2W3RA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 126
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3rA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3rA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3rA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3rA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3rA04
2MBRA 3D2DA 4ZHOA 5EE1A 1E9MA 3NVYA 5G5GA 3P4QB 2AXRA 4C7YA 2BT6A 2CU3A 2Q4WA 1ZXIA 1V8CA 2AX5A 1A70A 5HMRA 5C2TB 2WU5B 1JRPA 3PO0A 1E6EB 4C80A 1AHZA 2P3HA 2KMMA 3FW8A 1N5XA 3AE6B 1RM6B 3A7AA 2WDQB 1FRRA 1E7PB 3A7UA 2OAIA 2BVFA 2Y5CA 2M56B 3L4PA 1VQZA 4PWCA 1NENB 1AWDA 3TSHA 2EKIA 2P4PA 1N63C 2PIAA 2MJDA 1FRDA 2PVGC 1NYRA 5FXFA 1E8GA 1HSKA 4OALA 1W1SA 3ZYYX 1J7AA 5H8YE 2R8DA 3W8XA 1PDXA 2CJOA 2JX5A 1QOAA 4N6EB 1F0XA 2N0SB 3S1EA 3ABVB 1J7CA 2WLBA 3AE9B 3AEFB 3R07C 1FXAA 1TJEA 2VFUA 2WS3B 3EUB3 3P1MA 1XLNA 1YQ3B 3NVZB 3AE7B 4YXDB 1SB3C 2YVSA 3DEDA 2W54A 1JWAD 2PKOA 1E0YA 4HG0A 2MJ3A 3D2HA 3CWIA 2DWQA 1XLPA 4KX6B 3VRAB 4DNSA 1N61C 4US9A 1FMAD 2BS4B 1ZP0B 3AE2B 5FXDA 2GQUA 4JB1A 1WGKA 5AUIA 2K22A 3NRZB 2W3RA 5FXPA 3AN1A 1J7BA 1FIQB 2M19A 3CIRB 3ETRA 1IUEA 1QOBA 2PLSA 1XO3A 3SR6B 2GQTA 2H88B 4FXCA 3D2JA 3DWMA 2Q85A 5AE2A 1I19A 1X2GA 1QF6A 2WDRB 5AE3A 2W55A 3PM9A 1JQ4A 3P63A 1WRIA 1JROA 1WYGA 1JW9D 1SB3B 5D79A 1AYFA 1E10A 4YSZB 2G1EA 4HRSA 4UD8A 1ZR6A 3BW7A 1KFYB 5AE1A 1L6VA 3AB5A 4TVWA 2L83A 1JWBD 1MBTA 3HRDD 1W1OA 1N5WA 1N61A 1F0ZA 1DOXA 2WDVB 2W3SA 1E8FA 3HVZA 3RPFC 4EC3A 3AH7A 3BIID 4PVKA 2K5PA 1W1RA 3LLBA 3VRBB 3A7RA 5EE9A 4USAA 4JAYA 3SFDB 3NVVB 3NS1B 2VFVA 1MBBA 4N59A 3B9JB 1EWYC 3AEGB 5MPOA 1W1QA 2VFSA 4BC9A 1FM0D 2LEKA 1VLBA 1DOYA 3VR9B 3JS8A 1NVID 2EXRA 4YTPB 5HQXA 4ZOHC 3LB8C 3VTEA 4PVHA 1GPXA 4HROA 4JWSC 1N60C 1FFVC 2I0KA 1QLTA 3NVZA 2QIEB 1N62C 2KAJA 3LAEA 3AE3B 2WQYB 2P13A 3TSJA 4XLOA 3B2GA 1L5PA 2BS3B 4YT0B 4PZFA 3P4PB 2E3TA 1X2HA 3DWGC 1W1LA 3VR8B 4YSXB 1QLUA 1N63A 3HUIA 1ZXIC 3AMZA 2E5AA 4ML8A 1YJIA 3S1CA 3I99A 2L52A 2ACZB 1B9RA 5G5HB 4A9AA 3NRZA 1FXIA 1YQ4B 3AEEB 3P4SB 1FFUC 2WP9B 3WCQA 1FIQA 1PFDA 5AUKA 1VAOA 1UWMA 3SR6A 3KWLA 5HHZA 3NVWB 3AEAB 1R7SA 4ZOHB 3AE5B 1WWTA 3GSYA 1OQRA 4YSYB 4O95A 3AE4B 1KF6B 4PYTA 3EUB2 5EE0A 1KRHA 3W9CB 2OHFA 2DBYA 1ZUD2 5EE3A 4BBYA 1OFFA 3W8WA 4ZHPA 2VFRA 2HTME 4MLAA 2K9XA 1QT9A 1DOIA 3NVYB 5G5GB 4ITKA 1AHVA 3FW7A 4JX1C 3FWAA 5ADZA 1ZOYB 1RYJA 3P4RB 1DIQA 1DIIA 3S1FA 2VFTA 4WQMA 3AECB 3DQ0A 1VDVA 5FXEA 1W1MA 4JWUC 2MH7A 1QOFA 3AV8A 1QOGA 1FFUA 4US8A 3HRDC 1WXQA 1CZPA 1SIJA 1W1KA 3LXFA 4N58A 3NVVA 3W5VB 4YTNB 3NS1A 1NEKB 1PUTA 2BVGA 3FAHA 2WU2B 2QPMA 3AE1B 1E8HA 3B2FA 3B9JA 1YJJA 1JALA 1SF0A 3AEBB 2BVHA 1ROEA 3AM9A 2H89B 4BC7A 2R2ZA 4PVEA 1L0VB 2PLIA 1T3QC 2JQRB 1V97A 3FC4A 5C3JB 4IDIA 3C0PA 4BCAA 3KJMA 1UXYA 4WWMA 2QJLA 5H92C 1AHUA 2CJNA 2MJEA 1NI3A 2QKNA 4LTUA 3FW9A 3TX1A 1TYGB 2VAOA 1DGJA 3AEDB 1TKEA 2PVOD 1RWSA 2Q5WD 4PVJA 1RM6C 5G5HA 1RFKA 1NYQA 1OQQA 1W1JA 1N5WC 1CJEA 3S1DA 2RK5A 2O3GA 1WVEA 1E0ZA 4PWBA 2B76B 1TKGA 1WVFA 1GAQB 2BS2B 3SFEB 4P6VF 3NVWA 1TKYA 2NQWA 1L6UA 1VJKA 1XLQA 2FBWB 3ETRB 3W5UB 1N60A 1DZNA 1FFVA 1T3QA 4YTMB 5GXGB 4C7ZA 3W8ZA 1FO4A 1N62A 1I7HA 1QLBB 3AE8B 4TVYA 1XLOA
chains in the Genus database with same CATH superfamily
1NHPA 2KDIA 3JPQA 3EFUA 3GY1A 4QIWC 3IDWA 2NR2A 3DBLB 4RQ4A 1E9MA 8ICPA 3KVFB 8ICQA 4BGDA 4HJGE 4PHAA 3EECA 3U7DA 2G0AA 4QWAA 2YMMA 4KMUA 3N3KB 2PGEA 2V4RA 3C19A 1ET9A 2G4DB 1H6VA 8ICEA 1KCZA 3A1QA 3GS2A 2JYEA 2WU5B 4C80A 3TFSA 2MBBB 1AHZA 8ICYA 1YMHE 3PW5A 3AE6B 3T5LA 2VH1A 2CHWA 3A4SC 2RDGA 3RH4A 1ENFA 2RGFA 1QTMA 1FRRA 4IRDA 5JZEB 3T9PA 5J0YA 2ZEQA 2OAIA 3H8SA 4C8NA 1ZJNA 3Q2AC 2M0NA 4DL7A 2BQRA 2BVFA 5IIJA 5L6GA 2UYZB 1NDAA 4TUQA 5IDZA 4NAWA 5HI1A 2DGZA 3L08A 3VAWA 4IHCA 3FV9A 4M01A 2ZPYA 4A8EA 4NLCA 3VTUA 1TZZA 2BPCA 1NJWA 5ALRA 2R8HA 4C4VA 1KRPA 4RQ7A 4PWCA 4BBNC 4KSLC 4BJQA 2D3GA 3DOWA 5KG5A 2A5UA 1IP9A 4M9JA 1MNSA 1ET6A 2MUCA 1ZDXA 2L76A 4P0PB 2O2VA 4M2YA 3L8KA 4GSWA 1FNWA 4XRHA 3BQ1A 2JXTA 3MABA 2PVGC 2Z7JA 4I6LB 2UUVA 2FDRA 5KVHA 3JW7A 1TZ1A 4M0AA 3EC8A 4IT1A 1Q1WA 2CJOA 5DDMA 2K8HA 2GBJA 4E0DA 5AM5A 5AKIA 5KAFU 2KJ5A 2BB6A 2CS4A 1F0XA 2FMPA 3P3BA 2W7PA 3ABVB 5AIAA 1WWUA 2W04A 3AE9B 2F1HA 3DFHA 1J2NA 1CQVA 3GZNI 4ZH4A 2Y1JA 4G50A 1FXAA 1TGZB 3RYTA 2HOQA 3V05A 2KFZA 3D32A 2AAQA 4ECTA 1BPYA 1LO5D 4TURA 2GGJA 2VJ4A 3RGTA 2MA1A 3KQ4A 1DNCA 2CRXA 3WALA 1KOTA 4K8GA 5JUMA 2DPJA 3RB6A 1BKHA 4HCLA 1BT0A 4ARIA 5J29A 1GSNA 1ZQEA 4M0WA 1VZ7A 2GLEA 5IO9A 3NVZB 3TFRA 1P0RA 2DYOA 1K4QA 4K3CA 3PSEB 3V7LA 3BYTB 2YVSA 3I28A 3M6KA 3PR4A 2P0IA 2W54A 4QJFB 2M8SA 2PKOA 3B1LX 2F8LA 4ECQA 1E0YA 2PMZF 1MJDA 4J57A 3DK9A 4H4VA 3ZXVA 2GSHA 1TK8A 2YQUA 2E1EA 7ICQA 2AL2A 2YQEA 1Y56A 4R8UB 2BGWA 2JPHA 3VH4B 2D07B 4FLHA 3U30A 4J03A 2FKPA 2ODGA 2KXJA 8ICCA 5HFYA 4US9A 2R8JA 3FILB 2BTEA 1FMAD 2VH2A 2V3PA 1ZP0B 3AE2B 3RNFC 3SAHA 4QZ8A 4OJ6A 2C5LC 4AP4C 1P7DA 1V1PB 4EEWA 1FEAA 1AOGA 1PDYA 3BZKA 3NRZB 1PZNA 3M3JA 3LJ3A 1D8BA 3MGIA 3C29A 4OZAA 3AN1A 4P7IA 3UF8A 5FXPA 3N4FA 3RRHA 2DQNB 2NTSA 4FS1A 4PGXA 1P9DU 4RH6A 2HBJA 5D2MB 1QQ6A 1JPDX 8ICKA 2M19A 3ZTCA 1YX6B 1TAUA 1F9CA 4KLEA 4BZAA 5J04A 1UELA 2KP7A 4I6NB 1SWVA 1XO3A 2C3CA 2PLSA 3UPQA 1BPZA 1L4DB 2G3QB 5ALVA 2M9NA 4RU9A 3IG5A 5AKXA 2BCRA 1COKA 3RNMA 4FXCA 3DWMA 2ZJAA 4BXOB 2HW3A 2D2QA 2Q85A 4F92B 2GWSA 3OJUA 3D9XA 2I5HA 2MBEA 3CGEA 4NEVA 4ED1A 2WDRB 1ZQLA 3RFZB 2W55A 5AE3A 5AM1A 1R4MB 3QQ8B 1ZXHA 2A19A 3EPIA 1JQ4A 3RRGA 2BQUA 3T3OA 2YB4A 4KLQA 7ICNA 4IWPA 3EAOA 2GBNA 1XPYA 1TFRA 2BKRB 2Z0DB 4DO9A 4AUQC 5JXVA 4HLEA 2W0HA 4GN1A 2RSUA 4RQ0A 4EZLA 4GFIA 3PW0A 2XGPA 1VZ8A 2WXOA 2G1EA 1YZ7A 4IG7B 1V5OA 1S10A 1E5WA 4X5VA 4II3B 3ZQ4A 2HJ1A 1SJAA 2PU0A 4J6IA 3MFGA 3N7SC 4DLEA 1IBXB 4ADWA 5K8EA 4G3IA 3F5EA 3IM1A 1X9WA 1AN8A 2L83A 2PXIA 1JWBD 2LI6A 1WXAA 3PX6A 4MM3A 5AM0A 3V3XA 3HRDD 3PPAA 2NVUI 4DF4A 2LJIA 2XBBC 3IN5A 1IV8A 2HBMA 2FLNA 1JWSD 4ZYSA 1A0PA 2EDUA 4CF4A 3R3MA 5KFBA 3U7ZA 1T6BX 3QARA 3NZGA 3MDAA 1S97A 2LM4A 1B43A 8ICAA 2NBWB 2QDEA 4FX9A 2HZGA 1UH6A 1K5OA 3T5JA 2WDTB 5DGAA 3PS6A 1TAMA 3PX0A 1LKYA 3OZMA 2R8IA 1V5TA 3BK2A 3SQSA 2OLAA 3BVMA 1DXSA 2YVCA 4RGOS 3H40A 2DW6A 4EC3A 5ENLA 7ICUA 4LA1A 4J9MA 1UA1A 3CSTA 1IM4A 4ANXA 3PSPA 2INCC 3RAQA 2KN5A 1F0MA 5AKHA 4JPSA 1L7OA 4USAA 4DBGA 3RF9A 1UGJA 4JAYA 3V5FA 2FE8A 2BVCA 3I5JC 9ICWA 3SFDB 3NS1B 1L3UA 2L05A 3EGRA 2PI4A 2HXTA 4UASA 1MBBA 3A9JA 2X8XX 2XH2A 5KFGA 4YL8A 3N6JA 3UXPA 1Z00B 4IM3A 4BC9A 4Y2PA 2LEKA 1VZ6A 1VLBA 5DQGA 2EANA 1WY8A 3VR9B 3BQ0A 3PV1A 3DH9A 1T0SC 3UJ2A 4ED8A 2CHZA 4YTPB 1S3SG 2LM1A 5HQXA 4PH5A 2M4NA 3OZYA 4FFDA 2A3VA 3A9KB 2WXQA 2WX0A 5AK3A 2KIWA 5L1KA 3RJJA 1FNUA 4NNJB 4PVHA 1MQ3A 3VTEA 1GPXA 2JEIA 1R4NB 4Q8EA 1O08A 1V80A 3U52E 3QFBA 2C22A 4DQQA 1WJ6A 1ZDLA 1COOA 3O65B 2QEJC 3GRSA 4MDKE 2QIEB 1IYFA 1UBIA 1N62C 2OFJA 4FBJB 3NUHB 1WJ4A 1Z1VA 3DDMA 3T3FA 4Y2QA 3SZ2A 2KACA 2LJ5A 4YG2A 3ZJTA 2JUOA 2HBKA 2HDEA 4WJNA 2D11A 3HW8A 3OTQA 4CGZA 2GBKA 2WDWA 4UATA 1TTNA 2BCQA 5KFEA 4WWPA 2GR1A 3DWGC 1W1LA 1FPYA 3MBYA 4N9F4 1U4AA 3RNBC 5J0QA 2JWZA 4CF3A 1QLUA 2OG9A 4GMEA 4OJLA 5DQIA 2KHVA 5ALFA 3PVXA 4FBUA 1MPEA 1YJIA 5HP4A 4FJZA 4NL9A 5HHDG 1CUKA 4S0RA 5EWGA 3G6VA 5CX3A 1DGSA 2DUYA 2KMDA 3FG2P 1BUIC 2B21A 4Y2JA 2EELA 1TV9A 3DHIC 4KPRA 2OYYA 1FXIA 3TQ1A 3NUQA 1PDZA 2JVCA 3P4SB 2DAJA 3UI3A 1HEKA 1BMLC 2WOWA 4I27A 3ZNGC 2JF5A 4FZMA 3DPDA 3ISDA 2QILA 9ICCA 3IHPC 2Y4GA 8ICOA 5JCMA 1X42A 3SR6A 1GRTA 3KWLA 4I2DA 4K81A 3AEAB 2O56A 4ZOHB 4MMWA 1MRAA 5BOLA 1XSNA 3WK5A 3ZXRA 4ENLA 3BYYB 2Y1IA 1GB1A 2CFYA 3IC9A 2LYBA 2WP6A 1Y88A 4DOBA 1DRGA 4IRCA 3BK1A 4FADA 3SV4A 2K89A 4W9EA 2RR9A 1JCTA 2IHMA 5DB8A 7ICFA 3QX1A 4RF1A 1ZPSA 4EQXA 4DSEA 3MKCA 3VTWA 2HOFA 5KFDA 2KSOB 4P4PA 3KFUF 2DBYA 4QWBA 3QC8B 2AJQA 1OFFA 1L3TA 1KFSA 4J1OA 4NJCA 3C2LA 4EWJA 1C4AA 3OJ3A 3EJBB 4QZ9A 3RULA 1ZD3A 4M47A 1V59A 3GIMA 3PW2A 3DESA 4DXGA 3EKGA 4IP5A 2GRIA 3JVZX 1DOIA 4IC7B 1X9MA 3D2SA 3EWAA 3ZDBA 3OP2A 2GGEA 4LNNA 2WXHA 2E5SA 1DK2A 2PI5A 8ICGA 3UMBA 5ADZA 4W9IA 1MG8A 1ZOYB 1RYJA 3P4RB 4HK2A 3KLSX 1DIIA 4REZA 5L9XA 4GIBA 1GB4A 4H4TA 5KFNA 2VFTA 3TADA 3MC0B 2QHOA 2KHWB 1FD6A 3OHBA 2X99A 3SAGA 3AECB 4IWQA 4DHZB 3N20C 3ZVVA 4BOZB 4YR0A 3A4RA 1PYWD 2OQYA 2MBOA 1XNSA 2WGSA 1SXEA 1VDVA 4XC2A 2KKPA 3R10A 3PTFC 2I1JA 3W2DA 1GREA 2OWOA 1QOFA 2PFQA 4WJ3B 3AV8A 1NZPA 4NLNA 4BKTA 1QOGA 1FFUA 4US8A 3QZ8A 1JXLA 1WXQA 3BQTA 1UNSA 1TYTA 2QGYA 4DSLA 2W9MA 2LGSA 3BS5B 3URYA 7ICOA 4JIOU 2FPLA 1ZMCA 4N58A 7ICIA 4C0ZA 3NVVA 9ICEA 2J7QB 2F5ZA 9ICXA 2BVGA 2PP0A 3MR6A 2WU2B 3GRTA 3AI5A 2RDHA 2QPMA 3JPOA 7ICJA 4C4TA 1HUOA 1MSWD 3UCCA 2K8CB 2QCZA 2BPGA 3B2FA 3RMKC 4YCXA 3B9JA 5L1MA 2BR0A 3Q8MA 3T8MA 1SIFA 1L0XB 5DG8A 3IBEA 4I2JA 2BVHA 3MGHA 1J19A 2ZIUB 2N9EB 4ZRKA 3R7QA 4E4FA 1QH9A 2LVOA 1Q1RA 3DBHB 1RYSA 4UB6U 5AZGA 1XU4A 3HSUA 2LGIA 2Z59B 4I6PA 4ED3A 5E6JA 1NPXA 4J9NA 2KWVB 3C0RB 4BAXA 2AL1A 2X8GA 1N56A 1BPBA 2W11A 2Y9TA 5C3JB 2GMIC 1TS5A 3C1ZA 2VRRB 3K9PB 1STZA 2I1QA 3C0PA 4E8GA 3II4A 3R8BA 1RVKA 2P8BA 3CMMB 3VCCA 2QARB 1UXYA 5HR7A 4F5RA 4H4UA 1T4GA 2IHNA 2KOXA 1FXTB 2QJLA 4IR9A 4TV3A 3AUOA 1C79A 1VD2A 3DIPA 3FDSA 2IOHA 4CCHA 1XDIA 3I4KA 3P93A 4EMIA 1H8CA 2WBAA 5KG6A 3HIZA 2KHQA 3NHEB 3T5HA 5LNK1 1ZKQA 2W9CB 3UMGA 4MF2A 8ICBA 3QN3A 3H8JA 4PHDA 2MP2B 4Y2VA 3TX1A 3RTVA 3DEQA 3WU2U 2IY1B 1I4GA 3V7JA 3LDAA 1AQ6A 1MVKA 1TYGB 2LGDA 2ESEA 3ONSA 1N6ZA 3FM9A 2HHQA 4KIKA 2SAKA 3TKAA 2Q5WD 1NOMA 4PVJA 1RM6C 3PV8A 4WAFA 5G5HA 3ENEA 1NYQA 2Y5BB 3Q8QB 4A6QA 4ECVA 3DG7A 4JK1A 3VTVA 9ICGA 1N5WC 4Y2UA 4PS8A 4L23A 3HP6A 2BDPA 1C20A 2NPTB 1FEZA 3KH0A 1T5XD 1C9FA 5ALWA 1ZQHA 3VDZA 2F3NA 1IGDA 3QNMA 1TKGA 1V85A 2ZCCA 2C3DA 2OH2A 3T8QA 1UGMA 3HKZF 4P6VF 3T4WA 3NVWA 2HHWA 1E8ZA 4H4RA 4Q2JA 2BKFA 4RQ2A 3WKCA 3PMNA 5JTIA 2XI9A 2KO3A 5E6PA 4YN4A 5ER0A 5DCNA 1PK1B 5DG9A 4LNIA 1T3QA 2MSNA 1TS4A 1ZQ1C 4C7ZA 4KN7A 1FO4A 2JXJA 4EZ9A 1N62A 2JXXA 2FIDA 1I7HA 3RJAA 3QE9Y 2LHTA 4TVYA 3VFCA 1D5ZC 2JEJA 4JWNA 5DDYA 1UA0A 4KDIC 2MBRA 2K8BA 3D2DA 5KFRA 3GC2A 4UB8U 5EE1A 2R61A 2WOIA 3IJQA 5FMHA 4O5CA 2WWZA 4UBBA 3NVYA 4PL1A 3IV6A 1MN8A 4HKQA 5G5GA 2KVCA 2K1FA 2EH9A 4ACOA 4I2GA 1WCNA 2BT6A 2VZKB 4WURA 3ZRCA 3WKDA 4U7CA 1V8CA 3DVNU 3THVA 5TR5A 5LLIA 1QSLA 1M6YA 5J2IA 3ZDCA 3U4FA 4RT2A 3RJFA 3P0WA 1L2NA 5FJOA 4YWGG 5D3DA 1V9JA 4QZFA 2P3HA 4OW0A 4X57B 5J2BA 3LWLA 1SL2A 1C4CA 1ZQSA 3R2IA 3RITA 1MG4A 2PMVA 4DYEA 3GIKA 2WDQB 3KWVA 1L7PA 2J0JA 1E7PB 3A7UA 1UZXB 2K6DB 5T14A 1SZHA 1DXLA 1BPEA 2ZTEA 1R0MA 1WCLA 2P8CA 3U9IA 2E6XA 4RNNA 3L4PA 4OVUA 4O5EA 1VQZA 1RPLA 3MSYA 3MDCA 4HPLB 3RR1A 2JHDA 4NM1A 4DFJA 3TUOA 1SKSA 1SJED 3S6JA 1SE9A 3TCAA 3X0WA 2ASDA 1WZ3A 1L8PA 1U49A 1HZ6A 4FJYA 4HCNB 3TI0A 3I63C 5BOFA 5EWFA 3WK9A 3V6EB 5KG1A 4OJPA 4LZDA 4I2EA 1E8WA 2EKIA 3RCYA 2HVHA 2WXRA 1KLNA 1N63C 2PIAA 4P0QB 1Z4NA 4YFKA 2EQ7A 2Q4TA 2F2AB 5D6JB 3UXNA 4P0PA 4B9MA 1FRDA 4ECYA 2ZW1A 2MAXA 4IM0A 1ZMDA 5J0TA 2QC8A 4Y2SA 5E6OA 5KG4A 2DX5B 2KZRA 5GTHU 3ZYYX 5IP4D 1W1SA 3H8HA 2R8DA 2YLMA 5KG7A 3PZPA 2AU0A 2NYVA 1SE2A 3Q69A 2G06A 3ETLA 1PVPA 3BDPA 2GQWA 5CHFA 4UW9A 1P3QU 2ONEA 4EX7A 1MI0A 4N6EB 3TEYA 4KWSA 3DJJA 1P7FA 2ZCBA 4EELA 1J7CA 2WLBA 3ZIMA 2Y5PA 4BWJA 5KFAA 2XCAA 4ELTA 8ICUA 3L5OA 3GV5B 2YVGA 2ZXHA 3MFHA 4RQ8A 3ZDAA 2KD0A 2DKZA 2IMWP 1TS2A 2IOFK 2A4ZA 2KT7A 3OJ4B 