2W3RA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 126
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3rA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3rA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3rA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3rA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3rA04
4YXDB 1N60A 4WWMA 1E10A 3D2JA 3LXFA 5EE3A 1N60C 4USAA 1EWYC 1JWAD 2GQTA 2MJEA 4BC7A 3AEGB 5G5GA 3LLBA 1FFUA 1DIIA 3PM9A 1E6EB 1UWMA 5AE2A 2EXRA 3VRAB 3B9JB 2KMMA 3B2FA 3NVVB 1OFFA 3AM9A 5ADZA 3L4PA 4N59A 3FC4A 2OAIA 1DOXA 2W3RA 1E0YA 5HMRA 2BS3B 3HRDC 3S1FA 1TJEA 1W1MA 5HQXA 1E8GA 3TSHA 1QLTA 2LEKA 3B2GA 1KF6B 1TYGB 1FFVA 1FRRA 5H92C 3AE4B 1ZXIA 1A70A 2PVGC 2MJDA 2WLBA 3AEAB 1FFVC 3NRZB 3TSJA 4US8A 2MJ3A 4FXCA 4PWCA 1DOIA 2QIEB 2BVFA 5G5HA 1DZNA 1N62A 3NVWA 3D2DA 2AX5A 3B9JA 2K22A 1WRIA 1NENB 2CU3A 3ZYYX 4BBYA 1ZUD2 1L0VB 5EE9A 4ZHOA 3LB8C 1VQZA 4PYTA 5C2TB 1I19A 4PVEA 1TKYA 1JROA 1RFKA 1W1SA 2WU2B 1N63A 3P63A 2MH7A 3KJMA 4C7YA 3NVZB 1PFDA 3AMZA 3VR9B 2P3HA 1N63C 4ITKA 1WVEA 1L6UA 3BIID 1OQRA 3AECB 1FRDA 4YTNB 3R07C 3CIRB 2K9XA 2PLSA 3W9CB 2L83A 3AE8B 3AN1A 5FXEA 1ZOYB 1MBBA 1I7HA 3CWIA 4ZOHB 5GXGB 1WWTA 4US9A 1JW9D 1E8FA 1RM6B 3S1EA 3HUIA 3AE5B 2H88B 1VAOA 1E7PB 5HHZA 1J7BA 4WQMA 3FW9A 1N5XA 1W1KA 2O3GA 4KX6B 1AWDA 3AB5A 2Q5WD 3HVZA 4PVKA 2BS2B 2PIAA 2BVGA 2WP9B 3RPFC 2VFRA 2QKNA 2R2ZA 2VFVA 4BCAA 2Y5CA 3C0PA 1R7SA 4YT0B 2K5PA 2W54A 1SB3C 1VLBA 1PDXA 1FFUC 3LAEA 2E3TA 3AE9B 2CJOA 4YSZB 1WVFA 2AXRA 5FXDA 1F0ZA 3AE7B 3P4QB 3W5UB 3TX1A 1NYRA 1ZR6A 1T3QA 1XLPA 4LTUA 1GPXA 1AHUA 4PVHA 1L6VA 2M56B 1T3QC 2DBYA 1QOGA 3ETRB 2VFSA 4PVJA 3VTEA 1ZXIC 2WS3B 3FW8A 2R8DA 1W1RA 1CJEA 2RK5A 3FAHA 3A7AA 1DGJA 4O95A 2H89B 5AUKA 1XO3A 1ROEA 1N62C 1V97A 3NVVA 1AYFA 4ML8A 2WQYB 1W1LA 1J7AA 4JAYA 1CZPA 2QPMA 3W8ZA 1QT9A 3NS1B 1AHVA 1SF0A 3NVYB 1FM0D 1MBTA 1QLBB 2P4PA 2JQRB 1XLNA 3SR6B 1RYJA 4A9AA 3PO0A 3ETRA 5FXPA 5AUIA 3NRZA 1N5WA 1XLQA 3AV8A 4YSYB 3A7UA 1N5WC 2M19A 1XLOA 3EUB3 1FIQB 1NVID 1SIJA 2P13A 5MPOA 5FXFA 1QOBA 4N58A 1AHZA 3VRBB 2VAOA 3AEBB 3SFEB 1JRPA 4JWSC 1E0ZA 2YVSA 4HG0A 3AE6B 4PZFA 2EKIA 2I0KA 3EUB2 4MLAA 4PWBA 3AE2B 3NVZA 1NYQA 3JS8A 4DNSA 4BC9A 3SFDB 1JQ4A 3S1DA 5C3JB 1X2GA 3P1MA 5D79A 1L5PA 4XLOA 4HROA 5AE1A 1X2HA 2B76B 2PVOD 1VJKA 2WDQB 1RWSA 4HRSA 3DEDA 3FW7A 4IDIA 1YJIA 1YJJA 1UXYA 4JB1A 1NI3A 5EE1A 3WCQA 4YSXB 4ZOHC 3P4PB 3AH7A 1HSKA 1IUEA 2BT6A 5G5HB 1RM6C 3NVWB 2NQWA 1V8CA 1FXAA 2PLIA 3DWMA 2HTME 1QOAA 1QOFA 1B9RA 4ZHPA 2G1EA 2W3SA 1OQQA 4OALA 1E9MA 4UD8A 2CJNA 2KAJA 3AEEB 1E8HA 1WGKA 4C7ZA 2Q85A 2MBRA 3KWLA 3W8XA 4JX1C 2OHFA 3ABVB 1JWBD 1QF6A 1KFYB 1NEKB 4P6VF 2GQUA 2PKOA 1J7CA 1DIQA 2N0SB 1FXIA 2FBWB 1JALA 1W1OA 3S1CA 3AEFB 3AE3B 3FWAA 1F0XA 4N6EB 3AE1B 2W55A 3GSYA 1TKEA 1TKGA 2Q4WA 1GAQB 1WXQA 4YTPB 1ZP0B 3DWGC 2VFUA 2QJLA 1PUTA 1N61A 2JX5A 5EE0A 3W5VB 3I99A 3P4SB 1N61C 1FO4A 2WDRB 4C80A 1W1JA 2BVHA 1SB3B 3DQ0A 2ACZB 3HRDD 4TVYA 5G5GB 1DOYA 3NS1A 2BS4B 5AE3A 3VR8B 3A7RA 3D2HA 3NVYA 2WDVB 2E5AA 3BW7A 2VFTA 3SR6A 2L52A 5H8YE 3W8WA 1YQ3B 1W1QA 3P4RB 1QLUA 1YQ4B 1VDVA 4YTMB 3AEDB 2WU5B 4EC3A 1WYGA 1FMAD 4JWUC 1FIQA 2DWQA 4TVWA 1KRHA
chains in the Genus database with same CATH superfamily
1E10A 3BJSA 5BMGA 1R6WA 5IIKA 2M9NA 1KKXA 2NVKX 3U26A 1RQLA 3RJJA 2C2DA 1EU4A 1ZKQA 5FK9C 4M01A 2LM4A 1EWYC 2R8JA 1JWAD 1WJ4A 5EDSA 3PW0A 4C8LA 2LVOA 3N6JA 4K7ZA 3QC8B 4K7SA 4J1OA 2ZZ0A 5G5GA 2EZYA 4ZRQA 3NRWA 3PM9A 4ROPA 4NM2A 3IC9A 3CMMB 4NLZA 2EXRA 1OJTA 2XGZA 3IV6A 4Y2YA 2Z8LA 3B2FA 4K3BA 2GGGA 2KANA 3VH4B 3DK8A 1RYRA 4YWGG 3AM9A 5AI5A 4ADWA 1XSLA 4YVZA 2BDUA 4BXOB 1UELA 2DENB 4H4RA 3BSMA 1QQ7A 1L8PA 2GR3A 1DXSA 4BAXA 1DOXA 2W3RA 1JRUA 1NKBA 3ZNGC 2CN1A 4PGXA 3Q8PB 4F4WA 1E0YA 2WXPA 3VFKA 3MHSD 4PYZA 4F4XA 1E8YA 1NPXA 1SV4A 2QARA 1S3SG 5HQXA 4EMJA 2EMSA 4A3PA 5FKAC 5KFFA 3OHBA 4MJSA 2V3AA 5AKGA 4IHCA 2I5HA 3RRHA 2KHWB 1XSNA 1NK5A 3TANA 2LJIA 4HEA1 1T94A 1KF6B 1FFVA 2XY6A 2MSNA 1TKDA 1TYGB 4DXAB 2OQYA 2WPFA 3DGHA 3U2SC 4BURA 1A70A 3N4MB 3QE9Y 4A8EA 2MJDA 4DO9A 1SE4A 2WLBA 4DSLA 4ANXA 4US8A 1UGJA 1MOKA 5FJRA 3MR3A 3UQBA 2YVGA 5AM4A 4FFDA 3T3NA 4B9KA 1TT5B 4ECQA 2I1JA 3PVXA 5J8YC 9ICSA 1DOIA 4IR9A 4C8OA 1B22A 3LJ3A 4J03A 4AWJA 3EEZA 3PHWB 4M8NA 4W9FA 3NVWA 3D2DA 3QU4A 3UJRA 3V62A 3I1YA 3B9JA 5J0OA 2E8MA 2E1FA 2N9LA 5LLIA 3KZXA 3TADA 4UARA 3GOEA 2KFZA 1ZUD2 5JCKA 9ICJA 1IGCA 3DVNV 1L0YB 4B9VA 2CR5A 1NK4A 9ICXA 4C8MA 3T9LA 3R8BA 2FPKA 4MF2A 3FJ4A 3ZLGA 4E5TA 1JN3A 4G50A 4W9IA 5L1KA 4O5CA 3N30A 5C2TB 2UVRA 5KFOA 8ICTA 2Q4TA 3CRXA 5CTRC 2EQ8A 8ICEA 3GZFA 1WGHA 2G45B 1URJA 3QZ7A 1OW5A 1MSWD 1YN3A 4GMVA 1XPYA 4C56C 3GDXA 2D10A 4PS8A 3D32A 3ZDDA 5J0YA 1EBDA 2A19A 4EZ6A 1PFDA 1ZD4A 3VR9B 4RGNA 2P3HA 3OHAA 2Y5PA 3AXCA 3Q8LA 1LB2B 3V6KA 4TUSA 1WVEA 3GQCA 3SMVA 3BIID 3JPTA 5DG7A 8ICZA 3HIZA 4KKIA 3AECB 1FRDA 4CF3A 3ONNA 5HFYA 1E90A 5KG0A 2VANA 4DS5A 2XY7A 5AKZA 5B5EU 2BCQA 1LKYB 2K9XA 2Y1IA 4A35A 2KN5A 3DG3A 5KG7A 3AE8B 2QKQA 1P7DA 3C1ZA 4UAVA 4KLLA 4HPLB 5TR5A 4X2PA 1AOGA 5AEKB 1UUPA 1ZOYB 1XSPA 3PSIA 2INNE 1R0MA 4RQNA 4O3QA 1Y8RC 2FLPA 4KT2A 5BOFA 1Z1VA 4P0PB 2AGQA 4XZ4A 2XVTA 1E8FA 4Y2VA 2K8CA 4KGTA 5KFAA 2KV2A 5CR0A 1RM6B 1BGXT 4BJQA 1L3TA 2KDBA 4M0WA 3OW1A 4GR1A 1MQ2A 3IT4B 1J7BA 1J97A 4RNNA 1NDAA 4PL1A 4AP4C 1LQBA 3GE3C 5D94A 4G8TA 5U25A 1ESFA 2G5IB 3PGEA 4RPZA 4MSMB 1SWVA 3L3FX 1ZQHA 4BWMA 4KGSA 2KN7A 3ML9A 3SHQA 3N7RC 2P88A 2OOBB 4PVKA 2MUTB 2P3ZA 4XDDA 3D2NA 2NVUI 3M95A 2SEBD 4KX3A 5E6NA 3D9XA 1D9FA 4UB4A 2HVIA 5ALDA 5BYRA 4G3XB 2D6FC 4QZAA 5J0WA 3PR5B 1R7SA 2OX4A 4KZ0A 1ZY8A 2K5PA 3ZDCA 2W54A 3NFUA 4FJYA 4GXIA 2JT4B 1BT0A 2IYDB 3PHXB 3PZPA 2NBUA 4RH6A 3TEZA 2HOIA 3DBHB 3LAEA 4I2AA 3ZXVA 2DYOA 2QB0B 1F0ZA 4O3OA 1PYWD 3Q8AA 4B9MA 3DGBA 3T3OA 4F2SA 1I4GA 1ZQKA 1NK8A 1DGSA 3RUIB 1ONEA 3FXGA 3K4GA 7ICIA 1GC6A 4FE3A 3M62B 4EZJA 2WOWA 3KHLA 4O3SA 3DVNU 1GPXA 2PU0A 3UXPA 2G9HD 7ICOA 1BMLC 1PK3A 2G07A 2OYYA 5D46A 2KMDA 3EANA 2QVHA 4DL4A 4M8MA 1QOGA 5KFKA 2WXOA 3RFZB 3ETRB 1HIWA 4YMMA 4J9LA 4ECYA 3L13A 3HP6A 5GTHU 2DW7A 4KV2A 3VTUA 1NI2A 2KJRA 3IHPC 3MC1A 5ALMA 3IT6B 1WCNA 3PFRA 2R8DA 4EE2A 2RK5A 1X66A 5AM5A 4KKJA 4PGQA 1ZQAA 2KSOB 2KWDA 1IBXA 5KFXA 3CNHA 4ECZA 1OEPA 1BPYA 2PXIA 4KMOB 4O95A 4EEWA 3EGRA 4NLCA 1XO3A 2Z59B 3BQ7A 2ZUBA 4DQSA 1I4QA 2JMGA 1IXRA 3NVVA 4IL6U 2IO3B 3L8KA 1TZ1A 4DXGA 1ZQFA 3RNAC 3RNBC 1W1LA 4JAYA 2MA9B 3EJDB 1U4AA 2W9CB 1NELA 3TADC 2R8GA 1MDLA 4F50A 5AICA 4HCHA 2BCPA 8ICRA 4IWQA 2IGGA 3P42A 2BPGA 1MHXA 2A1JA 1QILA 1ZQDA 4C8KA 4RQ5A 3RJEA 1FM0D 2KNJA 2XICA 2OZTA 3GC2A 4CQNA 2P4PA 3FILA 2LXAA 2N4FA 4Y2XA 2R8KA 3AU6A 4II2B 1SXDA 2WFAA 3Q3OC 5FXPA 4DL7A 3NRZA 3UM9A 1L4DB 4M6WA 2KVZA 3KQ4A 5FP0A 3ZIMA 4UB5A 3VDZA 1Y88A 4REZA 3AV8A 1XO0A 2XK5A 5ALRA 2MBQA 3UQ0A 1XLOA 2WX1A 2J7QB 1JMLA 5FJPA 3HILA 2HMXA 2Y5BB 1CMXB 3L54A 4W9KA 4EELA 1SIJA 4R63A 3OLMD 5FXFA 5KFBA 2EELA 4JE3B 4PGYA 3W1YA 5KVHA 3KWVA 8ICMA 2K4PA 4GRTA 1ECWA 1E5WA 5J0TA 3VRBB 4DHZE 3PX4A 1VZ8A 4J57A 2GR0A 2JEGA 1P3QU 3TSSA 2P0IA 1JRPA 4CF4A 3ALRA 3GZNB 2EDUA 3OTQA 1NKCA 3VDGA 2PTXA 3GP7A 2K8AA 3KBBA 3DBLB 4YP3A 1P98A 2K0PA 5ALNA 3V3XA 4PZFA 2KWUB 3Q6JA 5F9NA 1ZE3D 3FG2P 1IP9A 2KIWA 1TE6A 1P9DU 2ZCCA 4MLAA 2KIVA 1NZBA 4PWBA 1L7PA 4DDID 3N20C 3NVZA 2KTRA 2EANA 5DBAA 4OD0A 4G7FA 4YFKA 8ICPA 5KFMA 3SFDB 1U9LA 3TARA 3RNEC 1JQ4A 4NJCA 3I57A 2NRXA 5C3JB 3GV8B 1V85A 2HJ1A 3QK0A 5KFYA 1U47A 1BPXA 3CF6E 1X2GA 3P1MA 1TFRA 5KFHA 1PGXA 1SL0A 2RDIA 2VA2A 2N9KA 2JK6A 4FZMA 2K6QA 3H8SA 4F92B 2LI6A 2B76B 4DOBA 2PVOD 1X2HA 3SQSA 4I2IA 2WP5A 1MPEA 5ALTA 2WDQB 2F2AB 5HMMA 1BPDA 3WK7A 2NTTA 1SL2A 3ECIA 4PYUA 1KFTA 2FI1A 1HA5A 5J04A 3AUOA 2GR1A 2WAQC 3RJAA 4ZH4A 1NNLA 3I76A 2LD9A 1WM2A 4FBTA 5AK4A 1UZXB 5FR6A 2BZFA 4OJOA 3A4RA 4DHZB 5AIAA 1FCCC 3A1QA 2KJ8A 4WWPA 2BT6A 2AHOB 3JPQA 2XIDA 5AKKA 2CKHB 1F44A 1FNWA 1FXAA 1XCQL 3APDA 4DQPA 5IP4D 2HTME 2W9BA 3RH6A 4IT1A 2REXA 4ZRPA 2P6RA 2HVHA 2KHVA 1Q3VA 4F4KA 5JCMA 2ZADA 1S97A 2KG5A 1HUOA 3GO2A 3DK9A 2BF8B 1VD2A 2NTSA 3OAWA 1V81A 2L8JA 2ZW0A 1CUKA 4OALA 4H4SA 3NUQA 2KAJA 3ZTCA 4DSFA 2J0JA 1Q5WB 2OXOA 2ZIUB 1ZDLA 3OGUA 4Z6DA 2JXTA 1A0PA 5AKXA 1R4MI 1A77A 4G0NB 1QTMA 2KZRA 4NL9C 4HKQA 4AUQC 1KH0A 3H4KA 2M4NA 4I2DA 3Q45A 3QPEA 5BMIA 4BX9C 4Q2JA 1VCBA 3RO6A 4RGMA 2ISPA 2JYEA 4IM3A 3W1SA 4P0QA 1C4CA 4IR1A 3TEXA 1J8CA 3RF9A 1BQGA 2YMLA 3H7IA 2G09A 4H2AA 2AL2A 5GMVA 1NEKB 1ZETA 8ICFA 4F4ZA 2PKOA 2KJ5A 4MELA 2AEHA 1M94A 4CCHA 2V3PA 4KZCA 4NAWB 4RGOS 4UBCA 4Q8FA 5FS7A 2KACA 2ZW1A 3M9MB 5ALLA 2WB1F 4QWEA 4CHKA 4IL2A 2MLBA 2NPTB 2ZVOA 4Q45A 4ICUA 1KLUD 3SBFA 5JH5C 2ZTEA 3PSEB 2KVCA 5H2FU 2BKRB 1DK3A 2YEPF 3WAMA 4YXMA 2JXXA 1QQRA 2CPRA 1PUZA 2W55A 1BPBA 9ICHA 9ICQA 1HE8A 2ZNVB 3PTFC 3QU2A 3RNFC 3IP4B 4RQ6A 3WK8A 4DL6A 3DV9A 4I2BA 1D8LA 1TKGA 2QJJA 1WMHB 3CYMA 2EAMA 2VA8A 1T5XD 2PE6B 4RNAA 2KXJA 2KJ6A 3PMNA 1K5OA 1YN4A 4GC6A 1WUEA 5KT7A 1WUDA 2QAEA 4K2SA 5DPWA 3QLDA 5C5JA 3KW5B 2V1YA 2PU1A 2AXTU 2C3CA 1RDFA 1PUTA 3SZ2A 2LVPA 5EE0A 4G3IA 2HOFA 5AKHA 3B08A 1F9CA 3R2IA 1HZ5A 1U48A 5LXHA 1D7YA 3C2LA 5F3XB 2ZIVA 2KP7A 3M9NB 2BCVA 4KGRA 4F5RA 1Q1OA 1F2RC 1N61C 5E6JA 1EO6A 3PRPB 5EWEA 4EUTA 3QUCA 1SKRA 2LRUA 4HLEA 4KTQA 5L1MA 1F5SA 1E8ZA 3NJTA 2BVHA 4EM3A 2D3GA 4DL3A 4P2HA 1Z00B 1ZQIA 4F3OA 1LFDA 1VRAB 1HEKA 4LZDA 2RDGA 4ANWA 1ZQWA 1SB3B 2LI5A 3OTRA 4TQSA 2C60A 5KAIU 1MVKA 2X8XX 5CEHA 1XC9A 9ICEA 2BPCA 1AROP 3FKYA 2JSVX 1DOYA 1S76D 1ZQNA 2HE7A 5FJOA 3QEAZ 3VUYA 5I1WA 1SJBA 1TK8A 5AE3A 3VR8B 3PZ7A 4PL2A 1GEUA 3F2BA 2RPQA 3D2HA 5AI8A 3IDWA 3R10A 2WXNA 2FPLA 2VFTA 3G6VA 2PFOA 2FMPA 2R18A 1KL9A 1ZD2P 2BPFA 3ZRFA 3ZO5B 1RYUA 4K4GA 5TZVA 8ICLA 1PVQA 4Y2QA 3FYYA 2W9MA 3P4RB 3RNCC 2E5SA 2OEHA 1L8LA 1C20A 4OW0A 3T8QA 1VJ5A 4W9DA 1WYGA 2LPEA 3NY5A 4NEWA 4NQLB 3RCYA 2KQ4X 4GLXA 3RJFA 4PJ0U 4YR3A 4DQOC 3TBLD 5AM1A 1UPHA 1PZNA 7ICFA 1X1MA 4QZBA 4IQWA 5DKWA 2PMQA 5IIOA 2Y1JA 1JCKB 8ICAA 5FJUA 5KFVA 4AP9A 1KBUA 2K4EA 1WR6E 3ZQ4A 1TGZB 4WWOA 2NQLA 2BR0A 1V38A 3O13A 2O6KA 2QSDA 3UXNA 9ICCA 1C77A 1SSNA 2MJEA 3AEGB 4BC7A 2I5QA 2WXMA 3THVA 2YMQA 4LNKA 2KFKB 3UQ2A 1UWMA 3KFUF 7ICUA 3M9OB 1DK2A 5AM2A 2J0KA 2KMMA 4DXFA 5KG5A 4NPNA 2LUMA 1EU3A 2XEWA 2KJHB 4N59A 4J9SA 1MG4A 3FC4A 2AKMA 5K8EA 4I6NB 4MEMA 3D2SA 2V9HA 3DCGA 4XRHA 3OJ3A 1SXTA 1XCTL 3RULA 3VQIA 1WE6A 1GC7A 4DK5A 2W0HA 4YMOA 2F44A 1LVHA 3Q6BA 2HQMA 4DLEA 4TUPA 2JEFA 2BS3B 4EEYA 2WGSA 4DHJD 2YEPB 3C29A 4I2GA 1TJEA 4M52A 2X38A 7ICSA 5HR6A 9ICBA 2KD1A 7ICRA 2ASQA 3KVFB 3ONSA 2NO5A 2NV3A 1WFYA 2LEKA 5L6FA 3WKCA 1R4NI 3MBYA 3B97A 1TZOA 3AE4B 4GIVA 2ZZBA 2FUG1 2PTZA 3TCAA 3DDCB 3NUHB 4GGBA 3W1SC 4KLJA 4E6MA 2H3QA 3N7SC 4JWNA 3WK4A 2LWPA 2VJ5A 4LNNA 5J8YA 8ICXA 4BUGA 4M9NA 1RXVA 7ICQA 2K25A 3HK0A 3EWAA 2JVCA 3UCCA 3ENLA 1DRGA 2JPHA 1DZNA 4C8NA 1ZQQA 4IW0A 2AGPA 4F5OA 4ECVA 2AX5A 2DX5B 3Q8KA 2JWZA 2CU1A 4FULA 5KT6A 2K22A 1A76A 2M0AA 2AL6A 3A0BU 2PTLA 1C76A 1WRIA 1JDFA 4F4RA 4BBYA 5HP4A 2GGJA 1ZJNA 4BXOA 1D8BA 4KN7A 1WG8A 8ICWA 3HM6X 4KSKC 1D3ZA 5HI1A 2AL1A 2GOWA 3H8WA 4Z6EA 1FXTB 4Y2TA 5J2FA 1T0RC 1V2YA 5KTQA 4ELTA 1NDDA 3TJPA 1X40A 4J9MA 2Y3RA 2NRZA 1I19A 1A6SA 4PVEA 3G6YA 4GU2A 1JWUD 3VC5A 3VXWA 1MBTA 4ECSA 1KRPA 2RDBC 3IFWB 5BMHA 1UBIA 4E4UA 4MFAA 3BDPA 3C21A 9ICRA 1TKKA 3T79A 5I1VA 5J2GA 1NK6A 3PY8A 3AMZA 4KLHA 