2W3RA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 126
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3rA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3rA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3rA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3rA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3rA04
2K5PA 1SF0A 2CU3A 1OFFA 2GQTA 4US9A 1ZXIA 2N0SB 1N61C 2JQRB 1FMAD 4C80A 1PUTA 3AECB 3S1CA 4YTMB 1JROA 5EE1A 1XLQA 2BVHA 2DBYA 3CWIA 1FIQB 3C0PA 3I99A 2QKNA 2PVOD 3VR9B 1FM0D 2WDQB 2O3GA 1T3QC 1QOBA 2PLSA 2B76B 1XLNA 2L52A 4JWUC 2HTME 2YVSA 3EUB3 5HHZA 1OQQA 3L4PA 3TX1A 3AN1A 1W1RA 1E0YA 4OALA 4LTUA 2PIAA 3SFDB 1RFKA 1QLUA 3AM9A 3D2JA 1GPXA 3LLBA 2H89B 4YSZB 3JS8A 2L83A 3NRZB 1UXYA 3NVZB 2AX5A 3AV8A 1VAOA 1RM6C 1DZNA 3AE5B 1SB3B 2BS2B 3HUIA 1CZPA 4ZOHB 1A70A 3AE7B 4JWSC 2GQUA 3NVVB 1FFVC 4HRSA 1XO3A 2W3SA 3AE9B 2MH7A 1JWAD 2OHFA 3NVWA 5EE9A 4BC7A 3B9JA 3FW8A 1E7PB 2W54A 1YQ3B 2CJOA 3W8WA 1W1LA 2OAIA 3DWMA 4YT0B 3LAEA 3GSYA 1XLOA 2G1EA 1I19A 2PVGC 5G5GB 1TKGA 4KX6B 2MJDA 1KRHA 1JRPA 1NEKB 2CJNA 3AE3B 5G5HA 1E10A 4ZHPA 4BCAA 2W55A 1ROEA 1EWYC 1W1QA 1W1KA 2P13A 1AWDA 5GXGB 2Q85A 2KMMA 4ML8A 2H88B 2MJ3A 1AHVA 5AUIA 1NYQA 2M19A 1WXQA 4JX1C 4HG0A 2VFTA 3P4SB 2R2ZA 3AE8B 3AEGB 2MBRA 2ACZB 3NVYA 2I0KA 4USAA 3AE6B 4N59A 4A9AA 3DEDA 3LB8C 3AB5A 3KWLA 1FRDA 4YSXB 2BT6A 2DWQA 3AH7A 1AHZA 3AEDB 3NS1B 2PLIA 1DOIA 1T3QA 3S1FA 3ETRA 4PYTA 1DGJA 2M56B 1DIIA 1TKYA 3FAHA 2WDRB 1JWBD 3B2GA 3AEFB 1ZR6A 3AEBB 3SR6A 3FW9A 1PDXA 5AE2A 1N60C 1N62A 1TKEA 1FO4A 2P3HA 1KFYB 1DOXA 1TYGB 1W1MA 1WWTA 3DQ0A 1SIJA 1AYFA 1W1SA 1FIQA 4JAYA 1N60A 1IUEA 3S1EA 1E8FA 4PWBA 2VFRA 4PVEA 1W1JA 2NQWA 2EXRA 1N5XA 3LXFA 1E9MA 2Q4WA 3VRBB 1QF6A 1JALA 5MPOA 4BC9A 3NS1A 1TJEA 2QPMA 1E8GA 1WVEA 1WRIA 1F0XA 4ZOHC 1AHUA 4YXDB 2PKOA 4MLAA 3P4RB 3FW7A 3A7UA 1E0ZA 1J7CA 2QIEB 3W5VB 4PVKA 3W8XA 4PVHA 3S1DA 1FFUA 5FXFA 1MBBA 1VJKA 2MJEA 5FXPA 4JB1A 1FXIA 1NYRA 1B9RA 5C2TB 3D2HA 2WLBA 2KAJA 3B2FA 3VRAB 1QOFA 1N5WC 3KJMA 2WU5B 2WDVB 3A7AA 5H92C 4C7ZA 4UD8A 3W8ZA 1YJIA 3VR8B 5EE3A 2BVGA 3HRDD 1L0VB 3AE1B 2Y5CA 1N5WA 1N62C 3BIID 1YJJA 3PM9A 1X2GA 1RWSA 3P4PB 1L5PA 1NVID 1OQRA 1VQZA 1QLTA 2JX5A 1I7HA 2VFSA 5HQXA 4C7YA 2Q5WD 4ITKA 4YTNB 4N58A 3AEEB 3AEAB 2BS4B 3BW7A 1NI3A 2VAOA 2EKIA 3SR6B 3A7RA 1ZP0B 1DOYA 4WQMA 1FFUC 4DNSA 4PWCA 4FXCA 1JQ4A 5AUKA 4O95A 1J7BA 1V8CA 5FXEA 1WYGA 1SB3C 2WP9B 4EC3A 1L6VA 1NENB 5ADZA 1W1OA 3SFEB 3NRZA 3WCQA 1JW9D 4N6EB 5C3JB 3R07C 3NVZA 1KF6B 1CJEA 3ETRB 3HVZA 2WQYB 1ZXIC 3HRDC 4IDIA 3PO0A 3NVVA 5D79A 3AE2B 3FWAA 2RK5A 4PZFA 2K9XA 1GAQB 1PFDA 3DWGC 1WGKA 2K22A 1R7SA 1N63C 4YTPB 3VTEA 4TVYA 5FXDA 3P4QB 4HROA 2P4PA 1XLPA 3RPFC 1MBTA 2E5AA 1UWMA 1F0ZA 3TSHA 1QOAA 1QOGA 1ZOYB 3ZYYX 3W9CB 1N61A 2VFUA 4P6VF 2E3TA 1V97A 3FC4A 3AE4B 4BBYA 2VFVA 4TVWA 1FXAA 1J7AA 2QJLA 5AE3A 3AMZA 1FRRA 3D2DA 1QLBB 1FFVA 2R8DA 1RYJA 1DIQA 3NVWB 3CIRB 1E8HA 2WS3B 1X2HA 1ZUD2 2WU2B 1HSKA 1VLBA 1WVFA 1YQ4B 5AE1A 2FBWB 2BS3B 4ZHOA 3TSJA 5G5GA 3P1MA 1VDVA 3ABVB 1QT9A 1RM6B 3W5UB 5G5HB 3EUB2 5EE0A 2AXRA 3B9JB 3NVYB 1L6UA 4PVJA 1E6EB 4XLOA 5HMRA 1N63A 2W3RA 4US8A 4YSYB 5H8YE 3P63A 4WWMA 2BVFA 2LEKA
chains in the Genus database with same CATH superfamily
3KZIU 1LQBA 4H19A 2PA6A 4ED8A 5DLFA 1SF0A 2K5PA 4PHPA 3TKAA 5L83A 1OFFA 2D3CA 2ZTCA 3SV3A 1GOZA 2VANA 2LKYA 3LYYA 1SL1A 2J6UA 4C4VB 2HE7A 1SE4A 1ZXIA 2PLPA 2VA2A 2QILA 2HXUA 4P0QA 3GD3A 4YN4A 1ZJMA 4FADA 3FXGA 1WGRA 2OJRA 1QZEA 5J2JA 4JK1A 4XA5A 2BPGA 3HM6X 3C2MA 4RU9A 1JOAA 4E8GA 3R1ZA 5ALWA 1X9SA 2VIXA 4BURA 4IR1A 2YB4A 1ZOLA 3QX7A 1X9MA 1L5UA 3TCAA 1MSWD 2E8MA 2KICA 1HXYD 5FJOA 3JPSA 3BK1A 3RITA 1XLQA 5IOIA 4AP9A 2WAQC 1D5ZC 3UJRA 4DF4A 2FCSA 2OKTA 2DBYA 5L95C 4HJKA 1FIQB 3C0PA 4FI4A 1ZQQA 3PTFC 3DH9A 5BMHA 1ZY8A 2DPIA 1XS9D 2WXOA 3PX6A 1LVHA 2AJQA 2O2VA 2WDQB 4FA6A 2Y0SC 2ZIWB 2BTEA 4C8NA 1LFDA 2H5XA 3VCCA 4OZAA 1WR6E 2EH9A 3D2QA 5U25A 2WAQF 1STEA 2GMIC 2L52A 3FKYA 4KX3A 1PVQA 3TL5A 1COOA 3V4BA 2KK0A 3RR8A 1ZQIA 2N9EB 2NMQA 1XF5L 5JXVA 3EUB3 1ZPSA 3NASA 3ZLGA 4I2BA 3H7SA 5DGAA 3PVLA 5HHZA 1YX5B 1RYRA 2PGWA 4PZNA 5JTIA 3RCZA 3QIJA 4MHVA 3L4PA 2PGEA 3TX1A 3VC8A 4XWWA 1E0YA 1WGDA 1W1RA 2L76A 4OALA 3IM1A 3F2BA 5AK6A 2BKFA 2BKRB 2KNBA 2FMPA 4KLHA 5J8YC 4NPNA 2N1WA 1QLUA 2M4NA 2O6KA 5J29A 1TIFA 9ICFA 4UBBA 3GE3C 3HK0A 3JS8A 3NRZB 2CHRA 3MWCA 1ZKHA 1XANA 4B9VA 5KFEA 2CR5A 1CUKA 4PL1A 4UQGA 3C1ZA 3M3JA 3PW5A 4QJFB 3A33B 5FP0A 5KFJA 3NOBA 4LJOB 2QDEA 1SE2A 7ICLA 2NBUA 5CHGA 1CZPA 4GFIA 1WZ0A 4HWIB 4JWSC 3VHTC 1ZRNA 4ECYA 2RGFA 4QZDA 1WCLA 3I76A 1NZBA 4E6MA 3H0LB 7ICRA 2PP0A 3L0WB 2OEHA 4M0WB 2MWSB 4K7UA 3OGUA 3MR2A 4NJ6A 3TMPB 2F1JA 4HVBA 2JR5A 5ALSA 4MEYA 2JK6A 4EZKA 4P2HA 2V4IB 2KDFB 4BXOB 5EE9A 3N4MB 8ICGA 1HE8A 5AKLA 4KGRA 4DL3A 3P3BA 4TUUA 3SENA 5KFPA 1C1YB 4BC7A 3Q8BA 2R9ZA 4JDRA 1Z5SB 2WFAA 1T6BX 2NV3A 3C2LA 2IPKD 2MBHA 3FW8A 2Z8LA 1GRFA 8ICXA 1NELA 3KYDD 2OAIA 4I2JA 1C4PA 4YT0B 1HEKA 2P8CA 3LAEA 1C4AA 2Y3AA 3RR7A 5IINA 3BVZA 2IOFA 2P3HA 9ICTA 3ICXA 4F4XA 1M6YA 4DS5A 2A3VA 1LXDA 3I5JC 3R2TA 4I6NB 4EX7A 3OSNA 3Q3JA 3KHGA 1JRPA 5KFHA 4ICAA 4UAWA 1NEKB 2KKCA 2WXQA 4E4FA 1N2XA 3KLSX 5KFMA 3JSVB 2KJ6A 1EWYC 2K8AA 1ET6A 1W1KA 2V3AA 1HUZA 8ICSA 2HSZA 5AI4A 2PCEA 2KMMA 4ML8A 3IFWB 4R66A 5KG5A 3ETLA 3T5HA 4K8DA 4F93B 4G3XB 1Q1RA 4DK5A 3IG8A 2D5GA 4EX6A 4EZJA 1CI4A 2BCUA 5J0QA 1TT5B 1NYQA 1BNPA 4EENA 3RN9C 4DQOC 1Z1VA 3MGVA 4UDUC 3WK8A 5EU9A 1Z00A 4BOSC 2LWPA 1R4NB 2M0XA 4IP4A 1MRAA 4NLZA 5L1IA 5J2AA 2POZA 2FCNA 1NDAA 4R8UB 2ZUDA 2R2ZA 4DBGA 2ACZB 3NVYA 4RQ7A 3Q8FA 4WJNA 5G55A 2I0KA 3J9CA 5J2RA 3DERA 3DESA 3QFBA 2DWQA 3OTRA 1XSNA 4TQSA 4KGSA 1KJTA 3AEDB 1ZDXA 2PLIA 4E0DA 4IR9A 4YWSA 4EMIA 2CPRA 5LLIA 4UB8U 2ON8A 3BVGA 3IT6B 3Q8MA 4P7IA 1TAUA 1C9FA 2MU2A 5AKZA 2ICIA 2WXFA 1LVLA 4LDTD 3AULA 1F52A 2VZKB 4ED1A 1M4VA 1ZQ1C 1NHSA 4UB3A 2K4PA 4OJPA 5DG7A 4JHMA 4M0XA 4ZYSA 4CCHA 4H4PA 2FYMA 4H4TA 2BB5A 4K1RB 1HA5A 2WDRB 1T5XD 3WK4A 4AYBF 2ZIUA 2Y9TA 5KL8B 4BOZB 1ZRMA 1C7YA 5AK3A 4R64A 3DBRI 1ZR6A 1GEUA 4DXAB 9ICEA 5AWVA 4P1BC 3AEBB 3I3TB 1WX9A 4NL9C 2M9NA 4RQ0A 4Y2RA 2MSED 5AE2A 4F7ZA 4PZOA 4WH4A 4IM2A 2NQLA 2XGZA 3V6KA 2LZ6A 2G3QB 3EAOA 4FZNA 3QUCA 1DOXA 5AM1A 1W1MA 5EBKA 1WWTA 4TV3A 3WA0A 3EANA 3I6EA 4EUTA 2DYMA 3N7SC 1AYFA 1U4AA 1KLUD 2KSOB 9ICBA 3ZUNA 4WWOA 2QQ6A 4FX9A 1IYFA 3PHXB 1FIQA 2YX8A 3Q2AC 1N60A 3NUQA 1NHRA 2F8LA 4L23A 4NLCA 3TW9A 4O3OA 3G6XA 1IUEA 3LADA 5JH5C 3R7RA 4KLOA 2AQ1B 2GH5A 2X99A 3O0HA 3WAMA 1E8FA 1E8YA 3T8MA 5KFTA 2INNE 2NR2A 2GL5A 4NEWA 2C7NB 4RQ8A 1T94A 1W1JA 5E6OA 5FS7A 2NQWA 3ZJVA 3LXFA 3TANA 4MEMA 2Q4WA 2MA1A 2W82A 2ZIVB 3PSPA 3TJIA 2AU0A 1Q3UA 1PK3A 1UT8A 4M8MA 2P6UA 1F44A 2MQJA 2K6DB 5MPOA 4I6LB 4EWJA 1SJCA 4BC9A 1VR9A 4RH6A 3FYHA 2P35A 4BWJA 2NPXA 3TQPA 2J4XA 2FUHB 1ZQDA 3AI5A 5KFIA 4MF2A 3I63C 5G2NA 1AHUA 2PKOA 4IL6U 3WK5A 5BYRA 5K8EA 4RT2A 2AAQA 4KLIA 2MUTA 3L54A 4MLAA 2HHSA 4BVUC 3Q14C 3KD3A 2N4FA 3WU2U 2FLNA 3N9YC 3WIMA 2IHNA 3ZDCA 4F50A 1WUDA 2BQQA 2DENB 3PR4A 2D2QA 4K4GA 3CGCA 1FEHA 2PMZC 1SJDA 2L0TA 4C0ZA 1Q1OA 3ENEA 4S17A 5FKAC 3T79A 1LV5A 2QIEB 3W5VB 2UUUA 3GQCA 3RNEC 2C9WB 4DYEA 1GRHA 1XC9A 3OW1A 1RZTA 1ENFA 3BQ1A 3S1DA 3L3FX 1FFUA 4R8UA 2FMQA 2KJRA 2KLCA 1IBXB 1HUOA 3BSMA 4O3SA 5J8YA 4DQQA 2MJEA 2WXIA 5FXPA 3TWAA 2QARB 4CNQA 1NYRA 2K39A 1IYXA 2RDIA 5KFQA 1TS3A 2BF8B 3NUHB 1L7PA 2LI6A 5C2TB 2WLBA 2KAJA 4ANVA 1ZQLA 2AEHA 4BKGA 1ZK7A 3TCSA 3VC5A 4FBJB 3ZDMC 5KT6A 3KJMA 3QU4A 1TY0A 1V80A 3C0RB 3PO5A 2NRWA 2W9NA 3W8ZA 5CHFA 3RR1A 3K9PB 2NYVA 2RDXA 5IDZA 3KHHA 7ICPA 3DVGY 2MCNB 4H4YA 3VR8B 4IRCA 4EZ9A 3L10B 5I1WA 3KHRA 1YJJA 1FEAA 3MKCA 1UZXB 2KTRB 3I57A 2KC2A 4E3CA 3DJJA 1BGXT 2HOIA 2Z59B 3V61A 4GYPA 1OQRA 5JCMA 3Q3MC 4GRTA 3UMGA 2KD1A 5KFWA 4KLEA 1I7HA 3RULA 2BCRA 5ALXA 1ZXHA 3NZ3A 2HHQA 3C5FA 1PVRA 3BZKA 2ISOA 4MH0E 4M04A 3FCPA 3PSFA 1GETA 4ITKA 1X66A 3DHIC 4YTNB 4F5PA 5ALLA 4KGTA 2GSHA 3PWIA 3R0KA 3UJ2A 3EA6A 3BQ7A 2BS4B 2BYFA 4GLSC 3EF6A 4M9GA 1Z19A 4HYRA 4A8XC 4AQ7A 1ZP0B 4KPLA 4KSKC 3SD7A 1ECQA 1JPMA 2A19A 2L00B 3A0BU 4AUQC 2N9LA 4FXCA 2XCPA 1MO9A 4G9BA 2KFKA 1GB1A 3H4KA 4QWBA 1TAQA 3TADA 2RMMA 5BMIA 4YVZA 2WP9B 2WX0A 3F5EA 4U6PA 1L6VA 8ICIA 1PGBA 3P2BA 5ADZA 4WAFA 1I4HA 2BCQA 3ZNGC 2KK8A 8ICTA 1W1OA 3DG6A 3FVDA 4IWPA 2DW7A 4H4ZA 1D5XC 4ASWC 3SBFA 3WKEA 4H2AA 2W11A 4FBUA 3ZNID 3HVZA 5F9LA 3BJYA 2H3VA 3H40A 5IIJA 2ZC8A 2P3ZA 5DB9A 4O5EA 4M8NA 1V6EA 2G4DB 2DPJA 3R66C 3APFA 1LPFA 3HRDC 4IDIA 2WXNA 4HKZE 3PO0A 5KHOA 2FNJB 2ASLA 4A6GA 2HCFA 4YP3A 1XQQA 5D79A 3AE2B 3FWAA 1Q1WA 2JEJA 1XD3B 2KDEB 5FS6A 3SJNA 2M8SA 4ANWA 4HPPA 1WGKA 4ZDVA 1GSNA 3PG6A 3N97B 4PYZA 4A3RA 2GBJA 5J2CA 1R7SA 2IPIA 1J97A 3QZ8A 4P1CC 5IKCM 4YTPB 2NPTB 1UCVA 1N63C 3MC0B 3F2CA 3PRPB 4XDCA 4NZLB 2K8CB 1OEPA 3UXLA 1N6ZA 4HROA 3RRHA 2BCVA 3BQ0A 3CXOA 4RQ4A 4DWIA 1EWCA 4OHJA 2AGPA 2ZVOA 4WJPA 3RPFC 3ZXRA 2GGGA 1V9JA 1KKOA 4UASA 4QZIA 4W9KA 5J0OA 4IP5A 3TSHA 3BS5B 3C28A 3QX1A 4ED2A 3SEIA 3UMBA 3V3WA 3F5AA 4TSSA 1N61A 4PH5A 4F3OA 1KFTA 1GC7A 2WHIA 3EJBB 1Z4OA 1KCZA 4NY8A 3PGEA 4IC9A 2FIDA 2DKZA 1QSLA 1V97A 1WRDB 2OJWA 3URHA 1ZYQA 1O03A 2A4ZA 2KE7A 3RB4A 2GBNA 4WIPA 2W9BA 1SV4A 5ALUA 2RR9A 3GB1A 5AKJA 4B9LA 1VZ6A 1L8OA 3DK8A 3N1YC 4DHJB 5AK4A 2Y5BB 4IWOA 5A0LA 3A4SC 3UIPB 2UUVA 2N7JA 4C8LA 3DGBA 2ZZPB 4RNNA 3GS2A 5D46A 4QIWF 1N56A 4MM3A 1ZQRA 3VFKA 2WB1F 2MBEA 4KT2A 4ACOA 4K2SA 5C23A 3NFUA 1Y88A 2WF6A 4UB2A 1E8HA 1AOGA 3RBEA 1X2HA 3PO4A 3NS8A 3TARA 1P3QU 3IHPC 4JN7A 4M2YA 3A9JB 4M01A 1SKRA 1EBDA 1E5WA 1YQ4B 4NM1A 2WF7A 2K60A 1WXAA 2JH1A 5EWFA 3MJWA 5JCNA 3PSIA 4ZHOA 3TSJA 5AI6A 1ZMDA 1L3UA 3CMMB 1QTMA 2PTWA 3BY4B 3N20C 2ZIUB 4PHAA 9ICXA 2NVUI 4OO1J 2JXXA 4ZRQA 3EFCA 5ALMA 4JN8A 5ALQA 2JRHA 3W5UB 7ICNA 1L4DB 2XGQA 1IGDA 5L6GA 1MDRA 2EQ6A 2AXRA 3GD6A 3EECA 1S5LU 2ASQA 3L13A 1ZQWA 3DBLB 3DK4A 5CHWA 2D10A 3QU2A 1I35A 1U48A 3ZDAA 2GBKA 4IQUA 1BQGA 4OCZA 4B0EA 2FKPA 3S5SA 1N63A 2W3RA 4US8A 1K8RB 2HNEA 1J8CA 2PTZA 5KT2A 1ZQKA 3DFYA 1ZGUB 3R10A 1TAMA 5L1JA 2LEKA 1NKBA 3QUQA 2BQUA 1JMSA 3Q4DA 3TFSA 2FMSA 1BPXA 2YN4A 3KUMA 3H7PB 1L3VA 2AKMA 3II4A 1ZMCA 3V3XA 2QSDA 4DCCA 4QWAA 4XZ4A 5JRBA 1Q8KA 3KHLA 4RF0A 2GR1A 4EYHB 1TY2A 1WE6A 1N61C 9ICLA 1MPEA 2NCNA 5CHVC 2ASJA 5AHXA 2C2DA 1JX4A 2HDEA 1ZKQA 3U9IA 2KT7A 3B0XA 3DDCB 1FMAD 4Z1YA 3LWMA 4C80A 1PUTA 2V0GA 1F77A 2K0PA 3M9NB 2XY5A 4IQWA 5EE1A 5J0XA 2ZXHA 1ZJNA 4TQ0A 4Q8EA 2JU6X 4CHKA 4DSJA 4KWSA 5F9NA 2L0FA 5HHDG 2ISPA 2LGYA 3BS7A 3THUA 4NLBA 2V3SA 5KFDA 1AQ6A 3ZNZB 3RYTA 4KN4A 3I99A 2PSNA 4RQ3A 1HIWA 3C8YA 3NZGA 1UA0A 4H4UA 4NV0A 2V6OA 3V6JA 3Q8EA 2CHWA 1NBFC 3ZQ4A 5ALOA 8ICWA 2N1VA 1F1HA 2O3GA 4FZMA 3N3KB 1E9IA 1F9JA 1T3QC 2E6XA 2FPLA 2DGZA 2MBQA 3PX4A 2C3CA 3DPDA 2KSOA 2ZUCA 5KFNA 1IBXA 3PPAA 4JWUC 2FIFA 3CT2A 3UXKA 2QARA 5D3IB 2DYBA 2MSNA 4H4RA 1AROP 2A1JA 3DHGC 2DAJA 1PK1A 1L8PA 4U7CA 2BGWA 1P0RA 3PX0A 1MNSA 3M7DA 1ZQNA 2NVKX 4J9RA 4DF8A 4MGKE 2X8HA 1BPZA 4BUGA 7ICUA 3UJSA 2W03A 1JMLA 2IGHA 4RZRA 2WYQA 1TKDA 1XSPA 5KFXA 3ALBA 3AN1A 4CF3A 2LM4A 3TI0A 2MAXA 2UWQA 5U1OA 1BZLA 2BC0A 1K51A 5FR3A 4LCDE 4RQ5A 3SFDB 2E8PA 1WJ6A 3UQ0A 1ZQMA 1GPXA 2QGYA 4X57B 4RNMA 2H89B 5GTHU 1TK5A 4LNNA 3RNFC 4YSZB 1TKKA 2WNMA 3O0FA 2KFNA 1WZ3A 4K3CA 2DFLA 2CN1A 1UXYA 4Y2JA 3B0AA 4F4RA 1V38A 2LI5A 1FPYA 2ZCCA 3AE5B 