2W3RA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 126
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3rA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3rA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3rA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3rA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3rA04
2BT6A 5GXGB 4MLAA 3P4PB 4C7YA 3AEGB 1UXYA 2R2ZA 1OQQA 4N6EB 5C3JB 5HQXA 4C7ZA 1R7SA 3W5VB 1N63C 4BC7A 3P4QB 4PZFA 1SF0A 2VFRA 2DBYA 3AE2B 1XLPA 1FIQB 3HRDC 3S1CA 1CJEA 3D2DA 3B9JA 1WRIA 2KAJA 3AE5B 4ZHOA 3AEAB 4JWUC 1N63A 3D2HA 1QOAA 1KF6B 1N62C 1FFUA 1QF6A 3W8ZA 1XLQA 3I99A 1WWTA 5AE2A 1JALA 1AHVA 4YXDB 2MJ3A 4WQMA 1NENB 3NVZB 1TYGB 1L0VB 4P6VF 3VR9B 3W8WA 1XLOA 1JRPA 3RPFC 3AECB 1WYGA 1QOGA 1NYRA 5D79A 3VRBB 4YTPB 1WGKA 5C2TB 3AE3B 5H92C 4BCAA 1JROA 3ZYYX 1J7CA 1B9RA 2I0KA 1T3QA 3P4RB 1QOFA 3C0PA 2YVSA 4HROA 1SB3B 3NVVB 1VQZA 1X2GA 1SIJA 1J7BA 1CZPA 1JQ4A 2PIAA 1PUTA 1IUEA 2AX5A 2PVOD 1A70A 2RK5A 5H8YE 1FRRA 4ZHPA 3P1MA 2OAIA 1W1QA 5G5GA 2H89B 3EUB2 3HRDD 1I7HA 3AV8A 3BW7A 4ZOHC 1XO3A 1W1JA 3NVWA 1XLNA 4HG0A 2W3SA 3BIID 2Y5CA 3S1FA 1GAQB 1DOXA 1N61A 3P4SB 3SR6A 3A7RA 2R8DA 4YSXB 3DWGC 1E0ZA 1AHZA 1JWBD 1RM6C 2DWQA 3AH7A 4PVKA 3HUIA 1YJJA 3D2JA 1N5XA 4PVEA 3B2FA 3W5UB 3NRZB 3ETRB 1GPXA 3DQ0A 5EE9A 1PFDA 1E9MA 5EE3A 1N60C 2CJOA 1W1MA 1YQ4B 1V97A 4YTMB 1E10A 3NS1A 1E8HA 3WCQA 1KFYB 2BS2B 2BVFA 3ETRA 3CWIA 2W54A 1FO4A 4US8A 1F0ZA 3AEBB 4TVWA 3AE8B 2Q4WA 1NI3A 3AMZA 5AE3A 2Q5WD 3FW7A 5G5HB 2WLBA 2P13A 3AE4B 4C80A 1J7AA 4YT0B 1UWMA 1WXQA 4O95A 1DIIA 2GQTA 1FMAD 2WQYB 4JX1C 4LTUA 3NRZA 3NVVA 3NVYA 1OQRA 3PM9A 3W9CB 1OFFA 3HVZA 5EE0A 2W3RA 4IDIA 1FFVC 1AYFA 1W1KA 4USAA 1E6EB 3NVZA 2P4PA 3DWMA 3PO0A 1YJIA 2AXRA 2WU5B 1AHUA 1TJEA 3CIRB 1W1OA 2W55A 4US9A 3R07C 2NQWA 1TKYA 2BS3B 2K9XA 4FXCA 4N59A 2N0SB 2BS4B 4A9AA 3GSYA 1E8FA 2OHFA 4XLOA 3AEEB 4DNSA 3SFEB 3JS8A 4YTNB 3B9JB 2QKNA 1T3QC 1DOYA 4JWSC 2VFUA 2QJLA 2O3GA 2WDQB 2EXRA 2WDRB 3AB5A 1N62A 1EWYC 1E7PB 1L6UA 1X2HA 1VAOA 2M56B 4JAYA 3S1DA 4WWMA 1FM0D 2LEKA 1W1RA 2MH7A 1QOBA 1RWSA 2MJEA 4PYTA 5AUKA 3SFDB 2PVGC 4N58A 1TKGA 4ITKA 5HHZA 3A7UA 3LB8C 3TSHA 1VDVA 5MPOA 3KWLA 1FFVA 3NVWB 1DZNA 1WVEA 1ZUD2 2VFSA 1FFUC 1JWAD 1NEKB 2CJNA 3VR8B 5G5GB 2MJDA 2FBWB 1V8CA 4PWCA 2PKOA 3TX1A 1ZXIA 1W1SA 2E3TA 1TKEA 2VFTA 2ACZB 3FAHA 3LLBA 2EKIA 2K22A 2WP9B 3EUB3 3FWAA 1QLTA 3VTEA 1DIQA 3AE6B 5FXEA 1VLBA 3FW9A 3DEDA 3NS1B 1QT9A 2B76B 2CU3A 4KX6B 3LAEA 5EE1A 2BVGA 1MBBA 1NVID 3AEFB 1I19A 3W8XA 2M19A 3AE7B 2HTME 1N60A 4YSZB 4PVJA 4BBYA 2K5PA 2PLIA 3AEDB 1FXAA 1JW9D 1KRHA 4PWBA 1E8GA 5AE1A 3L4PA 2KMMA 2H88B 3SR6B 1L5PA 1RFKA 1FIQA 2QIEB 3TSJA 1N61C 3ABVB 1VJKA 1QLBB 1L6VA 3S1EA 2P3HA 1MBTA 4ZOHB 1RM6B 1DOIA 1N5WA 3LXFA 1ZR6A 3FW8A 5AUIA 3A7AA 2JQRB 2WU2B 2L52A 1NYQA 1QLUA 4UD8A 1FXIA 1AWDA 4OALA 4PVHA 2BVHA 3AN1A 3VRAB 3FC4A 4BC9A 5FXDA 1SB3C 2L83A 3NVYB 1WVFA 1PDXA 1W1LA 1RYJA 2WDVB 4ML8A 5HMRA 3P63A 1N5WC 5G5HA 2VFVA 5FXPA 1E0YA 2WS3B 1ZP0B 4TVYA 2JX5A 2G1EA 1YQ3B 1HSKA 4HRSA 5FXFA 2MBRA 3AM9A 4JB1A 3AE9B 1FRDA 2QPMA 5ADZA 1ZXIC 1ROEA 4EC3A 4YSYB 2Q85A 2GQUA 3B2GA 2VAOA 3KJMA 2PLSA 3AE1B 1F0XA 2E5AA 1ZOYB 1DGJA
chains in the Genus database with same CATH superfamily
4KLOA 2OYYA 3GP7A 4DS4A 4AWJA 4I6LB 5J0WA 1UXYA 2R2ZA 2CRXA 2GH1A 4O3MA 3GIIA 5HQXA 1R7SA 3BQ7A 2YVFA 3DGBA 2UU7A 1FPYA 3EA6A 1MN8A 3VH4B 1N63C 3N6JA 4H2HA 4ZRKA 1ZDLA 3NRWA 9ICVA 1RXVA 4MGKE 2LHTA 3CB3A 1UD7A 5JCNA 3OJ3A 2MBQA 1F9CA 4KPLA 4E8GA 2LMCA 2PODA 1JEHA 2P6RA 9ICXA 4A90A 4LZDA 2BCQA 4GIRA 1WRIA 4B9MA 5IDZA 4U6PA 3V7JA 2XGQA 3RB0A 1HTOA 1CUKA 2H3QA 5D46A 2ZJ5A 3GDXA 2VA2A 4O9MA 9ICEA 1N63A 7ICQA 1KD0A 3RJ8A 1RAXA 1WI0A 4K7UA 2WXQA 4J9OA 4KLUA 3VUYA 2EAMA 5J0TA 5J8YA 1SXEA 1QF6A 4PHEA 2L3ZA 3VC5A 1SL2A 5KFBA 1E90A 1DYQA 8ICWA 5J0XA 3I99A 2CFYA 2GDQA 3OTQA 1ZQPA 2KVRA 5AE2A 1EU3A 2X8HA 3LB8A 3IAS1 2HHVA 1AHVA 2Y3RA 5ALXA 2MJ3A 1A0PA 1Y56A 1ZQKA 1NENB 3RR8A 2WF7A 2YX8A 3BS5B 2EMTA 1WCNA 4LJPB 4DDGD 1V5OA 2BKEA 5DPRA 1PGBA 3DEQA 1TYGB 3DVGX 4EELA 2LXCA 3VR9B 7ENLA 5ALRA 3ZDDA 2INDC 1JRPA 4RU9A 2VH2A 3BQ1A 3AECB 3HHMA 2YB4A 1QOGA 1QZEA 2DZJA 4H4SA 5D79A 4ED0A 2QVHA 3ES7A 1NJXA 1ZQHA 3NASA 3SD5A 2GGEA 1LQBA 1BVSA 8ICCA 1OGWA 3CMMB 4F2SA 4JWNA 4F4XA 3RB4A 1V9JA 2WXHA 1STZA 5D94A 3ZDBA 5IKCM 4GRTA 1RYUA 3KYCD 5CHWA 3C29A 2HJ8A 2E8MA 4BCAA 1EF1A 4RQ7A 1MJDA 1JPMA 5KAFU 1YZ7A 2I0KA 1T3QA 3CW2C 2RDGA 5J0OA 3C0PA 4DS5A 2PMZF 4DQRA 4DL6A 5KFWA 4Q43A 1KLNA 4M9HA 6ENLA 2F3NA 1P0RA 1VQZA 3ML8A 5AI0A 2PCEA 1UNSA 1O03A 1NK7A 4EQWA 1E8XA 2JXXA 5BYQA 2YVJA 2PVOD 1BGXT 2CXYA 3Q3JA 1FRRA 1BNOA 1XO1A 4NPNA 5DGBA 3C1YA 4ARCA 3C2MA 1LKYB 3SAFA 2MBBB 4ANWA 2BYFA 2IOFA 2K3UA 3P1MA 2KX3A 2NRTA 5AICA 1MHHE 2LRWA 3E56A 2KNBA 4BWMA 2VKQA 4FBTA 1R4MI 3N1ZC 3EUB2 4OCZA 9ICOA 3A9JB 4F4ZA 3U2SC 4LDTB 4TUUA 4PT5A 3BW7A 3PY8A 3JSVA 5KFZA 8ICUA 2JHDA 3HK0A 4F1SA 2OXOA 1XO3A 3RNCC 5FR6A 1RG6A 4RQMA 3M8RA 3M8SA 4UAWA 2CHZA 3N97B 2X50A 3MDCA 4Y2RA 3UXPA 4RGOS 1SJED 2FUG1 3Q8SB 4HG0A 3BIID 3BYTB 3T4WA 4F91B 2UWQA 3KBBA 4YMOA 1NK5A 4QJFB 2LGSA 4EMIA 1GAQB 3KLSX 2I2YA 3KUZA 2WTFA 3N20C 5J0UA 1ZQIA 3DGZA 4H50A 1UH6A 2KD1A 1XSNA 1C4CA 1X42A 2P6UA 1H8CA 4RUCA 3A7RA 2R8DA 4AP4C 4DSIA 1SWWA 1AHZA 4IL6U 4M6WB 4BKSA 1ZQGA 4GC7A 4HCHA 2KVCA 5C1ZA 2WFAA 4OJ6A 4XUSA 3AH7A 3HUIA 1YJJA 4GIVA 2KZMA 3OG5A 2H5XA 5AI8A 1N5XA 4C8KA 2AQ2B 3W5UB 5FS8A 3OPXA 5GTHU 5KFXA 2JEIA 1ZQQA 1E7VA 1NK4A 2CPRA 4RF0A 3PW4A 2WXPA 2BC1A 1S3SG 4B0MA 4XWWA 1RZTA 3ENLA 1L0YB 1W1MA 5DCNA 4REZA 4ZYSA 2FDRA 1YQ4B 1WF9A 5CP2A 4DL4A 3PK7A 1E8HA 4LLGM 2V3NA 2ISOA 4O5CA 4YWSA 2PTLA 2ZVOA 3TEWA 2CN1A 3W2DA 1XNSA 4W9EA 2BVFA 4BUGA 3CWIA 1RPLA 2P8CA 3DBSA 3QHTA 3Q8BA 2AGOA 4C8NA 4F71A 5CHGA 1TS3A 2GB1A 4B0EA 1M4VA 2PP0A 1L8OA 2X38A 1S0MA 4WIPA 4IM0A 2DLBA 3OC4A 1ED1A 3H6NA 3CXOA 4A35A 4NAWA 1TT5B 3UJ2A 1NI3A 2C28A 1B22A 3CSFA 3QTPA 1VJ5A 3UJSA 4R8UA 5AE3A 2Q5WD 3KLJA 3ES8A 1TK8A 4W9LA 4UQGA 3Q6BA 4LA1A 2CDUA 5C5JA 1A77A 2QKNA 4J9PA 4WAFA 5KFYA 4JPSA 1XU4A 3UM9A 4PYZA 3DERA 1D9FA 2IO0B 3IVFA 2KSOA 2XK5A 4NLGA 5FJOA 5KVIA 2F76X 2ATLA 3M63B 4KV2A 4K3CA 4ECUA 1QILA 5KFTA 1YD8U 3M3JA 4W9GA 3O0HA 4Y2UA 4F93B 2QC8A 3NVVA 7ICLA 4UAZA 4GMVA 5CX3A 2QQ6A 2V3AA 2M9NA 1IM4A 2QKQA 2KFNA 2RDIA 1OQRA 4K7SA 3H8WA 5BOEA 3DG3A 5EE0A 4JIOU 1Z19A 1LGRA 4XDDA 1QTMA 3UCDA 4QWDA 4LZGA 2JVCA 2LD9A 3GZFA 3QXGA 2REXA 1ZD2P 2XI9A 4RGNA 3X0WA 1W1KA 3L5OA 4FE3A 5LNK1 3DBRI 3UQ0A 2KWUB 2P4PA 1JIHA 2E8OA 4QW9A 3WKAA 5D49A 1TK0A 1PK1B 1T0RC 3WAOA 2GR0A 3PO0A 3R25A 4HNLA 5AM0A 2K8CB 4K4HA 3T3NA 4EZ9A 3RJJA 1PYWD 3R07C 2HHXA 4J9SA 1TKYA 1WY8A 2BS3B 4HPMB 5E6NA 3BQTA 1WJ6A 8ICSA 4GDKA 1VD2A 2J42A 4ARIA 4KLMA 1IV8A 4FXCA 4H4WA 2BCRA 2GLEA 2DAFA 1UPHA 2GBMA 3V7KA 2D07B 2WB1C 1JN3A 2IO1B 2GH5A 4RM9A 3LXDA 5KFNA 1NBFC 4IWPA 4UAYA 4F2RA 1WM2A 2INCC 2XH0A 2DZKA 1OEYA 2G3QB 3AEEB 4FZMA 2AEHA 2NRVA 5KFPA 1AN8A 3TKAA 3B9JB 4ACFA 3THUA 3SN4A 4E5TA 3VVWB 5AZFA 3RFZB 2QJLA 2WPFA 3TACB 1Q1WA 2O3GA 7ICRA 1GC7A 4GB9A 3RZFA 2PU1A 2AGPA 1UUPA 5I1WA 2EXRA 2JPHA 2PXIA 3G6VA 3AB5A 1KH0A 2ZIUB 1E7PB 1NZBA 3QNMA 4B9VA 4H1ZA 2CHWA 3H8MA 1Z00B 2M56B 3DHHC 4A3PA 1G6JA 2BCSA 4JAYA 2RHFA 3Q8PB 3S1DA 2ZZPB 2OFJA 4XGAB 4F5OA 2PS2A 5TZVA 3IAM1 3MFGA 4TSSA 1ENFA 5LXHA 2JR5A 4I2IA 4IL2A 1ZYQA 1ET9A 4ADWA 3Q8MA 3UXLA 4ED7A 1NK8A 3ZIMA 2LGIA 4K7ZA 4BOSC 4NLKA 2LM4A 2BQQA 5AI9A 3JVAA 3SFDB 1ZQZA 5KFHA 4YMMA 4L2YA 4N58A 2FPLA 4BKTA 1SZHA 4K4IA 1TKGA 2IY0B 5KHQA 1MSWD 2ASDA 3V6HA 2DNFA 4PHPA 4RQ3A 5HHZA 1EM7A 3EHVA 4BGDA 4YL8A 5MPOA 2AH5A 3KWLA 2ZZ0A 4NL9A 2LPEA 1MHXA 3FV9A 2MP2B 5HMMA 3VH3B 5KFEA 1WXMA 1C1YB 3BSMA 1JX4A 1FFUC 3PSIA 5KT6A 2FE9A 3IC9A 2G9HD 3E0FA 5KFRA 1NEKB 2PGEA 1V38A 1J2MA 3E58A 5IIJA 1OTRB 3RGTA 5G5GB 3RRAA 2MJDA 2WXKA 3BJSA 3N4FA 1KL9A 5BYRA 4KITB 3H0RB 4IP4A 2JEGA 2PKOA 2D3GA 3L0WB 4RNAA 4ECTA 1SV0A 2NR2A 1OJTA 3TX1A 4KMOB 3K75D 2NTTA 2HOQA 4ECYA 1P43A 3DDMA 2BWFA 5JCKA 3Q14C 2E3TA 5J0QA 1BXTA 3OTRA 3N7PD 3DQVA 3MC0B 3FAHA 1H38A 3P93A 3MJWA 3LLBA 3BQ0A 4DWDA 1SL1A 1Q46A 5U25A 2W7OA 4GDLB 3ZO5B 2NRWA 3RBDA 3FWAA 2PMZC 1FNVA 3Q8LA 4AYBC 2WHEA 4AJYB 1QLTA 3H8JA 3DFYA 1BT0A 3VTEA 4GLXA 2QMTA 1D4BA 2V9HA 4RPXA 3SQIA 4PS3A 3PHWB 2C7MB 4MEMA 4ROPA 1QQ7A 3NS1B 1QT9A 2QDDA 2L76A 4DXKA 2WF5A 2BVGA 3QU4A 5KNIA 2AAQA 1ZDVA 5E6PA 3SD7A 4ACOA 1JDFA 1NVID 1L4ZB 1AQ6A 1S1QB 2NCNA 3RNGC 4GR1A 1NKEA 2LJIA 4IR1A 2OM6A 2M19A 3VUWA 2KO3A 2GBKA 3DG7A 5EDSA 1NDDA 3TWAA 2PPHA 2YLMA 2GBRA 4CQNA 3A1QB 1FCLA 4RGMA 4YSZB 4KSLC 1NHPA 4ZCWA 3SSZA 2VH1A 2POZA 2JU6X 4C4TA 2W8LA 1UBQA 4Y2PA 1U47A 1E7UA 5ALSA 1JW9D 3RBEA 1T3NA 3M95A 5I4DA 2D2QA 3DESA 1E8GA 4YP3A 3DFHA 2Y1JA 1TBEA 1ECWA 4HJGE 2BQRA 1ZQMA 2KN7A 2KMMA 5KG7A 3RNFC 3PFRA 2H3VA 3U7DA 3ZXRA 1NJZA 3M6ZA 2Y3AA 1MNSA 2AL2B 2E8NA 1UCVA 3WK8A 3ZDMC 2WOVA 2DZIA 3PNCA 3GE8C 4DFJA 3UXKA 8ICHA 1KN5A 4RMAA 3DBHB 2OEDA 1ZGUB 2J6TA 2MX2A 3QARA 3CK5A 3JPPA 1D5MC 1DOIA 3KQ4A 4EOYA 3SENA 1UBIA 2KXJA 2AL3A 1F1HA 3LXFA 4LNFA 4YWOA 3ZJUA 4DHZB 2IOFK 2K4PA 1V2YA 9ICKA 3FW8A 5HHHA 3U9IA 2WU2B 2ICIA 2L52A 3AU5A 4M2YA 3PWIA 4HWIB 4DNAA 1QLUA 2YY6A 4F72A 2W9AA 2AL1A 4NXZA 3MZNA 2W9CA 4H4RA 4DCCA 5JCMA 4P16A 2XK5B 3ZNZB 1J8CA 5F9LA 1ZKQA 3IT6B 2XVTA 4DSKA 4F5QA 1ZD3A 4UDUC 3HW2A 2H3FA 5D7GA 4AS1A 1GRFA 3FC4A 4BC9A 5FXDA 3NVYB 1KFDA 5AKGA 4HKZE 4M8MA 4MGZE 2H3IA 3PZ8A 4RM8A 1ECQA 3KTQA 1V5TA 2WDVB 3DK9A 4I2GA 2N9XA 3M9MB 3S2AA 3V6CB 2XSXA 3QA8A 2KZ3A 3LVVA 3SDLC 2FLPA 4DFMA 1A5RA 3M9OB 1SE4A 2YN4A 3FJ4A 3SJNA 8ICFA 8ICZA 1N5WC 9ICPA 2ZADA 2OZ8A 1NPXA 5AK4A 2JYTA 4KLEA 2NS5A 2MU2A 2L0FA 2G07A 3RJAA 1QQRA 4IM2A 8ICBA 3EAOA 4YR0A 3GZNB 2HCFA 4BFRA 4DBGA 2OQHA 1ZP0B 5ALIA 2KT7A 2Y5BB 3M9NB 3KKAC 2ZJDA 2GI9A 3ZUNA 2EH9A 7ICFA 4I2AA 7ICMA 1Z5SB 5FXFA 2MBRA 4A6GA 1L3TA 4OD0A 4L23A 3VCBA 5DPTA 3HIZA 2O6VB 2LBOA 3E9SA 4KLHA 3GQCA 3BZKA 4XQ8A 2LMRA 5DKWA 1NJWA 1C77A 2KQ7A 1DNCA 2ZIXB 3HJEA 2KFZA 2MUTA 3GU3A 1ROEA 3SV3A 4EC3A 2KVZA 1X6JA 2QHOA 5BYSA 3PO4A 2ZUCA 1ZQCA 1V49A 5CHFA 3UQAA 2NMQA 2EDUA 3QZ8A 2PLSA 2ZZCA 1STEA 3ZDEA 4H4YA 3Q8QB 2BYEA 1FEHA 3ZTDA 2F5ZA 3NXLA 4B9UA 3P3BA 1XWLA 2R2OA 2C5LC 5KFQA 2BT6A 4GOCA 4M0WA 3H8SA 5GXGB 3P4PB 4MLAA 4M52A 4PGQA 1SKRA 3URYA 4NL9C 5C3JB 1XCTL 4IG7B 3KUCB 4C7ZA 1TIFA 3HILA 3H7SA 2KJ9A 3N28A 4M0AA 3IJQA 4KWSA 4Y2YA 5TR3A 4OZBA 3K1RB 5J2DA 2RDJA 2HTHA 4EFOA 4PZFA 3QPEA 5JCIA 4XZ4A 2QJNA 2JZ3B 3AE2B 3QYPA 3C0RB 3V72A 2LFIA 2GQWA 3R1ZA 2MNRA 4E4FA 2QDFA 2UVWA 3K9PB 4M01A 3JPQA 2N1VA 1SKSA 2PFOA 2AKZA 2HBMA 4KN4A 1U49A 1UF0A 4A55A 3J9CA 3CGCA 4H4ZA 2ZUDA 1NK9A 1TS2A 5KAIU 3D2HA 2MSNA 1LVHA 4CNQA 1DGSA 4ED8A 4C4RA 4E0DA 2G4DB 3IHPC 2GSHA 4G7FA 5BMIA 1XEEA 2HDOA 1WIAA 3ECIA 3QJZA 4OVVA 2EANA 1KTQA 3EJBB 4LDTD 1Q5WB 3ENEA 2IGHA 4H4PA 4QWAA 1D8LA 5D3DA 2BR0A 4DFKA 1KCZA 1WWTA 1V86A 2LYBA 1L3VA 1Z1VA 1SE2A 2GL5A 5KG5A 4WQMA 4JV1A 1S5LU 2A3VA 1ZK7A 4EBEA 4DXAB 3NVZB 1GUAB 3ZW3A 4IQUA 2HOFA 2DPIA 2FJ6A 3JPNA 4Y2XA 1L0VB 1WGDA 1DOQA 4P6VF 2K6DB 3Q3FA 4MEYA 1XLOA 1KLGD 2LASA 4ZRPA 3VAWA 4Z6EA 1RDFA 2MP2A 3KH0A 5ALGA 2QJMA 5J2BA 2PW9A 5G2NA 3ZGZA 1WGKA 5KFVA 5J0SA 2G06A 4EENA 1TE6A 4GFIA 2B6GA 2VANA 2DW7A 3SMVA 3EWAA 4F50A 4PPXA 3UPQA 4GXIA 3UQ2A 1GNUA 1X9XA 2Y0SC 2XNAC 1J7CA 4MMWA 3UXOA 2YVCA 4MH0E 3I1YA 4BZAA 3OSPA 2HHUA 4DF8A 