2W3RA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 126
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3rA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3rA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3rA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3rA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3rA04
1T3QA 1JROA 1ZOYB 3NVWA 3AE2B 3AE9B 1NYQA 3D2HA 3A7UA 3D2JA 2E5AA 1E8GA 1RM6C 4C80A 1FM0D 3AE4B 4YT0B 1FFUA 3NVZB 1ZUD2 3P4PB 2WLBA 3AEBB 4ML8A 1W1MA 3A7AA 3EUB2 4HROA 2CJNA 3FW7A 1AHVA 4DNSA 3DWMA 3LB8C 2OAIA 2EKIA 1NENB 2GQTA 3I99A 1ZR6A 1UWMA 3FW9A 4PVKA 3FW8A 3L4PA 1NI3A 1FFVA 4TVWA 3AEEB 2QPMA 1E8HA 3P4SB 1TYGB 2VFRA 3HVZA 4ZOHB 4BBYA 2JQRB 2PVGC 4WWMA 1PFDA 5AUKA 5AE1A 1YQ3B 1V8CA 3NVYA 5HHZA 1QOFA 1XLPA 2W55A 2G1EA 4YSXB 1MBBA 1E9MA 2BT6A 3RPFC 4O95A 3AV8A 4EC3A 1NVID 4YSYB 2MJ3A 2Q4WA 4PYTA 3AM9A 2B76B 3AE6B 3WCQA 2VFVA 1B9RA 1R7SA 1CJEA 3SR6B 2WDQB 2MJEA 1JWBD 1NEKB 2H89B 5AUIA 3AE3B 1YJIA 2MJDA 1PUTA 3ETRB 3AECB 1J7AA 5G5GA 1DOYA 3HRDC 2BS2B 1RYJA 2P13A 3TX1A 3AB5A 2VFUA 3DWGC 2R2ZA 3HRDD 2MBRA 3BIID 3VTEA 1QLBB 1E10A 4JAYA 3AH7A 1AYFA 1WGKA 5GXGB 1AWDA 2BVHA 1N5XA 3BW7A 3CWIA 2FBWB 1E6EB 2K9XA 3LLBA 1W1RA 1E7PB 1VLBA 3NS1B 3NVVA 1N63C 5G5HB 1ZXIC 1T3QC 1RM6B 1FXAA 1DGJA 1L0VB 1SB3C 4BC7A 2M19A 5HMRA 2PLSA 1HSKA 3NVZA 1QOAA 4N58A 4PVJA 1I7HA 5FXEA 2BVGA 1YQ4B 1QF6A 2ACZB 5H8YE 1FFUC 3B2GA 2JX5A 1GPXA 1WWTA 2PKOA 2VAOA 2DWQA 1TKYA 1KFYB 1E0YA 4WQMA 3TSJA 3S1EA 1AHUA 2M56B 1WYGA 2YVSA 1FO4A 1N60A 3W8XA 2WQYB 5C2TB 3NRZA 1CZPA 3S1DA 1DIQA 2BVFA 1DOIA 1J7CA 1QOGA 1W1QA 2WU2B 2L83A 3VR8B 4PZFA 1F0ZA 1FFVC 1N60C 2EXRA 4LTUA 1FIQB 1AHZA 3AEDB 4HG0A 5FXPA 3DEDA 1FRRA 1DIIA 2WU5B 2PIAA 1RFKA 2L52A 4C7ZA 1JALA 3PM9A 3W8ZA 3FWAA 1FXIA 2BS4B 3SFEB 1W1OA 2AX5A 4HRSA 5D79A 1WVFA 4P6VF 1W1JA 1X2GA 3S1FA 4YTNB 1XLNA 3LAEA 3VR9B 3CIRB 3AE1B 1X2HA 1MBTA 5AE3A 2R8DA 3A7RA 2CJOA 3C0PA 2KMMA 2K22A 3SR6A 2Q85A 3B9JB 5AE2A 5MPOA 1JRPA 3AEGB 3LXFA 4PWBA 1EWYC 1I19A 4N6EB 1E8FA 1ZP0B 4XLOA 1TKGA 1OQQA 4JB1A 1VJKA 1JWAD 5G5GB 4TVYA 3FAHA 1QOBA 5EE1A 1GAQB 3AMZA 4IDIA 1VAOA 3D2DA 1FRDA 1N5WA 1N61A 1N62A 3AEAB 1SIJA 1WXQA 1QT9A 2QIEB 3B2FA 2PLIA 2MH7A 4PWCA 4US8A 4YTMB 2W3RA 3SFDB 3KJMA 3NS1A 1TJEA 2AXRA 3NVWB 5C3JB 1SB3B 2Q5WD 3P63A 3ABVB 4PVHA 2RK5A 3JS8A 1SF0A 3NVVB 4USAA 4YSZB 1W1LA 3HUIA 1IUEA 2VFTA 1UXYA 3VRAB 3AN1A 1TKEA 3S1CA 2DBYA 1NYRA 2WDRB 5FXFA 4PVEA 3DQ0A 1DZNA 4BC9A 1QLUA 1L5PA 1W1SA 4OALA 1ROEA 2HTME 1OFFA 1QLTA 2GQUA 4A9AA 4BCAA 2CU3A 3NRZB 2WDVB 5ADZA 2Y5CA 2W3SA 2VFSA 3ZYYX 1VDVA 1KF6B 1J7BA 1FIQA 4FXCA 4ZHOA 1FMAD 4UD8A 5H92C 2PVOD 5EE9A 4ZOHC 3W5VB 1DOXA 1VQZA 1YJJA 4YTPB 3PO0A 3VRBB 1F0XA 1XLOA 1WVEA 3AE8B 3NVYB 1PDXA 2LEKA 3W5UB 2O3GA 2N0SB 2W54A 2E3TA 4US9A 1RWSA 3R07C 1JQ4A 2OHFA 1JW9D 4ITKA 5FXDA 2WP9B 3AE5B 1E0ZA 1KRHA 3P4RB 4YXDB 3B9JA 5HQXA 3ETRA 3P4QB 3KWLA 2P4PA 3FC4A 1L6VA 2KAJA 2BS3B 3W9CB 5EE0A 3EUB3 2I0KA 1XLQA 1XO3A 1WRIA 4MLAA 4JWSC 2K5PA 4ZHPA 1OQRA 2H88B 1W1KA 3AEFB 2WS3B 1V97A 2QKNA 1L6UA 3W8WA 3GSYA 2P3HA 2QJLA 5EE3A 4C7YA 1A70A 3AE7B 4N59A 2NQWA 4JWUC 5G5HA 1N62C 1N61C 1N5WC 1N63A 4JX1C 1ZXIA 3TSHA 4KX6B 3P1MA
chains in the Genus database with same CATH superfamily
1T3QA 3DOWA 5D49A 1UGMA 7ICKA 2Z59B 3WAMA 4J6IA 3R11A 3GILA 1NYQA 4Q45A 1PYWD 1CK1A 4GGHA 2Y3RA 2ZJ5A 4Y2PA 3RH5A 2I1JA 2RPQA 4F5OA 3STPA 2L00B 5L1JA 1FEBA 3PTFC 4AYBF 2XK5A 4O5EA 4MJSA 1TYTA 3RNBC 1ZJNA 1RM6C 2HHWA 2KTRB 2BYEA 2L05A 3H9DA 5FR3A 4OO1J 4W9DA 5CEHA 3ZLZA 4WJOA 5J2CA 1NNLA 5AI4A 2JF5A 2QHOA 3H12A 4LJPB 5IDZA 5J8YC 3ZDAA 1O03A 2JEJA 9ICSA 1JMLA 2BWES 4GDLA 4A8EA 4GDKB 3EUB2 3GE8C 2X8CA 4EQXA 2F77X 4MGZE 3PT2B 3ONNA 2EKIA 4CHKA 1V9JA 4F5NA 3ZDDA 3KWVA 4QAYA 2KQ7A 1XF5L 1FEAA 3THVA 2KIVA 5K4LA 2GGHA 2KHQA 1D6EC 5ALUA 4M6WB 5G2NA 5AKXA 1PDYA 5ALYA 1S0OA 1YT3A 3MC9A 1MDRA 2FNJB 2Z0DB 5J2BA 3FW9A 2BPFA 2BYVE 2KNJA 2KN7A 2GB1A 4IM0A 3FW8A 4ICVA 3LYYA 4XRHA 4A90A 4KT2A 2K4HA 1TBEA 2MA1A 1IP9A 2KVRA 4WJNA 4I2HA 2R8GA 2NCNA 5DCNA 1TYGB 2VFRA 2D10A 2Y9TA 2LGYA 2V9HA 1JCTA 5CHGA 2K8CB 4PZOA 3PR4A 4WH4A 3N4MB 5KHQA 1K52A 3KD3A 4GYPA 4G11A 2V1YA 1IPGA 4GLXA 1BPXA 1K8RB 2W8LA 5KVHA 1I4QA 2JZBB 5IINA 2QJJA 4A8XC 4BBYA 3JW0X 2BGFA 2DW7A 2GR3A 3UMBA 1UCVA 2KC2A 2V3PA 4GGQA 1EBDA 3V3WA 1F44A 1WXSA 4FJZA 4BGDA 3UJEA 1MHHE 2XH4A 2CHWA 4ZRPA 4Z6EA 4RFBA 4XC2A 2I2YA 4M0XA 2O6KA 1FNVA 4C4SA 5AE1A 2WPCA 1XSNA 1WH3A 3KVFB 5J0RA 1TYPA 5E6OA 4W9KA 2PCEA 3NHEB 2P35A 1DK2A 1ECWA 5DDYA 3TWAA 3RBDA 2BZFA 9ICFA 3HM3A 2LZ6A 3AU6A 5AWVA 4UAUA 1E9MA 1V86A 2AWTA 2BT6A 3DCGA 3PX6A 4O95A 1V81A 3VC5A 4RQNA 4GMVA 4ARIA 1TK5A 3SMVA 8ICVA 2MJ3A 4F7ZA 2HZGA 2QB0A 2Q4WA 2P8CA 9ICJA 3QC8B 2QGYA 2QSDA 9ICIA 2F8LA 2F44A 2KACA 4I6PA 5BPCA 1L2NA 2FCNA 3W1SA 4WIPA 5KG5A 4DF8A 4HLEA 3W2DA 3T5HA 2AYOB 5AKJA 1GERA 3T3FA 5LNK1 2LUMA 4OW0A 2NRZA 2WDQB 1LV5A 4P4MA 4R8UA 3D2SA 8ICNA 1NEKB 4YVZA 2H89B 2HDEA 5AUIA 2BDPA 1KN0A 1DXSA 3H7IA 1D5ZC 3AE3B 1YJIA 2DZMA 4EZ9A 4DXFA 2PS2A 3ISBA 3KZIU 1TVAA 4XGAB 5IIJA 5CRXA 5IN7A 2JEGA 2P13A 4A3OA 5ALQA 3M95A 3AB5A 4M9HA 4NJ6A 2BKRB 2YVGA 5J04A 1X6JA 1VRAB 3RAQA 1VR9A 2A19A 5KG0A 4KSLC 4C4RA 3H7SA 4KKIA 2ZZPB 1SZPA 3OG5A 3DV9A 5AM2A 2V3BA 3I4KA 2KE7A 4F5RA 2NS5A 2RDHA 2OH2A 5CB1A 1F3PA 2VIXA 4ED7A 2HDOA 3ISCA 4KLSA 9ICNA 1AYFA 1WGKA 2WXGA 2LMRA 3RB4A 3CW2C 4LVSA 1SJHD 4OZCA 4MELA 4LLGM 1XCTL 4NLKA 4H83A 4A35A 1ZXHA 3GV8B 3AXCA 4BVUC 2OVLA 3GRSA 2A3VA 4ED0A 4PPXA 1E6EB 5J0YA 2X38A 1HTQA 5B66U 1W1RA 2TSSA 3LLBA 4L1BA 1E7PB 3EGRA 3PHXB 3QARA 3UQBA 1RYRA 1SWWA 2NTTA 2N9XA 3U8ZA 1VLBA 3UIOB 1ZDXA 4N9F4 3NS1B 2AQ3B 1S5LU 2OJWA 1N63C 1KFDA 2F5ZA 4NJ7A 2BGWA 2WFAA 2GGGA 1S0VA 2IBIB 1FXAA 3MR3A 4RT2A 1UA1A 4XE0A 1P48A 3M6ZA 2AGQA 1L0VB 4BC7A 3U30A 1I4PA 2E1FA 5J2GA 2H3ZA 4DSLA 2M19A 5HMRA 1PZNA 3BVZA 3VHTC 1MRAA 2LMCA 2AQ0A 2MAXA 4Y2XA 3WK4A 3IG3A 3QWZB 5FXEA 4DXKA 5KFHA 4F5PA 4ECRA 1N56A 2PTLA 1QF6A 4MJSB 2ACZB 2HBKA 4CQNA 4LNFA 4H4ZA 1T0QC 4HKZE 4LNOA 3ZNID 3V62A 1GETA 9ICOA 2MLBA 4GDLB 4WQMA 4Y2JA 3FCPA 3GD4A 2KZ3A 2NYVA 2KDFB 4DOBA 3GZNI 4EQWA 4HCDA 5C23A 5ALZA 1UD7A 2ZIWB 1WYGA 5JXVA 3G6VA 1AHUA 4H4YA 2YVSA 2PJHA 2UVVA 2WQYB 2GBMA 2IGGA 2MWSB 3NRZA 4OJOA 5DB7A 2HHUA 2IHMA 2WF5A 4C8LA 3RR1A 1MVKA 3EW9A 4FS2A 4I27A 3BZDB 4JLCA 1JXLA 5HHHA 2G0AA 4RF1A 1P1AA 1DIQA 1DOIA 2BVFA 4EMWA 3FJ4A 3DBLB 4B6JA 2WU2B 2ISPA 3NZUA 4J9QA 4GXJA 3CRXA 4FHKA 4I29A 2L83A 5T8IA 2KD1A 3V60A 4DQPA 4PZFA 2OO6A 3H70A 4UBBA 3KH0A 2RSUA 1CI4A 3J81j 1NJXA 3I5JC 4ANUA 3A9JA 4TUUA 4K4GA 1TK0A 1C79A 3RNAC 4NEVA 4F4WA 2L76A 1SXTA 4C00A 4WAFA 2EH9A 2AL1A 2CR5A 1LGRA 4HG0A 3ZKJC 1TAMA 4ICAA 4F4ZA 4B9MA 3IM1A 3VAWA 4DL6A 4FFDA 2LASA 2PIAA 1C76A 3FYYA 4HYKA 5ALXA 2XBBC 4FJYA 1VCBA 1JALA 3ENEA 3UXLA 2D3BA 5AKKA 2KWCA 3UIPB 3JZUA 4NQLB 2ZIVA 4U6PA 1IBXA 1GUAB 3JVZX 1IV8A 4DQSA 1JWMD 3NJTA 4JIOU 4ADWA 2OM6A 4G8TA 5KFWA 5D79A 2OKTA 4KLLA 1WVFA 1SSNA 2OZ3A 2RQ5A 1N2XA 1ZQSA 8ICJA 4YTNB 2KC1A 4ELUA 4AOFA 1JPMA 1NHQA 4OJLA 4PZNA 3CIRB 1KEJA 5FS8A 3Q3NC 2LYHA 1X2HA 2GR2A 3LADA 5FS9A 2RHFA 3OW1A 5DGBA 1TGZB 3DEQA 5KFPA 2ZNVB 4MHVA 5AE3A 3EHVA 4S17A 4EX6A 1OEYA 4EEWA 1LVLA 1ZQUA 1QQ6A 2CJOA 4KVGB 2R8DA 1JX4A 2W7PA 4C8OA 1L7NA 3ZDCA 1GB1A 1RQLA 2G3QB 3SR6A 2K22A 3EF6A 2QB0B 1ELSA 2BCPA 4KPLA 1TT5B 1PDZA 3PW7A 2KFZA 4ZYNA 4GU2A 1WGGA 4IM3A 1AQ6A 2H3IA 2RLTA 1EWYC 5J0TA 4N6EB 1OGWA 2LJ5A 1ZP0B 1KLGD 2POZA 4MGIE 2XCPA 4DL5A 2NVKX 4R8UB 4M8NA 3CB3A 2NRWA 2Y5PA 1VJKA 3Q3OC 3NXLA 2B21A 2MEKA 2QCZA 4P0QA 2EELA 2GI9A 2VZKB 1ZQOA 1KTQA 3GD6A 3ZLFA 3R8BA 2PU0A 2BCRA 8ICOA 3TWBA 3PZ7A 1FNWA 4Y2UA 2L5YA 1WI0A 1UF0A 4ELTA 5DQHA 3QEBZ 4H2HA 1ZQZA 5J2RA 4A3PA 1TAQA 1WXAA 4EZ6A 3IRUA 1WXMA 5AK6A 2NVUI 3Q8CA 1BXTA 2C7NB 3IK4A 2MH7A 4PWCA 2D8CA 5BYSA 4DQOC 3QAQA 2AEHA 4JWMA 4E3CA 2KTQA 1D7YA 3RJKA 2J0JA 3SFDB 2O56A 3NASA 3VUYA 3ZLHA 2YMLA 4NV0A 1TJEA 2HD5B 4B9TA 1C9FA 2DF4B 4OD0A 3JPOA 3RB3A 4LNKA 3NVWB 3UMCA 3DK9A 1SB3B 2MHJA 3J9CA 4MH0E 2E8OA 3P93A 4PS7A 4REZA 2M0NA 1TS4A 4EOYA 2MRPA 3RD2A 3DG3A 2IHNA 1OXJA 1HA5A 3A4SC 4M52A 3PW4A 2HBMA 4B9LA 2C3DA 1W1LA 3QPEA 2I5HA 3FM9A 3LVWA 2W7OA 4PHEA 2AL2A 2D3GA 3LB8A 3MFGA 4KMOB 5GTIU 1NK9A 1UXYA 2P3ZA 4O3OA 1Z2MA 2ZPNA 4DYEA 3WKAA 2JRHA 1XDIA 3THUA 4BXOA 2PI4A 1UUPA 1ZQVA 2QJMA 4KLTA 3RAXA 1S3SG 3IT4B 4ED6A 2JU6X 4YG2A 2UYZB 5FXFA 2K8BB 2LPEA 5ALRA 3HP6A 5HR7A 2RABA 4NEWA 1P9DU 2WP6A 3WKCA 1SJED 1WXVA 3ZD9A 3DHHC 3H1UA 5CTRC 3X23A 2N4FA 1SJAA 4P4OA 1L5PA 3BQ2A 1P7EA 2NBWB 2RDXA 3LJ3A 2G4SA 4XA5A 5KFGA 1OFFA 5JCIA 2LKYA 1Z5SB 5D3DA 2GQUA 3L5OA 2HOIA 4CGZA 4UARA 2I1KA 3QU2A 2IA6A 1V1PA 3PVXA 4PL2A 1SE9A 3NRZB 4HCLA 2VKQA 3I6EA 4PGXA 4PYUA 1MJDA 5DB6A 2LRWA 4YR2A 3WANA 2EKEC 1LO5D 1J2MA 2KVCA 3GY1A 3GV5B 4ED2A 2BQUA 3RYTA 2ASDA 4DL4A 3C23A 1FMAD 2WAQF 1BPYA 2J6SA 3ZVHA 3SSZA 5H92C 4DHZE 5EE9A 4TSSA 1KN5A 4IC9A 1VQZA 3PVLA 4YQWA 2KZMA 4DCCA 2K0PA 2JWZA 4UB6U 4DL2A 2GGJA 4FHJA 1L3VA 1XLOA 1AROP 3MR5A 2R8IA 2MRLA 3C21A 2IO3B 4JGHB 2EANA 2AQ1B 3X0WA 8ICHA 4E4FA 2XICA 1L7MA 3AE8B 5FJRA 3OJ4B 5DB8A 3NVYB 3EWAA 5L1KA 4J9KA 2KJ9A 2FLPA 1RZTA 1BVSA 2OJRA 4NAWA 1YIWA 2MBQA 2LXAA 2YVJA 9ICAA 2W03A 5TR3A 1ZX9A 2O3GA 3SEIA 2W54A 5ALOA 3KUDB 1EBHA 3V4BA 2E3TA 4GC7A 2W9AA 4PGYA 2ZW0A 3DG7A 4WWPA 4HKQA 2QAEA 1RWSA 1F1HA 4UB1A 2KJRA 1JQ4A 4JB3A 4UAZA 2OHFA 1JW9D 2KFKA 4ITKA 3LWMA 3WK6A 2KTFA 2NRVA 2LGXA 4R3DA 4GLSC 4F92B 2ZTDA 3SBFA 3SN1A 3DBHB 2AJQA 4DF4A 9ICXA 1KRHA 2QDEA 2ZC8A 4J9OA 3P4RB 1S7MA 2KDEB 4DHJB 3B9JA 2ICIA 4DOAA 3ETRA 5HQXA 5KHOA 3RR7A 3IV6A 3R7QA 4II3B 1Q3VA 2DYOA 3T4WA 3FC4A 4O3PA 3PGEA 3F2BA 4F5QA 5KT6A 4GSWA 2BQQA 2MQJA 1VZ7A 5EE0A 1QILA 5AI9A 3W9CB 3D2QA 2CN1A 1MQ2A 4NY0A 1XO3A 3S6JA 1X40A 4PHDA 1V1OA 3O13A 4FBJB 4MLAA 1NPXA 3BVMA 2K5PA 4F4KA 2PTZA 3A0HU 3Q45A 2PEAA 4EYIB 2FCSA 1OQRA 1KDHA 1ISNA 1W1KA 4EE2A 3AEFB 2YB4A 1LM8B 3EFUA 4ANVA 3EEZA 1HEZE 1ZQCA 2YY6A 2QKNA 2HI0A 3W8WA 5IIMA 3GSYA 5I4DA 4J9PA 1XT9B 5EE3A 2FKPA 1YX5B 2KT7A 3ZXVA 4ECXA 1A70A 2EQ7A 1XCQL 1ZQRA 2ASJA 1ZQPA 2NQWA 2A4ZA 1DNCA 3ENLA 3RT3B 2DKXA 3BOXA 4OZBA 2C9WB 1N5WC 1ZQXA 4BUGA 5J2FA 5ALNA 3PSEB 3TSHA 3P1MA 2XY5A 1IG6A 3DG6A 1JROA 4LA1A 2WF8A 1ZOYB 1OJTA 3AE9B 5ALSA 3AE2B 5C0YA 3A7UA 1NJWA 4QWAA 3SAHA 2AL6A 2LI5A 4GN1A 3DPDA 1MDLA 3D2JA 2EAMA 3OAWA 2E5AA 1L5UA 3QA8A 2ZVOA 4L23A 2HVIA 1U48A 1YEYA 1SJCA 3QXGA 1MQ3A 1A5RA 3O0FA 9ICMA 2WHEA 3H4KA 4BWMA 2HQMA 2PFOA 1EWCA 2DAFA 5J2DA 4YT0B 1FFUA 1BT0A 3KW5B 2XO7A 1WGRA 4I2JA 1C3TA 1MFWA 9ICQA 4BZAA 2ZJ8A 4CDGA 4I2FA 2WLBA 3AEBB 8ICFA 1BPEA 2J7QB 3RNCC 4ML8A 1KKRA 3CK5A 3RRHA 4YMMA 1ZQBA 2P8BA 5AKHA 3I28A 1CQVA 5FP0A 3T5JA 2E8NA 1TY0A 1AHVA 3V7LA 3DWMA 9ICTA 4DNSA 5GRTA 2OAIA 2OXOA 2AL2B 1G6JA 1FECA 2PP0A 4G3IA 5HP4A 2OG9A 3VQIA 1L0YB 3K4GA 3PW0A 2BDUA 3UJSA 4LZDA 1F9JA 4BXOB 5JHAA 2OQHA 1S8OA 5J0OA 5AI5A 2AQ4A 4OVVA 3IJQA 1WUFA 4Z1YA 3WIMA 3ZLGA 4LDTB 5HNKA 2DQNB 4LNIA 3A33B 1NI3A 2LGIA 3M63B 5ENLA 1FFVA 2LVOA 4GYPC 1LPFA 5JZEB 3GDXA 3C29A 2JT4B 1KOTA 4IQWA 2DL0A 1KM7A 2G06A 5FMHA 2KP7A 3V05A 4H4VA 3HVZA 1U45A 2I9GA 1L3SA 1NDDA 3SD5A 9ICGA 5CP2A 4J9NA 1PGXA 2KMDA 3FVDA 5A0LA 2FE9A 3NUQA 9ICKA 1ZD3A 5IIIA 3T5KA 8ICIA 1RFAA 1V1PB 2NPXA 4NLNA 2KD0A 1C4CA 1WJNA 1X9XA 4ZOHB 1S9FA 4GIBA 2J3NA 2DENB 4IWPA 2V4LA 3EJEB 4ECZA 1S0NA 4FZLA 1HTOA 