5KFLA 4W9HA 2WPFA 5TR3A 4RQ3A 2J6TA 2MX2A 8ICVA 2V1YA 1JUDA 2J4XA 2O6VD 2REXA 2BDUA 3KKAA 3DHGC 4P1CC 4IL2A 3RJEA 4FA6A 4UAYA 4OD0A 1U47A 4W9LA 4HAIA 2KFKB 4TSSA 2LVPA 2JY6A 5DBAA 2LVQA 4EQSA 4JWMA 3P1MA 1Q10A 1UQVA 2JZBB 4AWJA 5BMGA 4B95A 5CEHA 5EWEA 7ICMA 3QA8A 2FCQA 4GDKB 1J8CA 3Q3JA 1JXEA 1SB3C 3Q8EA 5EBKA 4JE3B 3Q8FA 3F2CA 2IA6A 1XT9B 1JWAD 1GOZA 1OQYA 3UXKA 4MFCA 5JRBA 2WXMA 2ZTDA 4P4OA 3T79A 2DYMA 3D2HA 4KT2A 4EENA 3TBLD 4YP3A 3H7PA 2DWQA 1X2IA 9ICJA 2V4LA 2PTZA 1OEPA 3HM6X 3VRAB 1D5MC 4IC9A 3GZNB 3QJZA 4Y2RA 3IK4A 5KT7A 3RJGA 2KWCA 4H4XA 2ZZBA 2MEKA 3QK0A 3PSTA 5C0YA 4AYBF 2WXJA 1XEEA 4JQWC 2PLPA 1F1HA 3EPGA 4B6WA 5I1WA 4E4UA 2D8CA 2V3BA 3VUXA 1WGKA 3Q6JA 2K22A 2EKEC 4P4MA 1BQGA 1D4BA 3MTNB 4NM2A 3UM9A 2ZVOA 1RLFA 1A6SA 1RAXA 2RDIA 4ECRA 5IIOA 4F2RA 1UWXA 4DFMA 1ZQQA 2XN9C 4PT5A 4TUUA 1FIQB 4PHEA 3RZFA 1IUEA 4EE2A 5HKHA 2BCPA 3KD3A 3IG8A 4DQSA 4I28A 2XY6A 3BSMA 4XUSA 4B9TA 4GU2A 2H88B 5AKYA 4YR3A 3D2JA 1NNLA 2ZG6A 1RXVA 1WGGA 1L8LA 2XY5A 4FN2A 1BNOA 2HBLA 3RNEC 4RQ5A 5KFYA 1B22A 2KJRA 2OZ3A 4M0XA 3MWCA 4W9KA 3PWGA 1TK5A 5FP0A 3IXSA 5J18A 1SJBA 1JROA 1WYGA 1B4FA 4ELUA 4RMAA 3SD7A 5ALDA 2IO1B 3TWBA 1L3SA 5AI6A 2EAMA 4KDLB 2KFJA 4J9SA 3PMLA 4DQRA 3HWTA 4ELVA 3UMCA 1EU4A 1Z4OA 1E10A 3OG5A 5DQHA 5DG7A 2K4IA 5J0XA 3BW7A 4UD8A 2WF6A 5HHHA 5IAAC 2WB1F 5AE1A 2KVZA 5EOZA 1L6VA 5KG2A 2IOFA 3C8YA 1N5WA 1I4RA 3K1GA 3URHA 5DBCA 4DOCA 1N61A 2IZVB 2KMAA 4F8CB 1DOXA 2QB0B 2ZZPB 1ZQBA 2ZTCA 1KKRA 2YVJA 3Q45A 4EYHB 2FAZA 1PVRA 4WAAA 4H4YA 4KLLA 4JB3A 3EJDB 3N6HA 5AI8A 5B5EU 5J0PA 2OZTA 3RI7C 2CR5A 3SENA 2WXNA 4LDTB 1E8FA 2BC0A 2HDOA 3HM3A 3EEZA 3HPFA 4O3RA 3BINA 3SEBA 2RDBC 5FS6A 4DQOC 3QX7A 3ONNA 2BCVA 2ZJDA 8ICWA 2HXUA 5GRTA 3IHQB 2PPHA 1DYQA 3AH7A 4FBTA 3C5FA 2X50A 5JCLA 3BIID 1RXWA 2W9BB 1WR6E 4CHKA 4NL9C 3KTQA 4RZRA 2KTRA 4J3OD 3VRBB 2MUTA 1QZEA 2BC1A 3QKEA 5U25A 2JZPA 1SXTA 2QJNA 3ZDMC 4EBCA 2E8MA 3L3FX 2R8KA 2KK0A 2KDBA 4NJ7A 5AM3A 1K51A 4MELA 8ICMA 1OEYJ 4ZA0A 2ATLA 2W9AA 2Y0SF 1S0NA 4LVSA 4CDGA 3AEGB 1W1QA 4IKGA 1FM0D 4K1RB 2BCSA 3JSVA 4F4KA 2J6SA 1KJTA 3JS8A 3QUTA 4J9PA 2FLPA 2ZNVC 3QYPA 3TQPA 3OAWA 3AULA 4Q8FA 1SBBB 3VDGA 3WKEA 2BKEA 3N4EA 1YN3A 3WAOA 2FUG1 3N7RC 3N28A 1F52A 5KFVA 4JWSC 5DGBA 1N60C 1FFVC 1F8WA 4M9NA 2WTFA 2E1FA 2C2DA 2V3AA 4ICAA 4H1ZA 3LAEA 3OSPA 4MEXA 1EU3A 2YVFA 3GFKB 4U6PA 1WE7A 3RB0A 4B9SA 1QKZA 3ORYA 4WJOA 1ONFA 1QQ5A 5C23A 3VQIA 4A20A 3V6HA 3S5SA 2PMZC 1YOVB 3MUCA 4B9KA 1J2MA 2BS3B 4B6JA 1UT5A 1ZKHA 2OJRA 5L83A 2E3TA 2V4QA 2XH7A 3G6XA 3DGBA 1Q5WB 2BF8B 4ACFA 2PPGA 3ZLGA 5HMLA 4ZRQA 3OPSA 2KJ6A 4EOYA 3FXGA 3NTUA 3N97B 1WMHB 3MP9A 3PT2B 3VR8B 2KIVA 1V86A 1N63A 4EZJA 1LM8B 1L8OA 3AMZA 3NASA 2QKQA 1CMXB 2JR5A 2FCSA 2ZIWA 3I99A 1S5LU 1SJHD 2QB1A 4I2IA 3TADC 4HEA1 4HYRA 2A8XA 3GE8C 3K1ZA 5H2FU 4RGMA 3VUYA 3QUBA 4DWFA 5AHXA 5BPCA 1B9RA 9ICSA 4TQ1A 1EC8A 1HZ5A 4RQNA 4LNFA 1EBDA 4H50A 4KGRA 2PE9A 2PTWA 1S77D 1ZW7A 4FJVB 1SXDA 3VA8A 2KZZA 2WXGA 2L32A 4UDUC 3APDA 5ALZA 2WOVA 5C1ZA 3E58A 1FFUC 2RMMA 5AUKA 4GXKA 3RNGC 1EWCA 2WP5A 1UWMA 1MO9A 2PODA 4KZCA 1KTKA 4EX6A 2HNEA 4TUSA 3AE5B 2ZIVA 1WWTA 1F2RI 2KOBA 3CB3A 2N1RA 1OQRA 1KQQA 5BOMA 5IN7A 2H3QA 2PMQA 2AQ1B 1WUEA 4XQ8A 2HHSA 2VKQA 3EUB2 3W9CB 1D9FA 4MACA 2POZA 4DFPA 4P2HA 5KFJA 2OHFA 2OCEA 4B0MA 1JEHA 2Y9UA 4YXJA 4K4GA 2RRDA 5EE3A 4W9DA 2KEYA 3RR7A 2VFRA 3UQ2A 5K4LA 2YMQA 1QSSA 2RPQA 3E9SA 1YD8U 2O6VA 3PRMB 1QT9A 5KFSA 3M95A 1S1QB 2KNBA 3D2NA 3VCBA 2ZXIA 4GYPA 3BS7A 4GGQA 2NRXA 2XO7A 3R9KA 3FW7A 3CT2A 8ICTA 4DS4A 1ZY8A 4HCDA 4QZEA 3PQBA 4RQ1A 3A1QB 3E2EA 8ICRA 1T7PA 4UB4A 1GO3F 3SYZA 5C5JA 9ICNA 4RNAA 3PRPB 4MJSA 3X23A 4F4WA 2AKZA 3GZFA 1CK1A 4ASWC 4K7SA 1CEZA 1KH0A 3RFAA 4QZAA 5L1JA 3H7VA 5ALTA 3PLUA 4WQMA 1PVQA 3U8ZA 5L1IA 2KKVA 2FNJB 4MF8A 3THUA 2F8KA 5FXEA 1W1MA 1DTNA 4AJWA 4M6UA 3APFA 2MH7A 1URJA 2RLTA 4JWUC 4O1NA 5JU5A 2XC9A 1ZRMA 4EYIB 2JMGA 4ECZA 1ISNA 1MFWA 2CKHB 2J0MA 5D4BA 4NAWB 5BO4B 3HRDC 3SI8A 2KVRA 3TW9A 2M1MA 4F93B 4H4QA 1J97A 5CP2A 4C4VB 5LXHA 2KTFA 2ZIXA 5D49A 2PEAA 2KX3A 3LXFA 2RD0A 2GR0A 3W5VB 4KLHA 5ALOA 2XY7A 1NEKB 3Q8BA 2LRUA 3FAHA 2DZKA 2O2VB 3AE1B 1ZQRA 3CGBA 2UVWA 3CAWA 4C4SA 2I5QA 4OCZA 4F72A 4WH4A 5HMMA 2LZ6A 2KE7A 2YMPA 4B9LA 2N9XA 2QDFA 3OWEB 1JCKB 2BBCA 3TOYA 2X8HA 2YAUA 4Z6EA 5EU9A 2NS5A 1UPHA 1ROEA 3JW0X 8ICJA 1U9LA 3AM9A 1WG8A 1IPGA 3QHTA 3CYMA 1GRBA 4R66A 1V49A 1Q8KA 5AKZA 3M9MB 4F4XA 2INNE 2NPXA 2R2ZA 2ON8A 4O3OA 4QZIA 2PLIA 1T3QC 2JQRB 3P42A 4GGBA 1JI7A 3FC4A 4YD2A 3OHAA 1F44A 2DAFA 3ZTDA 3DGZA 1XQQA 2H5XA 3OTRA 4A35A 2LASA 1ZK7A 1GC7A 3KJMA 3J81j 4TUPA 1SSNA 4B9NA 4KGTA 1ZE3D 4WWMA 1D8LA 2QARA 4W9CA 1TIFA 1BPDA 1GUAB 2FIFA 2I9GA 5DLFA 3GIIA 1XSPA 1XC9A 3QU4A 4K8DA 3SQPA 2XVTA 4M0WB 5D3IB 2Y08A 1NI3A 2OKTA 5IINA 2KYWA 3ZNHB 1UT8A 5KFOA 9ICOA 4RPYA 1XCQL 4XDDA 2ZC8A 4OZCA 2I6XA 3MR2A 5KL1B 2XICA 4IQWA 1T0YA 4LTUA 4W9JA 3TSSA 4Q43A 4NZLB 4NY0A 1DGJA 2G9HD 5DBBA 3AEDB 2K4PA 4AQ7A 2AL2B 1TYPA 4O5KA 4IS7A 1F2RC 2PVOD 4HWIB 1H2IA 1RWSA 3M8SA 4DFKA 4NLZA 3TJIA 1Y8RC 3NS8A 4FP1A 1ZQDA 1PUZA 1ZGUB 1W1JA 3ZRFA 4QZGA 4GGHA 5J2DA 2RK5A 1WX9A 1WVEA 3RRAA 2GH1A 2WXPA 4KN4A 5ALPA 3QUCA 1M4VA 3IJLA 3RBEA 1E0ZA 1EF1A 5AIBA 4Q44A 3ZNZB 2C9WB 5FJPA 2VA3A 1Z1BA 2AH5A 1S0MA 1TS3A 2IYDB 2JU6X 2FCMA 4OJ5A 2W9NA 4MEMA 4JN8A 2VANA 2XGZA 2KANA 1FNVA 1TKYA 4FULA 3F53A 2JZZA 3TMPB 2OEDA 5HG2A 2MNRA 4GC7A 1I4QA 1L6UA 2QLTA 2FBWB 1LFDA 2LXAA 1ZYQA 2AQ2B 1N60A 3E56A 1FFVA 3TCSA 2KTQA 2Y3RA 4I2CA 4MHVA 1L0YB 4FHKA 3CF6E 2LRWA 1SZPA 2R2QA 3F5AA 1QLBB 4EQRA 3RZWC 5KT3A 2K25A 1XF5L 1XLOA 5J2HA 4ZHOA 2G4SA 2JWUA 1IYXA 3TANA 3BZCA 2JGAA 1I4PA 2AWTA 2KV2A 4FDCB 4LLGM 1LPFA 2AXRA 1K52A 2DW7A 2CU3A 3KKAC 3UINB 4XX5A 2AX5A 1A70A 1P48A 4F4ZA 3BVGA 9ICAA 2UWQA 3I6TA 5HMRA 5C2TB 4MGYE 1E6EB 2V9WA 3RJKA 4HCHA 1L6NA 3CXBA 2IPIA 2KMMA 4J9OA 4UAUA 1E7UA 5A0LA 3FKYA 3LVVA 3QEBZ 1Z3EB 1ZQCA 2KNJA 3RAXA 2HE7A 3IT6B 1GEUA 5IKCM 3A7AA 3UJSA 3NG0A 4XE0A 2A1JA 2GBRA 3RH5A 4TQ0A 1KEJA 1HQRD 4GRTA 2N9KA 1AW7A 1XXGA 1YNTE 3ZLFA 4YMNA 1Z19A 4EFOA 4F4YA 3QAQA 4QNLA 5KFCA 4K7UA 3PO5A 4UB3A 4I2HA 1A77A 1Q0WB 2ASJA 3WK7A 2X38A 1LKYB 2GDQA 3PX4A 2M0XA 4QWDA 2XH0A 1NENB 1MA7A 3L5KA 3EYZA 1AWDA 2JSVX 3TSHA 4B0EA 5KFZA 1WX8A 3ZJUA 4GIVA 3S2AA 4R63A 3ZKJC 4KLJA 3ZVIA 4MH8A 5CWRA 4GFJA 1ZETA 4MFFA 1EBHA 3UIOB 1NK8A 1TY0A 3V6KA 2LGYA 2NCNA 1NYRA 1LVLA 1ZQIA 4OALA 3MJ5A 2UU7A 1HE8A 3H0RB 1J7AA 2KDMA 4FHJA 4YVZA 2GR3A 3W8XA 1P7EA 3PZ8A 3D46A 4JV2A 5T8IA 4DHJB 4IL6U 4GR1A 3STPA 1JMSA 1NDDA 2JX5A 4KVGB 3PY8A 1D6EC 3M8RA 1D5XC 1QOAA 2KX0A 1GXFA 3A9JB 5ALQA 3IAM1 4K3BA 4F5NA 3OPXA 4M6WA 4KLIA 4BKGA 2OPJA 4PS7A 4DXKA 5AICA 1ED1A 1E9IA 1ZX9A 2NRVA 3AEFB 4DQPA 3GD3A 5ALKA 4RGNA 3DDHA 1TJEA 1C77A 5JCKA 3CRXA 4NLBA 1H38A 4KGSA 3H1UA 4WJQA 3N4MB 1KL9A 2VJ5A 7ICSA 3N1ZC 2C7MB 2VFUA 1YN5A 3KHRA 2GLSA 2WS3B 2WYQA 3AU5A 4KLMA 3EUB3 3QU5A 1PQSA 3HVDA 4DWDA 1EC9A 2NQLA 1XLNA 1YN4A 2PKEA 1WRDB 1YQ3B 4RQ6A 3RBDA 2KICA 1BNPA 3QPEA 5J2EA 4YXDB 3ZLHA 1NJYA 1EBGA 4KLSA 4ICUA 3QXGA 4JHMA 1NJXA 3JZUA 3PR5B 3PRZA 3DEDA 4RM8A 2RP5A 2K8AA 3Q8LA 1ZD2P 5KFPA 3ISBA 3SJNA 2H3VA 4C8OA 2MJ3A 3ZVHA 9ICPA 3CW2C 3KHLA 1MHHE 4WIPA 5FR3A 1WJUA 4LJOB 3V61A 1EUVB 4ED2A 3KZXA 3SSZA 3V62A 3HPOA 2KZMA 1QLNA 2BYFA 1TAQA 2JRIB 4XWTA 1N61C 2IPKD 1SV0A 2PCEA 4GDLA 1JWMD 5EDSA 4JQ9A 3PW7A 4XDCA 1FEBA 8ICHA 2BS4B 5DB9A 2WXKA 2IGDA 3SDLC 3LWMA 1WFYA 1V9PA 2GGGA 3KUDB 2GQUA 3H70A 3SN1A 5AK4A 5AUIA 1IXRA 3QLDA 8ICZA 2ZJ5A 3HT3A 1UD7A 2DHZA 3HKZC 2HHXA 5BYQA 5L6FA 4DDID 4C4RA 2RABA 1KD0A 1V38A 2BQQA 4HYKA 1MOKA 2LXCA 2DLBA 1U48A 3EANA 3ETRA 1ESFA 3JPRA 7ENLA 4PGQA 1X9SA 8ICXA 2MCNB 2BPSA 3FJ4A 3SR6B 4GMVA 2GQTA 1WIAA 9ICTA 2N4FA 3TEXA 5IILA 3NZUA 5F3XB 5KFUA 3I3TB 3PG6A 3B0AA 1NK9A 5FS7A 3GP7A 3ED5A 4PPXA 1I19A 1X2GA 1GERA 2YX8A 1P43A 2V4IB 3R7RA 2NRZA 5J2CA 3PM9A 2MBHA 2JT4B 3P63A 2LMRA 2WPEA 3TTEA 3GD6A 4W9FA 1VRAB 3WKBA 2LYAA 3ZI4A 1KW4A 5KFIA 2ICIA 2RHFA 4HJKA 2CN1A 5AKEA 4QZDA 3W1SA 3ZW3A 4KEMA 2M0AA 4G9BA 1SL1A 1ECWA 9ICMA 4NQKE 2HSZA 3ZDDA 1X9XA 3PLVA 3R11A 5IIMA 4DL6A 1AYFA 3O0FA 2W43A 5CHWA 5KFHA 1AARA 3ES7A 4HRSA 4EEKA 4H4ZA 1ZR6A 4DOAA 5AM2A 1KFYB 2V6OA 3NFUA 1DK3A 4IR1A 1NK6A 4PYZA 3AB5A 1HIWA 4DQIA 2HHUA 4TVWA 2FPMA 2PFNA 1I35A 4HDOA 2J52A 5BMHA 1TY2A 3UQ0A 4MGIE 3PREA 3N7PD 2DKXA 2JEFA 1L4ZB 3V6CB 1TT5B 1ZQZA 2MRLA 4NV0A 1A5RA 2OEHA 2MHJA 3RUIB 1XWLA 1YZ6A 5KTQA 4DXAB 2WPCA 4UQGA 4CE6A 1T0RC 2W3SA 4KLGA 4C56C 4A3PA 4Z6FA 2EQ8A 5IA7A 4XWWA 4RPZA 4IL0A 3MGVA 1C4PA 2AL3A 2B0CA 2N1VA 3FVDA 4J56A 3RPFC 5J0WA 5D46A 5BYRA 4IWOA 2ZUCA 2HVIA 1FEHA 1FCCC 2K5PA 3ZGZA 3Q3FA 1ZQKA 4A3RA 3A7RA 3OJSA 5EE9A 2PA6A 1ZQFA 2QQ6A 1TZOA 5CRXA 3V6JA 4DHGA 3BWUD 3NVVB 3KOOA 1XCTL 9ICBA 4GB9A 4J9KA 3C2KA 2ZZCA 4RF0A 1WXVA 1JDFA 2D3DA 4ED0A 5LXIB 4EMJA 2VFVA 2PJHA 1S0VA 1S76D 2AL6A 1KLUD 3GILA 3QIJA 4N59A 2VFSA 3B9JB 4PYUA 4PZOA 3V3WA 5AK6A 3QU2A 3Q8RB 4O3QA 3Q4DA 3Q3OC 1LVHA 1NVID 2CPRA 2LMCA 3QU9A 3ICXA 2INPE 5J17A 4ZOHC 3BQ7A 4ECUA 3SU8X 2WXIA 5FJTA 4C8LA 2NBVB 1RYUA 3TAPA 4TQSA 1ACCA 3KYDD 1KFTA 1BGXT 4G0NB 4HROA 2AQ3B 3U2SC 3OW1A 2HQMA 2P35A 2WAQF 3NVZA 1JX4A 5J2FA 4H2AA 3DERA 1ZQTA 1M94A 3EHVA 3UJEA 2KAJA 4NAMA 4MGKE 5AZFA 2PGWA 2NO4A 5AI4A 2BB5A 3AE3B 3MZNA 2KJ9A 4L1BA 4UARA 3QWZB 4QW9A 2NVKX 4FI4A 1SJCA 5KT2A 3DVNV 5KT5A 3KBBA 4O0IA 3G6YA 2R2OA 4XLOA 3TSJA 3B2GA 1L5PA 3UXLA 4PZFA 1ZD4A 3P4PB 4CQNA 4GYPC 4YXMA 2W03A 4DSIA 1KLVA 4R8UA 1WM3A 4YSXB 2C2EA 1SKWA 1YIWA 2LHEA 1BWCA 3HUIA 1ZXIC 1E90A 2L8JA 2ZJ8A 2Y3SA 4PZNA 2D6FC 2R18A 3FILA 4HCPB 5KFMA 3C2MA 4WJPA 4AYBC 3RR8A 4KIKB 2CDUA 3V60A 1V1PA 3DEEA 4E71A 5G5HB 3K4GA 1P1AA 3HK0A 3NRZA 4A9AA 3CNHA 4DEZA 6ENLA 1YQ4B 4NPNA 5FKAC 4DX3A 1VR9A 4KZ0A 4ROPA 5I1VA 5J2GA 4BVUC 1NZBA 3RD2A 1PFDA 1RRBA 4BFRA 1KFDA 4DDGD 2E8NA 3MQTA 3L13A 2K4HA 5DPRA 1VAOA 3WK8A 4H4WA 1WXMA 4G11A 3V5CA 4J3ZA 2LYHA 1B1ZA 3GB1A 5HHZA 4ZRIA 5J0SA 3NVWB 4RQMA 1EO6A 3GSYA 1V6EA 4BXOA 3QU7A 3DBRI 3ZDTA 8ICNA 3E0FA 3KUZA 4ZRJA 2ALZA 3B97A 4K1WA 3Q6BA 2OJWA 1R6WA 3TWAA 2K39A 3SBFA 1LXDA 2D5GA 1WUDA 4ANWA 3C1YA 4O95A 4PYTA 3TJPA 5EE0A 4CO7A 4YWSA 1KRHA 3KHHA 4I2AA 2F44A 2DYBA 1OTRB 2IO3B 2A1AA 5FS8A 4MSMB 1LQBA 2HTME 4MLAA 2K8BB 3GQCA 4QIWF 3AU6A 2K9XA 1IGCA 4CF5A 1MDLA 1STEA 2NTTA 2ISOA 4H83A 4RPXA 3CXOA 1WJNA 3NVYB 3DCGA 3RN9C 1F9JA 5G5GB 1BVSA 2WF5A 1IBXA 2E8PA 4EM3A 2WB1C 5G55A 2IO2B 3B0YA 3DJGX 4HPPA 1ZQYA 5CR0A 1L5UA 4Y2YA 2FUHB 2KQSA 1D7YA 4NLGA 2GOWA 2G5IB 4F8RA 3IJIA 4LNOA 4BURA 1BXTA 1SL0A 1XS2A 5D7GA 4MH0E 4ZYNA 1J0GA 4DHZE 2N7DA 3EFCA 1ZQMA 3QFAA 2LBOA 1T94A 1TE6A 4MGZE 4QWCA 3RNAC 1NKBA 2SEBD 1N2XA 1ZOLA 1FECA 1NHSA 4JGHB 2FE9A 3Q8KA 4AJYB 3HW2A 1KKXA 4BX9C 5KHOA 4RUAA 3I9V1 3SHQA 4R65A 4TMAB 2ZADA 4DL5A 3HJEA 1GETA 4GLXA 2GBMA 2N9LA 3K9OB 5GMVA 2LHDA 2NRWA 1OW5A 4PS3A 1KM7A 2G08A 5ALHA 5KAIU 1SIJA 3H8MA 2INDC 4BBNF 1W1KA 2FI1A 2QVHA 4IZGA 3DHHC 2EQYA 3ZO5B 1JN3A 4HKZE 2NO5A 1ZQGA 1EM7A 4YTNB 3NS1A 3AL0B 1HA5A 1ZQWA 2ES6A 1XANA 4S17A 5KHQA 4UB2A 4DXFA 2XGQA 2BYVE 4FZLA 2Y0SC 9ICIA 4PL2A 3GIJA 2IO0B 5KNIA 1UUPA 3UIPB 3H7IA 4Z1YA 3ZDEA 2KLGA 1Z00A 3TL5A 3RB4A 1H4RA 3RO6A 7ICHA 1SF0A 2DFLA 2MRPA 4PJ0U 3Q8CA 3AU2A 1AROP 4F50A 2H89B 3A9KA 3IG3A 3PGEA 2DZIA 2JH7A 2F76X 3GDXA 4PVEA 2EQ9A 1KTQA 1L0VB 2VZKD 3B08A 3IVFA 1LV5A 1QSYA 2YEPB 3H9DA 1MDRA 3OC4A 