4GDLA 3UIOB 3VCNA 4NV0A 4KLGA 4CYEA 2C2RA 3OC4A 2JUOA 2UYZB 2HHTA 2K60A 1F52A 3F2DA 2MWSB 1DNCA 2N1WA 5ALEA 3H0RB 2PLPA 3QQ8B 2WXIA 2R2OA 3BK1A 3Q3JA 3U52E 3V5CA 4NWIA 5B66U 4YTNB 1MUCA 2OWOA 4I2EA 5J2KA 1M6YA 3Q8FA 2NMQA 2F1HA 4UAUA 4JDRA 2PLSA 2BWES 1I4RA 1ZDXA 4GMEA 2LM1A 2DKZA 3AEVA 5ALIA 4DQIA 3CWIA 3BWUD 4JGHB 4WURA 4ZOHB 3R66C 1XHCA 5AIBA 4MGYE 2FKPA 4HJKA 1WWTA 4US9A 5J29A 2HHWA 2E6XA 4JUZA 3Q4DA 4W9JA 3VH3B 5JRBA 5E6PA 3LDZE 2C28A 3DH9A 3F2CA 2DLBA 2LYHA 4RGTA 3S1EA 1RXWA 3TCSA 3MABA 2FNJB 1E7PB 1KOTA 5HHZA 2WHIA 2K8HA 4WAAA 5JU5A 5KFPA 2X8GA 1ZD5A 4EX6A 2HTHA 1KD0A 5CHWA 2O6VB 2C5LC 2YQEA 2HHUA 1AWDA 2JZZA 2OZ3A 2F77X 5KT3A 3WKAA 3HVZA 7ICLA 1IGDA 1WX7A 3APFA 4GGHA 2BS2B 2EMTA 3PSPA 2BVGA 3UCDA 3VCBA 2WP9B 3RPFC 4BGDA 1X9WA 3M6KA 1ZPSA 5KHQA 3HPFA 5AK3A 1WJNA 4K81A 3TFRA 1KN0A 3QWZB 3RFAA 3LWLA 2IOHA 2INDC 5T8IA 4BCAA 3JW7A 4IG7B 3T4WA 4WQOB 4RCOA 4MGGA 1TY0A 2PEAA 4YT0B 2C2EA 2KYWA 5DBBA 2DQNB 4Z6CA 4GDKB 4GOCA 3ZD9A 1LKYA 4KLIA 4PZNA 5KG6A 1GUAB 4J56A 4EQXA 2QMTA 2RDHA 4F72A 2ZXHA 3AE9B 3SEBA 2EQ6A 3UQAA 1FEZA 2HBKA 2ZEQA 4AS1A 2QJNA 4QZ9A 1LVLA 1GB4A 2K8BB 1ZQPA 1HQRD 4P0PA 3L0WB 3LYSA 2E8PA 4DFPA 2GLEA 4DQRA 4ECUA 5EBKA 1QH9A 5KFRA 3ES7A 3RJ8A 4QZEA 1WM3A 4PVHA 5FMHA 2EAPA 2M56B 2WXGA 1H38A 3B0YA 3PREA 4B9NA 1T3QC 1JOAA 2GO7A 3EJBB 2K4HA 3FM9A 4XYCA 1BUIC 3WK6A 3V6HA 4DX3A 1S0MA 3KKAA 2YVFA 1PVRA 2ZIXB 4UW9A 1C1YB 4FZLA 1K1SA 4PVJA 2AL3A 1S7MA 4NNJB 3VTEA 4Z17A 1DTNA 2ZC8A 1W1RA 4FDCB 2G08A 5D49A 4K7WA 3ZXRA 3KLJA 2PGEA 4RUCA 1L7OA 2X50A 1WX8A 4JQWC 8ICSA 2XCAA 5AWVA 1QCKA 3BS7A 2YY6A 1E8XA 2DNFA 5AUKA 3U7ZA 4HYKA 4U7CA 1GREA 5GTIU 2LYBA 4HAIA 5T14A 3OJSA 2L05A 4KIKB 3QNMA 4IRCA 3OSNA 3P2BA 4QZFA 4W9EA 4GSWA 1J7AA 2VRRB 3ENEA 4FN2A 4HCPB 5G55A 3MUCA 2QB0A 4AYBC 3DBRI 1CZPA 4ZCWA 4NY8A 3Q3NC 4EZLA 3W8ZA 5DLGA 2NRTA 2MRPA 2WPEA 1XS9D 1SF0A 3NHEB 1WH3A 1TYPA 2NO4A 3H9DA 3AQEA 5JHAA 2Y0SC 4HKZE 9ICUA 4H4UA 4K8GA 2FCMA 3RNMA 1A5RA 2A5UA 1AQ6A 3PZDA 3MGVA 3S2AA 3SR6B 1AARA 2M17A 1WSPA 1XD3B 1P43A 1WY8A 4EMWA 4QJFB 2BWFA 4A9AA 3PO0A 1WJ6A 3ETRA 5KFDA 9ICAA 1OEYJ 3TAQA 3H6NA 2GOLA 4RZRA 1SIFA 1T6BX 2ZG6A 2DZIA 1XLQA 4GN1A 2IBKA 3H0MB 1ZKHA 2NBVB 3GE8C 3F5AA 4O9MA 2KSOA 4ANVA 2KFNA 5KT4A 3EUB3 2BKEA 5KFZA 3QUTA 3TQ1A 1JX4A 5KT5A 1BWCA 1XNSA 1JWMD 4Y2PA 5IILA 4F5QA 2RABA 2TPRA 2WXHA 2DHZA 1TV9A 8ICJA 5KFQA 2XGPA 1ZJMA 3KHRA 4W9CA 4FHJA 1ZQTA 2MBEA 3CSTA 3MY9A 1WE7A 1UA1A 2VAOA 3J81j 3AEBB 2KKCA 3PK7A 4YG2A 1WGYA 2IY0B 2J3NA 2HNEA 4MH8A 3KUZA 4H4QA 4HG0A 3AE6B 1J19A 4ZRIA 2W9NA 2IOFK 4XX5A 4PK1A 1NK0A 1QSYA 4PS7A 2V4LA 1P7FA 4F7ZA 1UHUA 5ALYA 3LXDA 3AL0B 1ACCA 4XGAB 3GIMA 1DXLA 2RDXA 4M6UA 1NYQA 5J2HA 1MRAA 3SQIA 3RB4A 2MBBB 1WRDB 3II4A 2WP6A 7ENLA 3TEYA 3S1DA 1ZD3A 2KC1A 2WX0A 3Q69A 1GV4A 3UMBA 1B1ZA 4I6PA 3LVWA 2IJ0A 2H5XA 2P8CA 2BCUA 5D79A 2VJ4A 4GYPA 3RBDA 5HG2A 1FHVA 4YR0A 1WXSA 4DLGA 5GRTA 4MSQB 3C1YA 1DOQA 1F9JA 1RWSA 1LPFA 1SJAA 4GXBA 4GXKA 1E8WA 1YJIA 2F8LA 1UXYA 4U6PA 4EFOA 3G6XA 3IG8A 3BS5B 1MI0A 5DB9A 1TY2A 3KHHA 1F8WA 2HXTA 2V6OA 4HNLA 1AN8A 5ALWA 4NY0A 3RJIA 1B43A 4I2HA 1M4VA 3BVMA 3N1ZC 3ZD8A 3WCQA 2CS4A 1KKRA 2MX2A 3QAQA 1HSKA 3RD2A 3TOYA 4RQ3A 4FP1A 4RQ1A 3E0FA 5J2JA 1RM6C 3NVWB 2NQWA 1EUVB 2D5GA 2EKEC 2OO6A 2PP1A 2MRLA 5KFWA 3SENA 1NBFC 2R8HA 3OG5A 3GY1A 1QOAA 4KDLB 2WXKA 1EBGA 1GOZA 1PGBA 8ICCA 2M0NA 4MGZE 4KEMA 1ZQLA 4I28A 1CK1A 3ML8A 3EYZA 3ZVVA 4ZHPA 5IIJA 1OQQA 3SU8X 4ZYNA 4DFKA 3KTQA 1E9MA 4LDTB 4UD8A 3IJQA 4BV6A 3M7DA 3ZTDA 7ICMA 4JL9A 3KKAC 1E8HA 4NL9A 2JU6X 3RN9C 2BGWA 5TSSA 2ZJDA 3KWLA 1EXNA 3QKEA 3W8XA 2CHXA 5KG4A 2OHFA 4GIRA 1SJDA 2UVVA 1T0SC 3ABVB 4OVVA 3T3FA 2HBMA 1TAQA 2AH5A 5L9XA 3Q2AC 1NJYA 4R65A 1CQVA 2DPIA 1SJCA 5J0XA 4DF8A 1KLGD 4OJLA 1V6EA 3Q8MA 4EENA 2BBCA 3K9OB 4B9TA 1PDYA 2F1IA 2Q0ZX 2B21A 4BDPA 3H4DA 5ALFA 2BC1A 3M1YA 1DIQA 2QLTA 2N0SB 1ZMCA 2PFNA 2FBWB 2OCEA 3QX1A 2J52A 3JPPA 1WGDA 4PS3A 4W9GA 2UVWA 2Z7JA 2GBJA 1W1OA 4RNOA 3FCPA 4R64A 3PX0A 3PX6A 2LHEA 3PZ8A 4NAMA 1R4NB 3QU5A 5KFTA 1WZ0A 2GH1A 2FIFA 4K7UA 1S5LU 4NJ6A 1YX5B 2ZJ5A 4Q8EA 2L1AA 5AKLA 1F0XA 2RSUA 2JRIB 3AE1B 3ES8A 2GB1A 3Q8BA 3NASA 3DIPA 4E0DA 2G06A 2JZ3B 2D3DA 9ICOA 3LB8A 4KPLA 4URKA 3BQ1A 1MO9A 1OXJA 2WF7A 3LWMA 4PHAA 1FEHA 3A4SC 2K8CB 4WJQA 1KCZA 4HCNB 1T4GA 3DVGX 3I28A 4M0WB 2LKYA 4R8UB 1YZ6A 3R11A 8ICHA 4IUMB 2NYVA 3DFHA 3U4FA 1N61A 1X6IA 2L7RA 5C23A 5JCNA 1T0QC 4R3DA 3IBEA 1BPZA 2ODGA 5KFEA 3LK9A 3W5VB 1V1PA 3CW2C 2UWQA 3MDAA 1L7MA 2DUYA 5KG3A 2QDFA 2BC0A 4M04A 1XO1A 4C80A 5KNIA 1COKA 1C79A 1TS5A 3CXOA 3KUCB 3SSZA 1W1JA 4DS4A 3PLVA 1X9SA 3TJIA 3A0HU 3ZDEA 5KFUA 1Q0WB 3V7LA 1FD6A 1YD8U 3R0KA 5DG8A 2ACZB 4DEZA 4DL2A 3NS1A 3TFSA 4BWJA 4XA5A 1KM7A 2BS4B 3QJZA 3TACB 1HZ6A 5TR3A 1S0VA 3AU2A 5CRXA 3NVYA 1TAUA 5KHOA 2QEJC 5D6JB 2M8SA 2QILA 2PA6A 8ICQA 2DPJA 2AQ2B 2L52A 1STEA 3BINA 5H8YE 3W8WA 3M6ZA 3HKZC 3UMCA 1ZYQA 1YQ3B 3P93A 9ICTA 4RT2A 2ASDA 1H4RA 2PS2A 3EAOA 1SWWA 2WYQA 3D46A 4TV3A 4WIPA 2XO7A 3U30A 5KVIA 1VDVA 5AZHA 4YTMB 5AZFA 4UAWA 5AKEA 4LNOA 3SI8A 1PQSA 5DB7A 2JY6A 1ET9A 4EC3A 4HYRA 4EMIA 2VKQA 3UXKA 4GFJA 1QQ5A 2FCNA 4HVBA 4UAYA 4RU9A 5FR3A 4C0ZA 2JZBB 1FIQA 4X5VA 1KQQA 1WXAA 1C4AA 3J9CA 4MGKE 3TMPB 1ZQEA 4MM3B 4FJZA 2PKEA 5A0LA 2OVLA 2DWQA 4GYPC 4H19A 3UJ2A 2PTYA 3S6JA 1D5MC 1KRHA 1I4PA 2QCZA 3MQTA 1JXLA 2OQHA 2BYVE 2WF5A 1F1HA 4EQWA 1TS3A 3RBEA 2AJQA 1N60C 3JZUA 3VC6A 4USAA 3K1GA 5KT2A 2GQTA 2MAXA 1IBXB 3V4BA 3PO4A 2X8CA 4I2JA 4DFJA 3NGDA 3ZGZA 3KZIU 1WCLA 1GRTA 4DN1A 4ZDVA 1P0RA 4A55A 1E6EB 1BKHA 2AAQA 1ZQUA 2BVCA 4XC2A 5AE2A 3FV9A 3H4BA 1C78A 4RQ0A 1NJZA 1UWXA 1EM7A 1IYXA 1QLNA 4ACFA 3NVVB 1OFFA 1RG6A 5AM3A 4RFBA 4Y2UA 3JPRA 4IC9A 2W04A 3L4PA 1ZQBA 4LK0M 4E71A 5ALVA 3RH4A 1L4ZB 3GILA 3A9KB 2OPJA 4IL0A 1SE9A 2OAIA 4R66A 3TJ4A 4QWCA 2LGYA 3N9YC 4DWFA 2YQUA 3ZLFA 1SZPA 1LXDA 3UPQA 5AI9A 3GS2A 2J42A 2MNRA 3ISCA 3RAQA 3S1FA 3V7JA 4F8RA 4O5EA 4JN7A 4M2YA 2WF6A 1SKWA 1E8GA 3QU9A 1JEHA 3TSHA 1QLTA 4QIWF 1C9FA 3PS6A 4EZKA 3B2GA 3MHZA 3JW0X 1FRRA 3H8HA 2YVCA 1ZXIA 3CAWA 2KO3A 2XNAC 5DLFA 4LJPB 3NRZB 2PGWA 4KLQA 3N4EA 2MJ3A 4M6WB 5DDYA 2ZJ8A 5L1LA 4FXCA 1FECA 4L23A 3PO5A 2FPMA 2HBLA 2TSSA 3V6CB 2G5HB 3MFIA 3RCZA 4PWCA 4UDUC 1MG8A 1STZA 2XK5B 2ZIWB 2C9WB 3ZDAA 4B9UA 5G5HA 4W9LA 3ISDA 1N62A 1J2MA 2F3NA 2WF9A 1GB1A 4F5NA 3ZW3A 4IOIE 2E8NA 3C5GA 1YZ7A 2FMSA 4IM2A 1WWVA 3ZYYX 5IO9A 3ZJTA 1O08A 4CF5A 1UA0A 3WAPA 4FS1A 5IINA 2VZKB 5DBCA 3IG3A 3OP2A 2Z0DB 4F2RA 5EE9A 5AI4A 3LB8C 3TWAA 2XC9A 1KFSA 2GL5A 4OCZA 4JK1A 3SN4A 4BBNF 4QZ8A 3RJHA 1PGAA 4APNA 1TKYA 1UH6A 1D4BA 2IZVB 3RNGC 2GRIA 5J0RA 4C4VB 1JCTA 4GC7A 2O2VA 1YJ1A 4EQSA 4UATA 1RFKA 7ICTA 4JV2A 3HW8A 3N3KB 5J0SA 3A33B 3Q3MC 4WAFA 5E6OA 3WA0A 5DPRA 3X0WA 3K1ZA 5J2RA 1WYWB 3HWTA 3KJMA 1EC7A 1Q1RA 5DG9A 3PW5A 1K52A 5L1IA 3NG0A 2ZPYA 4OZBA 1TE2A 3DBRB 3NVZB 3MZNA 1N63C 5KL1B 2D2QA 1L6UA 2WPCA 4UAZA 2PMZF 1N6ZA 2JXJA 3N6HA 4J3ZA 2V0GA 4IWOA 4P4MA 3BJYA 4BOZB 2YX8A 1P1AA 5DPSA 2O56A 4ZRKA 4QZIA 3TAPA 4ICVA 3R07C 2KK8A 3CIRB 2DYMA 1P48A 4O0IA 3JPNA 5DGBA 3WK9A 3PW7A 1KLNA 2FLLA 2KZ3A 2L83A 3W9CB 2EZZA 4TMAB 3AN1A 5FXEA 1E7UA 2ONEA 2RHFA 2IO1B 2NBWB 1MBBA 1YEYA 2WF8A 2MW5A 4UB3A 3OJ4B 3RB6A 2ZXIA 4TQ1A 3EJEB 5AM0A 1E9IA 4OJPA 3OSPA 2G0AA 4ELUA 1JW9D 3EW9A 4QWBA 2JYTA 2ZNVC 7ICVA 2JRHA 4II3B 3QFAA 3T6CA 1HJPA 1U49A 4MH0E 3QEBZ 3A1QB 4PHEA 3AE5B 1VAOA 2WTFA 1BXTA 3V05A 3CT2A 3DHGC 4G11A 4WQMA 3FW9A 4A6GA 4NLNA 2HCFA 2GH5A 2KX0A 2OJRA 1W1KA 1ZX9A 2H3FA 3ZDMC 2W9BB 1OTRB 3W2DA 2GGIA 4ECRA 4FLHA 1TYTA 4DF4A 4HWIB 5L95C 4Y2SA 1L6NA 2ON8A 5IAAC 3ICXA 5JRTA 2HJ8A 5BYQA 1GETA 4RQ2A 1RPLA 1HEZE 8ICYA 3WK5A 1WXVA 2IPKD 2KE7A 2PIAA 3Q8QB 8ICNA 1XQQA 4FI4A 4JMUA 4Y2JA 1WWUA 3IG5A 1XDIA 4KWSA 3V61A 2F1JA 3PV1A 4A6QA 1QSLA 4G9BA 4FBUA 1VZ7A 1ZXHA 2IO0B 2Y5CA 4YMNA 3C0PA 2XGQA 1HUZA 4UB6U 1WR1A 3PQBA 4GFIA 2F8KA 1SB3C 2JH1A 1YQZA 1SV0A 4P0QB 3I63C 1Z3EB 3A9JA 4KLDA 4EEKA 4N9F4 1PDXA 4TKNA 2MBHA 1K1QA 1TK0A 2E3TA 2HI0A 2LHDA 4P1CC 3N97B 4YSZB 4OZCA 1WVFA 5LXIB 2CRXA 1SEBD 4S0RA 1S77D 2AXRA 5FXDA 1KJTA 2W7OA 3O65B 4C4RA 2K89A 1QQ6A 3IJIA 5CB1A 5IA7A 4LA1A 3PW2A 1VR9A 3H7VA 3NXLA 1NYRA 4JV0A 3DHHC 1T3QA 1XLPA 4LTUA 3UGVA 2WXLA 3HVDA 3U9IA 2EQ7A 1L6VA 1X2IA 1GSNA 3TI0A 1WUFA 3WKBA 3H7PB 2N7EA 4CGZA 3DJGX 1UNSA 2L76A 4LZGA 4J9OA 4YCXA 2MBOA 4P4OA 3V6EB 2VFSA 3R1ZA 3C19A 1ZXIC 3RB0A 7ICEA 3WALA 4DOCA 3FW8A 2LZ6A 4KX5A 3OPSA 1T7PA 1D5ZC 1HXYD 4PHDA 3IK4A 3FAHA 2DKXA 4NLBA 2PP0A 4M9JA 3JPOA 1YT3A 1X9XA 1DGJA 3R3MA 3JVAA 2ZVNA 3GD6A 2ZIVB 2KTFA 4OZAA 3RZWC 2H89B 2K6DB 4WJPA 4TUQA 1IM4A 1ROEA 4ED6A 4AQ7A 1N62C 1Z4OA 1V97A 2JHDA 3JSVB 2AQ1B 2PSNA 2BCRA 1AYFA 4MT5A 2PJHA 3MTNB 4HCLA 3NTUA 1WJUA 1HTOA 1GXFA 3R0UA 4DSIA 5LNK1 1L7YA 1XXGA 1X9MA 2KZMA 4KMUA 4W9HA 3V6JA 2WB1C 5D4BA 3C2MA 1D6EC 1QT9A 4XUSA 3AU4A 1Q3UA 2RMMA 1AHVA 3DFYA 4NXZA 5FS6A 2JF5A 2OLAA 3WAOA 7ICNA 3I3TB 3QU7A 4M9HA 2C7HA 3MFGA 2FUHB 4GB9A 2NR2A 5CP2A 4AOFA 1QLBB 4O3PA 2W9AA 1B4FA 5ALSA 5C0YA 2YLMA 4LJXA 5CHFA 2QDEA 1MC8A 1RQNA 3RITA 3SJNA 3B0XA 3ZVHB 2HZGA 4RQ4A 2FCSA 2ZIXA 1YMHE 4QAYA 3AULA 5AUIA 3CSFA 3VAWA 4B95A 2K4IA 1ENFA 2ICIA 4F1SA 2BYTA 3SAGA 2DFLA 4BOSC 2KMCA 2D3AA 2EZXA 2IA6A 3A7UA 4EZ9A 1TTNA 4O1NA 1N5WC 3GZNI 3KYCD 2LGIA 3T9PA 4RUAA 5BYSA 1HTQA 1Z4NA 3T5JA 2ZTCA 3FYHA 1NVID 2SAKA 3I6EA 5AHXA 3MWCA 3VCCA 3RRGA 4ED7A 2LMRA 2W43A 5CJ7A 2IBIB 1LGRA 1K53A 1UGMA 4FA6A 2P13A 1QKZA 1WX9A 2N7DA 2QQ6A 5AI6A 3OJUA 2AGOA 2O6VD 1AHZA 1ZQVA 4OJ5A 1FPYA 1KFDA 3V7KA 4NLGA 5EWGA 4RF1A 3DPDA 4JWSC 1W6TA 5ALQA 1SGHA 3C0RB 1E0ZA 4KLTA 2GRTA 3RYTA 2YVSA 4MFCA 2H3VA 5D3DA 3H12A 1IV8A 5BOMA 3SD7A 2Y9TA 2EKIA 2KEYA 1PVPA 4I2CA 2I0KA 3PPAA 3D2QA 4K3CA 4P16A 3QCAA 3EUB2 3URYA 1XF5L 1N56A 2PTWA 5J18A 3MGHA 2CHRA 5AK6A 5JCLA 1Q46A 2HSZA 5J17A 4EYIB 4TQRA 2IOFA 4F4YA 3RJGA 3ZRCA 3RMKC 1Q8KA 5DDMA 3ETLA 4XE0A 3TKAA 2MA1A 3E58A 3PWIA 1BNOA 4EM4A 3JYUA 3IAM1 2PI4A 2VH1A 4UB2A 3LYYA 1Q1WA 3U7DA 2UVUA 8ICVA 1L3SA 3QIJA 4HROA 5AE1A 2G4DB 1GRAA 3KHGA 3AU5A 2L0FA 1VJKA 2XN9C 5FS9A 3GIJA 2HOQA 5BOLA 1ZQJA 1LV5A 1RRBA 3WKDA 1WZ3A 4HRSA 4LCDE 2FE8A 3QX7A 1SV0C 4LNIA 3IJLA 4IDIA 2AU0A 1YJJA 4QWDA 2ESEA 2BGFA 3D47A 2V4QA 3MFHA 3U4EG 2Y08A 4F5PA 3ORYA 5L83A 2YMPA 4F93B 1CEZA 2AQ0A 3UINB 4YSXB 3I4KA 4DWIA 4ZOHC 4I2FA 3C5FA 1PK1B 2FDRA 3AH7A 3AI5A 2AKZA 3M63B 1I42A 4IZGA 1KEJA 4DFMA 2PE9A 3HT3A 2ONQA 3I5JC 1JWSD 4ZA0A 2DW6A 1V5OA 2CHWA 4H4WA 2HHSA 1T0YA 4NEVA 4J9NA 1F2RI 2JRZA 1GRFA 1SXEA 2ZJAA 1QOFA 3VUWA 2GI9A 3P0WA 1OQYA 3MKCA 2G1EA 4RM8A 3KH0A 2MP2B 1J2NA 2MUTA 2CJNA 5CHVC 4S17A 4LVSA 2AWTA 3AEEB 4C7ZA 1XT9B 2Q85A 2MBRA 1GESA 1TVAA 5ALJA 3RR1A 3RAXA 2BQRA 1NKEA 3HSUA 3IAS1 5I4DA 4EQRA 3K1RB 5K4LA 2W82A 4LNFA 2KOXA 2LYAA 1SBBB 2E8OA 4CNQA 3QHTA 7ICPA 1QF6A 4MEXA 3PV8A 3DVGY 2IDYA 5HKHA 3UJFA 4GDLB 4F91B 4P6VF 1WI0A 3MGIA 5IOIA 1MJDA 3KUMA 5D3IB 1R4MB 3DERA 2R8IA 1J7CA 4F71A 2ASJA 1B0XA 3BS5A 2D3BA 2NS5A 2GSHA 1FXIA 4DHGA 3MR6A 3EECA 3BQ0A 3RTVA 3S1CA 4OHJA 5ALXA 3EZ5A 1EF5A 2X99A 3NZGA 3QYPA 3AE3B 3PNCA 3STPA 4I27A 4M0AA 5KFGA 3NS8A 3RZFA 4EBEA 1SGGA 3GIKA 1ZOLA 4N6EB 1WGGA 4E74A 2FE9A 4J9PA 2MSED 2VH2A 2G4SA 2EAOA 4B9SA 4XDCA 5DQIA 2INCC 2W11A 1WXQA 3KOOA 3BYTB 2KVSA 4M00A 4P7IA 4YTPB 1GRHA 1ZP0B 4L1BA 3TIXA 3SYZA 4CO7A 2BYEA 2HXUA 1YX6B 5IIMA 3QTPA 4H4PA 3EFCA 4KLFA 1EWCA 2LMCA 