2B21A 1SB3B 3STPA 3Q45A 5DQHA 1I4XA 2MUCA 1ZQHA 1D3ZA 2ASDA 1QH9A 4YCXA 3E0FA 4YQWA 4KLQA 2MHJA 4QIWC 5BYSA 3AE7B 4ROPA 4KPRA 1WGYA 4LNKA 3OAWA 4GN1A 2GQUA 2D07B 4HXDA 1WF9A 3ZDDA 2HBLA 1IM4A 4W9GA 3OP2A 2WGSA 4YR2A 1EUVB 4HRSA 5AM4A 1XO3A 3I4KA 4QNLA 2PKEA 4IL2A 2W3SA 1JWUD 1T0RC 1XXGA 4M9JA 2J6TA 2MH7A 3V62A 1R4MB 3HJEA 1GRBA 1WSPA 3NVWA 1T0QC 3FILA 5KFKA 2Y3SA 1WUFA 3PV8A 1QQ7A 2IO3B 2RHFA 2CKHB 4RGNA 5CJ7A 3BYTB 4P0PA 2W54A 1H8CA 4ECTA 3IG5A 5DDMA 2KACA 3BDPA 4BJQA 3W8WA 4MKSA 2G45B 8ICCA 4KN7A 1ISNA 3QCAA 1XCQL 4HPMB 3GSYA 1L0XB 5E6PA 3JPNA 3IHQB 1SGGA 4DSLA 1S77D 5KVIA 2C5LC 2BZFA 2HBKA 2ZJAA 2CJNA 3RD2A 1SJHD 5G5HA 5D7GA 4ZHPA 4BCAA 3OJ3A 2YMPA 1LB2B 4W9JA 2D3DA 3QJZA 2Y1IA 4Y2VA 4KLGA 3Q6JA 1WYWB 5BOFA 4DQRA 2P13A 1B43A 2Q85A 2I9GA 1EF5A 1J0GA 4UW9A 1YQBA 5ALVA 5AUIA 7ICEA 3RT3B 4ECXA 2G4SA 2FPMA 1BWCA 4MGYE 3MBYA 4LJPB 3RJEA 3QKEA 1HJPA 1ZQEA 2KX3A 4X2PA 4JX1C 4IKGA 4AYBC 1YX6B 2IY0B 2VFTA 4O3QA 4J9KA 3P4SB 2LMCA 3AE8B 3AEGB 2MBRA 3TFRA 4FULA 1D4BA 4LZDA 1F3PA 2JEFA 4N59A 3DEDA 2J6SA 3AB5A 3OZMA 3KWLA 1FRDA 1P9DU 2BKEA 3MC1A 3P93A 4DQSA 1YIWA 1GO3F 3T4WA 4GFJA 1A5RA 2BW2A 4AWJA 4M0WA 3S1FA 1T4GA 4BBNC 3ETRA 5AKYA 4PYTA 1FEBA 4EEYA 4GC6A 2JUOA 2UVRA 1F2RI 4W9EA 5IA7A 1XO1A 4KIKA 4RQ6A 3M9OB 2WBAA 1HTOA 4REZA 3TSSA 3H12A 4J3ZA 4TUSA 1TKYA 2CU1A 1L6NA 5KFGA 2R8KA 4KV2A 1O08A 1V85A 2BYTA 4II3B 3WAOA 2RRDA 4G3IA 3T9PA 4YMNA 3D47A 2AQ4A 1PDXA 1KH0A 1Z4NA 2XO7A 2HVHA 1N60C 8ICLA 2FJ6A 2RDHA 5J04A 3IC9A 2XICA 1V2YA 2R8GA 3N30A 3V6CB 1ZQXA 5B5EU 4DXKA 3MZNA 3UIOB 1KKXA 3RJFA 4UAVA 1MQ2A 1KLGD 3H9DA 3DQ0A 3S47A 3GIKA 2WP5A 5AKHA 3HW2A 1G6JA 4JIOU 1QSYA 3IP4B 4MM3B 1EM7A 4BV6A 2GI9A 4I2HA 5FR6A 3HX0A 3Q8CA 4GDLA 1QKZA 3RH4A 2XH2A 3PMNA 5FS8A 2EAOA 4GOCA 4F5RA 1MHXA 2L05A 3S1EA 4GGBA 2XSXA 4QZBA 2Y3RA 2F5ZA 1FCCC 2DF4B 4KSLC 1XS2A 4CF5A 4RPZA 4O3RA 2JWUA 4KLLA 3M6KA 1OJTA 4GMEA 5LNK1 3FDSA 3V5CA 4KEMA 3KYCD 3LYSA 3JW0X 3W1YA 3WK9A 4HCHA 3TJ4A 1S0VA 1JALA 3X0WA 4NM2A 4F72A 3EYZA 1HEZE 3HHMA 4ADWA 2YQEA 2IGGA 3NS1A 1F5SA 1E8WA 5D6JB 2QHOA 5T8IA 1P7FA 3BZCA 1WRIA 1D8LA 3JPOA 3QHTA 5KG3A 4YXMA 3LXDA 3SI8A 2FI1A 3MR5A 3HP6A 1RXVA 1MFWA 5KTQA 5IN7A 1IIPA 4EQRA 1SXEA 2FE9A 1CRXA 2ZTEA 4DSKA 1EF1A 3Q8AA 2DKXA 1R0MA 4I2GA 5IILA 2J7QB 2EKEC 4MFAA 5ALTA 1UGMA 3MC9A 2PMVA 2QLTA 4RM9A 2KHQA 5AM3A 5KT5A 5AKKA 1J7CA 3GZNB 5HI1A 4B9KA 1E0ZA 5DQIA 5AI8A 4EFOA 4DX3A 8ICEA 5J0TA 2XCAA 3H1UA 2JMGA 5J0UA 4LDTB 4PVKA 3W8XA 3SEBA 3PLVA 1EC8A 5AIBA 4XC2A 3VQIA 5AZFA 1B1ZA 4UB5A 2H3IA 2N7DA 4W9FA 3VTUA 2GGHA 3DCGA 2X8CA 1L3TA 1UNSA 1P43A 8ICOA 1VJKA 4KDLB 1BPEA 4OVVA 4JB1A 3FG2P 1BKHA 4DHZB 4GYPC 1KLNA 2W9CB 1GRAA 2DZKA 1KFSA 3B2FA 1K1QA 2OWOA 3ZLHA 1QOFA 2M17A 1N5WC 1B4FA 2XBBC 3RMKC 3ZVVA 4DOCA 2JH7A 3C5GA 2RABA 3A7AA 6ENLA 1EU3A 2IO1B 3JSVA 4RQ1A 1VD2A 1IG6A 3IXSA 3I1YA 1S97A 9ICIA 5D49A 4EEWA 1UA1A 2KN5A 3I9V1 3LVVA 3HRDD 1I4PA 1L0VB 3BWUD 4HK2A 1ECWA 3T3OA 1FHVA 4J9LA 1N5WA 4QZEA 1NJWA 5ALJA 2N7EA 4MGGA 2UVUA 2EANA 3MFIA 2PFOA 1ZD3A 1L5PA 1YN4A 3DBHI 1KLVA 3TADC 1VQZA 1XDIA 3HKZF 2ZZBA 1DTNA 3POPA 9ICVA 3V7KA 4F8CB 8ICFA 1W6TA 2DW6A 1ZD4A 4DL6A 5HQXA 2Q0ZX 3ZDTA 4EMJA 2LHEA 2KJ8A 4K4IA 2KWCA 4BKSA 4MF8A 2AL1A 1X2IA 4XWTA 3QN3A 5BOEA 4EQWA 1UWXA 1U9LA 2IMWP 1D8BA 3UCCA 4ELTA 3RNCC 3EPGA 3N28A 3M6ZA 1DOYA 2KWDA 9ICNA 4WQMA 2FLLA 1CMXB 2PEAA 5BOLA 4IM3A 1KFDA 8ICQA 2FUG1 3N1XC 4JQWC 1XWLA 8ICNA 1JQ4A 2XH4A 3ZGZA 1XHCA 4W9CA 1J7BA 2GGIA 5FXEA 1WYGA 4ECWA 1LO5D 3QEAZ 2MP2A 4K4HA 1TE6A 4F4WA 2M0NA 1ZD5A 3NXLA 3CW2C 1KSPA 3CXBA 2PXIA 2HZGA 2KVSA 3WCQA 1JI7A 4DFPA 3NVZA 5J0YA 1KF6B 1KTKA 3QPEA 1WXVA 3ETRB 1TS2A 3UQAA 5TISU 4ECZA 2PI4A 5B66U 5J2IA 4KLUA 2Z0DB 2MBOA 4DHJD 3H0MB 4DFKA 1ZXIC 5JZEB 1KBUA 2HHWA 1MVKA 1TBEA 3A9JA 7ICGA 4F71A 2YVCA 1NDDA 4ZRIA 4TKNA 3HVDA 3N6JA 5EWEA 5CWRA 1KN5A 3DEEA 3F53A 1X9WA 2OZTA 1GAQB 1PFDA 3IT4B 1EBGA 1FECA 4K7WA 3TEZA 3ALRA 3SSZA 3SQIA 2NS5A 1JN3A 2HTHA 3SN1A 1JUDA 2V3PA 2E1EA 4JGHB 2KTRA 2D3AA 5FXDA 3APCA 3P4QB 1WX8A 1ELSA 2V1YA 2VA3A 3DG7A 2P4PA 4DQPA 7ICFA 1XLPA 4IW0A 2N9PC 3CSTA 3GP7A 2J3NA 1S10A 2E5AA 2ZW0A 4UAZA 3OHAA 2LJIA 3SN0A 5DLGA 3GE8C 3K75D 1NZPA 2K6QA 2QEJC 7ICKA 1QOGA 2ZZCA 3D9XA 4O3MA 1ZOYB 4GXJA 4EBDA 2JPHA 3QC8B 5AIAA 2KQ7A 2WPEA 1Q10A 2IO0B 3BOXA 2WXMA 2E3TA 3D2NA 3ZDEA 3R11A 5FJTA 4H50A 2C7MB 2INDC 4OW0A 2PP1A 5DB8A 2W43A 3B0YA 4Y2XA 1K5OA 5J17A 1J7AA 5ALZA 3RI7C 1K52A 3KUCB 3R9KA 1UGJA 5DCNA 3AMZA 1FRRA 3UXOA 4JWMA 3T8QA 2L32A 4RCOA 1Q0WB 2HOFA 3OSPA 3QYPA 9ICUA 1DXLA 1EU4A 1URJA 1SE3A 4JPSA 3ZTCA 2R8DA 3Q3FA 1DIQA 2AL2A 2B3AA 3CYMA 2R61A 3CIRB 5T14A 5ALYA 5I4DA 4B9TA 4HDOA 1ZUD2 3V72A 4UARA 5C1ZA 2K8BB 2XI9A 1YJ1A 3GOEA 2PODA 1VLBA 2OYYA 1N48A 3G6YA 4J3OD 3IRUA 1TTNA 2FE8A 4QZ9A 2HVIA 5G5GA 2AGQA 3RJ8A 1YNTE 5ER0A 4UB4A 3AEVA 2V9WA 1UBIA 4ECRA 5AI9A 4MSQB 4Y2PA 2JVCA 3L08A 1DK2A 3CGBA 4F8RA 3DEQA 4LJXA 2R8HA 2OQHA 4H4WA 5G5HB 1GNUA 2QB1A 2ZIVA 3EUB2 2D6FC 5KAIU 4ECQA 5EE0A 5J2EA 3LWLA 3THVA 5KFAA 4JLCA 4F5OA 1A6SA 2EQ9A 3P0WA 1X6IA 3CP8A 4YXJA 2KC1A 3NVYB 2BGFA 3DVNU 3L17A 3QA8A 3ES7A 1SV0A 2R2OA 1P48A 2JXJA 2G5HB 1BXTA 1X9XA 2PTXA 5C0YA 2HQMA 1E6EB 2WWZA 3PZPA 4K3BA 4XLOA 4WJ3B 4EZ6A 4DL4A 8ICMA 1GUAB 1MG8A 1KQQA 2F3NA 3HIZA 2IO2B 1WXMA 1SZHA 3DQVA 1SJAA 2KXJA 3SV4A 2FAZA 4IOIE 1JRUA 7ICHA 4F2SA 3KH0A 1RAXA 3LDAA 2ZG6A 2KTQA 3NRWA 3NY5A 8ICJA 5TR5A 2ZJ8A 1YMHE 2K4EA 4HCDA 9ICAA 2LVOA 2GQTA 5CEHA 3MGHA 3AQFA 2C28A 2ZZ0A 1EO6A 2LM1A 2LMRA 3QUTA 2KVCA 2N0SB 4UAUA 1DOQA 3SD5A 4MDKE 1NK4A 2W8KA 1JPDX 1ZQAA 3RRAA 4I2FA 2Z0EB 2JQRB 3N6HA 2XY6A 2CDUA 2BR0A 1TV9A 3RAXA 1WMHB 4OVZA 4KLDA 4EKUA 2C2RA 3AECB 4C00A 1L7MA 4YTMB 4GDKB 3JPTA 1GC6A 2W7OA 4BAXA 2KTFA 1ESFA 2KOBA 4ED3A 3BQTA 1GRTA 3PR5B 4RNOA 3UXPA 2O56A 4FZLA 3CWIA 4YR0A 4GXKA 3VCBA 4J9OA 1SSNA 4P0QB 1L0YB 4KVGB 4LVSA 3QU9A 1A77A 1V59A 3QTPA 4ZA0A 2PPGA 2CHZA 1VZ8A 3VR9B 1FM0D 4JB3A 5ALDA 4GSWA 1BPYA 3IDWA 1SWWA 5BPCA 2BBCA 4PK1A 2PLSA 2B76B 1XLNA 4KIKB 5DQGA 4M6WB 5KG7A 2FDRA 3GU3A 3GV7B 4KLJA 1JWSD 4E71A 3TWBA 2Y9UA 3IAS1 3E9SA 2JEGA 2BWES 3UGBB 2ZW1A 2HTME 2WDTB 1SJBA 2P66A 1KN0A 3BZDB 5HKHA 4O9MA 3PMLA 1OQQA 3CK5A 1CEZA 4MGZE 3V6EB 4RGTA 4G7FA 4NY0A 5AM5A 4ACFA 5KT3A 2MNRA 5EOZA 4Q2JA 4IRKA 4M02A 2V3BA 3CRXA 1JIHA 1WM3A 4UATA 2BCPA 2P8BA 5IO9A 8ICZA 4KLFA 3RJKA 3MR6A 3ED5A 4I2EA 4B9SA 3AM9A 3KLJA 4RT3A 1WG8A 4Q44A 2W8LA 1P98A 3ZJUA 1DNCA 2YAUA 3LLBA 5CR0A 4P4MA 4UAYA 2CFYA 5HG2A 2GLEA 2G9HD 3CSFA 3PS6A 4HPLB 1PDZA 4RGOS 1J19A 3T5KA 2AX5A 2QCZA 2P0IA 8ICUA 4K7ZA 1SXDA 4HCNB 1RM6C 2V4RA 1DZNA 2YEPB 4ZRPA 2KHWB 2QB0B 4LNIA 4FP1A 4Z6CA 3HUIA 2SEBD 2OPJA 2M1MA 3BQ2A 2KWUB 4ZOHB 5J0SA 4PHEA 1KTQA 1D5MC 3O13A 3UGVA 1A70A 4ICUA 4RF1A 1FHUA 3D6JA 2NBVB 2XH0A 3AU2A 1U49A 3CGDA 5KFVA 7ICJA 1FNUA 2HJ8A 2RDBC 3RUIB 1TYTA 2L5YA 1UELA 3ZLZA 3AE9B 3U52E 4XYCA 1GREA 2MBBB 3ZVHA 4EZLA 3N4FA 2PTYA 2AL6A 2K3UA 4YD2A 3V05A 2NPTA 1D6EC 2Y0SF 3RBDA 4ANUA 3TOYA 1K50A 3B9JA 1KM7A 2HJ1A 2JHDA 4H4QA 5KT4A 7ICOA 2XVTA 4R63A 3OHBA 2WXKA 2ZVNA 1VJ5A 3DWMA 4WWPA 2J0JA 3MTNB 1XLOA 3U26A 2PP3A 2G1EA 1I19A 9ICWA 2BDPA 2JZZA 2EDUA 4HAIA 5HHHA 1TKGA 2MJDA 2KMAA 1EBHA 1KRHA 2KP7A 2KG5A 3E58A 2KVZA 1HTQA 2I1JA 5FS9A 4DSIA 2QMTA 1E10A 2DQNB 3PV1A 2F44A 2W55A 4O5CA 5J2GA 1ROEA 4E5TA 4GIRA 4EBCA 1SKWA 1LKYA 3AUOA 2DYOA 1XSLA 5GXGB 4GDKA 2XEWA 2H88B 4DO9A 4PJ0U 2MJ3A 3L8KA 1HZ5A 4PYUA 2IDYA 3VXWA 4EBEA 1D8YA 1C20A 1SJED 2D3GA 2CS4A 1DXSA 4C4RA 1RLFA 4XGAB 2M19A 4PT5A 3GD4A 1WXQA 4YL8A 1OTRB 1V1OA 2YY6A 4NJCA 5J0PA 4HG0A 3S2AA 3W1SA 2IYDB 4Q43A 2VZKD 3ISCA 4QZGA 2IY1B 1OGWA 4F4ZA 1ZQSA 2KFKB 4P4OA 3QEBZ 2N9XA 2NBWB 2R2QA 3AE6B 4IZGA 3UJEA 1JCTA 4R3DA 1I4QA 2BT6A 4A55A 3AH7A 4JE3B 2LYHA 5K4LA 4RPYA 1SIFA 2DNFA 9ICKA 1RYSA 5LXHA 4QW8A 4CF4A 2W7PA 3NS1B 5HFYA 8ICHA 1Q5WB 2JZBA 3DVNV 4OD0A 2JZPA 2KJ9A 4JWNA 4QWCA 3GV5B 2J52A 3JPPA 3RFAA 1GRGA 3TTEA 2R8IA 3ONNA 1UBQA 4ED7A 1KKRA 3LDZE 2M56B 1KD0A 3N1ZC 3PHWB 3Q8SB 3JYUA 4M9NA 2IGDA 4LK0M 1DIIA 1YEYA 1XT9B 5L1KA 2A8XA 2QVHA 4AJWA 3UJFA 1JWBD 3WKBA 4HDQA 3H8AA 3AEFB 4FS1A 3AU5A 3APDA 4HYKA 2M0AA 2ZJDA 5E6JA 4FJVB 4Y2SA 5KFFA 3VAWA 3SR6A 1GJZA 2OVLA 3FW9A 4EQXA 1TK0A 2PJHA 2BB6A 2AWTA 1N62A 1FO4A 4Q8FA 2J0KA 4BWMA 1TZZA 1V9PA 4KLTA 2K8CA 2KQSA 1NK8A 4YD1A 2IBIB 3VTWA 2YMLA 1SIJA 4YFKA 4RUAA 1TZOA 4I2CA 2DL0A 2MA9B 4ZCWA 2X8GA 1T8EA 5DPWA 3JVAA 4JMUA 1W1SA 1ONEA 1UF0A 2QKQA 1E90A 2GH1A 2CXYA 4K7SA 3N4EA 1A0PA 2GOLA 4LZGA 1JXEA 3MUCA 3WK7A 4M9HA 8ICRA 4PWBA 4WQOB 3M62B 4HNCA 4NNJB 4I2IA 1GG3A 3VH3B 4IT1A 3H8WA 1NHQA 3VH4B 1E9MA 3EJEB 2KIVA 3ML8A 3SDLC 1S9FA 3MABA 4FJZA 4XDDA 3SMVA 2RLTA 1NK9A 1TFRA 2NRTA 4M47A 4ZRKA 3GILA 4Y2TA 1C78A 4KMOB 4Y2UA 3TIXA 3UQ2A 1E8GA 4JV1A 4C4TA 1F0XA 3H7IA 3RNGC 3LVWA 4ZOHC 5GTIU 2PPHA 4YXDB 2INPE 2WF9A 2I5QA 3A9KA 3DBSA 1SL0A 5C5JA 2P88A 3QUBA 1SBBB 3PY8A 5DPTA 3P4RB 3U8ZA 1RQNA 4IL0A 3FW7A 2VJ5A 3DIPA 5AKXA 1WXSA 3A7UA 5KG4A 1U45A 2IHMA 3Q3OC 4PS8A 3R8BA 3PFRA 5KVHA 2EZYA 2VA8A 5JCLA 4UB1A 1BPDA 2G5IB 2ZEQA 3DGHA 1NJXA 2F8KA 3PSEB 2QB0A 2PE6B 4PVHA 1DRGA 3ZRFA 2WB1C 2BCSA 4FN2A 3MDAA 2KJHB 3MY9A 4E74A 5FXFA 3A9KB 2XH7A 5ALEA 3CYJA 2IA6A 1YD8U 4BGDA 4MELA 4FDCB 5KFYA 5FJRA 4C4SA 4TUQA 1T0SC 2KZMA 1MC8A 1V1PB 1V81A 1YT3A 1ZQOA 3EZ5A 7ICTA 3BS5A 2Z7JA 3TQ1A 1RRBA 1ZQUA 3ZD8A 3KKAC 1TE2A 4OJ6A 4H83A 5KFCA 3VRAB 3V5FA 2UU7A 1S0OA 5AEKB 1NHPA 3H8MA 3GRSA 2DUYA 1SKSA 2WU5B 2IJ0A 1CQVA 2WDVB 3L16A 5H92C 4PGYA 2OOBB 2MEKA 1L4ZB 1YZ7A 1YJIA 3V7LA 5HR7A 3IJIA 4DL2A 3PK7A 1L7OA 3KUDB 1LM8B 4F5QA 1WE7A 2X50A 2GR3A 3PSTA 3UF8A 3PW0A 2BVGA 4HPNA 4FE3A 3AE1B 4ED0A 2RDGA 2Y5CA 4URKA 1N62C 2WOVA 3TBLD 4R65A 2WOIA 3PM9A 1RWSA 2KANA 3P4PB 3OC4A 3L5KA 4TUPA 3UCDA 1NVID 3KWVA 3J81j 3LK9A 1FCLA 3PW4A 2REXA 2JX5A 4O0IA 1ZE3D 2KN4A 3Q69A 2L3ZA 1LKYB 2KFJA 3N32A 4TMAB 4UB6U 2YVFA 3NG0A 2VFSA 4J03A 4C7YA 3MR3A 2LHTA 1L7NA 4NAMA 1MDLA 3WKDA 4Y2YA 2Q5WD 1PGXA 4GLXA 1B0XA 2WXPA 1OXJA 3N7RC 1ZQFA 4M0AA 2KJ5A 3AEEB 3AEAB 2HOQA 4JL9A 2Y08A 4IWQA 2HD5B 2WXHA 1NI3A 2VAOA 1SV0C 4ECSA 3MDCA 5TR3A 2OG9A 2LRWA 5AICA 3DBHB 5AKIA 1Z00B 9ICMA 1PDYA 4E4UA 3QARA 1WI0A 4DL5A 2JY6A 3ZXVA 1FFUC 2LYBA 1H4RA 4DNSA 1DK3A 1M6IA 4PWCA 1ZX9A 4P4PA 2GBMA 4O95A 3DK9A 3K4GA 4O5KA 5CP2A 4GGHA 3KVFB 3K1ZA 3PW7A 4L1BA 1NENB 5AZHA 2I2YA 3SQSA 3PRZA 1NNLA 4YG2A 2JRZA 2RDJA 1VCBA 3NRZA 3SFEB 5C3JB 1WR1A 3C1YA 3R07C 1MG4A 3RJIA 3U4FA 5AZGA 2W0HA 2H3ZA 3GFKB 4FLHA 3HSUA 4XRHA 3TUOA 4XX5A 2Y1JA 4AJYB 3H7VA 2ZCBA 2NO5A 2ONEA 4RFBA 4F92B 2ZIWA 4BFRA 1WFYA 3T5LA 4WJOA 4IS7A 3SAFA 2EELA 2WX1A 4QZFA 3Q8QB 3TAQA 1WMHA 5JCKA 3PT2B 3PWGA 3M63B 1NK6A 3QXGA 2AQ2B 2GRTA 3SQPA 4PZFA 2EQYA 1S3SG 1R6WA 4A3PA 3DWGC 1NKEA 1MQ3A 3V60A 3C29A 1MUCA 1E8ZA 2HBJA 2BQ3A 3ES8A 5ENLA 1PQSA 2V4LA 2JGAA 4BXOA 7ICIA 2GRIA 4FHJA 5DGBA 3Q8LA 4IUMB 3QFAA 3AL0B 3RJAA 2AXTU 5KFBA 2RPQA 4MT5A 2B6GA 4RQ2A 1M94A 3RAQA 5AI0A 3OG5A 1MBTA 2JZ3B 4B9NA 1F0ZA 1D7YA 1WWUA 2RP5A 3MJ5A 5CTRC 1K1SA 4KKIA 4NL9A 1QOAA 3ONSA 3W9CB 2AHOB 4RNAA 4DN1A 2TPRA 3OZYA 5D2MB 2VFUA 2XK5B 4ECVA 4IRDA 4P6VF 4QZHA 4X5VA 1OW5A 1WIAA 3H8HA 4DHZE 1TS5A 3VTVA 3SU8X 2C2EA 4NLKA 4N9F4 4YWGG 5TSSA 2MP2B 2HHUA 2LYAA 3UM9A 2ZXIA 1FXAA 4DOAA 3RB6A 2PFPA 9ICJA 5CA7A 5AE3A 2KWVB 1FD6A 2OLAA 4HCLA 5ALRA 2C7HA 2A1JB 3WALA 1FFVA 4F91B 2DHZA 4AOFA 4DOBA 3R0UA 1C4CA 3VUWA 