1SKRA 2ZZ0A 3DDCB 2OVLA 2ZUDA 3JYUA 1NKCA 4G3XB 2KDFB 1FHVA 1F3PA 4BCAA 3LYYA 5ALMA 4K7WA 1ECQA 3D2QA 2F77X 5H92C 2WF7A 1LB2B 1AHUA 3ES8A 2ZVNA 5J8YA 2K0PA 3Q8AA 4IQVA 2CJNA 1WUFA 3UGVA 4TQRA 2MJEA 4MFAA 5BYSA 3UXOA 3U26A 4UBCA 3BZDB 3BJSA 1ZQUA 1L7NA 4YMMA 1XSLA 2KG5A 1ZQJA 2QJMA 4JMUA 4MT5A 2AYOB 2QKNA 2GOLA 2UVVA 4IOIE 2JRHA 3FW9A 1HUZA 2I38A 4ML8A 3N9YC 9ICQA 2VAOA 3V4BA 8ICLA 2I1KA 3VFKA 4ICVA 2M17A 3WAMA 4NEWA 3NZ3A 3H7PB 3EF6A 1NI2A 3UCDA 1RYRA 3DBLI 4ECXA 1QQRA 4PHPA 1UHUA 5KFQA 3WA0A 1GRAA 4KKJA 1MQ2A 2XEWA 2N9PC 1XO1A 1N48A 2JYTA 2MBQA 1CJEA 2FMQA 3S1DA 1S0OA 2J42A 4LZGA 2FLLA 3UQBA 3PFRA 2FYMA 4XA5A 2XH4A 2BWES 3VCNA 2XK5B 5FJUA 2ZUBA 4BKSA 3DBSA 2B76B 1C78A 1GAQB 2Y3AA 4QZCA 2PTYA 3JPNA 3KZIU 2WHIA 5ALSA 2BS2B 2HMXA 4A90A 3SFEB 5TISU 4F7ZA 1A76A 3AQEA 1W6TA 2EZZA 1CI4A 2G45B 5FJRA 1E7VA 5J2KA 3M6ZA 2XCPA 2ONQA 1WWVA 2WHEA 1VJKA 4MGGA 1XLQA 4RT3A 4EQWA 2BWFA 4G8TA 5J0RA 3GU3A 5AM4A 2P66A 2H3IA 2N1WA 1DZNA 2KWDA 4YTMB 5GXGB 3OGUA 2EAPA 4O3PA 3H8AA 2KSOA 3NJTA 3DVGX 2GB1A 3O0HA 5KL8B 2AHOB 4URKA 2KN4A 3D6JA 2I2YA 1D8YA 4RGTA 5ALGA 1ZQPA 4IP4A 4GLSC 4X2PA 4DL3A 3M63B 4CYEA 1C3TA 2D10A 7ICVA 3P4QB 2XSXA 1KSPA 4C7YA 1IG6A 2KD1A 4HPMB 4RFBA 4GXJA 2Q4WA 1ZXIA 3SV3A 2MA9B 2UUUA 4JV0A 5F9LA 1NK0A 3PNCA 3PO0A 1JRPA 4ED7A 5AKLA 1T3NA 2GR2A 3FW8A 1N5XA 5DB6A 1XD3B 3L10B 3PZ7A 5BMIA 1RM6B 2P3ZA 3JVAA 2WXFA 4BWMA 2IJ0A 5AEKB 4DF8A 4YQWA 4UB1A 1ELSA 1SV4A 3CSFA 2KWUB 5JCNA 5L95C 9ICFA 4O3SA 2WX1A 5FR6A 5KFXA 4WWOA 4A55A 2Y5CA 2M56B 2HI0A 4TKNA 2YTUA 5CHGA 1E8YA 2H3ZA 5I4DA 3A33B 2BCUA 4F91B 1NK7A 3MR5A 4GXBA 1YEYA 4ZCWA 3NRWA 4I2FA 3BS5A 3Q8SB 2N7EA 3CGDA 4F2SA 3L54A 4AOFA 2UVUA 4EMWA 1YQBA 2AQ4A 2P4PA 4B9VA 1SV0C 1ZQVA 4F5PA 3GOEA 3KYCD 3PHWB 2MJDA 2D3AA 1OEYA 2K8CA 2KTRB 7ICPA 1I42A 3FCPA 3GV7B 5FXFA 2MUTB 2Q0ZX 2VA8A 3ALRA 1E8GA 1HSKA 3R66C 4E3CA 5CA7A 4DN1A 2HHVA 5H8YE 3TEZA 4A6GA 2QMTA 1PDXA 4Z17A 1V2YA 5AI0A 2ZIUA 2BYEA 2IDYA 4II2B 1TKDA 3B0XA 3KW5B 2DL0A 1E8XA 1K53A 4PGYA 2N0SB 3S1EA 2C2RA 3RJ8A 1EXNA 4ZDVA 4G7FA 3Q8PB 3AEVA 3RJHA 3R07C 2F1IA 1MHXA 1QILA 3JSVB 3T6CA 1MUCA 2BZFA 3H6NA 2HOIA 1JWUD 2KN7A 3NO1A 3V72A 4L2YA 3ISCA 3PK7A 4DS5A 7ICEA 2FCNA 3K75D 2R8GA 3ZJVA 2AKMA 3MR3A 3ZD9A 4KITB 2PU1A 4Q45A 4OVVA 3DG6A 2FJ6A 1TK0A 2GGIA 4KX5A 5JCIA 2C28A 2DNFA 3W1SC 2W9CA 3AE7B 1WI0A 3POPA 3R25A 4JL9A 4JV1A 2K6QA 1NU5A 4EM4A 2MP2A 1RQNA 3KUMA 3TARA 4LDTD 3DK4A 5TSSA 4EUTA 3SMVA 4HG0A 4DL2A 4C8KA 3APCA 1RQLA 3NGDA 3CWIA 3ECIA 3SEIA 5GTIU 3U4EG 5KG3A 1WE6A 4JDRA 3NZSA 4GC6A 1R4MI 1XLPA 4KX6B 3WANA 3C5GA 2ISPA 2KJ8A 5JH5C 2TPRA 4DNSA 4D2KA 2D3CA 4OO1J 2EMTA 1C1YB 2EZXA 2FPKA 1ZQNA 1Z5SB 3PSFA 2EZYA 2NPTA 2ZIWB 4NY8A 5AK5A 2KKCA 4KSKC 4DL4A 4ANVA 5FXDA 2J0KA 4JB1A 2MU2A 4O3NA 1HXYD 4M52A 1HTOA 4IW0A 1I4HA 2W3RA 3QUQA 2DENB 3C21A 1FHUA 1TVAA 2RDXA 4M04A 1OUQA 2RDJA 1WGRA 1RG6A 3HILA 4HN8A 1J7BA 2PTLA 4RNMA 3CIRB 3CYJA 3VC6A 4EBEA 2J53A 7ICTA 3S47A 1PK1A 3CP8A 1GG3A 1P98A 1QOBA 1WGHA 2XIDA 4KV2A 2AGPA 2ZW0A 1ZJMA 4P1BC 4FS2A 1KBUA 4HNLA 3IFWB 1NBFC 1YT3A 1G6JA 2TSSA 4F71A 2ZIVB 2BQ3A 2IBKA 3V7KA 5DPSA 3H12A 3PHXB 1LGRA 4KPLA 3N30A 5AE2A 3DK8A 2WF8A 4GOCA 1QF6A 1M6IA 1T8EA 3WK4A 3QEAZ 1ZQOA 4ECWA 3FYHA 2KC2A 3NXLA 4M8MA 1WRIA 4LJXA 2G07A 1T0QC 3QCAA 4RM9A 3PO4A 4FE3A 1JW9D 1SB3B 4DLGA 4GXIA 1Q3VA 4DSJA 5D79A 1GESA 5KFKA 4RUCA 9ICUA 4ECSA 4QWEA 2PTXA 3M7DA 3RB3A 3N32A 5CJ7A 3R1ZA 5CB1A 1U45A 3TAQA 1PK3A 4M02A 4YSZB 2PFOA 2O6VB 1YQZA 2NRTA 3WK6A 3H4KA 3H0MB 2P88A 3MHZA 3O13A 4MM3B 2AXTU 2EQ6A 2YEPF 3ZLZA 4YR2A 3M9OB 1ZD5A 5HR6A 4ZRPA 3H8WA 5J2RA 1MBTA 4F1SA 3ML8A 1W1OA 4EZ6A 2J3NA 4Z6CA 2BYTA 3IAS1 3IT4B 1CRXA 1F0ZA 4KTQA 4MJSB 3OLMD 2WDVB 1X40A 5DB7A 1BPXA 1D9DA 1KKOA 2OXOA 2D3BA 3OSNA 4CRXA 2IGGA 1GJZA 3GO2A 1VJ5A 3A0BU 4AP9A 4O9MA 1HEZE 3HVZA 2V0GA 3CGCA 5IOIA 5G2NA 3N1YC 1R4NI 4HVBA 2GI9A 1UF0A 4H4PA 3IP4B 9ICKA 4P0QA 1WGDA 3MJWA 4PVKA 2VIXA 1W1RA 3LLBA 5AKJA 3TJ4A 2G5HB 2KLCA 4O3MA 3HX0A 1ZDVA 4BDPA 3PZDA 3WIMA 4H19A 2ZIXB 4ANUA 1U4BA 4MSQB 5BOEA 4M9LA 3SD5A 3NOBA 3I1YA 5ALLA 1C7YA 4DSKA 1ONEA 2YB1A 2DZJA 2X8CA 3LYSA 3PVLA 2GO7A 1WGYA 1NKEA 1MC8A 3R0KA 4F3OA 2HD5B 5DPTA 1ZRNA 4HXDA 1GNUA 5KT6A 4OVZA 2OM6A 2OQHA 1EWYC 1SE3A 2L00B 2NBUA 5MPOA 1K1SA 7ICKA 3LVWA 1HTQA 3MC9A 1DOYA 1X1MA 2UVRA 4LNKA 3R0UA 2H3FA 1L7YA 2HTHA 1D3ZA 1K1QA 2EXRA 3GV8B 5D94A 4NJ6A 1L3VA 2OO6A 5ALXA 1JRUA 4IRKA 3ALBA 4KLOA 5ALEA 3VC5A 3JPPA 2KFKA 3LB8C 4RCOA 2WNMA 1X66A 2FMSA 3T3NA 3ZNID 2GRTA 2O6KA 5AKGA 7ICRA 2L0TA 3NY5A 4NQLB 4QAYA 3DGHA 2JZBA 5E79U 2LUEA 2MWSB 2V3NA 3R2TA 5J0OA 2LGXA 2I0KA 2OX4A 1QLTA 3KUCB 1NJZA 4GDKA 5E6NA 4WWNA 1GRHA 1YX5B 3BJYA 3H4BA 3L0WB 2V9HA 4C00A 4K4HA 1SEBD 3C23A 3DQVA 2WQYB 3P2BA 2PP1A 3DFYA 4HNCA 1B0XA 2KK8A 4QZHA 3LXDA 4R64A 1Z2MA 4BUGA 4EZKA 2P13A 2N7JA 5IIKA 4PK1A 4YT0B 3VVWB 4UB5A 4KLTA 1C76A 1TKKA 4KLUA 1WH3A 1X2HA 5ALNA 1GC6A 1K8RB 4LIIA 3BQ2A 2PP3A 4J9LA 5J2JA 9ICRA 2JEGA 4JUZA 2Z0EB 2Z8LA 1JPMA 4IQTA 2AGOA 1PGBA 3Q3NC 2BPFA 3DVGY 1EC7A 4E5TA 2OZ8A 2QAEA 3BY4B 3S1CA 2E5AA 1OGWA 3Q14C 5JRTA 4BV6A 4OZBA 2L52A 3UJRA 2ACZB 2P6RA 3LADA 4YD1A 2DPIA 4DWIA 1FCLA 4IUMB 3H7SA 5CTRC 3AEEB 2LWPA 4OJOA 4C8MA 9ICHA 4DSFA 3RJIA 5F9NA 2WP9B 2RQ5A 2YY6A 3WCQA 1FIQA 4YWOA 2JZ3B 5J0UA 3MC8A 2DZMA 2ZNVB 3VUWA 2L3ZA 2LD9A 1R7SA 1ZQXA 3UQAA 4EBDA 3W1YA 3SN0A 2E8OA 1DOQA 4E74A 2KQ7A 1TBEA 1PGXA 3Q3MC 4Z6DA 4YSYB 1NHRA 2BGFA 3AE4B 1KF6B 5J2AA 2B6GA 4XYCA 2HHTA 1XS9D 2MLBA 2OOBB 5ALYA 3VC8A 4NLKA 1GRGA 1UCVA 4UAWA 1ZUD2 4M00A 1O03A 1Q1OA 2V3SA 1HJPA 3UGBB 4A3OA 4BBYA 3W8WA 4ZHPA 3EW9A 3QTPA 3ZUNA 2KVSA 4P16A 1QCKA 3PWIA 4J9RA 1WX7A 2P6UA 2AEHA 4QW8A 3VH3B 4K2SA 2LUMA 4ED6A 1JIHA 2JK6A 3MY9A 1WYWB 3EZ5A 3M9NB 8ICFA 4ITKA 3BVZA 5CHVC 2L1AA 1AHVA 3L17A 4JX1C 3FWAA 1WXSA 5HHIA 1OJTA 2F1JA 2VA2A 4NXZA 2QB0A 4LK0M 4KKIA 9ICVA 1DIQA 3F2DA 3PW4A 3HHMA 3MHSD 1F5SA 3S1FA 3GD4A 5J8YC 3DBRB 1RFAA 4JLCA 3DBHI 4IM2A 1PGAA 2W7OA 4H4SA 4NJ8A 3KHGA 2CHXA 2KQ4X 4CNQA 2DF4B 4JN7A 3DQ0A 4AS1A 4M8NA 2A1JB 4BKSD 1UBQA 2NV3A 2EAOA 2ZPNA 2HCFA 2JRZA 1I4XA 1WZ0A 3RCZA 4GISA 4UAZA 1WM2A 2AQ0A 3SAFA 5DKWA 1K50A 1V1OA 2QSDA 2ASQA 3LDZE 3N1XC 4HDQA 5AKKA 2QJJA 2YMLA 4DK5A 2W9BA 5KVIA 4RNOA 4B9UA 1CZPA 2K60A 5KG0A 1KLGD 3RNCC 4ARCA 4FO6A 5AZHA 4A8XC 1GRFA 2KMCA 1XO0A 4YMOA 2L0FA 2ASLA 3VXWA 3BOXA 1NK4A 5ALUA 1PUTA 4QZBA 1Q46A 2IGHA 2BHNA 3MFIA 2KZ3A 2G09A 2CHRA 3RT3B 1E8HA 4R3DA 3EA6A 4KLFA 1YJJA 4Y2TA 1JALA 3CK5A 1VCBA 5ALJA 4DNAA 2PFPA 2JH1A 3AEBB 5B66U 4M9HA 1NHQA 4K7ZA 1X6JA 3WAPA 4H2HA 3GE3C 4APNA 2MW5A 3AU4A 4K4IA 1X6IA 4BC7A 2WF9A 4M6WB 5DPWA 2QDDA 4XGAB 2KDEB 3LK9A 5AI5A 2W8LA 3L16A 2GL5A 2WXLA 1IIPA 2L5YA 2C60A 2MSED 1V97A 4FZNA 1RDFA 4EEYA 3M62B 5AI9A 3H0LB 3T9LA 5HNKA 1KN5A 4KMOB 2JV3A 2WAQC 1SE4A 2C7NB 2RPVA 2LPEA 5L1LA 4IDIA 3EJEB 3UJFA 3TIXA 5AWVA 3JPTA 2IY0B 1SJDA 4M9GA 3VHTC 1WR1A 3RH6A 3SN4A 3F2BA 2KFNA 4MKSA 2K4EA 2W82A 3KLJA 3D47A 3ML9A 7ICLA 1QQ7A 2PS2A 1RZTA 8ICIA 9ICLA 1YJ1A 4UAVA 7ICGA 2KJHB 3J9CA 1L7MA 1S9FA 1WMHA 4XZ4A 4HPNA 3H4DA 3MC1A 5KFTA 3AQFA 1JMLA 4WQOB 4NWIA 2YN4A 3AXCA 2KC1A 4W9GA 2WFAA 3ZVHB 4IQUA 1TKEA 1XHCA 3A0HU 2LFIA 3TACB 2BW2A 1JOAA 3I57A 1S8OA 4OHJA 1TE2A 2LKYA 2MQJA 2R9ZA 5JHBA 3FYYA 2B3AA 1RFKA 2IBIB 5DLGA 3I6EA 2K3UA 3PSIA 2NMQA 4Y2XA 2CXYA 4J9QA 1OQQA 3C28A 2J6UA 5KT4A 4GDLB 3ZD8A 2EMSA 2O3GA 4BOSC 5JHAA 5FS9A 3T5KA 2AGQA 4F5QA 2CU1A 3M1YA 4LJPB 4DHJD 3DV9A 1WVFA 1Q3UA 4I2BA 1OXJA 2XK5A 3TEWA 5TZVA 4PWBA 1NELA 2C7HA 1F77A 5IIIA 5FK9C 5KFWA 2LI5A 4F5OA 1SWWA 1WSPA 3QZ7A 1KN0A 4GIRA 2XNAC 2NQWA 4KX3A 3K1RB 1KDHA 3I76A 4KLDA 3LB8A 1V81A 1ZQAA 1WF9A 4EKUA 3DG3A 4F4RA 3ETRB 3IRUA 3WKAA 2HJ8A 3W5UB 2PSNA 4E6MA 3JPSA 2GH5A 4LCDE 2PW9A 4DFDA 5KFFA 4MEYA 3SQIA 1NK5A 3W8ZA 1S7MA 2GGHA 1SGGA 1SGHA 5U1OA 1GV4A 2W8KA 1EF5A 8ICSA 3AE8B 3ENLA 4DCCA 2L7RA 2PE6B 1BZLA 4I29A 5ALIA
chains in the Genus database with same CATH topology
2MBRA 2I2YA 3D2DA 4ZHOA 2R61A 2JWUA 4RGTA 5EE1A 4GLSC 3TEYA 1E9MA 3NVYA 1I4PA 4HJGE 5G5GA 4HKQA 3P4QB 4LLGM 2AXRA 4C7YA 1K52A 4RFBA 2BT6A 2CU3A 2VZKB 2Q4WA 4WURA 1ZXIA 1ET9A 1V8CA 2AX5A 1A70A 3GS2A 3BVGA 2UUUA 2JYEA 5HMRA 3PO0A 2WU5B 1JRPA 5C2TB 1E6EB 4C80A 4YWGG 5D3DA 1AHZA 2P3HA 4OW0A 2IPIA 2KMMA 3FW8A 1YMHE 1N5XA 3AE6B 1RM6B 3PZ7A 5BMIA 1C4CA 3IT6B 2WXFA 3R2IA 2IJ0A 3A7AA 2PMVA 4XE0A 2RDGA 1ENFA 2WDQB 3KWVA 4TQ0A 1FRRA 1E7PB 1HQRD 3A7UA 2N9KA 2OAIA 1AW7A 2BVFA 1XXGA 1YNTE 4A55A 5L6GA 2Y5CA 2M56B 5HI1A 5I4DA 2E6XA 3L4PA 1VQZA 2X38A 1SJED 4PWCA 1NENB 1HZ6A 2JSVX 1AWDA 3TSHA 4B0EA 2EKIA 3ZJUA 1ET6A 2P4PA 1ZDXA 2WXRA 4MH8A 1N63C 2PIAA 2MJDA 1FNWA 1TY0A 2JXTA 2UUVA 1FRDA 2PVGC 1NYRA 2ZW1A 5FXFA 1E8GA 1HSKA 4OALA 3MJ5A 1W1SA 3ZYYX 1J7AA 2KDMA 5H8YE 3TEZA 3H8HA 2R8DA 3W8XA 1P7EA 1PDXA 2QMTA 3PZ8A 5T8IA 1SE2A 2CJOA 3Q69A 2IDYA 2JX5A 1K53A 1D6EC 1MI0A 1D5XC 1QOAA 2BB6A 2N0SB 4N6EB 1P7FA 3ABVB 3IAM1 1F0XA 1J7CA 2WLBA 3S1EA 2Y5PA 3RJ8A 3AE9B 3AEFB 1CQVA 3R07C 1TS2A 1MHXA 4RGNA 1QILA 1FXAA 1TJEA 1C77A 1JWUD 2J4XA 4KGSA 3V05A 4L2YA 1LO5D 2VFUA 1YN5A 4TSSA 2WS3B 3KQ4A 3ZJVA 3EUB3 3HVDA 3P1MA 1Q10A 1XLNA 1YN4A 4ARIA 1YQ3B 5BMGA 4M0WA 1VZ7A 3NVZB 2DYOA 4GDKB 3AE7B 4YXDB 1SB3C 3BYTB 2YVSA 3POPA 3Q8EA 4JE3B 3Q8FA 2W54A 3DEDA 1JWAD 2PKOA 1GOZA 5TSSA 1E0YA 4HG0A 2MJ3A 2WXMA 4WIPA 5FR3A 1MHHE 3D2HA 2DYMA 3CWIA 3U4EG 2DWQA 1Y56A 1XLPA 4KX6B 3VRAB 4DNSA 1D5MC 4D2KA 1N61C 4XWTA 2IPKD 5HFYA 4US9A 1JWMD 3FILB 2BTEA 1FMAD 4XDCA 2MEKA 2V3PA 2WXKA 2BS4B 2WXJA 1XEEA 1ZP0B 2IGDA 3AE2B 5FXDA 2PLPA 5I1WA 2GQUA 4JB1A 1HXYD 1V1PB 1WGKA 5AUIA 2K22A 1I4HA 1D4BA 3NRZB 2W3RA 5BYQA 5L6FA 4OZAA 5FXPA 3AN1A 2NTSA 1UWXA 4RH6A 2XN9C 4PT5A 2DLBA 1J7BA 2PTLA 2M19A 3CIRB 1FIQB 3ETRA 1IUEA 2J53A 3TUOA 1ESFA 1QOBA 2PLSA 1XO3A 2ZW0A 4EE2A 1L4DB 3SR6B 2GQTA 3TEXA 2TSSA 2H88B 4FXCA 3D2JA 3DWMA 2Q85A 3GP7A 5AE2A 1I19A 1X2GA 1QF6A 2WDRB 3RFZB 2V4IB 2W55A 5AE3A 3PM9A 1ZXHA 1JQ4A 3P63A 1WRIA 3IXSA 1VRAB 3T3OA 1JROA 1WYGA 1JW9D 1SB3B 2ICIA 5D79A 3W1SA 2M0AA 5JXVA 1AYFA 1EU4A 1E10A 4YSZB 1VZ8A 2WXOA 2G1EA 4HRSA 3ZQ4A 4UD8A 3MHZA 1ZR6A 3BW7A 1KFYB 3O13A 3MFGA 5K8EA 4MM3B 1IBXB 5AE1A 1L6VA 2YEPF 1AN8A 2L83A 3AB5A 1JWBD 3V3XA 1MBTA 4ZRPA 4TVWA 2J52A 3C8YA 3HRDD 1W1OA 1N5WA 1I4RA 1TY2A 5BMHA 1N61A 2LJIA 2BYTA 3IAS1 3IT4B 1DOXA 1F0ZA 4ZYSA 1JWSD 2WDVB 1L4ZB 3U7ZA 1T6BX 2IGGA 2W3SA 4C56C 2WXNA 1E8FA 1HEZE 3SEBA 3HVZA 2V0GA 4XWWA 3BK2A 3BVMA 1C4PA 4RGOS 3RPFC 2GI9A 4EC3A 5BYRA 1DYQA 3AH7A 3BIID 4J3OD 1FEHA 4PVKA 1FCCC 2K5PA 3ZGZA 3VRBB 1W1RA 3LLBA 3A7RA 5EE9A 1ZDVA 4JPSA 4USAA 2JZPA 1SXTA 1TZOA 1UGJA 4JAYA 2FE8A 3BWUD 3SFDB 3NVVB 1XCTL 3NS1B 1K51A 3EGRA 4RF0A 2VFVA 1MBBA 4OVZA 1KLUD 4N59A 3B9JB 1EWYC 1SE3A 3AEGB 5MPOA 1W1QA 2VFSA 4IKGA 4BC9A 1FM0D 2LEKA 1VZ6A 1VLBA 1DOYA 3VR9B 3JS8A 1NVID 2LMCA 2EXRA 4YTPB 5HQXA 2INPE 1SBBB 4ZOHC 1YN3A 2WXQA 2WXIA 2FUG1 3LB8C 4RCOA 2WNMA 3VTEA 1FNUA 1ACCA 3T3NA 4PVHA 1GPXA 3U52E 4HROA 4JWSC 2AQ3B 3U2SC 1N60C 2V3NA 3R2TA 1FFVC 2I0KA 4H2AA 3NVZA 1QLTA 2QEJC 2QIEB 1N62C 2KAJA 3LAEA 4NAMA 1EU3A 3NUHB 2BB5A 3AE3B 1SEBD 4L1BA 1QKZA 2KACA 2WQYB 3ZJTA 2HDEA 3VQIA 2P13A 3TSJA 2N7JA 4XLOA 2WDWA 3B2GA 1L5PA 2BS3B 4YT0B 4PZFA 3P4PB 4CQNA 2E3TA 1C76A 1X2HA 3DWGC 1W1LA 4ZRQA 3VR8B 3MP9A 2Z8LA 4YSXB 1QLUA 2LHEA 1N63A 3HUIA 1ZXIC 1PGBA 3AMZA 2Y3SA 1MPEA 4ML8A 1YJIA 3FILA 3S1CA 