2W42A

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt dna duplex.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGYEGTKVKLSSKRYLLTLLQMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPIRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN
publication title Enhancement of the Seed-Target Recognition Step in RNA Silencing by a Piwi-Mid Domain Protein
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein/dna complex
total genus 137
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2w42A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2w42A01
1D4ZA 4CHOA 3QLVA 1HYZA 1EXQA 4MFBA 2NT3A 2ZD1A 3HO1A 1L5ZA 4DQSA 3IP9A 1BCOA 4YGXB 3LZIA 1CZ9A 4O0IA 2MYPA 1L3UA 1MVOA 1S1TA 3DLHA 2OZSA 3T19A 4F8RA 4I2PA 3F9KA 3LWLA 4HUEA 4Z4CA 1KGSA 4CEFA 1REVA 1JYFA 1VKRA 3Q15C 1AB5A 1BHLA 3K5MA 3O75A 1WN7A 4FB4A 3GWGA 2H0AA 4FE4A 4CGFA 3CFPA 1GOAA 2OPPA 4CGHA 2E4UA 4KV8A 3NBMA 3QX8A 4J2AA 4CJVA 1A2OA 5KQLA 1OXKB 4QOZB 5KRSA 4JOQA 4RU1A 4CERA 1B00A 4FCYA 4OG2A 1RBTA 3LALA 3KLIA 4CGJA 2FMIA 3TO5A 2V0NA 2E6LA 3LPUA 3QNOA 3N0RA 3A3KA 1JLKA 4NICA 3G85A 4DTOA 4Z4HA 1ZH4A 5B3JA 4DF4A 2QKBA 4EY3A 2B4AA 2Z1GA 2B1JA 1TK8A 5KRTA 3O1IC 1VSEA 4TLMB 1QMPA 3AVJA 4Q7EA 4GMJB 3AVHA 2LIVA 1BCMA 3UIQA 4O55A 1SL0A 4E7HA 4YO7A 1D9FA 4ICLA 1VSMA 3OYHA 1MIHA 3HPOA 4IF4A 3HSYA 1TV6A 2I5JA 7ABPA 1KSPA 4HNQA 3ZT3A 1JXEA 3KLHA 1PEAA 2R47A 4B9TA 4Z4EA 1SD5A 2FMFA 3AO5A 1TLFA 4ELVA 1IKVA 4OATA 3F6PA 3H75A 4B9SA 1KFDA 4CHZA 2XDYA 2X74A 4KHYA 3HDVA 1FFWA 2DY4A 4LX8A 4WXEA 3TABA 3QLHA 3IG1A 1SXHA 4ETIA 4B8CA 3IDOA 3PX6A 3JSMA 2WONA 5TPWB 2FBTA 4CFCA 4M3WA 5IEJA 3HVTA 1XWWA 1HNVA 3KD5E 2FBXA 2F8TA 3QLUA 2KFNA 5F64A 3RH0A 3IPCA 4TLLB 3TAPA 4CJEA 1QO0D 2YHAA 3V9WA 4JRPA 4MAAA 1S8NA 4JLHA 1MU2A 1SV5A 4MQ3A 2A1SA 4RK7A 1USKA 1UAXA 4FW2A 4DU1A 1L5YA 1RZRA 4KPYA 1ZAYA 4G0YA 2AJQA 1QQCA 4KHNA 3OY9A 1S1VA 2IAJA 4DLGA 3ZSYA 3OYBA 5FRMA 1J9AA 2PYJA 5EWJA 3P9YA 1IH7A 4IG0A 3KYJB 3K2PA 4XAQA 3AA4A 4KQ9A 2QXFA 1ZVVA 3FMVA 