2L8JA 1V6EA 2LVPA 2WB1F 2RPVA 1SB3B 4FA6A 8ICPA 2QDEA 2EQYA 5HR7A 1X2GA 1EBHA 3ZNHB 4M04A 2LI6A 1CZPA 2Y5PA 1JQ4A 1XPYA 2ZIUA 3KHGA 4IRKA 1PUTA 5DQGA 1TKDA 3WAMA 4YXMA 4PHDA 2BB5A 4A8XC 1WMHA 1BPEA 1ZW7A 2QB1A 2M4NA 3IM1A 1B0XA 5ALTA 2RMMA 2WBAA 3ONNA 3R3MA 3F2DA 1JXEA 4P0QA 3I57A 1KM7A 3VXWA 3UCCA 2IO2B 3RJFA 5IIOA 3UIOB 5BOFA 8ICVA 2OAIA 2P66A 3RNBC 3H4DA 3VFKA 5G5GA 2H89B 4ED1A 1S0OA 3DVNU 2WF9A 4DN1A 1M6YA 2B0CA 5DB7A 2NRXA 4L1BA 4F3OA 3AV8A 5ALMA 2WXNA 4F8RA 3MABA 2DYOA 1ONFA 3PT2B 1HXYD 2D5GA 4B9NA 1R4MB 4KKJA 1XS2A 1W1JA 3IJIA 5D3IB 3D2NA 4JK1A 2WXFA 2NVUI 5HG2A 4J3ZA 3PX0A 2BWES 1BNPA 3SEIA 4M9LA 3KUDB 2KACA 2NPTA 5J0RA 2WXOA 2HHQA 4NJ8A 1Q3UA 1UQVA 5DLGA 1ESFA 2BW2A 4ICUA 2MBEA 1S9FA 3TL5A 5AEKB 4FJZA 2WF8A 5L1LA 3S1FA 4DK5A 3QLDA 5K4LA 4KN7A 3WK6A 2BZFA 3EPIA 1P3QU 2DUYA 5DBBA 3DPDA 3RCZA 1FXTB 3PZ7A 4MGYE 4HEA1 2L5YA 1XSPA 5J17A 1TTNA 3GD3A 4MKSA 4Y2SA 3PW5A 2JY6A 1R6WA 2Q4TA 4DFPA 1L2NA 3EFCA 3G6YA 3VTVA 1Z1BA 3MR3A 4DO9A 3RFAA 3GIMA 5KT7A 2JRZA 7ICUA 3A0HU 3B0AA 4E71A 3ALBA 3TADA 1C9FA 4LNNA 3QU7A 9ICTA 2IY1B 1RYRA 2OCEA 9ICNA 1GPXA 3NZSA 3Q8AA 5EE9A 3DQ0A 1ZMDA 1N60C 1E9MA 5EE3A 3D47A 4IZGA 2H3ZA 2C7HA 3W1SC 4AOFA 3UJEA 2W0HA 5T14A 3PMNA 1PK3A 3TEXA 1JWUD 2ODGA 1V97A 1E10A 2NYVA 1F8WA 4MJSB 4P7IA 4DQQA 3NS1A 3K1ZA 4I6PA 4EEWA 2WPEA 2NO5A 9ICJA 5FS9A 4GLSC 2KDEB 2C22A 4K1RB 1I4XA 5EU9A 5GRTA 2HBLA 1UZXB 3NUHB 4PH5A 1P7DA 1P7FA 3TJ4A 2W54A 3NOBA 1P48A 4Z1YA 1P7EA 3F2CA 4PK1A 1CMXB 4K2SA 4R64A 1HA5A 3POPA 1TE2A 1EF5A 3TSSA 1UGMA 4WJNA 1QSLA 3JPRA 1L5UA 1KTKA 2ZIVA 2LYHA 2Q4WA 2KG5A 2MHJA 1SIFA 2AQ3B 1ISNA 1IGCA 8ICJA 2WXLA 5J2CA 3U7ZA 1KW4A 1WGYA 5G5HB 4EZJA 3LVWA 2R8GA 4DDID 2OX4A 2OQYA 1XSLA 2WLBA 1BKHA 2QJJA 3PQBA 1KBUA 2C9WB 5JU5A 3DBLB 3C5FA 4KDIC 1UWMA 2KK8A 4ECRA 9ICGA 2KN5A 2KWCA 2K8AA 3NGDA 8ICTA 3PSEB 2GQTA 4TUPA 1NELA 1K5OA 1BMLC 1K1QA 4LTUA 1GRBA 3VC6A 4X5VA 1ZQLA 4ENLA 4KLFA 2UUVA 3ORYA 4WH4A 5ALFA 5AKHA 4ED3A 4MM3B 2A1AA 8ICGA 5EWEA 4WWPA 2W3RA 4NQKE 4DQPA 4C0ZA 4IDIA 3TCAA 1TAMA 5JTIA 1HTQA 4HCLA 3MFIA 2N1RA 1OUQA 4USAA 1BPDA 4O0IA 3OHBA 1E6EB 4CCHA 1V1PB 2G45B 2IHNA 2MLBA 4O3QA 1KKXA 1ELSA 4TV3A 4B6JA 2DF4B 5KG1A 8ICLA 3GILA 4TQ1A 1YOVB 4Y2VA 4JDRA 2V4QA 1YJIA 4UASA 3VQIA 4YD2A 5ENLA 2QLTA 2WU5B 3ZD8A 1AHUA 1TJEA 3S6JA 1BPZA 2NRZA 3N32A 3MGVA 4NEVA 5AKKA 1IPGA 2A1JB 3RN9C 4K1WA 2MWSB 2ESEA 4F5PA 1QLNA 7ICIA 2GGHA 1Z4NA 4NLNA 4M0WB 4A9AA 2NTSA 2GRTA 4FZLA 1YIWA 4M9JA 1E8FA 1JUDA 1XO0A 4DL7A 2YMLA 1PZNA 4DNSA 2JXTA 3I4KA 4EQRA 2F1HA 1TVAA 2MCNB 1DOYA 2OZ3A 4FP1A 4KT2A 4Q45A 3GD6A 4I2DA 2WDQB 3VCNA 4B95A 3T9LA 2WDRB 3DGHA 3V5FA 1ZQVA 4IOIE 5DDYA 2I1KA 2JZZA 2KOXA 2IGGA 3OWEB 2YEPF 1BWCA 4DHZE 1WMHB 1X2HA 3M62B 3PZPA 3HT3A 1C78A 2GR3A 4KLQA 3VC8A 2KN4A 4W9IA 1L8LA 1JMSA 4ANUA 1TZOA 2P8BA 4O3OA 2E1FA 1WJNA 2LEKA 5BMHA 3N7RC 2BPGA 1YN3A 5AUKA 1DTNA 4WJOA 2XY7A 4HCDA 3QEAZ 3BYYB 3KHRA 3LWLA 2AHOB 1L7YA 2LWPA 1FFVA 1M6IA 3I6TA 1T0SC 3RZWC 3ZVIA 3PRMB 4YR2A 5HHIA 2JH7A 1WVEA 4O3PA 1ZUD2 2JF5A 1LM8B 3UQBA 4ELUA 4HXDA 2IJ0A 2L0TA 4CYEA 1EWCA 1JWAD 4JN7A 2AYOB 4DF4A 2IZVB 2UVUA 3EFUA 3SAHA 2CJNA 2LHDA 2NBUA 3WK7A 3RULA 4NLCA 4Q8EA 2O2VA 4ASWC 5IA7A 1GREA 1ZX9A 3T5LA 3ZVVA 2AJQA 4HJKA 4TURA 3OLMD 4ECSA 1TY2A 5HMLA 4R8UB 3DBLI 4NAMA 3NUQA 2PEAA 2XO7A 2KMCA 1TKEA 2F1IA 3OW1A 4G50A 2WX0A 9ICHA 1KKOA 4F8CB 4LNOA 1ZQ1C 3B08A 3RAXA 1NKBA 2YMQA 3FDSA 3L10B 3QCAA 3ISCA 3MFHA 5BMGA 2X8GA 4GFJA 1DIQA 3AE6B 3T5KA 2DZMA 4MFAA 3KOOA 1WWUA 1VLBA 1SZPA 3BS7A 2BPFA 1OEPA 3RRGA 1X1MA 4G8TA 2GMIC 9ICWA 4UAVA 4DWIA 1MRAA 2PP1A 5JRBA 4EZLA 4NV0A 1X6IA 3BDPA 2W03A 3IV6A 3AEFB 3C5GA 1L7OA 3C23A 5EWGA 2HXUA 4NJ6A 4O3NA 4DQSA 1W6TA 2L32A 4DLEA 1MG4A 1WGRA 1TS5A 4M02A 1IBXA 1WYWB 4KX3A 2HTME 3IK4A 3F53A 4PVJA 4C4VA 2OPJA 1YMHE 4NZLB 2ZXIA 2RABA 4B6WA 4JGHB 2RD0A 1FXAA 4M8NA 1WWVA 4EBCA 4XX5A 5IO9A 4RGTA 5JHBA 4MT5A 5KFOA 3O13A 1H2IA 4Q2JA 3CYJA 3RITA 1TZ1A 3K9OB 5AZGA 3RJGA 5FK9C 1ZY8A 2OO6A 2PMQA 3JZUA 2EZXA 5DPWA 2GR2A 4I29A 2XBBC 3DV9A 1XS9D 3V3XA 3SR6B 1NZPA 1L5PA 1HJPA 1RFKA 2ZW1A 3N30A 4KEMA 2A4ZA 3TSJA 1N61C 4H4TA 4P0PB 2KKCA 3V61A 5AKYA 3UMGA 1GRGA 3ABVB 1GC6A 1VJKA 3F2BA 1WFYA 1QLBB 3S1EA 3BVMA 4LIIA 2A8XA 4ZOHB 5ALHA 1ZD5A 2WX1A 3N4EA 1ZQBA 3Q4DA 3RUIB 2BKFA 1Q3VA 3ZNID 4IQTA 5JZEB 4DLGA 4JMUA 2CKHB 4M0XA 2AL2A 2ZTEA 3SEBA 2WXGA 2KFKA 3A7AA 4JV2A 3MDAA 2KNJA 3AQFA 3A9JA 1SJDA 3WU2U 2EKEC 4GIBA 4A3RA 1ZQAA 4EM4A 2R8JA 9ICAA 1JRUA 5I1VA 1K50A 4RQ8A 4UATA 4QWEA 2W9NA 3EGRA 1TYPA 5K8EA 2D3DA 2KC1A 1ZQWA 3C1ZA 1WSPA 3DJJA 1MC8A 5AI4A 4FBJB 4PL1A 5AI6A 2MEKA 1AWDA 1HIWA 4QZFA 1XCQL 4MM3A 4OZAA 1GEUA 1SL0A 5JUMA 2L83A 4YG2A 1ZXHA 2Y9UA 3ONSA 1J97A 3I9V1 4J1OA 1E9IA 4O3SA 1RYJA 3THVA 1N48A 1Z3EB 5KFCA 4ML8A 2Y0SF 3TWBA 3E2EA 4OJOA 4JWMA 2HVHA 4KMUA 3ZXVA 1RLFA 2KHQA 2HDEA 1WGGA 2KANA 4HN8A 2BYVE 2WXIA 2MA9B 3ZJVA 5G5HA 1CI4A 4RQNA 3WK4A 4F4WA 4O5EA 3EF6A 3A4RA 1B1ZA 2BGWA 3L54A 5D4BA 3M1YA 5AI5A 4HCNB 4II3B 3ZLZA 3CGBA 4EEKA 2WS3B 4DQOC 1KRPA 1MVKA 1KOTA 1I4PA 2Y9TA 4F4KA 3BK2A 1FEAA 2QAEA 4JLCA 5KG3A 4XE0A 2DX5B 2J0KA 2P3ZA 1YQ3B 2KC2A 3N4MB 1UA0A 3NY5A 1HSKA 2KJ5A 3D46A 1DRGA 4P2HA 3K4GA 9ICQA 3QUCA 1D8YA 3AE9B 2J6SA 2JRHA 2GR1A 4MGIE 2ZUBA 4YN4A 1ZQEA 3DDCB 3ZVHB 2PFPA 3KHHA 1WX9A 1SEBD 1BUIC 4GGHA 2OJRA 4RQ6A 2N7DA 3TI0A 1ZXIC 2AGQA 2KOBA 5CRXA 1SJCA 5KT3A 2Q85A 1RYSA 1D9DA 4I6NB 2FKPA 2R9ZA 2I6XA 7ICOA 2UVVA 3ZNGC 3AEVA 2KQSA 2GQUA 5FJPA 5IP4D 5F9NA 2M0XA 2EELA 3LWMA 5BPCA 4B9KA 3KJMA 3EKGA 4NLBA 3UMCA 2WGSA 1SJAA 3RJKA 2HI0A 5LXIB 3H0MB 3AE1B 1F0XA 3MBYA 2RGFA 1L3SA 3MGIA 2E5AA 4UARA 2PTYA 1FCCC 1ZOYB 4LVSA 4ELTA 1Q0WB 2FUHB 4GDKB 4IWQA 5FJRA 3AEGB 5AIAA 3GV7B 4E74A 1SGHA 3JYUA 4N6EB 2JWZA 5E6OA 4QWBA 1UA1A 5U1OA 1L7PA 2JH1A 2MA1A 4K8GA 3GB1A 4GGBA 3PV8A 1T5XD 3SN1A 4BC7A 3EC8A 4GXJA 3P4QB 4GGQA 1SF0A 2JMGA 2VRRB 2HHTA 4KGTA 3EJEB 2DBYA 2G4SA 4K4GA 4M47A 1LVLA 3JPOA 1S97A 3FILB 5JHAA 1S76D 3D2DA 3AU2A 4HAIA 2ZCCA 2IYDB 3A9KB 2PLPA 3AE5B 4ZHOA 2V6OA 4BDPA 4JWUC 2DKXA 3N1YC 3KYDD 4DL2A 1MFWA 5L95C 4FO6A 4QZGA 5HFYA 5L6GA 3I63C 2EAPA 4BXOA 2IBIB 2PFNA 3R7QA 3SHQA 2BCUA 3DIPA 4EWJA 1D5ZC 2N9KA 5KFJA 4RQ0A 1ZD4A 2GOWA 3ZDAA 2LVOA 1ZJMA 5HKHA 3RR1A 3RH5A 4PHAA 2ONQA 3JPTA 3DCGA 2EQ9A 2HHSA 1X2IA 4P4PA 4YXDB 3DJGX 2KZZA 3TCSA 4EQSA 5TR5A 2WWZA 2HBJA 1IYXA 4OO1J 3ALRA 4AJWA 4RNOA 2YMMA 3DH9A 5BOLA 1R4NI 2KMAA 3SZ2A 3W8WA 3OP2A 4RH6A 1R0MA 2EMSA 4NLZA 2ZNVC 3RPFC 1NOMA 1QSYA 5IAAC 1NYRA 5IILA 3MR5A 1QCKA 4YTPB 1T7PA 3TIXA 2C60A 1K53A 2JXJA 4HLEA 5GTIU 4YCXA 3KHLA 3V6JA 3D32A 4GYPC 2LM1A 4NEWA 2QGYA 4YXJA 1CRXA 1OQYA 1ONEA 3OPSA 3PX4A 3LK9A 1MUCA 3V3WA 3H0LB 2V9WA 3RF9A 2MQJA 3HM6X 3ZYYX 1GXFA 4MGGA 4F92B 4RT3A 2O6VD 3DVGY 3FILA 1BPYA 4EZKA 2IO3B 2CU1A 1WR6E 1TKKA 4RFBA 1NDAA 2YVSA 4HROA 2WAQF 4IHCA 5J2RA 3NJTA 4J9LA 3PLUA 3NVVB 3HX0A 2OLAA 5J2EA 3RB3A 3HKZC 2VJ4A 3PR4A 2V1YA 1SIJA 2N7JA 1J7BA 3JPSA 4OJ5A 5DB8A 4EX7A 2G09A 2PIAA 3APCA 4MEXA 3JVZX 2QCZA 4W9HA 1IUEA 2AX5A 2GLSA 2DYMA 4UB5A 3RYTA 1ZQXA 3A33B 2WF6A 2RK5A 3I6EA 2C2EA 5H8YE 4ZHPA 3PR5B 2M17A 1WJUA 4ZRQA 2K8CA 1E8WA 1VZ6A 2HHWA 2DENB 4OW0A 3II4A 2D3BA 1W1QA 3I28A 3U4EG 4TQ0A 2HD5B 2WAQC 2K4IA 1ZQSA 4AUQC 1SV4A 5J2JA 4UB1A 2XY5A 2PKEA 3KUMA 3RJHA 4MH8A 1KJTA 4ZOHC 3D2QA 4BKGA 4GSWA 2DPJA 1HEKA 1WUEA 7ICJA 1MDRA 2XICA 4PGXA 2BYTA 1XLNA 2KV2A 2CHXA 5JRTA 1L0XB 1F44A 4JB3A 3WKBA 1F2RI 1KFSA 1K1SA 2ZW0A 9ICCA 3QWZB 2W3SA 4QZ8A 4O3RA 1GERA 3TW9A 1LV5A 4I28A 1Z2MA 1DOXA 5L1JA 4PGYA 1N61A 2MRLA 3P4SB 3V4BA 3PSFA 3QK0A 1T0YA 2V4IB 4W9FA 5ALPA 2XY6A 4A6QA 3DWGC 4YSXB 1E0ZA 4FI4A 1JWBD 1HUZA 1KSPA 3NFUA 1XF5L 2ZIXA 1X9WA 3HRDC 1LXDA 2V4LA 1X9MA 2VA3A 2FAZA 4EBDA 4PVKA 2MUCA 4KGSA 3D2JA 4C4VB 3QN3A 3S5SA 2AQ0A 3A9KA 2E5SA 2KTRB 5DPSA 2BPCA 4BBNF 5ALWA 4PVEA 2LKYA 3C19A 3MQTA 4QZAA 1P1AA 1PGAA 3PX6A 1ET6A 5CEHA 1JWMD 1MG8A 3TMPB 1LO5D 3SN0A 3SQSA 3SU8X 1QKZA 1T0QC 3GFKB 4DFDA 2FMPA 2CJOA 2IMWP 1RVKA 4APNA 3N7SC 8ICYA 4EKUA 4DX3A 2KMDA 1V9PA 2PE9A 3KW5B 4M00A 2KLCA 4Q44A 7ICPA 3F5AA 3RRHA 5GMVA 5AM1A 2XCPA 1SJHD 2UVRA 1IXRA 3QQ8B 3WCQA 3MUCA 2KIWA 2RLTA 3STPA 1VCBA 2O6VA 4DL5A 2BS2B 3RNEC 3MR6A 3L16A 4QZ9A 2BDPA 4BURA 3ED5A 2CR5A 4LNIA 4E6MA 2KWDA 1FNUA 3X23A 4A20A 3CGDA 1U4BA 3WKEA 4F4RA 4US8A 3L17A 2QB0B 4QZHA 2D8CA 3DK8A 2JYEA 3AE8B 3TARA 1JOAA 4I2CA 1IYFA 4BBNC 4P4OA 1MI0A 3TTEA 2FIDA 4A3OA 1YX5B 2LYAA 2P13A 2BB6A 4TUSA 1WJ4A 2PJHA 1WXQA 2PTWA 1GRAA 2N7EA 4O95A 3RH4A 2ZG6A 5FJTA 3ZVHA 4UBCA 2WQYB 4JHMA 4WJPA 5LLIA 5L1IA 2F77X 3NRZA 4J9RA 8ICNA 2MW5A 2R2QA 3UXNA 2SEBD 3U8ZA 3T3FA 4K7WA 2VIXA 3NVYA 1MQ3A 5DG8A 2PFQA 4DXFA 3PM9A 4PZNA 2INPE 3HP6A 2HMXA 2NBWB 5J04A 1FEZA 2JV3A 4TQSA 3BS5A 1SGGA 4FULA 8ICXA 2HQMA 2RRDA 5J29A 1FFVC 3P0WA 5KFIA 3IBEA 4JE3B 2Y1IA 4J56A 3NVZA 3CXBA 1T4GA 2GGIA 1ACCA 2KICA 4HDQA 3ZLFA 1IBXB 3DWMA 4ECXA 3VDZA 3N1XC 4XDCA 3PG6A 3WK9A 4BVUC 4DYEA 4ECVA 4J9MA 3FCPA 4CDGA 2FCSA 2P0IA 2AXRA 5DGAA 2JUOA 4PYUA 1IP9A 2C2RA 1PGXA 4JQWC 4AYBF 1RRBA 3CIRB 2AQ4A 3IRUA 2KVSA 2W55A 4US9A 3R2IA 2HVIA 5KL8B 3SI8A 2NQWA 4YVZA 7ICHA 3T5JA 3JW7A 4N59A 3K1GA 2KKVA 2W04A 9ICMA 5AKIA 2Z8LA 2KLGA 3MHZA 4FADA 2K1FA 3Q3OC 1I4HA 2FMQA 2OHFA 3ICXA 5DLFA 2R61A 8ICRA 4XLOA 2O56A 3H70A 1PUZA 5KT4A 1FD6A 2Z0EB 3DK4A 4KLIA 2ZJAA 3FYHA 4KDLB 4ZYNA 1XD3B 3AULA 4P0PA 3R7RA 3UGBB 4JWSC 3UI3A 2VFUA 4RZRA 1EC7A 1XHCA 7ICGA 4EUTA 2KEYA 3MC1A 2KFJA 1GB1A 1PQSA 3NTUA 5JXVA 2GBJA 3AXCA 2OJWA 2PTXA 1WG8A 4NM2A 3TJIA 4IM3A 4OZCA 1N62A 3CP8A 5DG9A 3QU9A 2X8CA 1LB2B 4Z6CA 1L6UA 1JPDX 3AU6A 1J19A 1VAOA 2LZ6A 2V0GA 3RNMA 1I4QA 3L8KA 4FS1A 3U30A 1F9JA 3EZ5A 4C8OA 4WWMA 3Q6JA 4GDLA 3GV8B 2JRIB 1SE9A 1BZLA 1FM0D 5DQIA 3IFWB 2WPCA 2E6XA 3QEBZ 1D3ZA 1Q1RA 1QOBA 1RWSA 4TUQA 2C3CA 2O6KA 2RDHA 4MF2A 3BWUD 4G11A 3RCYA 1GSNA 2PVGC 2IPKD 3RMKC 1YQZA 2JSVX 5AWVA 2K60A 4F5RA 1C4PA 3Q3NC 2KP7A 3R0KA 3RH6A 5BOMA 2L00B 4LK0M 5ALDA 3TSHA 1VDVA 2EAOA 1WXVA 3PVXA 1T8EA 3HSUA 1F5SA 3LYSA 4UB2A 4KKIA 3NVWB 3IN5A 4IWOA 4G3IA 2KZRA 2JWUA 8ICAA 4Y2QA 4CO7A 2DW6A 2HOIA 4AQ7A 3FG2P 3IT4B 2FNJB 1KFTA 3U52E 1WXSA 1A6SA 3OGUA 3CNHA 4H4UA 2MBOA 1WUFA 2WOWA 3VR8B 1ZRNA 3A0BU 2J4XA 2WYQA 1S8OA 1SSNA 5C0YA 1WX7A 5CA7A 1YN5A 2C2DA 1V8CA 4B9TA 5J2GA 3DG6A 5HI1A 1GRHA 1HZ6A 2WP6A 3DBHI 2MAXA 1TY0A 3ZRFA 3L5KA 3PTFC 4JN8A 3QE9Y 1W1SA 4DQIA 3SV4A 4I2BA 3EEZA 3F5EA 3GE3C 2VFTA 1V59A 2XGPA 2XH7A 1V85A 2ACZB 1TYTA 2JZBA 5J2HA 5KL1B 5KT5A 2ZXHA 1HUOA 2EKIA 2WP9B 3EUB3 1B4FA 1FNWA 2F44A 1GO3F 1QQ5A 2ALZA 2KDFB 3VHTC 2FCNA 3CF6E 1VZ7A 4KPRA 4J57A 2FPKA 2C7NB 4E4UA 9ICRA 2B76B 5EBKA 3FKYA 3LAEA 3NS8A 4OVUA 1MBBA 3OSNA 2Y4GA 5AKXA 1KEJA 3SAGA 1TAUA 3W8XA 2GGGA 2OKTA 3RI7C 2J6UA 2HW3A 3TQ1A 3CT2A 3GIJA 2LRUA 1V1OA 4Y2JA 2KDMA 2WDTB 3W1SA 2CS4A 2FCQA 1V1PA 1N60A 4KLDA 4BBYA 3V5CA 5HNKA 4TQRA 1VZ8A 2K5PA 3T5HA 4HPLB 2ISPA 4FJYA 2PLIA 4CF3A 3RD2A 4PS7A 1WZ0A 2JZPA 3MY9A 3C21A 2W43A 4BWJA 1DK3A 5L9XA 4O5KA 5HR6A 2KD0A 3EJDB 1KRHA 4KLLA 1FECA 2I9GA 3ISDA 3RR7A 4PWBA 4Z6DA 2I5QA 5AE1A 1RQLA 3KVFB 2X99A 4J03A 1MQ2A 3ZDTA 4OHJA 1M94A 4M6UA 2ES6A 1CK1A 2DYBA 1TGZB 2WDWA 2NV3A 3IG8A 2KTFA 2HXTA 1Z4OA 4MF8A 2M0NA 3KFUF 1L6VA 2EZYA 2P3HA 2BCPA 1MBTA 3C2KA 4WJ3B 1RM6B 3A4SC 2VZKB 5CWRA 3Q8RB 1N5WA 3C28A 4F4YA 3TAPA 2KYWA 4XC2A 1NHSA 1GJZA 4HVBA 3Q45A 5AM3A 1ZR6A 2EZZA 5E79U 1K52A 1JWSD 