2E5AA 5HHDG 3I99A 1SJHD 4HEA1 4OZBA 2L52A 4RGMA 2ACZB 1B9RA 1BUIC 1V1PA 4TQ1A 1HZ5A 5G5HB 2EELA 4KGRA 4A9AA 3NRZA 1FCLA 1FXIA 1YQ4B 3AEEB 5FKAC 2WXGA 1VR9A 2L32A 4UDUC 3P4SB 5I1VA 3UI3A 1BMLC 2WP9B 1FFUC 3WCQA 1FIQA 1PFDA 2RMMA 5AUKA 1VAOA 2QILA 1EWCA 1UWMA 2Y4GA 3SR6A 3KWLA 1KTKA 1B1ZA 3GB1A 5HHZA 3NVWB 3AEAB 1R7SA 4ZOHB 3AE5B 1WWTA 1F2RI 3GSYA 3BYYB 1GB1A 1OQRA 3BK1A 1PGXA 2AQ1B 2D5GA 4YSYB 4RF1A 1ZPSA 1KF6B 3AE4B 4O95A 3EUB2 5EE0A 4PYTA 1KRHA 4MACA 3W9CB 2OHFA 4B0MA 2DBYA 1ZUD2 5EE3A 4BBYA 1OFFA 3W8WA 4ZHPA 2VFRA 2HTME 4NJCA 4MLAA 1C4AA 2K9XA 4P16A 1IGCA 1STEA 2NTTA 3E9SA 1QT9A 4DXGA 2GRIA 2LUMA 1DOIA 3NVYB 5G5GB 1IBXA 4ITKA 3BVZA 2L1AA 1AHVA 3FW7A 4JX1C 3FWAA 2WXHA 3PQBA 5ADZA 4RNAA 1ZOYB 1BXTA 1RYJA 4KKIA 3P4RB 4LK0M 5D7GA 3KLSX 1CK1A 4REZA 1DIQA 1DIIA 1KH0A 1GB4A 3S1FA 2VFTA 3MC0B 4WQMA 1FD6A 1PGAA 3AECB 2KQ4X 2SEBD 1PYWD 3DQ0A 4AS1A 1VDVA 5FXEA 1W1MA 1I4XA 3W2DA 2MH7A 4JWUC 4O1NA 1QOFA 3I9V1 1V1OA 1K50A 3AV8A 4TMAB 2QSDA 1QOGA 1FFUA 4NAWB 4US8A 2N9LA 3HRDC 2LHDA 1WXQA 1CZPA 1UNSA 1KLGD 4ARCA 1SIJA 1W1KA 3URYA 4A8XC 3LXFA 4N58A 4HKZE 3NVVA 3W5VB 1EM7A 3Q8BA 3NS1A 1NEKB 1HA5A 1PUTA 2IGHA 4YTNB 2BVGA 3FAHA 2WU2B 2RDHA 2QPMA 3AE1B 4DXFA 1E8HA 3B2FA 4R3DA 3EA6A 3B9JA 4WH4A 1UUPA 3OWEB 1YJJA 1JALA 1JCKB 1L0XB 2BBCA 1SF0A 3AEBB 2BVHA 3Q8CA 1ROEA 3AM9A 2H89B 3HSUA 2LGIA 2INNE 4BC7A 5E6JA 2R2ZA 2ON8A 4PVEA 1L0VB 2VZKD 2WXLA 1T3QC 2PLIA 2JQRB 3P42A 1V97A 2YEPB 3FC4A 5C3JB 1TS5A 1SE4A 2RPVA 4IDIA 3C0PA 3R8BA 5AWVA 4BCAA 3KJMA 3LYYA 1SSNA 1UXYA 4KGTA 1ZE3D 4WWMA 2QJLA 1C79A 5H92C 1AHUA 2K0PA 3Q8AA 2CJNA 2W82A 2MJEA 5BYSA 5D3IB 2Y08A 1NI3A 3BZDB 5LNK1 3J9CA 4XDDA 1XCQL 4OZCA 4MT5A 2QKNA 4LTUA 4IOIE 3FW9A 1JMLA 3TX1A 3TSSA 2I38A 1I4GA 4NZLB 1MVKA 3N9YC 1TYGB 2VAOA 1DGJA 2G9HD 3AEDB 1TKEA 2LFIA 4AQ7A 1F2RC 2BW2A 2PVOD 1RWSA 2SAKA 3I57A 4OHJA 2Q5WD 3NZ3A 4PVJA 1RM6C 4WAFA 5G5HA 1QQRA 1NYQA 1RFKA 2K3UA 4KKJA 4A6QA 2NMQA 1OQQA 1W1JA 1N5WC 2JYTA 1CJEA 4GDLB 3S1DA 4L23A 2J42A 2O3GA 1WVEA 2RK5A 1C9FA 1T5XD 2WXPA 1IGDA 1M4VA 1E0ZA 4PWBA 2B76B 1TKGA 1WVFA 1C78A 1GAQB 2Y3AA 3TEWA 4DQOC 1TS3A 2BS2B 2JU6X 4A90A 1F77A 3SFEB 5FK9C 4P6VF 3NVWA 1FNVA 1TKYA 1WSPA 2OEDA 4Q2JA 2XNAC 5HG2A 2NQWA 2ONQA 1I4QA 1L6UA 1VJKA 1XLQA 2FBWB 3ETRB 3E56A 3W5UB 2AQ2B 1N60A 1DZNA 1FFVA 2KWDA 1T3QA 2Y3RA 1TS4A 4YTMB 2PW9A 4C7ZA 1L0YB 5GXGB 3W8ZA 1FO4A 1N62A 2GB1A 1I7HA 1QLBB 3RJAA 3AE8B 4TVYA 1D5ZC 1XLOA 2KN4A 1XF5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBR A;  3D2D A;  4ZHO A;  5EE1 A;  1E9M A;  3NVY A;  5G5G A;  3P4Q B;  2AXR A;  4C7Y A;  2BT6 A;  2CU3 A;  2Q4W A;  1ZXI A;  1V8C A;  2AX5 A;  1A70 A;  5HMR A;  5C2T B;  2WU5 B;  1JRP A;  3PO0 A;  1E6E B;  4C80 A;  1AHZ A;  2P3H A;  2KMM A;  3FW8 A;  1N5X A;  3AE6 B;  1RM6 B;  3A7A A;  2WDQ B;  1FRR A;  1E7P B;  3A7U A;  2OAI A;  2BVF A;  2Y5C A;  2M56 B;  3L4P A;  1VQZ A;  4PWC A;  1NEN B;  1AWD A;  3TSH A;  2EKI A;  2P4P A;  1N63 C;  2PIA A;  2MJD A;  1FRD A;  2PVG C;  1NYR A;  5FXF A;  1E8G A;  1HSK A;  4OAL A;  1W1S A;  3ZYY X;  1J7A A;  5H8Y E;  2R8D A;  3W8X A;  1PDX A;  2CJO A;  2JX5 A;  1QOA A;  4N6E B;  1F0X A;  2N0S B;  3S1E A;  3ABV B;  1J7C A;  2WLB A;  3AE9 B;  3AEF B;  3R07 C;  1FXA A;  1TJE A;  2VFU A;  2WS3 B;  3EUB 3;  3P1M A;  1XLN A;  1YQ3 B;  3NVZ B;  3AE7 B;  4YXD B;  1SB3 C;  2YVS A;  3DED A;  2W54 A;  1JWA D;  2PKO A;  1E0Y A;  4HG0 A;  2MJ3 A;  3D2H A;  3CWI A;  2DWQ A;  1XLP A;  4KX6 B;  3VRA B;  4DNS A;  1N61 C;  4US9 A;  1FMA D;  2BS4 B;  1ZP0 B;  3AE2 B;  5FXD A;  2GQU A;  4JB1 A;  1WGK A;  5AUI A;  2K22 A;  3NRZ B;  2W3R A;  5FXP A;  3AN1 A;  1J7B A;  1FIQ B;  2M19 A;  3CIR B;  3ETR A;  1IUE A;  1QOB A;  2PLS A;  1XO3 A;  3SR6 B;  2GQT A;  2H88 B;  4FXC A;  3D2J A;  3DWM A;  2Q85 A;  5AE2 A;  1I19 A;  1X2G A;  1QF6 A;  2WDR B;  5AE3 A;  2W55 A;  3PM9 A;  1JQ4 A;  3P63 A;  1WRI A;  1JRO A;  1WYG A;  1JW9 D;  1SB3 B;  5D79 A;  1AYF A;  1E10 A;  4YSZ B;  2G1E A;  4HRS A;  4UD8 A;  1ZR6 A;  3BW7 A;  1KFY B;  5AE1 A;  1L6V A;  3AB5 A;  4TVW A;  2L83 A;  1JWB D;  1MBT A;  3HRD D;  1W1O A;  1N5W A;  1N61 A;  1F0Z A;  1DOX A;  2WDV B;  2W3S A;  1E8F A;  3HVZ A;  3RPF C;  4EC3 A;  3AH7 A;  3BII D;  4PVK A;  2K5P A;  1W1R A;  3LLB A;  3VRB B;  3A7R A;  5EE9 A;  4USA A;  4JAY A;  3SFD B;  3NVV B;  3NS1 B;  2VFV A;  1MBB A;  4N59 A;  3B9J B;  1EWY C;  3AEG B;  5MPO A;  1W1Q A;  2VFS A;  4BC9 A;  1FM0 D;  2LEK A;  1VLB A;  1DOY A;  3VR9 B;  3JS8 A;  1NVI D;  2EXR A;  4YTP B;  5HQX A;  4ZOH C;  3LB8 C;  3VTE A;  4PVH A;  1GPX A;  4HRO A;  4JWS C;  1N60 C;  1FFV C;  2I0K A;  1QLT A;  3NVZ A;  2QIE B;  1N62 C;  2KAJ A;  3LAE A;  3AE3 B;  2WQY B;  2P13 A;  3TSJ A;  4XLO A;  3B2G A;  1L5P A;  2BS3 B;  4YT0 B;  4PZF A;  3P4P B;  2E3T A;  1X2H A;  3DWG C;  1W1L A;  3VR8 B;  4YSX B;  1QLU A;  1N63 A;  3HUI A;  1ZXI C;  3AMZ A;  2E5A A;  4ML8 A;  1YJI A;  3S1C A;  3I99 A;  2L52 A;  2ACZ B;  1B9R A;  5G5H B;  4A9A A;  3NRZ A;  1FXI A;  1YQ4 B;  3AEE B;  3P4S B;  1FFU C;  2WP9 B;  3WCQ A;  1FIQ A;  1PFD A;  5AUK A;  1VAO A;  1UWM A;  3SR6 A;  3KWL A;  5HHZ A;  3NVW B;  3AEA B;  1R7S A;  4ZOH B;  3AE5 B;  1WWT A;  3GSY A;  1OQR A;  4YSY B;  4O95 A;  3AE4 B;  1KF6 B;  4PYT A;  3EUB 2;  5EE0 A;  1KRH A;  3W9C B;  2OHF A;  2DBY A;  1ZUD 2;  5EE3 A;  4BBY A;  1OFF A;  3W8W A;  4ZHP A;  2VFR A;  2HTM E;  4MLA A;  2K9X A;  1QT9 A;  1DOI A;  3NVY B;  5G5G B;  4ITK A;  1AHV A;  3FW7 A;  4JX1 C;  3FWA A;  5ADZ A;  1ZOY B;  1RYJ A;  3P4R B;  1DIQ A;  1DII A;  3S1F A;  2VFT A;  4WQM A;  3AEC B;  3DQ0 A;  1VDV A;  5FXE A;  1W1M A;  4JWU C;  2MH7 A;  1QOF A;  3AV8 A;  1QOG A;  1FFU A;  4US8 A;  3HRD C;  1WXQ A;  1CZP A;  1SIJ A;  1W1K A;  3LXF A;  4N58 A;  3NVV A;  3W5V B;  4YTN B;  3NS1 A;  1NEK B;  1PUT A;  2BVG A;  3FAH A;  2WU2 B;  2QPM A;  3AE1 B;  1E8H A;  3B2F A;  3B9J A;  1YJJ A;  1JAL A;  1SF0 A;  3AEB B;  2BVH A;  1ROE A;  3AM9 A;  2H89 B;  4BC7 A;  2R2Z A;  4PVE A;  1L0V B;  2PLI A;  1T3Q C;  2JQR B;  1V97 A;  3FC4 A;  5C3J B;  4IDI A;  3C0P A;  4BCA A;  3KJM A;  1UXY A;  4WWM A;  2QJL A;  5H92 C;  1AHU A;  2CJN A;  2MJE A;  1NI3 A;  2QKN A;  4LTU A;  3FW9 A;  3TX1 A;  1TYG B;  2VAO A;  1DGJ A;  3AED B;  1TKE A;  2PVO D;  1RWS A;  2Q5W D;  4PVJ A;  1RM6 C;  5G5H A;  1RFK A;  1NYQ A;  1OQQ A;  1W1J A;  1N5W C;  1CJE A;  3S1D A;  2RK5 A;  2O3G A;  1WVE A;  1E0Z A;  4PWB A;  2B76 B;  1TKG A;  1WVF A;  1GAQ B;  2BS2 B;  3SFE B;  4P6V F;  3NVW A;  1TKY A;  2NQW A;  1L6U A;  1VJK A;  1XLQ A;  2FBW B;  3ETR B;  3W5U B;  1N60 A;  1DZN A;  1FFV A;  1T3Q A;  4YTM B;  5GXG B;  4C7Z A;  3W8Z A;  1FO4 A;  1N62 A;  1I7H A;  1QLB B;  3AE8 B;  4TVY A;  1XLO A; 
#chains in the Genus database with same CATH topology
 1NHP A;  2KDI A;  3JPQ A;  3EFU A;  3GY1 A;  4QIW C;  3IDW A;  2NR2 A;  3DBL B;  4RQ4 A;  1E9M A;  8ICP A;  3KVF B;  8ICQ A;  4BGD A;  4HJG E;  4PHA A;  3EEC A;  3U7D A;  2G0A A;  4QWA A;  2YMM A;  4KMU A;  3N3K B;  2PGE A;  2V4R A;  3C19 A;  1ET9 A;  2G4D B;  1H6V A;  8ICE A;  1KCZ A;  3A1Q A;  3GS2 A;  2JYE A;  2WU5 B;  4C80 A;  3TFS A;  2MBB B;  1AHZ A;  8ICY A;  1YMH E;  3PW5 A;  3AE6 B;  3T5L A;  2VH1 A;  2CHW A;  3A4S C;  2RDG A;  3RH4 A;  1ENF A;  2RGF A;  1QTM A;  1FRR A;  4IRD A;  5JZE B;  3T9P A;  5J0Y A;  2ZEQ A;  2OAI A;  3H8S A;  4C8N A;  1ZJN A;  3Q2A C;  2M0N A;  4DL7 A;  2BQR A;  2BVF A;  5IIJ A;  5L6G A;  2UYZ B;  1NDA A;  4TUQ A;  5IDZ A;  4NAW A;  5HI1 A;  2DGZ A;  3L08 A;  3VAW A;  4IHC A;  3FV9 A;  4M01 A;  2ZPY A;  4A8E A;  4NLC A;  3VTU A;  1TZZ A;  2BPC A;  1NJW A;  5ALR A;  2R8H A;  4C4V A;  1KRP A;  4RQ7 A;  4PWC A;  4BBN C;  4KSL C;  4BJQ A;  2D3G A;  3DOW A;  5KG5 A;  2A5U A;  1IP9 A;  4M9J A;  1MNS A;  1ET6 A;  2MUC A;  1ZDX A;  2L76 A;  4P0P B;  2O2V A;  4M2Y A;  3L8K A;  4GSW A;  1FNW A;  4XRH A;  3BQ1 A;  2JXT A;  3MAB A;  2PVG C;  2Z7J A;  4I6L B;  2UUV A;  2FDR A;  5KVH A;  3JW7 A;  1TZ1 A;  4M0A A;  3EC8 A;  4IT1 A;  1Q1W A;  2CJO A;  5DDM A;  2K8H A;  2GBJ A;  4E0D A;  5AM5 A;  5AKI A;  5KAF U;  2KJ5 A;  2BB6 A;  2CS4 A;  1F0X A;  2FMP A;  3P3B A;  2W7P A;  3ABV B;  5AIA A;  1WWU A;  2W04 A;  3AE9 B;  2F1H A;  3DFH A;  1J2N A;  1CQV A;  3GZN I;  4ZH4 A;  2Y1J A;  4G50 A;  1FXA A;  1TGZ B;  3RYT A;  2HOQ A;  3V05 A;  2KFZ A;  3D32 A;  2AAQ A;  4ECT A;  1BPY A;  1LO5 D;  4TUR A;  2GGJ A;  2VJ4 A;  3RGT A;  2MA1 A;  3KQ4 A;  1DNC A;  2CRX A;  3WAL A;  1KOT A;  4K8G A;  5JUM A;  2DPJ A;  3RB6 A;  1BKH A;  4HCL A;  1BT0 A;  4ARI A;  5J29 A;  1GSN A;  1ZQE A;  4M0W A;  1VZ7 A;  2GLE A;  5IO9 A;  3NVZ B;  3TFR A;  1P0R A;  2DYO A;  1K4Q A;  4K3C A;  3PSE B;  3V7L A;  3BYT B;  2YVS A;  3I28 A;  3M6K A;  3PR4 A;  2P0I A;  2W54 A;  4QJF B;  2M8S A;  2PKO A;  3B1L X;  2F8L A;  4ECQ A;  1E0Y A;  2PMZ F;  1MJD A;  4J57 A;  3DK9 A;  4H4V A;  3ZXV A;  2GSH A;  1TK8 A;  2YQU A;  2E1E A;  7ICQ A;  2AL2 A;  2YQE A;  1Y56 A;  4R8U B;  2BGW A;  2JPH A;  3VH4 B;  2D07 B;  4FLH A;  3U30 A;  4J03 A;  2FKP A;  2ODG A;  2KXJ A;  8ICC A;  5HFY A;  4US9 A;  2R8J A;  3FIL B;  2BTE A;  1FMA D;  2VH2 A;  2V3P A;  1ZP0 B;  3AE2 B;  3RNF C;  3SAH A;  4QZ8 A;  4OJ6 A;  2C5L C;  4AP4 C;  1P7D A;  1V1P B;  4EEW A;  1FEA A;  1AOG A;  1PDY A;  3BZK A;  3NRZ B;  1PZN A;  3M3J A;  3LJ3 A;  1D8B A;  3MGI A;  3C29 A;  4OZA A;  3AN1 A;  4P7I A;  3UF8 A;  5FXP A;  3N4F A;  3RRH A;  2DQN B;  2NTS A;  4FS1 A;  4PGX A;  1P9D U;  4RH6 A;  2HBJ A;  5D2M B;  1QQ6 A;  1JPD X;  8ICK A;  2M19 A;  3ZTC A;  1YX6 B;  1TAU A;  1F9C A;  4KLE A;  4BZA A;  5J04 A;  1UEL A;  2KP7 A;  4I6N B;  1SWV A;  1XO3 A;  2C3C A;  2PLS A;  3UPQ A;  1BPZ A;  1L4D B;  2G3Q B;  5ALV A;  2M9N A;  4RU9 A;  3IG5 A;  5AKX A;  2BCR A;  1COK A;  3RNM A;  4FXC A;  3DWM A;  2ZJA A;  4BXO B;  2HW3 A;  2D2Q A;  2Q85 A;  4F92 B;  2GWS A;  3OJU A;  3D9X A;  2I5H A;  2MBE A;  3CGE A;  4NEV A;  4ED1 A;  2WDR B;  1ZQL A;  3RFZ B;  2W55 A;  5AE3 A;  5AM1 A;  1R4M B;  3QQ8 B;  1ZXH A;  2A19 A;  3EPI A;  1JQ4 A;  3RRG A;  2BQU A;  3T3O A;  2YB4 A;  4KLQ A;  7ICN A;  4IWP A;  3EAO A;  2GBN A;  1XPY A;  1TFR A;  2BKR B;  2Z0D B;  4DO9 A;  4AUQ C;  5JXV A;  4HLE A;  2W0H A;  4GN1 A;  2RSU A;  4RQ0 A;  4EZL A;  4GFI A;  3PW0 A;  2XGP A;  1VZ8 A;  2WXO A;  2G1E A;  1YZ7 A;  4IG7 B;  1V5O A;  1S10 A;  1E5W A;  4X5V A;  4II3 B;  3ZQ4 A;  2HJ1 A;  1SJA A;  2PU0 A;  4J6I A;  3MFG A;  3N7S C;  4DLE A;  1IBX B;  4ADW A;  5K8E A;  4G3I A;  3F5E A;  3IM1 A;  1X9W A;  1AN8 A;  2L83 A;  2PXI A;  1JWB D;  2LI6 A;  1WXA A;  3PX6 A;  4MM3 A;  5AM0 A;  3V3X A;  3HRD D;  3PPA A;  2NVU I;  4DF4 A;  2LJI A;  2XBB C;  3IN5 A;  1IV8 A;  2HBM A;  2FLN A;  1JWS D;  4ZYS A;  1A0P A;  2EDU A;  4CF4 A;  3R3M A;  5KFB A;  3U7Z A;  1T6B X;  3QAR A;  3NZG A;  3MDA A;  1S97 A;  2LM4 A;  1B43 A;  8ICA A;  2NBW B;  2QDE A;  4FX9 A;  2HZG A;  1UH6 A;  1K5O A;  3T5J A;  2WDT B;  5DGA A;  3PS6 A;  1TAM A;  3PX0 A;  1LKY A;  3OZM A;  2R8I A;  1V5T A;  3BK2 A;  3SQS A;  2OLA A;  3BVM A;  1DXS A;  2YVC A;  4RGO S;  3H40 A;  2DW6 A;  4EC3 A;  5ENL A;  7ICU A;  4LA1 A;  4J9M A;  1UA1 A;  3CST A;  1IM4 A;  4ANX A;  3PSP A;  2INC C;  3RAQ A;  2KN5 A;  1F0M A;  5AKH A;  4JPS A;  1L7O A;  4USA A;  4DBG A;  3RF9 A;  1UGJ A;  4JAY A;  3V5F A;  2FE8 A;  2BVC A;  3I5J C;  9ICW A;  3SFD B;  3NS1 B;  1L3U A;  2L05 A;  3EGR A;  2PI4 A;  2HXT A;  4UAS A;  1MBB A;  3A9J A;  2X8X X;  2XH2 A;  5KFG A;  4YL8 A;  3N6J A;  3UXP A;  1Z00 B;  4IM3 A;  4BC9 A;  4Y2P A;  2LEK A;  1VZ6 A;  1VLB A;  5DQG A;  2EAN A;  1WY8 A;  3VR9 B;  3BQ0 A;  3PV1 A;  3DH9 A;  1T0S C;  3UJ2 A;  4ED8 A;  2CHZ A;  4YTP B;  1S3S G;  2LM1 A;  5HQX A;  4PH5 A;  2M4N A;  3OZY A;  4FFD A;  2A3V A;  3A9K B;  2WXQ A;  2WX0 A;  5AK3 A;  2KIW A;  5L1K A;  3RJJ A;  1FNU A;  4NNJ B;  4PVH A;  1MQ3 A;  3VTE A;  1GPX A;  2JEI A;  1R4N B;  4Q8E A;  1O08 A;  1V80 A;  3U52 E;  3QFB A;  2C22 A;  4DQQ A;  1WJ6 A;  1ZDL A;  1COO A;  3O65 B;  2QEJ C;  3GRS A;  4MDK E;  2QIE B;  1IYF A;  1UBI A;  1N62 C;  2OFJ A;  4FBJ B;  3NUH B;  1WJ4 A;  1Z1V A;  3DDM A;  3T3F A;  4Y2Q A;  3SZ2 A;  2KAC A;  2LJ5 A;  4YG2 A;  3ZJT A;  2JUO A;  2HBK A;  2HDE A;  4WJN A;  2D11 A;  3HW8 A;  3OTQ A;  4CGZ A;  2GBK A;  2WDW A;  4UAT A;  1TTN A;  2BCQ A;  5KFE A;  4WWP A;  2GR1 A;  3DWG C;  1W1L A;  1FPY A;  3MBY A;  4N9F 4;  1U4A A;  3RNB C;  5J0Q A;  2JWZ A;  4CF3 A;  1QLU A;  2OG9 A;  4GME A;  4OJL A;  5DQI A;  2KHV A;  5ALF A;  3PVX A;  4FBU A;  1MPE A;  1YJI A;  5HP4 A;  4FJZ A;  4NL9 A;  5HHD G;  1CUK A;  4S0R A;  5EWG A;  3G6V A;  5CX3 A;  1DGS A;  2DUY A;  2KMD A;  3FG2 P;  1BUI C;  2B21 A;  4Y2J A;  2EEL A;  1TV9 A;  3DHI C;  4KPR A;  2OYY A;  1FXI A;  3TQ1 A;  3NUQ A;  1PDZ A;  2JVC A;  3P4S B;  2DAJ A;  3UI3 A;  1HEK A;  1BML C;  2WOW A;  4I27 A;  3ZNG C;  2JF5 A;  4FZM A;  3DPD A;  3ISD A;  2QIL A;  9ICC A;  3IHP C;  2Y4G A;  8ICO A;  5JCM A;  1X42 A;  3SR6 A;  1GRT A;  3KWL A;  4I2D A;  4K81 A;  3AEA B;  2O56 A;  4ZOH B;  4MMW A;  1MRA A;  5BOL A;  1XSN A;  3WK5 A;  3ZXR A;  4ENL A;  3BYY B;  2Y1I A;  1GB1 A;  2CFY A;  3IC9 A;  2LYB A;  2WP6 A;  1Y88 A;  4DOB A;  1DRG A;  4IRC A;  3BK1 A;  4FAD A;  3SV4 A;  2K89 A;  4W9E A;  2RR9 A;  1JCT A;  2IHM A;  5DB8 A;  7ICF A;  3QX1 A;  4RF1 A;  1ZPS A;  4EQX A;  4DSE A;  3MKC A;  3VTW A;  2HOF A;  5KFD A;  2KSO B;  4P4P A;  3KFU F;  2DBY A;  4QWB A;  3QC8 B;  2AJQ A;  1OFF A;  1L3T A;  1KFS A;  4J1O A;  4NJC A;  3C2L A;  4EWJ A;  1C4A A;  3OJ3 A;  3EJB B;  4QZ9 A;  3RUL A;  1ZD3 A;  4M47 A;  1V59 A;  3GIM A;  3PW2 A;  3DES A;  4DXG A;  3EKG A;  4IP5 A;  2GRI A;  3JVZ X;  1DOI A;  4IC7 B;  1X9M A;  3D2S A;  3EWA A;  3ZDB A;  3OP2 A;  2GGE A;  4LNN A;  2WXH A;  2E5S A;  1DK2 A;  2PI5 A;  8ICG A;  3UMB A;  5ADZ A;  4W9I A;  1MG8 A;  1ZOY B;  1RYJ A;  3P4R B;  4HK2 A;  3KLS X;  1DII A;  4REZ A;  5L9X A;  4GIB A;  1GB4 A;  4H4T A;  5KFN A;  2VFT A;  3TAD A;  3MC0 B;  2QHO A;  2KHW B;  1FD6 A;  3OHB A;  2X99 A;  3SAG A;  3AEC B;  4IWQ A;  4DHZ B;  3N20 C;  3ZVV A;  4BOZ B;  4YR0 A;  3A4R A;  1PYW D;  2OQY A;  2MBO A;  1XNS A;  2WGS A;  1SXE A;  1VDV A;  4XC2 A;  2KKP A;  3R10 A;  3PTF C;  2I1J A;  3W2D A;  1GRE A;  2OWO A;  1QOF A;  2PFQ A;  4WJ3 B;  3AV8 A;  1NZP A;  4NLN A;  4BKT A;  1QOG A;  1FFU A;  4US8 A;  3QZ8 A;  1JXL A;  1WXQ A;  3BQT A;  1UNS A;  1TYT A;  2QGY A;  4DSL A;  2W9M A;  2LGS A;  3BS5 B;  3URY A;  7ICO A;  4JIO U;  2FPL A;  1ZMC A;  4N58 A;  7ICI A;  4C0Z A;  3NVV A;  9ICE A;  2J7Q B;  2F5Z A;  9ICX A;  2BVG A;  2PP0 A;  3MR6 A;  2WU2 B;  3GRT A;  3AI5 A;  2RDH A;  2QPM A;  3JPO A;  7ICJ A;  4C4T A;  1HUO A;  1MSW D;  3UCC A;  2K8C B;  2QCZ A;  2BPG A;  3B2F A;  3RMK C;  4YCX A;  3B9J A;  5L1M A;  2BR0 A;  3Q8M A;  3T8M A;  1SIF A;  1L0X B;  5DG8 A;  3IBE A;  4I2J A;  2BVH A;  3MGH A;  1J19 A;  2ZIU B;  2N9E B;  4ZRK A;  3R7Q A;  4E4F A;  1QH9 A;  2LVO A;  1Q1R A;  3DBH B;  1RYS A;  4UB6 U;  5AZG A;  1XU4 A;  3HSU A;  2LGI A;  2Z59 B;  4I6P A;  4ED3 A;  5E6J A;  1NPX A;  4J9N A;  2KWV B;  3C0R B;  4BAX A;  2AL1 A;  2X8G A;  1N56 A;  1BPB A;  2W11 A;  2Y9T A;  5C3J B;  2GMI C;  1TS5 A;  3C1Z A;  2VRR B;  3K9P B;  1STZ A;  2I1Q A;  3C0P A;  4E8G A;  3II4 A;  3R8B A;  1RVK A;  2P8B A;  3CMM B;  3VCC A;  2QAR B;  1UXY A;  5HR7 A;  4F5R A;  4H4U A;  1T4G A;  2IHN A;  2KOX A;  1FXT B;  2QJL A;  4IR9 A;  4TV3 A;  3AUO A;  1C79 A;  1VD2 A;  3DIP A;  3FDS A;  2IOH A;  4CCH A;  1XDI A;  3I4K A;  3P93 A;  4EMI A;  1H8C A;  2WBA A;  5KG6 A;  3HIZ A;  2KHQ A;  3NHE B;  3T5H A;  5LNK 1;  1ZKQ A;  2W9C B;  3UMG A;  4MF2 A;  8ICB A;  3QN3 A;  3H8J A;  4PHD A;  2MP2 B;  4Y2V A;  3TX1 A;  3RTV A;  3DEQ A;  3WU2 U;  2IY1 B;  1I4G A;  3V7J A;  3LDA A;  1AQ6 A;  1MVK A;  1TYG B;  2LGD A;  2ESE A;  3ONS A;  1N6Z A;  3FM9 A;  2HHQ A;  4KIK A;  2SAK A;  3TKA A;  2Q5W D;  1NOM A;  4PVJ A;  1RM6 C;  3PV8 A;  4WAF A;  5G5H A;  3ENE A;  1NYQ A;  2Y5B B;  3Q8Q B;  4A6Q A;  4ECV A;  3DG7 A;  4JK1 A;  3VTV A;  9ICG A;  1N5W C;  4Y2U A;  4PS8 A;  4L23 A;  3HP6 A;  2BDP A;  1C20 A;  2NPT B;  1FEZ A;  3KH0 A;  1T5X D;  1C9F A;  5ALW A;  1ZQH A;  3VDZ A;  2F3N A;  1IGD A;  3QNM A;  1TKG A;  1V85 A;  2ZCC A;  2C3D A;  2OH2 A;  3T8Q A;  1UGM A;  3HKZ F;  4P6V F;  3T4W A;  3NVW A;  2HHW A;  1E8Z A;  4H4R A;  4Q2J A;  2BKF A;  4RQ2 A;  3WKC A;  3PMN A;  5JTI A;  2XI9 A;  2KO3 A;  5E6P A;  4YN4 A;  5ER0 A;  5DCN A;  1PK1 B;  5DG9 A;  4LNI A;  1T3Q A;  2MSN A;  1TS4 A;  1ZQ1 C;  4C7Z A;  4KN7 A;  1FO4 A;  2JXJ A;  4EZ9 A;  1N62 A;  2JXX A;  2FID A;  1I7H A;  3RJA A;  3QE9 Y;  2LHT A;  4TVY A;  3VFC A;  1D5Z C;  2JEJ A;  4JWN A;  5DDY A;  1UA0 A;  4KDI C;  2MBR A;  2K8B A;  3D2D A;  5KFR A;  3GC2 A;  4UB8 U;  5EE1 A;  2R61 A;  2WOI A;  3IJQ A;  5FMH A;  4O5C A;  2WWZ A;  4UBB A;  3NVY A;  4PL1 A;  3IV6 A;  1MN8 A;  4HKQ A;  5G5G A;  2KVC A;  2K1F A;  2EH9 A;  4ACO A;  4I2G A;  1WCN A;  2BT6 A;  2VZK B;  4WUR A;  3ZRC A;  3WKD A;  4U7C A;  1V8C A;  3DVN U;  3THV A;  5TR5 A;  5LLI A;  1QSL A;  1M6Y A;  5J2I A;  3ZDC A;  3U4F A;  4RT2 A;  3RJF A;  3P0W A;  1L2N A;  5FJO A;  4YWG G;  5D3D A;  1V9J A;  4QZF A;  2P3H A;  4OW0 A;  4X57 B;  5J2B A;  3LWL A;  1SL2 A;  1C4C A;  1ZQS A;  3R2I A;  3RIT A;  1MG4 A;  2PMV A;  4DYE A;  3GIK A;  2WDQ B;  3KWV A;  1L7P A;  2J0J A;  1E7P B;  3A7U A;  1UZX B;  2K6D B;  5T14 A;  1SZH A;  1DXL A;  1BPE A;  2ZTE A;  1R0M A;  1WCL A;  2P8C A;  3U9I A;  2E6X A;  4RNN A;  3L4P A;  4OVU A;  4O5E A;  1VQZ A;  1RPL A;  3MSY A;  3MDC A;  4HPL B;  3RR1 A;  2JHD A;  4NM1 A;  4DFJ A;  3TUO A;  1SKS A;  1SJE D;  3S6J A;  1SE9 A;  3TCA A;  3X0W A;  2ASD A;  1WZ3 A;  1L8P A;  1U49 A;  1HZ6 A;  4FJY A;  4HCN B;  3TI0 A;  3I63 C;  5BOF A;  5EWF A;  3WK9 A;  3V6E B;  5KG1 A;  4OJP A;  4LZD A;  4I2E A;  1E8W A;  2EKI A;  3RCY A;  2HVH A;  2WXR A;  1KLN A;  1N63 C;  2PIA A;  4P0Q B;  1Z4N A;  4YFK A;  2EQ7 A;  2Q4T A;  2F2A B;  5D6J B;  3UXN A;  4P0P A;  4B9M A;  1FRD A;  4ECY A;  2ZW1 A;  2MAX A;  4IM0 A;  1ZMD A;  5J0T A;  2QC8 A;  4Y2S A;  5E6O A;  5KG4 A;  2DX5 B;  2KZR A;  5GTH U;  3ZYY X;  5IP4 D;  1W1S A;  3H8H A;  2R8D A;  2YLM A;  5KG7 A;  3PZP A;  2AU0 A;  2NYV A;  1SE2 A;  3Q69 A;  2G06 A;  3ETL A;  1PVP A;  3BDP A;  2GQW A;  5CHF A;  4UW9 A;  1P3Q U;  2ONE A;  4EX7 A;  1MI0 A;  4N6E B;  3TEY A;  4KWS A;  3DJJ A;  1P7F A;  2ZCB A;  4EEL A;  1J7C A;  2WLB A;  3ZIM A;  2Y5P A;  4BWJ A;  5KFA A;  2XCA A;  4ELT A;  8ICU A;  3L5O A;  3GV5 B;  2YVG A;  2ZXH A;  3MFH A;  4RQ8 A;  3ZDA A;  2KD0 A;  2DKZ A;  2IMW P;  1TS2 A;  2IOF K;  2A4Z A;  2KT7 A;  3OJ4 B;  5KFL A;  4W9H A;  2WPF A;  5TR3 A;  4RQ3 A;  2J6T A;  2MX2 A;  8ICV A;  2V1Y A;  1JUD A;  2J4X A;  2O6V D;  2REX A;  2BDU A;  3KKA A;  3DHG C;  4P1C C;  4IL2 A;  3RJE A;  4FA6 A;  4UAY A;  4OD0 A;  1U47 A;  4W9L A;  4HAI A;  2KFK B;  4TSS A;  2LVP A;  2JY6 A;  5DBA A;  2LVQ A;  4EQS A;  4JWM A;  3P1M A;  1Q10 A;  1UQV A;  2JZB B;  4AWJ A;  5BMG A;  4B95 A;  5CEH A;  5EWE A;  7ICM A;  3QA8 A;  2FCQ A;  4GDK B;  1J8C A;  3Q3J A;  1JXE A;  1SB3 C;  3Q8E A;  5EBK A;  4JE3 B;  3Q8F A;  3F2C A;  2IA6 A;  1XT9 B;  1JWA D;  1GOZ A;  1OQY A;  3UXK A;  4MFC A;  5JRB A;  2WXM A;  2ZTD A;  4P4O A;  3T79 A;  2DYM A;  3D2H A;  4KT2 A;  4EEN A;  3TBL D;  4YP3 A;  3H7P A;  2DWQ A;  1X2I A;  9ICJ A;  2V4L A;  2PTZ A;  1OEP A;  3HM6 X;  3VRA B;  1D5M C;  4IC9 A;  3GZN B;  3QJZ A;  4Y2R A;  3IK4 A;  5KT7 A;  3RJG A;  2KWC A;  4H4X A;  2ZZB A;  2MEK A;  3QK0 A;  3PST A;  5C0Y A;  4AYB F;  2WXJ A;  1XEE A;  4JQW C;  2PLP A;  1F1H A;  3EPG A;  4B6W A;  5I1W A;  4E4U A;  2D8C A;  2V3B A;  3VUX A;  1WGK A;  3Q6J A;  2K22 A;  2EKE C;  4P4M A;  1BQG A;  1D4B A;  3MTN B;  4NM2 A;  3UM9 A;  2ZVO A;  1RLF A;  1A6S A;  1RAX A;  2RDI A;  4ECR A;  5IIO A;  4F2R A;  1UWX A;  4DFM A;  1ZQQ A;  2XN9 C;  4PT5 A;  4TUU A;  1FIQ B;  4PHE A;  3RZF A;  1IUE A;  4EE2 A;  5HKH A;  2BCP A;  3KD3 A;  3IG8 A;  4DQS A;  4I28 A;  2XY6 A;  3BSM A;  4XUS A;  4B9T A;  4GU2 A;  2H88 B;  5AKY A;  4YR3 A;  3D2J A;  1NNL A;  2ZG6 A;  1RXV A;  1WGG A;  1L8L A;  2XY5 A;  4FN2 A;  1BNO A;  2HBL A;  3RNE C;  4RQ5 A;  5KFY A;  1B22 A;  2KJR A;  2OZ3 A;  4M0X A;  3MWC A;  4W9K A;  3PWG A;  1TK5 A;  5FP0 A;  3IXS A;  5J18 A;  1SJB A;  1JRO A;  1WYG A;  1B4F A;  4ELU A;  4RMA A;  3SD7 A;  5ALD A;  2IO1 B;  3TWB A;  1L3S A;  5AI6 A;  2EAM A;  4KDL B;  2KFJ A;  4J9S A;  3PML A;  4DQR A;  3HWT A;  4ELV A;  3UMC A;  1EU4 A;  1Z4O A;  1E10 A;  3OG5 A;  5DQH A;  5DG7 A;  2K4I A;  5J0X A;  3BW7 A;  4UD8 A;  2WF6 A;  5HHH A;  5IAA C;  2WB1 F;  5AE1 A;  2KVZ A;  5EOZ A;  1L6V A;  5KG2 A;  2IOF A;  3C8Y A;  1N5W A;  1I4R A;  3K1G A;  3URH A;  5DBC A;  4DOC A;  1N61 A;  2IZV B;  2KMA A;  4F8C B;  1DOX A;  2QB0 B;  2ZZP B;  1ZQB A;  2ZTC A;  1KKR A;  2YVJ A;  3Q45 A;  4EYH B;  2FAZ A;  1PVR A;  4WAA A;  4H4Y A;  4KLL A;  4JB3 A;  3EJD B;  3N6H A;  5AI8 A;  5B5E U;  5J0P A;  2OZT A;  3RI7 C;  2CR5 A;  3SEN A;  2WXN A;  4LDT B;  1E8F A;  2BC0 A;  2HDO A;  3HM3 A;  3EEZ A;  3HPF A;  4O3R A;  3BIN A;  3SEB A;  2RDB C;  5FS6 A;  4DQO C;  3QX7 A;  3ONN A;  2BCV A;  2ZJD A;  8ICW A;  2HXU A;  5GRT A;  3IHQ B;  2PPH A;  1DYQ A;  3AH7 A;  4FBT A;  3C5F A;  2X50 A;  5JCL A;  3BII D;  1RXW A;  2W9B B;  1WR6 E;  4CHK A;  4NL9 C;  3KTQ A;  4RZR A;  2KTR A;  4J3O D;  3VRB B;  2MUT A;  1QZE A;  2BC1 A;  3QKE A;  5U25 A;  2JZP A;  1SXT A;  2QJN A;  3ZDM C;  4EBC A;  2E8M A;  3L3F X;  2R8K A;  2KK0 A;  2KDB A;  4NJ7 A;  5AM3 A;  1K51 A;  4MEL A;  8ICM A;  1OEY J;  4ZA0 A;  2ATL A;  2W9A A;  2Y0S F;  1S0N A;  4LVS A;  4CDG A;  3AEG B;  1W1Q A;  4IKG A;  1FM0 D;  4K1R B;  2BCS A;  3JSV A;  4F4K A;  2J6S A;  1KJT A;  3JS8 A;  3QUT A;  4J9P A;  2FLP A;  2ZNV C;  3QYP A;  3TQP A;  3OAW A;  3AUL A;  4Q8F A;  1SBB B;  3VDG A;  3WKE A;  2BKE A;  3N4E A;  1YN3 A;  3WAO A;  2FUG 1;  3N7R C;  3N28 A;  1F52 A;  5KFV A;  4JWS C;  5DGB A;  1N60 C;  1FFV C;  1F8W A;  4M9N A;  2WTF A;  2E1F A;  2C2D A;  2V3A A;  4ICA A;  4H1Z A;  3LAE A;  3OSP A;  4MEX A;  1EU3 A;  2YVF A;  3GFK B;  4U6P A;  1WE7 A;  3RB0 A;  4B9S A;  1QKZ A;  3ORY A;  4WJO A;  1ONF A;  1QQ5 A;  5C23 A;  3VQI A;  4A20 A;  3V6H A;  3S5S A;  2PMZ C;  1YOV B;  3MUC A;  4B9K A;  