3FV9A 3ZO5B 1X42A 3HKZC 3GDXA 3U2SC 4A35A 1WJ4A 2WOWA 3JPQA 4M00A 1F0MA 3ZJTA 2NO4A 1SL2A 2WU2B 3MQTA 2JXTA 2QAEA 3F2DA 2JYTA 2XNAC 4H4VA 2XY7A 4GXBA 2FBWB 4IM0A 3V6HA 5ALHA 3EKGA 1U4BA 5CB1A 4B6JA 1J2NA 2YMMA 4WWNA 3BYYB 5E6NA 2D3BA 3P1MA 4QZAA 4F1SA 1VDVA 5ALKA 1UUPA 3E56A 3MHZA 4OJOA 3EPIA 5FJUA 1Q46A 2BQRA 1TGZB 1AN8A 3RZWC 4M9LA 3ENLA 2O2VB 4B95A 3TEWA 2F1IA 1CK1A 1XPYA 3ZVHB 3OPXA 3NJTA 9ICRA 4F2RA 3WANA 1PVPA 4KLMA 2H3FA 2EZZA 1H38A 1FNVA 2OEDA 5DDYA 3KQ4A 1B22A 7ICMA 1V1PA 3B9JB 3GY1A 4A90A 4YMOA 3DVGX 2N9KA 2VJ4A 1L6UA 4NLNA 4IQTA 1COKA 2NRXA 1T0YA 4TQRA 4GIVA 4BKSD 3Q8RB 3PREA 2OCEA 2HXTA 3RTVA 7ENLA 3IBEA 3L5OA 3HPFA 4YSYB 4GISA 4AS1A 5JRTA 4I29A 5H8YE 3P63A 2EAMA 4WWMA 2BVFA 4LNFA 4S0RA 5L1MA 9ICPA 3R7QA 2GGJA 5DG9A 1LGRA 4UBCA 5EDSA 2ZTDA 3HW8A 3PQBA 2QJJA 1ZW7A 2CU3A 4TQ1A 3AXCA 3VVWB 1DGSA 5DB7A 5LXIB 1ZETA 2LRUA 4US9A 1L2NA 4PHDA 2KDBA 2G09A 4NAWB 2C3DA 1KL9A 2BHNA 3RJHA 1KEJA 1KW4A 5KT7A 1ZDVA 3ZVIA 3D46A 4F4KA 1QLNA 2AKZA 1OEYJ 4I2DA 4KZ0A 2EZXA 4J9MA 3RH5A 3R2IA 3ZLFA 2WF5A 1YQZA 2AQ0A 4DS4A 1X1MA 1S7MA 3VC6A 2WHEA 2GQWA 5JUMA 3CNHA 1SEBD 3A1QB 2LBOA 2G0AA 3SYZA 3UMCA 2NTSA 1JROA 4PS3A 3S1CA 3ZRCA 3SN4A 4H4XA 1MN8A 4RQNA 2I6XA 1S76D 2ZIXA 4GR1A 2BVHA 1RYUA 4GC7A 4DQIA 1TYPA 2GLSA 3OJUA 4GU2A 4O1NA 7ICSA 4NAWA 4NQLB 4YR3A 1EC7A 3DHHC 2QKNA 4MSMB 2MUTB 5DKWA 5L6FA 2PVOD 4DL7A 2LD9A 4Y2QA 2HHVA 1WJUA 2LVPA 3B1LX 4I2AA 3I28A 5HHIA 8ICAA 3T9LA 1BUIC 3GV8B 2SAKA 1QOBA 3ZIMA 4K1WA 1GERA 1GXFA 4DNAA 2I1QA 5KFLA 4BX9C 7ICVA 2PU0A 2LGSA 2MLBA 3NZUA 2KOXA 2YVSA 2F2AB 1C79A 5KFOA 1IPGA 1C76A 5KFUA 2QJNA 4HKQA 3WKAA 1RVKA 3RCYA 4CE6A 4LLGM 4AP4C 3C19A 4HJGE 2E5SA 3AU6A 5KFZA 2PFQA 5J2BA 1KOTA 4M6UA 5H2FU 1IXRA 2IZVB 2LHDA 2RPVA 5JHBA 2FLPA 1SE9A 2WF8A 4YMMA 2GOWA 3VCNA 2JT4B 4LTUA 3HM3A 2CRXA 1D9DA 1BNOA 3TJPA 2XGPA 2PIAA 3BINA 3DG3A 1UHUA 1RFKA 2XIDA 3RNBC 3D2JA 4J56A 2KV2A 2HI0A 3CF6E 4KMUA 2L83A 4DFMA 4JQ9A 1VRAB 3NVZB 2R8JA 2XC9A 2QC8A 4NJ8A 2PTLA 3KKAA 2BDUA 1FEZA 2YB1A 2YMQA 3AV8A 3QZ7A 1YN3A 3ZNHB 1VAOA 5CRXA 1BPBA 1NKCA 2BS2B 2KEYA 3UI3A 3IJQA 3H0RB 4A8EA 1RPLA 2J0MA 5L1LA 8ICPA 8ICKA 2WXLA 1YZ6A 4J9QA 1H6VA 2LGXA 3RNAC 2K89A 2F1HA 3M95A 4A20A 4BZAA 1YN5A 1FFVC 3NVVB 1WGGA 5F3XB 1WM2A 4J9NA 4FJYA 2ODGA 2W9CA 2BPSA 4EEKA 1UQVA 4OJLA 5IAAC 1HQRD 3H6NA 1OEYA 1JWAD 2OHFA 2RQ5A 5AM2A 4GXIA 1E7UA 2EMSA 3OWEB 3PLUA 2AL2B 4G8TA 5KG2A 3SAGA 4ENLA 5KG1A 2IBKA 3R3MA 3MFHA 2JWZA 2OZ3A 1Z1BA 4EQSA 4J9PA 1BT0A 1E7PB 2KD0A 4C8OA 2KZ3A 2ZUBA 3BJSA 2KZRA 3ML9A 3X23A 3RJGA 1YQ3B 2CJOA 2KDMA 1MA7A 1W1LA 4WAAA 2BYEA 1F9CA 4H2HA 4NXZA 2EQ8A 5ALIA 1FXTB 2JF5A 5G5GB 2PVGC 5AM0A 4GIBA 4O3NA 3PVXA 3AU4A 3UINB 3HILA 4KX6B 1ZDLA 5FMHA 3W1SC 2HBMA 2W9MA 3K9OB 1AW7A 5J2HA 1TK8A 2PMQA 1X6JA 3CGEA 2GB1A 2ONQA 3IJLA 3UQBA 3AE3B 4JV2A 2VH1A 3OTQA 5IIOA 3ZD9A 2GO7A 2KKPA 5HR6A 1W1QA 2AL3A 2GBRA 9ICSA 1VZ7A 3DBLI 4KLSA 1AWDA 3T3FA 5BYQA 3RFZB 3DV9A 1NJYA 1AHVA 2IOHA 3QWZB 4ZRJA 1FNWA 4L2YA 2BVCA 4KITB 3IN5A 3SZ2A 1ACCA 2MW5A 2D11A 3TEYA 1EC9A 4I28A 1SXTA 3OLMD 2CHXA 2X38A 2A5UA 5HMMA 4HNLA 1L3SA 3KUZA 2YVGA 4CRXA 2ZPYA 1WX7A 4KKJA 3OPSA 3GIJA 1HZ6A 2KYWA 3IAM1 1K4QA 2GR0A 2J53A 4USAA 5KHQA 4A9AA 5GRTA 3LB8C 1IP9A 4NLGA 4YWOA 4B6WA 4G0NB 4YSXB 2BPCA 2DAFA 1AHZA 2HW3A 4BBNF 5ALNA 2ESEA 3IVFA 1Q3VA 5AKEA 5KG0A 2DZJA 4RPXA 1DOIA 2D8CA 4PGXA 1T3QA 4JUZA 3IV6A 5DBAA 4ED6A 1NU5A 1DGJA 5J2KA 3MGIA 4Z17A 4DSFA 1T3NA 5D3DA 2KIWA 2K8BA 1GV4A 4DDGD 2KMCA 2KKVA 1V5TA 3WK6A 2YLMA 2LFIA 3H7PA 2MRPA 4J9SA 2QJMA 2JRIB 1STZA 3GIMA 4MFFA 4DLEA 1L8LA 3HWTA 1MI0A 1XEEA 1S8OA 2E8NA 2OQYA 1WH3A 3RRGA 3FAHA 1Y56A 1RQLA 2KQ4X 1X40A 3B2GA 4NJ7A 1GB4A 4H4SA 2WTFA 5BOMA 2O6VA 1QILA 2XK5A 3KOOA 3DDHA 4DFJA 1V5OA 2R18A 2LGIA 2Y5PA 4MGIE 4FFDA 3QQ8B 3EHVA 4LA1A 5L9XA 3SHQA 3NTUA 3DDMA 3G6VA 1P1AA 3PZDA 3EEZA 1TKEA 3A1QA 4ANXA 1PZNA 3EFUA 4FO6A 3GZFA 1ET9A 1ZD2P 5IIMA 4JV0A 1KFYB 1TYGB 1QQ5A 1XO0A 3Q6BA 2GR2A 3H8SA 5KL1B 2VH2A 2J42A 1I4GA 3QE9Y 1Y8RC 4EM3A 1JWMD 3RF9A 4APNA 4MJSA 2LXAA 4JAYA 3AQEA 3W2DA 2PFNA 2A1AA 5E79U 1AARA 3JPRA 2DZMA 1QSSA 3P42A 4C4VA 2LASA 2VFRA 5JHAA 3KBBA 2KDIA 4ZH4A 2PS2A 5GMVA 3CB3A 1QCKA 5KFSA 4PVEA 2IOFK 5J2DA 3ZKJC 4DFDA 1N5XA 2EXRA 2EAPA 4W9DA 4P0PB 3ZDBA 2UVVA 2AYOB 3VRBB 3GO2A 1WGHA 2EMTA 3MP9A 4KTQA 2RSUA 5EWGA 3BVMA 3GZNI 1QF6A 4IC7B 1WY8A 2EQ7A 2LVQA 1H2IA 1P7DA 4HCPB 1KDHA 4PS7A 1TJEA 3Q8PB 2AH5A 1WVEA 1A76A 4C56C 2QPMA 3E2EA 2KZZA 4CQNA 3QU5A 2UVWA 3DBRB 1D9FA 1JCKB 3ZTDA 1IV8A 4PL2A 1TZ1A 2KHVA 3PW2A 4B9UA 4RM8A 1C77A 2KX0A 3QLDA 4F5NA 3OJ4B 1NJZA 4LNOA 4XQ8A 3VA8A 3RGTA 1ZQVA 1S1QB 3ZW3A 5CX3A 2KMDA 4CDGA 3RB3A 4K8GA 2FPKA 3MFGA 3VFCA 1JXLA 1E8XA 5JU5A 5FK9C 4K81A 3LB8A 4FS2A 3MC8A 3WAPA 4MEXA 1MJDA 5JCIA 4M6WA 3EW9A 4P16A 2I5HA 5D4BA 1P7EA 5AK5A 1XNSA 1C3TA 1MBBA 4LIIA 3M8RA 3T6CA 2WDWA 1FXIA 8ICBA 3KW5B 2KVRA 1B9RA 4DXFA 1Z2MA 4A6QA 1RG6A 1JEHA 3D2HA 2DZIA 2OH2A 5DBBA 3DJGX 3NHEB 2ZJ5A 1S0MA 2INCC 1ZQTA 4DWDA 1ZQGA 1Z3EB 4C7ZA 2PMZF 4UD8A 4I27A 2OX4A 2YVJA 4O3PA 5TZVA 9ICQA 5HMLA 9ICOA 2BWFA 2LGDA 3A0HU 2V4QA 4OZBA 4WURA 2ZIXB 5IIKA 2DLBA 4MMWA 4IG7B 1BVSA 3QNMA 5EE3A 5IIIA 3URYA 3T5JA 3H70A 3KZXA 5AKGA 4TURA 3JZUA 3BIID 2MX2A 3ECIA 1TS4A 4ELUA 2OXOA 1X2GA 2VKQA 2O6VB 3EGRA 3ISDA 3D32A 2XN9C 2E1FA 2ALZA 8ICVA 4W9LA 3ISBA 1QLTA 3U7ZA 3IG3A 1L7YA 1F8WA 2HDOA 4ELVA 4ICVA 4RGMA 4W9IA 1MOKA 1E7VA 1DYQA 2FCQA 5DB6A 4ZYNA 1YOVB 2PI5A 4FBTA 4WJQA 4N58A 3SAHA 2GWSA 1XU4A 3BW7A 4DLGA 3QAQA 2LPEA 3EWAA 4ECUA 2EKIA 3SR6B 2ZADA 3A7RA 4J57A 2HHXA 4D2KA 5DG8A 3MHSD 2DX5B 1ZQZA 3M9MB 2YEPF 2LXCA 3FJ4A 4GMVA 4RUCA 3M1YA 1I4RA 4RQMA 2KNJA 3UXNA 4DSEA 4B0MA 5DBCA 3H4BA 5AUKA 3K1GA 2WP6A 4M52A 1V8CA 1SB3C 2W9BB 1IGCA 1NK0A 4F4YA 5J0RA 3PZ8A 1WCNA 3C2KA 4EC3A 3MSYA 1SGHA 5IP4D 2AQ3B 7ICQA 3Q3NC 3FM9A 3R25A 2JEIA 1JW9D 4N6EB 3ORYA 3RJJA 2K1FA 4ARCA 3VUYA 3RNMA 1UT5A 4Z6DA 5HP4A 2QDFA 1QQ6A 1CJEA 1NI2A 2OZ8A 1T7PA 5KG6A 2LJ5A 3QK0A 4DXGA 2W04A 4I6PA 4EOYA 3FYYA 3GRTA 3D2SA 3S6JA 2WQYB 4EE2A 2F76X 2O6VD 4ARIA 3TAPA 4NEVA 4QZCA 4QAYA 1ONFA 3I6TA 2KN7A 1SWVA 2ZPNA 1UH6A 2L8JA 2OFJA 4QWEA 5BO4B 2AGOA 1ZQYA 1ZQPA 1F2RC 2NRVA 3NVVA 4EELA 3T3NA 3UPQA 2WPFA 4KZCA 2RK5A 4II2B 2LUEA 3RB0A 3C23A 9ICHA 2K9XA 2BC1A 4BKTA 2WXGA 4CO7A 2B0CA 2YQUA 2YTUA 4KDIC 5KNIA 1WWVA 2K22A 3VUXA 3JVZX 4NWIA 4IQVA 4Z6EA 1RFAA 4EYIB 2RD0A 3NGDA 1RXWA 4J6IA 5BMGA 3VTEA 5D94A 3NO1A 4TVYA 2K8HA 4EMWA 1KRPA 2K4HA 3OJSA 2X8XX 3JW7A 1XCTL 1R4NI 2JSVX 1WUEA 2KO3A 2OO6A 2H3QA 2WXJA 3VDGA 1NK7A 1UWMA 5KAFU 1EXNA 4BDPA 4G11A 4GDLB 4CGZA 2L7RA 4C8MA 3C21A 4MFCA 3ZYYX 2I38A 2L1AA 2TSSA 1NOMA 2W9AA 3B97A 1PUZA 1S0NA 1MHHE 3N7PD 3RO6A 2E8OA 2LUMA 5ALPA 3HPOA 1BMLC 3O65B 2C22A 4C8KA 4KX5A 3U30A 4OZCA 3FC4A 2V3NA 3HT3A 2NRZA 3AE4B 3K1RB 3Q8KA 4A3OA 4XE0A 5J18A 2I1KA 3LJ3A 1V49A 2VFVA 5DPSA 4BBYA 1JDFA 4TVWA 3V7JA 4RMAA 2Y4GA 2QJLA 4GGQA 4Q45A 9ICGA 5DPRA 2QDDA 5FJPA 1V86A 2K4IA 1ZQBA 3D2DA 2GDQA 2WPCA 2JV3A 1K53A 1QLBB 2NTTA 2PE9A 3PRMB 1I42A 3H8JA 2VRRB 4HEA1 2V9HA 3A4RA 2ZNVB 1UPHA 5AI5A 8ICYA 3VDZA 1J2MA 1RYJA 3EC8A 4GB9A 4EM4A 3FILB 3EJDB 3NVWB 2WS3B 4DDID 2PW9A 5J2FA 2G08A 4OJ5A 3GC2A 2G06A 4HLEA 2HHTA 1UD7A 1ZQJA 1HSKA 3RH6A 2ATLA 1TVAA 1WVFA 3U4EG 3ZI4A 5J0WA 3GIIA 5AE1A 2BS3B 5I1VA 2Q4TA 4QZ8A 3KTQA 1PYWD 4Z6FA 3M8SA 5ALGA 9ICCA 1ED1A 3B08A 4MH8A 3U7DA 2C60A 4XUSA 3CAWA 1GESA 5ALFA 4J1OA 2KFZA 3KFUF 3ABVB 1QT9A 4DHGA 1RM6B 3RZFA 2G07A 4QW9A 4PPXA 2K25A 2ZNVC 4W9HA 3QU7A 2GGEA 2WXRA 4MACA 3DGZA 2ES6A 4FHKA 2N1RA 4DWFA 2BYVE 2HMXA 2PU1A 1ZQCA 1SZPA 2FCMA 1WJNA 4OVUA 1R4MI 4G50A 5HNKA 4PGQA 1U47A 3DFHA 4B9MA 1RDFA 3NZSA 2JYEA 3H4DA 3TACB 5KFRA 3PZ7A 4HN8A 2KLGA 1PK1B 1PGAA 1OQYA 4PVJA 2F77X 4MJSB 4DEZA 4NQKE 5HMRA 2UYZB 3DOWA 3WKCA 4CYEA 3IK4A 2OM6A 1NK5A 3BK2A 1OUQA 4QWDA 2P6RA 1QQRA 4H1ZA 2BPFA 2JZBB 2MRLA 3TEXA 1NPXA 3PNCA 4IHCA
chains in the Genus database with same CATH topology
1YMHE 1SF0A 2K5PA 3PQBA 2CU3A 4TQ1A 1OFFA 2GQTA 1GOZA 4US9A 3LYYA 2QSDA 3V3XA 1SE4A 1ZXIA 4NAWB 2PLPA 4RF0A 2QILA 1TY2A 2N0SB 1N61C 1MPEA 1ZDVA 2JQRB 2HDEA 3R2IA 1FMAD 4OVZA 4C80A 1PUTA 2V0GA 1SEBD 3AECB 1F77A 2K0PA 3S1CA 2NTSA 4YTMB 1JROA 4TQ0A 4GDKB 5EE1A 1HXYD 4IOIE 2JU6X 3BK1A 1XLQA 2BVHA 1ESFA 1D5ZC 4O1NA 5HHDG 2DBYA 3CWIA 1FIQB 3C0PA 3I99A 1SSNA 5BMHA 1L0YB 3C8YA 2QKNA 5L6FA 2PVOD 2WXOA 3Q8EA 3VR9B 1VZ8A 1FM0D 2WDQB 3ZQ4A 2BTEA 2O3GA 1BUIC 2SAKA 2BBCA 1QOBA 4OZAA 1T3QC 2E6XA 2B76B 1XLNA 2PLSA 1JWSD 1STEA 1IBXA 2L52A 4JWUC 3IAS1 3E9SA 2ZW1A 2HTME 2YVSA 1C79A 5D3IB 2NMQA 1XF5L 5JXVA 3EUB3 1ZPSA 3BZDB 1C76A 5HHZA 1OQQA 4HKQA 4RGTA 1JMLA 2IGHA 4LLGM 4HJGE 3L4PA 3TX1A 2LHDA 3AN1A 2RPVA 4Q2JA 4XWWA 1E0YA 1W1RA 4OALA 1K51A 4LTUA 5FR3A 2PIAA 3SFDB 1RFKA 1QLUA 3AM9A 3D2JA 3ZJUA 1GPXA 3LLBA 2H89B 4YSZB 3JS8A 2L83A 3NRZB 2WNMA 5HG2A 2G9HD 1UXYA 1VRAB 3NVZB 4RGOS 2AX5A 2PTLA 3AV8A 1YN3A 1RM6C 1DZNA 1VAOA 3AE5B 1SB3B 2YEPB 4ZRPA 1I4XA 2BS2B 1SE2A 3UI3A 3HUIA 2SEBD 1CZPA 5BYSA 4ZOHB 1D5MC 3O13A 1A70A 2WXLA 3AE7B 4RF1A 4JWSC 2GQUA 3NVVB 1FNUA 1FFVC 1YN5A 4HRSA 1XO3A 2W3SA 1JWUD 1XXGA 3AE9B 2MH7A 3U52E 1HQRD 1JWAD 2OHFA 1WSPA 2V4IB 3NVWA 3FILA 3OWEB 2K3UA 4KGRA 5EE9A 2Y3SA 3V05A 1D6EC 4BC7A 3Q8BA 1K50A 4RGNA 3B9JA 1T6BX 3BYTB 2IPKD 3FW8A 1E7PB 2Z8LA 2W54A 2KACA 1YQ3B 2CJOA 2KDMA 2WXKA 1W1LA 3DWMA 1C4PA 4YT0B 3W8WA 2OAIA 3LAEA 1XCQL 3GSYA 1C4AA 1XLOA 1L0XB 2G1EA 2Y3AA 2PVGC 1I19A 5G5GB 3BVZA 1TKGA 4KX6B 2MJDA 3R2TA 1AW7A 1KRHA 1JRPA 2GB1A 2ONQA 2WXQA 1NEKB 2CJNA 1SJHD 3AE3B 5G5HA 2QMTA 3KLSX 5D7GA 4ZHPA 1E10A 2W55A 4BCAA 1ROEA 1EWYC 1W1QA 1W1KA 1ET6A 1VZ7A 2DYOA 2P13A 1AWDA 5GXGB 5BYQA 3RFZB 2KMMA 2Q85A 4ML8A 2H88B 2MJ3A 1AHVA 1HZ5A 1FNWA 2IDYA 4L2YA 2D5GA 5AUIA 1SJED 1ACCA 1NYQA 4DQOC 2M19A 4PT5A 3TEYA 1WXQA 1SXTA 1V1OA 4NJCA 4UDUC 2X38A 4JX1C 4IKGA 4HG0A 3W1SA 4KKJA 2VFTA 2VZKD 3P4SB 2R2ZA 1HZ6A 2LMCA 3AE8B 3AEGB 3IAM1 2ACZB 3NVYA 3Q8FA 3TSSA 1D4BA 2J53A 4USAA 3AE6B 3J9CA 4N59A 4A9AA 2I0KA 3DEDA 3LB8C 3AB5A 3KWLA 1FRDA 4R3DA 1I4QA 4YSXB 2BT6A 2DWQA 4A55A 3AH7A 4JE3B 4KGSA 1AHZA 3AEDB 1ZDXA 3NS1B 2PLIA 2BW2A 1DOIA 4M0WA 5HFYA 1T3QA 3S1FA 3ETRA 2JZPA 1DGJA 2ON8A 4PYTA 2J52A 3BVGA 3IT6B 1C9FA 2ICIA 2WXFA 1F2RI 5D3DA 2VZKB 1M4VA 2M56B 2LFIA 4ZYSA 2IGDA 4LK0M 1DIIA 1MI0A 1XEEA 2BB5A 4REZA 1TKYA 3FAHA 1HA5A 1T5XD 2WDRB 1JWBD 1Y56A 1GB4A 2KQ4X 2BYTA 3B2GA 3AEFB 1ZR6A 2M0AA 5AWVA 1QILA 5E6JA 3AEBB 3SR6A 2LGIA 2Y5PA 3FW9A 1PDXA 1KH0A 5AE2A 1N60C 2RDHA 2BB6A 4WH4A 1N62A 1TKEA 1FO4A 2P3HA 1ET9A 1KFYB 1KLGD 1TYGB 1DOXA 1W1MA 1WWTA 3DQ0A 1SIJA 1TZOA 2DYMA 1AYFA 2J42A 1I4GA 1KLUD 1JWMD 4MM3B 1W1SA 1EM7A 1FIQA 2GI9A 4JAYA 1N60A 4L23A 3Q8CA 1QKZA 1IUEA 3W2DA 2AQ1B 1MHXA 3S1EA 3P42A 1E8FA 4PWBA 2VFRA 2Y3RA 1FCCC 2INNE 2MBRA 2JWUA 4PVEA 1W1JA 2NQWA 5LNK1 2EXRA 1N5XA 3ZJVA 3LXFA 1E9MA 2Q4WA 2W82A 3VRBB 4XDDA 3MP9A 3BVMA 1QF6A 1JALA 5MPOA 1HEZE 4BC9A 1VR9A 1C78A 2IGGA 3NS1A 4RH6A 1TJEA 5T8IA 1P7FA 1E8GA 1WVEA 4C56C 2QPMA 1WRIA 1F0XA 4CQNA 2J4XA 4ZOHC 1JCKB 4YXDB 1AHUA 2PKOA 2INPE 5K8EA 5BYRA 4MLAA 1C77A 3Q8AA 1SBBB 3N9YC 3P4RB 3FW7A 3A7UA 2PMVA 1FEHA 5HI1A 1J7CA 1E0ZA 3R8BA 5FKAC 2QIEB 3MFGA 3W5VB 5FK9C 2UUUA 4PVKA 3W8XA 3SEBA 4PVHA 3VQIA 1B1ZA 1ENFA 3S1DA 4P16A 1FFUA 5FXFA 1IBXB 1UNSA 1P7EA 1MBBA 1VJKA 2MJEA 2WXIA 5FXPA 4JB1A 2WDWA 1FXIA 1NYRA 1V1PB 1B9RA 1TS3A 