  4ZBE A;  3B33 A;  4UHU A;  3EEH A;  2QHK A;  5TFQ A;  1S1Z A;  3K2N A;  5L8M A;  1JVJ A;  3LI9 A;  1T18 A;  2L0W A;  5G18 A;  2H10 A;  4LV1 A;  3QP5 A;  3F1P B;  4M4X A;  4GHI B;  4DDS A;  2J7V A;  1YLY A;  5GLC A;  2XSS A;  3CMZ A;  2PDR A;  1Y54 A;  4OLD A;  4HH2 A;  4S2I A;  1H8M A;  3F1O A;  4HNB A;  3IXH A;  4DXC A;  4MLL A;  3T50 A;  4PKY A;  4CLC C;  1ERM A;  1FR1 A;  1G68 A;  3NOP C;  3BLM A;  5L2F A;  5M19 A;  5TGF A;  3C38 A;  3UPO A;  3MKF A;  2HPB A;  4Q0I A;  5FSR A;  2Y79 A;  4OON A;  1OJG A;  4R23 A;  3E2L A;  5FAQ A;  1CF0 A;  3NBL A;  5TBM B;  4Y0U A;  1JWZ A;  1RGZ A;  3IXG A;  2HP9 A;  5JYO A;  3RFB A;  4I38 A;  4LRZ E;  3PBQ A;  5FAO A;  4UQI S;  3OC2 A;  5CTN A;  2Z6C A;  3DTI A;  3ZNT A;  1CI9 A;  4HJ6 A;  2O9B A;  4KQO A;  4GJ4 A;  2PAV P;  3TE8 A;  4H6J B;  3ZYT A;  3ZVW A;  5A90 A;  3I7J A;  3IBR A;  5EE8 A;  3OCN A;  1ODV A;  3HLB A;  1K57 C;  1N9B A;  1OTA A;  2ZC4 B;  4S2P A;  2ZL1 B;  3FPW A;  4ZRR A;  5A92 A;  3IHB A;  3NHQ A;  4DJ3 A;  3IH8 A;  1OTD A;  3VV4 A;  5AQ9 A;  3ZFZ A;  3IXB A;  4RX2 A;  4OPY A;  3AGF A;  3Q7V B;  1XFN A;  5AJG A;  3C7V A;  2YKH A;  4JPM A;  1YLW A;  4PM6 A;  4C6Y A;  5HD5 A;  1XA1 A;  2P9V B;  4S2J A;  1KVM A;  2QJ5 A;  2WK0 A;  5J4E A;  3HLF A;  2G7U A;  4OPQ A;  4B4Z A;  3C4O A;  2JKT M;  3WWX A;  1OJ5 A;  4UA7 A;  3RH8 B;  1N9O A;  5TJJ A;  4P6Z M;  4G3W A;  3PYP A;  3QNB A;  4R0Q A;  3C8C A;  2V8C A;  3LIC A;  4O01 A;  3CUE C;  5DJU A;  2VV6 A;  1BTL A;  1GA0 A;  5DTS A;  3UB7 A;  2HF6 A;  4QJG A;  5CHM A;  2BAS A;  1MZU A;  2XLN A;  1NY0 A;  3UO9 A;  3V3R A;  4DN0 A;  2DRW A;  3M2J A;  5CGX A;  4BD1 A;  1J3W A;  4EUV A;  3BY8 A;  2JKR I;  3IQA A;  3DAV A;  4GOG A;  4HQA A;  3VFF A;  4KZ3 A;  1IKG A;  1PZO A;  2K2N A;  5DVA A;  3SOI A;  2H0T A;  3GR2 A;  4KEN B;  3KSI A;  2EFX A;  4QY6 A;  5FQM A;  1PW8 A;  4F94 A;  1D1J A;  4X56 A;  2XRO A;  5EV0 A;  3ITB A;  3H9W A;  5F83 A;  5KSC A;  1E3U D;  3D3O A;  4Q8I A;  4CLC A;  2XH9 A;  5FL3 A;  1XXM A;  3MZE A;  3C2W A;  3W4Q A;  3PBN A;  3T12 B;  3Q1F A;  1OT9 A;  3EEA A;  3MQO A;  1XGJ A;  2XFT A;  3UNW A;  1V9Y A;  1F2K A;  2Y2I A;  2VV7 A;  1E25 A;  1K4E A;  3E2K A;  3FKV A;  5EVI C;  1MWS A;  4E3L A;  