2PSNA 4UW9A 2X8XX 3QKEA 3AU4A 3T8QA 1T6BX 2IA6A 2R18A 4RPYA 2GBNA 4H83A 3L3FX 3ISBA 4IKGA 2G5IB 1X66A 2Z7JA 4QNLA 3UJRA 3DEEA 1XC9A 5IOIA 2OEHA 5KFLA 2HSZA 4QZBA 2FI1A 3TAQA 4I27A 2YEPB 2XH2A 3BZDB 4LCDE 3HVDA 1FXIA 4J6IA 4ECWA 4OALA 3AN1A 3VRAB 5JH5C 3G6XA 1YEYA 2ASLA 2IPIA 4IQVA 2QARB 1SB3C 1TV9A 1C7YA 2AU0A 2ON8A 5G55A 4D2KA 3AQEA 1PDXA 3QU2A 1Y88A 1A76A 4RF1A 3IG3A 5C23A 2IOHA 1W1LA 2QB0A 3IXSA 5T8IA 2V3BA 9ICFA 8ICIA 4BKSD 4P4MA 4I2HA 1YNTE 4KGRA 2XGZA 2QILA 5HMRA 2FMSA 1ZPSA 4EE2A 4BV6A 2QSDA 3I3TB 2PI5A 2DHZA 2VFVA 5IINA 1T94A 5AHXA 3EECA 1E0YA 1WX8A 9ICSA 3UINB 1MOKA 4LNKA 5DB9A 3GIKA 1GOZA 5KFMA 1ZRMA 3OJSA 1FHVA 2G1EA 1SJBA 4KX5A 4UB3A 3BINA 3IG5A 2HJ1A 3M7DA 3TJPA 4HRSA 2EQ6A 2NPXA 4Z17A 5H2FU 3TFSA 3IJLA 2K0PA 5AM5A 4FBUA 3ETLA 3ZTCA 4EEYA 2QPMA 5ADZA 2F8LA 3B0XA 3D9XA 4IC7B 3WIMA 1FEBA 1UWXA 3PHXB 5J18A 4YR3A 4YSYB 2W7PA 5JCLA 3PMLA 1XQQA 2GGJA 3DVNV 1URJA 2YTUA 4QW8A 3B2GA 5B5EU 2VAOA 4UB4A 4M9GA 2XC9A 5BO4B 3NHEB 4JQ9A 5AKJA 2ZZBA 4C8MA 3L08A 3VTWA 1GETA 4OJPA 4BX9C 5D2MB 4M9NA 1HQRD 2JEFA 4QZEA 1S10A 5A0LA 3S47A 2KKPA 4U7CA 5E6JA 4C7YA 3VTUA 1MPEA 2L05A 2IBKA 3B0YA 3QUBA 3NZ3A 1F3PA 3GRSA 4EYHB 2VJ5A 1OQQA 3V62A 3QUTA 2OZTA 4FJVB 3H1UA 4ANXA 3QFAA 4FFDA 4MFCA 2BKRB 3GC2A 3W5VB 1OEYJ 2MBHA 3LDZE 1D7YA 5ALOA 2PP3A 3CGEA 3R0UA 2ZPNA 1RQNA 2VFRA 2HBKA 2YQEA 3O0FA 2NBVB 4MSMB 4H19A 4DHJD 1XLPA 1FIQB 3AUOA 3S1CA 1SV0C 1CJEA 4I2EA 1S0VA 2J7QB 2K8HA 3B9JA 1V80A 5ALNA 3P2BA 4NWIA 2KAJA 5J2FA 2BC0A 2KHVA 3AEAB 5D6JB 1S77D 2JEJA 3GZNI 4J9QA 8ICQA 1JCKB 4CRXA 4IL0A 2BDUA 2IHMA 1CQVA 4HYKA 1QOAA 1Y8RC 5B66U 1KF6B 4ZRIA 4RQ1A 4RNNA 3T8MA 1N62C 4WURA 3NZUA 1FFUA 3TANA 4KLGA 3ZQ4A 1J2NA 3WALA 3W8ZA 1YJ1A 5CJ7A 4MFFA 4N9F4 3SBFA 1D5XC 2KHWB 4F5NA 1AOGA 1XLQA 2VA8A 4B9LA 4KIKA 3RO6A 1WR1A 1LKYA 1NKCA 2JK6A 4RT2A 1JALA 1NK6A 2J53A 4EQXA 1WE6A 2IGDA 3RTVA 1WH3A 2MRPA 5CTRC 1TZZA 1JXLA 4DOBA 1ZETA 2RDXA 3UMBA 3LYYA 1EUVB 3NO1A 4ECQA 3TFRA 1AROP 4URKA 3SQPA 4ICVA 2J0MA 1TS4A 3L13A 2Y08A 4RQ5A 5KFUA 2RSUA 3GS2A 2BVCA 2ZIVB 1NI2A 5ER0A 1L7MA 1D6EC 1WYGA 2LJ5A 4NJCA 2EQ7A 8ICMA 2V3PA 1HZ5A 3Q8FA 4KSKC 3H4BA 3VRBB 3TEZA 1X40A 4C8LA 4HNCA 2XIDA 1U9LA 4XA5A 3QZ7A 1P98A 5C2TB 1EO6A 4EMWA 2KE7A 3AE3B 4C56C 1HE8A 2PA6A 2M8SA 3R10A 1SXTA 2KSOB 1J0GA 3CAWA 4KTQA 2W9BA 3KKAA 4DEZA 4MHVA 2JGAA 3H40A 5H92C 1JROA 3PWGA 2M0AA 3OAWA 1B9RA 3P4RB 1Q1OA 3VUXA 1QOFA 2SAKA 2HNEA 5AKEA 1UHUA 3DHGC 4IS7A 5AIBA 3EPGA 1ZKHA 2W11A 3GOEA 4BJQA 3R8BA 3N6HA 4GC6A 1SKWA 3WA0A 4K81A 4H4QA 4BXOB 3TEYA 5AZHA 1PVPA 3URHA 5CHVC 3MWCA 3PVLA 4LJXA 3GV5B 5HHDG 5L83A 4CF4A 3CSTA 3JSVB 1A70A 3QX7A 2PMVA 3H8HA 2CHRA 4QZIA 2FLNA 2LUMA 4G0NB 2ASQA 4K3BA 1WM3A 4RNMA 2NVKX 3MSYA 5IIMA 2Q0ZX 5DBAA 2W9MA 4BAXA 4S0RA 2TPRA 3EYZA 3NG0A 1NNLA 2K8BA 7ICTA 3VDGA 2NO4A 3AL0B 3HRDD 5FJUA 3RT3B 3WKCA 4ANVA 1EC8A 2ASJA 4HYRA 1I7HA 2HE7A 5IN7A 2AL6A 4FHKA 3BZCA 3TBLD 2FLLA 1H6VA 2D3AA 2W8KA 4QWCA 2BPSA 3NVWA 4MSQB 1E5WA 1K51A 4QIWF 4EZ6A 2IDYA 2D11A 3VFCA 1TK5A 3LADA 4I2FA 5ALVA 4GN1A 3M6KA 4X57B 2WXJA 1RXWA 4JL9A 1BQGA 2L7RA 2Y5CA 5J0YA 2K89A 2DKZA 2WOIA 1ZQYA 3H7IA 5CB1A 3BY4B 1YN4A 2R8KA 4KLSA 3I5JC 2KJ8A 2DFLA 2KWVB 3SR6A 1V81A 3PW7A 4GU2A 1L4DB 4WQOB 1ZQUA 1I4GA 4A8EA 2O2VB 3H7PB 5ALJA 1RM6C 4RCOA 4ZDVA 2N9LA 3DOWA 2DWQA 4R3DA 1ZQNA 2PTZA 2ZNVB 1NK0A 4DSFA 3O65B 4S17A 2D3CA 5DB6A 3PSTA 3B2FA 4E3CA 5J2KA 1D8BA 1F52A 1NHRA 3NRZB 3V7LA 2LGYA 5FS7A 4W9CA 3ETRB 4UB8U 4NNJB 1JCTA 1PFDA 3D6JA 3HWTA 4H4VA 3UF8A 3KWVA 3QUQA 3D2SA 2OVLA 1LPFA 5AK6A 5KG0A 7ICSA 4YTMB 4W9KA 1U48A 3TQPA 2W9BB 5J0PA 4FN2A 4ED6A 9ICLA 3Q69A 5AKZA 4IP5A 1KFYB 2PE6B 2MUTB 2AWTA 3ETRA 2RPQA 3ML9A 3Q8KA 2LHEA 3HM3A 3GRTA 3WKDA 1DXLA 4H2AA 1UT5A 5IIKA 2ZTDA 1FO4A 5FS6A 1EC9A 1F0ZA 3AEBB 2PGWA 4DOCA 1PDYA 5L1MA 4TVWA 4ZH4A 1I4RA 2N9EB 4J3OD 3B1LX 1I42A 3KZXA 7ICNA 3AMZA 2GWSA 4HPNA 4RQ4A 2BHNA 3V05A 3FW7A 2YAUA 1EXNA 3SYZA 1KLVA 1F77A 3IHQB 5ALLA 1NU5A 3GY1A 5KVHA 3BQ2A 1WGHA 3AE4B 3WK5A 1TAQA 4C80A 1J7AA 4YT0B 4IC9A 2J0JA 3APFA 3N9YC 1WUDA 3LDAA 4UBBA 4FHJA 2RP5A 2OWOA 3CYMA 3OJ4B 3CRXA 1DIIA 1FMAD 4JX1C 3BK1A 4DSJA 2KTRA 3JW0X 9ICBA 2N9PC 4FDCB 1C76A 1SWVA 1BPBA 4MELA 1GRTA 3PW0A 2Z0DB 3BVGA 3HPFA 3W9CB 3PSPA 4FS2A 1OFFA 3HVZA 2J3NA 4DOAA 4Q8FA 3HPOA 2A5UA 4TKNA 1C79A 3DHIC 3WAPA 3MGHA 4GISA 1AYFA 4PJ0U 1RFAA 1R4NB 3RB6A 2LXAA 3A1QA 5J2IA 2KX0A 3T3OA 1O08A 2XH4A 5EWFA 2WNMA 2W9CB 3PRPB 4GYPA 2UUUA 1OXJA 3ZKJC 2GO7A 4IT1A 2KK0A 4YFKA 4XRHA 1ZE3D 4C00A 2ZC8A 4IRDA 3R11A 3TUOA 2PU0A 2AKMA 4Z6FA 1W1OA 3LJ3A 4IUMB 4F7ZA 2E1EA 2PPGA 4R63A 4ECZA 1TFRA 4JUZA 2K9XA 4YD1A 2F8KA 3HW8A 5AM2A 3H7PA 2A19A 3EW9A 1K8RB 2N0SB 2KJHB 3FYYA 1IG6A 2BS4B 3PS6A 1YT3A 1SXDA 3GSYA 5FMHA 4CGZA 4IW0A 1UT8A 3QFBA 2C3DA 3IDWA 2P35A 1COKA 3SFEB 3JS8A 4J9KA 4YTNB 4H4XA 3PZDA 5AK3A 3Q3MC 8ICOA 2BF8B 3PREA 3R2TA 1QH9A 4G9BA 5AKLA 3BJYA 4ED2A 4KZ0A 1T3QC 4EMJA 2YQUA 1P9DU 5ALEA 2LGXA 2FYMA 4ICAA 5CR0A 2ZPYA 1AW7A 2OOBB 4DSEA 2MSED 2BTEA 2KJRA 4K8DA 4NQLB 4P1CC 3T6CA 3Q8CA 2G5HB 1Q8KA 1EWYC 2ZTCA 7ICKA 2HZGA 4IR9A 1ZQDA 4HK2A 4NY8A 1UGJA 3OZMA 4HPPA 3C2LA 1F0MA 1AARA 4NM1A 1SBBB 1WXAA 2B3AA 2K6QA 3V6KA 2QEJC 4NJ7A 1VR9A 2ZVNA 3H12A 4DHGA 4FZNA 1OW5A 3ZJTA 1FHUA 3FXGA 3H7VA 3MKCA 3RNAC 1LFDA 3QX1A 2OG9A 2JT4B 2MH7A 4G3XB 1W1RA 2FIFA 5IIIA 2WXRA 3VA8A 2XCAA 2MJEA 4PYTA 5DQHA 2D6FC 2K8BB 4LJOB 2R8IA 5ALZA 1GG3A 3C8YA 3BOXA 1U4AA 3QIJA 4GMEA 2RQ5A 5L6FA 4IQWA 2I38A 2AXTU 1QSSA 2J52A 4RPZA 4ITKA 5KHOA 1WRDB 3A7UA 5L1KA 3LB8C 1N2XA 5F3XB 2K39A 4QZCA 3ZD9A 2A1JA 2GRIA 3QC8B 4P1BC 1DZNA 5ALKA 4EX6A 1B43A 3PPAA 2VFSA 4UB6U 5J8YC 4X2PA 3HKZF 4CE6A 3FM9A 2BBCA 3FVDA 1XXGA 5KFGA 2G0AA 2VZKD 3W1YA 1IIPA 1YZ6A 2BQ3A 2FBWB 3H4KA 4HDOA 1JMLA 4PWCA 4QZDA 2V3SA 5KG4A 2KTQA 4KVGB 4DL3A 1ZQFA 3ZLGA 4QIWC 3IP4B 5KT2A 3RJIA 4NAWB 1PDZA 1ZXIA 4O1NA 2FE8A 4UAUA 5EOZA 4YWGG 3VCCA 3Q2AC 1EBDA 4WWOA 1X9SA 2XN9C 2TSSA 5FP0A 4J9NA 2K22A 3EANA 4RUAA 8ICEA 3U4FA 4WWNA 5J2AA 1GB4A 2RR9A 1S0NA 1Z00A 2NQLA 3I76A 3NZGA 3PLVA 4TMAB 5FXEA 3UJFA 5DBCA 3H8AA 1UELA 3RJEA 4II2B 3FW9A 3UGVA 3DEDA 4PS8A 3H9DA 4DSLA 2CU3A 2KQ4X 4KX6B 4KZCA 1DXSA 5EE1A 3U26A 1H4RA 3R66C 2FPMA 4RQ2A 1I35A 1XANA 3KZIU 4DHJB 5KFKA 1I19A 4OJLA 4CF5A 4R66A 2ZIWB 4KIKB 1WCLA 3AE7B 3N3KB 1L7NA 1QQ6A 5AM4A 2XEWA 4HCPB 1ZJNA 1KKRA 3T79A 1IGDA 4MDKE 5ALUA 1GESA 1ZQOA 5HP4A 1E8ZA 1EBGA 3AEDB 2L1AA 2GOLA 1COOA 2QARA 1N56A 1S7MA 3MR2A 1N6ZA 4FLHA 1SE3A 2KIVA 7ICEA 4MJSA 1L3UA 4KLTA 4DWFA 1GV4A 2DAJA 3L4PA 3R9KA 1EU4A 5KFSA 4QAYA 3PW2A 2H88B 3AI5A 5KFAA 4OVZA 2N4FA 1XT9B 5DG7A 2KDIA 5KG6A 5DDMA 1FIQA 1C4AA 2QIEB 2LUEA 4KLJA 1ZDXA 2ZJ8A 1XDIA 3ZLHA 4WAAA 2P88A 2ZCBA 3GD4A 5KTQA 1ZQTA 4P0QB 4I2JA 2YB1A 4W9JA 4BOZB 3UIPB 2V4RA 1MO9A 3GO2A 7ICVA 1WE7A 5AK5A 8ICKA 3MHSD 4XYCA 2R8HA 9ICIA 4ZA0A 4B9SA 1DK2A 4DXGA 3T9PA 2BQUA 5AUIA 3DDHA 2JQRB 2Y3SA 1NYQA 2D10A 2UYZB 4WJQA 2OH2A 3TOYA 3OHAA 5TSSA 1ZMCA 1ZQRA 3QU5A 2M1MA 3QAQA 2I1QA 3V6EB 3ZI4A 2DGZA 1ZQJA 4UD8A 2ZIWA 3ZRCA 1PVQA 3B97A 3J81j 3PO5A 2NPTB 4PVHA 2ZEQA 2BVHA 1NHQA 1VRAB 3PRZA 4FX9A 4YMNA 2YVGA 1C3TA 1WVFA 3DBRB 1KDHA 2W82A 2INNE 4ZRJA 2KDBA 1MA7A 1L8PA 4GXBA 3KD3A 4PL2A 4YQWA 2N1WA 2I1JA 2FCMA 3PV1A 4EM3A 1PK1A 4GXKA 3P63A 1KN0A 2F1JA 4HKQA 2BCVA 5TISU 1C20A 3MP9A 2PI4A 4AP9A 1KLUD 2AQ1B 2LVQA 5FXPA 1E8YA 3MTNB 3V60A 2DL0A 2K4EA 2E8PA 2LI5A 1WZ3A 2K25A 2KJ6A 4TVYA 1BPXA 2JX5A 4ELVA 2RDBC 2EQ8A 3TADC 3PGEA 5FR3A 5ALYA 2WHIA 2YMPA 2B21A 2KFKB 3APDA 4XWTA 9ICUA 1KQQA 3AM9A 4JB1A 3Q8EA 2JZBB 1FRDA 2F2AB 1MDLA 1YX6B 3MJ5A 2Z59B 3MC9A 5KFDA 4M6WA 3BVZA 3RAQA 3WANA 3ZDCA 1YQBA 5FKAC 4IRCA 1L6NA 2I5HA 2LGDA 3P42A 2ONEA 1Q10A 3OJUA 1PVRA 2WP5A 2DQNB 4JV0A 1F2RC 4CHKA 5KFFA 5KG2A 1JI7A 1CEZA 2G08A 1NJYA 2BGFA 4EYIB 2K4HA 1HEZE 4MACA 1ZOLA 4W9DA 4C4SA 5ALQA 4Y2TA 1U45A 1K4QA 2WXMA 3OZYA 4PZOA 3MC8A 4NY0A 4R65A 1DGJA
chains in the Genus database with same CATH topology
4M0WA 2BT6A 4GDKB 5GXGB 4MLAA 3P4PB 4C7YA 3GP7A 1MPEA 3AEGB 3NZ3A 3URYA 1UXYA 1OQQA 4N6EB 1XCTL 5C3JB 2R2ZA 5HQXA 4C7ZA 1R7SA 3EA6A 3W5VB 1N63C 3GB1A 1T5XD 4OZBA 4BC7A 3P4QB 4PZFA 1SF0A 4KGTA 2VFRA 2DBYA 3AE2B 3FILB 2LFIA 2LMCA 1XLPA 1FIQB 3HRDC 3S1CA 1CJEA 4A90A 3D2DA 3B9JA 1WRIA 2KAJA 2PLPA 3AE5B 4ZHOA 3AEAB 4A55A 3J9CA 4JWUC 3RJ8A 1N63A 1JCKB 1TS2A 5L6GA 5HFYA 3D2HA 1CQVA 1QOAA 1KF6B 2WXQA 5BMIA 1N62C 1XEEA 4WURA 1D5ZC 1FFUA 3ZQ4A 2N9KA 1QF6A 3W8ZA 1D5XC 2IGHA 1DYQA 1XLQA 3I99A 5D3DA 1WWTA 2ONQA 5AE2A 1EU3A 1JALA 3IAS1 1AHVA 1SE2A 4YXDB 2J53A 2Y3RA 2MJ3A 1Y56A 2IGDA 4WQMA 1NENB 3NVZB 1PGBA 3LYYA 1TYGB 1L0VB 4P6VF 3VR9B 2Y08A 3W8WA 1TS4A 4RH6A 1XLOA 1JRPA 1KLGD 3GS2A 4ZRPA 3RPFC 1D6EC 3AECB 1WYGA 1QOGA 4NJCA 1NYRA 1HZ5A 2V3PA 3Q8FA 5D79A 3VRBB 3TEZA 2PW9A 4YTPB 3ZGZA 1WGKA 1K53A 5C2TB 2WXHA 3AE3B 4C56C 1SXTA 5H92C 4BCAA 1JROA 2M0AA 3ZYYX 2XNAC 1J7CA 1B9RA 3FILA 2I0KA 1T3QA 3P4RB 2RDGA 1QOFA 3C0PA 4RFBA 2SAKA 2YVSA 4HROA 2RPVA 3R8BA 1SB3B 3NVVB 1VQZA 1X2GA 1SIJA 2N7JA 1J7BA 1UNSA 1CZPA 1JQ4A 2Y5PA 2PIAA 3TEYA 1PUTA 5BYQA 1IUEA 2AX5A 5HHDG 2PVOD 2BB5A 2DYMA 4A8XC 1A70A 2RK5A 2PMVA 1FRRA 2RMMA 3H8HA 5H8YE 4ZHPA 2LUMA 3I57A 4ZRQA 4ARCA 1VZ6A 2K3UA 4OW0A 3P1MA 2OAIA 1MHHE 1W1QA 3U4EG 4TQ0A 5G5GA 3E56A 2H89B 3EUB2 3HRDD 1I7HA 4MH8A 4L1BA 3AV8A 3U2SC 4PT5A 4ZOHC 2WXNA 3BW7A 2DYOA 1HXYD 2D5GA 1XO3A 4KKJA 1W1JA 3NVWA 1K51A 5D3IB 2WXFA 1XLNA 2IDYA 5HG2A 2KACA 1L0XB 2WXOA 2BYTA 2BW2A 1ESFA 1F2RI 1SJED 4RGOS 2FUG1 2WXJA 2ZW0A 4HG0A 2W3SA 3BIID 2Y5CA 3BYTB 3S1FA 1GAQB 1YN4A 3KLSX 2I2YA 1DOXA 1N61A 3P4SB 1C4CA 3SR6A 3PZ7A 3A7RA 1L4DB 2V4IB 4HEA1 1I4GA 2R8DA 4A6QA 4YSXB 3DWGC 1E0ZA 1AHZA 1JWBD 4RCOA 1RM6C 1XF5L 2N9LA 2DWQA 4R3DA 3AH7A 4PVKA 3HUIA 1YJJA 4KGSA 3D2JA 1N5XA 2AQ2B 3B2FA 4PVEA 3W5UB 3NRZB 1C9FA 1PGAA 1ET6A 1JWMD 1LO5D 4RF0A 3ETRB 1GPXA 3DQ0A 2WXPA 3Q8AA 5EE9A 1PFDA 1E9MA 1QKZA 5EE3A 1N60C 4B0MA 4XWWA 2CJOA 3KWVA 1L0YB 1W1MA 4REZA 4ZYSA 3TEXA 1JWUD 1YQ4B 1V97A 4YTMB 1E10A 3NS1A 1E8HA 4LLGM 2V3NA 1SJHD 4GLSC 3WCQA 3Q69A 2PTLA 1I4XA 1KFYB 2BS2B 3W2DA 3TEWA 2BVFA 3ETRA 3CWIA 2LHEA 3Q8BA 3NUHB 4H2AA 2KWDA 2GB1A 1P7FA 2W54A 1FNUA 1FO4A 1TS3A 1P7EA 1M4VA 4B0EA 3POPA 2X38A 1HA5A 4WIPA 3TSSA 2DLBA 4US8A 1F0ZA 3AEBB 1KTKA 4TVWA 1I4RA 2JYEA 3AE8B 1NI3A 4J3OD 2Q4WA 2AQ3B 3AMZA 5AE3A 2Q5WD 1IGCA 3U7ZA 2WXLA 3V05A 3FW7A 5G5HB 1MI0A 1F77A 4WAFA 2WLBA 2P13A 3PQBA 4JPSA 2BB6A 3AE4B 4C80A 1J7AA 4YT0B 1UWMA 3N9YC 1WXQA 4O95A 1DIIA 2GQTA 1FMAD 2WQYB 1QILA 4JX1C 1BMLC 3BK1A 4LTUA 3NRZA 2SEBD 3NVVA 2UUVA 1C76A 4WH4A 3NVYA 1OQRA 3PM9A 4DXFA 3BVGA 4MM3B 3W9CB 2INPE 1OFFA 3HVZA 5EE0A 4XDDA 2W3RA 4IDIA 1C79A 1FFVC 1AYFA 1W1KA 4USAA 1E6EB 4RGNA 4JE3B 1V1PB 3NVZA 5LNK1 3T3OA 1ACCA 1IBXB 2P4PA 2WNMA 3DWMA 4XDCA 2UUUA 3PO0A 4TQ1A 1YJIA 3VQIA 1ZE3D 2AXRA 2WU5B 3T3NA 3TUOA 1AHUA 1PGXA 1TJEA 3CIRB 3R2IA 1W1OA 1PYWD 2W55A 4US9A 3R07C 2NQWA 1TKYA 2BS3B 2K9XA 2J42A 4ARIA 4FXCA 4N59A 2N0SB 2BS4B 2Z8LA 3MHZA 4A9AA 2NTSA 3GSYA 1I4HA 1E8FA 2OHFA 2R61A 4XLOA 3AEEB 4DNSA 3SFEB 1FD6A 2JXTA 4YTNB 3JS8A 1AN8A 3B9JB 3R2TA 2QKNA 1T3QC 1DOYA 4JWSC 3UI3A 3RFZB 2VFUA 2QJLA 2O3GA 5I1WA 2WDQB 1GB1A 1UUPA 5JXVA 1AW7A 2EXRA 2WDRB 2BTEA 4IOIE 3AB5A 1KH0A 4OZCA 1N62A 2IGGA 3Q8CA 3OWEB 1EWYC 2YEPF 1E7PB 1L6UA 1X2HA 1VAOA 2M56B 1UGJA 4JAYA 2V0GA 1C78A 1SBBB 3S1DA 1I4QA 2KN4A 2QEJC 1VR9A 3IAM1 