1J2M A;  2BS3 B;  4B6J A;  1UT5 A;  1ZKH A;  2OJR A;  5L83 A;  2E3T A;  2V4Q A;  2XH7 A;  3G6X A;  3DGB A;  1Q5W B;  2BF8 B;  4ACF A;  2PPG A;  3ZLG A;  5HML A;  4ZRQ A;  3OPS A;  2KJ6 A;  4EOY A;  3FXG A;  3NTU A;  3N97 B;  1WMH B;  3MP9 A;  3PT2 B;  3VR8 B;  2KIV A;  1V86 A;  1N63 A;  4EZJ A;  1LM8 B;  1L8O A;  3AMZ A;  3NAS A;  2QKQ A;  1CMX B;  2JR5 A;  2FCS A;  2ZIW A;  3I99 A;  1S5L U;  1SJH D;  2QB1 A;  4I2I A;  3TAD C;  4HEA 1;  4HYR A;  2A8X A;  3GE8 C;  3K1Z A;  5H2F U;  4RGM A;  3VUY A;  3QUB A;  4DWF A;  5AHX A;  5BPC A;  1B9R A;  9ICS A;  4TQ1 A;  1EC8 A;  1HZ5 A;  4RQN A;  4LNF A;  1EBD A;  4H50 A;  4KGR A;  2PE9 A;  2PTW A;  1S77 D;  1ZW7 A;  4FJV B;  1SXD A;  3VA8 A;  2KZZ A;  2WXG A;  2L32 A;  4UDU C;  3APD A;  5ALZ A;  2WOV A;  5C1Z A;  3E58 A;  1FFU C;  2RMM A;  5AUK A;  4GXK A;  3RNG C;  1EWC A;  2WP5 A;  1UWM A;  1MO9 A;  2POD A;  4KZC A;  1KTK A;  4EX6 A;  2HNE A;  4TUS A;  3AE5 B;  2ZIV A;  1WWT A;  1F2R I;  2KOB A;  3CB3 A;  2N1R A;  1OQR A;  1KQQ A;  5BOM A;  5IN7 A;  2H3Q A;  2PMQ A;  2AQ1 B;  1WUE A;  4XQ8 A;  2HHS A;  2VKQ A;  3EUB 2;  3W9C B;  1D9F A;  4MAC A;  2POZ A;  4DFP A;  4P2H A;  5KFJ A;  2OHF A;  2OCE A;  4B0M A;  1JEH A;  2Y9U A;  4YXJ A;  4K4G A;  2RRD A;  5EE3 A;  4W9D A;  2KEY A;  3RR7 A;  2VFR A;  3UQ2 A;  5K4L A;  2YMQ A;  1QSS A;  2RPQ A;  3E9S A;  1YD8 U;  2O6V A;  3PRM B;  1QT9 A;  5KFS A;  3M95 A;  1S1Q B;  2KNB A;  3D2N A;  3VCB A;  2ZXI A;  4GYP A;  3BS7 A;  4GGQ A;  2NRX A;  2XO7 A;  3R9K A;  3FW7 A;  3CT2 A;  8ICT A;  4DS4 A;  1ZY8 A;  4HCD A;  4QZE A;  3PQB A;  4RQ1 A;  3A1Q B;  3E2E A;  8ICR A;  1T7P A;  4UB4 A;  1GO3 F;  3SYZ A;  5C5J A;  9ICN A;  4RNA A;  3PRP B;  4MJS A;  3X23 A;  4F4W A;  2AKZ A;  3GZF A;  1CK1 A;  4ASW C;  4K7S A;  1CEZ A;  1KH0 A;  3RFA A;  4QZA A;  5L1J A;  3H7V A;  5ALT A;  3PLU A;  4WQM A;  1PVQ A;  3U8Z A;  5L1I A;  2KKV A;  2FNJ B;  4MF8 A;  3THU A;  2F8K A;  5FXE A;  1W1M A;  1DTN A;  4AJW A;  4M6U A;  3APF A;  2MH7 A;  1URJ A;  2RLT A;  4JWU C;  4O1N A;  5JU5 A;  2XC9 A;  1ZRM A;  4EYI B;  2JMG A;  4ECZ A;  1ISN A;  1MFW A;  2CKH B;  2J0M A;  5D4B A;  4NAW B;  5BO4 B;  3HRD C;  3SI8 A;  2KVR A;  3TW9 A;  2M1M A;  4F93 B;  4H4Q A;  1J97 A;  5CP2 A;  4C4V B;  5LXH A;  2KTF A;  2ZIX A;  5D49 A;  2PEA A;  2KX3 A;  3LXF A;  2RD0 A;  2GR0 A;  3W5V B;  4KLH A;  5ALO A;  2XY7 A;  1NEK B;  3Q8B A;  2LRU A;  3FAH A;  2DZK A;  2O2V B;  3AE1 B;  1ZQR A;  3CGB A;  2UVW A;  3CAW A;  4C4S A;  2I5Q A;  4OCZ A;  4F72 A;  4WH4 A;  5HMM A;  2LZ6 A;  2KE7 A;  2YMP A;  4B9L A;  2N9X A;  2QDF A;  3OWE B;  1JCK B;  2BBC A;  3TOY A;  2X8H A;  2YAU A;  4Z6E A;  5EU9 A;  2NS5 A;  1UPH A;  1ROE A;  3JW0 X;  8ICJ A;  1U9L A;  3AM9 A;  1WG8 A;  1IPG A;  3QHT A;  3CYM A;  1GRB A;  4R66 A;  1V49 A;  1Q8K A;  5AKZ A;  3M9M B;  4F4X A;  2INN E;  2NPX A;  2R2Z A;  2ON8 A;  4O3O A;  4QZI A;  2PLI A;  1T3Q C;  2JQR B;  3P42 A;  4GGB A;  1JI7 A;  3FC4 A;  4YD2 A;  3OHA A;  1F44 A;  2DAF A;  3ZTD A;  3DGZ A;  1XQQ A;  2H5X A;  3OTR A;  4A35 A;  2LAS A;  1ZK7 A;  1GC7 A;  3KJM A;  3J81 j;  4TUP A;  1SSN A;  4B9N A;  4KGT A;  1ZE3 D;  4WWM A;  1D8L A;  2QAR A;  4W9C A;  1TIF A;  1BPD A;  1GUA B;  2FIF A;  2I9G A;  5DLF A;  3GII A;  1XSP A;  1XC9 A;  3QU4 A;  4K8D A;  3SQP A;  2XVT A;  4M0W B;  5D3I B;  2Y08 A;  1NI3 A;  2OKT A;  5IIN A;  2KYW A;  3ZNH B;  1UT8 A;  5KFO A;  9ICO A;  4RPY A;  1XCQ L;  4XDD A;  2ZC8 A;  4OZC A;  2I6X A;  3MR2 A;  5KL1 B;  2XIC A;  4IQW A;  1T0Y A;  4LTU A;  4W9J A;  3TSS A;  4Q43 A;  4NZL B;  4NY0 A;  1DGJ A;  2G9H D;  5DBB A;  3AED B;  2K4P A;  4AQ7 A;  2AL2 B;  1TYP A;  4O5K A;  4IS7 A;  1F2R C;  2PVO D;  4HWI B;  1H2I A;  1RWS A;  3M8S A;  4DFK A;  4NLZ A;  3TJI A;  1Y8R C;  3NS8 A;  4FP1 A;  1ZQD A;  1PUZ A;  1ZGU B;  1W1J A;  3ZRF A;  4QZG A;  4GGH A;  5J2D A;  2RK5 A;  1WX9 A;  1WVE A;  3RRA A;  2GH1 A;  2WXP A;  4KN4 A;  5ALP A;  3QUC A;  1M4V A;  3IJL A;  3RBE A;  1E0Z A;  1EF1 A;  5AIB A;  4Q44 A;  3ZNZ B;  2C9W B;  5FJP A;  2VA3 A;  1Z1B A;  2AH5 A;  1S0M A;  1TS3 A;  2IYD B;  2JU6 X;  2FCM A;  4OJ5 A;  2W9N A;  4MEM A;  4JN8 A;  2VAN A;  2XGZ A;  2KAN A;  1FNV A;  1TKY A;  4FUL A;  3F53 A;  2JZZ A;  3TMP B;  2OED A;  5HG2 A;  2MNR A;  4GC7 A;  1I4Q A;  1L6U A;  2QLT A;  2FBW B;  1LFD A;  2LXA A;  1ZYQ A;  2AQ2 B;  1N60 A;  3E56 A;  1FFV A;  3TCS A;  2KTQ A;  2Y3R A;  4I2C A;  4MHV A;  1L0Y B;  4FHK A;  3CF6 E;  2LRW A;  1SZP A;  2R2Q A;  3F5A A;  1QLB B;  4EQR A;  3RZW C;  5KT3 A;  2K25 A;  1XF5 L;  1XLO A;  5J2H A;  4ZHO A;  2G4S A;  2JWU A;  1IYX A;  3TAN A;  3BZC A;  2JGA A;  1I4P A;  2AWT A;  2KV2 A;  4FDC B;  4LLG M;  1LPF A;  2AXR A;  1K52 A;  2DW7 A;  2CU3 A;  3KKA C;  3UIN B;  4XX5 A;  2AX5 A;  1A70 A;  1P48 A;  4F4Z A;  3BVG A;  9ICA A;  2UWQ A;  3I6T A;  5HMR A;  5C2T B;  4MGY E;  1E6E B;  2V9W A;  3RJK A;  4HCH A;  1L6N A;  3CXB A;  2IPI A;  2KMM A;  4J9O A;  4UAU A;  1E7U A;  5A0L A;  3FKY A;  3LVV A;  3QEB Z;  1Z3E B;  1ZQC A;  2KNJ A;  3RAX A;  2HE7 A;  3IT6 B;  1GEU A;  5IKC M;  3A7A A;  3UJS A;  3NG0 A;  4XE0 A;  2A1J A;  2GBR A;  3RH5 A;  4TQ0 A;  1KEJ A;  1HQR D;  4GRT A;  2N9K A;  1AW7 A;  1XXG A;  1YNT E;  3ZLF A;  4YMN A;  1Z19 A;  4EFO A;  4F4Y A;  3QAQ A;  4QNL A;  5KFC A;  4K7U A;  3PO5 A;  4UB3 A;  4I2H A;  1A77 A;  1Q0W B;  2ASJ A;  3WK7 A;  2X38 A;  1LKY B;  2GDQ A;  3PX4 A;  2M0X A;  4QWD A;  2XH0 A;  1NEN B;  1MA7 A;  3L5K A;  3EYZ A;  1AWD A;  2JSV X;  3TSH A;  4B0E A;  5KFZ A;  1WX8 A;  3ZJU A;  4GIV A;  3S2A A;  4R63 A;  3ZKJ C;  4KLJ A;  3ZVI A;  4MH8 A;  5CWR A;  4GFJ A;  1ZET A;  4MFF A;  1EBH A;  3UIO B;  1NK8 A;  1TY0 A;  3V6K A;  2LGY A;  2NCN A;  1NYR A;  1LVL A;  1ZQI A;  4OAL A;  3MJ5 A;  2UU7 A;  1HE8 A;  3H0R B;  1J7A A;  2KDM A;  4FHJ A;  4YVZ A;  2GR3 A;  3W8X A;  1P7E A;  3PZ8 A;  3D46 A;  4JV2 A;  5T8I A;  4DHJ B;  4IL6 U;  4GR1 A;  3STP A;  1JMS A;  1NDD A;  2JX5 A;  4KVG B;  3PY8 A;  1D6E C;  3M8R A;  1D5X C;  1QOA A;  2KX0 A;  1GXF A;  3A9J B;  5ALQ A;  3IAM 1;  4K3B A;  4F5N A;  3OPX A;  4M6W A;  4KLI A;  4BKG A;  2OPJ A;  4PS7 A;  4DXK A;  5AIC A;  1ED1 A;  1E9I A;  1ZX9 A;  2NRV A;  3AEF B;  4DQP A;  3GD3 A;  5ALK A;  4RGN A;  3DDH A;  1TJE A;  1C77 A;  5JCK A;  3CRX A;  4NLB A;  1H38 A;  4KGS A;  3H1U A;  4WJQ A;  3N4M B;  1KL9 A;  2VJ5 A;  7ICS A;  3N1Z C;  2C7M B;  2VFU A;  1YN5 A;  3KHR A;  2GLS A;  2WS3 B;  2WYQ A;  3AU5 A;  4KLM A;  3EUB 3;  3QU5 A;  1PQS A;  3HVD A;  4DWD A;  1EC9 A;  2NQL A;  1XLN A;  1YN4 A;  2PKE A;  1WRD B;  1YQ3 B;  4RQ6 A;  3RBD A;  2KIC A;  1BNP A;  3QPE A;  5J2E A;  4YXD B;  3ZLH A;  1NJY A;  1EBG A;  4KLS A;  4ICU A;  3QXG A;  4JHM A;  1NJX A;  3JZU A;  3PR5 B;  3PRZ A;  3DED A;  4RM8 A;  2RP5 A;  2K8A A;  3Q8L A;  1ZD2 P;  5KFP A;  3ISB A;  3SJN A;  2H3V A;  4C8O A;  2MJ3 A;  3ZVH A;  9ICP A;  3CW2 C;  3KHL A;  1MHH E;  4WIP A;  5FR3 A;  1WJU A;  4LJO B;  3V61 A;  1EUV B;  4ED2 A;  3KZX A;  3SSZ A;  3V62 A;  3HPO A;  2KZM A;  1QLN A;  2BYF A;  1TAQ A;  2JRI B;  4XWT A;  1N61 C;  2IPK D;  1SV0 A;  2PCE A;  4GDL A;  1JWM D;  5EDS A;  4JQ9 A;  3PW7 A;  4XDC A;  1FEB A;  8ICH A;  2BS4 B;  5DB9 A;  2WXK A;  2IGD A;  3SDL C;  3LWM A;  1WFY A;  1V9P A;  2GGG A;  3KUD B;  2GQU A;  3H70 A;  3SN1 A;  5AK4 A;  5AUI A;  1IXR A;  3QLD A;  8ICZ A;  2ZJ5 A;  3HT3 A;  1UD7 A;  2DHZ A;  3HKZ C;  2HHX A;  5BYQ A;  5L6F A;  4DDI D;  4C4R A;  2RAB A;  1KD0 A;  1V38 A;  2BQQ A;  4HYK A;  1MOK A;  2LXC A;  2DLB A;  1U48 A;  3EAN A;  3ETR A;  1ESF A;  3JPR A;  7ENL A;  4PGQ A;  1X9S A;  8ICX A;  2MCN B;  2BPS A;  3FJ4 A;  3SR6 B;  4GMV A;  2GQT A;  1WIA A;  9ICT A;  2N4F A;  3TEX A;  5IIL A;  3NZU A;  5F3X B;  5KFU A;  3I3T B;  3PG6 A;  3B0A A;  1NK9 A;  5FS7 A;  3GP7 A;  3ED5 A;  4PPX A;  1I19 A;  1X2G A;  1GER A;  2YX8 A;  1P43 A;  2V4I B;  3R7R A;  2NRZ A;  5J2C A;  3PM9 A;  2MBH A;  2JT4 B;  3P63 A;  2LMR A;  2WPE A;  3TTE A;  3GD6 A;  4W9F A;  1VRA B;  3WKB A;  2LYA A;  3ZI4 A;  1KW4 A;  5KFI A;  2ICI A;  2RHF A;  4HJK A;  2CN1 A;  5AKE A;  4QZD A;  3W1S A;  3ZW3 A;  4KEM A;  2M0A A;  4G9B A;  1SL1 A;  1ECW A;  9ICM A;  4NQK E;  2HSZ A;  3ZDD A;  1X9X A;  3PLV A;  3R11 A;  5IIM A;  4DL6 A;  1AYF A;  3O0F A;  2W43 A;  5CHW A;  5KFH A;  1AAR A;  3ES7 A;  4HRS A;  4EEK A;  4H4Z A;  1ZR6 A;  4DOA A;  5AM2 A;  1KFY B;  2V6O A;  3NFU A;  1DK3 A;  4IR1 A;  1NK6 A;  4PYZ A;  3AB5 A;  1HIW A;  4DQI A;  2HHU A;  4TVW A;  2FPM A;  2PFN A;  1I35 A;  4HDO A;  2J52 A;  5BMH A;  1TY2 A;  3UQ0 A;  4MGI E;  3PRE A;  3N7P D;  2DKX A;  2JEF A;  1L4Z B;  3V6C B;  1TT5 B;  1ZQZ A;  2MRL A;  4NV0 A;  1A5R A;  2OEH A;  2MHJ A;  3RUI B;  1XWL A;  1YZ6 A;  5KTQ A;  4DXA B;  2WPC A;  4UQG A;  4CE6 A;  1T0R C;  2W3S A;  4KLG A;  4C56 C;  4A3P A;  4Z6F A;  2EQ8 A;  5IA7 A;  4XWW A;  4RPZ A;  4IL0 A;  3MGV A;  1C4P A;  2AL3 A;  2B0C A;  2N1V A;  3FVD A;  4J56 A;  3RPF C;  5J0W A;  5D46 A;  5BYR A;  4IWO A;  2ZUC A;  2HVI A;  1FEH A;  1FCC C;  2K5P A;  3ZGZ A;  3Q3F A;  1ZQK A;  4A3R A;  3A7R A;  3OJS A;  5EE9 A;  2PA6 A;  1ZQF A;  2QQ6 A;  1TZO A;  5CRX A;  3V6J A;  4DHG A;  3BWU D;  3NVV B;  3KOO A;  1XCT L;  9ICB A;  4GB9 A;  4J9K A;  3C2K A;  2ZZC A;  4RF0 A;  1WXV A;  1JDF A;  2D3D A;  4ED0 A;  5LXI B;  4EMJ A;  2VFV A;  2PJH A;  1S0V A;  1S76 D;  2AL6 A;  1KLU D;  3GIL A;  3QIJ A;  4N59 A;  2VFS A;  3B9J B;  4PYU A;  4PZO A;  3V3W A;  5AK6 A;  3QU2 A;  3Q8R B;  4O3Q A;  3Q4D A;  3Q3O C;  1LVH A;  1NVI D;  2CPR A;  2LMC A;  3QU9 A;  3ICX A;  2INP E;  5J17 A;  4ZOH C;  3BQ7 A;  4ECU A;  3SU8 X;  2WXI A;  5FJT A;  4C8L A;  2NBV B;  1RYU A;  3TAP A;  4TQS A;  1ACC A;  3KYD D;  1KFT A;  1BGX T;  4G0N B;  4HRO A;  2AQ3 B;  3U2S C;  3OW1 A;  2HQM A;  2P35 A;  2WAQ F;  3NVZ A;  1JX4 A;  5J2F A;  4H2A A;  3DER A;  1ZQT A;  1M94 A;  3EHV A;  3UJE A;  2KAJ A;  4NAM A;  4MGK E;  5AZF A;  2PGW A;  2NO4 A;  5AI4 A;  2BB5 A;  3AE3 B;  3MZN A;  2KJ9 A;  4L1B A;  4UAR A;  3QWZ B;  4QW9 A;  2NVK X;  4FI4 A;  1SJC A;  5KT2 A;  3DVN V;  5KT5 A;  3KBB A;  4O0I A;  3G6Y A;  2R2O A;  4XLO A;  3TSJ A;  3B2G A;  1L5P A;  3UXL A;  4PZF A;  1ZD4 A;  3P4P B;  4CQN A;  4GYP C;  4YXM A;  2W03 A;  4DSI A;  1KLV A;  4R8U A;  1WM3 A;  4YSX B;  2C2E A;  1SKW A;  1YIW A;  2LHE A;  1BWC A;  3HUI A;  1ZXI C;  1E90 A;  2L8J A;  2ZJ8 A;  2Y3S A;  4PZN A;  2D6F C;  2R18 A;  3FIL A;  4HCP B;  5KFM A;  3C2M A;  4WJP A;  4AYB C;  3RR8 A;  4KIK B;  2CDU A;  3V60 A;  1V1P A;  3DEE A;  4E71 A;  5G5H B;  3K4G A;  1P1A A;  3HK0 A;  3NRZ A;  4A9A A;  3CNH A;  4DEZ A;  6ENL A;  1YQ4 B;  4NPN A;  5FKA C;  4DX3 A;  1VR9 A;  4KZ0 A;  4ROP A;  5I1V A;  5J2G A;  4BVU C;  1NZB A;  3RD2 A;  1PFD A;  1RRB A;  4BFR A;  1KFD A;  4DDG D;  2E8N A;  3MQT A;  3L13 A;  2K4H A;  5DPR A;  1VAO A;  3WK8 A;  4H4W A;  1WXM A;  4G11 A;  3V5C A;  4J3Z A;  2LYH A;  1B1Z A;  3GB1 A;  5HHZ A;  4ZRI A;  5J0S A;  3NVW B;  4RQM A;  1EO6 A;  3GSY A;  1V6E A;  4BXO A;  3QU7 A;  3DBR I;  3ZDT A;  8ICN A;  3E0F A;  3KUZ A;  4ZRJ A;  2ALZ A;  3B97 A;  4K1W A;  3Q6B A;  2OJW A;  1R6W A;  3TWA