2WXLA 4KLOA 4WWMA 4HJKA 4IQTA 4YR0A 3WU2U 5KT7A 4DL3A 3ES8A 3ZVHB 5D3IB 5AUKA 1WJ4A 2LHTA 2FPMA 1UHUA 1YQ3B 1V8CA 5AICA 2HTHA 3R3MA 1KW4A 4UW9A 3RN9C 3DERA 4EYHB 4WQOB 1KKOA 3EECA 2CRXA 2G1EA 1GEUA 1XU4A 1ZDVA 1I42A 3EC8A 1X2IA 3TANA 4MFAA 2K8AA 1SKSA 3AV8A 2FAZA 2YMQA 3UXKA 2PMVA 1ZMCA 4HNCA 1NVID 3WKBA 1NKCA 4QIWC 2DZJA 1AW7A 2KKVA 3TADA 2ONEA 2X8GA 1HE8A 1WMHA 2WXPA 2F8KA 4AS1A 2JVCA 1FHUA 4NY8A 4M9JA 3IAM1 4FBUA 1NKEA 1P0RA 2KFKB 2ZNVC 1ZXIA 3TCAA 5BMHA 1F0XA 2VFVA 4KN4A 3KHHA 4RQMA 1WX7A 1QZEA 1RVKA 1PUZA 1JWBD 3KHRA 2GR0A 1MN8A 2ZUDA 2R18A 3D32A 4JQWC 2YVFA 1ZQFA 1PUTA 4Y2YA 2L0TA 3ETRB 3AECB 2ZIUA 2YN4A 2JSVX 2WXKA 1ET6A 2Z8LA 2BS2B 4P1CC 3Q14C 4XYCA 1MOKA 2IY1B 4MGYE 2GH1A 2JXTA 5AI6A 1ZQMA 1BKHA 3TX1A 4F4XA 4JN7A 3PX4A 5AEKB 4AYBC 2PFPA 4K4IA 3HRDD 3B1LX 3VFKA 3KLJA 2BPSA 2CDUA 3RF9A 3ZNZB 4J9SA 3VTEA 5KT5A 3Q8FA 3RITA 2CHRA 3HILA 2VH2A 1ZKQA 2BB5A 4YP3A 1I35A 4Y2SA 1MUCA 2D6FC 1T7PA 4MF2A 4KSKC 4DBGA 1UGJA 5F9NA 1SV0A 2W43A 4ACFA 2IPKD 2HBLA 2KOXA 4Z6CA 2ISOA 2RDGA 3BS5A 2XY7A 3BW7A 3SN0A 1RRBA 4QZAA 2FBWB 1E7VA 4IZGA 3H4BA 4B9KA 1UPHA 3TJPA 2EAPA 3PSFA 1D8YA 4DSKA 3OGUA 3PO4A 7ICFA 2UWQA 1OTRB 5KTQA 3G6XA 2BB6A 3FILB 2ZXHA 4AWJA 3UI3A 3NVVA 3QUQA 1KQQA 5KFBA 3CXOA 5DBBA 4S0RA 2F1JA 2KN4A 4FP1A 4K7UA 4DNAA 1NK7A 3KOOA 1LKYA 1YOVB 2RDBC 1L8PA 4GC6A 2BQ3A 3VXWA 5CHFA 4ECWA 1U4AA 4TQRA 3WA0A 2FJ6A 2HCFA 3PR5B 2RDIA 1SB3C 3GQCA 2KZZA 3K9PB 2GBRA 4EZKA 2PLSA 4KLGA 4CRXA 3NVZA 8ICSA 1QOAA 3A4RA 1HSKA 4JHMA 4W9EA 4PVJA 2EQ6A 1I7HA 1WX8A 2O6VD 3MABA 3RJ8A 1WUDA 5KFKA 3OJUA 4EEKA 4F8RA 3DBLI 5H8YE 1ZDLA 2OWOA 3GD3A 3B2GA 3N6JA 4ROPA 2B3AA 1GPXA 3BWUD 1WWTA 3MDCA 1OQYA 2DWQA 2VAOA 2PP3A 1YN3A 1TKYA 1L7OA 2WXMA 4FE3A 2J6UA 5DPTA 4GXKA 4YWGG 3AU5A 2DYBA 4RF0A 2WP5A 3MJ5A 3TSJA 3S1EA 3UJFA 5KFYA 1ESFA 4H2AA 2M56B 2PGWA 4RQ1A 1N60A 5KG7A 1T0YA 4M0WA 2ATLA 2N9LA 4BKTA 1PQSA 1ZGUB 1NHPA 2WXHA 1TE2A 4KX3A 3PLVA 4C8KA 2GH5A 4HYRA 2WB1F 4DFMA 3RJEA 1RYSA 4M01A 1CEZA 4UAVA 3MWCA 2AKMA 2JH7A 5GTHU 4NLCA 4Q8EA 9ICUA 1EO6A 1L4DB 4J9RA 2UVUA 4TURA 2D3DA 3L8KA 3Q8QB 2EXRA 3EJBB 4B9NA 3R10A 4J3ZA 2M8SA 2UUVA 5I1WA 3T3OA 2LJIA 1Y8RC 3DFHA 4F72A 5J2EA 2J4XA 4PJ0U 1FIQB 3AEDB 1ACCA 1WE7A 5AI8A 2UU7A 2YEPF 4ACOA 2A1JA 4G3XB 1X66A 4M02A 4BV6A 3QX1A 4ZRKA 3DEDA 3SENA 3DJGX 4Q44A 1JI7A 3U4FA 4Z6DA 4W9HA 4IRKA 4NAMA 1UELA 1QKZA 1SL1A 3E56A 3PM9A 3W8ZA 3E58A 4IRDA 2IO2B 2BS4B 1D5XC 1SWVA 5HHDG 4E5TA 4HRSA 4YFKA 3U2SC 4BURA 3GIJA 3POPA 1K4QA 4QWEA 3K75D 5KAIU 1WZ0A 2ZCBA 5FR6A 2WU5B 3KYDD 4AUQC 5L95C 1W1JA 9ICRA 1X2GA 3DDHA 5JRTA 4CE6A 4JK1A 9ICBA 4BBNC 4F50A 3ZGZA 3T9PA 2N1VA 3LAEA 2FI1A 1EU4A 2CU1A 3VR9B 2QVHA 4CYEA 3AE1B 3H0RB 4A55A 2JUOA 3BQ7A 3C28A 1RXWA 3DDCB 1KFSA 3V3XA 1MBTA 4UBCA 3DK4A 3QJZA 1V2YA 1QQ5A 2VA8A 1WCLA 2KWDA 1UNSA 3C0PA 2EMTA 5KG4A 2MBOA 3HX0A 1Y56A 2BTEA 1F9CA 1WMHB 5DB9A 5D2MB 1X42A 2IYDB 5MPOA 3N1YC 4NWIA 3AEGB 2ZCCA 3LXFA 4BAXA 4K1WA 4NL9C 1V5TA 2WHIA 1GRAA 2DLBA 4K7ZA 4ECVA 1E8FA 3H8WA 1NJZA 3IJIA 1KJTA 3PPAA 1R6WA 3S47A 2DPIA 2NBUA 1TKGA 1OQQA 1JCKB 2MSED 4JB1A 2YB1A 4UB4A 4HN8A 3HVDA 1BZLA 1ZY8A 4DEZA 5BMGA 1WYWB 3ED5A 4O3RA 2WDTB 1QOBA 1Z4NA 1VAOA 2BR0A 3AMZA 2PPHA 4IDIA 1TFRA 8ICAA 1P7DA 3OTQA 4RZRA 1SV4A 4KDIC 3VDZA 2PODA 2Y08A 3PRMB 4Q2JA 4EBDA 7ICLA 1X9MA 2LVQA 4DO9A 2R2OA 5AHXA 1N61A 2G5IB 3AEAB 4HPMB 4FA6A 1KBUA 5J17A 1SIJA 2UUUA 2Y1IA 3OWEB 1K5OA 2LVPA 1FNUA 4MMWA 7ICJA 1NU5A 4NJ8A 2KK8A 2WXOA 4OJ5A 4YTMB 1QSSA 1GJZA 4HVBA 7ICPA 4DS5A 1XO1A 5CX3A 3WALA 2FDRA 3P3BA 2W9BA 3SZ2A 3V61A 4M6UA 4O9MA 4MEXA 1H4RA 3L3FX 5E79U 2R2QA 3BS5B 2AXRA 4UB3A 1Q8KA 5KFNA 1ONFA 4IHCA 3UCDA 1COKA 3MR2A 1QQRA 2ONQA 3P63A 3ABVB 1ZETA 2XIDA 1XSPA 1RAXA 2RK5A 3A1QA 1GREA 1TZZA 4ELVA 4QZGA 3ZDMC 3VC6A 2XK5B 3NVVB 5JUMA 4USAA 1NJYA 2EZYA 3G6YA 4KMUA 5J8YA 2ASQA 4KLEA 2WPEA 4IP5A 5EOZA 1TZ1A 4LCDE 1LKYB 3QZ7A 5ALJA 3MJWA 9ICEA 5ALVA 4QNLA 3NFUA 1ZQJA 3DBRB 3AEVA 3V6KA 3SJNA 4EX7A 3EANA 2OZ8A 2WXQA 3ZTCA 2IMWP 3RR8A 8ICUA 3V6HA 5TSSA 2RPVA 1NK4A 1SEBD 1V80A 2MBEA 5BOMA 2HJ8A 1B4FA 3I6TA 1X6IA 4UB5A 4RM9A 3TTEA 3ZUNA 2OZTA 2JGAA 1Q5WB 2DBYA 1NYRA 5DG9A 2W9NA 5LLIA 4KX5A 1TZOA 2AH5A 3PV8A 3DQ0A 1KKXA 4F4YA 1DZNA 1JIHA 1FCLA 1QLUA 4IW0A 1FXTB 3UF8A 5ALLA 4KLQA 2NR2A 5ALWA 2AGOA 2D11A 3NTUA 2Y3AA 3L17A 4II2B 4AJWA 3CP8A 3ZI4A 1ET9A 4J9MA 3BQ0A 2QEJC 3AH7A 3MUCA 5FK9C 1IYFA 2EZZA 2N7JA 3KFUF 1Q0WB 4DLGA 2Y5CA 2PLPA 2VA2A 4DL7A 3TEXA 3DGBA 3EAOA 5L6GA 1VDVA 2YLMA 4ECUA 2NBVB 2IGHA 4RQ3A 5L1IA 2RGFA 4OVUA 3IP4B 4EENA 1J7BA 3L54A 3VUWA 4KPRA 1A77A 1D9DA 2W0HA 5E6PA 4ZHOA 1M6IA 4UD8A 2OLAA 1NZBA 2WYQA 3CGEA 4NPNA 5DDMA 4ZOHC 3W5VB 3IG8A 5KFEA 1YJJA 4W9CA 2R61A 3DBHI 3NOBA 1FEHA 3KKAC 3R2IA 3BZKA 2A1JB 1HXYD 2FCQA 3VRBB 3VTUA 4EBEA 4K1RB 4TV3A 2WX1A 5DBCA 5BOEA 3N32A 3VUXA 2N7EA 3QQ8B 1ZMDA 1UT8A 1NK6A 3VTVA 4I2DA 4IR9A 4J3OD 3FDSA 1BQGA 2P6UA 1GRGA 3URYA 2LEKA 3RTVA 8ICPA 4US9A 3PX0A 2KWUB 2YQUA 1XHCA 3ISDA 5FKAC 3R07C 4UAYA 5HMLA 4MT5A 1XSLA 1LXDA 3RJAA 3QZ8A 3N3KB 2J0MA 2WP9B 2L7RA 1D8LA 1YJ1A 3L16A 2LGDA 2EZXA 3NRWA 4P1BC 3Q6JA 3JPSA 2YMPA 4IWQA 1LVHA 4F71A 2CHXA 2CPRA 4ED8A 3EA6A 4Y2TA 1E0ZA 3PLUA 3HW8A 2WXRA 3P4QB 3SV4A 4HDQA 4E0DA 1ZRMA 1GSNA 2K25A 1WG8A 1NK0A 3KWLA 2P4PA 2HXUA 4MM3A 2KWVB 1Q1WA 4O3QA 4IG7B 2Y9UA 2KANA 3WK8A 2KAJA 3L5KA 3PW2A 3PO5A 2V3AA 3EUB3 4NQKE 4KKJA 4C8NA 4I2CA 5AK5A 4JWSC 2VJ5A 4YCXA 4J03A 2JWUA 3OLMD 4IL2A 2K60A 3AU2A 5D46A 4IOIE 2VRRB 2XY6A 2FMSA 1MG8A 3IAS1 4GIRA 2H88B 4RQ2A 1RQNA 3H0LB 3BQ1A 2I1QA 1V97A 3ZJVA 3OHAA 1K53A 1L6UA 1PK3A 3U4EG 2XGZA 2QJLA 2FIDA 3S5SA 1YD8U 4RQ4A 4P0PA 3AE7B 3MC8A 4N59A 1DXLA 5J18A 1NDAA 1Q46A 3BS7A 4EMIA 2ZEQA 2FMQA 4L2YA 4O1NA 5G5HA 1N62C 1N63A 2GWSA 2K3UA 4KX6B 3I3TB 3Q8AA 1R4MB 3C2KA 2ZJDA 2YX8A 2DNFA 4YXJA 4XDDA 3D2HA 1JDFA 4ZCWA 2BVCA 1C78A 3GU3A 3D6JA 1E7UA 4W9LA 4EFOA 1Q1RA 4W9FA 2KDIA 4QZEA 2HMXA 5KAFU 3KLSX 2L32A 1V5OA 3KYCD 3RZFA 4TUPA 1JOAA 3E2EA 1YN4A 4ECQA 3URHA 3HHMA 1IIPA 1CUKA 3V7JA 1CRXA 2H3VA 4RM8A 2LGSA 4M2YA 2W04A 5BOFA 1GC7A 4JV1A 3APDA 1VD2A 3C1YA 4RGMA 1R0MA 3R0KA 1ZUD2 4H1ZA 3A1QB 2OOBB 4NLGA 3P4PB 4RQ5A 4K7WA 2BKEA 1C77A 5AKLA 3Q2AC 4HROA 4A20A 1RLFA 4K8DA 5IKCM 3FW7A 2YEPB 3VTWA 4APNA 5AKZA 1O08A 4RGNA 3GC2A 4A6GA 2K8HA 3MGVA 8ICRA 4M9LA 1WX9A 1SXEA 4RPYA 3PWGA 3R1ZA 5AI0A 3SD7A 2WAQC 3KUMA 2PMQA 4E6MA 5IO9A 4EQRA 2HBJA 4UDUC 2L3ZA 2GQTA 5KFQA 2ON8A 1GOZA 5KG6A 5B5EU 1SE3A 4PS8A 4WWOA 3VVWB 4URKA 2BC0A 3H8HA 4TUSA 1UWMA 2NO5A 1BPBA 3H7PB 4K3CA 1HUOA 3N30A 5ALHA 3L4PA 2FUHB 4UASA 2KV2A 2J53A 1F0MA 4W9GA 1E9IA 1H6VA 1UA0A 1FCCC 5DG7A 4GISA 1E8HA 3NUHB 2JEIA 3SHQA 5J2JA 1WSPA 2JZZA 4H4PA 4G9BA 2Q4TA 3R66C 3ZTDA 4M9NA 4HEA1 3AUOA 4F4RA 2OFJA 1E8ZA 3A9JB 2HOQA 2GBKA 4IP4A 1C4AA 2PI5A 1C20A 4UB8U 2LYBA 2H3FA 1YNTE 1UQVA 2F3NA 5KL8B 3HM6X 5EWEA 2C2EA 2XH2A 3SQPA 4C8MA 2JQRB 2XCAA 5J29A 3JSVA 3ES7A 2ZW1A 5KG3A 2GRIA 2QQ6A 3K1ZA 3IVFA 2JHDA 3TCSA 1L3TA 3K9OB 4YD1A 5DQGA 3TSSA 1XNSA 3UINB 4BKSD 2KIWA 2N1WA 7ENLA 2ZIVB 1IBXB 3PSIA 2KKCA 2I5QA 3D46A 5HHZA 1QOFA 4KZ0A 5KFCA 1XLPA 2DHZA 4EQSA 1KTKA 3ML8A 2REXA 3BZCA 2Z7JA 3VH4B 5CA7A 3RPFC 2KX0A 4UQGA 4RGOS 3SU8X 1ZQ1C 2INNE 2QB1A 3DESA 1QTMA 2FUG1 1GESA 1L8LA 2IY0B 5AKEA 4MFFA 7ICNA 2M17A 4H19A 3EFCA 3SYZA 2ESEA 4HNLA 4AP4C 2PMZF 1M94A 1AARA 2PGEA 2EDUA 5L9XA 5KFZA 1VZ6A 3RH4A 2C7HA 2B76B 1TIFA 3WCQA 5JCNA 2DGZA 2GO7A 1R7SA 3C2LA 3RJGA 2ZZCA 3SR6B 1U9LA 2HHVA 4H4XA 2WXNA 2MJEA 3FG2P 4F93B 4GRTA 1DOQA 5JTIA 3TADC 2W11A 3GO2A 5CWRA 1P98A 3TMPB 1FEZA 2MJDA 4NJCA 2D07B 5J0XA 3SAFA 2GBNA 2YVCA 3B08A 4J56A 1J7AA 2GQWA 4JQ9A 4BWJA 5AZHA 3U7DA 4MM3B 3TL5A 3TEWA 1RYJA 2MUCA 3MC0B 1BNPA 3IBEA 4ARCA 1ZKHA 1XWLA 2F2AB 5AK4A 4P0QB 3DWGC 2KVZA 3APCA 3CGCA 4IL0A 3SN4A 1QSLA 4FLHA 1NBFC 1TS2A 3BIID 3DQVA 4HCPB 5HHIA 3PRPB 1E10A 2HXTA 3PFRA 1ZQKA 3TKAA 3ZNHB 2X50A 5BYQA 2SEBD 5LXHA 1ZK7A 1GRFA 2NO4A 3CF6E 2NPTA 1SJBA 1JEHA 4DLEA 8ICTA 3OTRA 4MFCA 3RUIB 1UH6A 2DYMA 3QLDA 3TARA 1TK8A 2K9XA 2O6VA 3CSTA 4JV0A 2B6GA 3DJJA 1HEKA 5F9LA 2PTYA 4G7FA 4QZCA 2TPRA 4EELA 1Y88A 5ALDA 2V3SA 4KLUA 3B0AA 1ZJMA 3ORYA 3UXNA 4MF8A 1BMLC 3VA8A 3T79A 1UBIA 5G5HB 1ZXIC 2V6OA 1S77D 1T3QC 1EF1A 1MI0A 2V4QA 2KTRA 2WBAA 7ICIA 4LK0M 1K1SA 3ZW3A 2WNMA 3MP9A 3N20C 4JUZA 1S76D 4GB9A 2XH7A 4IC7B 3RJIA 4EZLA 2F1HA 2OCEA 4DSJA 5KVIA 4NXZA 4DQIA 2MNRA 4XUSA 3NO1A 1YZ6A 1YQ4B 1ZD2P 5EWGA 3JPPA 2AL3A 3Q69A 2KOBA 4GDKA 4F1SA 3VCNA 2AGPA 1WZ3A 5J2IA 2ZADA 5DLFA 2JRIB 5HI1A 2JK6A 2GRTA 2KFNA 2PKOA 1T4GA 1JRUA 3RNMA 4GXBA 3M8SA 1KFYB 3JVAA 3OJSA 4ZDVA 2IOFK 4JN8A 1MHXA 3GB1A 2MUTA 3TIXA 1V9PA 4RPXA 1V85A 4RUCA 4F2SA 1RDFA 3BK2A 1WJUA 3HKZC 4NLZA 2MX2A 4YMOA 5KFSA 3Q3JA 3WAOA 3W8XA 5C2TB 4KDLB 2PA6A 3R7RA 2OPJA 3HK0A 1QQ7A 1GRHA 4W9JA 2MBHA 4K3BA 2WXJA 3KQ4A 2FE8A 1W1QA 5J0PA 2BBCA 4B9VA 5CJ7A 1ZD5A 4R64A 3N4FA 3RRGA 1A6SA 3Q8EA 1PGAA 3VR8B 1N60C 2OEDA 3FXGA 4CF5A 1YN5A 5FS7A 2ALZA 3SEBA 2WOWA 1A76A 2PU1A 1GV4A 1SGHA 2PFNA 1EF5A 1WWUA 1K51A 4DHZB 3APFA 2BC1A 2WX0A 1NZPA 1FRRA 4JE3B 5TR5A 1DIIA 3DDMA 5FS6A 4JMUA 5KNIA 4DXGA 1L4ZB 3ZJTA 2LBOA 4GXIA 3EPIA 1NKBA 4C7ZA 1YQZA 4QZ9A 5AKYA 4WJQA 2N9PC 3VC8A 2UVRA 3H6NA 4HWIB 3CXBA 3CAWA 1FXIA 1YX6B 2KJ6A 2M1MA 5JCMA 3TAPA 1WJ6A 1I4HA 2JEFA 2KMAA 1YQBA 2LHDA 3RBEA 1D5MC 3SFEB 4DDID 2AX5A 3TQ1A 2KVSA 4I2EA 5KFIA 3FV9A 1V38A 5AK3A 2K89A 1TKDA 4NAWB 1WF9A 2IZVB 2DAJA 3BJSA 2RP5A 1UWXA 1NELA 3S1FA 5KFFA 4DOCA 1WWVA 3P42A 4NLBA 1F77A 1B22A 1XLNA 2K4IA 1F8WA 3RFZB 2LD9A 2JMGA 3N9YC 2K39A 3BYTB 3Q3MC 4I2IA 2HW3A 4BX9C 3C8YA 4MSMB 5IIOA 1B43A 3N7SC 4EM3A 2OX4A 3BVGA 4FBTA 2BHNA 3H8JA 4IRCA 2HE7A 2J52A 4EWJA 3RJHA 3Q8MA 2HHSA 3H40A 1JXEA 4Y2RA 5D6JB 4OCZA 3B9JB 2GBJA 5AE2A 1VZ8A 2Y3SA 2JY6A 3W1SC 3B0YA 9ICHA 3T3NA 3QUBA 3I57A 4QWDA 1ZQAA 7ICUA 5KT2A 3KHLA 2D3CA 2LM1A 5KFOA 3CT2A 3O0HA 2C7MB 7ICHA 2QLTA 4RPZA 4DSIA 2IJ0A 1EM7A 2XVTA 1HZ6A 4XLOA 4CF3A 2KJHB 4CNQA 3TFSA 3RJJA 4RU9A 4KGSA 2F1IA 3TW9A 1JWAD 4TVYA 1EU3A 2KFJA 3QTPA 2AQ2B 2J42A 3GRTA 4RQ8A 3DHIC 5EE1A 4CCHA 1SZHA 2K1FA 5CHWA 4J1OA 3MR6A 2YTUA 4JWNA 5DBAA 7ICSA 4NM2A 1KH0A 2JYEA 2LHEA 3SV3A 8ICLA 3V5FA 3IG5A 4FULA 5DPWA 1WGYA 1N5WA 3TI0A 4R66A 1KFTA 2QIEB 4R65A 2Y4GA 4DWDA 3DBRI 5AM3A 5DKWA 1S10A 2XEWA 4E71A 1GC6A 2W3RA 1JPDX 2NPTB 4J9LA 3ZVVA 2GOLA 4CO7A 4DWFA 4MEMA 3KJMA 3NS1A 1J2NA 4O3NA 1SXDA 3PRZA 2IPIA 1ZQYA 5L83A 2O6VB 3RCYA 1W6TA 3LDZE 5C3JB 2GDQA 4EM4A 2Q5WD 4DK5A 2V3NA 4PVHA 4DSEA 1NHSA 3DEEA 3MGHA 4ECSA 1FHVA 2EQYA 1SF0A 4RNOA 3PZPA 2NRTA 4KGTA 2WB1C 2KK0A 1SL2A 5AM0A 1X9WA 3NZ3A 1IUEA 1F2RI 1M4VA 3RB6A 4WJPA 2ASLA 1S97A 4FZMA 2Y0SF 2G5HB 2JPHA 4FS1A 2QILA 2G9HD 3VRAB 5D4BA 5AIBA 4P16A 4HJGE 3UGVA 2PE6B 5KFDA 3PS6A 5ALMA 2XNAC 3RI7C 1EC7A 3QYPA 3DVNV 1JWSD 3S1CA 2OEHA 2WDRB 1OUQA 5J0QA 2NTSA 3TQPA 2ZIWA 4IUMB 1E5WA 1JMSA 4BC9A 4ZRIA 1ZQQA 2H3QA 8ICYA 4I28A 1Q10A 3A9KA 3NZSA 4F8CB 3TOYA 2JXJA 1ZQEA 2XSXA 1MPEA 5KFAA 4LZGA 4OALA 2MUTB 2KHVA 3RNGC 2NV3A 1K1QA 1XS2A 8ICBA 3TACB 4ED3A 1S0MA 3DVNU 4A9AA 2CU3A 3IFWB 2WDVB 4C56C 2MSNA 1ZRNA 2VH1A 3SQSA 3VDGA 1UT5A 5AZGA 3ZYYX 2DPJA 1KF6B 1ZOLA 2IO0B 3V7KA 2KQSA 4Z6FA 3EJDB 1AOGA 3ZXRA 5DLGA 3QE9Y 3CGDA 2MBBB 4FJVB 3I9V1 4TQ1A 3ALRA 4I2BA 1DK3A 4GMEA 3DFYA 2LUEA 5FJUA 2Z0EB 2WOIA 1TY2A 4P4PA 1WCNA 1P3QU 2WGSA 4KLDA 3ZO5B 4Q8FA 4AJYB 4EEYA 3GIIA 2XGQA 2Y1JA 