4DXFA 4A6QA 3NUHB 5C2TB 3D2HA 2WLBA 2KAJA 3B2FA 3VRAB 1QOFA 1N5WC 3KJMA 1TY0A 2IJ0A 1CQVA 2WDVB 2WU5B 5H92C 3A7AA 1EU3A 2MEKA 1L4ZB 4C7ZA 4UD8A 3W8ZA 1YJIA 4OZBA 4WURA 3IXSA 2DLBA 3I9V1 3VR8B 5EE3A 2BVGA 3HRDD 1I4PA 1L0VB 3AE1B 3BWUD 3URYA 3T3OA 2Y5CA 2RDGA 1N5WA 1N62C 5I1WA 3BIID 1YJJA 1TS4A 3I57A 3PM9A 1X2GA 1RWSA 3P4PB 3EGRA 1L5PA 1NVID 1OQRA 1YN4A 3KWVA 2XN9C 1FCLA 1VQZA 1QLTA 3POPA 3U7ZA 2JX5A 1I7HA 1ZE3D 1ZXHA 2KN4A 3NZ3A 3Q69A 4RGMA 4TMAB 2VFSA 5HQXA 1DYQA 4C7YA 4NAMA 2Q5WD 4ITKA 1PGXA 4YTNB 2LHEA 4KGTA 2WXPA 4N58A 3AEEB 3EA6A 2Y08A 3AEAB 2BS4B 3BW7A 4XWTA 4GLSC 2WXHA 1NI3A 2VAOA 1UWXA 2EKIA 3SR6B 3A7RA 4A8XC 4D2KA 4AQ7A 1ZP0B 1DOYA 2KWDA 2YEPF 4WQMA 1FFUC 4DNSA 2FUG1 4PWCA 1I4RA 2N9LA 4FXCA 4B0MA 1JQ4A 5AUKA 3ZGZA 1GB1A 4O95A 1J7BA 5BMIA 1V8CA 2RMMA 1WYGA 1SB3C 1IGCA 1LO5D 2WP9B 5FXEA 4EC3A 1L6VA 3PZ8A 1NENB 1PGBA 4L1BA 2I2YA 5ADZA 4WAFA 1I4HA 2AQ3B 1W1OA 3SFEB 3NRZA 1JW9D 4N6EB 3WCQA 5C3JB 3R07C 1D5XC 4ARCA 3NVZA 1KF6B 4H2AA 1CJEA 1KTKA 3HSUA 3ETRB 3HVZA 1TS2A 4DXGA 3TUOA 2WQYB 4EE2A 4ARIA 4RFBA 1ZXIC 3HRDC 1MVKA 4IDIA 2EELA 2WXNA 1F2RC 4HKZE 3PO0A 3NVVA 3T3NA 3HVDA 2AQ2B 5D79A 3AE2B 3FWAA 2RK5A 4PZFA 2K9XA 1GAQB 1PFDA 2WXGA 3IT4B 3DWGC 1WGKA 3TEZA 2K22A 1R7SA 2GRIA 5BMGA 2IPIA 2V3PA 3RJAA 1N63C 4YTPB 3VTEA 3MC0B 4TVYA 5FXDA 3P4QB 4XDCA 4NZLB 4MT5A 4HROA 2P4PA 1XCTL 1XLPA 1EWCA 2JSVX 4OHJA 3GP7A 3RPFC 2WXJA 1MBTA 2E5AA 2ZW0A 1UWMA 1F0ZA 2LJIA 3MJ5A 4GDLB 3TSHA 2QEJC 4KKIA 1QOAA 1QOGA 1ZOYB 3W9CB 3ZYYX 2I38A 4RNAA 2L1AA 1N61A 2TSSA 4TSSA 1MHHE 1Q10A 2VFUA 2LUMA 4P6VF 2WXMA 1BMLC 2E3TA 3H8HA 1TS5A 1V97A 4OZCA 3FC4A 2V3NA 4OW0A 4YWGG 5TSSA 4WIPA 3AE4B 3GB1A 4XE0A 1VZ6A 4BBYA 2VFVA 4TVWA 2Y4GA 1J7AA 1FXAA 2QJLA 2UUVA 5AE3A 2N7JA 1K52A 1FD6A 1UGJA 3AMZA 1FRRA 3D2DA 3GS2A 1K53A 1QLBB 2L32A 2NTTA 1FFVA 4RCOA 4HEA1 1EU4A 1SE3A 1C4CA 4JPSA 2R8DA 1RYJA 3FILB 1DIQA 3NVWB 3CIRB 3U2SC 2R61A 2WS3B 5I4DA 2PW9A 1E8HA 1X2HA 1ZUD2 3ZJTA 2WU2B 1HSKA 2JXTA 1VLBA 2JYTA 2XNAC 1YQ4B 1WVFA 3U4EG 5AE1A 2FBWB 2BS3B 4J3OD 5I1VA 4ZHOA 3TSJA 2FE8A 1PYWD 4MH8A 5G5GA 3BYYB 3RJ8A 1YNTE 3P1MA 1VDVA 1UUPA 3E56A 3ABVB 3MHZA 4ZRQA 1QT9A 1AN8A 1RM6B 3W5UB 3TEWA 1CK1A 5G5HB 1L4DB 2WXRA 1IGDA 4MACA 5L6GA 3EUB2 1FNVA 5EE0A 2OEDA 2AXRA 3KQ4A 1V1PA 3B9JB 3NVYB 4A90A 2N9KA 1L6UA 2JYEA 3PZ7A 1BXTA 4PVJA 1PGAA 1E6EB 4XLOA 4B0EA 5HMRA 1N63A 2W3RA 4US8A 3BK2A 4YSYB 1QQRA 4AS1A 3TEXA 5H8YE 3P63A 4WWMA 2BVFA 2LEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5P A;  1SF0 A;  2CU3 A;  1OFF A;  2GQT A;  4US9 A;  1ZXI A;  2N0S B;  1N61 C;  2JQR B;  1FMA D;  4C80 A;  1PUT A;  3AEC B;  3S1C A;  4YTM B;  1JRO A;  5EE1 A;  1XLQ A;  2BVH A;  2DBY A;  3CWI A;  1FIQ B;  3C0P A;  3I99 A;  2QKN A;  2PVO D;  3VR9 B;  1FM0 D;  2WDQ B;  2O3G A;  1T3Q C;  1QOB A;  2PLS A;  2B76 B;  1XLN A;  2L52 A;  4JWU C;  2HTM E;  2YVS A;  3EUB 3;  5HHZ A;  1OQQ A;  3L4P A;  3TX1 A;  3AN1 A;  1W1R A;  1E0Y A;  4OAL A;  4LTU A;  2PIA A;  3SFD B;  1RFK A;  1QLU A;  3AM9 A;  3D2J A;  1GPX A;  3LLB A;  2H89 B;  4YSZ B;  3JS8 A;  2L83 A;  3NRZ B;  1UXY A;  3NVZ B;  2AX5 A;  3AV8 A;  1VAO A;  1RM6 C;  1DZN A;  3AE5 B;  1SB3 B;  2BS2 B;  3HUI A;  1CZP A;  4ZOH B;  1A70 A;  3AE7 B;  4JWS C;  2GQU A;  3NVV B;  1FFV C;  4HRS A;  1XO3 A;  2W3S A;  3AE9 B;  2MH7 A;  1JWA D;  2OHF A;  3NVW A;  5EE9 A;  4BC7 A;  3B9J A;  3FW8 A;  1E7P B;  2W54 A;  1YQ3 B;  2CJO A;  3W8W A;  1W1L A;  2OAI A;  3DWM A;  4YT0 B;  3LAE A;  3GSY A;  1XLO A;  2G1E A;  1I19 A;  2PVG C;  5G5G B;  1TKG A;  4KX6 B;  2MJD A;  1KRH A;  1JRP A;  1NEK B;  2CJN A;  3AE3 B;  5G5H A;  1E10 A;  4ZHP A;  4BCA A;  2W55 A;  1ROE A;  1EWY C;  1W1Q A;  1W1K A;  2P13 A;  1AWD A;  5GXG B;  2Q85 A;  2KMM A;  4ML8 A;  2H88 B;  2MJ3 A;  1AHV A;  5AUI A;  1NYQ A;  2M19 A;  1WXQ A;  4JX1 C;  4HG0 A;  2VFT A;  3P4S B;  2R2Z A;  3AE8 B;  3AEG B;  2MBR A;  2ACZ B;  3NVY A;  2I0K A;  4USA A;  3AE6 B;  4N59 A;  4A9A A;  3DED A;  3LB8 C;  3AB5 A;  3KWL A;  1FRD A;  4YSX B;  2BT6 A;  2DWQ A;  3AH7 A;  1AHZ A;  3AED B;  3NS1 B;  2PLI A;  1DOI A;  1T3Q A;  3S1F A;  3ETR A;  4PYT A;  1DGJ A;  2M56 B;  1DII A;  1TKY A;  3FAH A;  2WDR B;  1JWB D;  3B2G A;  3AEF B;  1ZR6 A;  3AEB B;  3SR6 A;  3FW9 A;  1PDX A;  5AE2 A;  1N60 C;  1N62 A;  1TKE A;  1FO4 A;  2P3H A;  1KFY B;  1DOX A;  1TYG B;  1W1M A;  1WWT A;  3DQ0 A;  1SIJ A;  1AYF A;  1W1S A;  1FIQ A;  4JAY A;  1N60 A;  1IUE A;  3S1E A;  1E8F A;  4PWB A;  2VFR A;  4PVE A;  1W1J A;  2NQW A;  2EXR A;  1N5X A;  3LXF A;  1E9M A;  2Q4W A;  3VRB B;  1QF6 A;  1JAL A;  5MPO A;  4BC9 A;  3NS1 A;  1TJE A;  2QPM A;  1E8G A;  1WVE A;  1WRI A;  1F0X A;  4ZOH C;  1AHU A;  4YXD B;  2PKO A;  4MLA A;  3P4R B;  3FW7 A;  3A7U A;  1E0Z A;  1J7C A;  2QIE B;  3W5V B;  4PVK A;  3W8X A;  4PVH A;  3S1D A;  1FFU A;  5FXF A;  1MBB A;  1VJK A;  2MJE A;  5FXP A;  4JB1 A;  1FXI A;  1NYR A;  1B9R A;  5C2T B;  3D2H A;  2WLB A;  2KAJ A;  3B2F A;  3VRA B;  1QOF A;  1N5W C;  3KJM A;  2WU5 B;  2WDV B;  3A7A A;  5H92 C;  4C7Z A;  4UD8 A;  3W8Z A;  1YJI A;  3VR8 B;  5EE3 A;  2BVG A;  3HRD D;  1L0V B;  3AE1 B;  2Y5C A;  1N5W A;  1N62 C;  3BII D;  1YJJ A;  3PM9 A;  1X2G A;  1RWS A;  3P4P B;  1L5P A;  1NVI D;  1OQR A;  1VQZ A;  1QLT A;  2JX5 A;  1I7H A;  2VFS A;  5HQX A;  4C7Y A;  2Q5W D;  4ITK A;  4YTN B;  4N58 A;  3AEE B;  3AEA B;  2BS4 B;  3BW7 A;  1NI3 A;  2VAO A;  2EKI A;  3SR6 B;  3A7R A;  1ZP0 B;  1DOY A;  4WQM A;  1FFU C;  4DNS A;  4PWC A;  4FXC A;  1JQ4 A;  5AUK A;  4O95 A;  1J7B A;  1V8C A;  5FXE A;  1WYG A;  1SB3 C;  2WP9 B;  4EC3 A;  1L6V A;  1NEN B;  5ADZ A;  1W1O A;  3SFE B;  3NRZ A;  3WCQ A;  1JW9 D;  4N6E B;  5C3J B;  3R07 C;  3NVZ A;  1KF6 B;  1CJE A;  3ETR B;  3HVZ A;  2WQY B;  1ZXI C;  3HRD C;  4IDI A;  3PO0 A;  3NVV A;  5D79 A;  3AE2 B;  3FWA A;  2RK5 A;  4PZF A;  2K9X A;  1GAQ B;  1PFD A;  3DWG C;  1WGK A;  2K22 A;  1R7S A;  1N63 C;  4YTP B;  3VTE A;  4TVY A;  5FXD A;  3P4Q B;  4HRO A;  2P4P A;  1XLP A;  3RPF C;  1MBT A;  2E5A A;  1UWM A;  1F0Z A;  3TSH A;  1QOA A;  1QOG A;  1ZOY B;  3ZYY X;  3W9C B;  1N61 A;  2VFU A;  4P6V F;  2E3T A;  1V97 A;  3FC4 A;  3AE4 B;  4BBY A;  2VFV A;  4TVW A;  1FXA A;  1J7A A;  2QJL A;  5AE3 A;  3AMZ A;  1FRR A;  3D2D A;  1QLB B;  1FFV A;  2R8D A;  1RYJ A;  1DIQ A;  3NVW B;  3CIR B;  1E8H A;  2WS3 B;  1X2H A;  1ZUD 2;  2WU2 B;  1HSK A;  1VLB A;  1WVF A;  1YQ4 B;  5AE1 A;  2FBW B;  2BS3 B;  4ZHO A;  3TSJ A;  5G5G A;  3P1M A;  1VDV A;  3ABV B;  1QT9 A;  1RM6 B;  3W5U B;  5G5H B;  3EUB 2;  5EE0 A;  2AXR A;  3B9J B;  3NVY B;  1L6U A;  4PVJ A;  1E6E B;  4XLO A;  5HMR A;  1N63 A;  2W3R A;  4US8 A;  4YSY B;  5H8Y E;  3P63 A;  4WWM A;  2BVF A;  2LEK A; 
#chains in the Genus database with same CATH topology
 3KZI U;  1LQB A;  4H19 A;  2PA6 A;  4ED8 A;  5DLF A;  1SF0 A;  2K5P A;  4PHP A;  3TKA A;  5L83 A;  1OFF A;  2D3C A;  2ZTC A;  3SV3 A;  1GOZ A;  2VAN A;  2LKY A;  3LYY A;  1SL1 A;  2J6U A;  4C4V B;  2HE7 A;  1SE4 A;  1ZXI A;  2PLP A;  2VA2 A;  2QIL A;  2HXU A;  4P0Q A;  3GD3 A;  4YN4 A;  1ZJM A;  4FAD A;  3FXG A;  1WGR A;  2OJR A;  1QZE A;  5J2J A;  4JK1 A;  4XA5 A;  2BPG A;  3HM6 X;  3C2M A;  4RU9 A;  1JOA A;  4E8G A;  3R1Z A;  5ALW A;  1X9S A;  2VIX A;  4BUR A;  4IR1 A;  2YB4 A;  1ZOL A;  3QX7 A;  1X9M A;  1L5U A;  3TCA A;  1MSW D;  2E8M A;  2KIC A;  1HXY D;  5FJO A;  3JPS A;  3BK1 A;  3RIT A;  1XLQ A;  5IOI A;  4AP9 A;  2WAQ C;  1D5Z C;  3UJR A;  4DF4 A;  2FCS A;  2OKT A;  2DBY A;  5L95 C;  4HJK A;  1FIQ B;  3C0P A;  4FI4 A;  1ZQQ A;  3PTF C;  3DH9 A;  5BMH A;  1ZY8 A;  2DPI A;  1XS9 D;  2WXO A;  3PX6 A;  1LVH A;  2AJQ A;  2O2V A;  2WDQ B;  4FA6 A;  2Y0S C;  2ZIW B;  2BTE A;  4C8N A;  1LFD A;  2H5X A;  3VCC A;  4OZA A;  1WR6 E;  2EH9 A;  3D2Q A;  5U25 A;  2WAQ F;  1STE A;  2GMI C;  2L52 A;  3FKY A;  4KX3 A;  1PVQ A;  3TL5 A;  1COO A;  3V4B A;  2KK0 A;  3RR8 A;  1ZQI A;  2N9E B;  2NMQ A;  1XF5 L;  5JXV A;  3EUB 3;  1ZPS A;  3NAS A;  3ZLG A;  4I2B A;  3H7S A;  5DGA A;  3PVL A;  5HHZ A;  1YX5 B;  1RYR A;  2PGW A;  4PZN A;  5JTI A;  3RCZ A;  3QIJ A;  4MHV A;  3L4P A;  2PGE A;  3TX1 A;  3VC8 A;  4XWW A;  1E0Y A;  1WGD A;  1W1R A;  2L76 A;  4OAL A;  3IM1 A;  3F2B A;  5AK6 A;  2BKF A;  2BKR B;  2KNB A;  2FMP A;  4KLH A;  5J8Y C;  4NPN A;  2N1W A;  1QLU A;  2M4N A;  2O6K A;  5J29 A;  1TIF A;  9ICF A;  4UBB A;  3GE3 C;  3HK0 A;  3JS8 A;  3NRZ B;  2CHR A;  3MWC A;  1ZKH A;  1XAN A;  4B9V A;  5KFE A;  2CR5 A;  1CUK A;  4PL1 A;  4UQG A;  3C1Z A;  3M3J A;  3PW5 A;  4QJF B;  3A33 B;  5FP0 A;  5KFJ A;  3NOB A;  4LJO B;  2QDE A;  1SE2 A;  7ICL A;  2NBU A;  5CHG A;  1CZP A;  4GFI A;  1WZ0 A;  4HWI B;  4JWS C;  3VHT C;  1ZRN A;  4ECY A;  2RGF A;  4QZD A;  1WCL A;  3I76 A;  1NZB A;  4E6M A;  3H0L B;  7ICR A;  2PP0 A;  3L0W B;  2OEH A;  4M0W B;  2MWS B;  4K7U A;  3OGU A;  3MR2 A;  4NJ6 A;  3TMP B;  2F1J A;  4HVB A;  2JR5 A;  5ALS A;  4MEY A;  2JK6 A;  4EZK A;  4P2H A;  2V4I B;  2KDF B;  4BXO B;  5EE9 A;  3N4M B;  8ICG A;  1HE8 A;  5AKL A;  4KGR A;  4DL3 A;  3P3B A;  4TUU A;  3SEN A;  5KFP A;  1C1Y B;  4BC7 A;  3Q8B A;  2R9Z A;  4JDR A;  1Z5S B;  2WFA A;  1T6B X;  2NV3 A;  3C2L A;  2IPK D;  2MBH A;  3FW8 A;  2Z8L A;  1GRF A;  8ICX A;  1NEL A;  3KYD D;  2OAI A;  4I2J A;  1C4P A;  4YT0 B;  1HEK A;  2P8C A;  3LAE A;  1C4A A;  2Y3A A;  3RR7 A;  5IIN A;  3BVZ A;  2IOF A;  2P3H A;  9ICT A;  3ICX A;  4F4X A;  1M6Y A;  4DS5 A;  2A3V A;  1LXD A;  3I5J C;  3R2T A;  4I6N B;  4EX7 A;  3OSN A;  3Q3J A;  3KHG A;  1JRP A;  5KFH A;  4ICA A;  4UAW A;  1NEK B;  2KKC A;  2WXQ A;  4E4F A;  1N2X A;  3KLS X;  5KFM A;  3JSV B;  2KJ6 A;  1EWY C;  2K8A A;  1ET6 A;  1W1K A;  2V3A A;  1HUZ A;  8ICS A;  2HSZ A;  5AI4 A;  2PCE A;  2KMM A;  4ML8 A;  3IFW B;  4R66 A;  5KG5 A;  3ETL A;  3T5H A;  4K8D A;  4F93 B;  4G3X B;  1Q1R A;  4DK5 A;  3IG8 A;  2D5G A;  4EX6 A;  4EZJ A;  1CI4 A;  2BCU A;  5J0Q A;  1TT5 B;  1NYQ A;  1BNP A;  4EEN A;  3RN9 C;  4DQO C;  1Z1V A;  3MGV A;  4UDU C;  3WK8 A;  5EU9 A;  1Z00 A;  4BOS C;  2LWP A;  1R4N B;  2M0X A;  4IP4 A;  1MRA A;  4NLZ A;  5L1I A;  5J2A A;  2POZ A;  2FCN A;  1NDA A;  4R8U B;  2ZUD A;  2R2Z A;  4DBG A;  2ACZ B;  3NVY A;  4RQ7 A;  3Q8F A;  4WJN A;  5G55 A;  2I0K A;  3J9C A;  5J2R A;  3DER A;  3DES A;  3QFB A;  2DWQ A;  3OTR A;  1XSN A;  4TQS A;  4KGS A;  1KJT A;  3AED B;  1ZDX A;  2PLI A;  4E0D A;  4IR9 A;  4YWS A;  4EMI A;  2CPR A;  5LLI A;  4UB8 U;  2ON8 A;  3BVG A;  3IT6 B;  3Q8M A;  4P7I A;  1TAU A;  1C9F A;  2MU2 A;  5AKZ A;  2ICI A;  2WXF A;  1LVL A;  4LDT D;  3AUL A;  1F52 A;  2VZK B;  4ED1 A;  1M4V A;  1ZQ1 C;  1NHS A;  4UB3 A;  2K4P A;  4OJP A;  5DG7 A;  4JHM A;  4M0X A;  4ZYS A;  4CCH A;  4H4P A;  2FYM A;  4H4T A;  2BB5 A;  4K1R B;  1HA5 A;  2WDR B;  1T5X D;  3WK4 A;  4AYB F;  2ZIU A;  2Y9T A;  5KL8 B;  4BOZ B;  1ZRM A;  1C7Y A;  5AK3 A;  4R64 A;  3DBR I;  1ZR6 A;  1GEU A;  4DXA B;  9ICE A;  5AWV A;  4P1B C;  3AEB B;  3I3T B;  1WX9 A;  4NL9 C;  2M9N A;  4RQ0 A;  4Y2R A;  2MSE D;  5AE2 A;  4F7Z A;  4PZO A;  4WH4 A;  4IM2 A;  2NQL A;  2XGZ A;  3V6K A;  2LZ6 A;  2G3Q B;  3EAO A;  4FZN A;  3QUC A;  1DOX A;  5AM1 A;  1W1M