1YQS A;  5FI7 A;  2D02 A;  1DRM A;  4Y0T A;  2BLS A;  1MKM A;  2A24 B;  3CIT A;  2ZOI A;  4QPR A;  3FKW A;  4N9L A;  3PBS A;  4FCF A;  1NYM A;  3LFV A;  4EXO A;  1Z09 A;  3HCY A;  1LL5 A;  1HLU P;  3T4L A;  4NET A;  2WZZ A;  1SDN A;  4KUO A;  2XQZ A;  3FG8 A;  4ZJ2 A;  3W4O A;  1IFQ A;  4QY5 A;  2IWB A;  1K57 A;  5KIZ A;  2OLU A;  3A0S A;  2Y91 A;  5FQQ A;  3KYQ A;  3CWF A;  2WAE A;  4BEN A;  3UE1 A;  2PU4 A;  4BLM A;  1H3Q A;  5CX7 A;  4F3L A;  2OWH A;  2R78 A;  1TS8 A;  3ZG9 B;  4R3J A;  2W1T A;  2H5S A;  1KDW A;  4K08 A;  3B47 A;  3A3F A;  4DKI A;  4KUK A;  3VP0 A;  3UB6 A;  5G4Y A;  1M40 A;  3VP1 A;  3G34 A;  3P01 A;  2CC1 A;  3A3D A;  2E8I A;  3N8S A;  1VEU A;  4EQ1 A;  3LUQ A;  3VOY A;  4LEN A;  2V0U A;  1F9I A;  3V39 A;  3NJA A;  2W3E A;  1YLT A;  3T1Q B;  4PAU A;  4EW7 A;  3IWI A;  1IEM A;  1NLZ A;  1MWU A;  3ZHH A;  3LY3 A;  3CUE A;  4MEZ A;  1G6A A;  4RX3 A;  5DKL A;  3UME A;  2OWJ A;  2L4R A;  2PD7 A;  5HL6 A;  3IF6 B;  3D72 A;  5GLB A;  1ES5 A;  4K0X A;  1MWT A;  3RJU A;  1FCN A;  3FV7 A;  3H82 B;  3O5Y A;  2ZC5 B;  1TEM A;  4FSF A;  1I2S A;  5FI2 A;  4ETX A;  4XUZ A;  2VZW A;  3VFH A;  2EX9 A;  3NI9 A;  3QHY A;  5CGS A;  2DNS A;  4PM7 A;  5L10 A;  4MBF A;  1P0Z A;  4WN5 A;  3GV9 A;  1W8Y A;  3QP2 A;  3TG9 A;  3OPP A;  2WKR A;  4GDB A;  3AGE A;  5FDH A;  1ES2 A;  1L3L A;  5CED A;  3DWK A;  4JGQ A;  3V3S A;  4S2M A;  5HW3 A;  3S7Q A;  5A8B A;  3GQZ A;  1GHM A;  4QWO A;  3LIA A;  1LL8 A;  3Q82 A;  2P04 A;  1K25 A;  3IS2 B;  2JHE A;  3C4P A;  2Y59 A;  2VA0 A;  4IUK A;  5GHZ A;  3JPU A;  3CJM A;  4UAA A;  4Y0O A;  4LPZ A;  2XRN A;  1VHM A;  5J8X A;  3KSG A;  4Y13 A;  3TOI A;  2PRF A;  5FQ9 A;  1BZA A;  4X1M A;  5EVI A;  4GNU A;  4ESP A;  3VOZ A;  5HAQ A;  5LBR A;  3G32 A;  3C30 A;  4CPK A;  4RYE A;  5IU1 A;  4N1X A;  3VP4 A;  1P9R A;  4LRX C;  2PT7 A;  3C7U A;  1YMX A;  4JKT A;  3HUO A;  4BQM A;  2Y2H A;  4YOF A;  3KSH A;  1C3B A;  2HJ9 C;  2Q9M A;  4L9F A;  1K55 C;  2Y2M A;  4OP8 A;  3KYZ A;  4LCM A;  5FQI A;  2Z2L B;  3UMD A;  3EQU A;  3UE6 A;  3GSG A;  4EET B;  5EVE A;  1Q2Q A;  3LCE A;  5M1A A;  2AVX A;  5G4Z A;  3SH9 A;  2ZM0 A;  1TDL A;  3P09 A;  4FD8 A;  4WYY A;  3MF0 A;  2O9C A;  1GHP A;  2EFU A;  