3MFGA 4TSSA 1ENFA 1TZOA 4WWMA 3ZJTA 1FM0D 1ET9A 2LEKA 2E6XA 5BMHA 2MH7A 1W1RA 2WXRA 2LGIA 1QOBA 1RWSA 2MJEA 1YN3A 2RDHA 4PYTA 3BWUD 5AUKA 3SFDB 3C8YA 2PVGC 4L2YA 2IPKD 2JSVX 2I38A 4N58A 5AWVA 5L6FA 1C4PA 1TKGA 4ITKA 2J52A 4LK0M 5HHZA 1EM7A 3LB8C 3BYYB 1VDVA 3TSHA 3A7UA 3HSUA 5MPOA 3KWLA 1FFVA 4KKIA 3NVWB 1MHXA 2GRIA 1DZNA 1WVEA 2JWUA 1ZUD2 2VFSA 1FFUC 4AQ7A 2IJ0A 3IT4B 2G9HD 3U52E 1EWCA 1JWAD 1NEKB 2BBCA 1XXGA 2CJNA 2LHDA 2MJDA 3VR8B 5G5GB 2VZKD 2J4XA 2WXKA 1SSNA 5BYRA 1YN5A 2FBWB 1V8CA 1JMLA 4PWCA 5HI1A 2PKOA 1HZ6A 4RNAA 1TY0A 1TY2A 3TX1A 4NAWB 2NTTA 4NAMA 1ZXIA 4O1NA 2FE8A 1W1SA 4YWGG 2E3TA 1BXTA 1TKEA 2VFTA 2XN9C 2ACZB 3MC0B 3FAHA 2TSSA 3LLBA 2EKIA 2K22A 2WP9B 4GDLB 3EUB3 3FWAA 1FNVA 1FNWA 1GB4A 1QLTA 5BMGA 3VTEA 1DIQA 1VZ7A 3AE6B 2QMTA 4TMAB 5FXEA 1D4BA 1VLBA 3FW9A 3DEDA 3NS1B 1QT9A 2B76B 2CU3A 2KQ4X 4KX6B 3LAEA 5EE1A 2BVGA 1ZDVA 1MBBA 1NVID 1L4ZB 3AEFB 2Y4GA 1I19A 2LJIA 3W8XA 2M19A 2L32A 1TS5A 3AE7B 1IBXA 1V1OA 3W1SA 2KDMA 2HTME 4CQNA 1FCLA 1V1PA 1N60A 4RGMA 4YSZB 1IGDA 4PVJA 4BBYA 1VZ8A 2K5PA 1YMHE 4NZLB 2PLIA 2JU6X 3AEDB 2L1AA 2JZPA 1FXAA 1JW9D 4RGTA 4MT5A 3O13A 1KRHA 4Q2JA 5I4DA 4PWBA 1SE3A 1E8GA 5FK9C 5AE1A 3L4PA 4HJGE 1EU4A 2KMMA 2H88B 4OHJA 4OVZA 3V3XA 3SR6B 1L5PA 1CK1A 2Y3AA 1RFKA 1FIQA 1C4AA 2ZW1A 2QIEB 3TSJA 1ZDXA 2WDWA 1N61C 3ABVB 1VJKA 1QLBB 2OEDA 1L6VA 3S1EA 2P3HA 3BVMA 1MBTA 4ZOHB 1RM6B 1D5MC 3KQ4A 1DOIA 2VZKB 1N5WA 3LXFA 3ZJUA 1ZR6A 4DXGA 3FW8A 1K52A 5AUIA 3SEBA 2JQRB 2WU2B 2WXGA 2ICIA 2L52A 1JWSD 1NYQA 3A7AA 2Y3SA 5TSSA 1T6BX 1QLUA 5I1VA 1K50A 4IKGA 3EGRA 5K8EA 1WSPA 4P16A 4UD8A 2YEPB 3BZDB 3IT6B 2MEKA 3HVDA 1FXIA 1AWDA 4OALA 4PVHA 2BVHA 1XCQL 3AN1A 4UDUC 3VRAB 5D7GA 4AS1A 1VRAB 3FC4A 4OZAA 4BC9A 2IPIA 5FXDA 1SB3C 2L83A 1ZXHA 4HKZE 2ON8A 4D2KA 3NVYB 1WVFA 1PDXA 2W82A 3I9V1 4RF1A 2INNE 3PZ8A 1W1LA 1RYJA 2WDVB 3IXSA 5T8IA 4ML8A 1YNTE 1SE4A 4KGRA 2QILA 5HMRA 3P63A 1N5WC 2HDEA 4HKQA 1ZPSA 4EE2A 2JYTA 2WXIA 2QSDA 3MP9A 3ZJVA 5G5HA 3RJAA 1KLUD 2AQ1B 1QQRA 2VFVA 1B1ZA 5FXPA 1E0YA 2WS3B 1ZP0B 4DQOC 1MVKA 1I4PA 3BK2A 4TVYA 2JX5A 1GOZA 4XE0A 2G1EA 2GI9A 5FR3A 1YQ3B 1HSKA 4HRSA 5FXFA 4XWTA 2MBRA 3AM9A 4JB1A 2K0PA 3AE9B 4L23A 3Q8EA 1FRDA 3E9SA 2QPMA 5ADZA 3MJ5A 3BVZA 1C77A 1SEBD 1BUIC 5FKAC 1UWXA 3P42A 1ZXIC 1ROEA 4EC3A 1Q10A 4YSYB 2Q85A 1F2RC 5BYSA 2GQUA 3B2GA 2VAOA 1HEZE 2EELA 2NMQA 4MACA 3KJMA 2PLSA 1HQRD 1STEA 2WXMA 1FEHA 3AE1B 1F0XA 2E5AA 1FCCC 1ZOYB 5E6JA 1DGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BT6 A;  5GXG B;  4MLA A;  3P4P B;  4C7Y A;  3AEG B;  1UXY A;  2R2Z A;  1OQQ A;  4N6E B;  5C3J B;  5HQX A;  4C7Z A;  1R7S A;  3W5V B;  1N63 C;  4BC7 A;  3P4Q B;  4PZF A;  1SF0 A;  2VFR A;  2DBY A;  3AE2 B;  1XLP A;  1FIQ B;  3HRD C;  3S1C A;  1CJE A;  3D2D A;  3B9J A;  1WRI A;  2KAJ A;  3AE5 B;  4ZHO A;  3AEA B;  4JWU C;  1N63 A;  3D2H A;  1QOA A;  1KF6 B;  1N62 C;  1FFU A;  1QF6 A;  3W8Z A;  1XLQ A;  3I99 A;  1WWT A;  5AE2 A;  1JAL A;  1AHV A;  4YXD B;  2MJ3 A;  4WQM A;  1NEN B;  3NVZ B;  1TYG B;  1L0V B;  4P6V F;  3VR9 B;  3W8W A;  1XLO A;  1JRP A;  3RPF C;  3AEC B;  1WYG A;  1QOG A;  1NYR A;  5D79 A;  3VRB B;  4YTP B;  1WGK A;  5C2T B;  3AE3 B;  5H92 C;  4BCA A;  1JRO A;  3ZYY X;  1J7C A;  1B9R A;  2I0K A;  1T3Q A;  3P4R B;  1QOF A;  3C0P A;  2YVS A;  4HRO A;  1SB3 B;  3NVV B;  1VQZ A;  1X2G A;  1SIJ A;  1J7B A;  1CZP A;  1JQ4 A;  2PIA A;  1PUT A;  1IUE A;  2AX5 A;  2PVO D;  1A70 A;  2RK5 A;  5H8Y E;  1FRR A;  4ZHP A;  3P1M A;  2OAI A;  1W1Q A;  5G5G A;  2H89 B;  3EUB 2;  3HRD D;  1I7H A;  3AV8 A;  3BW7 A;  4ZOH C;  1XO3 A;  1W1J A;  3NVW A;  1XLN A;  4HG0 A;  2W3S A;  3BII D;  2Y5C A;  3S1F A;  1GAQ B;  1DOX A;  1N61 A;  3P4S B;  3SR6 A;  3A7R A;  2R8D A;  4YSX B;  3DWG C;  1E0Z A;  1AHZ A;  1JWB D;  1RM6 C;  2DWQ A;  3AH7 A;  4PVK A;  3HUI A;  1YJJ A;  3D2J A;  1N5X A;  4PVE A;  3B2F A;  3W5U B;  3NRZ B;  3ETR B;  1GPX A;  3DQ0 A;  5EE9 A;  1PFD A;  1E9M A;  5EE3 A;  1N60 C;  2CJO A;  1W1M A;  1YQ4 B;  1V97 A;  4YTM B;  1E10 A;  3NS1 A;  1E8H A;  3WCQ A;  1KFY B;  2BS2 B;  2BVF A;  3ETR A;  3CWI A;  2W54 A;  1FO4 A;  4US8 A;  1F0Z A;  3AEB B;  4TVW A;  3AE8 B;  2Q4W A;  1NI3 A;  3AMZ A;  5AE3 A;  2Q5W D;  3FW7 A;  5G5H B;  2WLB A;  2P13 A;  3AE4 B;  4C80 A;  1J7A A;  4YT0 B;  1UWM A;  1WXQ A;  4O95 A;  1DII A;  2GQT A;  1FMA D;  2WQY B;  4JX1 C;  4LTU A;  3NRZ A;  3NVV A;  3NVY A;  1OQR A;  3PM9 A;  3W9C B;  1OFF A;  3HVZ A;  5EE0 A;  2W3R A;  4IDI A;  1FFV C;  1AYF A;  1W1K A;  4USA A;  1E6E B;  3NVZ A;  2P4P A;  3DWM A;  3PO0 A;  1YJI A;  2AXR A;  2WU5 B;  1AHU A;  1TJE A;  3CIR B;  1W1O A;  2W55 A;  4US9 A;  3R07 C;  2NQW A;  1TKY A;  2BS3 B;  2K9X A;  4FXC A;  4N59 A;  2N0S B;  2BS4 B;  4A9A A;  3GSY A;  1E8F A;  2OHF A;  4XLO A;  3AEE B;  4DNS A;  3SFE B;  3JS8 A;  4YTN B;  3B9J B;  2QKN A;  1T3Q C;  1DOY A;  4JWS C;  2VFU A;  2QJL A;  2O3G A;  2WDQ B;  2EXR A;  2WDR B;  3AB5 A;  1N62 A;  1EWY C;  1E7P B;  1L6U A;  1X2H A;  1VAO A;  2M56 B;  4JAY A;  3S1D A;  4WWM A;  1FM0 D;  2LEK A;  1W1R A;  2MH7 A;  1QOB A;  1RWS A;  2MJE A;  4PYT A;  5AUK A;  3SFD B;  2PVG C;  4N58 A;  1TKG A;  4ITK A;  5HHZ A;  3A7U A;  3LB8 C;  3TSH A;  1VDV A;  5MPO A;  3KWL A;  1FFV A;  3NVW B;  1DZN A;  1WVE A;  1ZUD 2;  2VFS A;  1FFU C;  1JWA D;  1NEK B;  2CJN A;  3VR8 B;  5G5G B;  2MJD A;  2FBW B;  1V8C A;  4PWC A;  2PKO A;  3TX1 A;  1ZXI A;  1W1S A;  2E3T A;  1TKE A;  2VFT A;  2ACZ B;  3FAH A;  3LLB A;  2EKI A;  2K22 A;  2WP9 B;  3EUB 3;  3FWA A;  1QLT A;  3VTE A;  1DIQ A;  3AE6 B;  5FXE A;  1VLB A;  3FW9 A;  3DED A;  3NS1 B;  1QT9 A;  2B76 B;  2CU3 A;  4KX6 B;  3LAE A;  5EE1 A;  2BVG A;  1MBB A;  1NVI D;  3AEF B;  1I19 A;  3W8X A;  2M19 A;  3AE7 B;  2HTM E;  1N60 A;  4YSZ B;  4PVJ A;  4BBY A;  2K5P A;  2PLI A;  3AED B;  1FXA A;  1JW9 D;  1KRH A;  4PWB A;  1E8G A;  5AE1 A;  3L4P A;  2KMM A;  2H88 B;  3SR6 B;  1L5P A;  1RFK A;  1FIQ A;  2QIE B;  3TSJ A;  1N61 C;  3ABV B;  1VJK A;  1QLB B;  1L6V A;  3S1E A;  2P3H A;  1MBT A;  4ZOH B;  1RM6 B;  1DOI A;  1N5W A;  3LXF A;  1ZR6 A;  3FW8 A;  5AUI A;  3A7A A;  2JQR B;  2WU2 B;  2L52 A;  1NYQ A;  1QLU A;  4UD8 A;  1FXI A;  1AWD A;  4OAL A;  4PVH A;  2BVH A;  3AN1 A;  3VRA B;  3FC4 A;  4BC9 A;  5FXD A;  1SB3 C;  2L83 A;  3NVY B;  1WVF A;  1PDX A;  1W1L A;  1RYJ A;  2WDV B;  4ML8 A;  5HMR A;  3P63 A;  1N5W C;  5G5H A;  2VFV A;  5FXP A;  1E0Y A;  2WS3 B;  1ZP0 B;  4TVY A;  2JX5 A;  2G1E A;  1YQ3 B;  1HSK A;  4HRS A;  5FXF A;  2MBR A;  3AM9 A;  4JB1 A;  3AE9 B;  1FRD A;  2QPM A;  5ADZ A;  1ZXI C;  1ROE A;  4EC3 A;  4YSY B;  2Q85 A;  2GQU A;  3B2G A;  2VAO A;  3KJM A;  2PLS A;  3AE1 B;  1F0X A;  2E5A A;  1ZOY B;  1DGJ A; 
#chains in the Genus database with same CATH topology
 4KLO A;  2OYY A;  3GP7 A;  4DS4 A;  4AWJ A;  4I6L B;  5J0W A;  1UXY A;  2R2Z A;  2CRX A;  2GH1 A;  4O3M A;  3GII A;  5HQX A;  1R7S A;  3BQ7 A;  2YVF A;  3DGB A;  2UU7 A;  1FPY A;  3EA6 A;  1MN8 A;  3VH4 B;  1N63 C;  3N6J A;  4H2H A;  4ZRK A;  1ZDL A;  3NRW A;  9ICV A;  1RXV A;  4MGK E;  2LHT A;  3CB3 A;  1UD7 A;  5JCN A;  3OJ3 A;  2MBQ A;  1F9C A;  4KPL A;  4E8G A;  2LMC A;  2POD A;  1JEH A;  2P6R A;  9ICX A;  4A90 A;  4LZD A;  2BCQ A;  4GIR A;  1WRI A;  4B9M A;  5IDZ A;  4U6P A;  3V7J A;  2XGQ A;  3RB0 A;  1HTO A;  1CUK A;  2H3Q A;  5D46 A;  2ZJ5 A;  3GDX A;  2VA2 A;  4O9M A;  9ICE A;  1N63 A;  7ICQ A;  1KD0 A;  3RJ8 A;  1RAX A;  1WI0 A;  4K7U A;  2WXQ A;  4J9O A;  4KLU A;  3VUY A;  2EAM A;  5J0T A;  5J8Y A;  1SXE A;  1QF6 A;  4PHE A;  2L3Z A;  3VC5 A;  1SL2 A;  5KFB A;  1E90 A;  1DYQ A;  8ICW A;  5J0X A;  3I99 A;  2CFY A;  2GDQ A;  3OTQ A;  1ZQP A;  2KVR A;  5AE2 A;  1EU3 A;  2X8H A;  3LB8 A;  3IAS 1;  2HHV A;  1AHV A;  2Y3R A;  5ALX A;  2MJ3 A;  1A0P A;  1Y56 A;  1ZQK A;  1NEN B;  3RR8 A;  2WF7 A;  2YX8 A;  3BS5 B;  2EMT A;  1WCN A;  4LJP B;  4DDG D;  1V5O A;  2BKE A;  5DPR A;  1PGB A;  3DEQ A;  1TYG B;  3DVG X;  4EEL A;  2LXC A;  3VR9 B;  7ENL A;  5ALR A;  3ZDD A;  2IND C;  1JRP A;  4RU9 A;  2VH2 A;  3BQ1 A;  3AEC B;  3HHM A;  2YB4 A;  1QOG A;  1QZE A;  2DZJ A;  4H4S A;  5D79 A;  4ED0 A;  2QVH A;  3ES7 A;  1NJX A;  1ZQH A;  3NAS A;  3SD5 A;  2GGE A;  1LQB A;  1BVS A;  8ICC A;  1OGW A;  3CMM B;  4F2S A;  4JWN A;  4F4X A;  3RB4 A;  1V9J A;  2WXH A;  1STZ A;  5D94 A;  3ZDB A;  5IKC M;  4GRT A;  1RYU A;  3KYC D;  5CHW A;  3C29 A;  2HJ8 A;  2E8M A;  4BCA A;  1EF1 A;  4RQ7 A;  1MJD A;  1JPM A;  5KAF U;  1YZ7 A;  2I0K A;  1T3Q A;  3CW2 C;  2RDG A;  5J0O A;  3C0P A;  4DS5 A;  2PMZ F;  4DQR A;  4DL6 A;  5KFW A;  4Q43 A;  1KLN A;  4M9H A;  6ENL A;  2F3N A;  1P0R A;  1VQZ A;  3ML8 A;  5AI0 A;  2PCE A;  1UNS A;  1O03 A;  1NK7 A;  4EQW A;  1E8X A;  2JXX A;  5BYQ A;  2YVJ A;  2PVO D;  1BGX T;  2CXY A;  3Q3J A;  1FRR A;  1BNO A;  1XO1 A;  4NPN A;  5DGB A;  3C1Y A;  4ARC A;  3C2M A;  1LKY B;  3SAF A;  2MBB B;  4ANW A;  2BYF A;  2IOF A;  2K3U A;  3P1M A;  2KX3 A;  2NRT A;  5AIC A;  1MHH E;  2LRW A;  3E56 A;  2KNB A;  4BWM A;  2VKQ A;  4FBT A;  1R4M I;  3N1Z C;  3EUB 2;  4OCZ A;  9ICO A;  3A9J B;  4F4Z A;  3U2S C;  4LDT B;  4TUU A;  4PT5 A;  3BW7 A;  3PY8 A;  3JSV A;  5KFZ A;  8ICU A;  2JHD A;  3HK0 A;  4F1S A;  2OXO A;  1XO3 A;  3RNC C;  5FR6 A;  1RG6 A;  4RQM A;  3M8R A;  3M8S A;  4UAW A;  2CHZ A;  3N97 B;  2X50 A;  3MDC A;  4Y2R A;  3UXP A;  4RGO S;  1SJE D;  2FUG 1;  3Q8S B;  4HG0 A;  3BII D;  3BYT B;  3T4W A;  4F91 B;  2UWQ A;  3KBB A;  4YMO A;  1NK5 A;  4QJF B;  2LGS A;  4EMI A;  1GAQ B;  3KLS X;  2I2Y A;  3KUZ A;  2WTF A;  3N20 C;  5J0U A;  1ZQI A;  3DGZ A;  4H50 A;  1UH6 A;  2KD1 A;  1XSN A;  1C4C A;  1X42 A;  2P6U A;  1H8C A;  4RUC A;  3A7R A;  2R8D A;  4AP4 C;  4DSI A;  1SWW A;  1AHZ A;  4IL6 U;  4M6W B;  4BKS A;  1ZQG A;  4GC7 A;  4HCH A;  2KVC A;  5C1Z A;  2WFA A;  4OJ6 A;  4XUS A;  3AH7 A;  3HUI A;  1YJJ A;  4GIV A;  2KZM A;  3OG5 A;  2H5X A;  5AI8 A;  1N5X A;  4C8K A;  2AQ2 B;  3W5U B;  5FS8 A;  3OPX A;  5GTH U;  5KFX A;  2JEI A;  1ZQQ A;  1E7V A;  1NK4 A;  2CPR A;  4RF0 A;  3PW4 A;  2WXP A;  2BC1 A;  1S3S G;  4B0M A;  4XWW A;  1RZT A;  3ENL A;  1L0Y B;  1W1M A;  5DCN A;  4REZ A;  4ZYS A;  2FDR A;  1YQ4 B;  1WF9 A;  5CP2 A;  4DL4 A;  3PK7 A;  1E8H A;  4LLG M;  2V3N A;  2ISO A;  4O5C A;  4YWS A;  2PTL A;  2ZVO A;  3TEW A;  2CN1 A;  3W2D A;  1XNS A;  4W9E A;  2BVF A;  4BUG A;  3CWI A;  1RPL A;  2P8C A;  3DBS A;  3QHT A;  3Q8B A;  2AGO A;  4C8N A;  4F71 A;  5CHG A;  1TS3 A;  2GB1 A;  4B0E A;  1M4V A;  2PP0 A;  1L8O A;  2X38 A;  1S0M A;  4WIP A;  4IM0 A;  2DLB A;  3OC4 A;  1ED1 A;  3H6N A;  3CXO A;  4A35 A;  4NAW A;  1TT5 B;  3UJ2 A;  1NI3 A;  2C28 A;  1B22 A;  3CSF A;  3QTP A;  1VJ5 A;  3UJS A;  4R8U A;  5AE3 A;  2Q5W D;  3KLJ A;  3ES8 A;  1TK8 A;  4W9L A;  4UQG A;  3Q6B A;  4LA1 A;  2CDU A;  5C5J A;  1A77 A;  2QKN A;  4J9P A;  4WAF A;  5KFY A;  4JPS A;  1XU4 A;  3UM9 A;  4PYZ A;  3DER A;  1D9F A;  2IO0 B;  3IVF A;  2KSO A;  2XK5 A;  4NLG A;  5FJO A;  5KVI A;  2F76 X;  2ATL A;  3M63 B;  4KV2 A;  4K3C A;  4ECU A;  1QIL A;  5KFT A;  1YD8 U;  3M3J A;  4W9G A;  3O0H A;  4Y2U A;  4F93 B;  2QC8 A;  3NVV A;  7ICL A;  4UAZ A;  4GMV