A;  5EBK A;  1WWT A;  4TV3 A;  3WA0 A;  3EAN A;  3I6E A;  4EUT A;  2DYM A;  3N7S C;  1AYF A;  1U4A A;  1KLU D;  2KSO B;  9ICB A;  3ZUN A;  4WWO A;  2QQ6 A;  4FX9 A;  1IYF A;  3PHX B;  1FIQ A;  2YX8 A;  3Q2A C;  1N60 A;  3NUQ A;  1NHR A;  2F8L A;  4L23 A;  4NLC A;  3TW9 A;  4O3O A;  3G6X A;  1IUE A;  3LAD A;  5JH5 C;  3R7R A;  4KLO A;  2AQ1 B;  2GH5 A;  2X99 A;  3O0H A;  3WAM A;  1E8F A;  1E8Y A;  3T8M A;  5KFT A;  2INN E;  2NR2 A;  2GL5 A;  4NEW A;  2C7N B;  4RQ8 A;  1T94 A;  1W1J A;  5E6O A;  5FS7 A;  2NQW A;  3ZJV A;  3LXF A;  3TAN A;  4MEM A;  2Q4W A;  2MA1 A;  2W82 A;  2ZIV B;  3PSP A;  3TJI A;  2AU0 A;  1Q3U A;  1PK3 A;  1UT8 A;  4M8M A;  2P6U A;  1F44 A;  2MQJ A;  2K6D B;  5MPO A;  4I6L B;  4EWJ A;  1SJC A;  4BC9 A;  1VR9 A;  4RH6 A;  3FYH A;  2P35 A;  4BWJ A;  2NPX A;  3TQP A;  2J4X A;  2FUH B;  1ZQD A;  3AI5 A;  5KFI A;  4MF2 A;  3I63 C;  5G2N A;  1AHU A;  2PKO A;  4IL6 U;  3WK5 A;  5BYR A;  5K8E A;  4RT2 A;  2AAQ A;  4KLI A;  2MUT A;  3L54 A;  4MLA A;  2HHS A;  4BVU C;  3Q14 C;  3KD3 A;  2N4F A;  3WU2 U;  2FLN A;  3N9Y C;  3WIM A;  2IHN A;  3ZDC A;  4F50 A;  1WUD A;  2BQQ A;  2DEN B;  3PR4 A;  2D2Q A;  4K4G A;  3CGC A;  1FEH A;  2PMZ C;  1SJD A;  2L0T A;  4C0Z A;  1Q1O A;  3ENE A;  4S17 A;  5FKA C;  3T79 A;  1LV5 A;  2QIE B;  3W5V B;  2UUU A;  3GQC A;  3RNE C;  2C9W B;  4DYE A;  1GRH A;  1XC9 A;  3OW1 A;  1RZT A;  1ENF A;  3BQ1 A;  3S1D A;  3L3F X;  1FFU A;  4R8U A;  2FMQ A;  2KJR A;  2KLC A;  1IBX B;  1HUO A;  3BSM A;  4O3S A;  5J8Y A;  4DQQ A;  2MJE A;  2WXI A;  5FXP A;  3TWA A;  2QAR B;  4CNQ A;  1NYR A;  2K39 A;  1IYX A;  2RDI A;  5KFQ A;  1TS3 A;  2BF8 B;  3NUH B;  1L7P A;  2LI6 A;  5C2T B;  2WLB A;  2KAJ A;  4ANV A;  1ZQL A;  2AEH A;  4BKG A;  1ZK7 A;  3TCS A;  3VC5 A;  4FBJ B;  3ZDM C;  5KT6 A;  3KJM A;  3QU4 A;  1TY0 A;  1V80 A;  3C0R B;  3PO5 A;  2NRW A;  2W9N A;  3W8Z A;  5CHF A;  3RR1 A;  3K9P B;  2NYV A;  2RDX A;  5IDZ A;  3KHH A;  7ICP A;  3DVG Y;  2MCN B;  4H4Y A;  3VR8 B;  4IRC A;  4EZ9 A;  3L10 B;  5I1W A;  3KHR A;  1YJJ A;  1FEA A;  3MKC A;  1UZX B;  2KTR B;  3I57 A;  2KC2 A;  4E3C A;  3DJJ A;  1BGX T;  2HOI A;  2Z59 B;  3V61 A;  4GYP A;  1OQR A;  5JCM A;  3Q3M C;  4GRT A;  3UMG A;  2KD1 A;  5KFW A;  4KLE A;  1I7H A;  3RUL A;  2BCR A;  5ALX A;  1ZXH A;  3NZ3 A;  2HHQ A;  3C5F A;  1PVR A;  3BZK A;  2ISO A;  4MH0 E;  4M04 A;  3FCP A;  3PSF A;  1GET A;  4ITK A;  1X66 A;  3DHI C;  4YTN B;  4F5P A;  5ALL A;  4KGT A;  2GSH A;  3PWI A;  3R0K A;  3UJ2 A;  3EA6 A;  3BQ7 A;  2BS4 B;  2BYF A;  4GLS C;  3EF6 A;  4M9G A;  1Z19 A;  4HYR A;  4A8X C;  4AQ7 A;  1ZP0 B;  4KPL A;  4KSK C;  3SD7 A;  1ECQ A;  1JPM A;  2A19 A;  2L00 B;  3A0B U;  4AUQ C;  2N9L A;  4FXC A;  2XCP A;  1MO9 A;  4G9B A;  2KFK A;  1GB1 A;  3H4K A;  4QWB A;  1TAQ A;  3TAD A;  2RMM A;  5BMI A;  4YVZ A;  2WP9 B;  2WX0 A;  3F5E A;  4U6P A;  1L6V A;  8ICI A;  1PGB A;  3P2B A;  5ADZ A;  4WAF A;  1I4H A;  2BCQ A;  3ZNG C;  2KK8 A;  8ICT A;  1W1O A;  3DG6 A;  3FVD A;  4IWP A;  2DW7 A;  4H4Z A;  1D5X C;  4ASW C;  3SBF A;  3WKE A;  4H2A A;  2W11 A;  4FBU A;  3ZNI D;  3HVZ A;  5F9L A;  3BJY A;  2H3V A;  3H40 A;  5IIJ A;  2ZC8 A;  2P3Z A;  5DB9 A;  4O5E A;  4M8N A;  1V6E A;  2G4D B;  2DPJ A;  3R66 C;  3APF A;  1LPF A;  3HRD C;  4IDI A;  2WXN A;  4HKZ E;  3PO0 A;  5KHO A;  2FNJ B;  2ASL A;  4A6G A;  2HCF A;  4YP3 A;  1XQQ A;  5D79 A;  3AE2 B;  3FWA A;  1Q1W A;  2JEJ A;  1XD3 B;  2KDE B;  5FS6 A;  3SJN A;  2M8S A;  4ANW A;  4HPP A;  1WGK A;  4ZDV A;  1GSN A;  3PG6 A;  3N97 B;  4PYZ A;  4A3R A;  2GBJ A;  5J2C A;  1R7S A;  2IPI A;  1J97 A;  3QZ8 A;  4P1C C;  5IKC M;  4YTP B;  2NPT B;  1UCV A;  1N63 C;  3MC0 B;  3F2C A;  3PRP B;  4XDC A;  4NZL B;  2K8C B;  1OEP A;  3UXL A;  1N6Z A;  4HRO A;  3RRH A;  2BCV A;  3BQ0 A;  3CXO A;  4RQ4 A;  4DWI A;  1EWC A;  4OHJ A;  2AGP A;  2ZVO A;  4WJP A;  3RPF C;  3ZXR A;  2GGG A;  1V9J A;  1KKO A;  4UAS A;  4QZI A;  4W9K A;  5J0O A;  4IP5 A;  3TSH A;  3BS5 B;  3C28 A;  3QX1 A;  4ED2 A;  3SEI A;  3UMB A;  3V3W A;  3F5A A;  4TSS A;  1N61 A;  4PH5 A;  4F3O A;  1KFT A;  1GC7 A;  2WHI A;  3EJB B;  1Z4O A;  1KCZ A;  4NY8 A;  3PGE A;  4IC9 A;  2FID A;  2DKZ A;  1QSL A;  1V97 A;  1WRD B;  2OJW A;  3URH A;  1ZYQ A;  1O03 A;  2A4Z A;  2KE7 A;  3RB4 A;  2GBN A;  4WIP A;  2W9B A;  1SV4 A;  5ALU A;  2RR9 A;  3GB1 A;  5AKJ A;  4B9L A;  1VZ6 A;  1L8O A;  3DK8 A;  3N1Y C;  4DHJ B;  5AK4 A;  2Y5B B;  4IWO A;  5A0L A;  3A4S C;  3UIP B;  2UUV A;  2N7J A;  4C8L A;  3DGB A;  2ZZP B;  4RNN A;  3GS2 A;  5D46 A;  4QIW F;  1N56 A;  4MM3 A;  1ZQR A;  3VFK A;  2WB1 F;  2MBE A;  4KT2 A;  4ACO A;  4K2S A;  5C23 A;  3NFU A;  1Y88 A;  2WF6 A;  4UB2 A;  1E8H A;  1AOG A;  3RBE A;  1X2H A;  3PO4 A;  3NS8 A;  3TAR A;  1P3Q U;  3IHP C;  4JN7 A;  4M2Y A;  3A9J B;  4M01 A;  1SKR A;  1EBD A;  1E5W A;  1YQ4 B;  4NM1 A;  2WF7 A;  2K60 A;  1WXA A;  2JH1 A;  5EWF A;  3MJW A;  5JCN A;  3PSI A;  4ZHO A;  3TSJ A;  5AI6 A;  1ZMD A;  1L3U A;  3CMM B;  1QTM A;  2PTW A;  3BY4 B;  3N20 C;  2ZIU B;  4PHA A;  9ICX A;  2NVU I;  4OO1 J;  2JXX A;  4ZRQ A;  3EFC A;  5ALM A;  4JN8 A;  5ALQ A;  2JRH A;  3W5U B;  7ICN A;  1L4D B;  2XGQ A;  1IGD A;  5L6G A;  1MDR A;  2EQ6 A;  2AXR A;  3GD6 A;  3EEC A;  1S5L U;  2ASQ A;  3L13 A;  1ZQW A;  3DBL B;  3DK4 A;  5CHW A;  2D10 A;  3QU2 A;  1I35 A;  1U48 A;  3ZDA A;  2GBK A;  4IQU A;  1BQG A;  4OCZ A;  4B0E A;  2FKP A;  3S5S A;  1N63 A;  2W3R A;  4US8 A;  1K8R B;  2HNE A;  1J8C A;  2PTZ A;  5KT2 A;  1ZQK A;  3DFY A;  1ZGU B;  3R10 A;  1TAM A;  5L1J A;  2LEK A;  1NKB A;  3QUQ A;  2BQU A;  1JMS A;  3Q4D A;  3TFS A;  2FMS A;  1BPX A;  2YN4 A;  3KUM A;  3H7P B;  1L3V A;  2AKM A;  3II4 A;  1ZMC A;  3V3X A;  2QSD A;  4DCC A;  4QWA A;  4XZ4 A;  5JRB A;  1Q8K A;  3KHL A;  4RF0 A;  2GR1 A;  4EYH B;  1TY2 A;  1WE6 A;  1N61 C;  9ICL A;  1MPE A;  2NCN A;  5CHV C;  2ASJ A;  5AHX A;  2C2D A;  1JX4 A;  2HDE A;  1ZKQ A;  3U9I A;  2KT7 A;  3B0X A;  3DDC B;  1FMA D;  4Z1Y A;  3LWM A;  4C80 A;  1PUT A;  2V0G A;  1F77 A;  2K0P A;  3M9N B;  2XY5 A;  4IQW A;  5EE1 A;  5J0X A;  2ZXH A;  1ZJN A;  4TQ0 A;  4Q8E A;  2JU6 X;  4CHK A;  4DSJ A;  4KWS A;  5F9N A;  2L0F A;  5HHD G;  2ISP A;  2LGY A;  3BS7 A;  3THU A;  4NLB A;  2V3S A;  5KFD A;  1AQ6 A;  3ZNZ B;  3RYT A;  4KN4 A;  3I99 A;  2PSN A;  4RQ3 A;  1HIW A;  3C8Y A;  3NZG A;  1UA0 A;  4H4U A;  4NV0 A;  2V6O A;  3V6J A;  3Q8E A;  2CHW A;  1NBF C;  3ZQ4 A;  5ALO A;  8ICW A;  2N1V A;  1F1H A;  2O3G A;  4FZM A;  3N3K B;  1E9I A;  1F9J A;  1T3Q C;  2E6X A;  2FPL A;  2DGZ A;  2MBQ A;  3PX4 A;  2C3C A;  3DPD A;  2KSO A;  2ZUC A;  5KFN A;  1IBX A;  3PPA A;  4JWU C;  2FIF A;  3CT2 A;  3UXK A;  2QAR A;  5D3I B;  2DYB A;  2MSN A;  4H4R A;  1ARO P;  2A1J A;  3DHG C;  2DAJ A;  1PK1 A;  1L8P A;  4U7C A;  2BGW A;  1P0R A;  3PX0 A;  1MNS A;  3M7D A;  1ZQN A;  2NVK X;  4J9R A;  4DF8 A;  4MGK E;  2X8H A;  1BPZ A;  4BUG A;  7ICU A;  3UJS A;  2W03 A;  1JML A;  2IGH A;  4RZR A;  2WYQ A;  1TKD A;  1XSP A;  5KFX A;  3ALB A;  3AN1 A;  4CF3 A;  2LM4 A;  3TI0 A;  2MAX A;  2UWQ A;  5U1O A;  1BZL A;  2BC0 A;  1K51 A;  5FR3 A;  4LCD E;  4RQ5 A;  3SFD B;  2E8P A;  1WJ6 A;  3UQ0 A;  1ZQM A;  1GPX A;  2QGY A;  4X57 B;  4RNM A;  2H89 B;  5GTH U;  1TK5 A;  4LNN A;  3RNF C;  4YSZ B;  1TKK A;  2WNM A;  3O0F A;  2KFN A;  1WZ3 A;  4K3C A;  2DFL A;  2CN1 A;  1UXY A;  4Y2J A;  3B0A A;  4F4R A;  1V38 A;  2LI5 A;  1FPY A;  2ZCC A;  3AE5 B;  2B21 A;  1SB3 B;  3STP A;  3Q45 A;  5DQH A;  1I4X A;  2MUC A;  1ZQH A;  1D3Z A;  2ASD A;  1QH9 A;  4YCX A;  3E0F A;  4YQW A;  4KLQ A;  2MHJ A;  4QIW C;  5BYS A;  3AE7 B;  4ROP A;  4KPR A;  1WGY A;  4LNK A;  3OAW A;  4GN1 A;  2GQU A;  2D07 B;  4HXD A;  1WF9 A;  3ZDD A;  2HBL A;  1IM4 A;  4W9G A;  3OP2 A;  2WGS A;  4YR2 A;  1EUV B;  4HRS A;  5AM4 A;  1XO3 A;  3I4K A;  4QNL A;  2PKE A;  4IL2 A;  2W3S A;  1JWU D;  1T0R C;  1XXG A;  4M9J A;  2J6T A;  2MH7 A;  3V62 A;  1R4M B;  3HJE A;  1GRB A;  1WSP A;  3NVW A;  1T0Q C;  3FIL A;  5KFK A;  2Y3S A;  1WUF A;  3PV8 A;  1QQ7 A;  2IO3 B;  2RHF A;  2CKH B;  4RGN A;  5CJ7 A;  3BYT B;  4P0P A;  2W54 A;  1H8C A;  4ECT A;  3IG5 A;  5DDM A;  2KAC A;  3BDP A;  4BJQ A;  3W8W A;  4MKS A;  2G45 B;  8ICC A;  4KN7 A;  1ISN A;  3QCA A;  1XCQ L;  4HPM B;  3GSY A;  1L0X B;  5E6P A;  3JPN A;  3IHQ B;  1SGG A;  4DSL A;  1S77 D;  5KVI A;  2C5L C;  2BZF A;  2HBK A;  2ZJA A;  2CJN A;  3RD2 A;  1SJH D;  5G5H A;  5D7G A;  4ZHP A;  4BCA A;  3OJ3 A;  2YMP A;  1LB2 B;  4W9J A;  2D3D A;  3QJZ A;  2Y1I A;  4Y2V A;  4KLG A;  3Q6J A;  1WYW B;  5BOF A;  4DQR A;  2P13 A;  1B43 A;  2Q85 A;  2I9G A;  1EF5 A;  1J0G A;  4UW9 A;  1YQB A;  5ALV A;  5AUI A;  7ICE A;  3RT3 B;  4ECX A;  2G4S A;  2FPM A;  1BWC A;  4MGY E;  3MBY A;  4LJP B;  3RJE A;  3QKE A;  1HJP A;  1ZQE A;  2KX3 A;  4X2P A;  4JX1 C;  4IKG A;  4AYB C;  1YX6 B;  2IY0 B;  2VFT A;  4O3Q A;  4J9K A;  3P4S B;  2LMC A;  3AE8 B;  3AEG B;  2MBR A;  3TFR A;  4FUL A;  1D4B A;  4LZD A;  1F3P A;  2JEF A;  4N59 A;  3DED A;  2J6S A;  3AB5 A;  3OZM A;  3KWL A;  1FRD A;  1P9D U;  2BKE A;  3MC1 A;  3P93 A;  4DQS A;  1YIW A;  1GO3 F;  3T4W A;  4GFJ A;  1A5R A;  2BW2 A;  4AWJ A;  4M0W A;  3S1F A;  1T4G A;  4BBN C;  3ETR A;  5AKY A;  4PYT A;  1FEB A;  4EEY A;  4GC6 A;  2JUO A;  2UVR A;  1F2R I;  4W9E A;  5IA7 A;  1XO1 A;  4KIK A;  4RQ6 A;  3M9O B;  2WBA A;  1HTO A;  4REZ A;  3TSS A;  3H12 A;  4J3Z A;  4TUS A;  1TKY A;  2CU1 A;  1L6N A;  5KFG A;  2R8K A;  4KV2 A;  1O08 A;  1V85 A;  2BYT A;  4II3 B;  3WAO A;  2RRD A;  4G3I A;  3T9P A;  4YMN A;  3D47 A;  2AQ4 A;  1PDX A;  1KH0 A;  1Z4N A;  2XO7 A;  2HVH A;  1N60 C;  8ICL A;  2FJ6 A;  2RDH A;  5J04 A;  3IC9 A;  2XIC A;  1V2Y A;  2R8G A;  3N30 A;  3V6C B;  1ZQX A;  5B5E U;  4DXK A;  3MZN A;  3UIO B;  1KKX A;  3RJF A;  4UAV A;  1MQ2 A;  1KLG D;  3H9D A;  3DQ0 A;  3S47 A;  3GIK A;  2WP5 A;  5AKH A;  3HW2 A;  1G6J A;  4JIO U;  1QSY A;  3IP4 B;  4MM3 B;  1EM7 A;  4BV6 A;  2GI9 A;  4I2H A;  5FR6 A;  3HX0 A;  3Q8C A;  4GDL A;  1QKZ A;  3RH4 A;  2XH2 A;  3PMN A;  5FS8 A;  2EAO A;  4GOC A;  4F5R A;  1MHX A;  2L05 A;  3S1E A;  4GGB A;  2XSX A;  4QZB A;  2Y3R A;  2F5Z A;  1FCC C;  2DF4 B;  4KSL C;  1XS2 A;  4CF5 A;  4RPZ A;  4O3R A;  2JWU A;  4KLL A;  3M6K A;  1OJT A;  4GME A;  5LNK 1;  3FDS A;  3V5C A;  4KEM A;  3KYC D;  3LYS A;  3JW0 X;  3W1Y A;  3WK9 A;  4HCH A;  3TJ4 A;  1S0V A;  1JAL A;  3X0W A;  4NM2 A;  4F72 A;  3EYZ A;  1HEZ E;  3HHM A;  4ADW A;  2YQE A;  2IGG A;  3NS1 A;  1F5S A;  1E8W A;  5D6J B;  2QHO A;  5T8I A;  1P7F A;  3BZC A;  1WRI A;  1D8L A;  3JPO A;  3QHT A;  5KG3 A;  4YXM A;  3LXD A;  3SI8 A;  2FI1 A;  3MR5 A;  3HP6 A;  1RXV A;  1MFW A;  5KTQ A;  5IN7 A;  1IIP A;  4EQR A;  1SXE A;  2FE9 A;  1CRX A;  2ZTE A;  4DSK A;  1EF1 A;  3Q8A A;  2DKX A;  1R0M A;  4I2G A;  5IIL A;  2J7Q B;  2EKE C;  4MFA A;  5ALT A;  1UGM A;  3MC9 A;  2PMV A;  2QLT A;  4RM9 A;  2KHQ A;  5AM3 A;  5KT5 A;  5AKK A;  1J7C A;  3GZN B;  5HI1 A;  4B9K A;  1E0Z A;  5DQI A;  5AI8 A;  4EFO A;  4DX3 A;  8ICE A;  5J0T A;  2XCA A;  3H1U A;  2JMG A;  5J0U A;  4LDT B;  4PVK A;  