4DE0 A;  2PYP A;  4PPR A;  3LYX A;  2IWD A;  1UWP X;  4WZ5 C;  2V1A A;  4U0T A;  2ZJ9 A;  5CRF A;  2Y2K A;  3P98 A;  2Y2O A;  4X1L A;  3EOI A;  2R9W A;  3G2Z A;  3MS6 A;  3S7N A;  5TR7 A;  1ZC2 A;  3UB8 A;  1AXB A;  1NWZ A;  2KDK A;  3ZG0 A;  1FOF A;  2VV8 A;  2PHY A;  2KX6 A;  1ZTU A;  1ZHH B;  4OQH A;  3DW0 A;  3PAE A;  1PWG A;  4BL3 A;  4C3Q A;  3VSK A;  3F1N A;  3WS5 A;  3OPH A;  4YNR A;  1RCJ A;  2X71 A;  2IWC A;  1ERQ A;  4S2K A;  1XKZ A;  3UDI A;  3GMW A;  3LY4 A;  4M3K A;  3ZCZ A;  5EOO A;  4HP9 A;  3B42 A;  2WKE A;  4E3J A;  3HVF A;  2EX8 A;  1PNE A;  3BFD A;  1CI8 A;  3F1P A;  3H7W B;  4GHI A;  5K5B A;  5AQA A;  2PBY A;  3BYD A;  5CEC A;  1HZO A;  3HUN A;  4ME4 A;  4FUW A;  1G28 A;  4R4S A;  2GX5 A;  3MZF A;  1PRQ A;  2HGV A;  1K54 C;  1GSW A;  1L0F A;  4KG2 A;  1A0K A;  2WGI A;  1FSY A;  3ZVT A;  4CLC E;  4OQI A;  2WGW B;  3UN7 A;  3KYE A;  4WMC D;  5TBM A;  1LT0 A;  4U3T A;  3E4Q A;  3LR0 A;  4R3B A;  4KZB A;  5HWT A;  3UPP A;  3IWO A;  5E2H A;  4P85 A;  2M7V A;  1XJ4 A;  3A3J A;  2UV0 E;  1KGE A;  3GDI A;  3V5M A;  4HJ4 A;  4MBH A;  2H0Y A;  4DE2 A;  2XA7 S;  2G2U A;  2ACG A;  4I39 A;  1L2S A;  3T4S A;  4H6J A;  5MC7 A;  1K55 A;  4IBR A;  2EXA A;  2P08 A;  3E4O A;  3BFC A;  3HLW A;  3TJZ C;  3L7H A;  3LO7 A;  3BJN A;  4IVI A;  1OME A;  3NOT C;  2ZL1 A;  5A91 A;  5AVE A;  3LI8 A;  2XDM A;  4E3K A;  4RA7 A;  4ID4 A;  1OTE A;  4NG2 A;  5CXW A;  2QMI A;  5DF8 A;  1F98 A;  4N1H A;  3WS2 A;  4HBU A;  3Q7V A;  5F69 A;  2XK1 A;  1UGU A;  4ZJ1 A;  2FH5 A;  1RGY A;  3IBJ A;  1DJB A;  2I9V A;  3N6I A;  4KG6 A;  4X55 A;  3G30 A;  3S4X A;  1DP6 A;  4OQ0 A;  2X02 A;  3BQ8 A;  1NZO A;  4QHC A;  3RXW A;  2P9V A;  4P0M A;  4N9K A;  4JF4 A;  2PU2 A;  3O3V A;  3WS1 A;  2R9X A;  4QU3 A;  3S22 A;  3E0Y A;  1V9Z A;  4WZ5 A;  1NRJ A;  5GLD A;  1ERO A;  4NEE D;  1GA9 A;  3MQQ A;  3IX8 A;  1ESI A;  5CHJ A;  3CLO A;  2ZC7 A;  5F82 A;  4G3K A;  5E43 A;  4IBX A;  3KSF A;  1ES3 A;  3IH9 A;  4NXF A;  2VGJ A;  3T1R A;  3MXS A;  4P6B A;  1P97 A;  5EVL A;  2P7J A;  4GS9 B;  1IYQ A;  3D9Y A;  2XGN A;  1PW1 A;  1NJ4 A;  3IF6 C;  1OTB A;  1ZG6 A;  1YPR A;  2FFF B;  4AFI A;  2JKT I;  4EUZ A;  1LHY A;  1NLY A;  4XXR A;  2LB5 A;  3EQV A;  