5J0SA 1KLUD 1DOXA 3OSPA 2GL5A 3M9OB 5IIKA 1XQQA 1SBBB 2QDFA 3MC1A 1XPYA 3IXSA 5EWFA 7ICGA 2WDWA 3F2DA 3RJFA 3RH6A 2D5GA 1WVEA 1L7YA 8ICEA 3VCBA 3B97A 1T5XD 5ER0A 5EU9A 2H5XA 2ZTCA 2ZJAA 3PW5A 2V4IB 5KFXA 4LNNA 2C2RA 3S2AA 4B6WA 5EBKA 3QKEA 4XQ8A 5KFJA 4HDOA 5LXIB 4H4QA 1WM3A 2GLSA 2QJNA 4BOSC 3EZ5A 2PKEA 2ZG6A 1JWUD 4RNNA 3U52E 3KBBA 2LYAA 8ICGA 2KJ8A 9ICPA 1TS5A 2P6RA 4ZA0A 2MCNB 4HK2A 5FXDA 1R4NB 1NOMA 2YQEA 4UATA 2EQ9A 5C1ZA 3AE5B 2KNBA 3AULA 2W9CA 3ALBA 3L08A 3AL0B 4I6NB 3T5LA 2KJ5A 4FX9A 2GOWA 3AU4A 4YXDB 5KFTA 3NY5A 3PWIA 1HUZA 1V6EA 3IN5A 5FJOA 2VA3A 3MQTA 1P43A 1ZQNA 1Z00A 1I4GA 3DGHA 2EQ8A 3CGBA 3U26A 2DKZA 4JV2A 2VJ4A 1L6VA 4M04A 3JPNA 5DG8A 4QWCA 4B0EA 4NM1A 1D4BA 1SIFA 3H0MB 2BWFA 2ES6A 2C28A 4MH8A 4RCOA 5TZVA 4IT1A 2C3CA 3RO6A 4O0IA 2ZIUB 4RMAA 1F5SA 5J2AA 3D47A 2IOFA 2M4NA 5HMMA 1R4MI 3VFCA 4ZHPA 1C1YB 4DDGD 2INCC 3RFAA 3UMGA 5ALKA 2M0XA 3HPOA 4BBNF 3K1RB 3LVVA 4FZNA 3F5AA 5J0WA 1MSWD 4IWOA 2BYTA 4C4TA 2OQYA 4MKSA 4U7CA 1WY8A 2MA9B 3Q8LA 4KITB 3BDPA 1L0XB 1H8CA 1X1MA 4E4UA 3RMKC 1GO3F 3B0XA 3L13A 4PK1A 3UQ0A 9ICLA 3II4A 4QW8A 4JWUC 2BQRA 2JRZA 2VANA 3FKYA 1T3NA 2N1RA 3NS8A 2WPFA 3KZXA 4LIIA 3I63C 3N28A 1WM2A 4JX1C 2AXTU 4OVZA 1HIWA 4B9UA 3I99A 2GGIA 2P88A 4Y2QA 3UQAA 3NVWA 4K81A 5ALPA 2C22A 2ZIXA 1XS9D 4H50A 3UQ2A 5BO4B 2A8XA 2KICA 2E1EA 4QZIA 1E8GA 3PZ8A 4P2HA 1PGBA 3GIMA 3AQFA 3CMMB 4HXDA 4ICUA 1T0RC 2LI6A 3PQBA 4C80A 2W9MA 2LM4A 2E5SA 4UB2A 1FM0D 3AE4B 4IL6U 1I4RA 2KSOA 2K4EA 2IGDA 3NVZB 1EBGA 2L0FA 3UM9A 4B9SA 4YN4A 5L1LA 3PY8A 2L8JA 2WXIA 1K50A 3C5GA 2HJ1A 1W1MA 2J6TA 3A7AA 5H2FU 3ZQ4A 4I6LB 1Q3UA 2CJNA 2KEYA 2YMMA 3M3JA 1RXVA 4DXAB 4FDCB 3Q4DA 3EYZA 3NGDA 4H4SA 3QU7A 2KDBA 4RUAA 3LB8C 2HSZA 3SDLC 1J0GA 2K8BA 1ZQDA 5DGAA 1N48A 1L6NA 4O5KA 5KG1A 2MP2A 2FLNA 3ETLA 3M7DA 1NENB 3ZJUA 8ICCA 2BF8B 1U4BA 1ZR6A 3P2BA 1GB4A 2DFLA 4M0WB 4PVKA 4YMNA 3GFKB 4X57B 3QX7A 3WK5A 4M9GA 4TVWA 1IGDA 3A9KB 3P0WA 4RNMA 3AEEB 5KT3A 2QPMA 3R0UA 3P4SB 4BKSA 4RQ7A 4HPPA 1D3ZA 2WOVA 3R2TA 5D7GA 4YXMA 5J0UA 1KD0A 1XEEA 4PS3A 3H7PA 4M0AA 3OPXA 3BQTA 2CXYA 3M1YA 4KWSA 4IS7A 2P0IA 1XO0A 3RZWC 2XN9C 1FPYA 5J2KA 4X2PA 1B0XA 4M47A 2AHOB 1TV9A 1BUIC 1DGSA 4RH6A 1XXGA 1T6BX 5KFLA 2G45B 3UGBB 5JH5C 4QZFA 2PE9A 2V4RA 3C19A 2PVGC 4MSQB 4ZYSA 1QH9A 2C5LC 3RNEC 1PFDA 1RYUA 3LWLA 2KG5A 1BPZA 1WIAA 3T8MA 4DN1A 2QARA 4XX5A 5HR6A 3T8QA 3M9NB 5TISU 3WAPA 2ZUCA 3NVYA 1XANA 5ALIA 1ECQA 3VCCA 2XI9A 1WGHA 3C1ZA 1EXNA 4IM2A 4DQRA 2W55A 5IAAC 4YSXB 1MBBA 3N4EA 5AM5A 3BK1A 3TEZA 5ALGA 4A6QA 4FI4A 3R9KA 3RNFC 3JYUA 5KFMA 1ONEA 4PHAA 2Y5BB 4EC3A 4YSYB 4PL1A 3MBYA 3A0BU 1N6ZA 3TJIA 4O5CA 3KUCB 4PYTA 1V49A 3AM9A 4XWTA 3HIZA 2WF6A 1RG6A 1C4PA 1ZYQA 3AE6B 1B9RA 2EMSA 1ZE3D 4MEYA 1CJEA 4NL9A 4ZRQA 3D9XA 3WKEA 1URJA 2RMMA 1TAUA 4KLIA 2W9CB 4CF4A 4HPNA 3ZNGC 2JYTA 1ZD4A 1WFYA 4F3OA 1RPLA 2FPKA 3PK7A 3TAQA 5G5GA 1DOYA 1Z00B 3F2CA 4Z17A 5DPRA 3SAGA 2NRXA 1B1ZA 2INPE 3OHBA 2O2VA 3HRDC 1D8BA 3K1GA 2BKFA 2BCVA 1ZPSA 2WTFA 4EMJA 2VFUA 2GSHA 2R2ZA 3O65B 1SGGA 3LDAA 4TMAB 3PMNA 1XC9A 3BINA 2MBRA 3DVGX 8ICXA 3MSYA 1QLBB 1SE4A 4JAYA 3TFRA 2W82A 3PG6A 3M6KA 3V72A 5ALFA 1H38A 3OSNA 1YMHE 3MFHA 2KX3A 3L10B 4ANXA 4TUQA 3GE3C 1CMXB 5GXGB 3N1XC 5BMIA 1HJPA 2ZZ0A 2QC8A 2VZKD 3TBLD 9ICVA 2HHTA 1AWDA 2PTWA 2YAUA 4KLJA 4H4UA 4O3SA 5AZFA 1X9SA 1N5XA 3W1YA 4QZ8A 1MA7A 5EDSA 2BVHA 2D2QA 2GGEA 3CWIA 1Z19A 2CHZA 4DS4A 3DGZA 3BJYA 5JCLA 3MDAA 5E6NA 2W9BB 1EC9A 5AKIA 2ZTEA 3GOEA 1IM4A 1ZQWA 3JPRA 1Z1BA 3NG0A 1KSPA 4XWWA 4MGGA 4PYZA 1SL0A 1RM6B 2JZ3B 4LJOB 4HCNB 5I1VA 1PK1A 3M9MB 9ICWA 2BYFA 2DZKA 4BJQA 7ICEA 1DGJA 2GMIC 3PV1A 1ZQTA 1STZA 3OPSA 2JXXA 2W8KA 1TKKA 2K6QA 3QU4A 2R8JA 2IOHA 4HAIA 2ZIXB 4PH5A 5BOLA 2PXIA 3AQEA 3RB0A 1L3UA 4N58A 2R9ZA 3QU9A 3ICXA 7ICRA 2BVGA 3TUOA 3R25A 2JH1A 4IKGA 1WR1A 4IR1A 2G4DB 2XH0A 1ED1A 5ALTA 5KFRA 2HVHA 1FFUC 3DH9A 4JDRA 2B0CA 1L8OA 2KLGA 2JX5A 2KSOB 3QU5A 3Q8BA 3GIKA 4H4RA 5JU5A 5J2HA 4WJ3B 1ZQHA 1IYXA 1MO9A 3I76A 1M6YA 1E0YA 1U47A 2KDMA 5L6FA 1A0PA 1WRDB 1QLNA 4XZ4A 2X8HA 4E8GA 2QKQA 3VH3B 1FO4A 2LFIA 5FJTA 4FO6A 3GS2A 1E8YA 4R63A 1GXFA 3ZDEA 1V59A 1CZPA 3DHGC 3RRAA 3S1DA 4Y2VA 8ICZA 2BCUA 2BPCA 4HCHA 5IA7A 2MP2B 1I4XA 5KG2A 2HOFA 4EUTA 4A3RA 4OHJA 2FMPA 3E9SA 1J7CA 1QOGA 3MHSD 3PREA 2DUYA 3T9LA 3UJ2A 3JW7A 5KT4A 1F0ZA 1FFVC 4KEMA 2LXCA 3F5EA 4NZLB 5U1OA 3CYMA 3MFIA 2ZZBA 5IP4D 3RULA 3PSTA 1STEA 2E8PA 4G0NB 1YZ7A 1TTNA 3MHZA 5E6JA 2XGPA 4DFDA 1WE6A 1QCKA 3GZNB 3KHGA 1VJ5A 4QZHA 3UJRA 4LTUA 4OZAA 2PMZC 2CKHB 2WF9A 3QK0A 1KLNA 2Q0ZX 4G50A 1WGDA 1AHZA 5FXPA 2A1AA 3HW2A 5F3XB 4RQ6A 1ZQLA 4PGQA 3KKAA 2RDJA 4KLMA 4IQUA 1F52A 1WR6E 1MNSA 1RFKA 2V9WA 4K4HA 3C5FA 4E74A 1BPDA 1BNOA 1EUVB 3C2MA 2DX5B 2L52A 3RCZA 4ENLA 3QCAA 2I38A 3DK8A 2JV3A 3FWAA 4MACA 3MKCA 1ZQGA 4MDKE 3Q3FA 1J19A 4KGRA 3N97B 4JPSA 3Q8KA 1QSYA 5T14A 1DRGA 3V6CB 1JN3A 1W1OA 1UBQA 1C7YA 1NI2A 3H4DA 3TEYA 4P6VF 1KRPA 2QARB 3HSUA 5KFUA 4M00A 4AQ7A 2CFYA 1KLVA 2N9EB 5IOIA 3V5CA 4QJFB 2LRUA 2AKZA 2KYWA 2CS4A 4ZRJA 2M9NA 2HHXA 4C4VA 3UPQA 5G55A 3UXOA 3UXPA 2K6DB 3AI5A 4XDCA 4GGBA 2PP1A 3A7RA 3BYYB 4ED1A 4B0MA 4H4TA 2KMMA 5CR0A 5AIAA 4JL9A 2G07A 4EKUA 2ZUBA 3KTQA 4DWIA 4I2GA 3WK9A 9ICCA 2Q85A 4GFJA 1GRTA 3HPFA 2I6XA 3PNCA 4TKNA 1JRPA 5AKGA 2AU0A 4RNAA 4PWBA 5D94A 1GRBA 2E8MA 1I19A 4LJXA 2L1AA 1T8EA 2LWPA 2KN5A 4EBCA 2EAOA 3ZD8A 2E6XA 2KMCA 4HPLB 4DHJD 3NZGA 3D2NA 2D3AA 4KZCA 1OEYJ 4O3MA 3Q8RB 3CYJA 4BDPA 4BKGA 5G5GB 5FJPA 1ENFA 3LYSA 4Q43A 3FAHA 2RRDA 4ECYA 2N9KA 1PVRA 2O2VB 4OJ6A 1GAQB 4KIKA 4C0ZA 4ANWA 3D2DA 2GR1A 2ZXIA 1FRDA 3IHPC 4FN2A 2ODGA 2OYYA 4YWOA 4PHPA 3QUCA 1ZQIA 4DFKA 1ZW7A 1S1QB 4B95A 3EPGA 1SE2A 5HKHA 1Z4OA 2KQ4X 2RR9A 1N62A 3IJLA 2N7DA 2FPLA 4YR3A 1WXQA 4P0PB 1QT9A 2QMTA 3B2FA 3OJ3A 2PLIA 7ICQA 4US8A 8ICQA 3U9IA 1SV0C 2SAKA 2IBKA 4RT3A 3FILA 1MG4A 3OZMA 3ZDTA 1KCZA 4GFIA 4BFRA 2DZIA 5JRBA 3FYHA 5DPSA 2FIFA 1COOA 5GMVA 1DTNA 2BPGA 1E8WA 1P7FA 5HG2A 1WUEA 2G09A 3V6JA 1D9FA 2DW6A 1PVQA 2WWZA 4X5VA 1TS3A 3JS8A 7ICTA 4YD2A 1Z1VA 8ICKA 3N6HA 4YSZB 3CSFA 2KXJA 3WK7A 3HUIA 1PK1B 3N1ZC 4GR1A 3F53A 3N7RC 3H8SA 1IXRA 2BCSA 2VFTA 5CHVC 3ZRFA 2KLCA 4DFPA 2JZPA 4K2SA 4M6WA 5KFVA 4RQ0A 1SKWA 3AN1A 2R8KA 5JCKA 4QWBA 3BY4B 2XC9A 4FADA 2J0KA 1TKEA 5DQIA 3ONSA 4PVEA 3U7ZA 3EKGA 3MY9A 1XD3B 3IDWA 1E90A 3OC4A 1SKRA 3C0RB 3RGTA 4DFJA 4I2AA 1W1SA 1DYQA 1F2RC 1LB2B 2K4PA 1ROEA 2HNEA 3WKDA 7ICMA 3H8MA 2HTME 1Q1OA 1L7PA 2K8CA 3H7VA 1PVPA 2FCMA 2HHQA 3DVGY 4PT5A 1QLTA 4W9IA 5HFYA 1GNUA 1LFDA 5JHBA 4BCAA 4F2RA 5ADZA 4GOCA 3HWTA 2W3SA 3PZDA 2JZBA 3GP7A 2PW9A 4LDTD 3ZDBA 2VFSA 3N7PD 2MU2A 2RD0A 4WURA 4DHGA 3HJEA 1AN8A 2ZVNA 2MW5A 5ALEA 4KLHA 1KL9A 3QFAA 2BCQA 1FIQA 2FLLA 4H4WA 4FXCA 4KLFA 1LQBA 2PPGA 2C60A 3JPTA 2GLEA 1NK5A 2G08A 5C5JA 8ICMA 1R4NI 2PVOD 3UCCA 1T0SC 3ZRCA 2NQLA 4M8MA 2R8HA 1GG3A 1HZ5A 3JSVB 4UAWA 4YTPB 2KKPA 5BYRA 2KZRA 3PO0A 2C2DA 4DX3A 4OJPA 3SQIA 3ECIA 4DSFA 5K8EA 2ZPYA 3HKZF 2PTXA 5KL1B 1J8CA 6ENLA 4DQQA 4TQSA 2P66A 1OW5A 4NNJB 1PDXA 4QZDA 1NHRA 3W5UB 2N0SB 1OEPA 1Z3EB 4KN7A 3QUTA 2JR5A 3QHTA 3T6CA 2PFQA 4QZBA 3ZVIA 1JUDA 2V0GA 3Q8SB 3M8RA 2KO3A 3TJ4A 1NK8A 1HQRD 3MGIA 3JPQA 3MTNB 3QN3A 5AM4A 4RGTA 4IQVA 3CNHA 4J57A 4WWNA 3HT3A 5L1MA 7ICOA 3DBSA 4GIVA 3PSPA 1SJDA 4C4VB 4WAAA 3IC9A 2PSNA 4YL8A 4F91B 2KHWB 3IHQB 4P7IA 1H2IA 5U25A 1TE6A 3V6EB 4BOZB 1MC8A 1J97A 2A5UA 4QW9A 1BWCA 2M0AA 2BS3B 1E8XA 4EZJA 5AM1A 2AAQA 2I0KA 1XLQA 4AP9A 8ICWA 1EC8A 3Q8PB 4YWSA 5IILA 1IGCA 1WRIA 2BW2A 3H8AA 3PHWB 1BGXT 3ML9A 2X8XX 3OP2A 2WXFA 3E0FA 3SI8A 2INDC 4ECTA 4D2KA 4QIWF 2NMQA 3MZNA 3QFBA 1FD6A 4ZH4A 3QNMA 1U49A 4MGKE 4ASWC 4K8GA 2WS3B 3L0WB 3IT6B 2UVWA 3KUZA 3Q6BA 3M62B 3ZIMA 2P3HA 7ICVA 2QDDA 4KTQA 3GZFA 2IO1B 3DIPA 4C7YA 1T94A 4KIKB 2X99A 2Y0SC 4KV2A 4K7SA 2F76X 3QEAZ 2FYMA 3PMLA 2WF7A 3BSMA 2IDYA 1N61C 3LXDA 3OZYA 4TQ0A 1UZXB 3I1YA 3GV7B 3LK9A 3QIJA
chains in the Genus database with same CATH topology
1T3QA 1JROA 3Q8AA 1ZOYB 3NVWA 3AE2B 1PYWD 1NYQA 3AE9B 4XDDA 1CK1A 3D2HA 3A7UA 2Y3RA 1C78A 3D2JA 2E5AA 1E8GA 3KLSX 2L32A 3PZ8A 1PGBA 4L23A 1YN4A 3PQBA 1RM6C 4C80A 5FR3A 1FM0D 3AE4B 1EWCA 1I4RA 2IGDA 4YT0B 1FFUA 3NVZB 4RGMA 1ZUD2 2WXIA 3P4PB 2WLBA 1K50A 3AEBB 4ML8A 1JMLA 1W1MA 1C77A 3A7AA 4GDKB 3EUB2 4HROA 3ZQ4A 2CJNA 1CQVA 3FW7A 2YEPB 1AHVA 4DNSA 1TY0A 3DWMA 4RGNA 3LB8C 2OAIA 2EKIA 3KWVA 1XF5L 4JX1C 3VQIA 1D6EC 1L0YB 3ZJUA 4UDUC 1NENB 2GQTA 2ON8A 1GOZA 3I99A 1SE3A 1ZR6A 1GB4A 3H8HA 1UWMA 3FW9A 4PVKA 3FW8A 2GB1A 3L4PA 1NI3A 2LGIA 3LYYA 1FFVA 4A90A 4TVWA 1IGDA 2J53A 1FCCC 3AEEB 2QPMA 1E8HA 3NUHB 3P4SB 1TYGB 2VFRA 1WSPA 3V05A 3HVZA 3R2TA 4HEA1 5D7GA 4WH4A 1XEEA 1K52A 1PGXA 1V1PB 1C4AA 1I4QA 2XN9C 1C4CA 4ZOHB 4A8XC 1YNTE 4BBYA 1BUIC 2JQRB 1XXGA 1T6BX 2V3PA 4RH6A 2WXLA 2PVGC 2ZW1A 1MHHE 4WWMA 4ZYSA 4ZRPA 2GRIA 4RFBA 2I2YA 1PFDA 5D3IB 3TSSA 5AUKA 1FNVA 5AE1A 1IBXB 1YQ3B 1V8CA 3NVYA 5HHZA 1QOFA 1XLPA 2W55A 1KTKA 2G1EA 1ZDVA 4YSXB 1MBBA 3TEZA 3BK1A 5AWVA 4A6QA 1E9MA 2BT6A 3RPFC 4RGOS 4O95A 2INNE 3AV8A 2PMVA 2FUG1 4EC3A 1NVID 4ARIA 4YSYB 2MJ3A 1AW7A 2Q4WA 2WXPA 4PYTA 3AM9A 4XWTA 4AS1A 2QSDA 1VZ6A 2KACA 1C4PA 2B76B 3W1SA 3AE6B 3IAM1 4WIPA 3WCQA 3W2DA 2VFVA 1B9RA 1R7SA 1ZE3D 5BMHA 1CJEA 4ZRQA 2LUMA 5LNK1 3SR6B 4OW0A 2WXNA 2RMMA 2WDQB 2MJEA 1JWBD 1NEKB 2H89B 2HDEA 5AUIA 2JYTA 1D5ZC 3AE3B 1YJIA 4NJCA 2MJDA 1PUTA 3ETRB 3AECB 1J7AA 5G5GA 4DXFA 1DOYA 2JSVX 2WXKA 1ET6A 1B1ZA 2INPE 2Z8LA 2BS2B 1RYJA 4MM3B 3TEWA 3HRDC 3MC0B 2JXTA 2P13A 1ZPSA 4ARCA 3TX1A 3AB5A 2VFUA 3DWGC 2R2ZA 1VRAB 4TMAB 3HRDD 1VR9A 2MBRA 1TS2A 3BIID 4KKIA 1QLBB 3Q8FA 3VTEA 1SE4A 1E10A 4JAYA 2W82A 1YMHE 2RDHA 2BB5A 2SEBD 5BYQA 3AH7A 1AYFA 1WGKA 2WXGA 5GXGB 4OZCA 5BMIA 1UGJA 1SJHD 2VZKD 4LLGM 1AWDA 1XCTL 2IPKD 2BVHA 1N5XA 1ZXHA 2RDGA 3BW7A 2DYMA 3CWIA 2FBWB 1E6EB 2K9XA 2X38A 3LLBA 1W1RA 2TSSA 4L1BA 1E7PB 3EGRA 2NTTA 1VLBA 2BB6A 1ZDXA 3FILB 3NS1B 2AQ3B 3UI3A 3NVVA 1BMLC 1N63C 2KN4A 1ZXIC 5G5HB 4XWWA 1T3QC 1RM6B 1FXAA 1MI0A 5I1VA 4XE0A 1DGJA 1L0VB 1SB3C 4LK0M 4BC7A 2WNMA 3MP9A 1I4PA 2M19A 5HMRA 2PLSA 1HSKA 3NVZA 1QOAA 3BVZA 4N58A 2LMCA 4PVJA 1I7HA 5FXEA 3RJ8A 2BVGA 3TUOA 4IKGA 1YQ4B 2PTLA 3Q69A 1QF6A 2ACZB 4CQNA 5H8YE 1FFUC 3B2GA 2JX5A 3Q8BA 4HKZE 3BWUD 5HI1A 1WWTA 1GPXA 2PKOA 2VAOA 2DWQA 1YN3A 1TKYA 2WXMA 1KFYB 4GDLB 4YWGG 1E0YA 4WQMA 2KDMA 4RF0A 5L6FA 3MJ5A 3TSJA 1MHXA 3S1EA 3GB1A 1ESFA 4H2AA 1AHUA 2M56B 1WYGA 3BK2A 5JXVA 1FO4A 2YVSA 2LFIA 1N60A 3GS2A 3W8XA 2WQYB 5C2TB 2IGGA 2N9LA 3NRZA 4M0WA 1CZPA 1MVKA 3BZDB 2WXHA 3S1DA 2WXJA 1I4XA 3KQ4A 1DIQA 2BVFA 1DOIA 2FE8A 4OHJA 3E9SA 1J7CA 1QOGA 2BBCA 1W1QA 2WU2B 5T8IA 3Q8EA 2L83A 1PGAA 3VR8B 4PZFA 1F0ZA 2OEDA 1FFVC 1N60C 4NZLB 1L4DB 1YN5A 2EXRA 5I1WA 2UUVA 1STEA 3SEBA 3T3OA 1C79A 2LJIA 3MHZA 5E6JA 1SXTA 4WAFA 4LTUA 2J4XA 4OZAA 1AHZA 1FIQB 3AEDB 1ACCA 1K51A 4RF1A 5FXPA 2YEPF 4HG0A 3DEDA 1FRRA 1DIIA 2WU5B 4JE3B 4DXGA 1L4ZB 2PIAA 1C76A 1RFKA 3ZJTA 4NAMA 1QKZA 4C7ZA 2L52A 3E56A 1JALA 3PM9A 3W8ZA 2I38A 3FWAA 1FXIA 4MACA 1IBXA 4KGRA 4JPSA 1I4HA 2BS4B 1D5XC 1JWMD 2LHDA 5HHDG 1D5MC 3SFEB 1W1OA 2AX5A 4HRSA 3U2SC 5D79A 3POPA 3TEYA 1SSNA 4NAWB 4P6VF 1W1JA 1WVFA 1UWXA 1X2GA 3HSUA 3ZGZA 3S1FA 4YTNB 4AQ7A 3P42A 1F77A 1XLNA 3LAEA 1EU4A 3VR9B 3CIRB 3AE1B 3RFZB 4A55A 1X2HA 3N9YC 3BYTB 3V3XA 1MBTA 3C8YA 5AE3A 3BVGA 4XDCA 2R8DA 3A7RA 2CJOA 2KWDA 1UNSA 2J52A 