A;  5CX3 A;  2QQ6 A;  2V3A A;  2M9N A;  1IM4 A;  2QKQ A;  2KFN A;  2RDI A;  1OQR A;  4K7S A;  3H8W A;  5BOE A;  3DG3 A;  5EE0 A;  4JIO U;  1Z19 A;  1LGR A;  4XDD A;  1QTM A;  3UCD A;  4QWD A;  4LZG A;  2JVC A;  2LD9 A;  3GZF A;  3QXG A;  2REX A;  1ZD2 P;  2XI9 A;  4RGN A;  3X0W A;  1W1K A;  3L5O A;  4FE3 A;  5LNK 1;  3DBR I;  3UQ0 A;  2KWU B;  2P4P A;  1JIH A;  2E8O A;  4QW9 A;  3WKA A;  5D49 A;  1TK0 A;  1PK1 B;  1T0R C;  3WAO A;  2GR0 A;  3PO0 A;  3R25 A;  4HNL A;  5AM0 A;  2K8C B;  4K4H A;  3T3N A;  4EZ9 A;  3RJJ A;  1PYW D;  3R07 C;  2HHX A;  4J9S A;  1TKY A;  1WY8 A;  2BS3 B;  4HPM B;  5E6N A;  3BQT A;  1WJ6 A;  8ICS A;  4GDK A;  1VD2 A;  2J42 A;  4ARI A;  4KLM A;  1IV8 A;  4FXC A;  4H4W A;  2BCR A;  2GLE A;  2DAF A;  1UPH A;  2GBM A;  3V7K A;  2D07 B;  2WB1 C;  1JN3 A;  2IO1 B;  2GH5 A;  4RM9 A;  3LXD A;  5KFN A;  1NBF C;  4IWP A;  4UAY A;  4F2R A;  1WM2 A;  2INC C;  2XH0 A;  2DZK A;  1OEY A;  2G3Q B;  3AEE B;  4FZM A;  2AEH A;  2NRV A;  5KFP A;  1AN8 A;  3TKA A;  3B9J B;  4ACF A;  3THU A;  3SN4 A;  4E5T A;  3VVW B;  5AZF A;  3RFZ B;  2QJL A;  2WPF A;  3TAC B;  1Q1W A;  2O3G A;  7ICR A;  1GC7 A;  4GB9 A;  3RZF A;  2PU1 A;  2AGP A;  1UUP A;  5I1W A;  2EXR A;  2JPH A;  2PXI A;  3G6V A;  3AB5 A;  1KH0 A;  2ZIU B;  1E7P B;  1NZB A;  3QNM A;  4B9V A;  4H1Z A;  2CHW A;  3H8M A;  1Z00 B;  2M56 B;  3DHH C;  4A3P A;  1G6J A;  2BCS A;  4JAY A;  2RHF A;  3Q8P B;  3S1D A;  2ZZP B;  2OFJ A;  4XGA B;  4F5O A;  2PS2 A;  5TZV A;  3IAM 1;  3MFG A;  4TSS A;  1ENF A;  5LXH A;  2JR5 A;  4I2I A;  4IL2 A;  1ZYQ A;  1ET9 A;  4ADW A;  3Q8M A;  3UXL A;  4ED7 A;  1NK8 A;  3ZIM A;  2LGI A;  4K7Z A;  4BOS C;  4NLK A;  2LM4 A;  2BQQ A;  5AI9 A;  3JVA A;  3SFD B;  1ZQZ A;  5KFH A;  4YMM A;  4L2Y A;  4N58 A;  2FPL A;  4BKT A;  1SZH A;  4K4I A;  1TKG A;  2IY0 B;  5KHQ A;  1MSW D;  2ASD A;  3V6H A;  2DNF A;  4PHP A;  4RQ3 A;  5HHZ A;  1EM7 A;  3EHV A;  4BGD A;  4YL8 A;  5MPO A;  2AH5 A;  3KWL A;  2ZZ0 A;  4NL9 A;  2LPE A;  1MHX A;  3FV9 A;  2MP2 B;  5HMM A;  3VH3 B;  5KFE A;  1WXM A;  1C1Y B;  3BSM A;  1JX4 A;  1FFU C;  3PSI A;  5KT6 A;  2FE9 A;  3IC9 A;  2G9H D;  3E0F A;  5KFR A;  1NEK B;  2PGE A;  1V38 A;  1J2M A;  3E58 A;  5IIJ A;  1OTR B;  3RGT A;  5G5G B;  3RRA A;  2MJD A;  2WXK A;  3BJS A;  3N4F A;  1KL9 A;  5BYR A;  4KIT B;  3H0R B;  4IP4 A;  2JEG A;  2PKO A;  2D3G A;  3L0W B;  4RNA A;  4ECT A;  1SV0 A;  2NR2 A;  1OJT A;  3TX1 A;  4KMO B;  3K75 D;  2NTT A;  2HOQ A;  4ECY A;  1P43 A;  3DDM A;  2BWF A;  5JCK A;  3Q14 C;  2E3T A;  5J0Q A;  1BXT A;  3OTR A;  3N7P D;  3DQV A;  3MC0 B;  3FAH A;  1H38 A;  3P93 A;  3MJW A;  3LLB A;  3BQ0 A;  4DWD A;  1SL1 A;  1Q46 A;  5U25 A;  2W7O A;  4GDL B;  3ZO5 B;  2NRW A;  3RBD A;  3FWA A;  2PMZ C;  1FNV A;  3Q8L A;  4AYB C;  2WHE A;  4AJY B;  1QLT A;  3H8J A;  3DFY A;  1BT0 A;  3VTE A;  4GLX A;  2QMT A;  1D4B A;  2V9H A;  4RPX A;  3SQI A;  4PS3 A;  3PHW B;  2C7M B;  4MEM A;  4ROP A;  1QQ7 A;  3NS1 B;  1QT9 A;  2QDD A;  2L76 A;  4DXK A;  2WF5 A;  2BVG A;  3QU4 A;  5KNI A;  2AAQ A;  1ZDV A;  5E6P A;  3SD7 A;  4ACO A;  1JDF A;  1NVI D;  1L4Z B;  1AQ6 A;  1S1Q B;  2NCN A;  3RNG C;  4GR1 A;  1NKE A;  2LJI A;  4IR1 A;  2OM6 A;  2M19 A;  3VUW A;  2KO3 A;  2GBK A;  3DG7 A;  5EDS A;  1NDD A;  3TWA A;  2PPH A;  2YLM A;  2GBR A;  4CQN A;  3A1Q B;  1FCL A;  4RGM A;  4YSZ B;  4KSL C;  1NHP A;  4ZCW A;  3SSZ A;  2VH1 A;  2POZ A;  2JU6 X;  4C4T A;  2W8L A;  1UBQ A;  4Y2P A;  1U47 A;  1E7U A;  5ALS A;  1JW9 D;  3RBE A;  1T3N A;  3M95 A;  5I4D A;  2D2Q A;  3DES A;  1E8G A;  4YP3 A;  3DFH A;  2Y1J A;  1TBE A;  1ECW A;  4HJG E;  2BQR A;  1ZQM A;  2KN7 A;  2KMM A;  5KG7 A;  3RNF C;  3PFR A;  2H3V A;  3U7D A;  3ZXR A;  1NJZ A;  3M6Z A;  2Y3A A;  1MNS A;  2AL2 B;  2E8N A;  1UCV A;  3WK8 A;  3ZDM C;  2WOV A;  2DZI A;  3PNC A;  3GE8 C;  4DFJ A;  3UXK A;  8ICH A;  1KN5 A;  4RMA A;  3DBH B;  2OED A;  1ZGU B;  2J6T A;  2MX2 A;  3QAR A;  3CK5 A;  3JPP A;  1D5M C;  1DOI A;  3KQ4 A;  4EOY A;  3SEN A;  1UBI A;  2KXJ A;  2AL3 A;  1F1H A;  3LXF A;  4LNF A;  4YWO A;  3ZJU A;  4DHZ B;  2IOF K;  2K4P A;  1V2Y A;  9ICK A;  3FW8 A;  5HHH A;  3U9I A;  2WU2 B;  2ICI A;  2L52 A;  3AU5 A;  4M2Y A;  3PWI A;  4HWI B;  4DNA A;  1QLU A;  2YY6 A;  4F72 A;  2W9A A;  2AL1 A;  4NXZ A;  3MZN A;  2W9C A;  4H4R A;  4DCC A;  5JCM A;  4P16 A;  2XK5 B;  3ZNZ B;  1J8C A;  5F9L A;  1ZKQ A;  3IT6 B;  2XVT A;  4DSK A;  4F5Q A;  1ZD3 A;  4UDU C;  3HW2 A;  2H3F A;  5D7G A;  4AS1 A;  1GRF A;  3FC4 A;  4BC9 A;  5FXD A;  3NVY B;  1KFD A;  5AKG A;  4HKZ E;  4M8M A;  4MGZ E;  2H3I A;  3PZ8 A;  4RM8 A;  1ECQ A;  3KTQ A;  1V5T A;  2WDV B;  3DK9 A;  4I2G A;  2N9X A;  3M9M B;  3S2A A;  3V6C B;  2XSX A;  3QA8 A;  2KZ3 A;  3LVV A;  3SDL C;  2FLP A;  4DFM A;  1A5R A;  3M9O B;  1SE4 A;  2YN4 A;  3FJ4 A;  3SJN A;  8ICF A;  8ICZ A;  1N5W C;  9ICP A;  2ZAD A;  2OZ8 A;  1NPX A;  5AK4 A;  2JYT A;  4KLE A;  2NS5 A;  2MU2 A;  2L0F A;  2G07 A;  3RJA A;  1QQR A;  4IM2 A;  8ICB A;  3EAO A;  4YR0 A;  3GZN B;  2HCF A;  4BFR A;  4DBG A;  2OQH A;  1ZP0 B;  5ALI A;  2KT7 A;  2Y5B B;  3M9N B;  3KKA C;  2ZJD A;  2GI9 A;  3ZUN A;  2EH9 A;  7ICF A;  4I2A A;  7ICM A;  1Z5S B;  5FXF A;  2MBR A;  4A6G A;  1L3T A;  4OD0 A;  4L23 A;  3VCB A;  5DPT A;  3HIZ A;  2O6V B;  2LBO A;  3E9S A;  4KLH A;  3GQC A;  3BZK A;  4XQ8 A;  2LMR A;  5DKW A;  1NJW A;  1C77 A;  2KQ7 A;  1DNC A;  2ZIX B;  3HJE A;  2KFZ A;  2MUT A;  3GU3 A;  1ROE A;  3SV3 A;  4EC3 A;  2KVZ A;  1X6J A;  2QHO A;  5BYS A;  3PO4 A;  2ZUC A;  1ZQC A;  1V49 A;  5CHF A;  3UQA A;  2NMQ A;  2EDU A;  3QZ8 A;  2PLS A;  2ZZC A;  1STE A;  3ZDE A;  4H4Y A;  3Q8Q B;  2BYE A;  1FEH A;  3ZTD A;  2F5Z A;  3NXL A;  4B9U A;  3P3B A;  1XWL A;  2R2O A;  2C5L C;  5KFQ A;  2BT6 A;  4GOC A;  4M0W A;  3H8S A;  5GXG B;  3P4P B;  4MLA A;  4M52 A;  4PGQ A;  1SKR A;  3URY A;  4NL9 C;  5C3J B;  1XCT L;  4IG7 B;  3KUC B;  4C7Z A;  1TIF A;  3HIL A;  3H7S A;  2KJ9 A;  3N28 A;  4M0A A;  3IJQ A;  4KWS A;  4Y2Y A;  5TR3 A;  4OZB A;  3K1R B;  5J2D A;  2RDJ A;  2HTH A;  4EFO A;  4PZF A;  3QPE A;  5JCI A;  4XZ4 A;  2QJN A;  2JZ3 B;  3AE2 B;  3QYP A;  3C0R B;  3V72 A;  2LFI A;  2GQW A;  3R1Z A;  2MNR A;  4E4F A;  2QDF A;  2UVW A;  3K9P B;  4M01 A;  3JPQ A;  2N1V A;  1SKS A;  2PFO A;  2AKZ A;  2HBM A;  4KN4 A;  1U49 A;  1UF0 A;  4A55 A;  3J9C A;  3CGC A;  4H4Z A;  2ZUD A;  1NK9 A;  1TS2 A;  5KAI U;  3D2H A;  2MSN A;  1LVH A;  4CNQ A;  1DGS A;  4ED8 A;  4C4R A;  4E0D A;  2G4D B;  3IHP C;  2GSH A;  4G7F A;  5BMI A;  1XEE A;  2HDO A;  1WIA A;  3ECI A;  3QJZ A;  4OVV A;  2EAN A;  1KTQ A;  3EJB B;  4LDT D;  1Q5W B;  3ENE A;  2IGH A;  4H4P A;  4QWA A;  1D8L A;  5D3D A;  2BR0 A;  4DFK A;  1KCZ A;  1WWT A;  1V86 A;  2LYB A;  1L3V A;  1Z1V A;  1SE2 A;  2GL5 A;  5KG5 A;  4WQM A;  4JV1 A;  1S5L U;  2A3V A;  1ZK7 A;  4EBE A;  4DXA B;  3NVZ B;  1GUA B;  3ZW3 A;  4IQU A;  2HOF A;  2DPI A;  2FJ6 A;  3JPN A;  4Y2X A;  1L0V B;  1WGD A;  1DOQ A;  4P6V F;  2K6D B;  3Q3F A;  4MEY A;  1XLO A;  1KLG D;  2LAS A;  4ZRP A;  3VAW A;  4Z6E A;  1RDF A;  2MP2 A;  3KH0 A;  5ALG A;  2QJM A;  5J2B A;  2PW9 A;  5G2N A;  3ZGZ A;  1WGK A;  5KFV A;  5J0S A;  2G06 A;  4EEN A;  1TE6 A;  4GFI A;  2B6G A;  2VAN A;  2DW7 A;  3SMV A;  3EWA A;  4F50 A;  4PPX A;  3UPQ A;  4GXI A;  3UQ2 A;  1GNU A;  1X9X A;  2Y0S C;  2XNA C;  1J7C A;  4MMW A;  3UXO A;  2YVC A;  4MH0 E;  3I1Y A;  4BZA A;  3OSP A;  2HHU A;  4DF8 A;  2L8J A;  1V6E A;  2LVP A;  2WB1 F;  2RPV A;  1SB3 B;  4FA6 A;  8ICP A;  2QDE A;  2EQY A;  5HR7 A;  1X2G A;  1EBH A;  3ZNH B;  4M04 A;  2LI6 A;  1CZP A;  2Y5P A;  1JQ4 A;  1XPY A;  2ZIU A;  3KHG A;  4IRK A;  1PUT A;  5DQG A;  1TKD A;  3WAM A;  4YXM A;  4PHD A;  2BB5 A;  4A8X C;  1WMH A;  1BPE A;  1ZW7 A;  2QB1 A;  2M4N A;  3IM1 A;  1B0X A;  5ALT A;  2RMM A;  2WBA A;  3ONN A;  3R3M A;  3F2D A;  1JXE A;  4P0Q A;  3I57 A;  1KM7 A;  3VXW A;  3UCC A;  2IO2 B;  3RJF A;  5IIO A;  3UIO B;  5BOF A;  8ICV A;  2OAI A;  2P66 A;  3RNB C;  3H4D A;  3VFK A;  5G5G A;  2H89 B;  4ED1 A;  1S0O A;  3DVN U;  2WF9 A;  4DN1 A;  1M6Y A;  2B0C A;  5DB7 A;  2NRX A;  4L1B A;  4F3O A;  3AV8 A;  5ALM A;  2WXN A;  4F8R A;  3MAB A;  2DYO A;  1ONF A;  3PT2 B;  1HXY D;  2D5G A;  4B9N A;  1R4M B;  4KKJ A;  1XS2 A;  1W1J A;  3IJI A;  5D3I B;  3D2N A;  4JK1 A;  2WXF A;  2NVU I;  5HG2 A;  4J3Z A;  3PX0 A;  2BWE S;  1BNP A;  3SEI A;  4M9L A;  3KUD B;  2KAC A;  2NPT A;  5J0R A;  2WXO A;  2HHQ A;  4NJ8 A;  1Q3U A;  1UQV A;  5DLG A;  1ESF A;  2BW2 A;  4ICU A;  2MBE A;  1S9F A;  3TL5 A;  5AEK B;  4FJZ A;  2WF8 A;  5L1L A;  3S1F A;  4DK5 A;  3QLD A;  5K4L A;  4KN7 A;  3WK6 A;  2BZF A;  3EPI A;  1P3Q U;  2DUY A;  5DBB A;  3DPD A;  3RCZ A;  1FXT B;  3PZ7 A;  4MGY E;  4HEA 1;  2L5Y A;  1XSP A;  5J17 A;  1TTN A;  3GD3 A;  4MKS A;  4Y2S A;  3PW5 A;  2JY6 A;  1R6W A;  2Q4T A;  4DFP A;  1L2N A;  3EFC A;  3G6Y A;  3VTV A;  1Z1B A;  3MR3 A;  4DO9 A;  3RFA A;  3GIM A;  5KT7 A;  2JRZ A;  7ICU A;  3A0H U;  3B0A A;  4E71 A;  3ALB A;  3TAD A;  1C9F A;  4LNN A;  3QU7 A;  9ICT A;  2IY1 B;  1RYR A;  2OCE A;  9ICN A;  1GPX A;  3NZS A;  3Q8A A;  5EE9 A;  3DQ0 A;  1ZMD A;  1N60 C;  1E9M A;  5EE3 A;  3D47 A;  4IZG A;  2H3Z A;  2C7H A;  3W1S C;  4AOF A;  3UJE A;  2W0H A;  5T14 A;  3PMN A;  1PK3 A;  3TEX A;  1JWU D;  2ODG A;  1V97 A;  1E10 A;  2NYV A;  1F8W A;  4MJS B;  4P7I A;  4DQQ A;  3NS1 A;  3K1Z A;  4I6P A;  4EEW A;  2WPE A;  2NO5 A;  9ICJ A;  5FS9 A;  4GLS C;  2KDE B;  2C22 A;  4K1R B;  1I4X A;  5EU9 A;  5GRT A;  2HBL A;  1UZX B;  3NUH B;  4PH5 A;  1P7D A;  1P7F A;  3TJ4 A;  2W54 A;  3NOB A;  1P48 A;  4Z1Y A;  1P7E A;  3F2C A;  4PK1 A;  1CMX B;  4K2S A;  4R64 A;  1HA5 A;  3POP A;  1TE2 A;  1EF5 A;  3TSS A;  1UGM A;  4WJN A;  1QSL A;  3JPR A;  1L5U A;  1KTK A;  2ZIV A;  2LYH A;  2Q4W A;  2KG5 A;  2MHJ A;  1SIF A;  2AQ3 B;  1ISN A;  1IGC A;  8ICJ A;  2WXL A;  5J2C A;  3U7Z A;  1KW4 A;  1WGY A;  5G5H B;  4EZJ A;  3LVW A;  2R8G A;  4DDI D;  2OX4 A;  2OQY A;  1XSL A;  2WLB A;  1BKH A;  2QJJ A;  3PQB A;  1KBU A;  2C9W B;  5JU5 A;  3DBL B;  3C5F A;  4KDI C;  1UWM A;  2KK8 A;  4ECR A;  9ICG A;  2KN5 A;  2KWC A;  2K8A A;  3NGD A;  8ICT A;  3PSE B;  2GQT A;  4TUP A;  1NEL A;  1K5O A;  1BML C;  1K1Q A;  4LTU A;  1GRB A;  3VC6 A;  4X5V A;  1ZQL A;  4ENL A;  4KLF A;  2UUV A;  3ORY A;  4WH4 A;  5ALF A;  5AKH A;  4ED3 A;  4MM3 B;  2A1A A;  8ICG A;  5EWE A;  4WWP A;  2W3R A;  4NQK E;  4DQP A;  4C0Z A;  4IDI A;  3TCA A;  1TAM A;  5JTI A;  1HTQ A;  4HCL A;  3MFI A;  2N1R A;  1OUQ A;  4USA A;  1BPD A;  4O0I A;  3OHB A;  1E6E B;  4CCH A;  1V1P B;  2G45 B;  2IHN A;  2MLB A;  4O3Q A;  1KKX A;  1ELS A;  4TV3 A;  4B6J A;  2DF4 B;  5KG1 A;  8ICL A;  3GIL A;  4TQ1 A;  1YOV B;  4Y2V A;  4JDR A;  2V4Q A;  1YJI A;  4UAS A;  3VQI A;  4YD2 A;  5ENL A;  2QLT A;  2WU5 B;  3ZD8 A;  1AHU A;  1TJE A;  3S6J A;  1BPZ A;  2NRZ A;  3N32 A;  3MGV A;  4NEV A;  5AKK A;  1IPG A;  2A1J B;  3RN9 C;  4K1W A;  2MWS B;  2ESE A;  4F5P A;  1QLN A;  7ICI A;  2GGH A;  1Z4N A;  4NLN A;  4M0W B;  4A9A A;  2NTS A;  2GRT A;  4FZL A;  1YIW A;  4M9J A;  