1XU4A 3VHTC 2FAZA 4NJ8A 4UBBA 4XWWA 4DCCA 2VIXA 4EX7A 1KDHA 4BKSA 1MFWA 3DOWA 4ECTA 4MDKE 3MC0B 3KD3A 2GR2A 4GISA 4KDIC 3N28A 1E7VA 3BY4B 5BO4B 1CI4A 3ZLHA 1KTQA 4WJNA 3UMGA 2ZPNA 3BZDB 5HHIA 3QUBA 1NHQA 2AYOB 1S1QB 4JPSA 4QW9A 9ICVA 1UBQA 5EOZA 2E1EA 3BVGA 1IIPA 1L3VA 5AI0A 4M02A 4DNAA 2W9CA 4IQVA 4OVUA 4WH4A 9ICNA 5AKJA 1U45A 2MQJA 1BZLA 2WDWA 2KK0A 5J2IA 5KFLA 3DGZA 4H4VA 2PFQA 5G5GB 3HRDD 2J6TA 2LGSA 2Y9UA 4TVYA 2P6UA 5U1OA 4Z1YA 4YQWA 3MR5A 2CXYA 2J6UA 2OEDA 4H4YA 4OVZA 3N32A 2WDVB 3SD5A 2E5AA 3HKZF 3ZI4A 3KUDB 4YR2A 3BW7A 3URHA 1K50A 1G6JA 4KLMA 2V3SA 3ALBA 3VTVA 5FJTA 1UT5A 1O03A 1NHSA 1NU5A 2OFJA 1FNVA 9ICFA 2DAFA 4O3RA 1XWLA 2HDOA 2P66A 5L1JA 3RT3B 1YQ4B 4ASWC 3H0LB 5FS8A 4R8UA 1M6IA 1ZQCA 4ED3A 1L2NA 5BPCA 4X57B 2QC8A 8ICKA 2HHXA 2QARB 1FMAD 1RFAA 4JWUC 5JTIA 1FEBA 2YAUA 3QARA 3LDAA 2BQ3A 4MJSB 4M0XA 3VTWA 1FHUA 2XI9A 3MJ5A 3WKEA 3QUQA 3DG6A 3IHQB 3L17A 2XH0A 3UF8A 4J9QA 3Q8CA 2MCNB 1S8OA 2JZPA 5J2BA 2WAQF 4YXDB 1N60A 4WWMA 3D2JA 1YNTE 3WANA 4EWJA 5KAFU 3LXFA 1KKOA 5EE3A 2IPIA 1V9JA 4PH5A 2KKPA 4UQGA 1ZQMA 2BHNA 3PG6A 1ZK7A 1FNUA 4LDTD 3ZNZB 1ECQA 2OH2A 4KN4A 4EBDA 1FFUA 2KICA 3IM1A 1DIIA 4YD2A 1JPMA 9ICIA 2R9ZA 3LLBA 4RQMA 3RR8A 4FJVB 1TK5A 3VRAB 3B9JB 1EC9A 4DSJA 2QDDA 3P3BA 2OZ8A 3VC8A 4BKSD 5ALUA 5C1ZA 1XS2A 2WXFA 3EC8A 3BZCA 1T3NA 2NRWA 2BQQA 4RM9A 4OO1J 1VZ6A 2BQUA 3QA8A 4QZGA 2KT7A 3ZJVA 5ADZA 4QWAA 3CP8A 1ZQRA 4KLEA 1SZHA 1COOA 5KG1A 1L3UA 5G2NA 2RD0A 4A3RA 5HMLA 2KKVA 3EPIA 3X23A 2PPGA 4KPRA 2D8CA 2C7NB 1J0GA 2ASLA 1SL1A 2OM6A 5HMRA 3CB3A 3TEWA 3DEQA 3Q3FA 3HRDC 3QN3A 8ICGA 3N1YC 1ZDVA 2IY1B 1GRGA 2YVJA 1W1MA 2KJ9A 5J0UA 2A3VA 2PCEA 1K4QA 2XBBC 2V3BA 4MFFA 5J2AA 4JLCA 2JZBA 4BKTA 2V4RA 4MM3A 5H92C 4DL5A 3PT2B 3M8RA 2RRDA 2PVGC 3AEAB 3CXBA 8ICBA 1FFVC 3TSJA 2XY5A 4Q43A 5D7GA 1YQBA 3Q8RB 3L10B 2W03A 1XEEA 3VUXA 4RF0A 3VA8A 2PFPA 4RQ8A 2QIEB 4WJ3B 2GMIC 2BVFA 5KG2A 3CGDA 4AJYB 3C28A 9ICKA 4JV1A 2N9PC 4GGQA 4KVGB 2KLGA 1QZEA 1ZQOA 4PT5A 3UXLA 4YD1A 3C23A 3C2KA 2YB4A 2KFJA 4DYEA 4FBJB 3N7PD 1NENB 2CU3A 1KW4A 2L32A 3GD3A 1SJHD 3OWEB 4D2KA 4O3NA 1NK7A 2DZJA 4K4HA 1IYFA 4IRDA 3EKGA 3R7QA 1JUDA 2N1RA 1ZW7A 1L0VB 2KDEB 2UU7A 4J9RA 1Z1BA 3A9KA 3HW2A 4ZHOA 2XH2A 1VQZA 2ZIUA 2HDEA 1BNPA 4ZRJA 4PYTA 2QHOA 2RP5A 5J0QA 4K1RB 1ZGUB 3RI7C 1JROA 4TUUA 1D9DA 2N7JA 2GLSA 4YL8A 3V72A 3DJJA 2WXQA 5JUMA 1W1SA 4IP5A 2WU2B 1N63A 4DBGA 4FS2A 4IRKA 1WGRA 2MH7A 3P63A 5JZEB 4H4ZA 2V4IB 4ENLA 4C7YA 2PP3A 5CX3A 4ITKA 2C7MB 4IC7B 1TZZA 5F9LA 1ZRNA 2FIDA 3U8ZA 4AJWA 2YTUA 1S10A 4FZNA 4NAWA 4B0EA 2J0MA 1H8CA 1OQRA 9ICPA 4IM0A 2MEKA 3H40A 3JPSA 3BQTA 2BPSA 2H3ZA 3SV4A 2RLTA 3FDSA 4Z6FA 2NPTA 2WDTB 3EFUA 2ZIWA 3I9V1 5ALOA 4ARIA 1GJZA 4FX9A 4JQ9A 1C4PA 2CHZA 2LFIA 4ANUA 2JWUA 4NJ7A 2LHTA 1D5XC 2L00B 3S5SA 4RT3A 4EYHB 1ZQSA 1UQVA 2ZZCA 4M9LA 1ZQZA 2HHVA 1I7HA 4NLKA 1GNUA 4FADA 2V9WA 1WMHA 5GXGB 4PHPA 2A8XA 2X8HA 4YWOA 3UJSA 8ICOA 3DQVA 3GRSA 8ICUA 2I1KA 3BYYB 3K9PB 4DSKA 2RDJA 1DYQA 2H88B 3HUIA 2RPVA 5KFIA 1S9FA 2IHNA 2KQSA 4TQ0A 1N5XA 2FLNA 4CE6A 1YIWA 2WXJA 4P4PA 4HCDA 2Y3SA 1NHRA 2KOBA 3MDCA 1Y56A 4IKGA 2O3GA 4C4VA 2DGZA 4LIIA 3E9SA 2KD0A 3JVZX 4KX6B 2XH7A 4HJGE 4KLOA 3AB5A 1JIHA 2EQ9A 4GIBA 4IWPA 2JEIA 2Q5WD 3L5KA 3T8MA 2OKTA 2BCSA 4E8GA 4O5KA 3OPXA 1MDRA 3N1XC 4QNLA 3R7RA 2VFRA 2QKNA 4BVUC 2DAJA 3Q8EA 1Z00A 4IQUA 3OZYA 2R2ZA 3GIIA 4ELVA 2VFVA 5J2DA 2KC2A 3EF6A 7ICKA 1I4XA 1ISNA 2AQ4A 4ECWA 2N9XA 4MF8A 3SEIA 5ALPA 2BTEA 4J6IA 5EWFA 2PI5A 2J53A 4LJOB 3GFKB 1WIAA 2BKFA 3NO1A 1BVSA 1GG3A 3DDMA 3TQPA 1H2IA 1VLBA 3ZKJC 1FFUC 1GRBA 2FCQA 2IGHA 5DCNA 3ZNHB 2CJOA 2BDPA 4H83A 4ED0A 5L6GA 2HHQA 2RQ5A 4WJOA 3BOXA 2BB6A 3AE7B 4EBCA 3P4QB 3ZNID 2NRVA 3W5UB 3TX1A 2ISOA 5KFSA 1L0XB 6ENLA 5IDZA 2UUUA 3O0FA 2A1JB 3UXOA 3SAFA 1TIFA 2GDQA 1OEYA 1YOVB 3GRTA 2IO2B 4Y2RA 1ZR6A 5JXVA 1AHUA 1Z2MA 3EHVA 4MACA 3ZLZA 5ALZA 3ED5A 4QZHA 1F3PA 1GO3F 1OUQA 3FILB 3BQ2A 3VVWB 1EC8A 1K8RB 3NOBA 2DBYA 2A1AA 4NZLB 1ZRMA 2IMWP 2DYBA 2IGDA 5EU9A 4C4SA 4HPNA 4JHMA 5AKIA 5ENLA 4ECXA 2HD5B 2PPHA 5E79U 2WS3B 4JIOU 2I2YA 2M1MA 4BZAA 3L5OA 2C3DA 2F76X 1CJEA 3HJEA 4HN8A 4DQQA 2JEJA 3A7AA 3APCA 1SJED 3E2EA 2VZKD 3IXSA 3I6TA 2XSXA 1TBEA 4YXJA 1JMSA 1V1PB 2N9EB 4QW8A 2KFKA 4M47A 3N4FA 2RR9A 4PPXA 2JGAA 2WHEA 2B6GA 2GBMA 2L5YA 4J9KA 4ZYSA 9ICMA 2GBRA 4ED2A 2GBNA 1NOMA 2LVQA 1JPDX 3TW9A 2QGYA 4XQ8A 1N2XA 2ATLA 4ML8A 2WQYB 3CYJA 4MHVA 2D3CA 3ZDBA 3D6JA 1SE3A 1GERA 2G3QB 2N1VA 2CFYA 2DF4B 2ZCBA 4Q44A 3HM3A 4IP4A 2QPMA 4UB1A 3UGBB 3NS1B 1UCVA 1V1OA 3PRZA 2Z0EB 3TWBA 4XWTA 5IKCM 4YWSA 5J2EA 3NZUA 3NVYB 4HK2A 4A8XC 2PW9A 2YMMA 1NJXA 2JQRB 1XLNA 2M0XA 2ZTDA 3B0AA 3H7PA 1RYJA 4PZOA 2Y3AA 3ZUNA 3POPA 1U4BA 2KTRB 3KYDD 2HW3A 4NQKE 2GQWA 2H3IA 2J6SA 2K1FA 4MKSA 4MGIE 4KLUA 1TS4A 3BZKA 4HDOA 2VA3A 4H50A 2PODA 3K75D 1N5WA 4K1WA 2IHMA 1L7NA 5IN7A 5JCIA 1P7EA 4YSYB 2B0CA 4DXKA 2M19A 1ZQ1C 4RPXA 2W7PA 3RGTA 1FIQB 3RB3A 3PMLA 1WF9A 2AQ3B 3H70A 2I9GA 4ED8A 2L0TA 4O3MA 1L5UA 2KZZA 3AQFA 1ELSA 5MPOA 4KLSA 4B6WA 5KL8B 1QOBA 2POZA 2KTQA 2LXCA 4N58A 4BKGA 1N48A 3WU2U 3JSVA 1FCLA 1ZQGA 2OG9A 3FVDA 5AK5A 5HR7A 3GB1A 1FEAA 4JN8A 4B9LA 3MJWA 3R9KA 2A4ZA 2WWZA 1SKSA 4DWDA 2JH7A 3SFEB 3R25A 3VFCA 2ZUDA 1Z5SB 2L3ZA 1V86A 4MEYA 4TURA 4NM1A 5CA7A 3TUOA 1QSSA 4HXDA 3ZDTA 4A90A 4GLSC 1T8EA 1NZPA 3M3JA 3O0HA 1PDZA 4DOAA 2LBOA 5KFJA 4CDGA 3F53A 3GV7B 2LGDA 3MC9A 3RH5A 9ICLA 3GU3A 1Q10A 3IVFA 3MSYA 3DESA 3R2TA 2LGXA 2ZUCA 2KWCA 2K39A 3AE2B 2ZZPB 3JS8A 3ZVHA 4DNSA 1X42A 9ICGA 4B6JA 3DBHI 2KQ7A 5KFNA 1ED1A 4BC9A 5JHBA 2EQYA 3PW4A 3HHMA 3UI3A 1C3TA 4ARCA 1ZQYA 4UASA 4JWMA 1IG6A 4EOYA 2GGEA 2KVRA 3H7SA 1X6JA 7ICJA 1V59A 1I35A 3HX0A 3SN1A 1L5PA 4XLOA 3PR4A 3QXGA 4I29A 3IN5A 5J2CA 4C4TA 4E4FA 4RQ7A 2ALZA 2AL2B 2QB1A 3DEDA 2KX3A 4ACOA 3IRUA 1SE2A 2LUEA 1NK9A 3FW7A 3CGEA 4JB1A 4IS7A 4MMWA 4ED1A 2MHJA 1UT8A 4QZDA 3H8JA 2FYMA 3BVZA 5HNKA 4C00A 1NI3A 5EE1A 4IQTA 2FMQA 4KSLC 3CGCA 3B1LX 2WOIA 3P4PB 1JXEA 1MHHE 2KN4A 5DB8A 4ICAA 7ICGA 4DDGD 3PWGA 1F77A 1IUEA 4F8CB 5G5HB 1TS2A 1ONFA 1F0MA 1KN5A 5ALHA 5TISU 3MR2A 3DK4A 1V8CA 2KDIA 2PLIA 3DWMA 1RLFA 4JB3A 1RYSA 7ICHA 3TTEA 1AW7A 2O6VA 1B9RA 5ER0A 4H2HA 1YN5A 4UB8U 2INPE 2WNMA 4HPMB 4HDQA 2HBJA 3H8MA 5DQGA 3EPGA 3L08A 2W3SA 2R61A 3PRMB 2BB5A 5J0PA 4J3OD 2V3NA 3H8AA 2KDMA 1MA7A 2YB1A 3DDHA 2RGFA 2WXRA 1WGKA 4HPPA 1JI7A 3ZJUA 4DFDA 2DL0A 2LASA 2D07B 2GBKA 4JX1C 3HPOA 3THUA 2O2VB 3E56A 3PSTA 4QZCA 1H6VA 2QJMA 2EH9A 3T5HA 1Z19A 1MQ3A 2K3UA 2NPXA 4DSEA 4GDKA 4P1BC 1JWBD 2P8BA 1D8YA 4CRXA 1KFYB 2DZMA 1ZMDA 2WBAA 2KNBA 4QIWC 5DPTA 4H4XA 3F5EA 3DHIC 2W8KA 1IPGA 3SQPA 2GQUA 4AYBF 4H4TA 1C7YA 3RRAA 3PSFA 2ES6A 2K8BA 5IIIA 4DHJB 1XANA 2DZKA 4K8DA 1JALA 3GV5B 3UIPB 4B0MA 1RVKA 1BPEA 4OJ6A 4BFRA 1RZTA 2BYFA 3AEFB 1PK1A 3SDLC 1S0OA 2Y0SF 4I6LB 3WIMA 2JR5A 3FWAA 4KITB 2KMAA 2GWSA 2YN4A 5ALKA 5DGAA 2KWVB 1WXMA 3H1UA 1TAMA 2I38A 3TL5A 3GSYA 1RAXA 4TSSA 4WWNA 1OGWA 1TKEA 1LO5D 5DQHA 1ZQXA 2Q4WA 2JV3A 1GAQB 3EA6A 2XH4A 2W8LA 1V49A 5AZGA 3LADA 2MP2A 2WOVA 3DWGC 2VFUA 2MUCA 2PMVA 4RNMA 2R2QA 2MU2A 1L8OA 3PVLA 3DBSA 3T5LA 1EBHA 3DG7A 3OZMA 2QJLA 2JX5A 4A3OA 1CRXA 4BBNC 4E3CA 9ICWA 2CDUA 2J4XA 5D2MB 3I99A 3S47A 3DBLI 1ET6A 3P4SB 1FO4A 4M9GA 1NJWA 1NHPA 2WDRB 4K4IA 2I1QA 5CHGA 1KSPA 2D11A 2KLCA 2LJ5A 3ZVIA 4KIKA 1I4HA 4EKUA 3QFBA 3LVVA 2UUVA 3NZSA 3NZ3A 1LM8B 3DQ0A 3QZ8A 2F5ZA 2PMZC 2OJWA 1UD7A 4RPYA 2B3AA 3RJKA 3L16A 4RMAA 2GGHA 2FJ6A 5DB6A 4L2YA 3KLSX 5CWRA 3A9JB 4LLGM 2P35A 3BK2A 4HNCA 4YN4A 2BW2A 2LRWA 3A7RA 5BOEA 1V9PA 4FO6A 3SV3A 1S0NA 4FHKA 3M8SA 2KHQA 3T5KA 3SR6A 1UF0A 2C22A 1EF1A 2KDFB 1KLVA 3RR7A 2NCNA 1K51A 3SN0A 1W1QA 5AKYA 3MC8A 1QLUA 3UJEA 3V5FA 8ICIA 3CK5A 3AEDB 3Q14C 3C8YA 2WU5B 1KTKA 4GXJA 4A20A 5HHDG 5KFCA 1MNSA 5ALGA 3PLUA 3SAHA 1V80A 2Y4GA 3DEEA 3CGBA 2I6XA 3GD4A 3V3WA 4H1ZA 1MN8A 5HHHA 3Q8SB 3V60A 2XCPA 1V5TA 4TVWA 3ISBA 3MP9A
chains in the Genus database with same CATH topology
4YXDB 1N60A 4WWMA 1E10A 1YNTE 5BMGA 3D2JA 3LXFA 3ZQ4A 5EE3A 2IPIA 1EU4A 1TS3A 1N60C 4USAA 5FK9C 3O13A 1EWYC 1FNUA 1JWAD 2GQTA 2QSDA 1IBXB 1C77A 1SSNA 2MJEA 4BC7A 3AEGB 3ZGZA 5G5GA 4ZRQA 3LLBA 1FFUA 2WXMA 1DIIA 3PM9A 4A55A 1E6EB 1UWMA 5AE2A 2EXRA 3VRAB 3B9JB 1C78A 1UWXA 1EM7A 2Z8LA 2KMMA 3B2FA 4DXFA 2WXFA 3NVVB 1OFFA 4RFBA 4YWGG 3AM9A 1VZ6A 2LUMA 1EU3A 3ZJVA 3L4PA 5ADZA 4LK0M 4N59A 5K8EA 3FC4A 1L4ZB 2OAIA 1DOXA 3VQIA 1SXTA 2W3RA 1XCTL 3N9YC 1E0YA 2WXPA 5HMRA 3GS2A 2BS3B 2J42A 3TEWA 3S1FA 3HRDC 2YEPB 1TJEA 1ZDVA 2X38A 1W1MA 5HQXA 5FKAC 1E8GA 3TSHA 1QLTA 2LEKA 5L6FA 1C9FA 2LJIA 3B2GA 3MHZA 1KF6B 1TYGB 1FFVA 4HEA1 1FRRA 3H8HA 1TZOA 5H92C 3AE4B 1ZXIA 2FUG1 2XNAC 3NUHB 3U2SC 1A70A 2PVGC 2MJDA 2WLBA 3AEAB 1SE4A 1FFVC 3NRZB 3TSJA 4US8A 1UGJA 2MJ3A 5D7GA 1XEEA 4RF0A 4FXCA 4L23A 2TSSA 3T3NA 4PWCA 4UDUC 1DOIA 2QIEB 2BVFA 5G5HA 1DZNA 1N62A 3NVWA 3D2DA 2AX5A 1GB1A 3B9JA 4PT5A 4IOIE 2K22A 2M0AA 2N9LA 2PTLA 1C76A 1WRIA 1NENB 2CU3A 2L32A 3ZYYX 3ZJTA 1SJHD 3OWEB 4D2KA 4BBYA 1ZUD2 1IGCA 1L0YB 5HI1A 2VZKB 1L0VB 5EE9A 4ZHOA 3LB8C 3R8BA 1VQZA 2HDEA 2Y3RA 4PYTA 1PGAA 5C2TB 1I19A 4PVEA 1TKYA 1JROA 1D4BA 1JWUD 2GRIA 2N7JA 1YN3A 5BMHA 1RFKA 4C56C 2WXQA 1W1SA 2WU2B 1N63A 4WAFA 3P63A 2MH7A 3KJMA 5I1VA 2V4IB 1K52A 4C7YA 3NVZB 1PFDA 3AMZA 4OZBA 4RGNA 3VR9B 2P3HA 2Y5PA 1N63C 4ITKA 1WVEA 1L6UA 3BIID 4B0EA 1OQRA 2V0GA 4KKIA 2MEKA 2PLPA 3AECB 2WXIA 1FRDA 3BK1A 3U52E 5HFYA 4YTNB 3I9V1 4ARIA 3Q8FA 3R07C 1C4PA 2LFIA 3CIRB 2DYMA 2NMQA 2K9XA 2JWUA 2PLSA 3W9CB 2L83A 3AE8B 1I4RA 4TMAB 3AN1A 1D5XC 1ZDXA 5FXEA 1UUPA 1ZOYB 2INNE 1I7HA 3CWIA 1MBBA 3BWUD 4WURA 4ZOHB 4TQ1A 5GXGB 1WWTA 4US9A 2E6XA 1JW9D 2JYTA 1E8FA 4KGTA 3BYYB 1RM6B 2DLBA 4RGTA 3S1EA 1DYQA 3AE5B 2H88B 3HUIA 4M0WA 1E7PB 3V05A 1BXTA 2RPVA 1VAOA 3IT4B 5HHZA 1J7BA 4WQMA 4TQ0A 3FW9A 1N5XA 2WXJA 1W1KA 2Y3SA 1Y56A 4IKGA 2O3GA 3W2DA 1ESFA 3E9SA 4KX6B 4HJGE 1AWDA 3AB5A 2ON8A 2Q5WD 4KGSA 5BYQA 3HVZA 1HEZE 1IGDA 2IPKD 4PVKA 2BS2B 2PIAA 4XDDA 2BVGA 2WP9B 3RPFC 2VFRA 1ZPSA 2SEBD 2QKNA 3Q8EA 2R2ZA 4A6QA 5BYRA 2VFVA 5T8IA 4BCAA 1VZ7A 1ZXHA 2Y5CA 3C0PA 4RCOA 1I4XA 1R7SA 1TY0A 4YT0B 2K5PA 2W54A 3PQBA 2BTEA 1SB3C 4GDKB 2J53A 3TEZA 1VLBA 1PDXA 1FFUC 4RH6A 2IGHA 3LAEA 2QMTA 2RDHA 2E3TA 2LHDA 3AE9B 3SEBA 3MP9A 2CJOA 4AS1A 4YSZB 4OZCA 5L6GA 2DYOA 1WVFA 1SEBD 1GB4A 2BB6A 2AXRA 5FXDA 1F0ZA 1HQRD 3AE7B 3P4QB 1PYWD 3Q8AA 2UUUA 3W5UB 3TX1A 1L0XB 3T3OA 1I4GA 1VR9A 1NYRA 1ZR6A 5JXVA 1T3QA 1XLPA 4LTUA 1GPXA 1AHUA 3RJ8A 2WXLA 3HVDA 4PVHA 4MACA 1L6VA 2M56B 2G9HD 2WXGA 1BMLC 3FILB 1T3QC 1BUIC 1UNSA 2DBYA 4NZLB 1QOGA 2IGDA 2WXOA 3RFZB 3ETRB 2VFSA 4PVJA 3VTEA 1ZXIC 2WS3B 2I2YA 3IT6B 3FW8A 2R8DA 1W1RA 1CJEA 1D5ZC 1HXYD 4KKJA 4EE2A 2RK5A 3FAHA 3A7AA 1SJED 2KWDA 2VZKD 3IXSA 1IBXA 1DGJA 1V1PB 5AWVA 4OZAA 4O95A 2H89B 5AUKA 3EGRA 1XO3A 3U7ZA 4ZYSA 1ROEA 1I4QA 4AQ7A 1V97A 1N62C 3NVVA 2AQ1B 1AYFA 4DXGA 4ML8A 4MT5A 2WQYB 1W1LA 1J7AA 4JAYA 1SE3A 5LNK1 1XXGA 1CZPA 2IGGA 3P42A 2QPMA 3W8ZA 1MHXA 1QILA 1QT9A 1D6EC 3NS1B 1V1OA 2RMMA 1AHVA 1SF0A 4XWTA 3NVYB 1FM0D 3MFGA 4HKZE 4A8XC 2PW9A 1QLBB 4CQNA 2JQRB 1XLNA 3FILA 1MBTA 2P4PA 3RJAA 3SR6B 1RYJA 3POPA 2Y3AA 1WSPA 4A9AA 3PO0A 3ETRA 1YMHE 5FXPA 5AUIA 3NRZA 1TS4A 1ENFA 1T6BX 2ICIA 1L4DB 2BYTA 1N5WA 1XLQA 3KQ4A 1P7EA 4REZA 3AV8A 4YSYB 3A7UA 4O1NA 1N5WC 2M19A 1XLOA 2LGIA 3EUB3 5BYSA 1FIQB 1JMLA 2SAKA 1NVID 2AQ3B 1JWMD 