3BYYB 4B0MA 3C0PA 2KMMA 1GB1A 2K22A 3SR6A 1Y56A 2Q85A 2BTEA 3B9JB 5AE2A 1VZ8A 2Y3SA 5MPOA 3T3NA 1JRPA 3AEGB 3I57A 3LXFA 4RNAA 4PWBA 1EWYC 2DLBA 1I19A 4N6EB 2L1AA 1E8FA 1ZP0B 1KLGD 2E6XA 2IJ0A 1EM7A 4XLOA 1HZ6A 1OQQA 1TKGA 1JCKB 4JB1A 2Y5PA 1VJKA 2MEKA 4KGSA 3HVDA 2EELA 2GI9A 2VZKB 1JWAD 5BMGA 5G5GB 4TVYA 1EU3A 1ENFA 2AQ2B 2J42A 3FAHA 3R8BA 1QOBA 2N9KA 3PZ7A 1GAQB 3AMZA 1FNWA 4IDIA 5EE1A 1VAOA 3D2DA 2LHEA 1FRDA 2JYEA 1KH0A 2Y08A 4Q2JA 1SE2A 2KQ4X 1N5WA 1N61A 1N62A 3AEAB 3Q8CA 2UUUA 1SIJA 1BXTA 1WXQA 1QT9A 2QIEB 2QMTA 3B2FA 3OWEB 1FNUA 2MH7A 2PLIA 2Y4GA 4PWCA 4US8A 2WXOA 4YTMB 4DQOC 5BYSA 2W3RA 2SAKA 3SFDB 3FILA 3KJMA 3NS1A 1TJEA 1C9FA 2AXRA 2IPIA 3NVWB 5C3JB 1P7FA 1QQRA 5HG2A 2ONQA 1SB3B 2Q5WD 3P63A 2V3NA 3ABVB 3J9CA 4PVHA 2RK5A 4REZA 1TS3A 1SF0A 1TS4A 3JS8A 3NVVB 4USAA 1HA5A 4KGTA 4YSZB 1W1LA 3HUIA 3NZ3A 1IUEA 1F2RI 1M4VA 2VFTA 3MFGA 2WXQA 1UXYA 2QILA 2G9HD 2JZPA 3VRAB 5TSSA 2RPVA 3AN1A 4P16A 1SEBD 4HJGE 2XNAC 1UUPA 3IT4B 1TKEA 3S1CA 1JWSD 2JU6X 2DBYA 1NYRA 2WDRB 5FXFA 2NTSA 4PVEA 1TZOA 3DQ0A 3U7ZA 1DZNA 4BC9A 1SJED 1FCLA 1QLUA 1Q10A 1L5PA 2Y3AA 1W1SA 1MPEA 1P7EA 4OALA 1DYQA 1F2RC 1ROEA 1ET9A 1OFFA 2HTME 2QEJC 4PT5A 5D3DA 1QLTA 2GQUA 4A9AA 5HFYA 4BCAA 2CU3A 5FK9C 1V1PA 3NRZB 2N7JA 2WDVB 4C56C 2Y5CA 5ADZA 2PLPA 2W3SA 3TEXA 5L6GA 2VFSA 3GP7A 2PW9A 1VDVA 3ZYYX 1KF6B 2IGHA 1LO5D 4WURA 1AN8A 4TQ1A 3I9V1 1J7BA 1FIQA 4FXCA 1TY2A 4ZHOA 1FMAD 4UD8A 5H92C 2PVOD 5EE9A 4ZOHC 4TSSA 3W5VB 1KLUD 1DOXA 1YJJA 1VQZA 1HZ5A 2K0PA 1SBBB 4YTPB 5BYRA 3IXSA 2R61A 3PO0A 1FEHA 3R2IA 3VRBB 1F0XA 1XLOA 1HXYD 2WDWA 2AQ1B 2D5GA 1WVEA 5K8EA 3AE8B 1T5XD 3NVYB 2V4IB 4J3OD 1PDXA 3URYA 2LEKA 3W5UB 2O3GA 2N0SB 2W54A 2E3TA 4US9A 2ZW0A 4HKQA 1RWSA 1JWUD 5FKAC 3U52E 2V0GA 3R07C 1JQ4A 4MT5A 1TS5A 2OHFA 1JW9D 4ITKA 5FXDA 1HQRD 3RJAA 2WP9B 4R3DA 4RGTA 4GLSC 3AE5B 3EA6A 1E0ZA 1KRHA 3P4RB 4YXDB 3B9JA 2ICIA 2WXRA 3ETRA 3P4QB 5HQXA 1I4GA 3KWLA 2P4PA 2DYOA 3FC4A 1L6VA 4B0EA 1D4BA 2M0AA 2KAJA 2BS3B 1VZ7A 4MH8A 1QILA 4RCOA 5EE0A 3W9CB 3EUB3 4KKJA 2I0KA 1XLQA 1XO3A 1V1OA 1IGCA 1WRIA 2BW2A 3O13A 4JWSC 3BVMA 4MLAA 2K5PA 4ZHPA 2JWUA 2WXFA 4IOIE 1OQRA 3IAS1 4D2KA 2NMQA 2H88B 1W1KA 4EE2A 1FD6A 3AEFB 1HEZE 2WS3B 1V97A 3ZJVA 1K53A 1L6UA 3IT6B 2BYTA 2QKNA 3W8WA 3U4EG 3GSYA 2P3HA 5I4DA 2QJLA 1L0XB 5EE3A 4C7YA 1A70A 1XCQL 3AE7B 4N59A 2NQWA 4JWUC 4L2YA 4O1NA 4OZBA 5G5HA 2IDYA 1N62C 1N61C 1N5WC 1N63A 4TQ0A 2K3UA 1ZXIA 3TSHA 4KX6B 3P1MA 4OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3Q A;  1JRO A;  1ZOY B;  3NVW A;  3AE2 B;  3AE9 B;  1NYQ A;  3D2H A;  3A7U A;  3D2J A;  2E5A A;  1E8G A;  1RM6 C;  4C80 A;  1FM0 D;  3AE4 B;  4YT0 B;  1FFU A;  3NVZ B;  1ZUD 2;  3P4P B;  2WLB A;  3AEB B;  4ML8 A;  1W1M A;  3A7A A;  3EUB 2;  4HRO A;  2CJN A;  3FW7 A;  1AHV A;  4DNS A;  3DWM A;  3LB8 C;  2OAI A;  2EKI A;  1NEN B;  2GQT A;  3I99 A;  1ZR6 A;  1UWM A;  3FW9 A;  4PVK A;  3FW8 A;  3L4P A;  1NI3 A;  1FFV A;  4TVW A;  3AEE B;  2QPM A;  1E8H A;  3P4S B;  1TYG B;  2VFR A;  3HVZ A;  4ZOH B;  4BBY A;  2JQR B;  2PVG C;  4WWM A;  1PFD A;  5AUK A;  5AE1 A;  1YQ3 B;  1V8C A;  3NVY A;  5HHZ A;  1QOF A;  1XLP A;  2W55 A;  2G1E A;  4YSX B;  1MBB A;  1E9M A;  2BT6 A;  3RPF C;  4O95 A;  3AV8 A;  4EC3 A;  1NVI D;  4YSY B;  2MJ3 A;  2Q4W A;  4PYT A;  3AM9 A;  2B76 B;  3AE6 B;  3WCQ A;  2VFV A;  1B9R A;  1R7S A;  1CJE A;  3SR6 B;  2WDQ B;  2MJE A;  1JWB D;  1NEK B;  2H89 B;  5AUI A;  3AE3 B;  1YJI A;  2MJD A;  1PUT A;  3ETR B;  3AEC B;  1J7A A;  5G5G A;  1DOY A;  3HRD C;  2BS2 B;  1RYJ A;  2P13 A;  3TX1 A;  3AB5 A;  2VFU A;  3DWG C;  2R2Z A;  3HRD D;  2MBR A;  3BII D;  3VTE A;  1QLB B;  1E10 A;  4JAY A;  3AH7 A;  1AYF A;  1WGK A;  5GXG B;  1AWD A;  2BVH A;  1N5X A;  3BW7 A;  3CWI A;  2FBW B;  1E6E B;  2K9X A;  3LLB A;  1W1R A;  1E7P B;  1VLB A;  3NS1 B;  3NVV A;  1N63 C;  5G5H B;  1ZXI C;  1T3Q C;  1RM6 B;  1FXA A;  1DGJ A;  1L0V B;  1SB3 C;  4BC7 A;  2M19 A;  5HMR A;  2PLS A;  1HSK A;  3NVZ A;  1QOA A;  4N58 A;  4PVJ A;  1I7H A;  5FXE A;  2BVG A;  1YQ4 B;  1QF6 A;  2ACZ B;  5H8Y E;  1FFU C;  3B2G A;  2JX5 A;  1GPX A;  1WWT A;  2PKO A;  2VAO A;  2DWQ A;  1TKY A;  1KFY B;  1E0Y A;  4WQM A;  3TSJ A;  3S1E A;  1AHU A;  2M56 B;  1WYG A;  2YVS A;  1FO4 A;  1N60 A;  3W8X A;  2WQY B;  5C2T B;  3NRZ A;  1CZP A;  3S1D A;  1DIQ A;  2BVF A;  1DOI A;  1J7C A;  1QOG A;  1W1Q A;  2WU2 B;  2L83 A;  3VR8 B;  4PZF A;  1F0Z A;  1FFV C;  1N60 C;  2EXR A;  4LTU A;  1FIQ B;  1AHZ A;  3AED B;  4HG0 A;  5FXP A;  3DED A;  1FRR A;  1DII A;  2WU5 B;  2PIA A;  1RFK A;  2L52 A;  4C7Z A;  1JAL A;  3PM9 A;  3W8Z A;  3FWA A;  1FXI A;  2BS4 B;  3SFE B;  1W1O A;  2AX5 A;  4HRS A;  5D79 A;  1WVF A;  4P6V F;  1W1J A;  1X2G A;  3S1F A;  4YTN B;  1XLN A;  3LAE A;  3VR9 B;  3CIR B;  3AE1 B;  1X2H A;  1MBT A;  5AE3 A;  2R8D A;  3A7R A;  2CJO A;  3C0P A;  2KMM A;  2K22 A;  3SR6 A;  2Q85 A;  3B9J B;  5AE2 A;  5MPO A;  1JRP A;  3AEG B;  3LXF A;  4PWB A;  1EWY C;  1I19 A;  4N6E B;  1E8F A;  1ZP0 B;  4XLO A;  1TKG A;  1OQQ A;  4JB1 A;  1VJK A;  1JWA D;  5G5G B;  4TVY A;  3FAH A;  1QOB A;  5EE1 A;  1GAQ B;  3AMZ A;  4IDI A;  1VAO A;  3D2D A;  1FRD A;  1N5W A;  1N61 A;  1N62 A;  3AEA B;  1SIJ A;  1WXQ A;  1QT9 A;  2QIE B;  3B2F A;  2PLI A;  2MH7 A;  4PWC A;  4US8 A;  4YTM B;  2W3R A;  3SFD B;  3KJM A;  3NS1 A;  1TJE A;  2AXR A;  3NVW B;  5C3J B;  1SB3 B;  2Q5W D;  3P63 A;  3ABV B;  4PVH A;  2RK5 A;  3JS8 A;  1SF0 A;  3NVV B;  4USA A;  4YSZ B;  1W1L A;  3HUI A;  1IUE A;  2VFT A;  1UXY A;  3VRA B;  3AN1 A;  1TKE A;  3S1C A;  2DBY A;  1NYR A;  2WDR B;  5FXF A;  4PVE A;  3DQ0 A;  1DZN A;  4BC9 A;  1QLU A;  1L5P A;  1W1S A;  4OAL A;  1ROE A;  2HTM E;  1OFF A;  1QLT A;  2GQU A;  4A9A A;  4BCA A;  2CU3 A;  3NRZ B;  2WDV B;  5ADZ A;  2Y5C A;  2W3S A;  2VFS A;  3ZYY X;  1VDV A;  1KF6 B;  1J7B A;  1FIQ A;  4FXC A;  4ZHO A;  1FMA D;  4UD8 A;  5H92 C;  2PVO D;  5EE9 A;  4ZOH C;  3W5V B;  1DOX A;  1VQZ A;  1YJJ A;  4YTP B;  3PO0 A;  3VRB B;  1F0X A;  1XLO A;  1WVE A;  3AE8 B;  3NVY B;  1PDX A;  2LEK A;  3W5U B;  2O3G A;  2N0S B;  2W54 A;  2E3T A;  4US9 A;  1RWS A;  3R07 C;  1JQ4 A;  2OHF A;  1JW9 D;  4ITK A;  5FXD A;  2WP9 B;  3AE5 B;  1E0Z A;  1KRH A;  3P4R B;  4YXD B;  3B9J A;  5HQX A;  3ETR A;  3P4Q B;  3KWL A;  2P4P A;  3FC4 A;  1L6V A;  2KAJ A;  2BS3 B;  3W9C B;  5EE0 A;  3EUB 3;  2I0K A;  1XLQ A;  1XO3 A;  1WRI A;  4MLA A;  4JWS C;  2K5P A;  4ZHP A;  1OQR A;  2H88 B;  1W1K A;  3AEF B;  2WS3 B;  1V97 A;  2QKN A;  1L6U A;  3W8W A;  3GSY A;  2P3H A;  2QJL A;  5EE3 A;  4C7Y A;  1A70 A;  3AE7 B;  4N59 A;  2NQW A;  4JWU C;  5G5H A;  1N62 C;  1N61 C;  1N5W C;  1N63 A;  4JX1 C;  1ZXI A;  3TSH A;  4KX6 B;  3P1M A; 
#chains in the Genus database with same CATH topology
 1T3Q A;  3DOW A;  5D49 A;  1UGM A;  7ICK A;  2Z59 B;  3WAM A;  4J6I A;  3R11 A;  3GIL A;  1NYQ A;  4Q45 A;  1PYW D;  1CK1 A;  4GGH A;  2Y3R A;  2ZJ5 A;  4Y2P A;  3RH5 A;  2I1J A;  2RPQ A;  4F5O A;  3STP A;  2L00 B;  5L1J A;  1FEB A;  3PTF C;  4AYB F;  2XK5 A;  4O5E A;  4MJS A;  1TYT A;  3RNB C;  1ZJN A;  1RM6 C;  2HHW A;  2KTR B;  2BYE A;  2L05 A;  3H9D A;  5FR3 A;  4OO1 J;  4W9D A;  5CEH A;  3ZLZ A;  4WJO A;  5J2C A;  1NNL A;  5AI4 A;  2JF5 A;  2QHO A;  3H12 A;  4LJP B;  5IDZ A;  5J8Y C;  3ZDA A;  1O03 A;  2JEJ A;  9ICS A;  1JML A;  2BWE S;  4GDL A;  4A8E A;  4GDK B;  3EUB 2;  3GE8 C;  2X8C A;  4EQX A;  2F77 X;  4MGZ E;  3PT2 B;  3ONN A;  2EKI A;  4CHK A;  1V9J A;  4F5N A;  3ZDD A;  3KWV A;  4QAY A;  2KQ7 A;  1XF5 L;  1FEA A;  3THV A;  2KIV A;  5K4L A;  2GGH A;  2KHQ A;  1D6E C;  5ALU A;  4M6W B;  5G2N A;  5AKX A;  1PDY A;  5ALY A;  1S0O A;  1YT3 A;  3MC9 A;  1MDR A;  2FNJ B;  2Z0D B;  5J2B A;  3FW9 A;  2BPF A;  2BYV E;  2KNJ A;  2KN7 A;  2GB1 A;  4IM0 A;  3FW8 A;  4ICV A;  3LYY A;  4XRH A;  4A90 A;  4KT2 A;  2K4H A;  1TBE A;  2MA1 A;  1IP9 A;  2KVR A;  4WJN A;  4I2H A;  2R8G A;  2NCN A;  5DCN A;  1TYG B;  2VFR A;  2D10 A;  2Y9T A;  2LGY A;  2V9H A;  1JCT A;  5CHG A;  2K8C B;  4PZO A;  3PR4 A;  4WH4 A;  3N4M B;  5KHQ A;  1K52 A;  3KD3 A;  4GYP A;  4G11 A;  2V1Y A;  1IPG A;  4GLX A;  1BPX A;  1K8R B;  2W8L A;  5KVH A;  1I4Q A;  2JZB B;  5IIN A;  2QJJ A;  4A8X C;  4BBY A;  3JW0 X;  2BGF A;  2DW7 A;  2GR3 A;  3UMB A;  1UCV A;  2KC2 A;  2V3P A;  4GGQ A;  1EBD A;  3V3W A;  1F44 A;  1WXS A;  4FJZ A;  4BGD A;  3UJE A;  1MHH E;  2XH4 A;  2CHW A;  4ZRP A;  4Z6E A;  4RFB A;  4XC2 A;  2I2Y A;  4M0X A;  2O6K A;  1FNV A;  4C4S A;  5AE1 A;  2WPC A;  1XSN A;  1WH3 A;  3KVF B;  5J0R A;  1TYP A;  5E6O A;  4W9K A;  2PCE A;  3NHE B;  2P35 A;  1DK2 A;  1ECW A;  5DDY A;  3TWA A;  3RBD A;  2BZF A;  9ICF A;  3HM3 A;  2LZ6 A;  3AU6 A;  5AWV A;  4UAU A;  1E9M A;  1V86 A;  2AWT A;  2BT6 A;  3DCG A;  3PX6 A;  4O95 A;  1V81 A;  3VC5 A;  4RQN A;  4GMV A;  4ARI A;  1TK5 A;  3SMV A;  8ICV A;  2MJ3 A;  4F7Z A;  2HZG A;  2QB0 A;  2Q4W A;  2P8C A;  9ICJ A;  3QC8 B;  2QGY A;  2QSD A;  9ICI A;  2F8L A;  2F44 A;  2KAC A;  4I6P A;  5BPC A;  1L2N A;  2FCN A;  3W1S A;  4WIP A;  5KG5 A;  4DF8 A;  4HLE A;  3W2D A;  3T5H A;  2AYO B;  5AKJ A;  1GER A;  3T3F A;  5LNK 1;  2LUM A;  4OW0 A;  2NRZ A;  2WDQ B;  1LV5 A;  4P4M A;  4R8U A;  3D2S A;  8ICN A;  1NEK B;  4YVZ A;  2H89 B;  2HDE A;  5AUI A;  2BDP A;  1KN0 A;  1DXS A;  3H7I A;  1D5Z C;  3AE3 B;  1YJI A;  2DZM A;  4EZ9 A;  4DXF A;  2PS2 A;  3ISB A;  3KZI U;  1TVA A;  4XGA B;  5IIJ A;  5CRX A;  5IN7 A;  2JEG A;  2P13 A;  4A3O A;  5ALQ A;  3M95 A;  3AB5 A;  4M9H A;  4NJ6 A;  2BKR B;  2YVG A;  5J04 A;  1X6J A;  1VRA B;  3RAQ A;  1VR9 A;  2A19 A;  5KG0 A;  4KSL C;  4C4R A;  3H7S A;  4KKI A;  2ZZP B;  1SZP A;  3OG5 A;  3DV9 A;  5AM2 A;  2V3B A;  3I4K A;  2KE7 A;  4F5R A;  2NS5 A;  2RDH A;  2OH2 A;  5CB1 A;  1F3P A;  2VIX A;  4ED7 A;  2HDO A;  3ISC A;  4KLS A;  9ICN A;  1AYF A;  1WGK A;  2WXG A;  2LMR A;  3RB4 A;  3CW2 C;  4LVS A;  1SJH D;  4OZC A;  4MEL A;  4LLG M;  1XCT L;  4NLK A;  4H83 A;  4A35 A;  1ZXH A;  3GV8 B;  3AXC A;  4BVU C;  2OVL A;  3GRS A;  2A3V A;  4ED0 A;  4PPX A;  1E6E B;  5J0Y A;  2X38 A;  1HTQ A;  5B66 U;  1W1R A;  2TSS A;  3LLB A;  4L1B A;  1E7P B;  3EGR A;  3PHX B;  3QAR A;  3UQB A;  1RYR A;  1SWW A;  2NTT A;  2N9X A;  3U8Z A;  1VLB A;  3UIO B;  1ZDX A;  4N9F 4;  3NS1 B;  2AQ3 B;  1S5L U;  2OJW A;  1N63 C;  1KFD A;  2F5Z A;  4NJ7 A;  2BGW A;  2WFA A;  2GGG A;  1S0V A;  2IBI B;  1FXA A;  3MR3 A;  4RT2 A;  1UA1 A;  4XE0 A;  1P48 A;  3M6Z A;  2AGQ A;  1L0V B;  4BC7 A;  3U30 A;  1I4P A;  2E1F A;  5J2G A;  2H3Z A;  4DSL A;  2M19 A;  5HMR A;  1PZN A;  3BVZ A;  3VHT C;  1MRA A;  2LMC A;  2AQ0 A;  2MAX A;  4Y2X A;  3WK4 A;  3IG3 A;  3QWZ B;  5FXE A;  4DXK A;  5KFH A;  4F5P A;  4ECR A;  1N56 A;  2PTL A;  1QF6 A;  4MJS B;  2ACZ B;  2HBK A;  4CQN A;  4LNF A;  4H4Z A;  1T0Q C;  4HKZ E;  4LNO A;  3ZNI D;  3V62 A;  1GET A;  9ICO A;  2MLB A;  4GDL B;  4WQM A;  4Y2J A;  3FCP A;  3GD4 A;  2KZ3 A;  2NYV A;  2KDF B;  4DOB A;  3GZN I;  4EQW A;  4HCD A;  5C23 A;  5ALZ A;  1UD7 A;  2ZIW B;  1WYG A;  5JXV A;  3G6V A;  1AHU A;  4H4Y A;  2YVS A;  2PJH A;  2UVV A;  2WQY B;  2GBM A;  2IGG A;  2MWS B;  3NRZ A;  4OJO A;  5DB7 