3W8X A;  3SEB A;  3PLV A;  1EC8 A;  5AIB A;  4XC2 A;  3VQI A;  5AZF A;  1B1Z A;  4UB5 A;  2H3I A;  2N7D A;  4W9F A;  3VTU A;  2GGH A;  3DCG A;  2X8C A;  1L3T A;  1UNS A;  1P43 A;  8ICO A;  1VJK A;  4KDL B;  1BPE A;  4OVV A;  4JB1 A;  3FG2 P;  1BKH A;  4DHZ B;  4GYP C;  1KLN A;  2W9C B;  1GRA A;  2DZK A;  1KFS A;  3B2F A;  1K1Q A;  2OWO A;  3ZLH A;  1QOF A;  2M17 A;  1N5W C;  1B4F A;  2XBB C;  3RMK C;  3ZVV A;  4DOC A;  2JH7 A;  3C5G A;  2RAB A;  3A7A A;  6ENL A;  1EU3 A;  2IO1 B;  3JSV A;  4RQ1 A;  1VD2 A;  1IG6 A;  3IXS A;  3I1Y A;  1S97 A;  9ICI A;  5D49 A;  4EEW A;  1UA1 A;  2KN5 A;  3I9V 1;  3LVV A;  3HRD D;  1I4P A;  1L0V B;  3BWU D;  4HK2 A;  1ECW A;  3T3O A;  1FHV A;  4J9L A;  1N5W A;  4QZE A;  1NJW A;  5ALJ A;  2N7E A;  4MGG A;  2UVU A;  2EAN A;  3MFI A;  2PFO A;  1ZD3 A;  1L5P A;  1YN4 A;  3DBH I;  1KLV A;  3TAD C;  1VQZ A;  1XDI A;  3HKZ F;  2ZZB A;  1DTN A;  3POP A;  9ICV A;  3V7K A;  4F8C B;  8ICF A;  1W6T A;  2DW6 A;  1ZD4 A;  4DL6 A;  5HQX A;  2Q0Z X;  3ZDT A;  4EMJ A;  2LHE A;  2KJ8 A;  4K4I A;  2KWC A;  4BKS A;  4MF8 A;  2AL1 A;  1X2I A;  4XWT A;  3QN3 A;  5BOE A;  4EQW A;  1UWX A;  1U9L A;  2IMW P;  1D8B A;  3UCC A;  4ELT A;  3RNC C;  3EPG A;  3N28 A;  3M6Z A;  1DOY A;  2KWD A;  9ICN A;  4WQM A;  2FLL A;  1CMX B;  2PEA A;  5BOL A;  4IM3 A;  1KFD A;  8ICQ A;  2FUG 1;  3N1X C;  4JQW C;  1XWL A;  8ICN A;  1JQ4 A;  2XH4 A;  3ZGZ A;  1XHC A;  4W9C A;  1J7B A;  2GGI A;  5FXE A;  1WYG A;  4ECW A;  1LO5 D;  3QEA Z;  2MP2 A;  4K4H A;  1TE6 A;  4F4W A;  2M0N A;  1ZD5 A;  3NXL A;  3CW2 C;  1KSP A;  3CXB A;  2PXI A;  2HZG A;  2KVS A;  3WCQ A;  1JI7 A;  4DFP A;  3NVZ A;  5J0Y A;  1KF6 B;  1KTK A;  3QPE A;  1WXV A;  3ETR B;  1TS2 A;  3UQA A;  5TIS U;  4ECZ A;  2PI4 A;  5B66 U;  5J2I A;  4KLU A;  2Z0D B;  2MBO A;  4DHJ D;  3H0M B;  4DFK A;  1ZXI C;  5JZE B;  1KBU A;  2HHW A;  1MVK A;  1TBE A;  3A9J A;  7ICG A;  4F71 A;  2YVC A;  1NDD A;  4ZRI A;  4TKN A;  3HVD A;  3N6J A;  5EWE A;  5CWR A;  1KN5 A;  3DEE A;  3F53 A;  1X9W A;  2OZT A;  1GAQ B;  1PFD A;  3IT4 B;  1EBG A;  1FEC A;  4K7W A;  3TEZ A;  3ALR A;  3SSZ A;  3SQI A;  2NS5 A;  1JN3 A;  2HTH A;  3SN1 A;  1JUD A;  2V3P A;  2E1E A;  4JGH B;  2KTR A;  2D3A A;  5FXD A;  3APC A;  3P4Q B;  1WX8 A;  1ELS A;  2V1Y A;  2VA3 A;  3DG7 A;  2P4P A;  4DQP A;  7ICF A;  1XLP A;  4IW0 A;  2N9P C;  3CST A;  3GP7 A;  2J3N A;  1S10 A;  2E5A A;  2ZW0 A;  4UAZ A;  3OHA A;  2LJI A;  3SN0 A;  5DLG A;  3GE8 C;  3K75 D;  1NZP A;  2K6Q A;  2QEJ C;  7ICK A;  1QOG A;  2ZZC A;  3D9X A;  4O3M A;  1ZOY B;  4GXJ A;  4EBD A;  2JPH A;  3QC8 B;  5AIA A;  2KQ7 A;  2WPE A;  1Q10 A;  2IO0 B;  3BOX A;  2WXM A;  2E3T A;  3D2N A;  3ZDE A;  3R11 A;  5FJT A;  4H50 A;  2C7M B;  2IND C;  4OW0 A;  2PP1 A;  5DB8 A;  2W43 A;  3B0Y A;  4Y2X A;  1K5O A;  5J17 A;  1J7A A;  5ALZ A;  3RI7 C;  1K52 A;  3KUC B;  3R9K A;  1UGJ A;  5DCN A;  3AMZ A;  1FRR A;  3UXO A;  4JWM A;  3T8Q A;  2L32 A;  4RCO A;  1Q0W B;  2HOF A;  3OSP A;  3QYP A;  9ICU A;  1DXL A;  1EU4 A;  1URJ A;  1SE3 A;  4JPS A;  3ZTC A;  2R8D A;  3Q3F A;  1DIQ A;  2AL2 A;  2B3A A;  3CYM A;  2R61 A;  3CIR B;  5T14 A;  5ALY A;  5I4D A;  4B9T A;  4HDO A;  1ZUD 2;  3V72 A;  4UAR A;  5C1Z A;  2K8B B;  2XI9 A;  1YJ1 A;  3GOE A;  2POD A;  1VLB A;  2OYY A;  1N48 A;  3G6Y A;  4J3O D;  3IRU A;  1TTN A;  2FE8 A;  4QZ9 A;  2HVI A;  5G5G A;  2AGQ A;  3RJ8 A;  1YNT E;  5ER0 A;  4UB4 A;  3AEV A;  2V9W A;  1UBI A;  4ECR A;  5AI9 A;  4MSQ B;  4Y2P A;  2JVC A;  3L08 A;  1DK2 A;  3CGB A;  4F8R A;  3DEQ A;  4LJX A;  2R8H A;  2OQH A;  4H4W A;  5G5H B;  1GNU A;  2QB1 A;  2ZIV A;  3EUB 2;  2D6F C;  5KAI U;  4ECQ A;  5EE0 A;  5J2E A;  3LWL A;  3THV A;  5KFA A;  4JLC A;  4F5O A;  1A6S A;  2EQ9 A;  3P0W A;  1X6I A;  3CP8 A;  4YXJ A;  2KC1 A;  3NVY B;  2BGF A;  3DVN U;  3L17 A;  3QA8 A;  3ES7 A;  1SV0 A;  2R2O A;  1P48 A;  2JXJ A;  2G5H B;  1BXT A;  1X9X A;  2PTX A;  5C0Y A;  2HQM A;  1E6E B;  2WWZ A;  3PZP A;  4K3B A;  4XLO A;  4WJ3 B;  4EZ6 A;  4DL4 A;  8ICM A;  1GUA B;  1MG8 A;  1KQQ A;  2F3N A;  3HIZ A;  2IO2 B;  1WXM A;  1SZH A;  3DQV A;  1SJA A;  2KXJ A;  3SV4 A;  2FAZ A;  4IOI E;  1JRU A;  7ICH A;  4F2S A;  3KH0 A;  1RAX A;  3LDA A;  2ZG6 A;  2KTQ A;  3NRW A;  3NY5 A;  8ICJ A;  5TR5 A;  2ZJ8 A;  1YMH E;  2K4E A;  4HCD A;  9ICA A;  2LVO A;  2GQT A;  5CEH A;  3MGH A;  3AQF A;  2C28 A;  2ZZ0 A;  1EO6 A;  2LM1 A;  2LMR A;  3QUT A;  2KVC A;  2N0S B;  4UAU A;  1DOQ A;  3SD5 A;  4MDK E;  1NK4 A;  2W8K A;  1JPD X;  1ZQA A;  3RRA A;  4I2F A;  2Z0E B;  2JQR B;  3N6H A;  2XY6 A;  2CDU A;  2BR0 A;  1TV9 A;  3RAX A;  1WMH B;  4OVZ A;  4KLD A;  4EKU A;  2C2R A;  3AEC B;  4C00 A;  1L7M A;  4YTM B;  4GDK B;  3JPT A;  1GC6 A;  2W7O A;  4BAX A;  2KTF A;  1ESF A;  2KOB A;  4ED3 A;  3BQT A;  1GRT A;  3PR5 B;  4RNO A;  3UXP A;  2O56 A;  4FZL A;  3CWI A;  4YR0 A;  4GXK A;  3VCB A;  4J9O A;  1SSN A;  4P0Q B;  1L0Y B;  4KVG B;  4LVS A;  3QU9 A;  1A77 A;  1V59 A;  3QTP A;  4ZA0 A;  2PPG A;  2CHZ A;  1VZ8 A;  3VR9 B;  1FM0 D;  4JB3 A;  5ALD A;  4GSW A;  1BPY A;  3IDW A;  1SWW A;  5BPC A;  2BBC A;  4PK1 A;  2PLS A;  2B76 B;  1XLN A;  4KIK B;  5DQG A;  4M6W B;  5KG7 A;  2FDR A;  3GU3 A;  3GV7 B;  4KLJ A;  1JWS D;  4E71 A;  3TWB A;  2Y9U A;  3IAS 1;  3E9S A;  2JEG A;  2BWE S;  3UGB B;  2ZW1 A;  2HTM E;  2WDT B;  1SJB A;  2P66 A;  1KN0 A;  3BZD B;  5HKH A;  4O9M A;  3PML A;  1OQQ A;  3CK5 A;  1CEZ A;  4MGZ E;  3V6E B;  4RGT A;  4G7F A;  4NY0 A;  5AM5 A;  4ACF A;  5KT3 A;  2MNR A;  5EOZ A;  4Q2J A;  4IRK A;  4M02 A;  2V3B A;  3CRX A;  1JIH A;  1WM3 A;  4UAT A;  2BCP A;  2P8B A;  5IO9 A;  8ICZ A;  4KLF A;  3RJK A;  3MR6 A;  3ED5 A;  4I2E A;  4B9S A;  3AM9 A;  3KLJ A;  4RT3 A;  1WG8 A;  4Q44 A;  2W8L A;  1P98 A;  3ZJU A;  1DNC A;  2YAU A;  3LLB A;  5CR0 A;  4P4M A;  4UAY A;  2CFY A;  5HG2 A;  2GLE A;  2G9H D;  3CSF A;  3PS6 A;  4HPL B;  1PDZ A;  4RGO S;  1J19 A;  3T5K A;  2AX5 A;  2QCZ A;  2P0I A;  8ICU A;  4K7Z A;  1SXD A;  4HCN B;  1RM6 C;  2V4R A;  1DZN A;  2YEP B;  4ZRP A;  2KHW B;  2QB0 B;  4LNI A;  4FP1 A;  4Z6C A;  3HUI A;  2SEB D;  2OPJ A;  2M1M A;  3BQ2 A;  2KWU B;  4ZOH B;  5J0S A;  4PHE A;  1KTQ A;  1D5M C;  3O13 A;  3UGV A;  1A70 A;  4ICU A;  4RF1 A;  1FHU A;  3D6J A;  2NBV B;  2XH0 A;  3AU2 A;  1U49 A;  3CGD A;  5KFV A;  7ICJ A;  1FNU A;  2HJ8 A;  2RDB C;  3RUI B;  1TYT A;  2L5Y A;  1UEL A;  3ZLZ A;  3AE9 B;  3U52 E;  4XYC A;  1GRE A;  2MBB B;  3ZVH A;  4EZL A;  3N4F A;  2PTY A;  2AL6 A;  2K3U A;  4YD2 A;  3V05 A;  2NPT A;  1D6E C;  2Y0S F;  3RBD A;  4ANU A;  3TOY A;  1K50 A;  3B9J A;  1KM7 A;  2HJ1 A;  2JHD A;  4H4Q A;  5KT4 A;  7ICO A;  2XVT A;  4R63 A;  3OHB A;  2WXK A;  2ZVN A;  1VJ5 A;  3DWM A;  4WWP A;  2J0J A;  3MTN B;  1XLO A;  3U26 A;  2PP3 A;  2G1E A;  1I19 A;  9ICW A;  2BDP A;  2JZZ A;  2EDU A;  4HAI A;  5HHH A;  1TKG A;  2MJD A;  2KMA A;  1EBH A;  1KRH A;  2KP7 A;  2KG5 A;  3E58 A;  2KVZ A;  1HTQ A;  2I1J A;  5FS9 A;  4DSI A;  2QMT A;  1E10 A;  2DQN B;  3PV1 A;  2F44 A;  2W55 A;  4O5C A;  5J2G A;  1ROE A;  4E5T A;  4GIR A;  4EBC A;  1SKW A;  1LKY A;  3AUO A;  2DYO A;  1XSL A;  5GXG B;  4GDK A;  2XEW A;  2H88 B;  4DO9 A;  4PJ0 U;  2MJ3 A;  3L8K A;  1HZ5 A;  4PYU A;  2IDY A;  3VXW A;  4EBE A;  1D8Y A;  1C20 A;  1SJE D;  2D3G A;  2CS4 A;  1DXS A;  4C4R A;  1RLF A;  4XGA B;  2M19 A;  4PT5 A;  3GD4 A;  1WXQ A;  4YL8 A;  1OTR B;  1V1O A;  2YY6 A;  4NJC A;  5J0P A;  4HG0 A;  3S2A A;  3W1S A;  2IYD B;  4Q43 A;  2VZK D;  3ISC A;  4QZG A;  2IY1 B;  1OGW A;  4F4Z A;  1ZQS A;  2KFK B;  4P4O A;  3QEB Z;  2N9X A;  2NBW B;  2R2Q A;  3AE6 B;  4IZG A;  3UJE A;  1JCT A;  4R3D A;  1I4Q A;  2BT6 A;  4A55 A;  3AH7 A;  4JE3 B;  2LYH A;  5K4L A;  4RPY A;  1SIF A;  2DNF A;  9ICK A;  1RYS A;  5LXH A;  4QW8 A;  4CF4 A;  2W7P A;  3NS1 B;  5HFY A;  8ICH A;  1Q5W B;  2JZB A;  3DVN V;  4OD0 A;  2JZP A;  2KJ9 A;  4JWN A;  4QWC A;  3GV5 B;  2J52 A;  3JPP A;  3RFA A;  1GRG A;  3TTE A;  2R8I A;  3ONN A;  1UBQ A;  4ED7 A;  1KKR A;  3LDZ E;  2M56 B;  1KD0 A;  3N1Z C;  3PHW B;  3Q8S B;  3JYU A;  4M9N A;  2IGD A;  4LK0 M;  1DII A;  1YEY A;  1XT9 B;  5L1K A;  2A8X A;  2QVH A;  4AJW A;  3UJF A;  1JWB D;  3WKB A;  4HDQ A;  3H8A A;  3AEF B;  4FS1 A;  3AU5 A;  3APD A;  4HYK A;  2M0A A;  2ZJD A;  5E6J A;  4FJV B;  4Y2S A;  5KFF A;  3VAW A;  3SR6 A;  1GJZ A;  2OVL A;  3FW9 A;  4EQX A;  1TK0 A;  2PJH A;  2BB6 A;  2AWT A;  1N62 A;  1FO4 A;  4Q8F A;  2J0K A;  4BWM A;  1TZZ A;  1V9P A;  4KLT A;  2K8C A;  2KQS A;  1NK8 A;  4YD1 A;  2IBI B;  3VTW A;  2YML A;  1SIJ A;  4YFK A;  4RUA A;  1TZO A;  4I2C A;  2DL0 A;  2MA9 B;  4ZCW A;  2X8G A;  1T8E A;  5DPW A;  3JVA A;  4JMU A;  1W1S A;  1ONE A;  1UF0 A;  2QKQ A;  1E90 A;  2GH1 A;  2CXY A;  4K7S A;  3N4E A;  1A0P A;  2GOL A;  4LZG A;  1JXE A;  3MUC A;  3WK7 A;  4M9H A;  8ICR A;  4PWB A;  4WQO B;  3M62 B;  4HNC A;  4NNJ B;  4I2I A;  1GG3 A;  3VH3 B;  4IT1 A;  3H8W A;  1NHQ A;  3VH4 B;  1E9M A;  3EJE B;  2KIV A;  3ML8 A;  3SDL C;  1S9F A;  3MAB A;  4FJZ A;  4XDD A;  3SMV A;  2RLT A;  1NK9 A;  1TFR A;  2NRT A;  4M47 A;  4ZRK A;  3GIL A;  4Y2T A;  1C78 A;  4KMO B;  4Y2U A;  3TIX A;  3UQ2 A;  1E8G A;  4JV1 A;  4C4T A;  1F0X A;  3H7I A;  3RNG C;  3LVW A;  4ZOH C;  5GTI U;  2PPH A;  4YXD B;  2INP E;  2WF9 A;  2I5Q A;  3A9K A;  3DBS A;  1SL0 A;  5C5J A;  2P88 A;  3QUB A;  1SBB B;  3PY8 A;  5DPT A;  3P4R B;  3U8Z A;  1RQN A;  4IL0 A;  3FW7 A;  2VJ5 A;  3DIP A;  5AKX A;  1WXS A;  3A7U A;  5KG4 A;  1U45 A;  2IHM A;  3Q3O C;  4PS8 A;  3R8B A;  3PFR A;  5KVH A;  2EZY A;  2VA8 A;  5JCL A;  4UB1 A;  1BPD A;  2G5I B;  2ZEQ A;  3DGH A;  1NJX A;  2F8K A;  3PSE B;  2QB0 A;  2PE6 B;  4PVH A;  1DRG A;  3ZRF A;  2WB1 C;  2BCS A;  4FN2 A;  3MDA A;  2KJH B;  3MY9 A;  4E74 A;  5FXF A;  3A9K B;  2XH7 A;  5ALE A;  3CYJ A;  2IA6 A;  1YD8 U;  4BGD A;  4MEL A;  4FDC B;  5KFY A;  5FJR A;  4C4S A;  4TUQ A;  1T0S C;  2KZM A;  1MC8 A;  1V1P B;  1V81 A;  1YT3 A;  1ZQO A;  3EZ5 A;  7ICT A;  3BS5 A;  2Z7J A;  3TQ1 A;  1RRB A;  1ZQU A;  3ZD8 A;  3KKA C;  1TE2 A;  4OJ6 A;  4H83 A;  5KFC A;  3VRA B;  3V5F A;  2UU7 A;  1S0O A;  5AEK B;  1NHP A;  3H8M A;  3GRS A;  2DUY A;  1SKS A;  2WU5 B;  2IJ0 A;  1CQV A;  2WDV B;  3L16 A;  5H92 C;  4PGY A;  2OOB B;  2MEK A;  1L4Z B;  1YZ7 A;  1YJI A;  3V7L A;  5HR7 A;  3IJI A;  4DL2 A;  3PK7 A;  1L7O A;  3KUD B;  1LM8 B;  4F5Q A;  1WE7 A;  2X50 A;  2GR3 A;  3PST A;  3UF8 A;  3PW0 A;  2BVG A;  4HPN A;  4FE3 A;  3AE1 B;  4ED0 A;  2RDG A;  2Y5C A;  4URK A;  1N62 C;  2WOV A;  3TBL D;  4R65 A;  2WOI A;  3PM9 A;  1RWS A;  2KAN A;  3P4P B;  3OC4 A;  3L5K A;  4TUP A;  3UCD A;  1NVI D;  3KWV A;  3J81 j;  3LK9 A;  1FCL A;  3PW4 A;  2REX A;  2JX5 A;  4O0I A;  1ZE3 D;  2KN4 A;  3Q69 A;  2L3Z A;  1LKY B;  2KFJ A;  3N32 A;  4TMA B;  4UB6 U;  2YVF A;  3NG0 A;  2VFS A;  4J03 A;  4C7Y A;  3MR3 A;  2LHT A;  1L7N A;  4NAM A;  1MDL A;  3WKD A;  4Y2Y A;  2Q5W D;  1PGX A;  4GLX A;  1B0X A;  2WXP A;  1OXJ A;  3N7R C;  1ZQF A;  4M0A A;  2KJ5 A;  3AEE B;  3AEA B;  2HOQ A;  4JL9 A;  2Y08 A;  4IWQ A;  2HD5 B;  2WXH A;  1NI3 A;  2VAO A;  1SV0 