1SIJA 2WXHA 5MPOA 5FXFA 1K53A 2EELA 4JE3B 2P13A 1QKZA 1QOBA 3KWVA 4N58A 1FCLA 1AHZA 3GB1A 3VRBB 2VAOA 1VZ8A 3AEBB 3TSSA 4RF1A 1JRPA 3SFEB 4JWSC 1E0ZA 3GP7A 3TUOA 4MH8A 4A90A 4GLSC 2YVSA 4HG0A 2K0PA 3AE6B 5D3DA 3V3XA 4PZFA 2EKIA 1ZE3D 2I0KA 4P16A 3URYA 3EUB2 1P7FA 1XF5L 1Q10A 4MLAA 1ACCA 3R2TA 4PWBA 3AE2B 3NVZA 1NYQA 3JS8A 4DNSA 4BC9A 3SFDB 3UI3A 1JQ4A 4XE0A 4ARCA 4NJCA 3I57A 3TEYA 3S1DA 3Q69A 5C3JB 1B1ZA 3IAM1 3LYYA 2IJ0A 1X2GA 3P1MA 5D79A 1PGXA 1L5PA 4XLOA 2N9KA 4HROA 5HG2A 5AE1A 1X2HA 2B76B 2PVOD 1VJKA 2XN9C 1MPEA 1RWSA 2WDQB 4HRSA 3DEDA 2FE8A 1SE2A 2NTTA 3FW7A 4IDIA 1YJIA 1YJJA 1UXYA 4JB1A 1HA5A 1MI0A 2Y08A 3U4EG 1TY2A 3BVZA 1AN8A 1NI3A 5EE1A 1M4VA 3BVMA 3WCQA 4YSXB 4ZOHC 3P4PB 3AH7A 1MHHE 2KN4A 1FCCC 1HSKA 1F77A 1IUEA 2BT6A 5G5HB 1TS2A 2ONQA 1RM6C 1JWSD 3NVWB 2D5GA 2NQWA 1V8CA 1FNWA 1FXAA 1XCQL 2PLIA 3DWMA 2HTME 1F2RI 1QOAA 1AW7A 4ZRPA 1QOFA 1B9RA 2GI9A 1YN5A 2INPE 2WXKA 1GOZA 1PGBA 2WNMA 1CK1A 4ZHPA 2G1EA 2W3SA 2NTSA 2R61A 1OQQA 2BB5A 4J3OD 2V3NA 1E9MA 2ZW0A 2CJNA 2KDMA 4OALA 2KAJA 4UD8A 3AEEB 1E8HA 2WXRA 1WGKA 4C7ZA 2JU6X 2Q85A 2MBRA 3ZJUA 5TSSA 2JXTA 3KWLA 3W8XA 3HSUA 4JX1C 2OHFA 3IAS1 4HKQA 1KH0A 5I4DA 3ABVB 3E56A 5BMIA 2W82A 4Q2JA 2K3UA 1SBBB 4RGMA 2JYEA 1JWBD 1CQVA 3W1SA 1QF6A 1C4CA 1KFYB 2IDYA 3TEXA 1KLGD 4GDLB 4H2AA 2BBCA 1NEKB 4P6VF 2GQUA 2PKOA 5D3IB 2V3PA 4NAWB 4RGOS 1J7CA 1DIQA 2KACA 2N0SB 2ZW1A 1FXIA 2FBWB 1JALA 4B0MA 2J52A 1W1OA 3S1CA 4OHJA 3AEFB 3AE3B 2LHEA 3PZ8A 4NAMA 1KLUD 2YEPF 3FWAA 2L1AA 1F0XA 1QQRA 4N6EB 3AE1B 2W55A 2GB1A 2I38A 3GSYA 3Q8BA 4TSSA 1TKEA 1LO5D 1TKGA 2Q4WA 4XDCA 1GAQB 3EA6A 1T5XD 1WXQA 3BYTB 1FEHA 4RNAA 4YTPB 1ZP0B 4L1BA 1YN4A 3DWGC 2VFUA 2PMVA 1EWCA 2LMCA 2QJLA 4XWWA 1PUTA 1N61A 2JX5A 5EE0A 4R3DA 3MC0B 1HZ5A 3R2IA 1V1PA 3W5VB 2J4XA 3I99A 1ET6A 3P4SB 1FO4A 4KGRA 1F2RC 1N61C 5E6JA 3BZDB 2WDRB 1C79A 4C80A 1TS5A 4JPSA 1I4HA 1W1JA 2BVHA 3BVGA 2UUVA 4WH4A 1VRAB 3NZ3A 2RDGA 1SB3B 3DQ0A 2WDWA 1MVKA 1FD6A 2ACZB 3HRDD 4TVYA 5G5GB 2JSVX 1DOYA 3NS1A 2BS4B 5I1WA 4L2YA 3KLSX 1HZ6A 4LLGM 3VR8B 5AE3A 3PZ7A 3BK2A 3A7RA 2BW2A 3D2HA 3NVYA 2OEDA 2QEJC 4OVZA 2WDVB 2E5AA 2QILA 3BW7A 2AQ2B 2WXNA 2VFTA 1K50A 3SR6A 1STEA 2L52A 5H8YE 3W8WA 1YQ3B 1K51A 1FNVA 1W1QA 3P4RB 1QLUA 4WIPA 1YQ4B 1VDVA 4YTMB 4OW0A 3AEDB 3C8YA 2WU5B 4EC3A 1WYGA 1ET9A 1KTKA 1FMAD 5HHDG 4JWUC 2KQ4X 2Y4GA 3MJ5A 4DQOC 5FR3A 1FIQA 1C4AA 3J9CA 3Q8CA 4MM3B 2DWQA 4TVWA 2JZPA 1D5MC 1KRHA 1I4PA 1JCKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD B;  1N60 A;  4WWM A;  1E10 A;  3D2J A;  3LXF A;  5EE3 A;  1N60 C;  4USA A;  1EWY C;  1JWA D;  2GQT A;  2MJE A;  4BC7 A;  3AEG B;  5G5G A;  3LLB A;  1FFU A;  1DII A;  3PM9 A;  1E6E B;  1UWM A;  5AE2 A;  2EXR A;  3VRA B;  3B9J B;  2KMM A;  3B2F A;  3NVV B;  1OFF A;  3AM9 A;  5ADZ A;  3L4P A;  4N59 A;  3FC4 A;  2OAI A;  1DOX A;  2W3R A;  1E0Y A;  5HMR A;  2BS3 B;  3HRD C;  3S1F A;  1TJE A;  1W1M A;  5HQX A;  1E8G A;  3TSH A;  1QLT A;  2LEK A;  3B2G A;  1KF6 B;  1TYG B;  1FFV A;  1FRR A;  5H92 C;  3AE4 B;  1ZXI A;  1A70 A;  2PVG C;  2MJD A;  2WLB A;  3AEA B;  1FFV C;  3NRZ B;  3TSJ A;  4US8 A;  2MJ3 A;  4FXC A;  4PWC A;  1DOI A;  2QIE B;  2BVF A;  5G5H A;  1DZN A;  1N62 A;  3NVW A;  3D2D A;  2AX5 A;  3B9J A;  2K22 A;  1WRI A;  1NEN B;  2CU3 A;  3ZYY X;  4BBY A;  1ZUD 2;  1L0V B;  5EE9 A;  4ZHO A;  3LB8 C;  1VQZ A;  4PYT A;  5C2T B;  1I19 A;  4PVE A;  1TKY A;  1JRO A;  1RFK A;  1W1S A;  2WU2 B;  1N63 A;  3P63 A;  2MH7 A;  3KJM A;  4C7Y A;  3NVZ B;  1PFD A;  3AMZ A;  3VR9 B;  2P3H A;  1N63 C;  4ITK A;  1WVE A;  1L6U A;  3BII D;  1OQR A;  3AEC B;  1FRD A;  4YTN B;  3R07 C;  3CIR B;  2K9X A;  2PLS A;  3W9C B;  2L83 A;  3AE8 B;  3AN1 A;  5FXE A;  1ZOY B;  1MBB A;  1I7H A;  3CWI A;  4ZOH B;  5GXG B;  1WWT A;  4US9 A;  1JW9 D;  1E8F A;  1RM6 B;  3S1E A;  3HUI A;  3AE5 B;  2H88 B;  1VAO A;  1E7P B;  5HHZ A;  1J7B A;  4WQM A;  3FW9 A;  1N5X A;  1W1K A;  2O3G A;  4KX6 B;  1AWD A;  3AB5 A;  2Q5W D;  3HVZ A;  4PVK A;  2BS2 B;  2PIA A;  2BVG A;  2WP9 B;  3RPF C;  2VFR A;  2QKN A;  2R2Z A;  2VFV A;  4BCA A;  2Y5C A;  3C0P A;  1R7S A;  4YT0 B;  2K5P A;  2W54 A;  1SB3 C;  1VLB A;  1PDX A;  1FFU C;  3LAE A;  2E3T A;  3AE9 B;  2CJO A;  4YSZ B;  1WVF A;  2AXR A;  5FXD A;  1F0Z A;  3AE7 B;  3P4Q B;  3W5U B;  3TX1 A;  1NYR A;  1ZR6 A;  1T3Q A;  1XLP A;  4LTU A;  1GPX A;  1AHU A;  4PVH A;  1L6V A;  2M56 B;  1T3Q C;  2DBY A;  1QOG A;  3ETR B;  2VFS A;  4PVJ A;  3VTE A;  1ZXI C;  2WS3 B;  3FW8 A;  2R8D A;  1W1R A;  1CJE A;  2RK5 A;  3FAH A;  3A7A A;  1DGJ A;  4O95 A;  2H89 B;  5AUK A;  1XO3 A;  1ROE A;  1N62 C;  1V97 A;  3NVV A;  1AYF A;  4ML8 A;  2WQY B;  1W1L A;  1J7A A;  4JAY A;  1CZP A;  2QPM A;  3W8Z A;  1QT9 A;  3NS1 B;  1AHV A;  1SF0 A;  3NVY B;  1FM0 D;  1MBT A;  1QLB B;  2P4P A;  2JQR B;  1XLN A;  3SR6 B;  1RYJ A;  4A9A A;  3PO0 A;  3ETR A;  5FXP A;  5AUI A;  3NRZ A;  1N5W A;  1XLQ A;  3AV8 A;  4YSY B;  3A7U A;  1N5W C;  2M19 A;  1XLO A;  3EUB 3;  1FIQ B;  1NVI D;  1SIJ A;  2P13 A;  5MPO A;  5FXF A;  1QOB A;  4N58 A;  1AHZ A;  3VRB B;  2VAO A;  3AEB B;  3SFE B;  1JRP A;  4JWS C;  1E0Z A;  2YVS A;  4HG0 A;  3AE6 B;  4PZF A;  2EKI A;  2I0K A;  3EUB 2;  4MLA A;  4PWB A;  3AE2 B;  3NVZ A;  1NYQ A;  3JS8 A;  4DNS A;  4BC9 A;  3SFD B;  1JQ4 A;  3S1D A;  5C3J B;  1X2G A;  3P1M A;  5D79 A;  1L5P A;  4XLO A;  4HRO A;  5AE1 A;  1X2H A;  2B76 B;  2PVO D;  1VJK A;  2WDQ B;  1RWS A;  4HRS A;  3DED A;  3FW7 A;  4IDI A;  1YJI A;  1YJJ A;  1UXY A;  4JB1 A;  1NI3 A;  5EE1 A;  3WCQ A;  4YSX B;  4ZOH C;  3P4P B;  3AH7 A;  1HSK A;  1IUE A;  2BT6 A;  5G5H B;  1RM6 C;  3NVW B;  2NQW A;  1V8C A;  1FXA A;  2PLI A;  3DWM A;  2HTM E;  1QOA A;  1QOF A;  1B9R A;  4ZHP A;  2G1E A;  2W3S A;  1OQQ A;  4OAL A;  1E9M A;  4UD8 A;  2CJN A;  2KAJ A;  3AEE B;  1E8H A;  1WGK A;  4C7Z A;  2Q85 A;  2MBR A;  3KWL A;  3W8X A;  4JX1 C;  2OHF A;  3ABV B;  1JWB D;  1QF6 A;  1KFY B;  1NEK B;  4P6V F;  2GQU A;  2PKO A;  1J7C A;  1DIQ A;  2N0S B;  1FXI A;  2FBW B;  1JAL A;  1W1O A;  3S1C A;  3AEF B;  3AE3 B;  3FWA A;  1F0X A;  4N6E B;  3AE1 B;  2W55 A;  3GSY A;  1TKE A;  1TKG A;  2Q4W A;  1GAQ B;  1WXQ A;  4YTP B;  1ZP0 B;  3DWG C;  2VFU A;  2QJL A;  1PUT A;  1N61 A;  2JX5 A;  5EE0 A;  3W5V B;  3I99 A;  3P4S B;  1N61 C;  1FO4 A;  2WDR B;  4C80 A;  1W1J A;  2BVH A;  1SB3 B;  3DQ0 A;  2ACZ B;  3HRD D;  4TVY A;  5G5G B;  1DOY A;  3NS1 A;  2BS4 B;  5AE3 A;  3VR8 B;  3A7R A;  3D2H A;  3NVY A;  2WDV B;  2E5A A;  3BW7 A;  2VFT A;  3SR6 A;  2L52 A;  5H8Y E;  3W8W A;  1YQ3 B;  1W1Q A;  3P4R B;  1QLU A;  1YQ4 B;  1VDV A;  4YTM B;  3AED B;  2WU5 B;  4EC3 A;  1WYG A;  1FMA D;  4JWU C;  1FIQ A;  2DWQ A;  4TVW A;  1KRH A; 
#chains in the Genus database with same CATH topology
 1E10 A;  3BJS A;  5BMG A;  1R6W A;  5IIK A;  2M9N A;  1KKX A;  2NVK X;  3U26 A;  1RQL A;  3RJJ A;  2C2D A;  1EU4 A;  1ZKQ A;  5FK9 C;  4M01 A;  2LM4 A;  1EWY C;  2R8J A;  1JWA D;  1WJ4 A;  5EDS A;  3PW0 A;  4C8L A;  2LVO A;  3N6J A;  4K7Z A;  3QC8 B;  4K7S A;  4J1O A;  2ZZ0 A;  5G5G A;  2EZY A;  4ZRQ A;  3NRW A;  3PM9 A;  4ROP A;  4NM2 A;  3IC9 A;  3CMM B;  4NLZ A;  2EXR A;  1OJT A;  2XGZ A;  3IV6 A;  4Y2Y A;  2Z8L A;  3B2F A;  4K3B A;  2GGG A;  2KAN A;  3VH4 B;  3DK8 A;  1RYR A;  4YWG G;  3AM9 A;  5AI5 A;  4ADW A;  1XSL A;  4YVZ A;  2BDU A;  4BXO B;  1UEL A;  2DEN B;  4H4R A;  3BSM A;  1QQ7 A;  1L8P A;  2GR3 A;  1DXS A;  4BAX A;  1DOX A;  2W3R A;  1JRU A;  1NKB A;  3ZNG C;  2CN1 A;  4PGX A;  3Q8P B;  4F4W A;  1E0Y A;  2WXP A;  3VFK A;  3MHS D;  4PYZ A;  4F4X A;  1E8Y A;  1NPX A;  1SV4 A;  2QAR A;  1S3S G;  5HQX A;  4EMJ A;  2EMS A;  4A3P A;  5FKA C;  5KFF A;  3OHB A;  4MJS A;  2V3A A;  5AKG A;  4IHC A;  2I5H A;  3RRH A;  2KHW B;  1XSN A;  1NK5 A;  3TAN A;  2LJI A;  4HEA 1;  1T94 A;  1KF6 B;  1FFV A;  2XY6 A;  2MSN A;  1TKD A;  1TYG B;  4DXA B;  2OQY A;  2WPF A;  3DGH A;  3U2S C;  4BUR A;  1A70 A;  3N4M B;  3QE9 Y;  4A8E A;  2MJD A;  4DO9 A;  1SE4 A;  2WLB A;  4DSL A;  4ANX A;  4US8 A;  1UGJ A;  1MOK A;  5FJR A;  3MR3 A;  3UQB A;  2YVG A;  5AM4 A;  4FFD A;  3T3N A;  4B9K A;  1TT5 B;  4ECQ A;  2I1J A;  3PVX A;  5J8Y C;  9ICS A;  1DOI A;  4IR9 A;  4C8O A;  1B22 A;  3LJ3 A;  4J03 A;  4AWJ A;  3EEZ A;  3PHW B;  4M8N A;  4W9F A;  3NVW A;  3D2D A;  3QU4 A;  3UJR A;  3V62 A;  3I1Y A;  3B9J A;  5J0O A;  2E8M A;  2E1F A;  2N9L A;  5LLI A;  3KZX A;  3TAD A;  4UAR A;  3GOE A;  2KFZ A;  1ZUD 2;  5JCK A;  9ICJ A;  1IGC A;  3DVN V;  1L0Y B;  4B9V A;  2CR5 A;  1NK4 A;  9ICX A;  4C8M A;  3T9L A;  3R8B A;  2FPK A;  4MF2 A;  3FJ4 A;  3ZLG A;  4E5T A;  1JN3 A;  4G50 A;  4W9I A;  5L1K A;  4O5C A;  3N30 A;  5C2T B;  2UVR A;  5KFO A;  8ICT A;  2Q4T A;  3CRX A;  5CTR C;  2EQ8 A;  8ICE A;  3GZF A;  1WGH A;  2G45 B;  1URJ A;  3QZ7 A;  1OW5 A;  1MSW D;  1YN3 A;  4GMV A;  1XPY A;  4C56 C;  3GDX A;  2D10 A;  4PS8 A;  3D32 A;  3ZDD A;  5J0Y A;  1EBD A;  2A19 A;  4EZ6 A;  1PFD A;  1ZD4 A;  3VR9 B;  4RGN A;  2P3H A;  3OHA A;  2Y5P A;  3AXC A;  3Q8L A;  1LB2 B;  3V6K A;  4TUS A;  1WVE A;  3GQC A;  3SMV A;  3BII D;  3JPT A;  5DG7 A;  8ICZ A;  3HIZ A;  4KKI A;  3AEC B;  1FRD A;  4CF3 A;  3ONN A;  5HFY A;  1E90 A;  5KG0 A;  2VAN A;  4DS5 A;  2XY7 A;  5AKZ A;  5B5E U;  2BCQ A;  1LKY B;  2K9X A;  2Y1I A;  4A35 A;  2KN5 A;  3DG3 A;  5KG7 A;  3AE8 B;  2QKQ A;  1P7D A;  3C1Z A;  4UAV A;  4KLL A;  4HPL B;  5TR5 A;  4X2P A;  1AOG A;  5AEK B;  1UUP A;  1ZOY B;  1XSP A;  3PSI A;  2INN E;  1R0M A;  4RQN A;  4O3Q A;  1Y8R C;  2FLP A;  4KT2 A;  5BOF A;  1Z1V A;  4P0P B;  2AGQ A;  4XZ4 A;  2XVT A;  1E8F A;  4Y2V A;  2K8C A;  4KGT A;  5KFA A;  2KV2 A;  5CR0 A;  1RM6 B;  1BGX T;  4BJQ A;  1L3T A;  2KDB A;  4M0W A;  3OW1 A;  4GR1 A;  1MQ2 A;  3IT4 B;  1J7B A;  1J97 A;  4RNN A;  1NDA A;  4PL1 A;  4AP4 C;  1LQB A;  3GE3 C;  5D94 A;  4G8T A;  5U25 A;  1ESF A;  2G5I B;  3PGE A;  4RPZ A;  4MSM B;  1SWV A;  3L3F X;  1ZQH A;  4BWM A;  4KGS A;  2KN7 A;  3ML9 A;  3SHQ A;  3N7R C;  2P88 A;  2OOB B;  4PVK A;  2MUT B;  2P3Z A;  4XDD A;  3D2N A;  2NVU I;  3M95 A;  2SEB D;  4KX3 A;  5E6N A;  3D9X A;  1D9F A;  4UB4 A;  2HVI A;  5ALD A;  5BYR A;  4G3X B;  2D6F C;  4QZA A;  5J0W A;  3PR5 B;  1R7S A;  2OX4 A;  4KZ0 A;  1ZY8 A;  2K5P A;  3ZDC A;  2W54 A;  3NFU A;  4FJY A;  4GXI A;  2JT4 B;  1BT0 A;  2IYD B;  3PHX B;  3PZP A;  2NBU A;  4RH6 A;  3TEZ A;  2HOI A;  3DBH B;  3LAE A;  4I2A A;  3ZXV A;  2DYO A;  2QB0 B;  1F0Z A;  4O3O A;  1PYW D;  3Q8A A;  4B9M A;  3DGB A;  3T3O A;  4F2S A;  1I4G A;  1ZQK A;  1NK8 A;  1DGS A;  3RUI B;  1ONE A;  3FXG A;  3K4G A;  7ICI A;  1GC6 A;  4FE3 A;  3M62 B;  4EZJ A;  2WOW A;  3KHL A;  4O3S A;  3DVN U;  1GPX A;  2PU0 A;  3UXP A;  2G9H D;  7ICO A;  1BML C;  1PK3 A;  2G07 A;  2OYY A;  5D46 A;  2KMD A;  3EAN A;  2QVH A;  4DL4 A;  4M8M A;  1QOG A;  5KFK A;  2WXO A;  3RFZ B;  3ETR B;  1HIW A;  4YMM A;  4J9L A;  4ECY A;  3L13 A;  3HP6 A;  5GTH U;  2DW7 A;  4KV2 A;  3VTU A;  1NI2 A;  2KJR A;  3IHP C;  3MC1 A;  5ALM A;  3IT6 B;  1WCN A;  3PFR A;  2R8D A;  4EE2 A;  2RK5 A;  1X66 A;  5AM5 A;  4KKJ A;  4PGQ A;  1ZQA A;  2KSO B;  2KWD A;  1IBX A;  5KFX A;  3CNH A;  4ECZ A;  1OEP A;  1BPY A;  2PXI A;  4KMO B;  4O95 A;  4EEW A;  3EGR A;  4NLC A;  1XO3 A;  2Z59 B;  3BQ7 A;  2ZUB A;  4DQS A;  1I4Q A;  2JMG A;  1IXR A;  3NVV A;  4IL6 U;  2IO3 B;  3L8K A;  1TZ1 A;  4DXG A;  1ZQF A;  3RNA C;  3RNB C;  1W1L A;  4JAY A;  2MA9 B;  3EJD B;  1U4A A;  2W9C B;  1NEL A;  3TAD C;  2R8G A;  1MDL A;  4F50 A;  5AIC A;  4HCH A;  2BCP A;  8ICR A;  4IWQ A;  2IGG A;  3P42 A;  2BPG A;  1MHX A;  2A1J A;  1QIL A;  1ZQD A;  4C8K A;  4RQ5 A;  3RJE A;  1FM0 D;  2KNJ A;  2XIC A;  2OZT A;  3GC2 A;  4CQN A;  2P4P A;  3FIL A;  2LXA A;  2N4F A;  4Y2X A;  2R8K A;  3AU6 A;  4II2 B;  1SXD A;  2WFA A;  3Q3O C;  5FXP A;  4DL7 A;  3NRZ A;  3UM9 A;  1L4D B;  4M6W A;  2KVZ A;  3KQ4 A;  5FP0 A;  3ZIM A;  4UB5 A;  3VDZ A;  1Y88 A;  4REZ A;  3AV8 A;  1XO0 A;  2XK5 A;  5ALR A;  2MBQ A;  3UQ0 A;  1XLO A;  2WX1 A;  2J7Q B;  1JML A;  5FJP A;  3HIL A;  2HMX A;  2Y5B B;  1CMX B;  3L54 A;  4W9K A;  4EEL A;  1SIJ A;  4R63 A;  3OLM D;  5FXF A;  5KFB A;  2EEL A;  4JE3 B;  4PGY A;  3W1Y A;  5KVH A;  3KWV A;  8ICM A;  2K4P A;  4GRT A;  1ECW A;  1E5W A;  5J0T A;  3VRB B;  4DHZ E;  3PX4 A;  1VZ8 A;  4J57 A;  2GR0 A;  2JEG A;  1P3Q U;  3TSS A;  2P0I A;  1JRP A;  4CF4 A;  3ALR A;  3GZN B;  2EDU A;  3OTQ A;  1NKC A;  3VDG A;  2PTX A;  3GP7 A;  2K8A A;  3KBB A;  3DBL B;  4YP3 A;  1P98 A;  2K0P A;  5ALN A;  3V3X A;  4PZF A;  2KWU B;  3Q6J A;  5F9N A;  1ZE3 D;  3FG2 P;  1IP9 A;  2KIW A;  1TE6 A;  1P9D U;  2ZCC A;  4MLA A;  2KIV A;  1NZB A;  4PWB A;  1L7P A;  4DDI D;  3N20 C;  3NVZ A;  2KTR A;  2EAN A;  5DBA A;  4OD0 A;  4G7F A;  4YFK A;  8ICP A;  5KFM A;  3SFD B;  1U9L A;  3TAR A;  3RNE C;  1JQ4 A;  4NJC A;  3I57 A;  2NRX A;  5C3J B;  3GV8 B;  1V85 A;  2HJ1 A;  3QK0 A;  5KFY A;  1U47 A;  1BPX A;  3CF6 E;  1X2G A;  3P1M A;  1TFR A;  5KFH A;  1PGX A;  1SL0 A;  2RDI A;  2VA2 A;  2N9K A;  2JK6 A;  4FZM A;  2K6Q A;  3H8S A;  4F92 B;  2LI6 A;  2B76 B;  4DOB A;  2PVO D;  1X2H A;  3SQS A;  4I2I A;  2WP5 A;  1MPE A;  5ALT A;  2WDQ B;  2F2A B;  5HMM A;  1BPD A;  3WK7 A;  2NTT A;  1SL2 A;  3ECI A;  4PYU A;  1KFT A;  2FI1 A;  1HA5 A;  5J04 A;  3AUO A;  2GR1 A;  2WAQ C;  3RJA A;  4ZH4 A;  1NNL A;  3I76 A;  2LD9 A;  1WM2 A;  4FBT A;  5AK4 A;  1UZX B;  5FR6 A;  2BZF A;  4OJO A;  3A4R A;  4DHZ B;  5AIA A;  1FCC C;  3A1Q A;  2KJ8 A;  4WWP A;  2BT6 A;  2AHO B;  3JPQ A;  2XID A;  5AKK A;  2CKH B;  1F44 A;  1FNW A;  1FXA A;  1XCQ L;  3APD A;  4DQP A;  5IP4 D;  2HTM E;  2W9B A;  3RH6 A;  4IT1 A;  2REX A;  4ZRP A;  2P6R A;  2HVH A;  2KHV A;  1Q3V A;  4F4K A;  5JCM A;  2ZAD A;  1S97 A;  2KG5 A;  1HUO A;  3GO2 A;  3DK9 A;  2BF8 B;  1VD2 A;  2NTS A;  3OAW A;  1V81 A;  2L8J A;  2ZW0 A;  1CUK A;  4OAL A;  4H4S A;  3NUQ A;  2KAJ A;  3ZTC A;  4DSF A;  2J0J A;  1Q5W B;  2OXO A;  2ZIU B;  1ZDL A;  3OGU A;  4Z6D A;  2JXT A;  1A0P A;  5AKX A;  1R4M I;  1A77 A;  4G0N B;  1QTM A;  2KZR A;  4NL9 C;  4HKQ A;  4AUQ C;  1KH0 A;  3H4K A;  2M4N A;  4I2D A;  3Q45 A;  3QPE A;  5BMI A;  4BX9 C;  4Q2J A;  1VCB A;  3RO6 A;  4RGM A;  2ISP A;  2JYE A;  4IM3 A;  3W1S A;  4P0Q A;  1C4C A;  4IR1 A;  3TEX A;  1J8C A;  3RF9 A;  1BQG A;  2YML A;  3H7I A;  2G09 A;  4H2A A;  2AL2 A;  5GMV A;  1NEK B;  1ZET A;  8ICF A;  4F4Z A;  2PKO A;  2KJ5 A;  4MEL A;  2AEH A;  1M94 A;  4CCH A;  2V3P A;  4KZC A;  4NAW B;  4RGO S;  4UBC A;  4Q8F A;  5FS7 A;  2KAC A;  2ZW1 A;  3M9M B;  5ALL A;  2WB1 F;  4QWE A;  4CHK A;  4IL2 A;  2MLB A;  2NPT B;  2ZVO A;  4Q45 A;  4ICU A;  1KLU D;  3SBF A;  5JH5 C;  2ZTE A;  3PSE B;  2KVC A;  5H2F U;  2BKR B;  1DK3 A;  2YEP F;  3WAM A;  4YXM A;  2JXX A;  1QQR A;  2CPR A;  1PUZ A;  2W55 A;  1BPB A;  9ICH A;  9ICQ A;  1HE8 A;  2ZNV B;  3PTF C;  3QU2 A;  3RNF C;  3IP4 B;  4RQ6 A;  3WK8 A;  4DL6 A;  3DV9 A;  4I2B A;  1D8L A;  1TKG A;  2QJJ A;  1WMH B;  3CYM A;  2EAM A;  2VA8 A;  1T5X D;  2PE6 B;  4RNA A;  2KXJ A;  2KJ6 A;  3PMN A;  1K5O A;  1YN4 A;  4GC6 A;  1WUE A;  5KT7 A;  1WUD A;  2QAE A;  4K2S A;  5DPW A;  3QLD A;  5C5J A;  3KW5 B;  2V1Y A;  2PU1 A;  2AXT U;  2C3C A;  1RDF A;  1PUT A;  3SZ2 A;  2LVP A;  5EE0 A;  4G3I A;  2HOF A;  5AKH A;  3B08 A;  1F9C A;  3R2I A;  1HZ5 A;  1U48 A;  5LXH A;  1D7Y A;  3C2L A;  5F3X B;  2ZIV A;  2KP7 A;  3M9N B;  2BCV A;  4KGR A;  4F5R A;  1Q1O A;  1F2R C;  1N61 C;  5E6J A;  1EO6 A;  3PRP B;  5EWE A;  4EUT A;  3QUC A;  1SKR A;  2LRU A;  4HLE A;  4KTQ A;  5L1M A;  1F5S A;  1E8Z A;  3NJT A;  2BVH A;  4EM3 A;  2D3G A;  4DL3 A;  4P2H A;  1Z00 B;  1ZQI A;  4F3O A;  1LFD A;  1VRA B;  1HEK A;  4LZD A;  2RDG A;  4ANW A;  1ZQW A;  1SB3 B;  2LI5 A;  3OTR A;  4TQS A;  2C60 A;  5KAI U;  1MVK A;  2X8X X;  5CEH A;  1XC9 A;  9ICE A;  2BPC A;  1ARO P;  3FKY A;  2JSV X;  1DOY A;  1S76 D;  1ZQN A;  2HE7 A;  5FJO A;  3QEA Z;  3VUY A;  5I1W A;  1SJB A;  1TK8 A;  5AE3 A;  3VR8 B;  3PZ7 A;  4PL2 A;  1GEU A;  3F2B A;  2RPQ A;  3D2H A;  5AI8 A;  3IDW A;  3R10 A;  2WXN A;  2FPL A;  2VFT A;  3G6V A;  2PFO A;  2FMP A;  2R18 A;  1KL9 A;  1ZD2 P;  2BPF A;  3ZRF A;  3ZO5 B;  1RYU A;  4K4G A;  5TZV A;  8ICL A;  1PVQ A;  4Y2Q A;  3FYY A;  2W9M A;  3P4R B;  3RNC C;  2E5S A;  2OEH A;  1L8L A;  1C20 A;  4OW0 A;  3T8Q A;  1VJ5 A;  4W9D A;  1WYG A;  2LPE A;  3NY5 A;  4NEW A;  4NQL B;  3RCY A;  2KQ4 X;  4GLX A;  3RJF A;  4PJ0 U;  4YR3 A;  4DQO C;  3TBL D;  5AM1 A;  1UPH A;  1PZN A;  7ICF A;  1X1M A;  4QZB A;  4IQW A;  5DKW A;  2PMQ A;  5IIO A;  2Y1J A;  1JCK B;  8ICA A;  5FJU A;  5KFV A;  4AP9 A;  1KBU A;  2K4E A;  1WR6 E;  3ZQ4 A;  1TGZ B;  4WWO A;  2NQL A;  2BR0 A;  1V38 A;  3O13 A;  2O6K A;  2QSD A;  3UXN A;  9ICC A;  1C77 A;  1SSN A;  2MJE A;  3AEG B;  4BC7 A;  2I5Q A;  2WXM A;  3THV A;  2YMQ A;  4LNK A;  2KFK B;  3UQ2 A;  1UWM A;  3KFU F;  7ICU A;  3M9O B;  1DK2 A;  5AM2 A;  2J0K A;  2KMM A;  4DXF A;  5KG5 A;  4NPN A;  2LUM A;  1EU3 A;  2XEW A;  2KJH B;  4N59 A;  4J9S A;  1MG4 A;  3FC4 A;  2AKM A;  5K8E A;  4I6N B;  4MEM A;  3D2S A;  2V9H A;  3DCG A;  4XRH A;  3OJ3 A;  1SXT A;  1XCT L;  3RUL A;  3VQI A;  1WE6 A;  1GC7 A;  4DK5 A;  2W0H A;  4YMO A;  2F44 A;  1LVH A;  3Q6B A;  2HQM A;  4DLE A;  4TUP A;  2JEF A;  2BS3 B;  4EEY A;  2WGS A;  4DHJ D;  2YEP B;  3C29 A;  4I2G A;  1TJE A;  4M52 A;  2X38 A;  7ICS A;  5HR6 A;  9ICB A;  2KD1 A;  7ICR A;  2ASQ A;  3KVF B;  3ONS A;  2NO5 A;  2NV3 A;  1WFY A;  2LEK A;  5L6F A;  3WKC A;  1R4N I;  3MBY A;  3B97 A;  1TZO A;  3AE4 B;  4GIV A;  2ZZB A;  2FUG 1;  2PTZ A;  3TCA A;  3DDC B;  3NUH B;  4GGB A;  3W1S C;  4KLJ A;  4E6M A;  2H3Q A;  3N7S C;  4JWN A;  3WK4 A;  2LWP A;  2VJ5 A;  4LNN A;  5J8Y A;  8ICX A;  4BUG A;  4M9N A;  1RXV A;  7ICQ A;  2K25 A;  3HK0 A;  3EWA A;  2JVC A;  3UCC A;  3ENL A;  1DRG A;  2JPH A;  1DZN A;  4C8N A;  1ZQQ A;  4IW0 A;  2AGP A;  4F5O A;  4ECV A;  2AX5 A;  2DX5 B;  3Q8K A;  2JWZ A;  2CU1 A;  4FUL A;  5KT6 A;  2K22 A;  1A76 A;  2M0A A;  2AL6 A;  3A0B U;  2PTL A;  1C76 A;  1WRI A;  1JDF A;  4F4R A;  4BBY A;  5HP4 A;  2GGJ A;  1ZJN A;  4BXO A;  1D8B A;  4KN7 A;  1WG8 A;  8ICW A;  3HM6 X;  4KSK C;  1D3Z A;  5HI1 A;  2AL1 A;  2GOW A;  3H8W A;  4Z6E A;  1FXT B;  4Y2T A;  5J2F A;  1T0R C;  1V2Y A;  5KTQ A;  4ELT A;  1NDD A;  3TJP A;  1X40 A;  4J9M A;  2Y3R A;  2NRZ A;  1I19 A;  1A6S A;  4PVE A;  3G6Y A;  4GU2 A;  1JWU D;  3VC5 A;  3VXW A;  1MBT A;  4ECS A;  1KRP A;  2RDB C;  3IFW B;  5BMH A;  1UBI A;  4E4U A;  4MFA A;  3BDP A;  3C21 A;  9ICR A;  1TKK A;  3T79 A;  5I1V A;  5J2G A;  1NK6 A;  3PY8 A;  3AMZ A;  4KLH A;  4GDL A;  3UIO B;  3VCN A;  4NV0 A;  4KLG A;  4CYE A;  2C2R A;  3OC4 A;  2JUO A;  2UYZ B;  2HHT A;  2K60 A;  1F52 A;  3F2D A;  2MWS B;  1DNC A;  2N1W A;  5ALE A;  3H0R B;  2PLP A;  3QQ8 B;  2WXI A;  2R2O A;  3BK1 A;  3Q3J A;  3U52 E;  3V5C A;  4NWI A;  5B66 U;  4YTN B;  1MUC A;  2OWO A;  4I2E A;  5J2K A;  1M6Y A;  3Q8F A;  2NMQ A;  2F1H A;  4UAU A;  4JDR A;  2PLS A;  2BWE S;  1I4R A;  1ZDX A;  4GME A;  2LM1 A;  2DKZ A;  3AEV A;  5ALI A;  4DQI A;  3CWI A;  3BWU D;  4JGH B;  4WUR A;  4ZOH B;  3R66 C;  1XHC A;  5AIB A;  4MGY E;  2FKP A;  4HJK A;  1WWT A;  4US9 A;  5J29 A;  2HHW A;  2E6X A;  4JUZ A;  3Q4D A;  4W9J A;  3VH3 B;  5JRB A;  5E6P A;  3LDZ E;  2C28 A;  3DH9 A;  3F2C A;  2DLB A;  2LYH A;  4RGT A;  3S1E A;  1RXW A;  3TCS A;  3MAB A;  2FNJ B;  1E7P B;  1KOT A;  5HHZ A;  2WHI A;  2K8H A;  4WAA A;  5JU5 A;  5KFP A;  2X8G A;  1ZD5 A;  4EX6 A;  2HTH A;  1KD0 A;  5CHW A;  2O6V B;  2C5L C;  2YQE A;  2HHU A;  1AWD A;  2JZZ A;  2OZ3 A;  2F77 X;  5KT3 A;  3WKA A;  3HVZ A;  7ICL A;  1IGD A;  1WX7 A;  3APF A;  4GGH A;  2BS2 B;  2EMT A;  3PSP A;  2BVG A;  3UCD A;  3VCB A;  2WP9 B;  3RPF C;  4BGD A;  1X9W A;  3M6K A;  1ZPS A;  5KHQ A;  3HPF A;  5AK3 A;  1WJN A;  4K81 A;  3TFR A;  1KN0 A;  3QWZ B;  3RFA A;  3LWL A;  2IOH A;  2IND C;  5T8I A;  4BCA A;  3JW7 A;  4IG7 B;  3T4W A;  4WQO B;  4RCO A;  4MGG A;  1TY0 A;  2PEA A;  4YT0 B;  2C2E A;  2KYW A;  5DBB A;  2DQN B;  4Z6C A;  4GDK B;  4GOC A;  3ZD9 A;  1LKY A;  4KLI A;  4PZN A;  5KG6 A;  1GUA B;  4J56 A;  4EQX A;  2QMT A;  2RDH A;  4F72 A;  2ZXH A;  3AE9 B;  3SEB A;  2EQ6 A;  3UQA A;  1FEZ A;  2HBK A;  2ZEQ A;  4AS1 A;  2QJN A;  4QZ9 A;  1LVL A;  1GB4 A;  2K8B B;  1ZQP A;  1HQR D;  4P0P A;  3L0W B;  3LYS A;  2E8P A;  4DFP A;  2GLE A;  4DQR A;  4ECU A;  5EBK A;  1QH9 A;  5KFR A;  3ES7 A;  3RJ8 A;  4QZE A;  1WM3 A;  4PVH A;  5FMH A;  2EAP A;  2M56 B;  2WXG A;  1H38 A;  3B0Y A;  3PRE A;  4B9N A;  1T3Q C;  1JOA A;  2GO7 A;  3EJB B;  2K4H A;  3FM9 A;  4XYC A;  1BUI C;  3WK6 A;  3V6H A;  4DX3 A;  1S0M A;  3KKA A;  2YVF A;  1PVR A;  2ZIX B;  4UW9 A;  1C1Y B;  4FZL A;  1K1S A;  4PVJ A;  2AL3 A;  1S7M A;  4NNJ B;  3VTE A;  4Z17 A;  1DTN A;  2ZC8 A;  1W1R A;  4FDC B;  2G08 A;  5D49 A;  4K7W A;  3ZXR A;  3KLJ A;  2PGE A;  4RUC A;  1L7O A;  2X50 A;  1WX8 A;  4JQW C;  8ICS A;  2XCA A;  5AWV A;  1QCK A;  3BS7 A;  2YY6 A;  1E8X A;  2DNF A;  5AUK A;  3U7Z A;  4HYK A;  4U7C A;  1GRE A;  5GTI U;  2LYB A;  4HAI A;  5T14 A;  3OJS A;  2L05 A;  4KIK B;  3QNM A;  4IRC A;  3OSN A;  3P2B A;  4QZF A;  4W9E A;  4GSW A;  1J7A A;  2VRR B;  3ENE A;  4FN2 A;  4HCP B;  5G55 A;  3MUC A;  2QB0 A;  4AYB C;  3DBR I;  1CZP A;  4ZCW A;  4NY8 A;  3Q3N C;  4EZL A;  3W8Z A;  5DLG A;  2NRT A;  2MRP A;  2WPE A;  1XS9 D;  1SF0 A;  3NHE B;  1WH3 A;  1TYP A;  2NO4 A;  3H9D A;  3AQE A;  5JHA A;  2Y0S C;  4HKZ E;  9ICU A;  4H4U A;  4K8G A;  2FCM A;  3RNM A;  1A5R A;  2A5U A;  1AQ6 A;  3PZD A;  3MGV A;  3S2A A;  3SR6 B;  1AAR A;  2M17 A;  1WSP A;  1XD3 B;  1P43 A;  1WY8 A;  4EMW A;  4QJF B;  2BWF A;  4A9A A;  3PO0 A;  1WJ6 A;  3ETR A;  5KFD A;  9ICA A;  1OEY J;  3TAQ A;  3H6N A;  2GOL A;  4RZR A;  1SIF A;  1T6B X;  2ZG6 A;  2DZI A;  1XLQ A;  4GN1 A;  2IBK A;  3H0M B;  1ZKH A;  2NBV B;  3GE8 C;  3F5A A;  4O9M A;  2KSO A;  4ANV A;  2KFN A;  5KT4 A;  3EUB 3;  2BKE A;  5KFZ A;  3QUT A;  3TQ1 A;  1JX4 A;  5KT5 A;  1BWC A;  1XNS A;  1JWM D;  4Y2P A;  5IIL A;  4F5Q A;  2RAB A;  2TPR A;  2WXH A;  2DHZ A;  1TV9 A;  8ICJ A;  5KFQ A;  2XGP A;  1ZJM A;  3KHR A;  4W9C A;  4FHJ A;  1ZQT A;  2MBE A;  3CST A;  3MY9 A;  1WE7 A;  1UA1 A;  2VAO A;  3J81 j;  3AEB B;  