A;  2HHU A;  2IHM A;  2WF5 A;  4C8L A;  3RR1 A;  1MVK A;  3EW9 A;  4FS2 A;  4I27 A;  3BZD B;  4JLC A;  1JXL A;  5HHH A;  2G0A A;  4RF1 A;  1P1A A;  1DIQ A;  1DOI A;  2BVF A;  4EMW A;  3FJ4 A;  3DBL B;  4B6J A;  2WU2 B;  2ISP A;  3NZU A;  4J9Q A;  4GXJ A;  3CRX A;  4FHK A;  4I29 A;  2L83 A;  5T8I A;  2KD1 A;  3V60 A;  4DQP A;  4PZF A;  2OO6 A;  3H70 A;  4UBB A;  3KH0 A;  2RSU A;  1CI4 A;  3J81 j;  1NJX A;  3I5J C;  4ANU A;  3A9J A;  4TUU A;  4K4G A;  1TK0 A;  1C79 A;  3RNA C;  4NEV A;  4F4W A;  2L76 A;  1SXT A;  4C00 A;  4WAF A;  2EH9 A;  2AL1 A;  2CR5 A;  1LGR A;  4HG0 A;  3ZKJ C;  1TAM A;  4ICA A;  4F4Z A;  4B9M A;  3IM1 A;  3VAW A;  4DL6 A;  4FFD A;  2LAS A;  2PIA A;  1C76 A;  3FYY A;  4HYK A;  5ALX A;  2XBB C;  4FJY A;  1VCB A;  1JAL A;  3ENE A;  3UXL A;  2D3B A;  5AKK A;  2KWC A;  3UIP B;  3JZU A;  4NQL B;  2ZIV A;  4U6P A;  1IBX A;  1GUA B;  3JVZ X;  1IV8 A;  4DQS A;  1JWM D;  3NJT A;  4JIO U;  4ADW A;  2OM6 A;  4G8T A;  5KFW A;  5D79 A;  2OKT A;  4KLL A;  1WVF A;  1SSN A;  2OZ3 A;  2RQ5 A;  1N2X A;  1ZQS A;  8ICJ A;  4YTN B;  2KC1 A;  4ELU A;  4AOF A;  1JPM A;  1NHQ A;  4OJL A;  4PZN A;  3CIR B;  1KEJ A;  5FS8 A;  3Q3N C;  2LYH A;  1X2H A;  2GR2 A;  3LAD A;  5FS9 A;  2RHF A;  3OW1 A;  5DGB A;  1TGZ B;  3DEQ A;  5KFP A;  2ZNV B;  4MHV A;  5AE3 A;  3EHV A;  4S17 A;  4EX6 A;  1OEY A;  4EEW A;  1LVL A;  1ZQU A;  1QQ6 A;  2CJO A;  4KVG B;  2R8D A;  1JX4 A;  2W7P A;  4C8O A;  1L7N A;  3ZDC A;  1GB1 A;  1RQL A;  2G3Q B;  3SR6 A;  2K22 A;  3EF6 A;  2QB0 B;  1ELS A;  2BCP A;  4KPL A;  1TT5 B;  1PDZ A;  3PW7 A;  2KFZ A;  4ZYN A;  4GU2 A;  1WGG A;  4IM3 A;  1AQ6 A;  2H3I A;  2RLT A;  1EWY C;  5J0T A;  4N6E B;  1OGW A;  2LJ5 A;  1ZP0 B;  1KLG D;  2POZ A;  4MGI E;  2XCP A;  4DL5 A;  2NVK X;  4R8U B;  4M8N A;  3CB3 A;  2NRW A;  2Y5P A;  1VJK A;  3Q3O C;  3NXL A;  2B21 A;  2MEK A;  2QCZ A;  4P0Q A;  2EEL A;  2GI9 A;  2VZK B;  1ZQO A;  1KTQ A;  3GD6 A;  3ZLF A;  3R8B A;  2PU0 A;  2BCR A;  8ICO A;  3TWB A;  3PZ7 A;  1FNW A;  4Y2U A;  2L5Y A;  1WI0 A;  1UF0 A;  4ELT A;  5DQH A;  3QEB Z;  4H2H A;  1ZQZ A;  5J2R A;  4A3P A;  1TAQ A;  1WXA A;  4EZ6 A;  3IRU A;  1WXM A;  5AK6 A;  2NVU I;  3Q8C A;  1BXT A;  2C7N B;  3IK4 A;  2MH7 A;  4PWC A;  2D8C A;  5BYS A;  4DQO C;  3QAQ A;  2AEH A;  4JWM A;  4E3C A;  2KTQ A;  1D7Y A;  3RJK A;  2J0J A;  3SFD B;  2O56 A;  3NAS A;  3VUY A;  3ZLH A;  2YML A;  4NV0 A;  1TJE A;  2HD5 B;  4B9T A;  1C9F A;  2DF4 B;  4OD0 A;  3JPO A;  3RB3 A;  4LNK A;  3NVW B;  3UMC A;  3DK9 A;  1SB3 B;  2MHJ A;  3J9C A;  4MH0 E;  2E8O A;  3P93 A;  4PS7 A;  4REZ A;  2M0N A;  1TS4 A;  4EOY A;  2MRP A;  3RD2 A;  3DG3 A;  2IHN A;  1OXJ A;  1HA5 A;  3A4S C;  4M52 A;  3PW4 A;  2HBM A;  4B9L A;  2C3D A;  1W1L A;  3QPE A;  2I5H A;  3FM9 A;  3LVW A;  2W7O A;  4PHE A;  2AL2 A;  2D3G A;  3LB8 A;  3MFG A;  4KMO B;  5GTI U;  1NK9 A;  1UXY A;  2P3Z A;  4O3O A;  1Z2M A;  2ZPN A;  4DYE A;  3WKA A;  2JRH A;  1XDI A;  3THU A;  4BXO A;  2PI4 A;  1UUP A;  1ZQV A;  2QJM A;  4KLT A;  3RAX A;  1S3S G;  3IT4 B;  4ED6 A;  2JU6 X;  4YG2 A;  2UYZ B;  5FXF A;  2K8B B;  2LPE A;  5ALR A;  3HP6 A;  5HR7 A;  2RAB A;  4NEW A;  1P9D U;  2WP6 A;  3WKC A;  1SJE D;  1WXV A;  3ZD9 A;  3DHH C;  3H1U A;  5CTR C;  3X23 A;  2N4F A;  1SJA A;  4P4O A;  1L5P A;  3BQ2 A;  1P7E A;  2NBW B;  2RDX A;  3LJ3 A;  2G4S A;  4XA5 A;  5KFG A;  1OFF A;  5JCI A;  2LKY A;  1Z5S B;  5D3D A;  2GQU A;  3L5O A;  2HOI A;  4CGZ A;  4UAR A;  2I1K A;  3QU2 A;  2IA6 A;  1V1P A;  3PVX A;  4PL2 A;  1SE9 A;  3NRZ B;  4HCL A;  2VKQ A;  3I6E A;  4PGX A;  4PYU A;  1MJD A;  5DB6 A;  2LRW A;  4YR2 A;  3WAN A;  2EKE C;  1LO5 D;  1J2M A;  2KVC A;  3GY1 A;  3GV5 B;  4ED2 A;  2BQU A;  3RYT A;  2ASD A;  4DL4 A;  3C23 A;  1FMA D;  2WAQ F;  1BPY A;  2J6S A;  3ZVH A;  3SSZ A;  5H92 C;  4DHZ E;  5EE9 A;  4TSS A;  1KN5 A;  4IC9 A;  1VQZ A;  3PVL A;  4YQW A;  2KZM A;  4DCC A;  2K0P A;  2JWZ A;  4UB6 U;  4DL2 A;  2GGJ A;  4FHJ A;  1L3V A;  1XLO A;  1ARO P;  3MR5 A;  2R8I A;  2MRL A;  3C21 A;  2IO3 B;  4JGH B;  2EAN A;  2AQ1 B;  3X0W A;  8ICH A;  4E4F A;  2XIC A;  1L7M A;  3AE8 B;  5FJR A;  3OJ4 B;  5DB8 A;  3NVY B;  3EWA A;  5L1K A;  4J9K A;  2KJ9 A;  2FLP A;  1RZT A;  1BVS A;  2OJR A;  4NAW A;  1YIW A;  2MBQ A;  2LXA A;  2YVJ A;  9ICA A;  2W03 A;  5TR3 A;  1ZX9 A;  2O3G A;  3SEI A;  2W54 A;  5ALO A;  3KUD B;  1EBH A;  3V4B A;  2E3T A;  4GC7 A;  2W9A A;  4PGY A;  2ZW0 A;  3DG7 A;  4WWP A;  4HKQ A;  2QAE A;  1RWS A;  1F1H A;  4UB1 A;  2KJR A;  1JQ4 A;  4JB3 A;  4UAZ A;  2OHF A;  1JW9 D;  2KFK A;  4ITK A;  3LWM A;  3WK6 A;  2KTF A;  2NRV A;  2LGX A;  4R3D A;  4GLS C;  4F92 B;  2ZTD A;  3SBF A;  3SN1 A;  3DBH B;  2AJQ A;  4DF4 A;  9ICX A;  1KRH A;  2QDE A;  2ZC8 A;  4J9O A;  3P4R B;  1S7M A;  2KDE B;  4DHJ B;  3B9J A;  2ICI A;  4DOA A;  3ETR A;  5HQX A;  5KHO A;  3RR7 A;  3IV6 A;  3R7Q A;  4II3 B;  1Q3V A;  2DYO A;  3T4W A;  3FC4 A;  4O3P A;  3PGE A;  3F2B A;  4F5Q A;  5KT6 A;  4GSW A;  2BQQ A;  2MQJ A;  1VZ7 A;  5EE0 A;  1QIL A;  5AI9 A;  3W9C B;  3D2Q A;  2CN1 A;  1MQ2 A;  4NY0 A;  1XO3 A;  3S6J A;  1X40 A;  4PHD A;  1V1O A;  3O13 A;  4FBJ B;  4MLA A;  1NPX A;  3BVM A;  2K5P A;  4F4K A;  2PTZ A;  3A0H U;  3Q45 A;  2PEA A;  4EYI B;  2FCS A;  1OQR A;  1KDH A;  1ISN A;  1W1K A;  4EE2 A;  3AEF B;  2YB4 A;  1LM8 B;  3EFU A;  4ANV A;  3EEZ A;  1HEZ E;  1ZQC A;  2YY6 A;  2QKN A;  2HI0 A;  3W8W A;  5IIM A;  3GSY A;  5I4D A;  4J9P A;  1XT9 B;  5EE3 A;  2FKP A;  1YX5 B;  2KT7 A;  3ZXV A;  4ECX A;  1A70 A;  2EQ7 A;  1XCQ L;  1ZQR A;  2ASJ A;  1ZQP A;  2NQW A;  2A4Z A;  1DNC A;  3ENL A;  3RT3 B;  2DKX A;  3BOX A;  4OZB A;  2C9W B;  1N5W C;  1ZQX A;  4BUG A;  5J2F A;  5ALN A;  3PSE B;  3TSH A;  3P1M A;  2XY5 A;  1IG6 A;  3DG6 A;  1JRO A;  4LA1 A;  2WF8 A;  1ZOY B;  1OJT A;  3AE9 B;  5ALS A;  3AE2 B;  5C0Y A;  3A7U A;  1NJW A;  4QWA A;  3SAH A;  2AL6 A;  2LI5 A;  4GN1 A;  3DPD A;  1MDL A;  3D2J A;  2EAM A;  3OAW A;  2E5A A;  1L5U A;  3QA8 A;  2ZVO A;  4L23 A;  2HVI A;  1U48 A;  1YEY A;  1SJC A;  3QXG A;  1MQ3 A;  1A5R A;  3O0F A;  9ICM A;  2WHE A;  3H4K A;  4BWM A;  2HQM A;  2PFO A;  1EWC A;  2DAF A;  5J2D A;  4YT0 B;  1FFU A;  1BT0 A;  3KW5 B;  2XO7 A;  1WGR A;  4I2J A;  1C3T A;  1MFW A;  9ICQ A;  4BZA A;  2ZJ8 A;  4CDG A;  4I2F A;  2WLB A;  3AEB B;  8ICF A;  1BPE A;  2J7Q B;  3RNC C;  4ML8 A;  1KKR A;  3CK5 A;  3RRH A;  4YMM A;  1ZQB A;  2P8B A;  5AKH A;  3I28 A;  1CQV A;  5FP0 A;  3T5J A;  2E8N A;  1TY0 A;  1AHV A;  3V7L A;  3DWM A;  9ICT A;  4DNS A;  5GRT A;  2OAI A;  2OXO A;  2AL2 B;  1G6J A;  1FEC A;  2PP0 A;  4G3I A;  5HP4 A;  2OG9 A;  3VQI A;  1L0Y B;  3K4G A;  3PW0 A;  2BDU A;  3UJS A;  4LZD A;  1F9J A;  4BXO B;  5JHA A;  2OQH A;  1S8O A;  5J0O A;  5AI5 A;  2AQ4 A;  4OVV A;  3IJQ A;  1WUF A;  4Z1Y A;  3WIM A;  3ZLG A;  4LDT B;  5HNK A;  2DQN B;  4LNI A;  3A33 B;  1NI3 A;  2LGI A;  3M63 B;  5ENL A;  1FFV A;  2LVO A;  4GYP C;  1LPF A;  5JZE B;  3GDX A;  3C29 A;  2JT4 B;  1KOT A;  4IQW A;  2DL0 A;  1KM7 A;  2G06 A;  5FMH A;  2KP7 A;  3V05 A;  4H4V A;  3HVZ A;  1U45 A;  2I9G A;  1L3S A;  1NDD A;  3SD5 A;  9ICG A;  5CP2 A;  4J9N A;  1PGX A;  2KMD A;  3FVD A;  5A0L A;  2FE9 A;  3NUQ A;  9ICK A;  1ZD3 A;  5III A;  3T5K A;  8ICI A;  1RFA A;  1V1P B;  2NPX A;  4NLN A;  2KD0 A;  1C4C A;  1WJN A;  1X9X A;  4ZOH B;  1S9F A;  4GIB A;  2J3N A;  2DEN B;  4IWP A;  2V4L A;  3EJE B;  4ECZ A;  1S0N A;  4FZL A;  1HTO A;  2WXL A;  4KLO A;  4WWM A;  4HJK A;  4IQT A;  4YR0 A;  3WU2 U;  5KT7 A;  4DL3 A;  3ES8 A;  3ZVH B;  5D3I B;  5AUK A;  1WJ4 A;  2LHT A;  2FPM A;  1UHU A;  1YQ3 B;  1V8C A;  5AIC A;  2HTH A;  3R3M A;  1KW4 A;  4UW9 A;  3RN9 C;  3DER A;  4EYH B;  4WQO B;  1KKO A;  3EEC A;  2CRX A;  2G1E A;  1GEU A;  1XU4 A;  1ZDV A;  1I42 A;  3EC8 A;  1X2I A;  3TAN A;  4MFA A;  2K8A A;  1SKS A;  3AV8 A;  2FAZ A;  2YMQ A;  3UXK A;  2PMV A;  1ZMC A;  4HNC A;  1NVI D;  3WKB A;  1NKC A;  4QIW C;  2DZJ A;  1AW7 A;  2KKV A;  3TAD A;  2ONE A;  2X8G A;  1HE8 A;  1WMH A;  2WXP A;  2F8K A;  4AS1 A;  2JVC A;  1FHU A;  4NY8 A;  4M9J A;  3IAM 1;  4FBU A;  1NKE A;  1P0R A;  2KFK B;  2ZNV C;  1ZXI A;  3TCA A;  5BMH A;  1F0X A;  2VFV A;  4KN4 A;  3KHH A;  4RQM A;  1WX7 A;  1QZE A;  1RVK A;  1PUZ A;  1JWB D;  3KHR A;  2GR0 A;  1MN8 A;  2ZUD A;  2R18 A;  3D32 A;  4JQW C;  2YVF A;  1ZQF A;  1PUT A;  4Y2Y A;  2L0T A;  3ETR B;  3AEC B;  2ZIU A;  2YN4 A;  2JSV X;  2WXK A;  1ET6 A;  2Z8L A;  2BS2 B;  4P1C C;  3Q14 C;  4XYC A;  1MOK A;  2IY1 B;  4MGY E;  2GH1 A;  2JXT A;  5AI6 A;  1ZQM A;  1BKH A;  3TX1 A;  4F4X A;  4JN7 A;  3PX4 A;  5AEK B;  4AYB C;  2PFP A;  4K4I A;  3HRD D;  3B1L X;  3VFK A;  3KLJ A;  2BPS A;  2CDU A;  3RF9 A;  3ZNZ B;  4J9S A;  3VTE A;  5KT5 A;  3Q8F A;  3RIT A;  2CHR A;  3HIL A;  2VH2 A;  1ZKQ A;  2BB5 A;  4YP3 A;  1I35 A;  4Y2S A;  1MUC A;  2D6F C;  1T7P A;  4MF2 A;  4KSK C;  4DBG A;  1UGJ A;  5F9N A;  1SV0 A;  2W43 A;  4ACF A;  2IPK D;  2HBL A;  2KOX A;  4Z6C A;  2ISO A;  2RDG A;  3BS5 A;  2XY7 A;  3BW7 A;  3SN0 A;  1RRB A;  4QZA A;  2FBW B;  1E7V A;  4IZG A;  3H4B A;  4B9K A;  1UPH A;  3TJP A;  2EAP A;  3PSF A;  1D8Y A;  4DSK A;  3OGU A;  3PO4 A;  7ICF A;  2UWQ A;  1OTR B;  5KTQ A;  3G6X A;  2BB6 A;  3FIL B;  2ZXH A;  4AWJ A;  3UI3 A;  3NVV A;  3QUQ A;  1KQQ A;  5KFB A;  3CXO A;  5DBB A;  4S0R A;  2F1J A;  2KN4 A;  4FP1 A;  4K7U A;  4DNA A;  1NK7 A;  3KOO A;  1LKY A;  1YOV B;  2RDB C;  1L8P A;  4GC6 A;  2BQ3 A;  3VXW A;  5CHF A;  4ECW A;  1U4A A;  4TQR A;  3WA0 A;  2FJ6 A;  2HCF A;  3PR5 B;  2RDI A;  1SB3 C;  3GQC A;  2KZZ A;  3K9P B;  2GBR A;  4EZK A;  2PLS A;  4KLG A;  4CRX A;  3NVZ A;  8ICS A;  1QOA A;  3A4R A;  1HSK A;  4JHM A;  4W9E A;  4PVJ A;  2EQ6 A;  1I7H A;  1WX8 A;  2O6V D;  3MAB A;  3RJ8 A;  1WUD A;  5KFK A;  3OJU A;  4EEK A;  4F8R A;  3DBL I;  5H8Y E;  1ZDL A;  2OWO A;  3GD3 A;  3B2G A;  3N6J A;  4ROP A;  2B3A A;  1GPX A;  3BWU D;  1WWT A;  3MDC A;  1OQY A;  2DWQ A;  2VAO A;  2PP3 A;  1YN3 A;  1TKY A;  1L7O A;  2WXM A;  4FE3 A;  2J6U A;  5DPT A;  4GXK A;  4YWG G;  3AU5 A;  2DYB A;  4RF0 A;  2WP5 A;  3MJ5 A;  3TSJ A;  3S1E A;  3UJF A;  5KFY A;  1ESF A;  4H2A A;  2M56 B;  2PGW A;  4RQ1 A;  1N60 A;  5KG7 A;  1T0Y A;  4M0W A;  2ATL A;  2N9L A;  4BKT A;  1PQS A;  1ZGU B;  1NHP A;  2WXH A;  1TE2 A;  4KX3 A;  3PLV A;  4C8K A;  2GH5 A;  4HYR A;  2WB1 F;  4DFM A;  3RJE A;  1RYS A;  4M01 A;  1CEZ A;  4UAV A;  3MWC A;  2AKM A;  2JH7 A;  5GTH U;  4NLC A;  4Q8E A;  9ICU A;  1EO6 A;  1L4D B;  4J9R A;  2UVU A;  4TUR A;  2D3D A;  3L8K A;  3Q8Q B;  2EXR A;  3EJB B;  4B9N A;  3R10 A;  4J3Z A;  2M8S A;  2UUV A;  5I1W A;  3T3O A;  2LJI A;  1Y8R C;  3DFH A;  4F72 A;  5J2E A;  2J4X A;  4PJ0 U;  1FIQ B;  3AED B;  1ACC A;  1WE7 A;  5AI8 A;  2UU7 A;  2YEP F;  4ACO A;  2A1J A;  4G3X B;  1X66 A;  4M02 A;  4BV6 A;  3QX1 A;  4ZRK A;  3DED A;  3SEN A;  3DJG X;  4Q44 A;  1JI7 A;  3U4F A;  4Z6D A;  4W9H A;  4IRK A;  4NAM A;  1UEL A;  1QKZ A;  1SL1 A;  3E56 A;  3PM9 A;  3W8Z A;  3E58 A;  4IRD A;  2IO2 B;  2BS4 B;  1D5X C;  1SWV A;  5HHD G;  4E5T A;  4HRS A;  4YFK A;  3U2S C;  