A;  2K39 A;  3SBF A;  1LXD A;  2D5G A;  1WUD A;  4ANW A;  3C1Y A;  4O95 A;  4PYT A;  3TJP A;  5EE0 A;  4CO7 A;  4YWS A;  1KRH A;  3KHH A;  4I2A A;  2F44 A;  2DYB A;  1OTR B;  2IO3 B;  2A1A A;  5FS8 A;  4MSM B;  1LQB A;  2HTM E;  4MLA A;  2K8B B;  3GQC A;  4QIW F;  3AU6 A;  2K9X A;  1IGC A;  4CF5 A;  1MDL A;  1STE A;  2NTT A;  2ISO A;  4H83 A;  4RPX A;  3CXO A;  1WJN A;  3NVY B;  3DCG A;  3RN9 C;  1F9J A;  5G5G B;  1BVS A;  2WF5 A;  1IBX A;  2E8P A;  4EM3 A;  2WB1 C;  5G55 A;  2IO2 B;  3B0Y A;  3DJG X;  4HPP A;  1ZQY A;  5CR0 A;  1L5U A;  4Y2Y A;  2FUH B;  2KQS A;  1D7Y A;  4NLG A;  2GOW A;  2G5I B;  4F8R A;  3IJI A;  4LNO A;  4BUR A;  1BXT A;  1SL0 A;  1XS2 A;  5D7G A;  4MH0 E;  4ZYN A;  1J0G A;  4DHZ E;  2N7D A;  3EFC A;  1ZQM A;  3QFA A;  2LBO A;  1T94 A;  1TE6 A;  4MGZ E;  4QWC A;  3RNA C;  1NKB A;  2SEB D;  1N2X A;  1ZOL A;  1FEC A;  1NHS A;  4JGH B;  2FE9 A;  3Q8K A;  4AJY B;  3HW2 A;  1KKX A;  4BX9 C;  5KHO A;  4RUA A;  3I9V 1;  3SHQ A;  4R65 A;  4TMA B;  2ZAD A;  4DL5 A;  3HJE A;  1GET A;  4GLX A;  2GBM A;  2N9L A;  3K9O B;  5GMV A;  2LHD A;  2NRW A;  1OW5 A;  4PS3 A;  1KM7 A;  2G08 A;  5ALH A;  5KAI U;  1SIJ A;  3H8M A;  2IND C;  4BBN F;  1W1K A;  2FI1 A;  2QVH A;  4IZG A;  3DHH C;  2EQY A;  3ZO5 B;  1JN3 A;  4HKZ E;  2NO5 A;  1ZQG A;  1EM7 A;  4YTN B;  3NS1 A;  3AL0 B;  1HA5 A;  1ZQW A;  2ES6 A;  1XAN A;  4S17 A;  5KHQ A;  4UB2 A;  4DXF A;  2XGQ A;  2BYV E;  4FZL A;  2Y0S C;  9ICI A;  4PL2 A;  3GIJ A;  2IO0 B;  5KNI A;  1UUP A;  3UIP B;  3H7I A;  4Z1Y A;  3ZDE A;  2KLG A;  1Z00 A;  3TL5 A;  3RB4 A;  1H4R A;  3RO6 A;  7ICH A;  1SF0 A;  2DFL A;  2MRP A;  4PJ0 U;  3Q8C A;  3AU2 A;  1ARO P;  4F50 A;  2H89 B;  3A9K A;  3IG3 A;  3PGE A;  2DZI A;  2JH7 A;  2F76 X;  3GDX A;  4PVE A;  2EQ9 A;  1KTQ A;  1L0V B;  2VZK D;  3B08 A;  3IVF A;  1LV5 A;  1QSY A;  2YEP B;  3H9D A;  1MDR A;  3OC4 A;  1SKR A;  2ZZ0 A;  3DDC B;  2OVL A;  2ZUD A;  3JYU A;  1NKC A;  4G3X B;  2KDF B;  1FHV A;  1F3P A;  4BCA A;  3LYY A;  5ALM A;  4K7W A;  1ECQ A;  3D2Q A;  2F77 X;  5H92 C;  2WF7 A;  1LB2 B;  1AHU A;  3ES8 A;  2ZVN A;  5J8Y A;  2K0P A;  3Q8A A;  4IQV A;  2CJN A;  1WUF A;  3UGV A;  4TQR A;  2MJE A;  4MFA A;  5BYS A;  3UXO A;  3U26 A;  4UBC A;  3BZD B;  3BJS A;  1ZQU A;  1L7N A;  4YMM A;  1XSL A;  2KG5 A;  1ZQJ A;  2QJM A;  4JMU A;  4MT5 A;  2AYO B;  2QKN A;  2GOL A;  2UVV A;  4IOI E;  2JRH A;  3FW9 A;  1HUZ A;  2I38 A;  4ML8 A;  3N9Y C;  9ICQ A;  2VAO A;  3V4B A;  8ICL A;  2I1K A;  3VFK A;  4ICV A;  2M17 A;  3WAM A;  4NEW A;  3NZ3 A;  3H7P B;  3EF6 A;  1NI2 A;  3UCD A;  1RYR A;  3DBL I;  4ECX A;  1QQR A;  4PHP A;  1UHU A;  5KFQ A;  3WA0 A;  1GRA A;  4KKJ A;  1MQ2 A;  2XEW A;  2N9P C;  1XO1 A;  1N48 A;  2JYT A;  2MBQ A;  1CJE A;  2FMQ A;  3S1D A;  1S0O A;  2J42 A;  4LZG A;  2FLL A;  3UQB A;  3PFR A;  2FYM A;  4XA5 A;  2XH4 A;  2BWE S;  3VCN A;  2XK5 B;  5FJU A;  2ZUB A;  4BKS A;  3DBS A;  2B76 B;  1C78 A;  1GAQ B;  2Y3A A;  4QZC A;  2PTY A;  3JPN A;  3KZI U;  2WHI A;  5ALS A;  2BS2 B;  2HMX A;  4A90 A;  3SFE B;  5TIS U;  4F7Z A;  1A76 A;  3AQE A;  1W6T A;  2EZZ A;  1CI4 A;  2G45 B;  5FJR A;  1E7V A;  5J2K A;  3M6Z A;  2XCP A;  2ONQ A;  1WWV A;  2WHE A;  1VJK A;  4MGG A;  1XLQ A;  4RT3 A;  4EQW A;  2BWF A;  4G8T A;  5J0R A;  3GU3 A;  5AM4 A;  2P66 A;  2H3I A;  2N1W A;  1DZN A;  2KWD A;  4YTM B;  5GXG B;  3OGU A;  2EAP A;  4O3P A;  3H8A A;  2KSO A;  3NJT A;  3DVG X;  2GB1 A;  3O0H A;  5KL8 B;  2AHO B;  4URK A;  2KN4 A;  3D6J A;  2I2Y A;  1D8Y A;  4RGT A;  5ALG A;  1ZQP A;  4IP4 A;  4GLS C;  4X2P A;  4DL3 A;  3M63 B;  4CYE A;  1C3T A;  2D10 A;  7ICV A;  3P4Q B;  2XSX A;  1KSP A;  4C7Y A;  1IG6 A;  2KD1 A;  4HPM B;  4RFB A;  4GXJ A;  2Q4W A;  1ZXI A;  3SV3 A;  2MA9 B;  2UUU A;  4JV0 A;  5F9L A;  1NK0 A;  3PNC A;  3PO0 A;  1JRP A;  4ED7 A;  5AKL A;  1T3N A;  2GR2 A;  3FW8 A;  1N5X A;  5DB6 A;  1XD3 B;  3L10 B;  3PZ7 A;  5BMI A;  1RM6 B;  2P3Z A;  3JVA A;  2WXF A;  4BWM A;  2IJ0 A;  5AEK B;  4DF8 A;  4YQW A;  4UB1 A;  1ELS A;  1SV4 A;  3CSF A;  2KWU B;  5JCN A;  5L95 C;  9ICF A;  4O3S A;  2WX1 A;  5FR6 A;  5KFX A;  4WWO A;  4A55 A;  2Y5C A;  2M56 B;  2HI0 A;  4TKN A;  2YTU A;  5CHG A;  1E8Y A;  2H3Z A;  5I4D A;  3A33 B;  2BCU A;  4F91 B;  1NK7 A;  3MR5 A;  4GXB A;  1YEY A;  4ZCW A;  3NRW A;  4I2F A;  3BS5 A;  3Q8S B;  2N7E A;  3CGD A;  4F2S A;  3L54 A;  4AOF A;  2UVU A;  4EMW A;  1YQB A;  2AQ4 A;  2P4P A;  4B9V A;  1SV0 C;  1ZQV A;  4F5P A;  3GOE A;  3KYC D;  3PHW B;  2MJD A;  2D3A A;  1OEY A;  2K8C A;  2KTR B;  7ICP A;  1I42 A;  3FCP A;  3GV7 B;  5FXF A;  2MUT B;  2Q0Z X;  2VA8 A;  3ALR A;  1E8G A;  1HSK A;  3R66 C;  4E3C A;  5CA7 A;  4DN1 A;  2HHV A;  5H8Y E;  3TEZ A;  4A6G A;  2QMT A;  1PDX A;  4Z17 A;  1V2Y A;  5AI0 A;  2ZIU A;  2BYE A;  2IDY A;  4II2 B;  1TKD A;  3B0X A;  3KW5 B;  2DL0 A;  1E8X A;  1K53 A;  4PGY A;  2N0S B;  3S1E A;  2C2R A;  3RJ8 A;  1EXN A;  4ZDV A;  4G7F A;  3Q8P B;  3AEV A;  3RJH A;  3R07 C;  2F1I A;  1MHX A;  1QIL A;  3JSV B;  3T6C A;  1MUC A;  2BZF A;  3H6N A;  2HOI A;  1JWU D;  2KN7 A;  3NO1 A;  3V72 A;  4L2Y A;  3ISC A;  3PK7 A;  4DS5 A;  7ICE A;  2FCN A;  3K75 D;  2R8G A;  3ZJV A;  2AKM A;  3MR3 A;  3ZD9 A;  4KIT B;  2PU1 A;  4Q45 A;  4OVV A;  3DG6 A;  2FJ6 A;  1TK0 A;  2GGI A;  4KX5 A;  5JCI A;  2C28 A;  2DNF A;  3W1S C;  2W9C A;  3AE7 B;  1WI0 A;  3POP A;  3R25 A;  4JL9 A;  4JV1 A;  2K6Q A;  1NU5 A;  4EM4 A;  2MP2 A;  1RQN A;  3KUM A;  3TAR A;  4LDT D;  3DK4 A;  5TSS A;  4EUT A;  3SMV A;  4HG0 A;  4DL2 A;  4C8K A;  3APC A;  1RQL A;  3NGD A;  3CWI A;  3ECI A;  3SEI A;  5GTI U;  3U4E G;  5KG3 A;  1WE6 A;  4JDR A;  3NZS A;  4GC6 A;  1R4M I;  1XLP A;  4KX6 B;  3WAN A;  3C5G A;  2ISP A;  2KJ8 A;  5JH5 C;  2TPR A;  4DNS A;  4D2K A;  2D3C A;  4OO1 J;  2EMT A;  1C1Y B;  2EZX A;  2FPK A;  1ZQN A;  1Z5S B;  3PSF A;  2EZY A;  2NPT A;  2ZIW B;  4NY8 A;  5AK5 A;  2KKC A;  4KSK C;  4DL4 A;  4ANV A;  5FXD A;  2J0K A;  4JB1 A;  2MU2 A;  4O3N A;  1HXY D;  4M52 A;  1HTO A;  4IW0 A;  1I4H A;  2W3R A;  3QUQ A;  2DEN B;  3C21 A;  1FHU A;  1TVA A;  2RDX A;  4M04 A;  1OUQ A;  2RDJ A;  1WGR A;  1RG6 A;  3HIL A;  4HN8 A;  1J7B A;  2PTL A;  4RNM A;  3CIR B;  3CYJ A;  3VC6 A;  4EBE A;  2J53 A;  7ICT A;  3S47 A;  1PK1 A;  3CP8 A;  1GG3 A;  1P98 A;  1QOB A;  1WGH A;  2XID A;  4KV2 A;  2AGP A;  2ZW0 A;  1ZJM A;  4P1B C;  4FS2 A;  1KBU A;  4HNL A;  3IFW B;  1NBF C;  1YT3 A;  1G6J A;  2TSS A;  4F71 A;  2ZIV B;  2BQ3 A;  2IBK A;  3V7K A;  5DPS A;  3H12 A;  3PHX B;  1LGR A;  4KPL A;  3N30 A;  5AE2 A;  3DK8 A;  2WF8 A;  4GOC A;  1QF6 A;  1M6I A;  1T8E A;  3WK4 A;  3QEA Z;  1ZQO A;  4ECW A;  3FYH A;  2KC2 A;  3NXL A;  4M8M A;  1WRI A;  4LJX A;  2G07 A;  1T0Q C;  3QCA A;  4RM9 A;  3PO4 A;  4FE3 A;  1JW9 D;  1SB3 B;  4DLG A;  4GXI A;  1Q3V A;  4DSJ A;  5D79 A;  1GES A;  5KFK A;  4RUC A;  9ICU A;  4ECS A;  4QWE A;  2PTX A;  3M7D A;  3RB3 A;  3N32 A;  5CJ7 A;  3R1Z A;  5CB1 A;  1U45 A;  3TAQ A;  1PK3 A;  4M02 A;  4YSZ B;  2PFO A;  2O6V B;  1YQZ A;  2NRT A;  3WK6 A;  3H4K A;  3H0M B;  2P88 A;  3MHZ A;  3O13 A;  4MM3 B;  2AXT U;  2EQ6 A;  2YEP F;  3ZLZ A;  4YR2 A;  3M9O B;  1ZD5 A;  5HR6 A;  4ZRP A;  3H8W A;  5J2R A;  1MBT A;  4F1S A;  3ML8 A;  1W1O A;  4EZ6 A;  2J3N A;  4Z6C A;  2BYT A;  3IAS 1;  3IT4 B;  1CRX A;  1F0Z A;  4KTQ A;  4MJS B;  3OLM D;  2WDV B;  1X40 A;  5DB7 A;  1BPX A;  1D9D A;  1KKO A;  2OXO A;  2D3B A;  3OSN A;  4CRX A;  2IGG A;  1GJZ A;  3GO2 A;  1VJ5 A;  3A0B U;  4AP9 A;  4O9M A;  1HEZ E;  3HVZ A;  2V0G A;  3CGC A;  5IOI A;  5G2N A;  3N1Y C;  1R4N I;  4HVB A;  2GI9 A;  1UF0 A;  4H4P A;  3IP4 B;  9ICK A;  4P0Q A;  1WGD A;  3MJW A;  4PVK A;  2VIX A;  1W1R A;  3LLB A;  5AKJ A;  3TJ4 A;  2G5H B;  2KLC A;  4O3M A;  3HX0 A;  1ZDV A;  4BDP A;  3PZD A;  3WIM A;  4H19 A;  2ZIX B;  4ANU A;  1U4B A;  4MSQ B;  5BOE A;  4M9L A;  3SD5 A;  3NOB A;  3I1Y A;  5ALL A;  1C7Y A;  4DSK A;  1ONE A;  2YB1 A;  2DZJ A;  2X8C A;  3LYS A;  3PVL A;  2GO7 A;  1WGY A;  1NKE A;  1MC8 A;  3R0K A;  4F3O A;  2HD5 B;  5DPT A;  1ZRN A;  4HXD A;  1GNU A;  5KT6 A;  4OVZ A;  2OM6 A;  2OQH A;  1EWY C;  1SE3 A;  2L00 B;  2NBU A;  5MPO A;  1K1S A;  7ICK A;  3LVW A;  1HTQ A;  3MC9 A;  1DOY A;  1X1M A;  2UVR A;  4LNK A;  3R0U A;  2H3F A;  1L7Y A;  2HTH A;  1D3Z A;  1K1Q A;  2EXR A;  3GV8 B;  5D94 A;  4NJ6 A;  1L3V A;  2OO6 A;  5ALX A;  1JRU A;  4IRK A;  3ALB A;  4KLO A;  5ALE A;  3VC5 A;  3JPP A;  2KFK A;  3LB8 C;  4RCO A;  2WNM A;  1X66 A;  2FMS A;  3T3N A;  3ZNI D;  2GRT A;  2O6K A;  5AKG A;  7ICR A;  2L0T A;  3NY5 A;  4NQL B;  4QAY A;  3DGH A;  2JZB A;  5E79 U;  2LUE A;  2MWS B;  2V3N A;  3R2T A;  5J0O A;  2LGX A;  2I0K A;  2OX4 A;  1QLT A;  3KUC B;  1NJZ A;  4GDK A;  5E6N A;  4WWN A;  1GRH A;  1YX5 B;  3BJY A;  3H4B A;  3L0W B;  2V9H A;  4C00 A;  4K4H A;  1SEB D;  3C23 A;  3DQV A;  2WQY B;  3P2B A;  2PP1 A;  3DFY A;  4HNC A;  1B0X A;  2KK8 A;  4QZH A;  3LXD A;  4R64 A;  1Z2M A;  4BUG A;  4EZK A;  2P13 A;  2N7J A;  5IIK A;  4PK1 A;  4YT0 B;  3VVW B;  4UB5 A;  4KLT A;  1C76 A;  1TKK A;  4KLU A;  1WH3 A;  1X2H A;  5ALN A;  1GC6 A;  1K8R B;  4LII A;  3BQ2 A;  2PP3 A;  4J9L A;  5J2J A;  9ICR A;  2JEG A;  4JUZ A;  2Z0E B;  2Z8L A;  1JPM A;  4IQT A;  2AGO A;  1PGB A;  3Q3N C;  2BPF A;  3DVG Y;  1EC7 A;  4E5T A;  2OZ8 A;  2QAE A;  3BY4 B;  3S1C A;  2E5A A;  1OGW A;  3Q14 C;  5JRT A;  4BV6 A;  4OZB A;  2L52 A;  3UJR A;  2ACZ B;  2P6R A;  3LAD A;  4YD1 A;  2DPI A;  4DWI A;  1FCL A;  4IUM B;  3H7S A;  5CTR C;  3AEE B;  2LWP A;  4OJO A;  4C8M A;  9ICH A;  4DSF A;  3RJI A;  5F9N A;  2WP9 B;  2RQ5 A;  2YY6 A;  3WCQ A;  1FIQ A;  4YWO A;  2JZ3 B;  5J0U A;  3MC8 A;  2DZM A;  2ZNV B;  3VUW A;  2L3Z A;  2LD9 A;  1R7S A;  1ZQX A;  3UQA A;  4EBD A;  3W1Y A;  3SN0 A;  2E8O A;  1DOQ A;  4E74 A;  2KQ7 A;  1TBE A;  1PGX A;  3Q3M C;  4Z6D A;  4YSY B;  1NHR A;  2BGF A;  3AE4 B;  1KF6 B;  5J2A A;  2B6G A;  4XYC A;  2HHT A;  1XS9 D;  2MLB A;  2OOB B;  5ALY A;  3VC8 A;  4NLK A;  1GRG A;  1UCV A;  4UAW A;  1ZUD 2;  4M00 A;  1O03 A;  1Q1O A;  2V3S A;  1HJP A;  3UGB B;  4A3O A;  4BBY A;  3W8W A;  4ZHP A;  3EW9 A;  3QTP A;  3ZUN A;  2KVS A;  4P16 A;  1QCK A;  3PWI A;  4J9R A;  1WX7 A;  2P6U A;  2AEH A;  4QW8 A;  3VH3 B;  4K2S A;  2LUM A;  4ED6 A;  1JIH A;  2JK6 A;  3MY9 A;  1WYW B;  3EZ5 A;  3M9N B;  8ICF A;  4ITK A;  3BVZ A;  5CHV C;  2L1A A;  1AHV A;  3L17 A;  4JX1 C;  3FWA A;  1WXS A;  5HHI A;  1OJT A;  2F1J A;  2VA2 A;  4NXZ A;  2QB0 A;  4LK0 M;  4KKI A;  9ICV A;  1DIQ A;  3F2D A;  3PW4 A;  3HHM A;  3MHS D;  1F5S A;  3S1F A;  3GD4 A;  5J8Y C;  3DBR B;  1RFA A;  4JLC A;  3DBH I;  4IM2 A;  1PGA A;  2W7O A;  4H4S A;  4NJ8 A;  3KHG A;  2CHX A;  2KQ4 X;  4CNQ A;  2DF4 B;  4JN7 A;  3DQ0 A;  4AS1 A;  4M8N A;  2A1J B;  4BKS D;  1UBQ A;  2NV3 A;  2EAO A;  2ZPN A;  2HCF A;  2JRZ A;  1I4X A;  1WZ0 A;  3RCZ A;  4GIS A;  4UAZ A;  1WM2 A;  2AQ0 A;  3SAF A;  5DKW A;  1K50 A;  1V1O A;  2QSD A;  2ASQ A;  3LDZ E;  3N1X C;  4HDQ A;  5AKK A;  2QJJ A;  2YML A;  4DK5 A;  2W9B A;  5KVI A;  4RNO A;  4B9U A;  1CZP A;  2K60 A;  5KG0 A;  1KLG D;  