3BLS A;  4S2O A;  5CTM A;  3HLC A;  3QP8 A;  1SHV A;  1TVF A;  2G2W A;  4Q0H A;  1KGG A;  1LL9 A;  4Y15 A;  2QZ6 A;  2ZQ8 A;  5M18 A;  4KZA A;  1FCO A;  3SS4 A;  1KE3 A;  4LGW A;  4R1G A;  2XEP A;  3E98 A;  3JVV A;  2JC7 A;  5DFX A;  1N4O A;  1KDS A;  1IYS A;  1CQA A;  1GSX A;  4GN2 A;  1ALQ A;  3MSH A;  2ZC6 B;  3VP2 A;  2ZMV A;  1FSW A;  4LRY C;  5EOE A;  4LFU A;  4S2N C;  4O7D A;  2QJ7 A;  2P74 A;  1DJC A;  4OPZ A;  5U47 A;  3K3D A;  2C6W B;  2W3D A;  1N9L A;  4EQI A;  4I5S A;  1EWZ A;  3BQA A;  1K54 A;  4EES A;  4EV4 A;  1LSX A;  2V2F F;  4MDZ A;  1XJ2 A;  4WUJ A;  1S4R A;  2C5W B;  3IT9 A;  5CEB A;  2PBD P;  1EI5 A;  1SKO B;  1VQQ A;  3VSL A;  2EX2 A;  2A24 A;  4MMN A;  1WYC A;  3LGO A;  3UY6 A;  5GLA A;  2Y4A A;  2Z2M B;  4NXB A;  4YWZ A;  3VOL A;  4G3V A;  3O87 A;  3OLO A;  3T1X A;  2K31 A;  1FR6 A;  4OOM A;  4A5R A;  1E4D A;  5IS1 A;  1K4F A;  3UB5 P;  1K56 A;  1YSP A;  2V8F A;  3NDG A;  4HY8 A;  2PR6 A;  1YKD A;  1X0O A;  3OOV A;  4GW9 A;  3VMA A;  4ARZ B;  5FQJ A;  3U4L P;  3RTY A;  5FI6 A;  1K38 A;  4HP4 A;  2Y2G A;  3A3E A;  5IT5 A;  2WUQ A;  4I3A A;  2ZD8 A;  5DF7 A;  2JCH A;  1W79 A;  2MJ6 A;  4PMA A;  3W2Z A;  4U0X A;  4HJ3 A;  4YIN A;  4DRT A;  2GDN A;  4MNR A;  3W8K A;  3CG5 A;  3T1S A;  4OLG A;  3ZDJ A;  4UEY A;  4Q0J A;  4H8R A;  5GHX A;  4E6X A;  1XX2 A;  1FIL A;  2O9A A;  3G4P A;  4ZAM A;  1W63 M;  3UB9 A;  2EA9 A;  4HES A;  4HOI A;  3LIE A;  5GL9 A;  4EWF A;  3WRZ A;  4JXS A;  4DJ2 A;  3QP4 A;  3OBF A;  5KZH A;  1XGI A;  1G5U A;  5IHV A;  1ONH A;  4IVK A;  4OOL A;  3BFF A;  4BWI A;  4DE1 A;  3QP1 A;  1PWD A;  1BUL A;  3IF6 A;  4XT2 B;  4P6Z S;  1FQG A;  4UQI M;  4WEL A;  3N8L A;  2ZQ9 A;  3OPL A;  1WE4 A;  2KOI A;  3H82 A;  1IOU A;  1MY8 A;  3A0V A;  1JTG A;  3LID A;  4LCL A;  1PI5 A;  2OSU A;  5FEG A;  4S2L A;  5EM0 A;  1TF1 A;  3UDF A;  4R3A A;  3MFD A;  1IKI A;  2HP5 A;  2NUP C;  4OKP A;  1NRF A;  4P87 A;  1J9M A;  4S2N A;  2B5R A;  2W3F A;  1YLZ A;  4MN5 A;  3WS4 A;  1BUE A;  3ZG7 B;  1KE0 A;  3HL9 A;  1LSV A;  4B88 A;  3N4I A;  3WS0 A;  2B02 A;  2GNX A;  5J3W A;  1ESU A;  4IUH A;  3OCL A;  3IS2 A;  5GHY A;  4GDN A;  2O99 A;  4JGO A;  1ES4 A;  1GHI A;  1MKI A;  4NXE A;  4GCZ A;  1KE4 A;  