2KKC A;  3PK7 A;  4YG2 A;  1WGY A;  2IY0 B;  2J3N A;  2HNE A;  4MH8 A;  3KUZ A;  4H4Q A;  4HG0 A;  3AE6 B;  1J19 A;  4ZRI A;  2W9N A;  2IOF K;  4XX5 A;  4PK1 A;  1NK0 A;  1QSY A;  4PS7 A;  2V4L A;  1P7F A;  4F7Z A;  1UHU A;  5ALY A;  3LXD A;  3AL0 B;  1ACC A;  4XGA B;  3GIM A;  1DXL A;  2RDX A;  4M6U A;  1NYQ A;  5J2H A;  1MRA A;  3SQI A;  3RB4 A;  2MBB B;  1WRD B;  3II4 A;  2WP6 A;  7ENL A;  3TEY A;  3S1D A;  1ZD3 A;  2KC1 A;  2WX0 A;  3Q69 A;  1GV4 A;  3UMB A;  1B1Z A;  4I6P A;  3LVW A;  2IJ0 A;  2H5X A;  2P8C A;  2BCU A;  5D79 A;  2VJ4 A;  4GYP A;  3RBD A;  5HG2 A;  1FHV A;  4YR0 A;  1WXS A;  4DLG A;  5GRT A;  4MSQ B;  3C1Y A;  1DOQ A;  1F9J A;  1RWS A;  1LPF A;  1SJA A;  4GXB A;  4GXK A;  1E8W A;  1YJI A;  2F8L A;  1UXY A;  4U6P A;  4EFO A;  3G6X A;  3IG8 A;  3BS5 B;  1MI0 A;  5DB9 A;  1TY2 A;  3KHH A;  1F8W A;  2HXT A;  2V6O A;  4HNL A;  1AN8 A;  5ALW A;  4NY0 A;  3RJI A;  1B43 A;  4I2H A;  1M4V A;  3BVM A;  3N1Z C;  3ZD8 A;  3WCQ A;  2CS4 A;  1KKR A;  2MX2 A;  3QAQ A;  1HSK A;  3RD2 A;  3TOY A;  4RQ3 A;  4FP1 A;  4RQ1 A;  3E0F A;  5J2J A;  1RM6 C;  3NVW B;  2NQW A;  1EUV B;  2D5G A;  2EKE C;  2OO6 A;  2PP1 A;  2MRL A;  5KFW A;  3SEN A;  1NBF C;  2R8H A;  3OG5 A;  3GY1 A;  1QOA A;  4KDL B;  2WXK A;  1EBG A;  1GOZ A;  1PGB A;  8ICC A;  2M0N A;  4MGZ E;  4KEM A;  1ZQL A;  4I28 A;  1CK1 A;  3ML8 A;  3EYZ A;  3ZVV A;  4ZHP A;  5IIJ A;  1OQQ A;  3SU8 X;  4ZYN A;  4DFK A;  3KTQ A;  1E9M A;  4LDT B;  4UD8 A;  3IJQ A;  4BV6 A;  3M7D A;  3ZTD A;  7ICM A;  4JL9 A;  3KKA C;  1E8H A;  4NL9 A;  2JU6 X;  3RN9 C;  2BGW A;  5TSS A;  2ZJD A;  3KWL A;  1EXN A;  3QKE A;  3W8X A;  2CHX A;  5KG4 A;  2OHF A;  4GIR A;  1SJD A;  2UVV A;  1T0S C;  3ABV B;  4OVV A;  3T3F A;  2HBM A;  1TAQ A;  2AH5 A;  5L9X A;  3Q2A C;  1NJY A;  4R65 A;  1CQV A;  2DPI A;  1SJC A;  5J0X A;  4DF8 A;  1KLG D;  4OJL A;  1V6E A;  3Q8M A;  4EEN A;  2BBC A;  3K9O B;  4B9T A;  1PDY A;  2F1I A;  2Q0Z X;  2B21 A;  4BDP A;  3H4D A;  5ALF A;  2BC1 A;  3M1Y A;  1DIQ A;  2QLT A;  2N0S B;  1ZMC A;  2PFN A;  2FBW B;  2OCE A;  3QX1 A;  2J52 A;  3JPP A;  1WGD A;  4PS3 A;  4W9G A;  2UVW A;  2Z7J A;  2GBJ A;  1W1O A;  4RNO A;  3FCP A;  4R64 A;  3PX0 A;  3PX6 A;  2LHE A;  3PZ8 A;  4NAM A;  1R4N B;  3QU5 A;  5KFT A;  1WZ0 A;  2GH1 A;  2FIF A;  4K7U A;  1S5L U;  4NJ6 A;  1YX5 B;  2ZJ5 A;  4Q8E A;  2L1A A;  5AKL A;  1F0X A;  2RSU A;  2JRI B;  3AE1 B;  3ES8 A;  2GB1 A;  3Q8B A;  3NAS A;  3DIP A;  4E0D A;  2G06 A;  2JZ3 B;  2D3D A;  9ICO A;  3LB8 A;  4KPL A;  4URK A;  3BQ1 A;  1MO9 A;  1OXJ A;  2WF7 A;  3LWM A;  4PHA A;  1FEH A;  3A4S C;  2K8C B;  4WJQ A;  1KCZ A;  4HCN B;  1T4G A;  3DVG X;  3I28 A;  4M0W B;  2LKY A;  4R8U B;  1YZ6 A;  3R11 A;  8ICH A;  4IUM B;  2NYV A;  3DFH A;  3U4F A;  1N61 A;  1X6I A;  2L7R A;  5C23 A;  5JCN A;  1T0Q C;  4R3D A;  3IBE A;  1BPZ A;  2ODG A;  5KFE A;  3LK9 A;  3W5V B;  1V1P A;  3CW2 C;  2UWQ A;  3MDA A;  1L7M A;  2DUY A;  5KG3 A;  2QDF A;  2BC0 A;  4M04 A;  1XO1 A;  4C80 A;  5KNI A;  1COK A;  1C79 A;  1TS5 A;  3CXO A;  3KUC B;  3SSZ A;  1W1J A;  4DS4 A;  3PLV A;  1X9S A;  3TJI A;  3A0H U;  3ZDE A;  5KFU A;  1Q0W B;  3V7L A;  1FD6 A;  1YD8 U;  3R0K A;  5DG8 A;  2ACZ B;  4DEZ A;  4DL2 A;  3NS1 A;  3TFS A;  4BWJ A;  4XA5 A;  1KM7 A;  2BS4 B;  3QJZ A;  3TAC B;  1HZ6 A;  5TR3 A;  1S0V A;  3AU2 A;  5CRX A;  3NVY A;  1TAU A;  5KHO A;  2QEJ C;  5D6J B;  2M8S A;  2QIL A;  2PA6 A;  8ICQ A;  2DPJ A;  2AQ2 B;  2L52 A;  1STE A;  3BIN A;  5H8Y E;  3W8W A;  3M6Z A;  3HKZ C;  3UMC A;  1ZYQ A;  1YQ3 B;  3P93 A;  9ICT A;  4RT2 A;  2ASD A;  1H4R A;  2PS2 A;  3EAO A;  1SWW A;  2WYQ A;  3D46 A;  4TV3 A;  4WIP A;  2XO7 A;  3U30 A;  5KVI A;  1VDV A;  5AZH A;  4YTM B;  5AZF A;  4UAW A;  5AKE A;  4LNO A;  3SI8 A;  1PQS A;  5DB7 A;  2JY6 A;  1ET9 A;  4EC3 A;  4HYR A;  4EMI A;  2VKQ A;  3UXK A;  4GFJ A;  1QQ5 A;  2FCN A;  4HVB A;  4UAY A;  4RU9 A;  5FR3 A;  4C0Z A;  2JZB B;  1FIQ A;  4X5V A;  1KQQ A;  1WXA A;  1C4A A;  3J9C A;  4MGK E;  3TMP B;  1ZQE A;  4MM3 B;  4FJZ A;  2PKE A;  5A0L A;  2OVL A;  2DWQ A;  4GYP C;  4H19 A;  3UJ2 A;  2PTY A;  3S6J A;  1D5M C;  1KRH A;  1I4P A;  2QCZ A;  3MQT A;  1JXL A;  2OQH A;  2BYV E;  2WF5 A;  1F1H A;  4EQW A;  1TS3 A;  3RBE A;  2AJQ A;  1N60 C;  3JZU A;  3VC6 A;  4USA A;  3K1G A;  5KT2 A;  2GQT A;  2MAX A;  1IBX B;  3V4B A;  3PO4 A;  2X8C A;  4I2J A;  4DFJ A;  3NGD A;  3ZGZ A;  3KZI U;  1WCL A;  1GRT A;  4DN1 A;  4ZDV A;  1P0R A;  4A55 A;  1E6E B;  1BKH A;  2AAQ A;  1ZQU A;  2BVC A;  4XC2 A;  5AE2 A;  3FV9 A;  3H4B A;  1C78 A;  4RQ0 A;  1NJZ A;  1UWX A;  1EM7 A;  1IYX A;  1QLN A;  4ACF A;  3NVV B;  1OFF A;  1RG6 A;  5AM3 A;  4RFB A;  4Y2U A;  3JPR A;  4IC9 A;  2W04 A;  3L4P A;  1ZQB A;  4LK0 M;  4E71 A;  5ALV A;  3RH4 A;  1L4Z B;  3GIL A;  3A9K B;  2OPJ A;  4IL0 A;  1SE9 A;  2OAI A;  4R66 A;  3TJ4 A;  4QWC A;  2LGY A;  3N9Y C;  4DWF A;  2YQU A;  3ZLF A;  1SZP A;  1LXD A;  3UPQ A;  5AI9 A;  3GS2 A;  2J42 A;  2MNR A;  3ISC A;  3RAQ A;  3S1F A;  3V7J A;  4F8R A;  4O5E A;  4JN7 A;  4M2Y A;  2WF6 A;  1SKW A;  1E8G A;  3QU9 A;  1JEH A;  3TSH A;  1QLT A;  4QIW F;  1C9F A;  3PS6 A;  4EZK A;  3B2G A;  3MHZ A;  3JW0 X;  1FRR A;  3H8H A;  2YVC A;  1ZXI A;  3CAW A;  2KO3 A;  2XNA C;  5DLF A;  4LJP B;  3NRZ B;  2PGW A;  4KLQ A;  3N4E A;  2MJ3 A;  4M6W B;  5DDY A;  2ZJ8 A;  5L1L A;  4FXC A;  1FEC A;  4L23 A;  3PO5 A;  2FPM A;  2HBL A;  2TSS A;  3V6C B;  2G5H B;  3MFI A;  3RCZ A;  4PWC A;  4UDU C;  1MG8 A;  1STZ A;  2XK5 B;  2ZIW B;  2C9W B;  3ZDA A;  4B9U A;  5G5H A;  4W9L A;  3ISD A;  1N62 A;  1J2M A;  2F3N A;  2WF9 A;  1GB1 A;  4F5N A;  3ZW3 A;  4IOI E;  2E8N A;  3C5G A;  1YZ7 A;  2FMS A;  4IM2 A;  1WWV A;  3ZYY X;  5IO9 A;  3ZJT A;  1O08 A;  4CF5 A;  1UA0 A;  3WAP A;  4FS1 A;  5IIN A;  2VZK B;  5DBC A;  3IG3 A;  3OP2 A;  2Z0D B;  4F2R A;  5EE9 A;  5AI4 A;  3LB8 C;  3TWA A;  2XC9 A;  1KFS A;  2GL5 A;  4OCZ A;  4JK1 A;  3SN4 A;  4BBN F;  4QZ8 A;  3RJH A;  1PGA A;  4APN A;  1TKY A;  1UH6 A;  1D4B A;  2IZV B;  3RNG C;  2GRI A;  5J0R A;  4C4V B;  1JCT A;  4GC7 A;  2O2V A;  1YJ1 A;  4EQS A;  4UAT A;  1RFK A;  7ICT A;  4JV2 A;  3HW8 A;  3N3K B;  5J0S A;  3A33 B;  3Q3M C;  4WAF A;  5E6O A;  3WA0 A;  5DPR A;  3X0W A;  3K1Z A;  5J2R A;  1WYW B;  3HWT A;  3KJM A;  1EC7 A;  1Q1R A;  5DG9 A;  3PW5 A;  1K52 A;  5L1I A;  3NG0 A;  2ZPY A;  4OZB A;  1TE2 A;  3DBR B;  3NVZ B;  3MZN A;  1N63 C;  5KL1 B;  2D2Q A;  1L6U A;  2WPC A;  4UAZ A;  2PMZ F;  1N6Z A;  2JXJ A;  3N6H A;  4J3Z A;  2V0G A;  4IWO A;  4P4M A;  3BJY A;  4BOZ B;  2YX8 A;  1P1A A;  5DPS A;  2O56 A;  4ZRK A;  4QZI A;  3TAP A;  4ICV A;  3R07 C;  2KK8 A;  3CIR B;  2DYM A;  1P48 A;  4O0I A;  3JPN A;  5DGB A;  3WK9 A;  3PW7 A;  1KLN A;  2FLL A;  2KZ3 A;  2L83 A;  3W9C B;  2EZZ A;  4TMA B;  3AN1 A;  5FXE A;  1E7U A;  2ONE A;  2RHF A;  2IO1 B;  2NBW B;  1MBB A;  1YEY A;  2WF8 A;  2MW5 A;  4UB3 A;  3OJ4 B;  3RB6 A;  2ZXI A;  4TQ1 A;  3EJE B;  5AM0 A;  1E9I A;  4OJP A;  3OSP A;  2G0A A;  4ELU A;  1JW9 D;  3EW9 A;  4QWB A;  2JYT A;  2ZNV C;  7ICV A;  2JRH A;  4II3 B;  3QFA A;  3T6C A;  1HJP A;  1U49 A;  4MH0 E;  3QEB Z;  3A1Q B;  4PHE A;  3AE5 B;  1VAO A;  2WTF A;  1BXT A;  3V05 A;  3CT2 A;  3DHG C;  4G11 A;  4WQM A;  3FW9 A;  4A6G A;  4NLN A;  2HCF A;  2GH5 A;  2KX0 A;  2OJR A;  1W1K A;  1ZX9 A;  2H3F A;  3ZDM C;  2W9B B;  1OTR B;  3W2D A;  2GGI A;  4ECR A;  4FLH A;  1TYT A;  4DF4 A;  4HWI B;  5L95 C;  4Y2S A;  1L6N A;  2ON8 A;  5IAA C;  3ICX A;  5JRT A;  2HJ8 A;  5BYQ A;  1GET A;  4RQ2 A;  1RPL A;  1HEZ E;  8ICY A;  3WK5 A;  1WXV A;  2IPK D;  2KE7 A;  2PIA A;  3Q8Q B;  8ICN A;  1XQQ A;  4FI4 A;  4JMU A;  4Y2J A;  1WWU A;  3IG5 A;  1XDI A;  4KWS A;  3V61 A;  2F1J A;  3PV1 A;  4A6Q A;  1QSL A;  4G9B A;  4FBU A;  1VZ7 A;  1ZXH A;  2IO0 B;  2Y5C A;  4YMN A;  3C0P A;  2XGQ A;  1HUZ A;  4UB6 U;  1WR1 A;  3PQB A;  4GFI A;  2F8K A;  1SB3 C;  2JH1 A;  1YQZ A;  1SV0 A;  4P0Q B;  3I63 C;  1Z3E B;  3A9J A;  4KLD A;  4EEK A;  4N9F 4;  1PDX A;  4TKN A;  2MBH A;  1K1Q A;  1TK0 A;  2E3T A;  2HI0 A;  2LHD A;  4P1C C;  3N97 B;  4YSZ B;  4OZC A;  1WVF A;  5LXI B;  2CRX A;  1SEB D;  4S0R A;  1S77 D;  2AXR A;  5FXD A;  1KJT A;  2W7O A;  3O65 B;  4C4R A;  2K89 A;  1QQ6 A;  3IJI A;  5CB1 A;  5IA7 A;  4LA1 A;  3PW2 A;  1VR9 A;  3H7V A;  3NXL A;  1NYR A;  4JV0 A;  3DHH C;  1T3Q A;  1XLP A;  4LTU A;  3UGV A;  2WXL A;  3HVD A;  3U9I A;  2EQ7 A;  1L6V A;  1X2I A;  1GSN A;  3TI0 A;  1WUF A;  3WKB A;  3H7P B;  2N7E A;  4CGZ A;  3DJG X;  1UNS A;  2L76 A;  4LZG A;  4J9O A;  4YCX A;  2MBO A;  4P4O A;  3V6E B;  2VFS A;  3R1Z A;  3C19 A;  1ZXI C;  3RB0 A;  7ICE A;  3WAL A;  4DOC A;  3FW8 A;  2LZ6 A;  4KX5 A;  3OPS A;  1T7P A;  1D5Z C;  1HXY D;  4PHD A;  3IK4 A;  3FAH A;  2DKX A;  4NLB A;  2PP0 A;  4M9J A;  3JPO A;  1YT3 A;  1X9X A;  1DGJ A;  3R3M A;  3JVA A;  2ZVN A;  3GD6 A;  2ZIV B;  2KTF A;  4OZA A;  3RZW C;  2H89 B;  2K6D B;  4WJP A;  4TUQ A;  1IM4 A;  1ROE A;  4ED6 A;  4AQ7 A;  1N62 C;  1Z4O A;  1V97 A;  2JHD A;  3JSV B;  2AQ1 B;  2PSN A;  2BCR A;  1AYF A;  4MT5 A;  2PJH A;  3MTN B;  4HCL A;  3NTU A;  1WJU A;  1HTO A;  1GXF A;  3R0U A;  4DSI A;  5LNK 1;  1L7Y A;  1XXG A;  1X9M A;  2KZM A;  4KMU A;  4W9H A;  3V6J A;  2WB1 C;  5D4B A;  3C2M A;  1D6E C;  1QT9 A;  4XUS A;  3AU4 A;  1Q3U A;  2RMM A;  1AHV A;  3DFY A;  4NXZ A;  5FS6 A;  2JF5 A;  2OLA A;  3WAO A;  7ICN A;  3I3T B;  3QU7 A;  4M9H A;  2C7H A;  3MFG A;  2FUH B;  4GB9 A;  2NR2 A;  5CP2 A;  4AOF A;  1QLB B;  4O3P A;  2W9A A;  1B4F A;  5ALS A;  5C0Y A;  2YLM A;  4LJX A;  5CHF A;  2QDE A;  1MC8 A;  1RQN A;  3RIT A;  3SJN A;  3B0X A;  3ZVH B;  2HZG A;  4RQ4 A;  2FCS A;  2ZIX A;  1YMH E;  4QAY A;  3AUL A;  5AUI A;  3CSF A;  3VAW A;  4B95 A;  2K4I A;  1ENF A;  2ICI A;  4F1S A;  2BYT A;  3SAG A;  2DFL A;  4BOS C;  2KMC A;  2D3A A;  2EZX A;  2IA6 A;  3A7U A;  4EZ9 A;  1TTN A;  4O1N A;  1N5W C;  3GZN I;  3KYC D;  2LGI A;  3T9P A;  4RUA A;  5BYS A;  1HTQ A;  1Z4N A;  3T5J A;  2ZTC A;  3FYH A;  1NVI D;  2SAK A;  3I6E A;  5AHX A;  3MWC A;  3VCC A;  3RRG A;  4ED7 A;  2LMR A;  2W43 A;  5CJ7 A;  2IBI B;  1LGR A;  1K53 A;  1UGM A;  4FA6 A;  2P13 A;  1QKZ A;  1WX9 A;  2N7D A;  2QQ6 A;  5AI6 A;  3OJU A;  2AGO A;  2O6V D;  1AHZ A;  1ZQV A;  4OJ5 A;  1FPY A;  1KFD A;  3V7K A;  4NLG A;  5EWG A;  4RF1 A;  3DPD A;  4JWS C;  1W6T A;  5ALQ A;  1SGH A;  3C0R B;  1E0Z A;  4KLT A;  2GRT A;  3RYT A;  2YVS A;  4MFC A;  2H3V A;  5D3D A;  3H12 A;  1IV8 A;  5BOM A;  3SD7 A;  2Y9T A;  2EKI A;  2KEY A;  1PVP A;  4I2C A;  2I0K A;  3PPA A;  3D2Q A;  4K3C A;  4P16 A;  3QCA A;  3EUB 2;  3URY A;  1XF5 L;  1N56 A;  2PTW A;  5J18 A;  3MGH A;  2CHR A;  5AK6 A;  5JCL A;  1Q46 A;  2HSZ A;  5J17 A;  4EYI B;  4TQR A;  2IOF A;  4F4Y A;  3RJG A;  3ZRC A;  3RMK C;  1Q8K A;  5DDM A;  3ETL A;  4XE0 A;  3TKA A;  2MA1 A;  3E58 A;  3PWI A;  1BNO A;  4EM4 A;  3JYU A;  3IAM 1;  2PI4 A;  2VH1 A;  4UB2 A;  3LYY A;  1Q1W A;  3U7D A;  2UVU A;  8ICV A;  1L3S A;  3QIJ A;  4HRO A;  5AE1 A;  2G4D B;  1GRA A;  3KHG A;  3AU5 A;  2L0F A;  1VJK A;  2XN9 C;  5FS9 A;  3GIJ A;  2HOQ A;  5BOL A;  1ZQJ A;  1LV5 A;  1RRB A;  3WKD A;  1WZ3 A;  4HRS A;  4LCD E;  2FE8 A;  3QX7 A;  1SV0 C;  4LNI A;  3IJL A;  4IDI A;  2AU0 A;  1YJJ A;  4QWD A;  2ESE A;  2BGF A;  3D47 A;  2V4Q A;  3MFH A;  3U4E G;  2Y08 A;  4F5P A;  3ORY A;  5L83 A;  2YMP A;  4F93 B;  1CEZ A;  2AQ0 A;  3UIN B;  4YSX B;  3I4K A;  4DWI A;  4ZOH C;  4I2F A;  3C5F A;  1PK1 B;  2FDR A;  3AH7 A;  3AI5 A;  2AKZ A;  3M63 B;  1I42 A;  4IZG A;  1KEJ A;  4DFM A;  2PE9 A;  3HT3 A;  2ONQ A;  3I5J C;  1JWS D;  4ZA0 A;  2DW6 A;  1V5O A;  2CHW A;  4H4W A;  2HHS A;  1T0Y A;  4NEV A;  4J9N A;  1F2R I;  2JRZ A;  1GRF A;  1SXE A;  2ZJA A;  1QOF A;  3VUW A;  2GI9 A;  3P0W A;  1OQY A;  3MKC A;  2G1E A;  4RM8 A;  3KH0 A;  2MP2 B;  1J2N A;  2MUT A;  2CJN A;  5CHV C;  4S17 A;  4LVS A;  2AWT A;  3AEE B;  4C7Z A;  1XT9 B;  2Q85 A;  2MBR A;  1GES A;  1TVA A;  5ALJ A;  3RR1 A;  3RAX A;  2BQR A;  1NKE A;  3HSU A;  3IAS 1;  5I4D A;  4EQR A;  3K1R B;  5K4L A;  2W82 A;  4LNF A;  2KOX A;  2LYA A;  1SBB B;  2E8O A;  4CNQ A;  3QHT A;  7ICP A;  1QF6 A;  4MEX A;  3PV8 A;  3DVG Y;  2IDY A;  5HKH A;  3UJF A;  4GDL B;  4F91 B;  4P6V F;  1WI0 A;  3MGI A;  5IOI A;  1MJD A;  3KUM A;  5D3I B;  1R4M B;  3DER A;  2R8I A;  1J7C A;  4F71 A;  2ASJ A;  1B0X A;  3BS5 A;  2D3B A;  2NS5 A;  2GSH A;  1FXI A;  4DHG A;  3MR6 A;  3EEC A;  3BQ0 A;  3RTV A;  3S1C A;  4OHJ A;  5ALX A;  3EZ5 A;  1EF5 A;  2X99 A;  3NZG A;  3QYP A;  3AE3 B;  3PNC A;  3STP A;  4I27 A;  4M0A A;  5KFG A;  3NS8 A;  3RZF A;  4EBE A;  1SGG A;  3GIK A;  1ZOL A;  4N6E B;  1WGG A;  4E74 A;  2FE9 A;  4J9P A;  2MSE D;  2VH2 A;  2G4S A;  2EAO A;  4B9S A;  4XDC A;  5DQI A;  2INC C;  2W11 A;  1WXQ A;  3KOO A;  3BYT B;  2KVS A;  4M00 A;  4P7I A;  4YTP B;  1GRH A;  1ZP0 B;  4L1B A;  3TIX A;  3SYZ A;  4CO7 A;  2BYE A;  2HXU A;  1YX6 B;  5IIM A;  3QTP A;  4H4P A;  3EFC A;  4KLF A;  1EWC A;  2LMC A;  1XU4 A;  3VHT C;  2FAZ A;  4NJ8 A;  4UBB A;  4XWW A;  4DCC A;  2VIX A;  4EX7 A;  1KDH A;  4BKS A;  1MFW A;  3DOW A;  4ECT A;  4MDK E;  3MC0 B;  3KD3 A;  2GR2 A;  4GIS A;  4KDI C;  3N28 A;  1E7V A;  3BY4 B;  5BO4 B;  1CI4 A;  3ZLH A;  1KTQ A;  4WJN A;  3UMG A;  2ZPN A;  3BZD B;  5HHI A;  3QUB A;  1NHQ A;  2AYO B;  1S1Q B;  4JPS A;  4QW9 A;  9ICV A;  1UBQ A;  5EOZ A;  2E1E A;  3BVG A;  1IIP A;  1L3V A;  5AI0 A;  4M02 A;  4DNA A;  2W9C A;  4IQV A;  4OVU A;  4WH4 A;  9ICN A;  5AKJ A;  1U45 A;  2MQJ A;  1BZL A;  2WDW A;  2KK0 A;  5J2I A;  5KFL A;  3DGZ A;  4H4V A;  2PFQ A;  5G5G B;  3HRD D;  2J6T A;  2LGS A;  2Y9U A;  4TVY A;  2P6U A;  5U1O A;  4Z1Y A;  4YQW A;  3MR5 A;  2CXY A;  2J6U A;  2OED A;  4H4Y A;  4OVZ A;  3N32 A;  2WDV B;  3SD5 A;  2E5A A;  3HKZ F;  3ZI4 A;  3KUD B;  4YR2 A;  3BW7 A;  3URH A;  1K50 A;  1G6J A;  4KLM A;  2V3S A;  3ALB A;  3VTV A;  5FJT A;  1UT5 A;  1O03 A;  1NHS A;  1NU5 A;  2OFJ A;  1FNV A;  9ICF A;  2DAF A;  4O3R A;  1XWL A;  2HDO A;  2P66 A;  5L1J A;  3RT3 B;  1YQ4 B;  4ASW C;  3H0L B;  5FS8 A;  4R8U A;  1M6I A;  1ZQC A;  4ED3 A;  1L2N A;  5BPC A;  4X57 B;  2QC8 A;  8ICK A;  2HHX A;  2QAR B;  1FMA D;  1RFA A;  4JWU C;  5JTI A;  1FEB A;  2YAU A;  3QAR A;  3LDA A;  2BQ3 A;  4MJS B;  4M0X A;  3VTW A;  1FHU A;  2XI9 A;  3MJ5 A;  3WKE A;  3QUQ A;  3DG6 A;  3IHQ B;  3L17 A;  2XH0 A;  3UF8 A;  4J9Q A;  3Q8C A;  2MCN B;  1S8O A;  2JZP A;  5J2B A;  2WAQ F;  4YXD B;  1N60 A;  4WWM A;  3D2J A;  1YNT E;  3WAN A;  4EWJ A;  5KAF U;  3LXF A;  1KKO A;  5EE3 A;  2IPI A;  1V9J A;  4PH5 A;  2KKP A;  4UQG A;  1ZQM A;  2BHN A;  3PG6 A;  1ZK7 A;  1FNU A;  4LDT D;  3ZNZ B;  1ECQ A;  2OH2 A;  4KN4 A;  4EBD A;  1FFU A;  2KIC A;  3IM1 A;  1DII A;  4YD2 A;  1JPM A;  9ICI A;  2R9Z A;  3LLB A;  4RQM A;  3RR8 A;  4FJV B;  1TK5 A;  3VRA B;  3B9J B;  1EC9 A;  4DSJ A;  2QDD A;  3P3B A;  2OZ8 A;  3VC8 A;  4BKS D;  5ALU A;  5C1Z A;  1XS2 A;  2WXF A;  3EC8 A;  3BZC A;  1T3N A;  2NRW A;  2BQQ A;  4RM9 A;  4OO1 J;  1VZ6 A;  2BQU A;  3QA8 A;  4QZG A;  2KT7 A;  3ZJV A;  5ADZ A;  4QWA A;  3CP8 A;  1ZQR A;  4KLE A;  1SZH A;  1COO A;  5KG1 A;  1L3U A;  5G2N A;  2RD0 A;  4A3R A;  5HML A;  2KKV A;  3EPI A;  3X23 A;  2PPG A;  4KPR A;  2D8C A;  2C7N B;  1J0G A;  2ASL A;  1SL1 A;  2OM6 A;  5HMR A;  3CB3 A;  3TEW A;  3DEQ A;  3Q3F A;  3HRD C;  3QN3 A;  8ICG A;  3N1Y C;  1ZDV A;  2IY1 B;  1GRG A;  2YVJ A;  1W1M A;  2KJ9 A;  5J0U A;  2A3V A;  2PCE A;  1K4Q A;  2XBB C;  2V3B A;  4MFF A;  5J2A A;  4JLC A;  2JZB A;  4BKT A;  2V4R A;  4MM3 A;  5H92 C;  4DL5 A;  3PT2 B;  3M8R A;  2RRD A;  2PVG C;  3AEA B;  3CXB A;  8ICB A;  1FFV C;  3TSJ A;  2XY5 A;  4Q43 A;  5D7G A;  1YQB A;  3Q8R B;  3L10 B;  2W03 A;  1XEE A;  3VUX A;  4RF0 A;  3VA8 A;  2PFP A;  4RQ8 A;  2QIE B;  4WJ3 B;  2GMI C;  2BVF A;  5KG2 A;  3CGD A;  4AJY B;  3C28 A;  9ICK A;  4JV1 A;  2N9P C;  4GGQ A;  4KVG B;  2KLG A;  1QZE A;  1ZQO A;  4PT5 A;  3UXL A;  4YD1 A;  3C23 A;  3C2K A;  2YB4 A;  2KFJ A;  4DYE A;  4FBJ B;  3N7P D;  1NEN B;  2CU3 A;  1KW4 A;  2L32 A;  3GD3 A;  1SJH D;  3OWE B;  4D2K A;  4O3N A;  1NK7 A;  2DZJ A;  4K4H A;  1IYF A;  4IRD A;  3EKG A;  3R7Q A;  1JUD A;  2N1R A;  1ZW7 A;  1L0V B;  2KDE B;  2UU7 A;  4J9R A;  1Z1B A;  3A9K A;  3HW2 A;  4ZHO A;  2XH2 A;  1VQZ A;  2ZIU A;  2HDE A;  1BNP A;  4ZRJ A;  4PYT A;  2QHO A;  2RP5 A;  5J0Q A;  4K1R B;  1ZGU B;  3RI7 C;  1JRO A;  4TUU A;  1D9D A;  2N7J A;  2GLS A;  4YL8 A;  3V72 A;  3DJJ A;  2WXQ A;  5JUM A;  1W1S A;  4IP5 A;  2WU2 B;  1N63 A;  4DBG A;  4FS2 A;  4IRK A;  1WGR A;  2MH7 A;  3P63 A;  5JZE B;  4H4Z A;  2V4I B;  4ENL A;  4C7Y A;  2PP3 A;  5CX3 A;  4ITK A;  2C7M B;  4IC7 B;  1TZZ A;  5F9L A;  1ZRN A;  2FID A;  3U8Z A;  4AJW A;  2YTU A;  1S10 A;  4FZN A;  4NAW A;  4B0E A;  2J0M A;  1H8C A;  1OQR A;  9ICP A;  4IM0 A;  2MEK A;  3H40 A;  3JPS A;  3BQT A;  2BPS A;  2H3Z A;  3SV4 A;  2RLT A;  3FDS A;  4Z6F A;  2NPT A;  2WDT B;  3EFU A;  2ZIW A;  3I9V 1;  5ALO A;  4ARI A;  1GJZ A;  4FX9 A;  4JQ9 A;  1C4P A;  2CHZ A;  2LFI A;  4ANU A;  2JWU A;  4NJ7 A;  2LHT A;  1D5X C;  2L00 B;  3S5S A;  4RT3 A;  4EYH B;  1ZQS A;  1UQV A;  2ZZC A;  4M9L A;  1ZQZ A;  2HHV A;  1I7H A;  4NLK A;  1GNU A;  4FAD A;  2V9W A;  1WMH A;  5GXG B;  4PHP A;  2A8X A;  2X8H A;  4YWO A;  3UJS A;  8ICO A;  3DQV A;  3GRS A;  8ICU A;  2I1K A;  3BYY B;  3K9P B;  4DSK A;  2RDJ A;  1DYQ A;  2H88 B;  3HUI A;  2RPV A;  5KFI A;  1S9F A;  2IHN A;  2KQS A;  4TQ0 A;  1N5X A;  2FLN A;  4CE6 A;  1YIW A;  2WXJ A;  4P4P A;  4HCD A;  2Y3S A;  1NHR A;  2KOB A;  3MDC A;  1Y56 A;  4IKG A;  2O3G A;  4C4V A;  2DGZ A;  4LII A;  3E9S A;  2KD0 A;  3JVZ X;  4KX6 B;  2XH7 A;  4HJG E;  4KLO A;  3AB5 A;  1JIH A;  2EQ9 A;  4GIB A;  4IWP A;  2JEI A;  2Q5W D;  3L5K A;  3T8M A;  2OKT A;  2BCS A;  4E8G A;  4O5K A;  3OPX A;  1MDR A;  3N1X C;  4QNL A;  3R7R A;  2VFR A;  2QKN A;  4BVU C;  2DAJ A;  3Q8E A;  1Z00 A;  4IQU A;  3OZY A;  2R2Z A;  3GII A;  4ELV A;  2VFV A;  5J2D A;  2KC2 A;  3EF6 A;  7ICK A;  1I4X A;  1ISN A;  2AQ4 A;  4ECW A;  2N9X A;  4MF8 A;  3SEI A;  5ALP A;  2BTE A;  4J6I A;  5EWF A;  2PI5 A;  2J53 A;  4LJO B;  3GFK B;  1WIA A;  2BKF A;  3NO1 A;  1BVS A;  1GG3 A;  3DDM A;  3TQP A;  1H2I A;  1VLB A;  3ZKJ C;  1FFU C;  1GRB A;  2FCQ A;  2IGH A;  5DCN A;  3ZNH B;  2CJO A;  2BDP A;  4H83 A;  4ED0 A;  5L6G A;  2HHQ A;  2RQ5 A;  4WJO A;  3BOX A;  2BB6 A;  3AE7 B;  4EBC A;  3P4Q B;  3ZNI D;  2NRV A;  3W5U B;  3TX1 A;  2ISO A;  5KFS A;  1L0X B;  6ENL A;  5IDZ A;  2UUU A;  3O0F A;  2A1J B;  3UXO A;  3SAF A;  1TIF A;  2GDQ A;  1OEY A;  1YOV B;  3GRT A;  2IO2 B;  4Y2R A;  1ZR6 A;  5JXV A;  1AHU A;  1Z2M A;  3EHV A;  4MAC A;  3ZLZ A;  5ALZ A;  3ED5 A;  4QZH A;  1F3P A;  1GO3 F;  1OUQ A;  3FIL B;  3BQ2 A;  3VVW B;  1EC8 A;  1K8R B;  3NOB A;  2DBY A;  2A1A A;  4NZL B;  1ZRM A;  2IMW P;  2DYB A;  2IGD A;  5EU9 A;  4C4S A;  4HPN A;  4JHM A;  5AKI A;  5ENL A;  4ECX A;  2HD5 B;  2PPH A;  5E79 U;  2WS3 B;  4JIO U;  2I2Y A;  2M1M A;  4BZA A;  3L5O A;  2C3D A;  2F76 X;  1CJE A;  3HJE A;  4HN8 A;  4DQQ A;  2JEJ A;  3A7A A;  3APC A;  1SJE D;  3E2E A;  2VZK D;  3IXS A;  3I6T A;  2XSX A;  1TBE A;  4YXJ A;  1JMS A;  1V1P B;  2N9E B;  4QW8 A;  2KFK A;  4M47 A;  3N4F A;  2RR9 A;  4PPX A;  2JGA A;  2WHE A;  2B6G A;  2GBM A;  2L5Y A;  4J9K A;  4ZYS A;  9ICM A;  2GBR A;  4ED2 A;  2GBN A;  1NOM A;  2LVQ A;  1JPD X;  3TW9 A;  2QGY A;  4XQ8 A;  1N2X A;  2ATL A;  4ML8 A;  2WQY B;  3CYJ A;  4MHV A;  2D3C A;  3ZDB A;  3D6J A;  1SE3 A;  1GER A;  2G3Q B;  2N1V A;  2CFY A;  2DF4 B;  2ZCB A;  4Q44 A;  3HM3 A;  4IP4 A;  2QPM A;  4UB1 A;  3UGB B;  3NS1 B;  1UCV A;  1V1O A;  3PRZ A;  2Z0E B;  3TWB A;  4XWT A;  5IKC M;  4YWS A;  5J2E A;  3NZU A;  3NVY B;  4HK2 A;  4A8X C;  2PW9 A;  2YMM A;  1NJX A;  2JQR B;  1XLN A;  2M0X A;  2ZTD A;  3B0A A;  3H7P A;  1RYJ A;  4PZO A;  2Y3A A;  3ZUN A;  3POP A;  1U4B A;  2KTR B;  3KYD D;  2HW3 A;  4NQK E;  2GQW A;  2H3I A;  2J6S A;  2K1F A;  4MKS A;  4MGI E;  4KLU A;  1TS4 A;  3BZK A;  4HDO A;  2VA3 A;  4H50 A;  2POD A;  3K75 D;  1N5W A;  4K1W A;  2IHM A;  1L7N A;  5IN7 A;  5JCI A;  1P7E A;  4YSY B;  2B0C A;  4DXK A;  2M19 A;  1ZQ1 C;  4RPX A;  2W7P A;  3RGT A;  1FIQ B;  3RB3 A;  3PML A;  1WF9 A;  2AQ3 B;  3H70 A;  2I9G A;  4ED8 A;  2L0T A;  4O3M A;  1L5U A;  2KZZ A;  3AQF A;  1ELS A;  5MPO A;  4KLS A;  4B6W A;  5KL8 B;  1QOB A;  2POZ A;  2KTQ A;  2LXC A;  4N58 A;  4BKG A;  1N48 A;  3WU2 U;  3JSV A;  1FCL A;  1ZQG A;  2OG9 A;  3FVD A;  5AK5 A;  5HR7 A;  3GB1 A;  1FEA A;  4JN8 A;  4B9L A;  3MJW A;  3R9K A;  2A4Z A;  2WWZ A;  1SKS A;  4DWD A;  2JH7 A;  3SFE B;  3R25 A;  3VFC A;  2ZUD A;  1Z5S B;  2L3Z A;  1V86 A;  4MEY A;  4TUR A;  4NM1 A;  5CA7 A;  3TUO A;  1QSS A;  4HXD A;  3ZDT A;  4A90 A;  4GLS C;  1T8E A;  1NZP A;  3M3J A;  3O0H A;  1PDZ A;  4DOA A;  2LBO A;  5KFJ A;  4CDG A;  3F53 A;  3GV7 B;  2LGD A;  3MC9 A;  3RH5 A;  9ICL A;  3GU3 A;  1Q10 A;  3IVF A;  3MSY A;  3DES A;  3R2T A;  2LGX A;  2ZUC A;  2KWC A;  2K39 A;  3AE2 B;  2ZZP B;  3JS8 A;  3ZVH A;  4DNS A;  1X42 A;  9ICG A;  4B6J A;  3DBH I;  2KQ7 A;  5KFN A;  1ED1 A;  4BC9 A;  5JHB A;  2EQY A;  3PW4 A;  3HHM A;  3UI3 A;  1C3T A;  4ARC A;  1ZQY A;  4UAS A;  4JWM A;  1IG6 A;  4EOY A;  2GGE A;  2KVR A;  3H7S A;  1X6J A;  7ICJ A;  1V59 A;  1I35 A;  3HX0 A;  3SN1 A;  1L5P A;  4XLO A;  3PR4 A;  3QXG A;  4I29 A;  3IN5 A;  5J2C A;  4C4T A;  4E4F A;  4RQ7 A;  2ALZ A;  2AL2 B;  2QB1 A;  3DED A;  2KX3 A;  4ACO A;  3IRU A;  1SE2 A;  2LUE A;  1NK9 A;  3FW7 A;  3CGE A;  4JB1 A;  4IS7 A;  4MMW A;  4ED1 A;  2MHJ A;  1UT8 A;  4QZD A;  3H8J A;  2FYM A;  3BVZ A;  5HNK A;  4C00 A;  1NI3 A;  5EE1 A;  4IQT A;  2FMQ A;  4KSL C;  3CGC A;  3B1L X;  2WOI A;  3P4P B;  1JXE A;  1MHH E;  2KN4 A;  5DB8 A;  4ICA A;  7ICG A;  4DDG D;  3PWG A;  1F77 A;  1IUE A;  4F8C B;  5G5H B;  1TS2 A;  1ONF A;  1F0M A;  1KN5 A;  5ALH A;  5TIS U;  3MR2 A;  3DK4 A;  1V8C A;  2KDI A;  2PLI A;  3DWM A;  1RLF A;  4JB3 A;  1RYS A;  7ICH A;  3TTE A;  1AW7 A;  2O6V A;  1B9R A;  5ER0 A;  4H2H A;  1YN5 A;  4UB8 U;  2INP E;  2WNM A;  4HPM B;  4HDQ A;  2HBJ A;  3H8M A;  5DQG A;  3EPG A;  3L08 A;  2W3S A;  2R61 A;  3PRM B;  