1E8F A;  1JUD A;  1XO0 A;  4DL7 A;  2YML A;  1PZN A;  4DNS A;  2JXT A;  3I4K A;  4EQR A;  2F1H A;  1TVA A;  2MCN B;  1DOY A;  2OZ3 A;  4FP1 A;  4KT2 A;  4Q45 A;  3GD6 A;  4I2D A;  2WDQ B;  3VCN A;  4B95 A;  3T9L A;  2WDR B;  3DGH A;  3V5F A;  1ZQV A;  4IOI E;  5DDY A;  2I1K A;  2JZZ A;  2KOX A;  2IGG A;  3OWE B;  2YEP F;  1BWC A;  4DHZ E;  1WMH B;  1X2H A;  3M62 B;  3PZP A;  3HT3 A;  1C78 A;  2GR3 A;  4KLQ A;  3VC8 A;  2KN4 A;  4W9I A;  1L8L A;  1JMS A;  4ANU A;  1TZO A;  2P8B A;  4O3O A;  2E1F A;  1WJN A;  2LEK A;  5BMH A;  3N7R C;  2BPG A;  1YN3 A;  5AUK A;  1DTN A;  4WJO A;  2XY7 A;  4HCD A;  3QEA Z;  3BYY B;  3KHR A;  3LWL A;  2AHO B;  1L7Y A;  2LWP A;  1FFV A;  1M6I A;  3I6T A;  1T0S C;  3RZW C;  3ZVI A;  3PRM B;  4YR2 A;  5HHI A;  2JH7 A;  1WVE A;  4O3P A;  1ZUD 2;  2JF5 A;  1LM8 B;  3UQB A;  4ELU A;  4HXD A;  2IJ0 A;  2L0T A;  4CYE A;  1EWC A;  1JWA D;  4JN7 A;  2AYO B;  4DF4 A;  2IZV B;  2UVU A;  3EFU A;  3SAH A;  2CJN A;  2LHD A;  2NBU A;  3WK7 A;  3RUL A;  4NLC A;  4Q8E A;  2O2V A;  4ASW C;  5IA7 A;  1GRE A;  1ZX9 A;  3T5L A;  3ZVV A;  2AJQ A;  4HJK A;  4TUR A;  3OLM D;  4ECS A;  1TY2 A;  5HML A;  4R8U B;  3DBL I;  4NAM A;  3NUQ A;  2PEA A;  2XO7 A;  2KMC A;  1TKE A;  2F1I A;  3OW1 A;  4G50 A;  2WX0 A;  9ICH A;  1KKO A;  4F8C B;  4LNO A;  1ZQ1 C;  3B08 A;  3RAX A;  1NKB A;  2YMQ A;  3FDS A;  3L10 B;  3QCA A;  3ISC A;  3MFH A;  5BMG A;  2X8G A;  4GFJ A;  1DIQ A;  3AE6 B;  3T5K A;  2DZM A;  4MFA A;  3KOO A;  1WWU A;  1VLB A;  1SZP A;  3BS7 A;  2BPF A;  1OEP A;  3RRG A;  1X1M A;  4G8T A;  2GMI C;  9ICW A;  4UAV A;  4DWI A;  1MRA A;  2PP1 A;  5JRB A;  4EZL A;  4NV0 A;  1X6I A;  3BDP A;  2W03 A;  3IV6 A;  3AEF B;  3C5G A;  1L7O A;  3C23 A;  5EWG A;  2HXU A;  4NJ6 A;  4O3N A;  4DQS A;  1W6T A;  2L32 A;  4DLE A;  1MG4 A;  1WGR A;  1TS5 A;  4M02 A;  1IBX A;  1WYW B;  4KX3 A;  2HTM E;  3IK4 A;  3F53 A;  4PVJ A;  4C4V A;  2OPJ A;  1YMH E;  4NZL B;  2ZXI A;  2RAB A;  4B6W A;  4JGH B;  2RD0 A;  1FXA A;  4M8N A;  1WWV A;  4EBC A;  4XX5 A;  5IO9 A;  4RGT A;  5JHB A;  4MT5 A;  5KFO A;  3O13 A;  1H2I A;  4Q2J A;  3CYJ A;  3RIT A;  1TZ1 A;  3K9O B;  5AZG A;  3RJG A;  5FK9 C;  1ZY8 A;  2OO6 A;  2PMQ A;  3JZU A;  2EZX A;  5DPW A;  2GR2 A;  4I29 A;  2XBB C;  3DV9 A;  1XS9 D;  3V3X A;  3SR6 B;  1NZP A;  1L5P A;  1HJP A;  1RFK A;  2ZW1 A;  3N30 A;  4KEM A;  2A4Z A;  3TSJ A;  1N61 C;  4H4T A;  4P0P B;  2KKC A;  3V61 A;  5AKY A;  3UMG A;  1GRG A;  3ABV B;  1GC6 A;  1VJK A;  3F2B A;  1WFY A;  1QLB B;  3S1E A;  3BVM A;  4LII A;  2A8X A;  4ZOH B;  5ALH A;  1ZD5 A;  2WX1 A;  3N4E A;  1ZQB A;  3Q4D A;  3RUI B;  2BKF A;  1Q3V A;  3ZNI D;  4IQT A;  5JZE B;  4DLG A;  4JMU A;  2CKH B;  4M0X A;  2AL2 A;  2ZTE A;  3SEB A;  2WXG A;  2KFK A;  3A7A A;  4JV2 A;  3MDA A;  2KNJ A;  3AQF A;  3A9J A;  1SJD A;  3WU2 U;  2EKE C;  4GIB A;  4A3R A;  1ZQA A;  4EM4 A;  2R8J A;  9ICA A;  1JRU A;  5I1V A;  1K50 A;  4RQ8 A;  4UAT A;  4QWE A;  2W9N A;  3EGR A;  1TYP A;  5K8E A;  2D3D A;  2KC1 A;  1ZQW A;  3C1Z A;  1WSP A;  3DJJ A;  1MC8 A;  5AI4 A;  4FBJ B;  4PL1 A;  5AI6 A;  2MEK A;  1AWD A;  1HIW A;  4QZF A;  1XCQ L;  4MM3 A;  4OZA A;  1GEU A;  1SL0 A;  5JUM A;  2L83 A;  4YG2 A;  1ZXH A;  2Y9U A;  3ONS A;  1J97 A;  3I9V 1;  4J1O A;  1E9I A;  4O3S A;  1RYJ A;  3THV A;  1N48 A;  1Z3E B;  5KFC A;  4ML8 A;  2Y0S F;  3TWB A;  3E2E A;  4OJO A;  4JWM A;  2HVH A;  4KMU A;  3ZXV A;  1RLF A;  2KHQ A;  2HDE A;  1WGG A;  2KAN A;  4HN8 A;  2BYV E;  2WXI A;  2MA9 B;  3ZJV A;  5G5H A;  1CI4 A;  4RQN A;  3WK4 A;  4F4W A;  4O5E A;  3EF6 A;  3A4R A;  1B1Z A;  2BGW A;  3L54 A;  5D4B A;  3M1Y A;  5AI5 A;  4HCN B;  4II3 B;  3ZLZ A;  3CGB A;  4EEK A;  2WS3 B;  4DQO C;  1KRP A;  1MVK A;  1KOT A;  1I4P A;  2Y9T A;  4F4K A;  3BK2 A;  1FEA A;  2QAE A;  4JLC A;  5KG3 A;  4XE0 A;  2DX5 B;  2J0K A;  2P3Z A;  1YQ3 B;  2KC2 A;  3N4M B;  1UA0 A;  3NY5 A;  1HSK A;  2KJ5 A;  3D46 A;  1DRG A;  4P2H A;  3K4G A;  9ICQ A;  3QUC A;  1D8Y A;  3AE9 B;  2J6S A;  2JRH A;  2GR1 A;  4MGI E;  2ZUB A;  4YN4 A;  1ZQE A;  3DDC B;  3ZVH B;  2PFP A;  3KHH A;  1WX9 A;  1SEB D;  1BUI C;  4GGH A;  2OJR A;  4RQ6 A;  2N7D A;  3TI0 A;  1ZXI C;  2AGQ A;  2KOB A;  5CRX A;  1SJC A;  5KT3 A;  2Q85 A;  1RYS A;  1D9D A;  4I6N B;  2FKP A;  2R9Z A;  2I6X A;  7ICO A;  2UVV A;  3ZNG C;  3AEV A;  2KQS A;  2GQU A;  5FJP A;  5IP4 D;  5F9N A;  2M0X A;  2EEL A;  3LWM A;  5BPC A;  4B9K A;  3KJM A;  3EKG A;  4NLB A;  3UMC A;  2WGS A;  1SJA A;  3RJK A;  2HI0 A;  5LXI B;  3H0M B;  3AE1 B;  1F0X A;  3MBY A;  2RGF A;  1L3S A;  3MGI A;  2E5A A;  4UAR A;  2PTY A;  1FCC C;  1ZOY B;  4LVS A;  4ELT A;  1Q0W B;  2FUH B;  4GDK B;  4IWQ A;  5FJR A;  3AEG B;  5AIA A;  3GV7 B;  4E74 A;  1SGH A;  3JYU A;  4N6E B;  2JWZ A;  5E6O A;  4QWB A;  1UA1 A;  5U1O A;  1L7P A;  2JH1 A;  2MA1 A;  4K8G A;  3GB1 A;  4GGB A;  3PV8 A;  1T5X D;  3SN1 A;  4BC7 A;  3EC8 A;  4GXJ A;  3P4Q B;  4GGQ A;  1SF0 A;  2JMG A;  2VRR B;  2HHT A;  4KGT A;  3EJE B;  2DBY A;  2G4S A;  4K4G A;  4M47 A;  1LVL A;  3JPO A;  1S97 A;  3FIL B;  5JHA A;  1S76 D;  3D2D A;  3AU2 A;  4HAI A;  2ZCC A;  2IYD B;  3A9K B;  2PLP A;  3AE5 B;  4ZHO A;  2V6O A;  4BDP A;  4JWU C;  2DKX A;  3N1Y C;  3KYD D;  4DL2 A;  1MFW A;  5L95 C;  4FO6 A;  4QZG A;  5HFY A;  5L6G A;  3I63 C;  2EAP A;  4BXO A;  2IBI B;  2PFN A;  3R7Q A;  3SHQ A;  2BCU A;  3DIP A;  4EWJ A;  1D5Z C;  2N9K A;  5KFJ A;  4RQ0 A;  1ZD4 A;  2GOW A;  3ZDA A;  2LVO A;  1ZJM A;  5HKH A;  3RR1 A;  3RH5 A;  4PHA A;  2ONQ A;  3JPT A;  3DCG A;  2EQ9 A;  2HHS A;  1X2I A;  4P4P A;  4YXD B;  3DJG X;  2KZZ A;  3TCS A;  4EQS A;  5TR5 A;  2WWZ A;  2HBJ A;  1IYX A;  4OO1 J;  3ALR A;  4AJW A;  4RNO A;  2YMM A;  3DH9 A;  5BOL A;  1R4N I;  2KMA A;  3SZ2 A;  3W8W A;  3OP2 A;  4RH6 A;  1R0M A;  2EMS A;  4NLZ A;  2ZNV C;  3RPF C;  1NOM A;  1QSY A;  5IAA C;  1NYR A;  5IIL A;  3MR5 A;  1QCK A;  4YTP B;  1T7P A;  3TIX A;  2C60 A;  1K53 A;  2JXJ A;  4HLE A;  5GTI U;  4YCX A;  3KHL A;  3V6J A;  3D32 A;  4GYP C;  2LM1 A;  4NEW A;  2QGY A;  4YXJ A;  1CRX A;  1OQY A;  1ONE A;  3OPS A;  3PX4 A;  3LK9 A;  1MUC A;  3V3W A;  3H0L B;  2V9W A;  3RF9 A;  2MQJ A;  3HM6 X;  3ZYY X;  1GXF A;  4MGG A;  4F92 B;  4RT3 A;  2O6V D;  3DVG Y;  3FIL A;  1BPY A;  4EZK A;  2IO3 B;  2CU1 A;  1WR6 E;  1TKK A;  4RFB A;  1NDA A;  2YVS A;  4HRO A;  2WAQ F;  4IHC A;  5J2R A;  3NJT A;  4J9L A;  3PLU A;  3NVV B;  3HX0 A;  2OLA A;  5J2E A;  3RB3 A;  3HKZ C;  2VJ4 A;  3PR4 A;  2V1Y A;  1SIJ A;  2N7J A;  1J7B A;  3JPS A;  4OJ5 A;  5DB8 A;  4EX7 A;  2G09 A;  2PIA A;  3APC A;  4MEX A;  3JVZ X;  2QCZ A;  4W9H A;  1IUE A;  2AX5 A;  2GLS A;  2DYM A;  4UB5 A;  3RYT A;  1ZQX A;  3A33 B;  2WF6 A;  2RK5 A;  3I6E A;  2C2E A;  5H8Y E;  4ZHP A;  3PR5 B;  2M17 A;  1WJU A;  4ZRQ A;  2K8C A;  1E8W A;  1VZ6 A;  2HHW A;  2DEN B;  4OW0 A;  3II4 A;  2D3B A;  1W1Q A;  3I28 A;  3U4E G;  4TQ0 A;  2HD5 B;  2WAQ C;  2K4I A;  1ZQS A;  4AUQ C;  1SV4 A;  5J2J A;  4UB1 A;  2XY5 A;  2PKE A;  3KUM A;  3RJH A;  4MH8 A;  1KJT A;  4ZOH C;  3D2Q A;  4BKG A;  4GSW A;  2DPJ A;  1HEK A;  1WUE A;  7ICJ A;  1MDR A;  2XIC A;  4PGX A;  2BYT A;  1XLN A;  2KV2 A;  2CHX A;  5JRT A;  1L0X B;  1F44 A;  4JB3 A;  3WKB A;  1F2R I;  1KFS A;  1K1S A;  2ZW0 A;  9ICC A;  3QWZ B;  2W3S A;  4QZ8 A;  4O3R A;  1GER A;  3TW9 A;  1LV5 A;  4I28 A;  1Z2M A;  1DOX A;  5L1J A;  4PGY A;  1N61 A;  2MRL A;  3P4S B;  3V4B A;  3PSF A;  3QK0 A;  1T0Y A;  2V4I B;  4W9F A;  5ALP A;  2XY6 A;  4A6Q A;  3DWG C;  4YSX B;  1E0Z A;  4FI4 A;  1JWB D;  1HUZ A;  1KSP A;  3NFU A;  1XF5 L;  2ZIX A;  1X9W A;  3HRD C;  1LXD A;  2V4L A;  1X9M A;  2VA3 A;  2FAZ A;  4EBD A;  4PVK A;  2MUC A;  4KGS A;  3D2J A;  4C4V B;  3QN3 A;  3S5S A;  2AQ0 A;  3A9K A;  2E5S A;  2KTR B;  5DPS A;  2BPC A;  4BBN F;  5ALW A;  4PVE A;  2LKY A;  3C19 A;  3MQT A;  4QZA A;  1P1A A;  1PGA A;  3PX6 A;  1ET6 A;  5CEH A;  1JWM D;  1MG8 A;  3TMP B;  1LO5 D;  3SN0 A;  3SQS A;  3SU8 X;  1QKZ A;  1T0Q C;  3GFK B;  4DFD A;  2FMP A;  2CJO A;  2IMW P;  1RVK A;  4APN A;  3N7S C;  8ICY A;  4EKU A;  4DX3 A;  2KMD A;  1V9P A;  2PE9 A;  3KW5 B;  4M00 A;  2KLC A;  4Q44 A;  7ICP A;  3F5A A;  3RRH A;  5GMV A;  5AM1 A;  2XCP A;  1SJH D;  2UVR A;  1IXR A;  3QQ8 B;  3WCQ A;  3MUC A;  2KIW A;  2RLT A;  3STP A;  1VCB A;  2O6V A;  4DL5 A;  2BS2 B;  3RNE C;  3MR6 A;  3L16 A;  4QZ9 A;  2BDP A;  4BUR A;  3ED5 A;  2CR5 A;  4LNI A;  4E6M A;  2KWD A;  1FNU A;  3X23 A;  4A20 A;  3CGD A;  1U4B A;  3WKE A;  4F4R A;  4US8 A;  3L17 A;  2QB0 B;  4QZH A;  2D8C A;  3DK8 A;  2JYE A;  3AE8 B;  3TAR A;  1JOA A;  4I2C A;  1IYF A;  4BBN C;  4P4O A;  1MI0 A;  3TTE A;  2FID A;  4A3O A;  1YX5 B;  2LYA A;  2P13 A;  2BB6 A;  4TUS A;  1WJ4 A;  2PJH A;  1WXQ A;  2PTW A;  1GRA A;  2N7E A;  4O95 A;  3RH4 A;  2ZG6 A;  5FJT A;  3ZVH A;  4UBC A;  2WQY B;  4JHM A;  4WJP A;  5LLI A;  5L1I A;  2F77 X;  3NRZ A;  4J9R A;  8ICN A;  2MW5 A;  2R2Q A;  3UXN A;  2SEB D;  3U8Z A;  3T3F A;  4K7W A;  2VIX A;  3NVY A;  1MQ3 A;  5DG8 A;  2PFQ A;  4DXF A;  3PM9 A;  4PZN A;  2INP E;  3HP6 A;  2HMX A;  2NBW B;  5J04 A;  1FEZ A;  2JV3 A;  4TQS A;  3BS5 A;  1SGG A;  4FUL A;  8ICX A;  2HQM A;  2RRD A;  5J29 A;  1FFV C;  3P0W A;  5KFI A;  3IBE A;  4JE3 B;  2Y1I A;  4J56 A;  3NVZ A;  3CXB A;  1T4G A;  2GGI A;  1ACC A;  2KIC A;  4HDQ A;  3ZLF A;  1IBX B;  3DWM A;  4ECX A;  3VDZ A;  3N1X C;  4XDC A;  3PG6 A;  3WK9 A;  4BVU C;  4DYE A;  4ECV A;  4J9M A;  3FCP A;  4CDG A;  2FCS A;  2P0I A;  2AXR A;  5DGA A;  2JUO A;  4PYU A;  1IP9 A;  2C2R A;  1PGX A;  4JQW C;  4AYB F;  1RRB A;  3CIR B;  2AQ4 A;  3IRU A;  2KVS A;  2W55 A;  4US9 A;  3R2I A;  2HVI A;  5KL8 B;  3SI8 A;  2NQW A;  4YVZ A;  7ICH A;  3T5J A;  3JW7 A;  4N59 A;  3K1G A;  2KKV A;  2W04 A;  9ICM A;  5AKI A;  2Z8L A;  2KLG A;  3MHZ A;  4FAD A;  2K1F A;  3Q3O C;  1I4H A;  2FMQ A;  2OHF A;  3ICX A;  5DLF A;  2R61 A;  8ICR A;  4XLO A;  2O56 A;  3H70 A;  1PUZ A;  5KT4 A;  1FD6 A;  2Z0E B;  3DK4 A;  4KLI A;  2ZJA A;  3FYH A;  4KDL B;  4ZYN A;  1XD3 B;  3AUL A;  4P0P A;  3R7R A;  3UGB B;  4JWS C;  3UI3 A;  2VFU A;  4RZR A;  1EC7 A;  1XHC A;  7ICG A;  4EUT A;  2KEY A;  3MC1 A;  2KFJ A;  1GB1 A;  1PQS A;  3NTU A;  5JXV A;  2GBJ A;  3AXC A;  2OJW A;  2PTX A;  1WG8 A;  4NM2 A;  3TJI A;  4IM3 A;  4OZC A;  1N62 A;  3CP8 A;  5DG9 A;  3QU9 A;  2X8C A;  1LB2 B;  4Z6C A;  1L6U A;  1JPD X;  3AU6 A;  1J19 A;  1VAO A;  2LZ6 A;  2V0G A;  3RNM A;  1I4Q A;  3L8K A;  4FS1 A;  3U30 A;  1F9J A;  3EZ5 A;  4C8O A;  4WWM A;  3Q6J A;  4GDL A;  3GV8 B;  2JRI B;  1SE9 A;  1BZL A;  1FM0 D;  5DQI A;  3IFW B;  2WPC A;  2E6X A;  3QEB Z;  1D3Z A;  1Q1R A;  1QOB A;  1RWS A;  4TUQ A;  2C3C A;  2O6K A;  2RDH A;  4MF2 A;  3BWU D;  4G11 A;  3RCY A;  1GSN A;  2PVG C;  2IPK D;  3RMK C;  1YQZ A;  2JSV X;  5AWV A;  2K60 A;  4F5R A;  1C4P A;  3Q3N C;  2KP7 A;  3R0K A;  3RH6 A;  5BOM A;  2L00 B;  4LK0 M;  5ALD A;  3TSH A;  1VDV A;  2EAO A;  1WXV A;  3PVX A;  1T8E A;  3HSU A;  1F5S A;  3LYS A;  4UB2 A;  4KKI A;  3NVW B;  3IN5 A;  4IWO A;  4G3I A;  2KZR A;  2JWU A;  8ICA A;  4Y2Q A;  4CO7 A;  2DW6 A;  2HOI A;  4AQ7 A;  3FG2 P;  3IT4 B;  2FNJ B;  1KFT A;  3U52 E;  1WXS A;  1A6S A;  3OGU A;  3CNH A;  4H4U A;  2MBO A;  1WUF A;  2WOW A;  3VR8 B;  1ZRN A;  3A0B U;  2J4X A;  2WYQ A;  1S8O A;  1SSN A;  5C0Y A;  1WX7 A;  5CA7 A;  1YN5 A;  2C2D A;  1V8C A;  4B9T A;  5J2G A;  3DG6 A;  5HI1 A;  1GRH A;  1HZ6 A;  2WP6 A;  3DBH I;  2MAX A;  1TY0 A;  3ZRF A;  3L5K A;  3PTF C;  4JN8 A;  3QE9 Y;  1W1S A;  4DQI A;  3SV4 A;  4I2B A;  3EEZ A;  3F5E A;  3GE3 C;  2VFT A;  1V59 A;  2XGP A;  2XH7 A;  1V85 A;  2ACZ B;  1TYT A;  2JZB A;  5J2H A;  5KL1 B;  5KT5 A;  2ZXH A;  1HUO A;  2EKI A;  2WP9 B;  3EUB 3;  1B4F A;  1FNW A;  2F44 A;  1GO3 F;  1QQ5 A;  2ALZ A;  2KDF B;  3VHT C;  2FCN A;  3CF6 E;  1VZ7 A;  4KPR A;  4J57 A;  2FPK A;  2C7N B;  4E4U A;  9ICR A;  2B76 B;  5EBK A;  3FKY A;  3LAE A;  3NS8 A;  4OVU A;  1MBB A;  3OSN A;  2Y4G A;  5AKX A;  1KEJ A;  3SAG A;  1TAU A;  3W8X A;  2GGG A;  2OKT A;  3RI7 C;  2J6U A;  2HW3 A;  3TQ1 A;  3CT2 A;  3GIJ A;  2LRU A;  1V1O A;  4Y2J A;  2KDM A;  2WDT B;  3W1S A;  2CS4 A;  2FCQ A;  1V1P A;  1N60 A;  4KLD A;  4BBY A;  3V5C A;  5HNK A;  4TQR A;  1VZ8 A;  2K5P A;  3T5H A;  4HPL B;  2ISP A;  4FJY A;  2PLI A;  4CF3 A;  3RD2 A;  4PS7 A;  1WZ0 A;  2JZP A;  3MY9 A;  3C21 A;  2W43 A;  4BWJ A;  1DK3 A;  5L9X A;  4O5K A;  5HR6 A;  2KD0 A;  3EJD B;  1KRH A;  4KLL A;  1FEC A;  2I9G A;  3ISD A;  3RR7 A;  4PWB A;  4Z6D A;  2I5Q A;  5AE1 A;  1RQL A;  3KVF B;  2X99 A;  4J03 A;  1MQ2 A;  3ZDT A;  4OHJ A;  1M94 A;  4M6U A;  2ES6 A;  1CK1 A;  2DYB A;  1TGZ B;  2WDW A;  2NV3 A;  3IG8 A;  2KTF A;  2HXT A;  1Z4O A;  4MF8 A;  2M0N A;  3KFU F;  1L6V A;  2EZY A;  2P3H A;  2BCP A;  1MBT A;  3C2K A;  4WJ3 B;  1RM6 B;  3A4S C;  2VZK B;  5CWR A;  3Q8R B;  1N5W A;  3C28 A;  4F4Y A;  3TAP A;  2KYW A;  4XC2 A;  1NHS A;  1GJZ A;  4HVB A;  3Q45 A;  5AM3 A;  1ZR6 A;  2EZZ A;  5E79 U;  1K52 A;  1JWS D;  2PSN A;  4UW9 A;  2X8X X;  3QKE A;  3AU4 A;  3T8Q A;  1T6B X;  2IA6 A;  2R18 A;  4RPY A;  2GBN A;  4H83 A;  3L3F X;  3ISB A;  4IKG A;  2G5I B;  1X66 A;  2Z7J A;  4QNL A;  3UJR A;  3DEE A;  1XC9 A;  5IOI A;  2OEH A;  5KFL A;  2HSZ A;  4QZB A;  2FI1 A;  3TAQ A;  4I27 A;  2YEP B;  2XH2 A;  3BZD B;  4LCD E;  3HVD A;  1FXI A;  4J6I A;  4ECW A;  4OAL A;  3AN1 A;  3VRA B;  5JH5 C;  3G6X A;  1YEY A;  2ASL A;  2IPI A;  4IQV A;  2QAR B;  1SB3 C;  1TV9 A;  1C7Y A;  2AU0 A;  2ON8 A;  5G55 A;  4D2K A;  3AQE A;  1PDX A;  3QU2 A;  1Y88 A;  1A76 A;  4RF1 A;  3IG3 A;  5C23 A;  2IOH A;  1W1L A;  2QB0 A;  3IXS A;  5T8I A;  2V3B A;  9ICF A;  8ICI A;  4BKS D;  4P4M A;  4I2H A;  1YNT E;  4KGR A;  2XGZ A;  2QIL A;  5HMR A;  2FMS A;  1ZPS A;  4EE2 A;  4BV6 A;  2QSD A;  3I3T B;  2PI5 A;  2DHZ A;  2VFV A;  5IIN A;  1T94 A;  5AHX A;  3EEC A;  1E0Y A;  1WX8 A;  9ICS A;  3UIN B;  1MOK A;  4LNK A;  5DB9 A;  3GIK A;  1GOZ A;  5KFM A;  1ZRM A;  3OJS A;  1FHV A;  2G1E A;  1SJB A;  4KX5 A;  4UB3 A;  3BIN A;  3IG5 A;  2HJ1 A;  3M7D A;  3TJP A;  4HRS A;  2EQ6 A;  2NPX A;  4Z17 A;  5H2F U;  3TFS A;  3IJL A;  2K0P A;  5AM5 A;  4FBU A;  3ETL A;  3ZTC A;  4EEY A;  2QPM A;  5ADZ A;  2F8L A;  3B0X A;  3D9X A;  4IC7 B;  3WIM A;  1FEB A;  1UWX A;  3PHX B;  5J18 A;  4YR3 A;  4YSY B;  2W7P A;  5JCL A;  3PML A;  1XQQ A;  2GGJ A;  3DVN V;  1URJ A;  2YTU A;  4QW8 A;  3B2G A;  5B5E U;  2VAO A;  4UB4 A;  4M9G A;  2XC9 A;  5BO4 B;  3NHE B;  4JQ9 A;  5AKJ A;  2ZZB A;  4C8M A;  3L08 A;  3VTW A;  1GET A;  4OJP A;  4BX9 C;  5D2M B;  4M9N A;  1HQR D;  2JEF A;  4QZE A;  1S10 A;  5A0L A;  3S47 A;  2KKP A;  4U7C A;  5E6J A;  4C7Y A;  3VTU A;  1MPE A;  2L05 A;  2IBK A;  3B0Y A;  3QUB A;  3NZ3 A;  1F3P A;  3GRS A;  4EYH B;  2VJ5 A;  1OQQ A;  3V62 A;  3QUT A;  2OZT A;  4FJV B;  3H1U A;  4ANX A;  3QFA A;  4FFD A;  4MFC A;  2BKR B;  3GC2 A;  3W5V B;  1OEY J;  2MBH A;  3LDZ E;  1D7Y A;  5ALO A;  2PP3 A;  3CGE A;  3R0U A;  2ZPN A;  1RQN A;  2VFR A;  2HBK A;  2YQE A;  3O0F A;  2NBV B;  4MSM B;  4H19 A;  4DHJ D;  1XLP A;  1FIQ B;  3AUO A;  3S1C A;  1SV0 C;  1CJE A;  4I2E A;  1S0V A;  2J7Q B;  2K8H A;  3B9J A;  1V80 A;  5ALN A;  3P2B A;  4NWI A;  2KAJ A;  5J2F A;  2BC0 A;  2KHV A;  3AEA B;  5D6J B;  1S77 D;  2JEJ A;  3GZN I;  4J9Q A;  8ICQ A;  1JCK B;  4CRX A;  4IL0 A;  2BDU A;  2IHM A;  1CQV A;  4HYK A;  1QOA A;  1Y8R C;  5B66 U;  1KF6 B;  4ZRI A;  4RQ1 A;  4RNN A;  3T8M A;  1N62 C;  4WUR A;  3NZU A;  1FFU A;  3TAN A;  4KLG A;  3ZQ4 A;  1J2N A;  3WAL A;  3W8Z A;  1YJ1 A;  5CJ7 A;  4MFF A;  4N9F 4;  3SBF A;  1D5X C;  2KHW B;  4F5N A;  1AOG A;  1XLQ A;  2VA8 A;  4B9L A;  4KIK A;  3RO6 A;  1WR1 A;  1LKY A;  1NKC A;  2JK6 A;  4RT2 A;  1JAL A;  1NK6 A;  2J53 A;  4EQX A;  1WE6 A;  2IGD A;  3RTV A;  1WH3 A;  2MRP A;  5CTR C;  1TZZ A;  1JXL A;  4DOB A;  1ZET A;  2RDX A;  3UMB A;  3LYY A;  1EUV B;  3NO1 A;  4ECQ A;  3TFR A;  1ARO P;  4URK A;  3SQP A;  4ICV A;  2J0M A;  1TS4 A;  3L13 A;  2Y08 A;  4RQ5 A;  5KFU A;  2RSU A;  3GS2 A;  2BVC A;  2ZIV B;  1NI2 A;  5ER0 A;  1L7M A;  1D6E C;  1WYG A;  2LJ5 A;  4NJC A;  2EQ7 A;  8ICM A;  2V3P A;  1HZ5 A;  3Q8F A;  4KSK C;  3H4B A;  3VRB B;  3TEZ A;  1X40 A;  4C8L A;  4HNC A;  2XID A;  1U9L A;  4XA5 A;  3QZ7 A;  1P98 A;  5C2T B;  1EO6 A;  4EMW A;  2KE7 A;  3AE3 B;  4C56 C;  1HE8 A;  2PA6 A;  2M8S A;  3R10 A;  1SXT A;  2KSO B;  1J0G A;  3CAW A;  4KTQ A;  2W9B A;  3KKA A;  4DEZ A;  4MHV A;  2JGA A;  3H40 A;  5H92 C;  1JRO A;  3PWG A;  2M0A A;  3OAW A;  1B9R A;  3P4R B;  1Q1O A;  3VUX A;  1QOF A;  2SAK A;  2HNE A;  5AKE A;  1UHU A;  3DHG C;  4IS7 A;  5AIB A;  3EPG A;  1ZKH A;  2W11 A;  3GOE A;  4BJQ A;  3R8B A;  3N6H A;  4GC6 A;  1SKW A;  3WA0 A;  4K81 A;  4H4Q A;  4BXO B;  3TEY A;  5AZH A;  1PVP A;  3URH A;  5CHV C;  3MWC A;  3PVL A;  4LJX A;  3GV5 B;  5HHD G;  5L83 A;  4CF4 A;  3CST A;  3JSV B;  1A70 A;  3QX7 A;  2PMV A;  3H8H A;  2CHR A;  4QZI A;  2FLN A;  2LUM A;  4G0N B;  2ASQ A;  4K3B A;  1WM3 A;  4RNM A;  2NVK X;  3MSY A;  5IIM A;  2Q0Z X;  5DBA A;  2W9M A;  4BAX A;  4S0R A;  2TPR A;  3EYZ A;  3NG0 A;  1NNL A;  2K8B A;  7ICT A;  3VDG A;  2NO4 A;  3AL0 B;  3HRD D;  5FJU A;  3RT3 B;  3WKC A;  4ANV A;  1EC8 A;  2ASJ A;  4HYR A;  1I7H A;  2HE7 A;  5IN7 A;  2AL6 A;  4FHK A;  3BZC A;  3TBL D;  2FLL A;  1H6V A;  2D3A A;  2W8K A;  4QWC A;  2BPS A;  3NVW A;  4MSQ B;  1E5W A;  1K51 A;  4QIW F;  4EZ6 A;  2IDY A;  2D11 A;  3VFC A;  1TK5 A;  3LAD A;  4I2F A;  5ALV A;  4GN1 A;  3M6K A;  4X57 B;  2WXJ A;  1RXW A;  4JL9 A;  1BQG A;  2L7R A;  2Y5C A;  5J0Y A;  2K89 A;  2DKZ A;  2WOI A;  1ZQY A;  3H7I A;  5CB1 A;  3BY4 B;  1YN4 A;  2R8K A;  4KLS A;  3I5J C;  2KJ8 A;  2DFL A;  2KWV B;  3SR6 A;  1V81 A;  3PW7 A;  4GU2 A;  1L4D B;  4WQO B;  1ZQU A;  1I4G A;  4A8E A;  2O2V B;  3H7P B;  5ALJ A;  1RM6 C;  4RCO A;  4ZDV A;  2N9L A;  3DOW A;  2DWQ A;  4R3D A;  1ZQN A;  2PTZ A;  2ZNV B;  1NK0 A;  4DSF A;  3O65 B;  4S17 A;  2D3C A;  5DB6 A;  3PST A;  3B2F A;  4E3C A;  5J2K A;  1D8B A;  1F52 A;  1NHR A;  3NRZ B;  3V7L A;  2LGY A;  5FS7 A;  4W9C A;  3ETR B;  4UB8 U;  4NNJ B;  1JCT A;  1PFD A;  3D6J A;  3HWT A;  4H4V A;  3UF8 A;  3KWV A;  3QUQ A;  3D2S A;  2OVL A;  1LPF A;  5AK6 A;  5KG0 A;  7ICS A;  4YTM B;  4W9K A;  1U48 A;  3TQP A;  2W9B B;  5J0P A;  4FN2 A;  4ED6 A;  9ICL A;  3Q69 A;  5AKZ A;  4IP5 A;  1KFY B;  2PE6 B;  2MUT B;  2AWT A;  3ETR A;  2RPQ A;  3ML9 A;  3Q8K A;  2LHE A;  3HM3 A;  3GRT A;  3WKD A;  1DXL A;  4H2A A;  1UT5 A;  5IIK A;  2ZTD A;  1FO4 A;  5FS6 A;  1EC9 A;  1F0Z A;  3AEB B;  2PGW A;  4DOC A;  1PDY A;  5L1M A;  4TVW A;  4ZH4 A;  1I4R A;  2N9E B;  4J3O D;  3B1L X;  1I42 A;  3KZX A;  7ICN A;  3AMZ A;  2GWS A;  4HPN A;  4RQ4 A;  2BHN A;  3V05 A;  3FW7 A;  2YAU A;  1EXN A;  3SYZ A;  1KLV A;  1F77 A;  3IHQ B;  5ALL A;  1NU5 A;  3GY1 A;  5KVH A;  3BQ2 A;  1WGH A;  3AE4 B;  3WK5 A;  1TAQ A;  4C80 A;  1J7A A;  4YT0 B;  4IC9 A;  2J0J A;  3APF A;  3N9Y C;  1WUD A;  3LDA A;  4UBB A;  4FHJ A;  2RP5 A;  2OWO A;  3CYM A;  3OJ4 B;  3CRX A;  1DII A;  1FMA D;  4JX1 C;  3BK1 A;  4DSJ A;  2KTR A;  3JW0 X;  9ICB A;  2N9P C;  4FDC B;  1C76 A;  1SWV A;  1BPB A;  4MEL A;  1GRT A;  3PW0 A;  2Z0D B;  3BVG A;  3HPF A;  3W9C B;  3PSP A;  4FS2 A;  1OFF A;  3HVZ A;  2J3N A;  4DOA A;  4Q8F A;  3HPO A;  2A5U A;  4TKN A;  1C79 A;  3DHI C;  3WAP A;  3MGH A;  4GIS A;  1AYF A;  4PJ0 U;  1RFA A;  1R4N B;  3RB6 A;  2LXA A;  3A1Q A;  5J2I A;  2KX0 A;  3T3O A;  1O08 A;  2XH4 A;  5EWF A;  2WNM A;  2W9C B;  3PRP B;  4GYP A;  2UUU A;  1OXJ A;  3ZKJ C;  2GO7 A;  4IT1 A;  2KK0 A;  4YFK A;  4XRH A;  1ZE3 D;  4C00 A;  2ZC8 A;  4IRD A;  3R11 A;  3TUO A;  2PU0 A;  2AKM A;  4Z6F A;  1W1O A;  3LJ3 A;  4IUM B;  4F7Z A;  2E1E A;  2PPG A;  4R63 A;  4ECZ A;  1TFR A;  4JUZ A;  2K9X A;  4YD1 A;  2F8K A;  3HW8 A;  5AM2 A;  3H7P A;  2A19 A;  3EW9 A;  1K8R B;  2N0S B;  2KJH B;  3FYY A;  1IG6 A;  2BS4 B;  3PS6 A;  1YT3 A;  1SXD A;  3GSY A;  5FMH A;  4CGZ A;  4IW0 A;  1UT8 A;  3QFB A;  2C3D A;  3IDW A;  2P35 A;  1COK A;  3SFE B;  3JS8 A;  4J9K A;  4YTN B;  4H4X A;  3PZD A;  5AK3 A;  3Q3M C;  8ICO A;  2BF8 B;  3PRE A;  3R2T A;  1QH9 A;  4G9B A;  5AKL A;  3BJY A;  4ED2 A;  4KZ0 A;  1T3Q C;  4EMJ A;  2YQU A;  1P9D U;  5ALE A;  2LGX A;  2FYM A;  4ICA A;  5CR0 A;  2ZPY A;  1AW7 A;  2OOB B;  4DSE A;  2MSE D;  2BTE A;  2KJR A;  4K8D A;  4NQL B;  4P1C C;  3T6C A;  3Q8C A;  2G5H B;  1Q8K A;  1EWY C;  2ZTC A;  7ICK A;  2HZG A;  4IR9 A;  1ZQD A;  4HK2 A;  4NY8 A;  1UGJ A;  3OZM A;  4HPP A;  3C2L A;  1F0M A;  1AAR A;  4NM1 A;  1SBB B;  1WXA A;  2B3A A;  2K6Q A;  3V6K A;  2QEJ C;  4NJ7 A;  1VR9 A;  2ZVN A;  3H12 A;  4DHG A;  4FZN A;  1OW5 A;  3ZJT A;  1FHU A;  3FXG A;  3H7V A;  3MKC A;  3RNA C;  1LFD A;  3QX1 A;  2OG9 A;  2JT4 B;  2MH7 A;  4G3X B;  1W1R A;  2FIF A;  5III A;  2WXR A;  3VA8 A;  2XCA A;  2MJE A;  4PYT A;  5DQH A;  2D6F C;  2K8B B;  4LJO B;  2R8I A;  5ALZ A;  1GG3 A;  3C8Y A;  3BOX A;  1U4A A;  3QIJ A;  4GME A;  2RQ5 A;  5L6F A;  4IQW A;  2I38 A;  2AXT U;  1QSS A;  2J52 A;  4RPZ A;  4ITK A;  5KHO A;  1WRD B;  3A7U A;  5L1K A;  3LB8 C;  1N2X A;  5F3X B;  2K39 A;  4QZC A;  3ZD9 A;  2A1J A;  2GRI A;  3QC8 B;  4P1B C;  1DZN A;  5ALK A;  4EX6 A;  1B43 A;  3PPA A;  2VFS A;  4UB6 U;  5J8Y C;  4X2P A;  3HKZ F;  4CE6 A;  3FM9 A;  2BBC A;  3FVD A;  1XXG A;  5KFG A;  2G0A A;  2VZK D;  3W1Y A;  1IIP A;  1YZ6 A;  2BQ3 A;  2FBW B;  3H4K A;  4HDO A;  1JML A;  4PWC A;  4QZD A;  2V3S A;  5KG4 A;  2KTQ A;  4KVG B;  4DL3 A;  1ZQF A;  3ZLG A;  4QIW C;  3IP4 B;  5KT2 A;  3RJI A;  4NAW B;  1PDZ A;  1ZXI A;  4O1N A;  2FE8 A;  4UAU A;  5EOZ A;  4YWG G;  3VCC A;  3Q2A C;  1EBD A;  4WWO A;  1X9S A;  2XN9 C;  2TSS A;  5FP0 A;  4J9N A;  2K22 A;  3EAN A;  4RUA A;  8ICE A;  3U4F A;  4WWN A;  5J2A A;  1GB4 A;  2RR9 A;  1S0N A;  1Z00 A;  2NQL A;  3I76 A;  3NZG A;  3PLV A;  4TMA B;  5FXE A;  3UJF A;  5DBC A;  3H8A A;  1UEL A;  3RJE A;  4II2 B;  3FW9 A;  3UGV A;  3DED A;  4PS8 A;  3H9D A;  4DSL A;  2CU3 A;  2KQ4 X;  4KX6 B;  4KZC A;  1DXS A;  5EE1 A;  3U26 A;  1H4R A;  3R66 C;  2FPM A;  4RQ2 A;  1I35 A;  1XAN A;  3KZI U;  4DHJ B;  5KFK A;  1I19 A;  4OJL A;  4CF5 A;  4R66 A;  2ZIW B;  