4BUR A;  3GIJ A;  3POP A;  1K4Q A;  4QWE A;  3K75 D;  5KAI U;  1WZ0 A;  2ZCB A;  5FR6 A;  2WU5 B;  3KYD D;  4AUQ C;  5L95 C;  1W1J A;  9ICR A;  1X2G A;  3DDH A;  5JRT A;  4CE6 A;  4JK1 A;  9ICB A;  4BBN C;  4F50 A;  3ZGZ A;  3T9P A;  2N1V A;  3LAE A;  2FI1 A;  1EU4 A;  2CU1 A;  3VR9 B;  2QVH A;  4CYE A;  3AE1 B;  3H0R B;  4A55 A;  2JUO A;  3BQ7 A;  3C28 A;  1RXW A;  3DDC B;  1KFS A;  3V3X A;  1MBT A;  4UBC A;  3DK4 A;  3QJZ A;  1V2Y A;  1QQ5 A;  2VA8 A;  1WCL A;  2KWD A;  1UNS A;  3C0P A;  2EMT A;  5KG4 A;  2MBO A;  3HX0 A;  1Y56 A;  2BTE A;  1F9C A;  1WMH B;  5DB9 A;  5D2M B;  1X42 A;  2IYD B;  5MPO A;  3N1Y C;  4NWI A;  3AEG B;  2ZCC A;  3LXF A;  4BAX A;  4K1W A;  4NL9 C;  1V5T A;  2WHI A;  1GRA A;  2DLB A;  4K7Z A;  4ECV A;  1E8F A;  3H8W A;  1NJZ A;  3IJI A;  1KJT A;  3PPA A;  1R6W A;  3S47 A;  2DPI A;  2NBU A;  1TKG A;  1OQQ A;  1JCK B;  2MSE D;  4JB1 A;  2YB1 A;  4UB4 A;  4HN8 A;  3HVD A;  1BZL A;  1ZY8 A;  4DEZ A;  5BMG A;  1WYW B;  3ED5 A;  4O3R A;  2WDT B;  1QOB A;  1Z4N A;  1VAO A;  2BR0 A;  3AMZ A;  2PPH A;  4IDI A;  1TFR A;  8ICA A;  1P7D A;  3OTQ A;  4RZR A;  1SV4 A;  4KDI C;  3VDZ A;  2POD A;  2Y08 A;  3PRM B;  4Q2J A;  4EBD A;  7ICL A;  1X9M A;  2LVQ A;  4DO9 A;  2R2O A;  5AHX A;  1N61 A;  2G5I B;  3AEA B;  4HPM B;  4FA6 A;  1KBU A;  5J17 A;  1SIJ A;  2UUU A;  2Y1I A;  3OWE B;  1K5O A;  2LVP A;  1FNU A;  4MMW A;  7ICJ A;  1NU5 A;  4NJ8 A;  2KK8 A;  2WXO A;  4OJ5 A;  4YTM B;  1QSS A;  1GJZ A;  4HVB A;  7ICP A;  4DS5 A;  1XO1 A;  5CX3 A;  3WAL A;  2FDR A;  3P3B A;  2W9B A;  3SZ2 A;  3V61 A;  4M6U A;  4O9M A;  4MEX A;  1H4R A;  3L3F X;  5E79 U;  2R2Q A;  3BS5 B;  2AXR A;  4UB3 A;  1Q8K A;  5KFN A;  1ONF A;  4IHC A;  3UCD A;  1COK A;  3MR2 A;  1QQR A;  2ONQ A;  3P63 A;  3ABV B;  1ZET A;  2XID A;  1XSP A;  1RAX A;  2RK5 A;  3A1Q A;  1GRE A;  1TZZ A;  4ELV A;  4QZG A;  3ZDM C;  3VC6 A;  2XK5 B;  3NVV B;  5JUM A;  4USA A;  1NJY A;  2EZY A;  3G6Y A;  4KMU A;  5J8Y A;  2ASQ A;  4KLE A;  2WPE A;  4IP5 A;  5EOZ A;  1TZ1 A;  4LCD E;  1LKY B;  3QZ7 A;  5ALJ A;  3MJW A;  9ICE A;  5ALV A;  4QNL A;  3NFU A;  1ZQJ A;  3DBR B;  3AEV A;  3V6K A;  3SJN A;  4EX7 A;  3EAN A;  2OZ8 A;  2WXQ A;  3ZTC A;  2IMW P;  3RR8 A;  8ICU A;  3V6H A;  5TSS A;  2RPV A;  1NK4 A;  1SEB D;  1V80 A;  2MBE A;  5BOM A;  2HJ8 A;  1B4F A;  3I6T A;  1X6I A;  4UB5 A;  4RM9 A;  3TTE A;  3ZUN A;  2OZT A;  2JGA A;  1Q5W B;  2DBY A;  1NYR A;  5DG9 A;  2W9N A;  5LLI A;  4KX5 A;  1TZO A;  2AH5 A;  3PV8 A;  3DQ0 A;  1KKX A;  4F4Y A;  1DZN A;  1JIH A;  1FCL A;  1QLU A;  4IW0 A;  1FXT B;  3UF8 A;  5ALL A;  4KLQ A;  2NR2 A;  5ALW A;  2AGO A;  2D11 A;  3NTU A;  2Y3A A;  3L17 A;  4II2 B;  4AJW A;  3CP8 A;  3ZI4 A;  1ET9 A;  4J9M A;  3BQ0 A;  2QEJ C;  3AH7 A;  3MUC A;  5FK9 C;  1IYF A;  2EZZ A;  2N7J A;  3KFU F;  1Q0W B;  4DLG A;  2Y5C A;  2PLP A;  2VA2 A;  4DL7 A;  3TEX A;  3DGB A;  3EAO A;  5L6G A;  1VDV A;  2YLM A;  4ECU A;  2NBV B;  2IGH A;  4RQ3 A;  5L1I A;  2RGF A;  4OVU A;  3IP4 B;  4EEN A;  1J7B A;  3L54 A;  3VUW A;  4KPR A;  1A77 A;  1D9D A;  2W0H A;  5E6P A;  4ZHO A;  1M6I A;  4UD8 A;  2OLA A;  1NZB A;  2WYQ A;  3CGE A;  4NPN A;  5DDM A;  4ZOH C;  3W5V B;  3IG8 A;  5KFE A;  1YJJ A;  4W9C A;  2R61 A;  3DBH I;  3NOB A;  1FEH A;  3KKA C;  3R2I A;  3BZK A;  2A1J B;  1HXY D;  2FCQ A;  3VRB B;  3VTU A;  4EBE A;  4K1R B;  4TV3 A;  2WX1 A;  5DBC A;  5BOE A;  3N32 A;  3VUX A;  2N7E A;  3QQ8 B;  1ZMD A;  1UT8 A;  1NK6 A;  3VTV A;  4I2D A;  4IR9 A;  4J3O D;  3FDS A;  1BQG A;  2P6U A;  1GRG A;  3URY A;  2LEK A;  3RTV A;  8ICP A;  4US9 A;  3PX0 A;  2KWU B;  2YQU A;  1XHC A;  3ISD A;  5FKA C;  3R07 C;  4UAY A;  5HML A;  4MT5 A;  1XSL A;  1LXD A;  3RJA A;  3QZ8 A;  3N3K B;  2J0M A;  2WP9 B;  2L7R A;  1D8L A;  1YJ1 A;  3L16 A;  2LGD A;  2EZX A;  3NRW A;  4P1B C;  3Q6J A;  3JPS A;  2YMP A;  4IWQ A;  1LVH A;  4F71 A;  2CHX A;  2CPR A;  4ED8 A;  3EA6 A;  4Y2T A;  1E0Z A;  3PLU A;  3HW8 A;  2WXR A;  3P4Q B;  3SV4 A;  4HDQ A;  4E0D A;  1ZRM A;  1GSN A;  2K25 A;  1WG8 A;  1NK0 A;  3KWL A;  2P4P A;  2HXU A;  4MM3 A;  2KWV B;  1Q1W A;  4O3Q A;  4IG7 B;  2Y9U A;  2KAN A;  3WK8 A;  2KAJ A;  3L5K A;  3PW2 A;  3PO5 A;  2V3A A;  3EUB 3;  4NQK E;  4KKJ A;  4C8N A;  4I2C A;  5AK5 A;  4JWS C;  2VJ5 A;  4YCX A;  4J03 A;  2JWU A;  3OLM D;  4IL2 A;  2K60 A;  3AU2 A;  5D46 A;  4IOI E;  2VRR B;  2XY6 A;  2FMS A;  1MG8 A;  3IAS 1;  4GIR A;  2H88 B;  4RQ2 A;  1RQN A;  3H0L B;  3BQ1 A;  2I1Q A;  1V97 A;  3ZJV A;  3OHA A;  1K53 A;  1L6U A;  1PK3 A;  3U4E G;  2XGZ A;  2QJL A;  2FID A;  3S5S A;  1YD8 U;  4RQ4 A;  4P0P A;  3AE7 B;  3MC8 A;  4N59 A;  1DXL A;  5J18 A;  1NDA A;  1Q46 A;  3BS7 A;  4EMI A;  2ZEQ A;  2FMQ A;  4L2Y A;  4O1N A;  5G5H A;  1N62 C;  1N63 A;  2GWS A;  2K3U A;  4KX6 B;  3I3T B;  3Q8A A;  1R4M B;  3C2K A;  2ZJD A;  2YX8 A;  2DNF A;  4YXJ A;  4XDD A;  3D2H A;  1JDF A;  4ZCW A;  2BVC A;  1C78 A;  3GU3 A;  3D6J A;  1E7U A;  4W9L A;  4EFO A;  1Q1R A;  4W9F A;  2KDI A;  4QZE A;  2HMX A;  5KAF U;  3KLS X;  2L32 A;  1V5O A;  3KYC D;  3RZF A;  4TUP A;  1JOA A;  3E2E A;  1YN4 A;  4ECQ A;  3URH A;  3HHM A;  1IIP A;  1CUK A;  3V7J A;  1CRX A;  2H3V A;  4RM8 A;  2LGS A;  4M2Y A;  2W04 A;  5BOF A;  1GC7 A;  4JV1 A;  3APD A;  1VD2 A;  3C1Y A;  4RGM A;  1R0M A;  3R0K A;  1ZUD 2;  4H1Z A;  3A1Q B;  2OOB B;  4NLG A;  3P4P B;  4RQ5 A;  4K7W A;  2BKE A;  1C77 A;  5AKL A;  3Q2A C;  4HRO A;  4A20 A;  1RLF A;  4K8D A;  5IKC M;  3FW7 A;  2YEP B;  3VTW A;  4APN A;  5AKZ A;  1O08 A;  4RGN A;  3GC2 A;  4A6G A;  2K8H A;  3MGV A;  8ICR A;  4M9L A;  1WX9 A;  1SXE A;  4RPY A;  3PWG A;  3R1Z A;  5AI0 A;  3SD7 A;  2WAQ C;  3KUM A;  2PMQ A;  4E6M A;  5IO9 A;  4EQR A;  2HBJ A;  4UDU C;  2L3Z A;  2GQT A;  5KFQ A;  2ON8 A;  1GOZ A;  5KG6 A;  5B5E U;  1SE3 A;  4PS8 A;  4WWO A;  3VVW B;  4URK A;  2BC0 A;  3H8H A;  4TUS A;  1UWM A;  2NO5 A;  1BPB A;  3H7P B;  4K3C A;  1HUO A;  3N30 A;  5ALH A;  3L4P A;  2FUH B;  4UAS A;  2KV2 A;  2J53 A;  1F0M A;  4W9G A;  1E9I A;  1H6V A;  1UA0 A;  1FCC C;  5DG7 A;  4GIS A;  1E8H A;  3NUH B;  2JEI A;  3SHQ A;  5J2J A;  1WSP A;  2JZZ A;  4H4P A;  4G9B A;  2Q4T A;  3R66 C;  3ZTD A;  4M9N A;  4HEA 1;  3AUO A;  4F4R A;  2OFJ A;  1E8Z A;  3A9J B;  2HOQ A;  2GBK A;  4IP4 A;  1C4A A;  2PI5 A;  1C20 A;  4UB8 U;  2LYB A;  2H3F A;  1YNT E;  1UQV A;  2F3N A;  5KL8 B;  3HM6 X;  5EWE A;  2C2E A;  2XH2 A;  3SQP A;  4C8M A;  2JQR B;  2XCA A;  5J29 A;  3JSV A;  3ES7 A;  2ZW1 A;  5KG3 A;  2GRI A;  2QQ6 A;  3K1Z A;  3IVF A;  2JHD A;  3TCS A;  1L3T A;  3K9O B;  4YD1 A;  5DQG A;  3TSS A;  1XNS A;  3UIN B;  4BKS D;  2KIW A;  2N1W A;  7ENL A;  2ZIV B;  1IBX B;  3PSI A;  2KKC A;  2I5Q A;  3D46 A;  5HHZ A;  1QOF A;  4KZ0 A;  5KFC A;  1XLP A;  2DHZ A;  4EQS A;  1KTK A;  3ML8 A;  2REX A;  3BZC A;  2Z7J A;  3VH4 B;  5CA7 A;  3RPF C;  2KX0 A;  4UQG A;  4RGO S;  3SU8 X;  1ZQ1 C;  2INN E;  2QB1 A;  3DES A;  1QTM A;  2FUG 1;  1GES A;  1L8L A;  2IY0 B;  5AKE A;  4MFF A;  7ICN A;  2M17 A;  4H19 A;  3EFC A;  3SYZ A;  2ESE A;  4HNL A;  4AP4 C;  2PMZ F;  1M94 A;  1AAR A;  2PGE A;  2EDU A;  5L9X A;  5KFZ A;  1VZ6 A;  3RH4 A;  2C7H A;  2B76 B;  1TIF A;  3WCQ A;  5JCN A;  2DGZ A;  2GO7 A;  1R7S A;  3C2L A;  3RJG A;  2ZZC A;  3SR6 B;  1U9L A;  2HHV A;  4H4X A;  2WXN A;  2MJE A;  3FG2 P;  4F93 B;  4GRT A;  1DOQ A;  5JTI A;  3TAD C;  2W11 A;  3GO2 A;  5CWR A;  1P98 A;  3TMP B;  1FEZ A;  2MJD A;  4NJC A;  2D07 B;  5J0X A;  3SAF A;  2GBN A;  2YVC A;  3B08 A;  4J56 A;  1J7A A;  2GQW A;  4JQ9 A;  4BWJ A;  5AZH A;  3U7D A;  4MM3 B;  3TL5 A;  3TEW A;  1RYJ A;  2MUC A;  3MC0 B;  1BNP A;  3IBE A;  4ARC A;  1ZKH A;  1XWL A;  2F2A B;  5AK4 A;  4P0Q B;  3DWG C;  2KVZ A;  3APC A;  3CGC A;  4IL0 A;  3SN4 A;  1QSL A;  4FLH A;  1NBF C;  1TS2 A;  3BII D;  3DQV A;  4HCP B;  5HHI A;  3PRP B;  1E10 A;  2HXT A;  3PFR A;  1ZQK A;  3TKA A;  3ZNH B;  2X50 A;  5BYQ A;  2SEB D;  5LXH A;  1ZK7 A;  1GRF A;  2NO4 A;  3CF6 E;  2NPT A;  1SJB A;  1JEH A;  4DLE A;  8ICT A;  3OTR A;  4MFC A;  3RUI B;  1UH6 A;  2DYM A;  3QLD A;  3TAR A;  1TK8 A;  2K9X A;  2O6V A;  3CST A;  4JV0 A;  2B6G A;  3DJJ A;  1HEK A;  5F9L A;  2PTY A;  4G7F A;  4QZC A;  2TPR A;  4EEL A;  1Y88 A;  5ALD A;  2V3S A;  4KLU A;  3B0A A;  1ZJM A;  3ORY A;  3UXN A;  4MF8 A;  1BML C;  3VA8 A;  3T79 A;  1UBI A;  5G5H B;  1ZXI C;  2V6O A;  1S77 D;  1T3Q C;  1EF1 A;  1MI0 A;  2V4Q A;  2KTR A;  2WBA A;  7ICI A;  4LK0 M;  1K1S A;  3ZW3 A;  2WNM A;  3MP9 A;  3N20 C;  4JUZ A;  1S76 D;  4GB9 A;  2XH7 A;  4IC7 B;  3RJI A;  4EZL A;  2F1H A;  2OCE A;  4DSJ A;  5KVI A;  4NXZ A;  4DQI A;  2MNR A;  4XUS A;  3NO1 A;  1YZ6 A;  1YQ4 B;  1ZD2 P;  5EWG A;  3JPP A;  2AL3 A;  3Q69 A;  2KOB A;  4GDK A;  4F1S A;  3VCN A;  2AGP A;  1WZ3 A;  5J2I A;  2ZAD A;  5DLF A;  2JRI B;  5HI1 A;  2JK6 A;  2GRT A;  2KFN A;  2PKO A;  1T4G A;  1JRU A;  3RNM A;  4GXB A;  3M8S A;  1KFY B;  3JVA A;  3OJS A;  4ZDV A;  2IOF K;  4JN8 A;  1MHX A;  3GB1 A;  2MUT A;  3TIX A;  1V9P A;  4RPX A;  1V85 A;  4RUC A;  4F2S A;  1RDF A;  3BK2 A;  1WJU A;  3HKZ C;  4NLZ A;  2MX2 A;  4YMO A;  5KFS A;  3Q3J A;  3WAO A;  3W8X A;  5C2T B;  4KDL B;  2PA6 A;  3R7R A;  2OPJ A;  3HK0 A;  1QQ7 A;  1GRH A;  4W9J A;  2MBH A;  4K3B A;  2WXJ A;  3KQ4 A;  2FE8 A;  1W1Q A;  5J0P A;  2BBC A;  4B9V A;  5CJ7 A;  1ZD5 A;  4R64 A;  3N4F A;  3RRG A;  1A6S A;  3Q8E A;  1PGA A;  3VR8 B;  1N60 C;  2OED A;  3FXG A;  4CF5 A;  1YN5 A;  5FS7 A;  2ALZ A;  3SEB A;  2WOW A;  1A76 A;  2PU1 A;  1GV4 A;  1SGH A;  2PFN A;  1EF5 A;  1WWU A;  1K51 A;  4DHZ B;  3APF A;  2BC1 A;  2WX0 A;  1NZP A;  1FRR A;  4JE3 B;  5TR5 A;  1DII A;  3DDM A;  5FS6 A;  4JMU A;  5KNI A;  4DXG A;  1L4Z B;  3ZJT A;  2LBO A;  4GXI A;  3EPI A;  1NKB A;  4C7Z A;  1YQZ A;  4QZ9 A;  5AKY A;  4WJQ A;  2N9P C;  3VC8 A;  2UVR A;  3H6N A;  4HWI B;  3CXB A;  3CAW A;  1FXI A;  1YX6 B;  2KJ6 A;  2M1M A;  5JCM A;  3TAP A;  1WJ6 A;  1I4H A;  2JEF A;  2KMA A;  1YQB A;  2LHD A;  3RBE A;  1D5M C;  3SFE B;  4DDI D;  2AX5 A;  3TQ1 A;  2KVS A;  4I2E A;  5KFI A;  3FV9 A;  1V38 A;  5AK3 A;  2K89 A;  1TKD A;  4NAW B;  1WF9 A;  2IZV B;  2DAJ A;  3BJS A;  2RP5 A;  1UWX A;  1NEL A;  3S1F A;  5KFF A;  4DOC A;  1WWV A;  3P42 A;  4NLB A;  1F77 A;  1B22 A;  1XLN A;  2K4I A;  1F8W A;  3RFZ B;  2LD9 A;  2JMG A;  3N9Y C;  2K39 A;  3BYT B;  3Q3M C;  4I2I A;  2HW3 A;  4BX9 C;  3C8Y A;  4MSM B;  5IIO A;  1B43 A;  3N7S C;  4EM3 A;  2OX4 A;  3BVG A;  4FBT A;  2BHN A;  3H8J A;  4IRC A;  2HE7 A;  2J52 A;  4EWJ A;  3RJH A;  3Q8M A;  2HHS A;  3H40 A;  1JXE A;  4Y2R A;  5D6J B;  4OCZ A;  3B9J B;  2GBJ A;  5AE2 A;  1VZ8 A;  2Y3S A;  2JY6 A;  3W1S C;  3B0Y A;  9ICH A;  3T3N A;  3QUB A;  3I57 A;  4QWD A;  1ZQA A;  7ICU A;  5KT2 A;  3KHL A;  2D3C A;  2LM1 A;  5KFO A;  3CT2 A;  3O0H A;  2C7M B;  7ICH A;  2QLT A;  4RPZ A;  4DSI A;  2IJ0 A;  1EM7 A;  2XVT A;  1HZ6 A;  4XLO A;  4CF3 A;  2KJH B;  4CNQ A;  3TFS A;  3RJJ A;  4RU9 A;  4KGS A;  2F1I A;  3TW9 A;  1JWA D;  4TVY A;  1EU3 A;  2KFJ A;  3QTP A;  2AQ2 B;  2J42 A;  3GRT A;  4RQ8 A;  3DHI C;  5EE1 A;  4CCH A;  1SZH A;  2K1F