2BB5 A;  5J0P A;  4J3O D;  2V3N A;  3H8A A;  2KDM A;  1MA7 A;  2YB1 A;  3DDH A;  2RGF A;  2WXR A;  1WGK A;  4HPP A;  1JI7 A;  3ZJU A;  4DFD A;  2DL0 A;  2LAS A;  2D07 B;  2GBK A;  4JX1 C;  3HPO A;  3THU A;  2O2V B;  3E56 A;  3PST A;  4QZC A;  1H6V A;  2QJM A;  2EH9 A;  3T5H A;  1Z19 A;  1MQ3 A;  2K3U A;  2NPX A;  4DSE A;  4GDK A;  4P1B C;  1JWB D;  2P8B A;  1D8Y A;  4CRX A;  1KFY B;  2DZM A;  1ZMD A;  2WBA A;  2KNB A;  4QIW C;  5DPT A;  4H4X A;  3F5E A;  3DHI C;  2W8K A;  1IPG A;  3SQP A;  2GQU A;  4AYB F;  4H4T A;  1C7Y A;  3RRA A;  3PSF A;  2ES6 A;  2K8B A;  5III A;  4DHJ B;  1XAN A;  2DZK A;  4K8D A;  1JAL A;  3GV5 B;  3UIP B;  4B0M A;  1RVK A;  1BPE A;  4OJ6 A;  4BFR A;  1RZT A;  2BYF A;  3AEF B;  1PK1 A;  3SDL C;  1S0O A;  2Y0S F;  4I6L B;  3WIM A;  2JR5 A;  3FWA A;  4KIT B;  2KMA A;  2GWS A;  2YN4 A;  5ALK A;  5DGA A;  2KWV B;  1WXM A;  3H1U A;  1TAM A;  2I38 A;  3TL5 A;  3GSY A;  1RAX A;  4TSS A;  4WWN A;  1OGW A;  1TKE A;  1LO5 D;  5DQH A;  1ZQX A;  2Q4W A;  2JV3 A;  1GAQ B;  3EA6 A;  2XH4 A;  2W8L A;  1V49 A;  5AZG A;  3LAD A;  2MP2 A;  2WOV A;  3DWG C;  2VFU A;  2MUC A;  2PMV A;  4RNM A;  2R2Q A;  2MU2 A;  1L8O A;  3PVL A;  3DBS A;  3T5L A;  1EBH A;  3DG7 A;  3OZM A;  2QJL A;  2JX5 A;  4A3O A;  1CRX A;  4BBN C;  4E3C A;  9ICW A;  2CDU A;  2J4X A;  5D2M B;  3I99 A;  3S47 A;  3DBL I;  1ET6 A;  3P4S B;  1FO4 A;  4M9G A;  1NJW A;  1NHP A;  2WDR B;  4K4I A;  2I1Q A;  5CHG A;  1KSP A;  2D11 A;  2KLC A;  2LJ5 A;  3ZVI A;  4KIK A;  1I4H A;  4EKU A;  3QFB A;  3LVV A;  2UUV A;  3NZS A;  3NZ3 A;  1LM8 B;  3DQ0 A;  3QZ8 A;  2F5Z A;  2PMZ C;  2OJW A;  1UD7 A;  4RPY A;  2B3A A;  3RJK A;  3L16 A;  4RMA A;  2GGH A;  2FJ6 A;  5DB6 A;  4L2Y A;  3KLS X;  5CWR A;  3A9J B;  4LLG M;  2P35 A;  3BK2 A;  4HNC A;  4YN4 A;  2BW2 A;  2LRW A;  3A7R A;  5BOE A;  1V9P A;  4FO6 A;  3SV3 A;  1S0N A;  4FHK A;  3M8S A;  2KHQ A;  3T5K A;  3SR6 A;  1UF0 A;  2C22 A;  1EF1 A;  2KDF B;  1KLV A;  3RR7 A;  2NCN A;  1K51 A;  3SN0 A;  1W1Q A;  5AKY A;  3MC8 A;  1QLU A;  3UJE A;  3V5F A;  8ICI A;  3CK5 A;  3AED B;  3Q14 C;  3C8Y A;  2WU5 B;  1KTK A;  4GXJ A;  4A20 A;  5HHD G;  5KFC A;  1MNS A;  5ALG A;  3PLU A;  3SAH A;  1V80 A;  2Y4G A;  3DEE A;  3CGB A;  2I6X A;  3GD4 A;  3V3W A;  4H1Z A;  1MN8 A;  5HHH A;  3Q8S B;  3V60 A;  2XCP A;  1V5T A;  4TVW A;  3ISB A;  3MP9 A; 
#chains in the Genus database with same CATH homology
 4YXD B;  1N60 A;  4WWM A;  1E10 A;  1YNT E;  5BMG A;  3D2J A;  3LXF A;  3ZQ4 A;  5EE3 A;  2IPI A;  1EU4 A;  1TS3 A;  1N60 C;  4USA A;  5FK9 C;  3O13 A;  1EWY C;  1FNU A;  1JWA D;  2GQT A;  2QSD A;  1IBX B;  1C77 A;  1SSN A;  2MJE A;  4BC7 A;  3AEG B;  3ZGZ A;  5G5G A;  4ZRQ A;  3LLB A;  1FFU A;  2WXM A;  1DII A;  3PM9 A;  4A55 A;  1E6E B;  1UWM A;  5AE2 A;  2EXR A;  3VRA B;  3B9J B;  1C78 A;  1UWX A;  1EM7 A;  2Z8L A;  2KMM A;  3B2F A;  4DXF A;  2WXF A;  3NVV B;  1OFF A;  4RFB A;  4YWG G;  3AM9 A;  1VZ6 A;  2LUM A;  1EU3 A;  3ZJV A;  3L4P A;  5ADZ A;  4LK0 M;  4N59 A;  5K8E A;  3FC4 A;  1L4Z B;  2OAI A;  1DOX A;  3VQI A;  1SXT A;  2W3R A;  1XCT L;  3N9Y C;  1E0Y A;  2WXP A;  5HMR A;  3GS2 A;  2BS3 B;  2J42 A;  3TEW A;  3S1F A;  3HRD C;  2YEP B;  1TJE A;  1ZDV A;  2X38 A;  1W1M A;  5HQX A;  5FKA C;  1E8G A;  3TSH A;  1QLT A;  2LEK A;  5L6F A;  1C9F A;  2LJI A;  3B2G A;  3MHZ A;  1KF6 B;  1TYG B;  1FFV A;  4HEA 1;  1FRR A;  3H8H A;  1TZO A;  5H92 C;  3AE4 B;  1ZXI A;  2FUG 1;  2XNA C;  3NUH B;  3U2S C;  1A70 A;  2PVG C;  2MJD A;  2WLB A;  3AEA B;  1SE4 A;  1FFV C;  3NRZ B;  3TSJ A;  4US8 A;  1UGJ A;  2MJ3 A;  5D7G A;  1XEE A;  4RF0 A;  4FXC A;  4L23 A;  2TSS A;  3T3N A;  4PWC A;  4UDU C;  1DOI A;  2QIE B;  2BVF A;  5G5H A;  1DZN A;  1N62 A;  3NVW A;  3D2D A;  2AX5 A;  1GB1 A;  3B9J A;  4PT5 A;  4IOI E;  2K22 A;  2M0A A;  2N9L A;  2PTL A;  1C76 A;  1WRI A;  1NEN B;  2CU3 A;  2L32 A;  3ZYY X;  3ZJT A;  1SJH D;  3OWE B;  4D2K A;  4BBY A;  1ZUD 2;  1IGC A;  1L0Y B;  5HI1 A;  2VZK B;  1L0V B;  5EE9 A;  4ZHO A;  3LB8 C;  3R8B A;  1VQZ A;  2HDE A;  2Y3R A;  4PYT A;  1PGA A;  5C2T B;  1I19 A;  4PVE A;  1TKY A;  1JRO A;  1D4B A;  1JWU D;  2GRI A;  2N7J A;  1YN3 A;  5BMH A;  1RFK A;  4C56 C;  2WXQ A;  1W1S A;  2WU2 B;  1N63 A;  4WAF A;  3P63 A;  2MH7 A;  3KJM A;  5I1V A;  2V4I B;  1K52 A;  4C7Y A;  3NVZ B;  1PFD A;  3AMZ A;  4OZB A;  4RGN A;  3VR9 B;  2P3H A;  2Y5P A;  1N63 C;  4ITK A;  1WVE A;  1L6U A;  3BII D;  4B0E A;  1OQR A;  2V0G A;  4KKI A;  2MEK A;  2PLP A;  3AEC B;  2WXI A;  1FRD A;  3BK1 A;  3U52 E;  5HFY A;  4YTN B;  3I9V 1;  4ARI A;  3Q8F A;  3R07 C;  1C4P A;  2LFI A;  3CIR B;  2DYM A;  2NMQ A;  2K9X A;  2JWU A;  2PLS A;  3W9C B;  2L83 A;  3AE8 B;  1I4R A;  4TMA B;  3AN1 A;  1D5X C;  1ZDX A;  5FXE A;  1UUP A;  1ZOY B;  2INN E;  1I7H A;  3CWI A;  1MBB A;  3BWU D;  4WUR A;  4ZOH B;  4TQ1 A;  5GXG B;  1WWT A;  4US9 A;  2E6X A;  1JW9 D;  2JYT A;  1E8F A;  4KGT A;  3BYY B;  1RM6 B;  2DLB A;  4RGT A;  3S1E A;  1DYQ A;  3AE5 B;  2H88 B;  3HUI A;  4M0W A;  1E7P B;  3V05 A;  1BXT A;  2RPV A;  1VAO A;  3IT4 B;  5HHZ A;  1J7B A;  4WQM A;  4TQ0 A;  3FW9 A;  1N5X A;  2WXJ A;  1W1K A;  2Y3S A;  1Y56 A;  4IKG A;  2O3G A;  3W2D A;  1ESF A;  3E9S A;  4KX6 B;  4HJG E;  1AWD A;  3AB5 A;  2ON8 A;  2Q5W D;  4KGS A;  5BYQ A;  3HVZ A;  1HEZ E;  1IGD A;  2IPK D;  4PVK A;  2BS2 B;  2PIA A;  4XDD A;  2BVG A;  2WP9 B;  3RPF C;  2VFR A;  1ZPS A;  2SEB D;  2QKN A;  3Q8E A;  2R2Z A;  4A6Q A;  5BYR A;  2VFV A;  5T8I A;  4BCA A;  1VZ7 A;  1ZXH A;  2Y5C A;  3C0P A;  4RCO A;  1I4X A;  1R7S A;  1TY0 A;  4YT0 B;  2K5P A;  2W54 A;  3PQB A;  2BTE A;  1SB3 C;  4GDK B;  2J53 A;  3TEZ A;  1VLB A;  1PDX A;  1FFU C;  4RH6 A;  2IGH A;  3LAE A;  2QMT A;  2RDH A;  2E3T A;  2LHD A;  3AE9 B;  3SEB A;  3MP9 A;  2CJO A;  4AS1 A;  4YSZ B;  4OZC A;  5L6G A;  2DYO A;  1WVF A;  1SEB D;  1GB4 A;  2BB6 A;  2AXR A;  5FXD A;  1F0Z A;  1HQR D;  3AE7 B;  3P4Q B;  1PYW D;  3Q8A A;  2UUU A;  3W5U B;  3TX1 A;  1L0X B;  3T3O A;  1I4G A;  1VR9 A;  1NYR A;  1ZR6 A;  5JXV A;  1T3Q A;  1XLP A;  4LTU A;  1GPX A;  1AHU A;  3RJ8 A;  2WXL A;  3HVD A;  4PVH A;  4MAC A;  1L6V A;  2M56 B;  2G9H D;  2WXG A;  1BML C;  3FIL B;  1T3Q C;  1BUI C;  1UNS A;  2DBY A;  4NZL B;  1QOG A;  2IGD A;  2WXO A;  3RFZ B;  3ETR B;  2VFS A;  4PVJ A;  3VTE A;  1ZXI C;  2WS3 B;  2I2Y A;  3IT6 B;  3FW8 A;  2R8D A;  1W1R A;  1CJE A;  1D5Z C;  1HXY D;  4KKJ A;  4EE2 A;  2RK5 A;  3FAH A;  3A7A A;  1SJE D;  2KWD A;  2VZK D;  3IXS A;  1IBX A;  1DGJ A;  1V1P B;  5AWV A;  4OZA A;  4O95 A;  2H89 B;  5AUK A;  3EGR A;  1XO3 A;  3U7Z A;  4ZYS A;  1ROE A;  1I4Q A;  4AQ7 A;  1V97 A;  1N62 C;  3NVV A;  2AQ1 B;  1AYF A;  4DXG A;  4ML8 A;  4MT5 A;  2WQY B;  1W1L A;  1J7A A;  4JAY A;  1SE3 A;  5LNK 1;  1XXG A;  1CZP A;  2IGG A;  3P42 A;  2QPM A;  3W8Z A;  1MHX A;  1QIL A;  1QT9 A;  1D6E C;  3NS1 B;  1V1O A;  2RMM A;  1AHV A;  1SF0 A;  4XWT A;  3NVY B;  1FM0 D;  3MFG A;  4HKZ E;  4A8X C;  2PW9 A;  1QLB B;  4CQN A;  2JQR B;  1XLN A;  3FIL A;  1MBT A;  2P4P A;  3RJA A;  3SR6 B;  1RYJ A;  3POP A;  2Y3A A;  1WSP A;  4A9A A;  3PO0 A;  3ETR A;  1YMH E;  5FXP A;  5AUI A;  3NRZ A;  1TS4 A;  1ENF A;  1T6B X;  2ICI A;  1L4D B;  2BYT A;  1N5W A;  1XLQ A;  3KQ4 A;  1P7E A;  4REZ A;  3AV8 A;  4YSY B;  3A7U A;  4O1N A;  1N5W C;  2M19 A;  1XLO A;  2LGI A;  3EUB 3;  5BYS A;  1FIQ B;  1JML A;  2SAK A;  1NVI D;  2AQ3 B;  1JWM D;  1SIJ A;  2WXH A;  5MPO A;  5FXF A;  1K53 A;  2EEL A;  4JE3 B;  2P13 A;  1QKZ A;  1QOB A;  3KWV A;  4N58 A;  1FCL A;  1AHZ A;  3GB1 A;  3VRB B;  2VAO A;  1VZ8 A;  3AEB B;  3TSS A;  4RF1 A;  1JRP A;  3SFE B;  4JWS C;  1E0Z A;  3GP7 A;  3TUO A;  4MH8 A;  4A90 A;  4GLS C;  2YVS A;  4HG0 A;  2K0P A;  3AE6 B;  5D3D A;  3V3X A;  4PZF A;  2EKI A;  1ZE3 D;  2I0K A;  4P16 A;  3URY A;  3EUB 2;  1P7F A;  1XF5 L;  1Q10 A;  4MLA A;  1ACC A;  3R2T A;  4PWB A;  3AE2 B;  3NVZ A;  1NYQ A;  3JS8 A;  4DNS A;  4BC9 A;  3SFD B;  3UI3 A;  1JQ4 A;  4XE0 A;  4ARC A;  4NJC A;  3I57 A;  3TEY A;  3S1D A;  3Q69 A;  5C3J B;  1B1Z A;  3IAM 1;  3LYY A;  2IJ0 A;  1X2G A;  3P1M A;  5D79 A;  1PGX A;  1L5P A;  4XLO A;  2N9K A;  4HRO A;  5HG2 A;  5AE1 A;  1X2H A;  2B76 B;  2PVO D;  1VJK A;  2XN9 C;  1MPE A;  1RWS A;  2WDQ B;  4HRS A;  3DED A;  2FE8 A;  1SE2 A;  2NTT A;  3FW7 A;  4IDI A;  1YJI A;  1YJJ A;  1UXY A;  4JB1 A;  1HA5 A;  1MI0 A;  2Y08 A;  3U4E G;  1TY2 A;  3BVZ A;  1AN8 A;  1NI3 A;  5EE1 A;  1M4V A;  3BVM A;  3WCQ A;  4YSX B;  4ZOH C;  3P4P B;  3AH7 A;  1MHH E;  2KN4 A;  1FCC C;  1HSK A;  1F77 A;  1IUE A;  2BT6 A;  5G5H B;  1TS2 A;  2ONQ A;  1RM6 C;  1JWS D;  3NVW B;  2D5G A;  2NQW A;  1V8C A;  1FNW A;  1FXA A;  1XCQ L;  2PLI A;  3DWM A;  2HTM E;  1F2R I;  1QOA A;  1AW7 A;  4ZRP A;  1QOF A;  1B9R A;  2GI9 A;  1YN5 A;  2INP E;  2WXK A;  1GOZ A;  1PGB A;  2WNM A;  1CK1 A;  4ZHP A;  2G1E A;  2W3S A;  2NTS A;  2R61 A;  1OQQ A;  2BB5 A;  4J3O D;  2V3N A;  1E9M A;  2ZW0 A;  2CJN A;  2KDM A;  4OAL A;  2KAJ A;  4UD8 A;  3AEE B;  1E8H A;  2WXR A;  1WGK A;  4C7Z A;  2JU6 X;  2Q85 A;  2MBR A;  3ZJU A;  5TSS A;  2JXT A;  3KWL A;  3W8X A;  3HSU A;  4JX1 C;  2OHF A;  3IAS 1;  4HKQ A;  1KH0 A;  5I4D A;  3ABV B;  3E56 A;  5BMI A;  2W82 A;  4Q2J A;  2K3U A;  1SBB B;  4RGM A;  2JYE A;  1JWB D;  1CQV A;  3W1S A;  1QF6 A;  1C4C A;  1KFY B;  2IDY A;  3TEX A;  1KLG D;  4GDL B;  4H2A A;  2BBC A;  1NEK B;  4P6V F;  2GQU A;  2PKO A;  5D3I B;  2V3P A;  4NAW B;  4RGO S;  1J7C A;  1DIQ A;  2KAC A;  2N0S B;  2ZW1 A;  1FXI A;  2FBW B;  1JAL A;  4B0M A;  2J52 A;  1W1O A;  3S1C A;  4OHJ A;  3AEF B;  3AE3 B;  2LHE A;  3PZ8 A;  4NAM A;  1KLU D;  2YEP F;  3FWA A;  2L1A A;  1F0X A;  1QQR A;  4N6E B;  3AE1 B;  2W55 A;  2GB1 A;  2I38 A;  3GSY A;  3Q8B A;  4TSS A;  1TKE A;  1LO5 D;  1TKG A;  2Q4W A;  4XDC A;  1GAQ B;  3EA6 A;  1T5X D;  1WXQ A;  3BYT B;  1FEH A;  4RNA A;  4YTP B;  1ZP0 B;  4L1B A;  1YN4 A;  3DWG C;  2VFU A;  2PMV A;  1EWC A;  2LMC A;  2QJL A;  4XWW A;  1PUT A;  1N61 A;  2JX5 A;  5EE0 A;  4R3D A;  3MC0 B;  1HZ5 A;  3R2I A;  1V1P A;  3W5V B;  2J4X A;  3I99 A;  1ET6 A;  3P4S B;  1FO4 A;  4KGR A;  1F2R C;  1N61 C;  5E6J A;  3BZD B;  2WDR B;  1C79 A;  4C80 A;  1TS5 A;  4JPS A;  1I4H A;  1W1J A;  2BVH A;  3BVG A;  2UUV A;  4WH4 A;  1VRA B;  3NZ3 A;  2RDG A;  1SB3 B;  3DQ0 A;  2WDW A;  1MVK A;  1FD6 A;  2ACZ B;  3HRD D;  4TVY A;  5G5G B;  2JSV X;  1DOY A;  3NS1 A;  2BS4 B;  5I1W A;  4L2Y A;  3KLS X;  1HZ6 A;  4LLG M;  3VR8 B;  5AE3 A;  3PZ7 A;  3BK2 A;  3A7R A;  2BW2 A;  3D2H A;  3NVY A;  2OED A;  2QEJ C;  4OVZ A;  2WDV B;  2E5A A;  2QIL A;  3BW7 A;  2AQ2 B;  2WXN A;  2VFT A;  1K50 A;  3SR6 A;  1STE A;  2L52 A;  5H8Y E;  3W8W A;  1YQ3 B;  1K51 A;  1FNV A;  1W1Q A;  3P4R B;  1QLU A;  4WIP A;  1YQ4 B;  1VDV A;  4YTM B;  4OW0 A;  3AED B;  3C8Y A;  2WU5 B;  4EC3 A;  1WYG A;  1ET9 A;  1KTK A;  1FMA D;  5HHD G;  4JWU C;  2KQ4 X;  2Y4G A;  3MJ5 A;  4DQO C;  5FR3 A;  1FIQ A;  1C4A A;  3J9C A;  3Q8C A;  4MM3 B;  2DWQ A;  4TVW A;  2JZP A;  1D5M C;  1KRH A;  1I4P A;  1JCK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...