4KIK B;  1WCL A;  3AE7 B;  3N3K B;  1L7N A;  1QQ6 A;  5AM4 A;  2XEW A;  4HCP B;  1ZJN A;  1KKR A;  3T79 A;  1IGD A;  4MDK E;  5ALU A;  1GES A;  1ZQO A;  5HP4 A;  1E8Z A;  1EBG A;  3AED B;  2L1A A;  2GOL A;  1COO A;  2QAR A;  1N56 A;  1S7M A;  3MR2 A;  1N6Z A;  4FLH A;  1SE3 A;  2KIV A;  7ICE A;  4MJS A;  1L3U A;  4KLT A;  4DWF A;  1GV4 A;  2DAJ A;  3L4P A;  3R9K A;  1EU4 A;  5KFS A;  4QAY A;  3PW2 A;  2H88 B;  3AI5 A;  5KFA A;  4OVZ A;  2N4F A;  1XT9 B;  5DG7 A;  2KDI A;  5KG6 A;  5DDM A;  1FIQ A;  1C4A A;  2QIE B;  2LUE A;  4KLJ A;  1ZDX A;  2ZJ8 A;  1XDI A;  3ZLH A;  4WAA A;  2P88 A;  2ZCB A;  3GD4 A;  5KTQ A;  1ZQT A;  4P0Q B;  4I2J A;  2YB1 A;  4W9J A;  4BOZ B;  3UIP B;  2V4R A;  1MO9 A;  3GO2 A;  7ICV A;  1WE7 A;  5AK5 A;  8ICK A;  3MHS D;  4XYC A;  2R8H A;  9ICI A;  4ZA0 A;  4B9S A;  1DK2 A;  4DXG A;  3T9P A;  2BQU A;  5AUI A;  3DDH A;  2JQR B;  2Y3S A;  1NYQ A;  2D10 A;  2UYZ B;  4WJQ A;  2OH2 A;  3TOY A;  3OHA A;  5TSS A;  1ZMC A;  1ZQR A;  3QU5 A;  2M1M A;  3QAQ A;  2I1Q A;  3V6E B;  3ZI4 A;  2DGZ A;  1ZQJ A;  4UD8 A;  2ZIW A;  3ZRC A;  1PVQ A;  3B97 A;  3J81 j;  3PO5 A;  2NPT B;  4PVH A;  2ZEQ A;  2BVH A;  1NHQ A;  1VRA B;  3PRZ A;  4FX9 A;  4YMN A;  2YVG A;  1C3T A;  1WVF A;  3DBR B;  1KDH A;  2W82 A;  2INN E;  4ZRJ A;  2KDB A;  1MA7 A;  1L8P A;  4GXB A;  3KD3 A;  4PL2 A;  4YQW A;  2N1W A;  2I1J A;  2FCM A;  3PV1 A;  4EM3 A;  1PK1 A;  4GXK A;  3P63 A;  1KN0 A;  2F1J A;  4HKQ A;  2BCV A;  5TIS U;  1C20 A;  3MP9 A;  2PI4 A;  4AP9 A;  1KLU D;  2AQ1 B;  2LVQ A;  5FXP A;  1E8Y A;  3MTN B;  3V60 A;  2DL0 A;  2K4E A;  2E8P A;  2LI5 A;  1WZ3 A;  2K25 A;  2KJ6 A;  4TVY A;  1BPX A;  2JX5 A;  4ELV A;  2RDB C;  2EQ8 A;  3TAD C;  3PGE A;  5FR3 A;  5ALY A;  2WHI A;  2YMP A;  2B21 A;  2KFK B;  3APD A;  4XWT A;  9ICU A;  1KQQ A;  3AM9 A;  4JB1 A;  3Q8E A;  2JZB B;  1FRD A;  2F2A B;  1MDL A;  1YX6 B;  3MJ5 A;  2Z59 B;  3MC9 A;  5KFD A;  4M6W A;  3BVZ A;  3RAQ A;  3WAN A;  3ZDC A;  1YQB A;  5FKA C;  4IRC A;  1L6N A;  2I5H A;  2LGD A;  3P42 A;  2ONE A;  1Q10 A;  3OJU A;  1PVR A;  2WP5 A;  2DQN B;  4JV0 A;  1F2R C;  4CHK A;  5KFF A;  5KG2 A;  1JI7 A;  1CEZ A;  2G08 A;  1NJY A;  2BGF A;  4EYI B;  2K4H A;  1HEZ E;  4MAC A;  1ZOL A;  4W9D A;  4C4S A;  5ALQ A;  4Y2T A;  1U45 A;  1K4Q A;  2WXM A;  3OZY A;  4PZO A;  3MC8 A;  4NY0 A;  4R65 A;  1DGJ A; 
#chains in the Genus database with same CATH homology
 4M0W A;  2BT6 A;  4GDK B;  5GXG B;  4MLA A;  3P4P B;  4C7Y A;  3GP7 A;  1MPE A;  3AEG B;  3NZ3 A;  3URY A;  1UXY A;  1OQQ A;  4N6E B;  1XCT L;  5C3J B;  2R2Z A;  5HQX A;  4C7Z A;  1R7S A;  3EA6 A;  3W5V B;  1N63 C;  3GB1 A;  1T5X D;  4OZB A;  4BC7 A;  3P4Q B;  4PZF A;  1SF0 A;  4KGT A;  2VFR A;  2DBY A;  3AE2 B;  3FIL B;  2LFI A;  2LMC A;  1XLP A;  1FIQ B;  3HRD C;  3S1C A;  1CJE A;  4A90 A;  3D2D A;  3B9J A;  1WRI A;  2KAJ A;  2PLP A;  3AE5 B;  4ZHO A;  3AEA B;  4A55 A;  3J9C A;  4JWU C;  3RJ8 A;  1N63 A;  1JCK B;  1TS2 A;  5L6G A;  5HFY A;  3D2H A;  1CQV A;  1QOA A;  1KF6 B;  2WXQ A;  5BMI A;  1N62 C;  1XEE A;  4WUR A;  1D5Z C;  1FFU A;  3ZQ4 A;  2N9K A;  1QF6 A;  3W8Z A;  1D5X C;  2IGH A;  1DYQ A;  1XLQ A;  3I99 A;  5D3D A;  1WWT A;  2ONQ A;  5AE2 A;  1EU3 A;  1JAL A;  3IAS 1;  1AHV A;  1SE2 A;  4YXD B;  2J53 A;  2Y3R A;  2MJ3 A;  1Y56 A;  2IGD A;  4WQM A;  1NEN B;  3NVZ B;  1PGB A;  3LYY A;  1TYG B;  1L0V B;  4P6V F;  3VR9 B;  2Y08 A;  3W8W A;  1TS4 A;  4RH6 A;  1XLO A;  1JRP A;  1KLG D;  3GS2 A;  4ZRP A;  3RPF C;  1D6E C;  3AEC B;  1WYG A;  1QOG A;  4NJC A;  1NYR A;  1HZ5 A;  2V3P A;  3Q8F A;  5D79 A;  3VRB B;  3TEZ A;  2PW9 A;  4YTP B;  3ZGZ A;  1WGK A;  1K53 A;  5C2T B;  2WXH A;  3AE3 B;  4C56 C;  1SXT A;  5H92 C;  4BCA A;  1JRO A;  2M0A A;  3ZYY X;  2XNA C;  1J7C A;  1B9R A;  3FIL A;  2I0K A;  1T3Q A;  3P4R B;  2RDG A;  1QOF A;  3C0P A;  4RFB A;  2SAK A;  2YVS A;  4HRO A;  2RPV A;  3R8B A;  1SB3 B;  3NVV B;  1VQZ A;  1X2G A;  1SIJ A;  2N7J A;  1J7B A;  1UNS A;  1CZP A;  1JQ4 A;  2Y5P A;  2PIA A;  3TEY A;  1PUT A;  5BYQ A;  1IUE A;  2AX5 A;  5HHD G;  2PVO D;  2BB5 A;  2DYM A;  4A8X C;  1A70 A;  2RK5 A;  2PMV A;  1FRR A;  2RMM A;  3H8H A;  5H8Y E;  4ZHP A;  2LUM A;  3I57 A;  4ZRQ A;  4ARC A;  1VZ6 A;  2K3U A;  4OW0 A;  3P1M A;  2OAI A;  1MHH E;  1W1Q A;  3U4E G;  4TQ0 A;  5G5G A;  3E56 A;  2H89 B;  3EUB 2;  3HRD D;  1I7H A;  4MH8 A;  4L1B A;  3AV8 A;  3U2S C;  4PT5 A;  4ZOH C;  2WXN A;  3BW7 A;  2DYO A;  1HXY D;  2D5G A;  1XO3 A;  4KKJ A;  1W1J A;  3NVW A;  1K51 A;  5D3I B;  2WXF A;  1XLN A;  2IDY A;  5HG2 A;  2KAC A;  1L0X B;  2WXO A;  2BYT A;  2BW2 A;  1ESF A;  1F2R I;  1SJE D;  4RGO S;  2FUG 1;  2WXJ A;  2ZW0 A;  4HG0 A;  2W3S A;  3BII D;  2Y5C A;  3BYT B;  3S1F A;  1GAQ B;  1YN4 A;  3KLS X;  2I2Y A;  1DOX A;  1N61 A;  3P4S B;  1C4C A;  3SR6 A;  3PZ7 A;  3A7R A;  1L4D B;  2V4I B;  4HEA 1;  1I4G A;  2R8D A;  4A6Q A;  4YSX B;  3DWG C;  1E0Z A;  1AHZ A;  1JWB D;  4RCO A;  1RM6 C;  1XF5 L;  2N9L A;  2DWQ A;  4R3D A;  3AH7 A;  4PVK A;  3HUI A;  1YJJ A;  4KGS A;  3D2J A;  1N5X A;  2AQ2 B;  3B2F A;  4PVE A;  3W5U B;  3NRZ B;  1C9F A;  1PGA A;  1ET6 A;  1JWM D;  1LO5 D;  4RF0 A;  3ETR B;  1GPX A;  3DQ0 A;  2WXP A;  3Q8A A;  5EE9 A;  1PFD A;  1E9M A;  1QKZ A;  5EE3 A;  1N60 C;  4B0M A;  4XWW A;  2CJO A;  3KWV A;  1L0Y B;  1W1M A;  4REZ A;  4ZYS A;  3TEX A;  1JWU D;  1YQ4 B;  1V97 A;  4YTM B;  1E10 A;  3NS1 A;  1E8H A;  4LLG M;  2V3N A;  1SJH D;  4GLS C;  3WCQ A;  3Q69 A;  2PTL A;  1I4X A;  1KFY B;  2BS2 B;  3W2D A;  3TEW A;  2BVF A;  3ETR A;  3CWI A;  2LHE A;  3Q8B A;  3NUH B;  4H2A A;  2KWD A;  2GB1 A;  1P7F A;  2W54 A;  1FNU A;  1FO4 A;  1TS3 A;  1P7E A;  1M4V A;  4B0E A;  3POP A;  2X38 A;  1HA5 A;  4WIP A;  3TSS A;  2DLB A;  4US8 A;  1F0Z A;  3AEB B;  1KTK A;  4TVW A;  1I4R A;  2JYE A;  3AE8 B;  1NI3 A;  4J3O D;  2Q4W A;  2AQ3 B;  3AMZ A;  5AE3 A;  2Q5W D;  1IGC A;  3U7Z A;  2WXL A;  3V05 A;  3FW7 A;  5G5H B;  1MI0 A;  1F77 A;  4WAF A;  2WLB A;  2P13 A;  3PQB A;  4JPS A;  2BB6 A;  3AE4 B;  4C80 A;  1J7A A;  4YT0 B;  1UWM A;  3N9Y C;  1WXQ A;  4O95 A;  1DII A;  2GQT A;  1FMA D;  2WQY B;  1QIL A;  4JX1 C;  1BML C;  3BK1 A;  4LTU A;  3NRZ A;  2SEB D;  3NVV A;  2UUV A;  1C76 A;  4WH4 A;  3NVY A;  1OQR A;  3PM9 A;  4DXF A;  3BVG A;  4MM3 B;  3W9C B;  2INP E;  1OFF A;  3HVZ A;  5EE0 A;  4XDD A;  2W3R A;  4IDI A;  1C79 A;  1FFV C;  1AYF A;  1W1K A;  4USA A;  1E6E B;  4RGN A;  4JE3 B;  1V1P B;  3NVZ A;  5LNK 1;  3T3O A;  1ACC A;  1IBX B;  2P4P A;  2WNM A;  3DWM A;  4XDC A;  2UUU A;  3PO0 A;  4TQ1 A;  1YJI A;  3VQI A;  1ZE3 D;  2AXR A;  2WU5 B;  3T3N A;  3TUO A;  1AHU A;  1PGX A;  1TJE A;  3CIR B;  3R2I A;  1W1O A;  1PYW D;  2W55 A;  4US9 A;  3R07 C;  2NQW A;  1TKY A;  2BS3 B;  2K9X A;  2J42 A;  4ARI A;  4FXC A;  4N59 A;  2N0S B;  2BS4 B;  2Z8L A;  3MHZ A;  4A9A A;  2NTS A;  3GSY A;  1I4H A;  1E8F A;  2OHF A;  2R61 A;  4XLO A;  3AEE B;  4DNS A;  3SFE B;  1FD6 A;  2JXT A;  4YTN B;  3JS8 A;  1AN8 A;  3B9J B;  3R2T A;  2QKN A;  1T3Q C;  1DOY A;  4JWS C;  3UI3 A;  3RFZ B;  2VFU A;  2QJL A;  2O3G A;  5I1W A;  2WDQ B;  1GB1 A;  1UUP A;  5JXV A;  1AW7 A;  2EXR A;  2WDR B;  2BTE A;  4IOI E;  3AB5 A;  1KH0 A;  4OZC A;  1N62 A;  2IGG A;  3Q8C A;  3OWE B;  1EWY C;  2YEP F;  1E7P B;  1L6U A;  1X2H A;  1VAO A;  2M56 B;  1UGJ A;  4JAY A;  2V0G A;  1C78 A;  1SBB B;  3S1D A;  1I4Q A;  2KN4 A;  2QEJ C;  1VR9 A;  3IAM 1;  3MFG A;  4TSS A;  1ENF A;  1TZO A;  4WWM A;  3ZJT A;  1FM0 D;  1ET9 A;  2LEK A;  2E6X A;  5BMH A;  2MH7 A;  1W1R A;  2WXR A;  2LGI A;  1QOB A;  1RWS A;  2MJE A;  1YN3 A;  2RDH A;  4PYT A;  3BWU D;  5AUK A;  3SFD B;  3C8Y A;  2PVG C;  4L2Y A;  2IPK D;  2JSV X;  2I38 A;  4N58 A;  5AWV A;  5L6F A;  1C4P A;  1TKG A;  4ITK A;  2J52 A;  4LK0 M;  5HHZ A;  1EM7 A;  3LB8 C;  3BYY B;  1VDV A;  3TSH A;  3A7U A;  3HSU A;  5MPO A;  3KWL A;  1FFV A;  4KKI A;  3NVW B;  1MHX A;  2GRI A;  1DZN A;  1WVE A;  2JWU A;  1ZUD 2;  2VFS A;  1FFU C;  4AQ7 A;  2IJ0 A;  3IT4 B;  2G9H D;  3U52 E;  1EWC A;  1JWA D;  1NEK B;  2BBC A;  1XXG A;  2CJN A;  2LHD A;  2MJD A;  3VR8 B;  5G5G B;  2VZK D;  2J4X A;  2WXK A;  1SSN A;  5BYR A;  1YN5 A;  2FBW B;  1V8C A;  1JML A;  4PWC A;  5HI1 A;  2PKO A;  1HZ6 A;  4RNA A;  1TY0 A;  1TY2 A;  3TX1 A;  4NAW B;  2NTT A;  4NAM A;  1ZXI A;  4O1N A;  2FE8 A;  1W1S A;  4YWG G;  2E3T A;  1BXT A;  1TKE A;  2VFT A;  2XN9 C;  2ACZ B;  3MC0 B;  3FAH A;  2TSS A;  3LLB A;  2EKI A;  2K22 A;  2WP9 B;  4GDL B;  3EUB 3;  3FWA A;  1FNV A;  1FNW A;  1GB4 A;  1QLT A;  5BMG A;  3VTE A;  1DIQ A;  1VZ7 A;  3AE6 B;  2QMT A;  4TMA B;  5FXE A;  1D4B A;  1VLB A;  3FW9 A;  3DED A;  3NS1 B;  1QT9 A;  2B76 B;  2CU3 A;  2KQ4 X;  4KX6 B;  3LAE A;  5EE1 A;  2BVG A;  1ZDV A;  1MBB A;  1NVI D;  1L4Z B;  3AEF B;  2Y4G A;  1I19 A;  2LJI A;  3W8X A;  2M19 A;  2L32 A;  1TS5 A;  3AE7 B;  1IBX A;  1V1O A;  3W1S A;  2KDM A;  2HTM E;  4CQN A;  1FCL A;  1V1P A;  1N60 A;  4RGM A;  4YSZ B;  1IGD A;  4PVJ A;  4BBY A;  1VZ8 A;  2K5P A;  1YMH E;  4NZL B;  2PLI A;  2JU6 X;  3AED B;  2L1A A;  2JZP A;  1FXA A;  1JW9 D;  4RGT A;  4MT5 A;  3O13 A;  1KRH A;  4Q2J A;  5I4D A;  4PWB A;  1SE3 A;  1E8G A;  5FK9 C;  5AE1 A;  3L4P A;  4HJG E;  1EU4 A;  2KMM A;  2H88 B;  4OHJ A;  4OVZ A;  3V3X A;  3SR6 B;  1L5P A;  1CK1 A;  2Y3A A;  1RFK A;  1FIQ A;  1C4A A;  2ZW1 A;  2QIE B;  3TSJ A;  1ZDX A;  2WDW A;  1N61 C;  3ABV B;  1VJK A;  1QLB B;  2OED A;  1L6V A;  3S1E A;  2P3H A;  3BVM A;  1MBT A;  4ZOH B;  1RM6 B;  1D5M C;  3KQ4 A;  1DOI A;  2VZK B;  1N5W A;  3LXF A;  3ZJU A;  1ZR6 A;  4DXG A;  3FW8 A;  1K52 A;  5AUI A;  3SEB A;  2JQR B;  2WU2 B;  2WXG A;  2ICI A;  2L52 A;  1JWS D;  1NYQ A;  3A7A A;  2Y3S A;  5TSS A;  1T6B X;  1QLU A;  5I1V A;  1K50 A;  4IKG A;  3EGR A;  5K8E A;  1WSP A;  4P16 A;  4UD8 A;  2YEP B;  3BZD B;  3IT6 B;  2MEK A;  3HVD A;  1FXI A;  1AWD A;  4OAL A;  4PVH A;  2BVH A;  1XCQ L;  3AN1 A;  4UDU C;  3VRA B;  5D7G A;  4AS1 A;  1VRA B;  3FC4 A;  4OZA A;  4BC9 A;  2IPI A;  5FXD A;  1SB3 C;  2L83 A;  1ZXH A;  4HKZ E;  2ON8 A;  4D2K A;  3NVY B;  1WVF A;  1PDX A;  2W82 A;  3I9V 1;  4RF1 A;  2INN E;  3PZ8 A;  1W1L A;  1RYJ A;  2WDV B;  3IXS A;  5T8I A;  4ML8 A;  1YNT E;  1SE4 A;  4KGR A;  2QIL A;  5HMR A;  3P63 A;  1N5W C;  2HDE A;  4HKQ A;  1ZPS A;  4EE2 A;  2JYT A;  2WXI A;  2QSD A;  3MP9 A;  3ZJV A;  5G5H A;  3RJA A;  1KLU D;  2AQ1 B;  1QQR A;  2VFV A;  1B1Z A;  5FXP A;  1E0Y A;  2WS3 B;  1ZP0 B;  4DQO C;  1MVK A;  1I4P A;  3BK2 A;  4TVY A;  2JX5 A;  1GOZ A;  4XE0 A;  2G1E A;  2GI9 A;  5FR3 A;  1YQ3 B;  1HSK A;  4HRS A;  5FXF A;  4XWT A;  2MBR A;  3AM9 A;  4JB1 A;  2K0P A;  3AE9 B;  4L23 A;  3Q8E A;  1FRD A;  3E9S A;  2QPM A;  5ADZ A;  3MJ5 A;  3BVZ A;  1C77 A;  1SEB D;  1BUI C;  5FKA C;  1UWX A;  3P42 A;  1ZXI C;  1ROE A;  4EC3 A;  1Q10 A;  4YSY B;  2Q85 A;  1F2R C;  5BYS A;  2GQU A;  3B2G A;  2VAO A;  1HEZ E;  2EEL A;  2NMQ A;  4MAC A;  3KJM A;  2PLS A;  1HQR D;  1STE A;  2WXM A;  1FEH A;  3AE1 B;  1F0X A;  2E5A A;  1FCC C;  1ZOY B;  5E6J A;  1DGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...