A;  5CHW A;  4J1O A;  3MR6 A;  2YTU A;  4JWN A;  5DBA A;  7ICS A;  4NM2 A;  1KH0 A;  2JYE A;  2LHE A;  3SV3 A;  8ICL A;  3V5F A;  3IG5 A;  4FUL A;  5DPW A;  1WGY A;  1N5W A;  3TI0 A;  4R66 A;  1KFT A;  2QIE B;  4R65 A;  2Y4G A;  4DWD A;  3DBR I;  5AM3 A;  5DKW A;  1S10 A;  2XEW A;  4E71 A;  1GC6 A;  2W3R A;  1JPD X;  2NPT B;  4J9L A;  3ZVV A;  2GOL A;  4CO7 A;  4DWF A;  4MEM A;  3KJM A;  3NS1 A;  1J2N A;  4O3N A;  1SXD A;  3PRZ A;  2IPI A;  1ZQY A;  5L83 A;  2O6V B;  3RCY A;  1W6T A;  3LDZ E;  5C3J B;  2GDQ A;  4EM4 A;  2Q5W D;  4DK5 A;  2V3N A;  4PVH A;  4DSE A;  1NHS A;  3DEE A;  3MGH A;  4ECS A;  1FHV A;  2EQY A;  1SF0 A;  4RNO A;  3PZP A;  2NRT A;  4KGT A;  2WB1 C;  2KK0 A;  1SL2 A;  5AM0 A;  1X9W A;  3NZ3 A;  1IUE A;  1F2R I;  1M4V A;  3RB6 A;  4WJP A;  2ASL A;  1S97 A;  4FZM A;  2Y0S F;  2G5H B;  2JPH A;  4FS1 A;  2QIL A;  2G9H D;  3VRA B;  5D4B A;  5AIB A;  4P16 A;  4HJG E;  3UGV A;  2PE6 B;  5KFD A;  3PS6 A;  5ALM A;  2XNA C;  3RI7 C;  1EC7 A;  3QYP A;  3DVN V;  1JWS D;  3S1C A;  2OEH A;  2WDR B;  1OUQ A;  5J0Q A;  2NTS A;  3TQP A;  2ZIW A;  4IUM B;  1E5W A;  1JMS A;  4BC9 A;  4ZRI A;  1ZQQ A;  2H3Q A;  8ICY A;  4I28 A;  1Q10 A;  3A9K A;  3NZS A;  4F8C B;  3TOY A;  2JXJ A;  1ZQE A;  2XSX A;  1MPE A;  5KFA A;  4LZG A;  4OAL A;  2MUT B;  2KHV A;  3RNG C;  2NV3 A;  1K1Q A;  1XS2 A;  8ICB A;  3TAC B;  4ED3 A;  1S0M A;  3DVN U;  4A9A A;  2CU3 A;  3IFW B;  2WDV B;  4C56 C;  2MSN A;  1ZRN A;  2VH1 A;  3SQS A;  3VDG A;  1UT5 A;  5AZG A;  3ZYY X;  2DPJ A;  1KF6 B;  1ZOL A;  2IO0 B;  3V7K A;  2KQS A;  4Z6F A;  3EJD B;  1AOG A;  3ZXR A;  5DLG A;  3QE9 Y;  3CGD A;  2MBB B;  4FJV B;  3I9V 1;  4TQ1 A;  3ALR A;  4I2B A;  1DK3 A;  4GME A;  3DFY A;  2LUE A;  5FJU A;  2Z0E B;  2WOI A;  1TY2 A;  4P4P A;  1WCN A;  1P3Q U;  2WGS A;  4KLD A;  3ZO5 B;  4Q8F A;  4AJY B;  4EEY A;  3GII A;  2XGQ A;  2Y1J A;  5J0S A;  1KLU D;  1DOX A;  3OSP A;  2GL5 A;  3M9O B;  5IIK A;  1XQQ A;  1SBB B;  2QDF A;  3MC1 A;  1XPY A;  3IXS A;  5EWF A;  7ICG A;  2WDW A;  3F2D A;  3RJF A;  3RH6 A;  2D5G A;  1WVE A;  1L7Y A;  8ICE A;  3VCB A;  3B97 A;  1T5X D;  5ER0 A;  5EU9 A;  2H5X A;  2ZTC A;  2ZJA A;  3PW5 A;  2V4I B;  5KFX A;  4LNN A;  2C2R A;  3S2A A;  4B6W A;  5EBK A;  3QKE A;  4XQ8 A;  5KFJ A;  4HDO A;  5LXI B;  4H4Q A;  1WM3 A;  2GLS A;  2QJN A;  4BOS C;  3EZ5 A;  2PKE A;  2ZG6 A;  1JWU D;  4RNN A;  3U52 E;  3KBB A;  2LYA A;  8ICG A;  2KJ8 A;  9ICP A;  1TS5 A;  2P6R A;  4ZA0 A;  2MCN B;  4HK2 A;  5FXD A;  1R4N B;  1NOM A;  2YQE A;  4UAT A;  2EQ9 A;  5C1Z A;  3AE5 B;  2KNB A;  3AUL A;  2W9C A;  3ALB A;  3L08 A;  3AL0 B;  4I6N B;  3T5L A;  2KJ5 A;  4FX9 A;  2GOW A;  3AU4 A;  4YXD B;  5KFT A;  3NY5 A;  3PWI A;  1HUZ A;  1V6E A;  3IN5 A;  5FJO A;  2VA3 A;  3MQT A;  1P43 A;  1ZQN A;  1Z00 A;  1I4G A;  3DGH A;  2EQ8 A;  3CGB A;  3U26 A;  2DKZ A;  4JV2 A;  2VJ4 A;  1L6V A;  4M04 A;  3JPN A;  5DG8 A;  4QWC A;  4B0E A;  4NM1 A;  1D4B A;  1SIF A;  3H0M B;  2BWF A;  2ES6 A;  2C28 A;  4MH8 A;  4RCO A;  5TZV A;  4IT1 A;  2C3C A;  3RO6 A;  4O0I A;  2ZIU B;  4RMA A;  1F5S A;  5J2A A;  3D47 A;  2IOF A;  2M4N A;  5HMM A;  1R4M I;  3VFC A;  4ZHP A;  1C1Y B;  4DDG D;  2INC C;  3RFA A;  3UMG A;  5ALK A;  2M0X A;  3HPO A;  4BBN F;  3K1R B;  3LVV A;  4FZN A;  3F5A A;  5J0W A;  1MSW D;  4IWO A;  2BYT A;  4C4T A;  2OQY A;  4MKS A;  4U7C A;  1WY8 A;  2MA9 B;  3Q8L A;  4KIT B;  3BDP A;  1L0X B;  1H8C A;  1X1M A;  4E4U A;  3RMK C;  1GO3 F;  3B0X A;  3L13 A;  4PK1 A;  3UQ0 A;  9ICL A;  3II4 A;  4QW8 A;  4JWU C;  2BQR A;  2JRZ A;  2VAN A;  3FKY A;  1T3N A;  2N1R A;  3NS8 A;  2WPF A;  3KZX A;  4LII A;  3I63 C;  3N28 A;  1WM2 A;  4JX1 C;  2AXT U;  4OVZ A;  1HIW A;  4B9U A;  3I99 A;  2GGI A;  2P88 A;  4Y2Q A;  3UQA A;  3NVW A;  4K81 A;  5ALP A;  2C22 A;  2ZIX A;  1XS9 D;  4H50 A;  3UQ2 A;  5BO4 B;  2A8X A;  2KIC A;  2E1E A;  4QZI A;  1E8G A;  3PZ8 A;  4P2H A;  1PGB A;  3GIM A;  3AQF A;  3CMM B;  4HXD A;  4ICU A;  1T0R C;  2LI6 A;  3PQB A;  4C80 A;  2W9M A;  2LM4 A;  2E5S A;  4UB2 A;  1FM0 D;  3AE4 B;  4IL6 U;  1I4R A;  2KSO A;  2K4E A;  2IGD A;  3NVZ B;  1EBG A;  2L0F A;  3UM9 A;  4B9S A;  4YN4 A;  5L1L A;  3PY8 A;  2L8J A;  2WXI A;  1K50 A;  3C5G A;  2HJ1 A;  1W1M A;  2J6T A;  3A7A A;  5H2F U;  3ZQ4 A;  4I6L B;  1Q3U A;  2CJN A;  2KEY A;  2YMM A;  3M3J A;  1RXV A;  4DXA B;  4FDC B;  3Q4D A;  3EYZ A;  3NGD A;  4H4S A;  3QU7 A;  2KDB A;  4RUA A;  3LB8 C;  2HSZ A;  3SDL C;  1J0G A;  2K8B A;  1ZQD A;  5DGA A;  1N48 A;  1L6N A;  4O5K A;  5KG1 A;  2MP2 A;  2FLN A;  3ETL A;  3M7D A;  1NEN B;  3ZJU A;  8ICC A;  2BF8 B;  1U4B A;  1ZR6 A;  3P2B A;  1GB4 A;  2DFL A;  4M0W B;  4PVK A;  4YMN A;  3GFK B;  4X57 B;  3QX7 A;  3WK5 A;  4M9G A;  4TVW A;  1IGD A;  3A9K B;  3P0W A;  4RNM A;  3AEE B;  5KT3 A;  2QPM A;  3R0U A;  3P4S B;  4BKS A;  4RQ7 A;  4HPP A;  1D3Z A;  2WOV A;  3R2T A;  5D7G A;  4YXM A;  5J0U A;  1KD0 A;  1XEE A;  4PS3 A;  3H7P A;  4M0A A;  3OPX A;  3BQT A;  2CXY A;  3M1Y A;  4KWS A;  4IS7 A;  2P0I A;  1XO0 A;  3RZW C;  2XN9 C;  1FPY A;  5J2K A;  4X2P A;  1B0X A;  4M47 A;  2AHO B;  1TV9 A;  1BUI C;  1DGS A;  4RH6 A;  1XXG A;  1T6B X;  5KFL A;  2G45 B;  3UGB B;  5JH5 C;  4QZF A;  2PE9 A;  2V4R A;  3C19 A;  2PVG C;  4MSQ B;  4ZYS A;  1QH9 A;  2C5L C;  3RNE C;  1PFD A;  1RYU A;  3LWL A;  2KG5 A;  1BPZ A;  1WIA A;  3T8M A;  4DN1 A;  2QAR A;  4XX5 A;  5HR6 A;  3T8Q A;  3M9N B;  5TIS U;  3WAP A;  2ZUC A;  3NVY A;  1XAN A;  5ALI A;  1ECQ A;  3VCC A;  2XI9 A;  1WGH A;  3C1Z A;  1EXN A;  4IM2 A;  4DQR A;  2W55 A;  5IAA C;  4YSX B;  1MBB A;  3N4E A;  5AM5 A;  3BK1 A;  3TEZ A;  5ALG A;  4A6Q A;  4FI4 A;  3R9K A;  3RNF C;  3JYU A;  5KFM A;  1ONE A;  4PHA A;  2Y5B B;  4EC3 A;  4YSY B;  4PL1 A;  3MBY A;  3A0B U;  1N6Z A;  3TJI A;  4O5C A;  3KUC B;  4PYT A;  1V49 A;  3AM9 A;  4XWT A;  3HIZ A;  2WF6 A;  1RG6 A;  1C4P A;  1ZYQ A;  3AE6 B;  1B9R A;  2EMS A;  1ZE3 D;  4MEY A;  1CJE A;  4NL9 A;  4ZRQ A;  3D9X A;  3WKE A;  1URJ A;  2RMM A;  1TAU A;  4KLI A;  2W9C B;  4CF4 A;  4HPN A;  3ZNG C;  2JYT A;  1ZD4 A;  1WFY A;  4F3O A;  1RPL A;  2FPK A;  3PK7 A;  3TAQ A;  5G5G A;  1DOY A;  1Z00 B;  3F2C A;  4Z17 A;  5DPR A;  3SAG A;  2NRX A;  1B1Z A;  2INP E;  3OHB A;  2O2V A;  3HRD C;  1D8B A;  3K1G A;  2BKF A;  2BCV A;  1ZPS A;  2WTF A;  4EMJ A;  2VFU A;  2GSH A;  2R2Z A;  3O65 B;  1SGG A;  3LDA A;  4TMA B;  3PMN A;  1XC9 A;  3BIN A;  2MBR A;  3DVG X;  8ICX A;  3MSY A;  1QLB B;  1SE4 A;  4JAY A;  3TFR A;  2W82 A;  3PG6 A;  3M6K A;  3V72 A;  5ALF A;  1H38 A;  3OSN A;  1YMH E;  3MFH A;  2KX3 A;  3L10 B;  4ANX A;  4TUQ A;  3GE3 C;  1CMX B;  5GXG B;  3N1X C;  5BMI A;  1HJP A;  2ZZ0 A;  2QC8 A;  2VZK D;  3TBL D;  9ICV A;  2HHT A;  1AWD A;  2PTW A;  2YAU A;  4KLJ A;  4H4U A;  4O3S A;  5AZF A;  1X9S A;  1N5X A;  3W1Y A;  4QZ8 A;  1MA7 A;  5EDS A;  2BVH A;  2D2Q A;  2GGE A;  3CWI A;  1Z19 A;  2CHZ A;  4DS4 A;  3DGZ A;  3BJY A;  5JCL A;  3MDA A;  5E6N A;  2W9B B;  1EC9 A;  5AKI A;  2ZTE A;  3GOE A;  1IM4 A;  1ZQW A;  3JPR A;  1Z1B A;  3NG0 A;  1KSP A;  4XWW A;  4MGG A;  4PYZ A;  1SL0 A;  1RM6 B;  2JZ3 B;  4LJO B;  4HCN B;  5I1V A;  1PK1 A;  3M9M B;  9ICW A;  2BYF A;  2DZK A;  4BJQ A;  7ICE A;  1DGJ A;  2GMI C;  3PV1 A;  1ZQT A;  1STZ A;  3OPS A;  2JXX A;  2W8K A;  1TKK A;  2K6Q A;  3QU4 A;  2R8J A;  2IOH A;  4HAI A;  2ZIX B;  4PH5 A;  5BOL A;  2PXI A;  3AQE A;  3RB0 A;  1L3U A;  4N58 A;  2R9Z A;  3QU9 A;  3ICX A;  7ICR A;  2BVG A;  3TUO A;  3R25 A;  2JH1 A;  4IKG A;  1WR1 A;  4IR1 A;  2G4D B;  2XH0 A;  1ED1 A;  5ALT A;  5KFR A;  2HVH A;  1FFU C;  3DH9 A;  4JDR A;  2B0C A;  1L8O A;  2KLG A;  2JX5 A;  2KSO B;  3QU5 A;  3Q8B A;  3GIK A;  4H4R A;  5JU5 A;  5J2H A;  4WJ3 B;  1ZQH A;  1IYX A;  1MO9 A;  3I76 A;  1M6Y A;  1E0Y A;  1U47 A;  2KDM A;  5L6F A;  1A0P A;  1WRD B;  1QLN A;  4XZ4 A;  2X8H A;  4E8G A;  2QKQ A;  3VH3 B;  1FO4 A;  2LFI A;  5FJT A;  4FO6 A;  3GS2 A;  1E8Y A;  4R63 A;  1GXF A;  3ZDE A;  1V59 A;  1CZP A;  3DHG C;  3RRA A;  3S1D A;  4Y2V A;  8ICZ A;  2BCU A;  2BPC A;  4HCH A;  5IA7 A;  2MP2 B;  1I4X A;  5KG2 A;  2HOF A;  4EUT A;  4A3R A;  4OHJ A;  2FMP A;  3E9S A;  1J7C A;  1QOG A;  3MHS D;  3PRE A;  2DUY A;  3T9L A;  3UJ2 A;  3JW7 A;  5KT4 A;  1F0Z A;  1FFV C;  4KEM A;  2LXC A;  3F5E A;  4NZL B;  5U1O A;  3CYM A;  3MFI A;  2ZZB A;  5IP4 D;  3RUL A;  3PST A;  1STE A;  2E8P A;  4G0N B;  1YZ7 A;  1TTN A;  3MHZ A;  5E6J A;  2XGP A;  4DFD A;  1WE6 A;  1QCK A;  3GZN B;  3KHG A;  1VJ5 A;  4QZH A;  3UJR A;  4LTU A;  4OZA A;  2PMZ C;  2CKH B;  2WF9 A;  3QK0 A;  1KLN A;  2Q0Z X;  4G50 A;  1WGD A;  1AHZ A;  5FXP A;  2A1A A;  3HW2 A;  5F3X B;  4RQ6 A;  1ZQL A;  4PGQ A;  3KKA A;  2RDJ A;  4KLM A;  4IQU A;  1F52 A;  1WR6 E;  1MNS A;  1RFK A;  2V9W A;  4K4H A;  3C5F A;  4E74 A;  1BPD A;  1BNO A;  1EUV B;  3C2M A;  2DX5 B;  2L52 A;  3RCZ A;  4ENL A;  3QCA A;  2I38 A;  3DK8 A;  2JV3 A;  3FWA A;  4MAC A;  3MKC A;  1ZQG A;  4MDK E;  3Q3F A;  1J19 A;  4KGR A;  3N97 B;  4JPS A;  3Q8K A;  1QSY A;  5T14 A;  1DRG A;  3V6C B;  1JN3 A;  1W1O A;  1UBQ A;  1C7Y A;  1NI2 A;  3H4D A;  3TEY A;  4P6V F;  1KRP A;  2QAR B;  3HSU A;  5KFU A;  4M00 A;  4AQ7 A;  2CFY A;  1KLV A;  2N9E B;  5IOI A;  3V5C A;  4QJF B;  2LRU A;  2AKZ A;  2KYW A;  2CS4 A;  4ZRJ A;  2M9N A;  2HHX A;  4C4V A;  3UPQ A;  5G55 A;  3UXO A;  3UXP A;  2K6D B;  3AI5 A;  4XDC A;  4GGB A;  2PP1 A;  3A7R A;  3BYY B;  4ED1 A;  4B0M A;  4H4T A;  2KMM A;  5CR0 A;  5AIA A;  4JL9 A;  2G07 A;  4EKU A;  2ZUB A;  3KTQ A;  4DWI A;  4I2G A;  3WK9 A;  9ICC A;  2Q85 A;  4GFJ A;  1GRT A;  3HPF A;  2I6X A;  3PNC A;  4TKN A;  1JRP A;  5AKG A;  2AU0 A;  4RNA A;  4PWB A;  5D94 A;  1GRB A;  2E8M A;  1I19 A;  4LJX A;  2L1A A;  1T8E A;  2LWP A;  2KN5 A;  4EBC A;  2EAO A;  3ZD8 A;  2E6X A;  2KMC A;  4HPL B;  4DHJ D;  3NZG A;  3D2N A;  2D3A A;  4KZC A;  1OEY J;  4O3M A;  3Q8R B;  3CYJ A;  4BDP A;  4BKG A;  5G5G B;  5FJP A;  1ENF A;  3LYS A;  4Q43 A;  3FAH A;  2RRD A;  4ECY A;  2N9K A;  1PVR A;  2O2V B;  4OJ6 A;  1GAQ B;  4KIK A;  4C0Z A;  4ANW A;  3D2D A;  2GR1 A;  2ZXI A;  1FRD A;  3IHP C;  4FN2 A;  2ODG A;  2OYY A;  4YWO A;  4PHP A;  3QUC A;  1ZQI A;  4DFK A;  1ZW7 A;  1S1Q B;  4B95 A;  3EPG A;  1SE2 A;  5HKH A;  1Z4O A;  2KQ4 X;  2RR9 A;  1N62 A;  3IJL A;  2N7D A;  2FPL A;  4YR3 A;  1WXQ A;  4P0P B;  1QT9 A;  2QMT A;  3B2F A;  3OJ3 A;  2PLI A;  7ICQ A;  4US8 A;  8ICQ A;  3U9I A;  1SV0 C;  2SAK A;  2IBK A;  4RT3 A;  3FIL A;  1MG4 A;  3OZM A;  3ZDT A;  1KCZ A;  4GFI A;  4BFR A;  2DZI A;  5JRB A;  3FYH A;  5DPS A;  2FIF A;  1COO A;  5GMV A;  1DTN A;  2BPG A;  1E8W A;  1P7F A;  5HG2 A;  1WUE A;  2G09 A;  3V6J A;  1D9F A;  2DW6 A;  1PVQ A;  2WWZ A;  4X5V A;  1TS3 A;  3JS8 A;  7ICT A;  4YD2 A;  1Z1V A;  8ICK A;  3N6H A;  4YSZ B;  3CSF A;  2KXJ A;  3WK7 A;  3HUI A;  1PK1 B;  3N1Z C;  4GR1 A;  3F53 A;  3N7R C;  3H8S A;  1IXR A;  2BCS A;  2VFT A;  5CHV C;  3ZRF A;  2KLC A;  4DFP A;  2JZP A;  4K2S A;  4M6W A;  5KFV A;  4RQ0 A;  1SKW A;  3AN1 A;  2R8K A;  5JCK A;  4QWB A;  3BY4 B;  2XC9 A;  4FAD A;  2J0K A;  1TKE A;  5DQI A;  