5EFW A;  5I5L A;  2JKG A;  2J80 A;  1T19 A;  4EBL A;  1IYO A;  5F68 A;  2B18 A;  4KZ7 A;  2EX6 A;  5DJT A;  3NUL A;  1D7E A;  4KQD A;  2FZ0 A;  2Y2L A;  4NK3 A;  5CGW A;  2Z6D A;  2A2L A;  4YFM A;  1DP9 A;  3ICY A;  3GVB A;  5DKK A;  3CHW P;  1I5Q A;  3VE3 A;  3HLD A;  5HAP A;  4BMW A;  1O07 A;  3AGD A;  3ITA A;  4L9E A;  1BYW A;  1NXY A;  3HJI A;  1TDG A;  1T1C A;  1VET A;  3S7P A;  2PD8 A;  3LR3 A;  1GSV A;  4Y17 A;  2J3T D;  4OH0 A;  2XR0 A;  4MN6 A;  3CPT B;  3D4F A;  4KZ4 A;  4X69 A;  3C5A A;  4WF0 A;  2ZQD A;  3S1Y A;  2Y2Q A;  1OT6 A;  2VGL S;  2RL3 A;  1IEL A;  4E3N A;  1FIK A;  5A93 A;  4LV2 A;  1Q2P A;  2LB9 A;  2W3G A;  2NUT C;  4NXG A;  1PIO A;  3R7W B;  4JBF A;  4GLQ A;  4OOY A;  5HDC A;  4JF6 A;  4EU0 A;  1DJA A;  3K3C A;  2ZQ7 A;  1H0M A;  4HIA A;  4GD8 A;  4LV0 A;  3OPR A;  2INW A;  5HL1 A;  4IHQ A;  4ZJ3 A;  1G6O A;  4DE3 A;  5E2F A;  2EWW A;  4NKP A;  1S4S A;  3N7W A;  3ZQ5 A;  3G6O A;  3RXX A;  4KZ8 A;  3MZD A;  4BBV A;  2WAD A;  2HDS A;  3F1O B;  3M6B A;  4I3J A;  2HDR A;  3T4K A;  1JWP A;  1H8Y A;  1PFL A;  1K6R A;  2DCF A;  2OOL A;  3BW6 A;  4DDY A;  5HZH A;  1SDE A;  1XJ3 A;  3LR5 A;  5EPH A;  3ZNY A;  2M7U A;  1XP4 A;  2ZMA A;  2E8J A;  1I2W A;  3LIF A;  2VJW A;  4MBK A;  4WL9 A;  2HV1 A;  4PM5 A;  3UE3 A;  2PR5 A;  2V1B A;  2J9P A;  4C75 A;  1XFQ A;  1PYY A;  4WMC A;  3T4O A;  3BFG A;  2OLV A;  4JGP A;  4CQH A;  1WYB A;  1LI9 A;  1EW0 A;  3H7W A;  4KQR A;  3VE4 A;  1XJ6 A;  3HLG A;  3TW8 A;  1CK3 A;  3EGD C;  1ZG4 A;  5HFO A;  3GTC A;  5FAP A;  3DWZ A;  4E3I A;  2WAF A;  1BSG A;  2RCX A;  1NZU A;  4L9G A;  1HD8 A;  3A0R A;  3HJK A;  2CMN A;  4BJP A;  4JXW A;  3NDE A;  4JF5 A;  5F1F A;  4Z9Q A;  2Q0O A;  3FPV A;  3L9K A;  2I72 A;  1ZKJ A;  4GB7 A;  3G35 A;  4GKU A;  2WGW A;  4R70 A;  2WKH A;  2XFS A;  3LIB A;  3IHA A;  3MXR A;  4Y2F A;  4UA9 A;  2XD5 A;  5HAR A;  3R4K A;  5CHU A;  3TRC A;  4KQQ A;  3LEQ A;  2PYR A;  2H28 A;  4FTX A;  1MC0 A;  3T4Q A;  3MMH A;  2OAQ 1;  2XF3 A;  5D3O A;  3OZH A;  2ZLY A;  1YMS A;  3BM6 A;  4E6W A;  3ZGA B;  3Q07 A;  3KX0 X;  1Y4O A;  5FQK A;  5HDS A;  3O86 A;  3LEZ A;  3NOU C;  4RVA A;  2JKR M;  5DFY A;  3EWK A;  2WKQ A;  1M6K A;  3MBZ A;  4DF6 A;  2XD1 A;  