C;  4ECS A;  3MDC A;  5TR3 A;  2OG9 A;  2LRW A;  5AIC A;  3DBH B;  5AKI A;  1Z00 B;  9ICM A;  1PDY A;  4E4U A;  3QAR A;  1WI0 A;  4DL5 A;  2JY6 A;  3ZXV A;  1FFU C;  2LYB A;  1H4R A;  4DNS A;  1DK3 A;  1M6I A;  4PWC A;  1ZX9 A;  4P4P A;  2GBM A;  4O95 A;  3DK9 A;  3K4G A;  4O5K A;  5CP2 A;  4GGH A;  3KVF B;  3K1Z A;  3PW7 A;  4L1B A;  1NEN B;  5AZH A;  2I2Y A;  3SQS A;  3PRZ A;  1NNL A;  4YG2 A;  2JRZ A;  2RDJ A;  1VCB A;  3NRZ A;  3SFE B;  5C3J B;  1WR1 A;  3C1Y A;  3R07 C;  1MG4 A;  3RJI A;  3U4F A;  5AZG A;  2W0H A;  2H3Z A;  3GFK B;  4FLH A;  3HSU A;  4XRH A;  3TUO A;  4XX5 A;  2Y1J A;  4AJY B;  3H7V A;  2ZCB A;  2NO5 A;  2ONE A;  4RFB A;  4F92 B;  2ZIW A;  4BFR A;  1WFY A;  3T5L A;  4WJO A;  4IS7 A;  3SAF A;  2EEL A;  2WX1 A;  4QZF A;  3Q8Q B;  3TAQ A;  1WMH A;  5JCK A;  3PT2 B;  3PWG A;  3M63 B;  1NK6 A;  3QXG A;  2AQ2 B;  2GRT A;  3SQP A;  4PZF A;  2EQY A;  1S3S G;  1R6W A;  4A3P A;  3DWG C;  1NKE A;  1MQ3 A;  3V60 A;  3C29 A;  1MUC A;  1E8Z A;  2HBJ A;  2BQ3 A;  3ES8 A;  5ENL A;  1PQS A;  2V4L A;  2JGA A;  4BXO A;  7ICI A;  2GRI A;  4FHJ A;  5DGB A;  3Q8L A;  4IUM B;  3QFA A;  3AL0 B;  3RJA A;  2AXT U;  5KFB A;  2RPQ A;  4MT5 A;  2B6G A;  4RQ2 A;  1M94 A;  3RAQ A;  5AI0 A;  3OG5 A;  1MBT A;  2JZ3 B;  4B9N A;  1F0Z A;  1D7Y A;  1WWU A;  2RP5 A;  3MJ5 A;  5CTR C;  1K1S A;  4KKI A;  4NL9 A;  1QOA A;  3ONS A;  3W9C B;  2AHO B;  4RNA A;  4DN1 A;  2TPR A;  3OZY A;  5D2M B;  2VFU A;  2XK5 B;  4ECV A;  4IRD A;  4P6V F;  4QZH A;  4X5V A;  1OW5 A;  1WIA A;  3H8H A;  4DHZ E;  1TS5 A;  3VTV A;  3SU8 X;  2C2E A;  4NLK A;  4N9F 4;  4YWG G;  5TSS A;  2MP2 B;  2HHU A;  2LYA A;  3UM9 A;  2ZXI A;  1FXA A;  4DOA A;  3RB6 A;  2PFP A;  9ICJ A;  5CA7 A;  5AE3 A;  2KWV B;  1FD6 A;  2OLA A;  4HCL A;  5ALR A;  2C7H A;  2A1J B;  3WAL A;  1FFV A;  4F91 B;  2DHZ A;  4AOF A;  4DOB A;  3R0U A;  1C4C A;  3VUW A;  3FV9 A;  3ZO5 B;  1X42 A;  3HKZ C;  3GDX A;  3U2S C;  4A35 A;  1WJ4 A;  2WOW A;  3JPQ A;  4M00 A;  1F0M A;  3ZJT A;  2NO4 A;  1SL2 A;  2WU2 B;  3MQT A;  2JXT A;  2QAE A;  3F2D A;  2JYT A;  2XNA C;  4H4V A;  2XY7 A;  4GXB A;  2FBW B;  4IM0 A;  3V6H A;  5ALH A;  3EKG A;  1U4B A;  5CB1 A;  4B6J A;  1J2N A;  2YMM A;  4WWN A;  3BYY B;  5E6N A;  2D3B A;  3P1M A;  4QZA A;  4F1S A;  1VDV A;  5ALK A;  1UUP A;  3E56 A;  3MHZ A;  4OJO A;  3EPI A;  5FJU A;  1Q46 A;  2BQR A;  1TGZ B;  1AN8 A;  3RZW C;  4M9L A;  3ENL A;  2O2V B;  4B95 A;  3TEW A;  2F1I A;  1CK1 A;  1XPY A;  3ZVH B;  3OPX A;  3NJT A;  9ICR A;  4F2R A;  3WAN A;  1PVP A;  4KLM A;  2H3F A;  2EZZ A;  1H38 A;  1FNV A;  2OED A;  5DDY A;  3KQ4 A;  1B22 A;  7ICM A;  1V1P A;  3B9J B;  3GY1 A;  4A90 A;  4YMO A;  3DVG X;  2N9K A;  2VJ4 A;  1L6U A;  4NLN A;  4IQT A;  1COK A;  2NRX A;  1T0Y A;  4TQR A;  4GIV A;  4BKS D;  3Q8R B;  3PRE A;  2OCE A;  2HXT A;  3RTV A;  7ENL A;  3IBE A;  3L5O A;  3HPF A;  4YSY B;  4GIS A;  4AS1 A;  5JRT A;  4I29 A;  5H8Y E;  3P63 A;  2EAM A;  4WWM A;  2BVF A;  4LNF A;  4S0R A;  5L1M A;  9ICP A;  3R7Q A;  2GGJ A;  5DG9 A;  1LGR A;  4UBC A;  5EDS A;  2ZTD A;  3HW8 A;  3PQB A;  2QJJ A;  1ZW7 A;  2CU3 A;  4TQ1 A;  3AXC A;  3VVW B;  1DGS A;  5DB7 A;  5LXI B;  1ZET A;  2LRU A;  4US9 A;  1L2N A;  4PHD A;  2KDB A;  2G09 A;  4NAW B;  2C3D A;  1KL9 A;  2BHN A;  3RJH A;  1KEJ A;  1KW4 A;  5KT7 A;  1ZDV A;  3ZVI A;  3D46 A;  4F4K A;  1QLN A;  2AKZ A;  1OEY J;  4I2D A;  4KZ0 A;  2EZX A;  4J9M A;  3RH5 A;  3R2I A;  3ZLF A;  2WF5 A;  1YQZ A;  2AQ0 A;  4DS4 A;  1X1M A;  1S7M A;  3VC6 A;  2WHE A;  2GQW A;  5JUM A;  3CNH A;  1SEB D;  3A1Q B;  2LBO A;  2G0A A;  3SYZ A;  3UMC A;  2NTS A;  1JRO A;  4PS3 A;  3S1C A;  3ZRC A;  3SN4 A;  4H4X A;  1MN8 A;  4RQN A;  2I6X A;  1S76 D;  2ZIX A;  4GR1 A;  2BVH A;  1RYU A;  4GC7 A;  4DQI A;  1TYP A;  2GLS A;  3OJU A;  4GU2 A;  4O1N A;  7ICS A;  4NAW A;  4NQL B;  4YR3 A;  1EC7 A;  3DHH C;  2QKN A;  4MSM B;  2MUT B;  5DKW A;  5L6F A;  2PVO D;  4DL7 A;  2LD9 A;  4Y2Q A;  2HHV A;  1WJU A;  2LVP A;  3B1L X;  4I2A A;  3I28 A;  5HHI A;  8ICA A;  3T9L A;  1BUI C;  3GV8 B;  2SAK A;  1QOB A;  3ZIM A;  4K1W A;  1GER A;  1GXF A;  4DNA A;  2I1Q A;  5KFL A;  4BX9 C;  7ICV A;  2PU0 A;  2LGS A;  2MLB A;  3NZU A;  2KOX A;  2YVS A;  2F2A B;  1C79 A;  5KFO A;  1IPG A;  1C76 A;  5KFU A;  2QJN A;  4HKQ A;  3WKA A;  1RVK A;  3RCY A;  4CE6 A;  4LLG M;  4AP4 C;  3C19 A;  4HJG E;  2E5S A;  3AU6 A;  5KFZ A;  2PFQ A;  5J2B A;  1KOT A;  4M6U A;  5H2F U;  1IXR A;  2IZV B;  2LHD A;  2RPV A;  5JHB A;  2FLP A;  1SE9 A;  2WF8 A;  4YMM A;  2GOW A;  3VCN A;  2JT4 B;  4LTU A;  3HM3 A;  2CRX A;  1D9D A;  1BNO A;  3TJP A;  2XGP A;  2PIA A;  3BIN A;  3DG3 A;  1UHU A;  1RFK A;  2XID A;  3RNB C;  3D2J A;  4J56 A;  2KV2 A;  2HI0 A;  3CF6 E;  4KMU A;  2L83 A;  4DFM A;  4JQ9 A;  1VRA B;  3NVZ B;  2R8J A;  2XC9 A;  2QC8 A;  4NJ8 A;  2PTL A;  3KKA A;  2BDU A;  1FEZ A;  2YB1 A;  2YMQ A;  3AV8 A;  3QZ7 A;  1YN3 A;  3ZNH B;  1VAO A;  5CRX A;  1BPB A;  1NKC A;  2BS2 B;  2KEY A;  3UI3 A;  3IJQ A;  3H0R B;  4A8E A;  1RPL A;  2J0M A;  5L1L A;  8ICP A;  8ICK A;  2WXL A;  1YZ6 A;  4J9Q A;  1H6V A;  2LGX A;  3RNA C;  2K89 A;  2F1H A;  3M95 A;  4A20 A;  4BZA A;  1YN5 A;  1FFV C;  3NVV B;  1WGG A;  5F3X B;  1WM2 A;  4J9N A;  4FJY A;  2ODG A;  2W9C A;  2BPS A;  4EEK A;  1UQV A;  4OJL A;  5IAA C;  1HQR D;  3H6N A;  1OEY A;  1JWA D;  2OHF A;  2RQ5 A;  5AM2 A;  4GXI A;  1E7U A;  2EMS A;  3OWE B;  3PLU A;  2AL2 B;  4G8T A;  5KG2 A;  3SAG A;  4ENL A;  5KG1 A;  2IBK A;  3R3M A;  3MFH A;  2JWZ A;  2OZ3 A;  1Z1B A;  4EQS A;  4J9P A;  1BT0 A;  1E7P B;  2KD0 A;  4C8O A;  2KZ3 A;  2ZUB A;  3BJS A;  2KZR A;  3ML9 A;  3X23 A;  3RJG A;  1YQ3 B;  2CJO A;  2KDM A;  1MA7 A;  1W1L A;  4WAA A;  2BYE A;  1F9C A;  4H2H A;  4NXZ A;  2EQ8 A;  5ALI A;  1FXT B;  2JF5 A;  5G5G B;  2PVG C;  5AM0 A;  4GIB A;  4O3N A;  3PVX A;  3AU4 A;  3UIN B;  3HIL A;  4KX6 B;  1ZDL A;  5FMH A;  3W1S C;  2HBM A;  2W9M A;  3K9O B;  1AW7 A;  5J2H A;  1TK8 A;  2PMQ A;  1X6J A;  3CGE A;  2GB1 A;  2ONQ A;  3IJL A;  3UQB A;  3AE3 B;  4JV2 A;  2VH1 A;  3OTQ A;  5IIO A;  3ZD9 A;  2GO7 A;  2KKP A;  5HR6 A;  1W1Q A;  2AL3 A;  2GBR A;  9ICS A;  1VZ7 A;  3DBL I;  4KLS A;  1AWD A;  3T3F A;  5BYQ A;  3RFZ B;  3DV9 A;  1NJY A;  1AHV A;  2IOH A;  3QWZ B;  4ZRJ A;  1FNW A;  4L2Y A;  2BVC A;  4KIT B;  3IN5 A;  3SZ2 A;  1ACC A;  2MW5 A;  2D11 A;  3TEY A;  1EC9 A;  4I28 A;  1SXT A;  3OLM D;  2CHX A;  2X38 A;  2A5U A;  5HMM A;  4HNL A;  1L3S A;  3KUZ A;  2YVG A;  4CRX A;  2ZPY A;  1WX7 A;  4KKJ A;  3OPS A;  3GIJ A;  1HZ6 A;  2KYW A;  3IAM 1;  1K4Q A;  2GR0 A;  2J53 A;  4USA A;  5KHQ A;  4A9A A;  5GRT A;  3LB8 C;  1IP9 A;  4NLG A;  4YWO A;  4B6W A;  4G0N B;  4YSX B;  2BPC A;  2DAF A;  1AHZ A;  2HW3 A;  4BBN F;  5ALN A;  2ESE A;  3IVF A;  1Q3V A;  5AKE A;  5KG0 A;  2DZJ A;  4RPX A;  1DOI A;  2D8C A;  4PGX A;  1T3Q A;  4JUZ A;  3IV6 A;  5DBA A;  4ED6 A;  1NU5 A;  1DGJ A;  5J2K A;  3MGI A;  4Z17 A;  4DSF A;  1T3N A;  5D3D A;  2KIW A;  2K8B A;  1GV4 A;  4DDG D;  2KMC A;  2KKV A;  1V5T A;  3WK6 A;  2YLM A;  2LFI A;  3H7P A;  2MRP A;  4J9S A;  2QJM A;  2JRI B;  1STZ A;  3GIM A;  4MFF A;  4DLE A;  1L8L A;  3HWT A;  1MI0 A;  1XEE A;  1S8O A;  2E8N A;  2OQY A;  1WH3 A;  3RRG A;  3FAH A;  1Y56 A;  1RQL A;  2KQ4 X;  1X40 A;  3B2G A;  4NJ7 A;  1GB4 A;  4H4S A;  2WTF A;  5BOM A;  2O6V A;  1QIL A;  2XK5 A;  3KOO A;  3DDH A;  4DFJ A;  1V5O A;  2R18 A;  2LGI A;  2Y5P A;  4MGI E;  4FFD A;  3QQ8 B;  3EHV A;  4LA1 A;  5L9X A;  3SHQ A;  3NTU A;  3DDM A;  3G6V A;  1P1A A;  3PZD A;  3EEZ A;  1TKE A;  3A1Q A;  4ANX A;  1PZN A;  3EFU A;  4FO6 A;  3GZF A;  1ET9 A;  1ZD2 P;  5IIM A;  4JV0 A;  1KFY B;  1TYG B;  1QQ5 A;  1XO0 A;  3Q6B A;  2GR2 A;  3H8S A;  5KL1 B;  2VH2 A;  2J42 A;  1I4G A;  3QE9 Y;  1Y8R C;  4EM3 A;  1JWM D;  3RF9 A;  4APN A;  4MJS A;  2LXA A;  4JAY A;  3AQE A;  3W2D A;  2PFN A;  2A1A A;  5E79 U;  1AAR A;  3JPR A;  2DZM A;  1QSS A;  3P42 A;  4C4V A;  2LAS A;  2VFR A;  5JHA A;  3KBB A;  2KDI A;  4ZH4 A;  2PS2 A;  5GMV A;  3CB3 A;  1QCK A;  5KFS A;  4PVE A;  2IOF K;  5J2D A;  3ZKJ C;  4DFD A;  1N5X A;  2EXR A;  2EAP A;  4W9D A;  4P0P B;  3ZDB A;  2UVV A;  2AYO B;  3VRB B;  3GO2 A;  1WGH A;  2EMT A;  3MP9 A;  4KTQ A;  2RSU A;  5EWG A;  3BVM A;  3GZN I;  1QF6 A;  4IC7 B;  1WY8 A;  2EQ7 A;  2LVQ A;  1H2I A;  1P7D A;  4HCP B;  1KDH A;  4PS7 A;  1TJE A;  3Q8P B;  2AH5 A;  1WVE A;  1A76 A;  4C56 C;  2QPM A;  3E2E A;  2KZZ A;  4CQN A;  3QU5 A;  2UVW A;  3DBR B;  1D9F A;  1JCK B;  3ZTD A;  1IV8 A;  4PL2 A;  1TZ1 A;  2KHV A;  3PW2 A;  4B9U A;  4RM8 A;  1C77 A;  2KX0 A;  3QLD A;  4F5N A;  3OJ4 B;  1NJZ A;  4LNO A;  4XQ8 A;  3VA8 A;  3RGT A;  1ZQV A;  1S1Q B;  3ZW3 A;  5CX3 A;  2KMD A;  4CDG A;  3RB3 A;  4K8G A;  2FPK A;  3MFG A;  3VFC A;  1JXL A;  1E8X A;  5JU5 A;  5FK9 C;  4K81 A;  3LB8 A;  4FS2 A;  3MC8 A;  3WAP A;  4MEX A;  1MJD A;  5JCI A;  4M6W A;  3EW9 A;  4P16 A;  2I5H A;  5D4B A;  1P7E A;  5AK5 A;  1XNS A;  1C3T A;  1MBB A;  4LII A;  3M8R A;  3T6C A;  2WDW A;  1FXI A;  8ICB A;  3KW5 B;  2KVR A;  1B9R A;  4DXF A;  1Z2M A;  4A6Q A;  1RG6 A;  1JEH A;  3D2H A;  2DZI A;  2OH2 A;  5DBB A;  3DJG X;  3NHE B;  2ZJ5 A;  1S0M A;  2INC C;  1ZQT A;  4DWD A;  1ZQG A;  1Z3E B;  4C7Z A;  2PMZ F;  4UD8 A;  4I27 A;  2OX4 A;  2YVJ A;  4O3P A;  5TZV A;  9ICQ A;  5HML A;  9ICO A;  2BWF A;  2LGD A;  3A0H U;  2V4Q A;  4OZB A;  4WUR A;  2ZIX B;  5IIK A;  2DLB A;  4MMW A;  4IG7 B;  1BVS A;  3QNM A;  5EE3 A;  5III A;  3URY A;  3T5J A;  3H70 A;  3KZX A;  5AKG A;  4TUR A;  3JZU A;  3BII D;  2MX2 A;  3ECI A;  1TS4 A;  4ELU A;  2OXO A;  1X2G A;  2VKQ A;  2O6V B;  3EGR A;  3ISD A;  3D32 A;  2XN9 C;  2E1F A;  2ALZ A;  8ICV A;  4W9L A;  3ISB A;  1QLT A;  3U7Z A;  3IG3 A;  1L7Y A;  1F8W A;  2HDO A;  4ELV A;  4ICV A;  4RGM A;  4W9I A;  1MOK A;  1E7V A;  1DYQ A;  2FCQ A;  5DB6 A;  4ZYN A;  1YOV B;  2PI5 A;  4FBT A;  4WJQ A;  4N58 A;  3SAH A;  2GWS A;  1XU4 A;  3BW7 A;  4DLG A;  3QAQ A;  2LPE A;  3EWA A;  4ECU A;  2EKI A;  3SR6 B;  2ZAD A;  3A7R A;  4J57 A;  2HHX A;  4D2K A;  5DG8 A;  3MHS D;  2DX5 B;  1ZQZ A;  3M9M B;  2YEP F;  2LXC A;  3FJ4 A;  4GMV A;  4RUC A;  3M1Y A;  1I4R A;  4RQM A;  2KNJ A;  3UXN A;  4DSE A;  4B0M A;  5DBC A;  3H4B A;  5AUK A;  3K1G A;  2WP6 A;  4M52 A;  1V8C A;  1SB3 C;  2W9B B;  1IGC A;  1NK0 A;  4F4Y A;  5J0R A;  3PZ8 A;  1WCN A;  3C2K A;  4EC3 A;  3MSY A;  1SGH A;  5IP4 D;  2AQ3 B;  7ICQ A;  3Q3N C;  3FM9 A;  3R25 A;  2JEI A;  1JW9 D;  4N6E B;  3ORY A;  3RJJ A;  2K1F A;  4ARC A;  3VUY A;  3RNM A;  1UT5 A;  4Z6D A;  5HP4 A;  2QDF A;  1QQ6 A;  1CJE A;  1NI2 A;  2OZ8 A;  1T7P A;  5KG6 A;  2LJ5 A;  3QK0 A;  4DXG A;  2W04 A;  4I6P A;  4EOY A;  3FYY A;  3GRT A;  3D2S A;  3S6J A;  2WQY B;  4EE2 A;  2F76 X;  2O6V D;  4ARI A;  3TAP A;  4NEV A;  4QZC A;  4QAY A;  1ONF A;  3I6T A;  2KN7 A;  1SWV A;  2ZPN A;  1UH6 A;  2L8J A;  2OFJ A;  4QWE A;  5BO4 B;  2AGO A;  1ZQY A;  1ZQP A;  1F2R C;  2NRV A;  3NVV A;  4EEL A;  3T3N A;  3UPQ A;  2WPF A;  4KZC A;  2RK5 A;  4II2 B;  2LUE A;  3RB0 A;  3C23 A;  9ICH A;  2K9X A;  2BC1 A;  