3ONS A;  4PVE A;  3U7Z A;  3EKG A;  3MY9 A;  1XD3 B;  3IDW A;  1E90 A;  3OC4 A;  1SKR A;  3C0R B;  3RGT A;  4DFJ A;  4I2A A;  1W1S A;  1DYQ A;  1F2R C;  1LB2 B;  2K4P A;  1ROE A;  2HNE A;  3WKD A;  7ICM A;  3H8M A;  2HTM E;  1Q1O A;  1L7P A;  2K8C A;  3H7V A;  1PVP A;  2FCM A;  2HHQ A;  3DVG Y;  4PT5 A;  1QLT A;  4W9I A;  5HFY A;  1GNU A;  1LFD A;  5JHB A;  4BCA A;  4F2R A;  5ADZ A;  4GOC A;  3HWT A;  2W3S A;  3PZD A;  2JZB A;  3GP7 A;  2PW9 A;  4LDT D;  3ZDB A;  2VFS A;  3N7P D;  2MU2 A;  2RD0 A;  4WUR A;  4DHG A;  3HJE A;  1AN8 A;  2ZVN A;  2MW5 A;  5ALE A;  4KLH A;  1KL9 A;  3QFA A;  2BCQ A;  1FIQ A;  2FLL A;  4H4W A;  4FXC A;  4KLF A;  1LQB A;  2PPG A;  2C60 A;  3JPT A;  2GLE A;  1NK5 A;  2G08 A;  5C5J A;  8ICM A;  1R4N I;  2PVO D;  3UCC A;  1T0S C;  3ZRC A;  2NQL A;  4M8M A;  2R8H A;  1GG3 A;  1HZ5 A;  3JSV B;  4UAW A;  4YTP B;  2KKP A;  5BYR A;  2KZR A;  3PO0 A;  2C2D A;  4DX3 A;  4OJP A;  3SQI A;  3ECI A;  4DSF A;  5K8E A;  2ZPY A;  3HKZ F;  2PTX A;  5KL1 B;  1J8C A;  6ENL A;  4DQQ A;  4TQS A;  2P66 A;  1OW5 A;  4NNJ B;  1PDX A;  4QZD A;  1NHR A;  3W5U B;  2N0S B;  1OEP A;  1Z3E B;  4KN7 A;  3QUT A;  2JR5 A;  3QHT A;  3T6C A;  2PFQ A;  4QZB A;  3ZVI A;  1JUD A;  2V0G A;  3Q8S B;  3M8R A;  2KO3 A;  3TJ4 A;  1NK8 A;  1HQR D;  3MGI A;  3JPQ A;  3MTN B;  3QN3 A;  5AM4 A;  4RGT A;  4IQV A;  3CNH A;  4J57 A;  4WWN A;  3HT3 A;  5L1M A;  7ICO A;  3DBS A;  4GIV A;  3PSP A;  1SJD A;  4C4V B;  4WAA A;  3IC9 A;  2PSN A;  4YL8 A;  4F91 B;  2KHW B;  3IHQ B;  4P7I A;  1H2I A;  5U25 A;  1TE6 A;  3V6E B;  4BOZ B;  1MC8 A;  1J97 A;  2A5U A;  4QW9 A;  1BWC A;  2M0A A;  2BS3 B;  1E8X A;  4EZJ A;  5AM1 A;  2AAQ A;  2I0K A;  1XLQ A;  4AP9 A;  8ICW A;  1EC8 A;  3Q8P B;  4YWS A;  5IIL A;  1IGC A;  1WRI A;  2BW2 A;  3H8A A;  3PHW B;  1BGX T;  3ML9 A;  2X8X X;  3OP2 A;  2WXF A;  3E0F A;  3SI8 A;  2IND C;  4ECT A;  4D2K A;  4QIW F;  2NMQ A;  3MZN A;  3QFB A;  1FD6 A;  4ZH4 A;  3QNM A;  1U49 A;  4MGK E;  4ASW C;  4K8G A;  2WS3 B;  3L0W B;  3IT6 B;  2UVW A;  3KUZ A;  3Q6B A;  3M62 B;  3ZIM A;  2P3H A;  7ICV A;  2QDD A;  4KTQ A;  3GZF A;  2IO1 B;  3DIP A;  4C7Y A;  1T94 A;  4KIK B;  2X99 A;  2Y0S C;  4KV2 A;  4K7S A;  2F76 X;  3QEA Z;  2FYM A;  3PML A;  2WF7 A;  3BSM A;  2IDY A;  1N61 C;  3LXD A;  3OZY A;  4TQ0 A;  1UZX B;  3I1Y A;  3GV7 B;  3LK9 A;  3QIJ A; 
#chains in the Genus database with same CATH homology
 1T3Q A;  1JRO A;  3Q8A A;  1ZOY B;  3NVW A;  3AE2 B;  1PYW D;  1NYQ A;  3AE9 B;  4XDD A;  1CK1 A;  3D2H A;  3A7U A;  2Y3R A;  1C78 A;  3D2J A;  2E5A A;  1E8G A;  3KLS X;  2L32 A;  3PZ8 A;  1PGB A;  4L23 A;  1YN4 A;  3PQB A;  1RM6 C;  4C80 A;  5FR3 A;  1FM0 D;  3AE4 B;  1EWC A;  1I4R A;  2IGD A;  4YT0 B;  1FFU A;  3NVZ B;  4RGM A;  1ZUD 2;  2WXI A;  3P4P B;  2WLB A;  1K50 A;  3AEB B;  4ML8 A;  1JML A;  1W1M A;  1C77 A;  3A7A A;  4GDK B;  3EUB 2;  4HRO A;  3ZQ4 A;  2CJN A;  1CQV A;  3FW7 A;  2YEP B;  1AHV A;  4DNS A;  1TY0 A;  3DWM A;  4RGN A;  3LB8 C;  2OAI A;  2EKI A;  3KWV A;  1XF5 L;  4JX1 C;  3VQI A;  1D6E C;  1L0Y B;  3ZJU A;  4UDU C;  1NEN B;  2GQT A;  2ON8 A;  1GOZ A;  3I99 A;  1SE3 A;  1ZR6 A;  1GB4 A;  3H8H A;  1UWM A;  3FW9 A;  4PVK A;  3FW8 A;  2GB1 A;  3L4P A;  1NI3 A;  2LGI A;  3LYY A;  1FFV A;  4A90 A;  4TVW A;  1IGD A;  2J53 A;  1FCC C;  3AEE B;  2QPM A;  1E8H A;  3NUH B;  3P4S B;  1TYG B;  2VFR A;  1WSP A;  3V05 A;  3HVZ A;  3R2T A;  4HEA 1;  5D7G A;  4WH4 A;  1XEE A;  1K52 A;  1PGX A;  1V1P B;  1C4A A;  1I4Q A;  2XN9 C;  1C4C A;  4ZOH B;  4A8X C;  1YNT E;  4BBY A;  1BUI C;  2JQR B;  1XXG A;  1T6B X;  2V3P A;  4RH6 A;  2WXL A;  2PVG C;  2ZW1 A;  1MHH E;  4WWM A;  4ZYS A;  4ZRP A;  2GRI A;  4RFB A;  2I2Y A;  1PFD A;  5D3I B;  3TSS A;  5AUK A;  1FNV A;  5AE1 A;  1IBX B;  1YQ3 B;  1V8C A;  3NVY A;  5HHZ A;  1QOF A;  1XLP A;  2W55 A;  1KTK A;  2G1E A;  1ZDV A;  4YSX B;  1MBB A;  3TEZ A;  3BK1 A;  5AWV A;  4A6Q A;  1E9M A;  2BT6 A;  3RPF C;  4RGO S;  4O95 A;  2INN E;  3AV8 A;  2PMV A;  2FUG 1;  4EC3 A;  1NVI D;  4ARI A;  4YSY B;  2MJ3 A;  1AW7 A;  2Q4W A;  2WXP A;  4PYT A;  3AM9 A;  4XWT A;  4AS1 A;  2QSD A;  1VZ6 A;  2KAC A;  1C4P A;  2B76 B;  3W1S A;  3AE6 B;  3IAM 1;  4WIP A;  3WCQ A;  3W2D A;  2VFV A;  1B9R A;  1R7S A;  1ZE3 D;  5BMH A;  1CJE A;  4ZRQ A;  2LUM A;  5LNK 1;  3SR6 B;  4OW0 A;  2WXN A;  2RMM A;  2WDQ B;  2MJE A;  1JWB D;  1NEK B;  2H89 B;  2HDE A;  5AUI A;  2JYT A;  1D5Z C;  3AE3 B;  1YJI A;  4NJC A;  2MJD A;  1PUT A;  3ETR B;  3AEC B;  1J7A A;  5G5G A;  4DXF A;  1DOY A;  2JSV X;  2WXK A;  1ET6 A;  1B1Z A;  2INP E;  2Z8L A;  2BS2 B;  1RYJ A;  4MM3 B;  3TEW A;  3HRD C;  3MC0 B;  2JXT A;  2P13 A;  1ZPS A;  4ARC A;  3TX1 A;  3AB5 A;  2VFU A;  3DWG C;  2R2Z A;  1VRA B;  4TMA B;  3HRD D;  1VR9 A;  2MBR A;  1TS2 A;  3BII D;  4KKI A;  1QLB B;  3Q8F A;  3VTE A;  1SE4 A;  1E10 A;  4JAY A;  2W82 A;  1YMH E;  2RDH A;  2BB5 A;  2SEB D;  5BYQ A;  3AH7 A;  1AYF A;  1WGK A;  2WXG A;  5GXG B;  4OZC A;  5BMI A;  1UGJ A;  1SJH D;  2VZK D;  4LLG M;  1AWD A;  1XCT L;  2IPK D;  2BVH A;  1N5X A;  1ZXH A;  2RDG A;  3BW7 A;  2DYM A;  3CWI A;  2FBW B;  1E6E B;  2K9X A;  2X38 A;  3LLB A;  1W1R A;  2TSS A;  4L1B A;  1E7P B;  3EGR A;  2NTT A;  1VLB A;  2BB6 A;  1ZDX A;  3FIL B;  3NS1 B;  2AQ3 B;  3UI3 A;  3NVV A;  1BML C;  1N63 C;  2KN4 A;  1ZXI C;  5G5H B;  4XWW A;  1T3Q C;  1RM6 B;  1FXA A;  1MI0 A;  5I1V A;  4XE0 A;  1DGJ A;  1L0V B;  1SB3 C;  4LK0 M;  4BC7 A;  2WNM A;  3MP9 A;  1I4P A;  2M19 A;  5HMR A;  2PLS A;  1HSK A;  3NVZ A;  1QOA A;  3BVZ A;  4N58 A;  2LMC A;  4PVJ A;  1I7H A;  5FXE A;  3RJ8 A;  2BVG A;  3TUO A;  4IKG A;  1YQ4 B;  2PTL A;  3Q69 A;  1QF6 A;  2ACZ B;  4CQN A;  5H8Y E;  1FFU C;  3B2G A;  2JX5 A;  3Q8B A;  4HKZ E;  3BWU D;  5HI1 A;  1WWT A;  1GPX A;  2PKO A;  2VAO A;  2DWQ A;  1YN3 A;  1TKY A;  2WXM A;  1KFY B;  4GDL B;  4YWG G;  1E0Y A;  4WQM A;  2KDM A;  4RF0 A;  5L6F A;  3MJ5 A;  3TSJ A;  1MHX A;  3S1E A;  3GB1 A;  1ESF A;  4H2A A;  1AHU A;  2M56 B;  1WYG A;  3BK2 A;  5JXV A;  1FO4 A;  2YVS A;  2LFI A;  1N60 A;  3GS2 A;  3W8X A;  2WQY B;  5C2T B;  2IGG A;  2N9L A;  3NRZ A;  4M0W A;  1CZP A;  1MVK A;  3BZD B;  2WXH A;  3S1D A;  2WXJ A;  1I4X A;  3KQ4 A;  1DIQ A;  2BVF A;  1DOI A;  2FE8 A;  4OHJ A;  3E9S A;  1J7C A;  1QOG A;  2BBC A;  1W1Q A;  2WU2 B;  5T8I A;  3Q8E A;  2L83 A;  1PGA A;  3VR8 B;  4PZF A;  1F0Z A;  2OED A;  1FFV C;  1N60 C;  4NZL B;  1L4D B;  1YN5 A;  2EXR A;  5I1W A;  2UUV A;  1STE A;  3SEB A;  3T3O A;  1C79 A;  2LJI A;  3MHZ A;  5E6J A;  1SXT A;  4WAF A;  4LTU A;  2J4X A;  4OZA A;  1AHZ A;  1FIQ B;  3AED B;  1ACC A;  1K51 A;  4RF1 A;  5FXP A;  2YEP F;  4HG0 A;  3DED A;  1FRR A;  1DII A;  2WU5 B;  4JE3 B;  4DXG A;  1L4Z B;  2PIA A;  1C76 A;  1RFK A;  3ZJT A;  4NAM A;  1QKZ A;  4C7Z A;  2L52 A;  3E56 A;  1JAL A;  3PM9 A;  3W8Z A;  2I38 A;  3FWA A;  1FXI A;  4MAC A;  1IBX A;  4KGR A;  4JPS A;  1I4H A;  2BS4 B;  1D5X C;  1JWM D;  2LHD A;  5HHD G;  1D5M C;  3SFE B;  1W1O A;  2AX5 A;  4HRS A;  3U2S C;  5D79 A;  3POP A;  3TEY A;  1SSN A;  4NAW B;  4P6V F;  1W1J A;  1WVF A;  1UWX A;  1X2G A;  3HSU A;  3ZGZ A;  3S1F A;  4YTN B;  4AQ7 A;  3P42 A;  1F77 A;  1XLN A;  3LAE A;  1EU4 A;  3VR9 B;  3CIR B;  3AE1 B;  3RFZ B;  4A55 A;  1X2H A;  3N9Y C;  3BYT B;  3V3X A;  1MBT A;  3C8Y A;  5AE3 A;  3BVG A;  4XDC A;  2R8D A;  3A7R A;  2CJO A;  2KWD A;  1UNS A;  2J52 A;  3BYY B;  4B0M A;  3C0P A;  2KMM A;  1GB1 A;  2K22 A;  3SR6 A;  1Y56 A;  2Q85 A;  2BTE A;  3B9J B;  5AE2 A;  1VZ8 A;  2Y3S A;  5MPO A;  3T3N A;  1JRP A;  3AEG B;  3I57 A;  3LXF A;  4RNA A;  4PWB A;  1EWY C;  2DLB A;  1I19 A;  4N6E B;  2L1A A;  1E8F A;  1ZP0 B;  1KLG D;  2E6X A;  2IJ0 A;  1EM7 A;  4XLO A;  1HZ6 A;  1OQQ A;  1TKG A;  1JCK B;  4JB1 A;  2Y5P A;  1VJK A;  2MEK A;  4KGS A;  3HVD A;  2EEL A;  2GI9 A;  2VZK B;  1JWA D;  5BMG A;  5G5G B;  4TVY A;  1EU3 A;  1ENF A;  2AQ2 B;  2J42 A;  3FAH A;  3R8B A;  1QOB A;  2N9K A;  3PZ7 A;  1GAQ B;  3AMZ A;  1FNW A;  4IDI A;  5EE1 A;  1VAO A;  3D2D A;  2LHE A;  1FRD A;  2JYE A;  1KH0 A;  2Y08 A;  4Q2J A;  1SE2 A;  2KQ4 X;  1N5W A;  1N61 A;  1N62 A;  3AEA B;  3Q8C A;  2UUU A;  1SIJ A;  1BXT A;  1WXQ A;  1QT9 A;  2QIE B;  2QMT A;  3B2F A;  3OWE B;  1FNU A;  2MH7 A;  2PLI A;  2Y4G A;  4PWC A;  4US8 A;  2WXO A;  4YTM B;  4DQO C;  5BYS A;  2W3R A;  2SAK A;  3SFD B;  3FIL A;  3KJM A;  3NS1 A;  1TJE A;  1C9F A;  2AXR A;  2IPI A;  3NVW B;  5C3J B;  1P7F A;  1QQR A;  5HG2 A;  2ONQ A;  1SB3 B;  2Q5W D;  3P63 A;  2V3N A;  3ABV B;  3J9C A;  4PVH A;  2RK5 A;  4REZ A;  1TS3 A;  1SF0 A;  1TS4 A;  3JS8 A;  3NVV B;  4USA A;  1HA5 A;  4KGT A;  4YSZ B;  1W1L A;  3HUI A;  3NZ3 A;  1IUE A;  1F2R I;  1M4V A;  2VFT A;  3MFG A;  2WXQ A;  1UXY A;  2QIL A;  2G9H D;  2JZP A;  3VRA B;  5TSS A;  2RPV A;  3AN1 A;  4P16 A;  1SEB D;  4HJG E;  2XNA C;  1UUP A;  3IT4 B;  1TKE A;  3S1C A;  1JWS D;  2JU6 X;  2DBY A;  1NYR A;  2WDR B;  5FXF A;  2NTS A;  4PVE A;  1TZO A;  3DQ0 A;  3U7Z A;  1DZN A;  4BC9 A;  1SJE D;  1FCL A;  1QLU A;  1Q10 A;  1L5P A;  2Y3A A;  1W1S A;  1MPE A;  1P7E A;  4OAL A;  1DYQ A;  1F2R C;  1ROE A;  1ET9 A;  1OFF A;  2HTM E;  2QEJ C;  4PT5 A;  5D3D A;  1QLT A;  2GQU A;  4A9A A;  5HFY A;  4BCA A;  2CU3 A;  5FK9 C;  1V1P A;  3NRZ B;  2N7J A;  2WDV B;  4C56 C;  2Y5C A;  5ADZ A;  2PLP A;  2W3S A;  3TEX A;  5L6G A;  2VFS A;  3GP7 A;  2PW9 A;  1VDV A;  3ZYY X;  1KF6 B;  2IGH A;  1LO5 D;  4WUR A;  1AN8 A;  4TQ1 A;  3I9V 1;  1J7B A;  1FIQ A;  4FXC A;  1TY2 A;  4ZHO A;  1FMA D;  4UD8 A;  5H92 C;  2PVO D;  5EE9 A;  4ZOH C;  4TSS A;  3W5V B;  1KLU D;  1DOX A;  1YJJ A;  1VQZ A;  1HZ5 A;  2K0P A;  1SBB B;  4YTP B;  5BYR A;  3IXS A;  2R61 A;  3PO0 A;  1FEH A;  3R2I A;  3VRB B;  1F0X A;  1XLO A;  1HXY D;  2WDW A;  2AQ1 B;  2D5G A;  1WVE A;  5K8E A;  3AE8 B;  1T5X D;  3NVY B;  2V4I B;  4J3O D;  1PDX A;  3URY A;  2LEK A;  3W5U B;  2O3G A;  2N0S B;  2W54 A;  2E3T A;  4US9 A;  2ZW0 A;  4HKQ A;  1RWS A;  1JWU D;  5FKA C;  3U52 E;  2V0G A;  3R07 C;  1JQ4 A;  4MT5 A;  1TS5 A;  2OHF A;  1JW9 D;  4ITK A;  5FXD A;  1HQR D;  3RJA A;  2WP9 B;  4R3D A;  4RGT A;  4GLS C;  3AE5 B;  3EA6 A;  1E0Z A;  1KRH A;  3P4R B;  4YXD B;  3B9J A;  2ICI A;  2WXR A;  3ETR A;  3P4Q B;  5HQX A;  1I4G A;  3KWL A;  2P4P A;  2DYO A;  3FC4 A;  1L6V A;  4B0E A;  1D4B A;  2M0A A;  2KAJ A;  2BS3 B;  1VZ7 A;  4MH8 A;  1QIL A;  4RCO A;  5EE0 A;  3W9C B;  3EUB 3;  4KKJ A;  2I0K A;  1XLQ A;  1XO3 A;  1V1O A;  1IGC A;  1WRI A;  2BW2 A;  3O13 A;  4JWS C;  3BVM A;  4MLA A;  2K5P A;  4ZHP A;  2JWU A;  2WXF A;  4IOI E;  1OQR A;  3IAS 1;  4D2K A;  2NMQ A;  2H88 B;  1W1K A;  4EE2 A;  1FD6 A;  3AEF B;  1HEZ E;  2WS3 B;  1V97 A;  3ZJV A;  1K53 A;  1L6U A;  3IT6 B;  2BYT A;  2QKN A;  3W8W A;  3U4E G;  3GSY A;  2P3H A;  5I4D A;  2QJL A;  1L0X B;  5EE3 A;  4C7Y A;  1A70 A;  1XCQ L;  3AE7 B;  4N59 A;  2NQW A;  4JWU C;  4L2Y A;  4O1N A;  4OZB A;  5G5H A;  2IDY A;  1N62 C;  1N61 C;  1N5W C;  1N63 A;  4TQ0 A;  2K3U A;  1ZXI A;  3TSH A;  4KX6 B;  3P1M A;  4OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...