3NC8 A;  2FFY A;  2Y8H A;  4E3M A;  3HRE A;  2JKF A;  4WEJ A;  1L0D A;  4OPR A;  4O0P A;  3IXD A;  3MKE A;  2QPN A;  2M1C A;  2WKI A;  3PHY A;  3SW1 A;  4X68 A;  4E3O A;  4QD4 A;  3QNC A;  3MFX A;  2UWX A;  4BD0 A;  5FAS A;  3U2A A;  4EBP A;  3DTK A;  1QMF A;  4X53 A;  3IX3 A;  2KLI A;  2ZOH A;  1TS0 A;  3SZT A;  4WBG A;  4RQ9 A;  3S7O A;  1HTZ A;  1PI4 A;  1F5M A;  4K0W A;  1YT4 A;  5HPF A;  2HDQ A;  1E3U A;  4WEK A;  3SH8 A;  4X25 A;  1XA7 A;  3CAX A;  4BBT A;  2Q9N A;  5HWW A;  3NCK A;  1CEF A;  1W5D A;  1YLP A;  1NYY A;  2K7S A;  2DMW A;  3PBR A;  3N8R A;  4BL2 A;  4ZTK A;  3W4P A;  1L0E A;  3UPN A;  1FCM A;  3MR0 A;  1K6S A;  1D06 A;  1H8Z A;  4CLC B;  2VK3 A;  2WZX A;  2VLG A;  4GS9 A;  1BLS A;  3BEC A;  1YAX A;  4FH4 A;  1VB6 A;  4KZ9 A;  2Y2N A;  1WA9 A;  2HP6 A;  1T1B A;  1W63 Q;  3NY4 A;  1S67 L;  1KGF A;  4HBT A;  1IYP A;  1MWR A;  1UWN X;  5KSH A;  2GJ3 A;  4DXB A;  4EER A;  1DY6 A;  2QKP A;  3PTE A;  5HWV A;  3IX4 A;  3G31 A;  3SS3 A;  4XUX A;  4B93 A;  2HJE A;  3G2Y A;  5KMW A;  4HH3 A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 1XFN A;  5AJG A;  1STZ A;  2KOI A;  3EOI A;  3H82 A;  1IOU A;  2YKH A;  3A0V A;  3S7N A;  5DF9 A;  3BY9 A;  4CLC D;  3UB8 A;  3LID A;  2J3T C;  5HD5 A;  1N9N A;  1NWZ A;  2KDK A;  3FC7 A;  3CI6 A;  1TF1 A;  4MN7 A;  2VV8 A;  2PHY A;  2KX6 A;  2VGL M;  2QJ5 A;  4R3A A;  4EEP A;  5J4E A;  1ZTU A;  2NUP C;  1ZHH B;  2G7U A;  3F1N A;  4F3L B;  2IA2 A;  4YNR A;  2JKT M;  2W3F A;  4MN5 A;  1OJ5 A;  3RH8 B;  1N9O A;  5HPI A;  5TJJ A;  3LR4 A;  4G3W A;  4P6Z M;  3PYP A;  2QYB A;  3C8C A;  1LSV A;  2W1T B;  2V0W A;  3LIC A;  4O01 A;  2B02 A;  2GNX A;  5J3W A;  3CUE C;  4HP9 A;  5DJU A;  3B42 A;  4IUH A;  2VV6 A;  3MQ0 A;  3OCL A;  3IS2 A;  3T4J A;  4JGO A;  2O99 A;  5AVF A;  4NXE A;  3E4P A;  3F1P A;  3H7W B;  4GHI A;  5K5B A;  4GCZ A;  3UB7 A;  2HF6 A;  5EFW A;  5I5L A;  2BAS A;  1MZU A;  1YSQ A;  2J80 A;  4ME4 A;  1T19 A;  4DN0 A;  5F68 A;  2B18 A;  5DJT A;  4EUV A;  1D7E A;  1G28 A;  3BY8 A;  4KQD A;  2JKR I;  2FZ0 A;  4MCW A;  2GX5 A;  2ZBB A;  2Z6D A;  4HQA A;  2A2L A;  4ETZ A;  1DP9 A;  2HGV A;  3ICY A;  4O8G A;  1GSW A;  4ARZ A;  2ZMF A;  2WKP A;  5DKK A;  2K2N A;  5C5K