4BKT A;  2WXG A;  4CO7 A;  2B0C A;  2YQU A;  2YTU A;  4KDI C;  5KNI A;  1WWV A;  2K22 A;  3VUX A;  3JVZ X;  4NWI A;  4IQV A;  4Z6E A;  1RFA A;  4EYI B;  2RD0 A;  3NGD A;  1RXW A;  4J6I A;  5BMG A;  3VTE A;  5D94 A;  3NO1 A;  4TVY A;  2K8H A;  4EMW A;  1KRP A;  2K4H A;  3OJS A;  2X8X X;  3JW7 A;  1XCT L;  1R4N I;  2JSV X;  1WUE A;  2KO3 A;  2OO6 A;  2H3Q A;  2WXJ A;  3VDG A;  1NK7 A;  1UWM A;  5KAF U;  1EXN A;  4BDP A;  4G11 A;  4GDL B;  4CGZ A;  2L7R A;  4C8M A;  3C21 A;  4MFC A;  3ZYY X;  2I38 A;  2L1A A;  2TSS A;  1NOM A;  2W9A A;  3B97 A;  1PUZ A;  1S0N A;  1MHH E;  3N7P D;  3RO6 A;  2E8O A;  2LUM A;  5ALP A;  3HPO A;  1BML C;  3O65 B;  2C22 A;  4C8K A;  4KX5 A;  3U30 A;  4OZC A;  3FC4 A;  2V3N A;  3HT3 A;  2NRZ A;  3AE4 B;  3K1R B;  3Q8K A;  4A3O A;  4XE0 A;  5J18 A;  2I1K A;  3LJ3 A;  1V49 A;  2VFV A;  5DPS A;  4BBY A;  1JDF A;  4TVW A;  3V7J A;  4RMA A;  2Y4G A;  2QJL A;  4GGQ A;  4Q45 A;  9ICG A;  5DPR A;  2QDD A;  5FJP A;  1V86 A;  2K4I A;  1ZQB A;  3D2D A;  2GDQ A;  2WPC A;  2JV3 A;  1K53 A;  1QLB B;  2NTT A;  2PE9 A;  3PRM B;  1I42 A;  3H8J A;  2VRR B;  4HEA 1;  2V9H A;  3A4R A;  2ZNV B;  1UPH A;  5AI5 A;  8ICY A;  3VDZ A;  1J2M A;  1RYJ A;  3EC8 A;  4GB9 A;  4EM4 A;  3FIL B;  3EJD B;  3NVW B;  2WS3 B;  4DDI D;  2PW9 A;  5J2F A;  2G08 A;  4OJ5 A;  3GC2 A;  2G06 A;  4HLE A;  2HHT A;  1UD7 A;  1ZQJ A;  1HSK A;  3RH6 A;  2ATL A;  1TVA A;  1WVF A;  3U4E G;  3ZI4 A;  5J0W A;  3GII A;  5AE1 A;  2BS3 B;  5I1V A;  2Q4T A;  4QZ8 A;  3KTQ A;  1PYW D;  4Z6F A;  3M8S A;  5ALG A;  9ICC A;  1ED1 A;  3B08 A;  4MH8 A;  3U7D A;  2C60 A;  4XUS A;  3CAW A;  1GES A;  5ALF A;  4J1O A;  2KFZ A;  3KFU F;  3ABV B;  1QT9 A;  4DHG A;  1RM6 B;  3RZF A;  2G07 A;  4QW9 A;  4PPX A;  2K25 A;  2ZNV C;  4W9H A;  3QU7 A;  2GGE A;  2WXR A;  4MAC A;  3DGZ A;  2ES6 A;  4FHK A;  2N1R A;  4DWF A;  2BYV E;  2HMX A;  2PU1 A;  1ZQC A;  1SZP A;  2FCM A;  1WJN A;  4OVU A;  1R4M I;  4G50 A;  5HNK A;  4PGQ A;  1U47 A;  3DFH A;  4B9M A;  1RDF A;  3NZS A;  2JYE A;  3H4D A;  3TAC B;  5KFR A;  3PZ7 A;  4HN8 A;  2KLG A;  1PK1 B;  1PGA A;  1OQY A;  4PVJ A;  2F77 X;  4MJS B;  4DEZ A;  4NQK E;  5HMR A;  2UYZ B;  3DOW A;  3WKC A;  4CYE A;  3IK4 A;  2OM6 A;  1NK5 A;  3BK2 A;  1OUQ A;  4QWD A;  2P6R A;  1QQR A;  4H1Z A;  2BPF A;  2JZB B;  2MRL A;  3TEX A;  1NPX A;  3PNC A;  4IHC A; 
#chains in the Genus database with same CATH homology
 1YMH E;  1SF0 A;  2K5P A;  3PQB A;  2CU3 A;  4TQ1 A;  1OFF A;  2GQT A;  1GOZ A;  4US9 A;  3LYY A;  2QSD A;  3V3X A;  1SE4 A;  1ZXI A;  4NAW B;  2PLP A;  4RF0 A;  2QIL A;  1TY2 A;  2N0S B;  1N61 C;  1MPE A;  1ZDV A;  2JQR B;  2HDE A;  3R2I A;  1FMA D;  4OVZ A;  4C80 A;  1PUT A;  2V0G A;  1SEB D;  3AEC B;  1F77 A;  2K0P A;  3S1C A;  2NTS A;  4YTM B;  1JRO A;  4TQ0 A;  4GDK B;  5EE1 A;  1HXY D;  4IOI E;  2JU6 X;  3BK1 A;  1XLQ A;  2BVH A;  1ESF A;  1D5Z C;  4O1N A;  5HHD G;  2DBY A;  3CWI A;  1FIQ B;  3C0P A;  3I99 A;  1SSN A;  5BMH A;  1L0Y B;  3C8Y A;  2QKN A;  5L6F A;  2PVO D;  2WXO A;  3Q8E A;  3VR9 B;  1VZ8 A;  1FM0 D;  2WDQ B;  3ZQ4 A;  2BTE A;  2O3G A;  1BUI C;  2SAK A;  2BBC A;  1QOB A;  4OZA A;  1T3Q C;  2E6X A;  2B76 B;  1XLN A;  2PLS A;  1JWS D;  1STE A;  1IBX A;  2L52 A;  4JWU C;  3IAS 1;  3E9S A;  2ZW1 A;  2HTM E;  2YVS A;  1C79 A;  5D3I B;  2NMQ A;  1XF5 L;  5JXV A;  3EUB 3;  1ZPS A;  3BZD B;  1C76 A;  5HHZ A;  1OQQ A;  4HKQ A;  4RGT A;  1JML A;  2IGH A;  4LLG M;  4HJG E;  3L4P A;  3TX1 A;  2LHD A;  3AN1 A;  2RPV A;  4Q2J A;  4XWW A;  1E0Y A;  1W1R A;  4OAL A;  1K51 A;  4LTU A;  5FR3 A;  2PIA A;  3SFD B;  1RFK A;  1QLU A;  3AM9 A;  3D2J A;  3ZJU A;  1GPX A;  3LLB A;  2H89 B;  4YSZ B;  3JS8 A;  2L83 A;  3NRZ B;  2WNM A;  5HG2 A;  2G9H D;  1UXY A;  1VRA B;  3NVZ B;  4RGO S;  2AX5 A;  2PTL A;  3AV8 A;  1YN3 A;  1RM6 C;  1DZN A;  1VAO A;  3AE5 B;  1SB3 B;  2YEP B;  4ZRP A;  1I4X A;  2BS2 B;  1SE2 A;  3UI3 A;  3HUI A;  2SEB D;  1CZP A;  5BYS A;  4ZOH B;  1D5M C;  3O13 A;  1A70 A;  2WXL A;  3AE7 B;  4RF1 A;  4JWS C;  2GQU A;  3NVV B;  1FNU A;  1FFV C;  1YN5 A;  4HRS A;  1XO3 A;  2W3S A;  1JWU D;  1XXG A;  3AE9 B;  2MH7 A;  3U52 E;  1HQR D;  1JWA D;  2OHF A;  1WSP A;  2V4I B;  3NVW A;  3FIL A;  3OWE B;  2K3U A;  4KGR A;  5EE9 A;  2Y3S A;  3V05 A;  1D6E C;  4BC7 A;  3Q8B A;  1K50 A;  4RGN A;  3B9J A;  1T6B X;  3BYT B;  2IPK D;  3FW8 A;  1E7P B;  2Z8L A;  2W54 A;  2KAC A;  1YQ3 B;  2CJO A;  2KDM A;  2WXK A;  1W1L A;  3DWM A;  1C4P A;  4YT0 B;  3W8W A;  2OAI A;  3LAE A;  1XCQ L;  3GSY A;  1C4A A;  1XLO A;  1L0X B;  2G1E A;  2Y3A A;  2PVG C;  1I19 A;  5G5G B;  3BVZ A;  1TKG A;  4KX6 B;  2MJD A;  3R2T A;  1AW7 A;  1KRH A;  1JRP A;  2GB1 A;  2ONQ A;  2WXQ A;  1NEK B;  2CJN A;  1SJH D;  3AE3 B;  5G5H A;  2QMT A;  3KLS X;  5D7G A;  4ZHP A;  1E10 A;  2W55 A;  4BCA A;  1ROE A;  1EWY C;  1W1Q A;  1W1K A;  1ET6 A;  1VZ7 A;  2DYO A;  2P13 A;  1AWD A;  5GXG B;  5BYQ A;  3RFZ B;  2KMM A;  2Q85 A;  4ML8 A;  2H88 B;  2MJ3 A;  1AHV A;  1HZ5 A;  1FNW A;  2IDY A;  4L2Y A;  2D5G A;  5AUI A;  1SJE D;  1ACC A;  1NYQ A;  4DQO C;  2M19 A;  4PT5 A;  3TEY A;  1WXQ A;  1SXT A;  1V1O A;  4NJC A;  4UDU C;  2X38 A;  4JX1 C;  4IKG A;  4HG0 A;  3W1S A;  4KKJ A;  2VFT A;  2VZK D;  3P4S B;  2R2Z A;  1HZ6 A;  2LMC A;  3AE8 B;  3AEG B;  3IAM 1;  2ACZ B;  3NVY A;  3Q8F A;  3TSS A;  1D4B A;  2J53 A;  4USA A;  3AE6 B;  3J9C A;  4N59 A;  4A9A A;  2I0K A;  3DED A;  3LB8 C;  3AB5 A;  3KWL A;  1FRD A;  4R3D A;  1I4Q A;  4YSX B;  2BT6 A;  2DWQ A;  4A55 A;  3AH7 A;  4JE3 B;  4KGS A;  1AHZ A;  3AED B;  1ZDX A;  3NS1 B;  2PLI A;  2BW2 A;  1DOI A;  4M0W A;  5HFY A;  1T3Q A;  3S1F A;  3ETR A;  2JZP A;  1DGJ A;  2ON8 A;  4PYT A;  2J52 A;  3BVG A;  3IT6 B;  1C9F A;  2ICI A;  2WXF A;  1F2R I;  5D3D A;  2VZK B;  1M4V A;  2M56 B;  2LFI A;  4ZYS A;  2IGD A;  4LK0 M;  1DII A;  1MI0 A;  1XEE A;  2BB5 A;  4REZ A;  1TKY A;  3FAH A;  1HA5 A;  1T5X D;  2WDR B;  1JWB D;  1Y56 A;  1GB4 A;  2KQ4 X;  2BYT A;  3B2G A;  3AEF B;  1ZR6 A;  2M0A A;  5AWV A;  1QIL A;  5E6J A;  3AEB B;  3SR6 A;  2LGI A;  2Y5P A;  3FW9 A;  1PDX A;  1KH0 A;  5AE2 A;  1N60 C;  2RDH A;  2BB6 A;  4WH4 A;  1N62 A;  1TKE A;  1FO4 A;  2P3H A;  1ET9 A;  1KFY B;  1KLG D;  1TYG B;  1DOX A;  1W1M A;  1WWT A;  3DQ0 A;  1SIJ A;  1TZO A;  2DYM A;  1AYF A;  2J42 A;  1I4G A;  1KLU D;  1JWM D;  4MM3 B;  1W1S A;  1EM7 A;  1FIQ A;  2GI9 A;  4JAY A;  1N60 A;  4L23 A;  3Q8C A;  1QKZ A;  1IUE A;  3W2D A;  2AQ1 B;  1MHX A;  3S1E A;  3P42 A;  1E8F A;  4PWB A;  2VFR A;  2Y3R A;  1FCC C;  2INN E;  2MBR A;  2JWU A;  4PVE A;  1W1J A;  2NQW A;  5LNK 1;  2EXR A;  1N5X A;  3ZJV A;  3LXF A;  1E9M A;  2Q4W A;  2W82 A;  3VRB B;  4XDD A;  3MP9 A;  3BVM A;  1QF6 A;  1JAL A;  5MPO A;  1HEZ E;  4BC9 A;  1VR9 A;  1C78 A;  2IGG A;  3NS1 A;  4RH6 A;  1TJE A;  5T8I A;  1P7F A;  1E8G A;  1WVE A;  4C56 C;  2QPM A;  1WRI A;  1F0X A;  4CQN A;  2J4X A;  4ZOH C;  1JCK B;  4YXD B;  1AHU A;  2PKO A;  2INP E;  5K8E A;  5BYR A;  4MLA A;  1C77 A;  3Q8A A;  1SBB B;  3N9Y C;  3P4R B;  3FW7 A;  3A7U A;  2PMV A;  1FEH A;  5HI1 A;  1J7C A;  1E0Z A;  3R8B A;  5FKA C;  2QIE B;  3MFG A;  3W5V B;  5FK9 C;  2UUU A;  4PVK A;  3W8X A;  3SEB A;  4PVH A;  3VQI A;  1B1Z A;  1ENF A;  3S1D A;  4P16 A;  1FFU A;  5FXF A;  1IBX B;  1UNS A;  1P7E A;  1MBB A;  1VJK A;  2MJE A;  2WXI A;  5FXP A;  4JB1 A;  2WDW A;  1FXI A;  1NYR A;  1V1P B;  1B9R A;  1TS3 A;  4DXF A;  4A6Q A;  3NUH B;  5C2T B;  3D2H A;  2WLB A;  2KAJ A;  3B2F A;  3VRA B;  1QOF A;  1N5W C;  3KJM A;  1TY0 A;  2IJ0 A;  1CQV A;  2WDV B;  2WU5 B;  5H92 C;  3A7A A;  1EU3 A;  2MEK A;  1L4Z B;  4C7Z A;  4UD8 A;  3W8Z A;  1YJI A;  4OZB A;  4WUR A;  3IXS A;  2DLB A;  3I9V 1;  3VR8 B;  5EE3 A;  2BVG A;  3HRD D;  1I4P A;  1L0V B;  3AE1 B;  3BWU D;  3URY A;  3T3O A;  2Y5C A;  2RDG A;  1N5W A;  1N62 C;  5I1W A;  3BII D;  1YJJ A;  1TS4 A;  3I57 A;  3PM9 A;  1X2G A;  1RWS A;  3P4P B;  3EGR A;  1L5P A;  1NVI D;  1OQR A;  1YN4 A;  3KWV A;  2XN9 C;  1FCL A;  1VQZ A;  1QLT A;  3POP A;  3U7Z A;  2JX5 A;  1I7H A;  1ZE3 D;  1ZXH A;  2KN4 A;  3NZ3 A;  3Q69 A;  4RGM A;  4TMA B;  2VFS A;  5HQX A;  1DYQ A;  4C7Y A;  4NAM A;  2Q5W D;  4ITK A;  1PGX A;  4YTN B;  2LHE A;  4KGT A;  2WXP A;  4N58 A;  3AEE B;  3EA6 A;  2Y08 A;  3AEA B;  2BS4 B;  3BW7 A;  4XWT A;  4GLS C;  2WXH A;  1NI3 A;  2VAO A;  1UWX A;  2EKI A;  3SR6 B;  3A7R A;  4A8X C;  4D2K A;  4AQ7 A;  1ZP0 B;  1DOY A;  2KWD A;  2YEP F;  4WQM A;  1FFU C;  4DNS A;  2FUG 1;  4PWC A;  1I4R A;  2N9L A;  4FXC A;  4B0M A;  1JQ4 A;  5AUK A;  3ZGZ A;  1GB1 A;  4O95 A;  1J7B A;  5BMI A;  1V8C A;  2RMM A;  1WYG A;  1SB3 C;  1IGC A;  1LO5 D;  2WP9 B;  5FXE A;  4EC3 A;  1L6V A;  3PZ8 A;  1NEN B;  1PGB A;  4L1B A;  2I2Y A;  5ADZ A;  4WAF A;  1I4H A;  2AQ3 B;  1W1O A;  3SFE B;  3NRZ A;  1JW9 D;  4N6E B;  3WCQ A;  5C3J B;  3R07 C;  1D5X C;  4ARC A;  3NVZ A;  1KF6 B;  4H2A A;  1CJE A;  1KTK A;  3HSU A;  3ETR B;  3HVZ A;  1TS2 A;  4DXG A;  3TUO A;  2WQY B;  4EE2 A;  4ARI A;  4RFB A;  1ZXI C;  3HRD C;  1MVK A;  4IDI A;  2EEL A;  2WXN A;  1F2R C;  4HKZ E;  3PO0 A;  3NVV A;  3T3N A;  3HVD A;  2AQ2 B;  5D79 A;  3AE2 B;  3FWA A;  2RK5 A;  4PZF A;  2K9X A;  1GAQ B;  1PFD A;  2WXG A;  3IT4 B;  3DWG C;  1WGK A;  3TEZ A;  2K22 A;  1R7S A;  2GRI A;  5BMG A;  2IPI A;  2V3P A;  3RJA A;  1N63 C;  4YTP B;  3VTE A;  3MC0 B;  4TVY A;  5FXD A;  3P4Q B;  4XDC A;  4NZL B;  4MT5 A;  4HRO A;  2P4P A;  1XCT L;  1XLP A;  1EWC A;  2JSV X;  4OHJ A;  3GP7 A;  3RPF C;  2WXJ A;  1MBT A;  2E5A A;  2ZW0 A;  1UWM A;  1F0Z A;  2LJI A;  3MJ5 A;  4GDL B;  3TSH A;  2QEJ C;  4KKI A;  1QOA A;  1QOG A;  1ZOY B;  3W9C B;  3ZYY X;  2I38 A;  4RNA A;  2L1A A;  1N61 A;  2TSS A;  4TSS A;  1MHH E;  1Q10 A;  2VFU A;  2LUM A;  4P6V F;  2WXM A;  1BML C;  2E3T A;  3H8H A;  1TS5 A;  1V97 A;  4OZC A;  3FC4 A;  2V3N A;  4OW0 A;  4YWG G;  5TSS A;  4WIP A;  3AE4 B;  3GB1 A;  4XE0 A;  1VZ6 A;  4BBY A;  2VFV A;  4TVW A;  2Y4G A;  1J7A A;  1FXA A;  2QJL A;  2UUV A;  5AE3 A;  2N7J A;  1K52 A;  1FD6 A;  1UGJ A;  3AMZ A;  1FRR A;  3D2D A;  3GS2 A;  1K53 A;  1QLB B;  2L32 A;  2NTT A;  1FFV A;  4RCO A;  4HEA 1;  1EU4 A;  1SE3 A;  1C4C A;  4JPS A;  2R8D A;  1RYJ A;  3FIL B;  1DIQ A;  3NVW B;  3CIR B;  3U2S C;  2R61 A;  2WS3 B;  5I4D A;  2PW9 A;  1E8H A;  1X2H A;  1ZUD 2;  3ZJT A;  2WU2 B;  1HSK A;  2JXT A;  1VLB A;  2JYT A;  2XNA C;  1YQ4 B;  1WVF A;  3U4E G;  5AE1 A;  2FBW B;  2BS3 B;  4J3O D;  5I1V A;  4ZHO A;  3TSJ A;  2FE8 A;  1PYW D;  4MH8 A;  5G5G A;  3BYY B;  3RJ8 A;  1YNT E;  3P1M A;  1VDV A;  1UUP A;  3E56 A;  3ABV B;  3MHZ A;  4ZRQ A;  1QT9 A;  1AN8 A;  1RM6 B;  3W5U B;  3TEW A;  1CK1 A;  5G5H B;  1L4D B;  2WXR A;  1IGD A;  4MAC A;  5L6G A;  3EUB 2;  1FNV A;  5EE0 A;  2OED A;  2AXR A;  3KQ4 A;  1V1P A;  3B9J B;  3NVY B;  4A90 A;  2N9K A;  1L6U A;  2JYE A;  3PZ7 A;  1BXT A;  4PVJ A;  1PGA A;  1E6E B;  4XLO A;  4B0E A;  5HMR A;  1N63 A;  2W3R A;  4US8 A;  3BK2 A;  4YSY B;  1QQR A;  4AS1 A;  3TEX A;  5H8Y E;  3P63 A;  4WWM A;  2BVF A;  2LEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...