3RNC C;  4ARC A;  4FO6 A;  5AZH A;  4A8X C;  1GRF A;  2KMC A;  1XO0 A;  4YMO A;  2L0F A;  2ASL A;  3VXW A;  3BOX A;  1NK4 A;  5ALU A;  1PUT A;  4QZB A;  1Q46 A;  2IGH A;  2BHN A;  3MFI A;  2KZ3 A;  2G09 A;  2CHR A;  3RT3 B;  1E8H A;  4R3D A;  3EA6 A;  4KLF A;  1YJJ A;  4Y2T A;  1JAL A;  3CK5 A;  1VCB A;  5ALJ A;  4DNA A;  2PFP A;  2JH1 A;  3AEB B;  5B66 U;  4M9H A;  1NHQ A;  4K7Z A;  1X6J A;  3WAP A;  4H2H A;  3GE3 C;  4APN A;  2MW5 A;  3AU4 A;  4K4I A;  1X6I A;  4BC7 A;  2WF9 A;  4M6W B;  5DPW A;  2QDD A;  4XGA B;  2KDE B;  3LK9 A;  5AI5 A;  2W8L A;  3L16 A;  2GL5 A;  2WXL A;  1IIP A;  2L5Y A;  2C60 A;  2MSE D;  1V97 A;  4FZN A;  1RDF A;  4EEY A;  3M62 B;  5AI9 A;  3H0L B;  3T9L A;  5HNK A;  1KN5 A;  4KMO B;  2JV3 A;  2WAQ C;  1SE4 A;  2C7N B;  2RPV A;  2LPE A;  5L1L A;  4IDI A;  3EJE B;  3UJF A;  3TIX A;  5AWV A;  3JPT A;  2IY0 B;  1SJD A;  4M9G A;  3VHT C;  1WR1 A;  3RH6 A;  3SN4 A;  3F2B A;  2KFN A;  4MKS A;  2K4E A;  2W82 A;  3KLJ A;  3D47 A;  3ML9 A;  7ICL A;  1QQ7 A;  2PS2 A;  1RZT A;  8ICI A;  9ICL A;  1YJ1 A;  4UAV A;  7ICG A;  2KJH B;  3J9C A;  1L7M A;  1S9F A;  1WMH A;  4XZ4 A;  4HPN A;  3H4D A;  3MC1 A;  5KFT A;  3AQF A;  1JML A;  4WQO B;  4NWI A;  2YN4 A;  3AXC A;  2KC1 A;  4W9G A;  2WFA A;  3ZVH B;  4IQU A;  1TKE A;  1XHC A;  3A0H U;  2LFI A;  3TAC B;  2BW2 A;  1JOA A;  3I57 A;  1S8O A;  4OHJ A;  1TE2 A;  2LKY A;  2MQJ A;  2R9Z A;  5JHB A;  3FYY A;  2B3A A;  1RFK A;  2IBI B;  5DLG A;  3I6E A;  2K3U A;  3PSI A;  2NMQ A;  4Y2X A;  2CXY A;  4J9Q A;  1OQQ A;  3C28 A;  2J6U A;  5KT4 A;  4GDL B;  3ZD8 A;  2EMS A;  2O3G A;  4BOS C;  5JHA A;  5FS9 A;  3T5K A;  2AGQ A;  4F5Q A;  2CU1 A;  3M1Y A;  4LJP B;  4DHJ D;  3DV9 A;  1WVF A;  1Q3U A;  4I2B A;  1OXJ A;  2XK5 A;  3TEW A;  5TZV A;  4PWB A;  1NEL A;  2C7H A;  1F77 A;  5III A;  5FK9 C;  5KFW A;  2LI5 A;  4F5O A;  1SWW A;  1WSP A;  3QZ7 A;  1KN0 A;  4GIR A;  2XNA C;  2NQW A;  4KX3 A;  3K1R B;  1KDH A;  3I76 A;  4KLD A;  3LB8 A;  1V81 A;  1ZQA A;  1WF9 A;  4EKU A;  3DG3 A;  4F4R A;  3ETR B;  3IRU A;  3WKA A;  2HJ8 A;  3W5U B;  2PSN A;  4E6M A;  3JPS A;  2GH5 A;  4LCD E;  2PW9 A;  4DFD A;  5KFF A;  4MEY A;  3SQI A;  1NK5 A;  3W8Z A;  1S7M A;  2GGH A;  1SGG A;  1SGH A;  5U1O A;  1GV4 A;  2W8K A;  1EF5 A;  8ICS A;  3AE8 B;  3ENL A;  4DCC A;  2L7R A;  2PE6 B;  1BZL A;  4I29 A;  5ALI A; 
#chains in the Genus database with same CATH homology
 2MBR A;  2I2Y A;  3D2D A;  4ZHO A;  2R61 A;  2JWU A;  4RGT A;  5EE1 A;  4GLS C;  3TEY A;  1E9M A;  3NVY A;  1I4P A;  4HJG E;  5G5G A;  4HKQ A;  3P4Q B;  4LLG M;  2AXR A;  4C7Y A;  1K52 A;  4RFB A;  2BT6 A;  2CU3 A;  2VZK B;  2Q4W A;  4WUR A;  1ZXI A;  1ET9 A;  1V8C A;  2AX5 A;  1A70 A;  3GS2 A;  3BVG A;  2UUU A;  2JYE A;  5HMR A;  3PO0 A;  2WU5 B;  1JRP A;  5C2T B;  1E6E B;  4C80 A;  4YWG G;  5D3D A;  1AHZ A;  2P3H A;  4OW0 A;  2IPI A;  2KMM A;  3FW8 A;  1YMH E;  1N5X A;  3AE6 B;  1RM6 B;  3PZ7 A;  5BMI A;  1C4C A;  3IT6 B;  2WXF A;  3R2I A;  2IJ0 A;  3A7A A;  2PMV A;  4XE0 A;  2RDG A;  1ENF A;  2WDQ B;  3KWV A;  4TQ0 A;  1FRR A;  1E7P B;  1HQR D;  3A7U A;  2N9K A;  2OAI A;  1AW7 A;  2BVF A;  1XXG A;  1YNT E;  4A55 A;  5L6G A;  2Y5C A;  2M56 B;  5HI1 A;  5I4D A;  2E6X A;  3L4P A;  1VQZ A;  2X38 A;  1SJE D;  4PWC A;  1NEN B;  1HZ6 A;  2JSV X;  1AWD A;  3TSH A;  4B0E A;  2EKI A;  3ZJU A;  1ET6 A;  2P4P A;  1ZDX A;  2WXR A;  4MH8 A;  1N63 C;  2PIA A;  2MJD A;  1FNW A;  1TY0 A;  2JXT A;  2UUV A;  1FRD A;  2PVG C;  1NYR A;  2ZW1 A;  5FXF A;  1E8G A;  1HSK A;  4OAL A;  3MJ5 A;  1W1S A;  3ZYY X;  1J7A A;  2KDM A;  5H8Y E;  3TEZ A;  3H8H A;  2R8D A;  3W8X A;  1P7E A;  1PDX A;  2QMT A;  3PZ8 A;  5T8I A;  1SE2 A;  2CJO A;  3Q69 A;  2IDY A;  2JX5 A;  1K53 A;  1D6E C;  1MI0 A;  1D5X C;  1QOA A;  2BB6 A;  2N0S B;  4N6E B;  1P7F A;  3ABV B;  3IAM 1;  1F0X A;  1J7C A;  2WLB A;  3S1E A;  2Y5P A;  3RJ8 A;  3AE9 B;  3AEF B;  1CQV A;  3R07 C;  1TS2 A;  1MHX A;  4RGN A;  1QIL A;  1FXA A;  1TJE A;  1C77 A;  1JWU D;  2J4X A;  4KGS A;  3V05 A;  4L2Y A;  1LO5 D;  2VFU A;  1YN5 A;  4TSS A;  2WS3 B;  3KQ4 A;  3ZJV A;  3EUB 3;  3HVD A;  3P1M A;  1Q10 A;  1XLN A;  1YN4 A;  4ARI A;  1YQ3 B;  5BMG A;  4M0W A;  1VZ7 A;  3NVZ B;  2DYO A;  4GDK B;  3AE7 B;  4YXD B;  1SB3 C;  3BYT B;  2YVS A;  3POP A;  3Q8E A;  4JE3 B;  3Q8F A;  2W54 A;  3DED A;  1JWA D;  2PKO A;  1GOZ A;  5TSS A;  1E0Y A;  4HG0 A;  2MJ3 A;  2WXM A;  4WIP A;  5FR3 A;  1MHH E;  3D2H A;  2DYM A;  3CWI A;  3U4E G;  2DWQ A;  1Y56 A;  1XLP A;  4KX6 B;  3VRA B;  4DNS A;  1D5M C;  4D2K A;  1N61 C;  4XWT A;  2IPK D;  5HFY A;  4US9 A;  1JWM D;  3FIL B;  2BTE A;  1FMA D;  4XDC A;  2MEK A;  2V3P A;  2WXK A;  2BS4 B;  2WXJ A;  1XEE A;  1ZP0 B;  2IGD A;  3AE2 B;  5FXD A;  2PLP A;  5I1W A;  2GQU A;  4JB1 A;  1HXY D;  1V1P B;  1WGK A;  5AUI A;  2K22 A;  1I4H A;  1D4B A;  3NRZ B;  2W3R A;  5BYQ A;  5L6F A;  4OZA A;  5FXP A;  3AN1 A;  2NTS A;  1UWX A;  4RH6 A;  2XN9 C;  4PT5 A;  2DLB A;  1J7B A;  2PTL A;  2M19 A;  3CIR B;  1FIQ B;  3ETR A;  1IUE A;  2J53 A;  3TUO A;  1ESF A;  1QOB A;  2PLS A;  1XO3 A;  2ZW0 A;  4EE2 A;  1L4D B;  3SR6 B;  2GQT A;  3TEX A;  2TSS A;  2H88 B;  4FXC A;  3D2J A;  3DWM A;  2Q85 A;  3GP7 A;  5AE2 A;  1I19 A;  1X2G A;  1QF6 A;  2WDR B;  3RFZ B;  2V4I B;  2W55 A;  5AE3 A;  3PM9 A;  1ZXH A;  1JQ4 A;  3P63 A;  1WRI A;  3IXS A;  1VRA B;  3T3O A;  1JRO A;  1WYG A;  1JW9 D;  1SB3 B;  2ICI A;  5D79 A;  3W1S A;  2M0A A;  5JXV A;  1AYF A;  1EU4 A;  1E10 A;  4YSZ B;  1VZ8 A;  2WXO A;  2G1E A;  4HRS A;  3ZQ4 A;  4UD8 A;  3MHZ A;  1ZR6 A;  3BW7 A;  1KFY B;  3O13 A;  3MFG A;  5K8E A;  4MM3 B;  1IBX B;  5AE1 A;  1L6V A;  2YEP F;  1AN8 A;  2L83 A;  3AB5 A;  1JWB D;  3V3X A;  1MBT A;  4ZRP A;  4TVW A;  2J52 A;  3C8Y A;  3HRD D;  1W1O A;  1N5W A;  1I4R A;  1TY2 A;  5BMH A;  1N61 A;  2LJI A;  2BYT A;  3IAS 1;  3IT4 B;  1DOX A;  1F0Z A;  4ZYS A;  1JWS D;  2WDV B;  1L4Z B;  3U7Z A;  1T6B X;  2IGG A;  2W3S A;  4C56 C;  2WXN A;  1E8F A;  1HEZ E;  3SEB A;  3HVZ A;  2V0G A;  4XWW A;  3BK2 A;  3BVM A;  1C4P A;  4RGO S;  3RPF C;  2GI9 A;  4EC3 A;  5BYR A;  1DYQ A;  3AH7 A;  3BII D;  4J3O D;  1FEH A;  4PVK A;  1FCC C;  2K5P A;  3ZGZ A;  3VRB B;  1W1R A;  3LLB A;  3A7R A;  5EE9 A;  1ZDV A;  4JPS A;  4USA A;  2JZP A;  1SXT A;  1TZO A;  1UGJ A;  4JAY A;  2FE8 A;  3BWU D;  3SFD B;  3NVV B;  1XCT L;  3NS1 B;  1K51 A;  3EGR A;  4RF0 A;  2VFV A;  1MBB A;  4OVZ A;  1KLU D;  4N59 A;  3B9J B;  1EWY C;  1SE3 A;  3AEG B;  5MPO A;  1W1Q A;  2VFS A;  4IKG A;  4BC9 A;  1FM0 D;  2LEK A;  1VZ6 A;  1VLB A;  1DOY A;  3VR9 B;  3JS8 A;  1NVI D;  2LMC A;  2EXR A;  4YTP B;  5HQX A;  2INP E;  1SBB B;  4ZOH C;  1YN3 A;  2WXQ A;  2WXI A;  2FUG 1;  3LB8 C;  4RCO A;  2WNM A;  3VTE A;  1FNU A;  1ACC A;  3T3N A;  4PVH A;  1GPX A;  3U52 E;  4HRO A;  4JWS C;  2AQ3 B;  3U2S C;  1N60 C;  2V3N A;  3R2T A;  1FFV C;  2I0K A;  4H2A A;  3NVZ A;  1QLT A;  2QEJ C;  2QIE B;  1N62 C;  2KAJ A;  3LAE A;  4NAM A;  1EU3 A;  3NUH B;  2BB5 A;  3AE3 B;  1SEB D;  4L1B A;  1QKZ A;  2KAC A;  2WQY B;  3ZJT A;  2HDE A;  3VQI A;  2P13 A;  3TSJ A;  2N7J A;  4XLO A;  2WDW A;  3B2G A;  1L5P A;  2BS3 B;  4YT0 B;  4PZF A;  3P4P B;  4CQN A;  2E3T A;  1C76 A;  1X2H A;  3DWG C;  1W1L A;  4ZRQ A;  3VR8 B;  3MP9 A;  2Z8L A;  4YSX B;  1QLU A;  2LHE A;  1N63 A;  3HUI A;  1ZXI C;  1PGB A;  3AMZ A;  2Y3S A;  1MPE A;  4ML8 A;  1YJI A;  3FIL A;  3S1C A;  2E5A A;  5HHD G;  3I99 A;  1SJH D;  4HEA 1;  4OZB A;  2L52 A;  4RGM A;  2ACZ B;  1B9R A;  1BUI C;  1V1P A;  4TQ1 A;  1HZ5 A;  5G5H B;  2EEL A;  4KGR A;  4A9A A;  3NRZ A;  1FCL A;  1FXI A;  1YQ4 B;  3AEE B;  5FKA C;  2WXG A;  1VR9 A;  2L32 A;  4UDU C;  3P4S B;  5I1V A;  3UI3 A;  1BML C;  2WP9 B;  1FFU C;  3WCQ A;  1FIQ A;  1PFD A;  2RMM A;  5AUK A;  1VAO A;  2QIL A;  1EWC A;  1UWM A;  2Y4G A;  3SR6 A;  3KWL A;  1KTK A;  1B1Z A;  3GB1 A;  5HHZ A;  3NVW B;  3AEA B;  1R7S A;  4ZOH B;  3AE5 B;  1WWT A;  1F2R I;  3GSY A;  3BYY B;  1GB1 A;  1OQR A;  3BK1 A;  1PGX A;  2AQ1 B;  2D5G A;  4YSY B;  4RF1 A;  1ZPS A;  1KF6 B;  3AE4 B;  4O95 A;  3EUB 2;  5EE0 A;  4PYT A;  1KRH A;  4MAC A;  3W9C B;  2OHF A;  4B0M A;  2DBY A;  1ZUD 2;  5EE3 A;  4BBY A;  1OFF A;  3W8W A;  4ZHP A;  2VFR A;  2HTM E;  4NJC A;  4MLA A;  1C4A A;  2K9X A;  4P16 A;  1IGC A;  1STE A;  2NTT A;  3E9S A;  1QT9 A;  4DXG A;  2GRI A;  2LUM A;  1DOI A;  3NVY B;  5G5G B;  1IBX A;  4ITK A;  3BVZ A;  2L1A A;  1AHV A;  3FW7 A;  4JX1 C;  3FWA A;  2WXH A;  3PQB A;  5ADZ A;  4RNA A;  1ZOY B;  1BXT A;  1RYJ A;  4KKI A;  3P4R B;  4LK0 M;  5D7G A;  3KLS X;  1CK1 A;  4REZ A;  1DIQ A;  1DII A;  1KH0 A;  1GB4 A;  3S1F A;  2VFT A;  3MC0 B;  4WQM A;  1FD6 A;  1PGA A;  3AEC B;  2KQ4 X;  2SEB D;  1PYW D;  3DQ0 A;  4AS1 A;  1VDV A;  5FXE A;  1W1M A;  1I4X A;  3W2D A;  2MH7 A;  4JWU C;  4O1N A;  1QOF A;  3I9V 1;  1V1O A;  1K50 A;  3AV8 A;  4TMA B;  2QSD A;  1QOG A;  1FFU A;  4NAW B;  4US8 A;  2N9L A;  3HRD C;  2LHD A;  1WXQ A;  1CZP A;  1UNS A;  1KLG D;  4ARC A;  1SIJ A;  1W1K A;  3URY A;  4A8X C;  3LXF A;  4N58 A;  4HKZ E;  3NVV A;  3W5V B;  1EM7 A;  3Q8B A;  3NS1 A;  1NEK B;  1HA5 A;  1PUT A;  2IGH A;  4YTN B;  2BVG A;  3FAH A;  2WU2 B;  2RDH A;  2QPM A;  3AE1 B;  4DXF A;  1E8H A;  3B2F A;  4R3D A;  3EA6 A;  3B9J A;  4WH4 A;  1UUP A;  3OWE B;  1YJJ A;  1JAL A;  1JCK B;  1L0X B;  2BBC A;  1SF0 A;  3AEB B;  2BVH A;  3Q8C A;  1ROE A;  3AM9 A;  2H89 B;  3HSU A;  2LGI A;  2INN E;  4BC7 A;  5E6J A;  2R2Z A;  2ON8 A;  4PVE A;  1L0V B;  2VZK D;  2WXL A;  1T3Q C;  2PLI A;  2JQR B;  3P42 A;  1V97 A;  2YEP B;  3FC4 A;  5C3J B;  1TS5 A;  1SE4 A;  2RPV A;  4IDI A;  3C0P A;  3R8B A;  5AWV A;  4BCA A;  3KJM A;  3LYY A;  1SSN A;  1UXY A;  4KGT A;  1ZE3 D;  4WWM A;  2QJL A;  1C79 A;  5H92 C;  1AHU A;  2K0P A;  3Q8A A;  2CJN A;  2W82 A;  2MJE A;  5BYS A;  5D3I B;  2Y08 A;  1NI3 A;  3BZD B;  5LNK 1;  3J9C A;  4XDD A;  1XCQ L;  4OZC A;  4MT5 A;  2QKN A;  4LTU A;  4IOI E;  3FW9 A;  1JML A;  3TX1 A;  3TSS A;  2I38 A;  1I4G A;  4NZL B;  1MVK A;  3N9Y C;  1TYG B;  2VAO A;  1DGJ A;  2G9H D;  3AED B;  1TKE A;  2LFI A;  4AQ7 A;  1F2R C;  2BW2 A;  2PVO D;  1RWS A;  2SAK A;  3I57 A;  4OHJ A;  2Q5W D;  3NZ3 A;  4PVJ A;  1RM6 C;  4WAF A;  5G5H A;  1QQR A;  1NYQ A;  1RFK A;  2K3U A;  4KKJ A;  4A6Q A;  2NMQ A;  1OQQ A;  1W1J A;  1N5W C;  2JYT A;  1CJE A;  4GDL B;  3S1D A;  4L23 A;  2J42 A;  2O3G A;  1WVE A;  2RK5 A;  1C9F A;  1T5X D;  2WXP A;  1IGD A;  1M4V A;  1E0Z A;  4PWB A;  2B76 B;  1TKG A;  1WVF A;  1C78 A;  1GAQ B;  2Y3A A;  3TEW A;  4DQO C;  1TS3 A;  2BS2 B;  2JU6 X;  4A90 A;  1F77 A;  3SFE B;  5FK9 C;  4P6V F;  3NVW A;  1FNV A;  1TKY A;  1WSP A;  2OED A;  4Q2J A;  2XNA C;  5HG2 A;  2NQW A;  2ONQ A;  1I4Q A;  1L6U A;  1VJK A;  1XLQ A;  2FBW B;  3ETR B;  3E56 A;  3W5U B;  2AQ2 B;  1N60 A;  1DZN A;  1FFV A;  2KWD A;  1T3Q A;  2Y3R A;  1TS4 A;  4YTM B;  2PW9 A;  4C7Z A;  1L0Y B;  5GXG B;  3W8Z A;  1FO4 A;  1N62 A;  2GB1 A;  1I7H A;  1QLB B;  3RJA A;  3AE8 B;  4TVY A;  1D5Z C;  1XLO A;  2KN4 A;  1XF5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...