A;  3VE3 A;  3KSI A;  4CLC E;  4PKY G;  2OAP 1;  3MJQ A;  4BMW A;  2XRO A;  5TBM A;  1LT0 A;  4L9E A;  3H9W A;  3E4Q A;  1BYW A;  3LR0 A;  3HJI A;  3S7P A;  1T1C A;  2PD8 A;  5HWT A;  3LR3 A;  1GSV A;  2J3T D;  4MN6 A;  3D3O A;  2M7V A;  4WF0 A;  4CLC A;  1XJ4 A;  5FL3 A;  3PXP A;  4L0L A;  1OT6 A;  2VGL S;  3C2W A;  2W1R A;  4EEU A;  1S66 L;  1Y28 A;  2V9A A;  3PBN A;  4PHT A;  3GDI A;  2YKF A;  3PBO A;  4HJ4 A;  2LB9 A;  2W3G A;  2NUT C;  2XA7 S;  1OT9 A;  4NXG A;  2O0Y A;  4BBU A;  3EEA A;  3MQO A;  3R7W B;  4Z1W A;  1V9Y A;  4GLQ A;  5HDC A;  2VV7 A;  4I39 A;  3ULF A;  3T4S A;  4EU0 A;  4II7 A;  4H6J A;  4HHD A;  2JN7 A;  2VX8 A;  3K3C A;  5MC7 A;  4HIA A;  4E04 A;  2P08 A;  3E4O A;  3TJZ C;  2INW A;  3KO6 A;  4DMZ A;  3BJN A;  4IHQ A;  3NOT C;  2D02 A;  5J7E A;  1DRM A;  5AVE A;  1MKM A;  2A24 B;  3CIT A;  3LI8 A;  3PBT A;  1G6O A;  2EWW A;  4NKP A;  2ZOI A;  1S4S A;  4QPR A;  5HDD A;  3ZQ5 A;  1OTE A;  3G6O A;  3PBS A;  3P7N A;  4XT2 A;  4BBV A;  1F98 A;  3LFV A;  5F69 A;  4EXO A;  3HCY A;  3F1O B;  1UGU A;  2XA7 M;  4I3J A;  3T4K A;  2FH5 A;  3T4L A;  3DBA A;  3IBJ A;  2I9V A;  4KUO A;  3FG8 A;  1DP6 A;  1IFQ A;  2OOL A;  3BQ8 A;  5KIZ A;  3BW6 A;  3PR6 A;  2L1M A;  5HSQ A;  5HZH A;  1XJ3 A;  3A0S A;  3LR5 A;  1OTI A;  3KYQ A;  2M7U A;  3CWF A;  4IJG A;  1TS7 A;  5F6A A;  4Y3I A;  3LIF A;  3E0Y A;  1V9Z A;  4B9O A;  2VJW A;  1H3Q A;  1NRJ A;  5CX7 A;  4WL9 A;  2HV1 A;  4F3L A;  3UE3 A;  2OWH A;  2PR5 A;  4NEE D;  3MQQ A;  2V1B A;  3CLO A;  2R78 A;  1TS8 A;  1XFQ A;  4G3K A;  2GZA A;  3EGX C;  3T4O A;  3KSF A;  2W1T A;  4JGP A;  4CQH A;  3T4T A;  4K08 A;  4NXF A;  3B47 A;  2VKS A;  4KUK A;  1P97 A;  2P7J A;  2W0N A;  4GS9 B;  4I3I A;  2EWV A;  5G4Y A;  3UB6 A;  1EW0 A;  1TS6 A;  3H7W A;  3VE4 A;  1OTB A;  1XJ6 A;  1JNU A;  1LSW A;  3TW8 A;  3P01 A;  1TD5 A;  3EGD C;  4AFI A;  2JKT I;  4EQ1 A;  1NLY A;  3LUQ A;  2LB5 A;  3EQV A;  2V0U A;  1KOU A;  2J3W A;  1F9I A;  3NJA A;  2W3E A;  4L9G A;  4PAU A;  4EW7 A;  1OPX A;  3A0R A;  2CMN A;  3HJK A;  4Q0H A;  4BJP A;  1NLZ A;  4WLA A;  4JGR A;  4Y5F A;  3CUE A;  5DKL A;  3UME A;  3JVV A;  3E98 A;  2OWJ A;  3JVU A;  3FPV A;  5DFX A;  2L4R A;  2PD7 A;  1T1A A;  2VEA A;  5HL6 A;  1GSX A;  3GEC A;  4HI4 A;  1S1Y A;  2ZMV A;  3D72 A;  4R38 A;  2W27 A;  4LRY C;  2QJ7 A;  4R70 A;  3LIB A;  4Y2F A;  3H82 B;  3O5Y A;  4FOF A;  2D01 A;  3R4K A;  1P9W A;  4FSF A;  4ETX A;  3K3D A;  4R6L A;  2VZW A;  2W3H A;  3TRC A;  2W3D A;  1N9L A;  4I5S A;  2PYR A;  3V67 A;  5HD3 A;  2H28 A;  1MC0 A;  1P0Z A;  3BQA A;  2QWS A;  5F5Y A;  3T4Q A;  4WN5 A;  4EES A;  1DP8 A;  3MMH A;  3MXQ A;  1LSX A;  2OAQ 1;  3BWL A;  2WKR A;  3R7W A;  4LLO B;  4MDZ A;  1XJ2 A;  4WUJ A;  1S4R A;  3F1N B;  3KX0 X;  5HDS A;  3B33 A;  4JGQ A;  3EEH A;  2QHK A;  3NOU C;  2JKR M;  5DFY A;  3EWK A;  1S1Z A;  3S7Q A;  5A8B A;  3K2N A;  2WKQ A;  3LIA A;  1LL8 A;  5L8M A;  2P04 A;  2Y8H A;  3LI9 A;  1T18 A;  2A24 A;  4MMN A;  2L0W A;  3IS2 B;  4WEJ A;  4NXB A;  2JHE A;  4O0P A;  4YWZ A;  3F1P B;  4M4X A;  4GHI B;  2VA0 A;  4IUK A;  3VOL A;  4G3V A;  2M1C A;  3OLO A;  3PHY A;  2XSS A;  2PDR A;  3SW1 A;  2K31 A;  4HH2 A;  4LPZ A;  2XRN A;  3MFX A;  4OOM A;  1H8M A;  1VHM A;  3F1O A;  5IS1 A;  4HNB A;  3KSG A;  1YSP A;  3U2A A;  4HY8 A;  3T50 A;  4PKY A;  2KLI A;  2ZOH A;  1TS0 A;  2PR6 A;  4CLC C;  5LBR A;  4RQ9 A;  3S7O A;  1YKD A;  1F5M A;  1X0O A;  3OOV A;  3NOP C;  4GW9 A;  3C30 A;  5HPF A;  4ARZ B;  4WEK A;  3C38 A;  5IU1 A;  3RTY A;  4Q0I A;  1P9R A;  4HP4 A;  4LRX C;  5IT5 A;  2PT7 A;  2Y79 A;  4I3A A;  3CAX A;  4BBT A;  1OJG A;  5HWW A;  2K7S A;  2MJ6 A;  2DMW A;  3W2Z A;  3PBR A;  4YOF A;  3KSH A;  2HJ9 C;  4HJ3 A;  4L9F A;  5TBM B;  3MR0 A;  1D06 A;  3KYZ A;  3RFB A;  4UEY A;  4CLC B;  4Q0J A;  4I38 A;  4LRZ E;  2VLG A;  4GS9 A;  3PBQ A;  3UMD A;  2O9A A;  4UQI S;  1YAX A;  1VB6 A;  3OC2 A;  3EQU A;  3UE6 A;  4EET B;  1WA9 A;  2Z6C A;  1T1B A;  1W63 Q;  4HJ6 A;  1W63 M;  2O9B A;  4KQO A;  4GJ4 A;  3UB9 A;  1S67 L;  5G4Z A;  3TE8 A;  2EA9 A;  4HOI A;  4H6J B;  3LIE A;  3ZYT A;  3IBR A;  3OCN A;  1UWN X;  3MF0 A;  1ODV A;  4DJ2 A;  5KSH A;  3OBF A;  2GJ3 A;  2O9C A;  1OTA A;  4EER A;  2PYP A;  2QKP A;  3LYX A;  3FPW A;  1UWP X;  4ZRR A;  4OOL A;  5HWV A;  3NHQ A;  4BWI A;  4DJ3 A;  2V1A A;  4B93 A;  1OTD A;  2HJE A;  3VV4 A;  4XT2 B;  4P6Z S;  4UQI M;  4HH3 A;  4WEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...