1N5YA 2VG6A 1NXWA 2GBZA 3MXMA 5HRNA 5JS1A 4CJPA 4CJQA 3DLBA 2HB5A 4CGIA 1TJYA 5IX8A 2LBPA 2KZZA 2HHUA 4HUGA 4CHQA 1Q9XA 2RJOA 4H4OA 1X9SA 3LUFA 4B9UA 4S04A 1JHZA 2LPMA 4Z0UA 2D0BA 2HNDA 5CY4A 2IS3A 1L3VA 3A0UA 3VQ6A 2YNHA 1YS6A 3QEVA 4FJKA 4CEAA 1TM2A 1M5UA 4EZ9A 4N5SA 4CEQA 3TI0A 4HCCA 1YT3A 1TGOA 1RNHA 1U47A 3VQDA 4YNQA 4RXUA 4CK3A 1F51E 3I5AA 1VRUA 1W0HA 3TB6A 2IKSA 3K5NA 4ZTFA 3RVNA 3NHGA 2HVHA 2JK1A 5FRNA 4QYWA 1Z2DA 4JS4A 4Q6BA 3P83D 3O3HA 2RDMA 4EYQA 4LE0A 3F6CA 3L2WA 4NQRA 3DRRA 1SXIA 4O0JA 4FJNA 4FYDA 3MF4A 3QEKA 1CEYA 2FTKE 3DGFC 4E7OA 1IG9A 4LZLA 3NH2A 3BILA 4KMRA 1JH9A 4MR9A 4DQQA 1YVUA 3SAJA 5KWSA 3RMDA 3G1WA 1GOCA 4RS3A 1NXTA 2D0CA 3KYIB 2FW0A 1JLFA 4BACA 1U48A 1A5VA 3DI6A 1EWVA 4DS5A 4OVLA 4FM0A 4L8RB 1ZHHA 3T1AA 2QR3A 1VSDA 2OYQA 3MQ4A 4IMIB 3DM2A 4IFYA 1LV5A 5K14A 3PO4A 1BQMA 2G8VA 3CQ8A 1RBRA 4FLUA 3PO5A 1HRHA 3EJWA 4EVRA 3OLXA 4JB0A 3HL8A 3OMXA 3NF9A 4O5AA 1RNLA 4EZ6A 1HPZA 1D8YA 2B5JA 2Z1HA 3K4HA 4RG8A 3AA5X 4B8AB 4XASA 2FQYA 2WB4A 3U3YA 4KHWA 4CF9A 3VQ8A 1KLNA 4N76A 2HHVA 3LUJA 1TK5A 3OYLA 5ED4A 6CHYA 1PHRA 4MS3B 5TQ2B 4D6YA 3DLEA 2RGYA 1ZYQA 3WNHA 4CHYA 2QSJA 3CFYA 1ZBLA 1X9MA 4KTWA 3ZSVA 2PY5A 1RBUA 3A10A 2B6AA 3KIOA 4OKJA 4LD0A 4M3RA 1QHTA 1RTIA 1EX4A 4J2DA 4FVMA 5TQ2A 4CF8A 4FLTA 4L85A 3AVLA 1OXBB 1NK7A 2GWRA 1JFTA 3CFRA 3RRGA 3T6KA 3IP7A 1S9EA 1QO0A 1JKHA 5DLEA 4E7JA 1TAUA 4BE1A 1ITGA 3GYBA 1NATA 1A0OA 1G15A 2EX3A 2Z1JA 4LRQA 3HDGA 4KB1A 3H1FA 2OPQA 4CJUA 3L2RA 4F4KA 3CU5A 2HHTA 3SZ2A 3HUTA 3EYZA 3AV9A 5HSGA 3IAYA 2P9HA 5EWMA 4EYOA 2G8IA 3CZCA 3EAFA 3CG7A 3JPWA 4IFVA 4XXHA 3VQAA 4H3KB 3FFWA 3L2QA 2PMCA 2HHSA 4FW1A 1HQUA 3TAEA 3MIZA 3VQBA 3QERA 3FFXA 3EODA 2KFZA 3FDFA 3RR7A 1U2QA 1YTUA 4MLDA 3G10A 3LUAA 4C8KA 3L49A 1BDJA 3RQIA 5KQMA 4E3SA 1U49A 4CJKA 3HCWA 2G8FA 1QNLA 3RVSA 3MYYA 2BANA 3HUUA 2ATQA 3TR8A 2E4XA 3RVJA 1USIA 1E6KA 1NY5A 3ALYA 4F3OA 4KQCA 2O4IA 3KJXA 2PUDA 4K8XA 5HM6A 4KI6A 1P6QA 5HRSA 1GUBA 2D0AA 4IG3A 3S3NA 1A5WA 1ASWA 2CHFA 4DFMA 4CFAA 1KMIY 3L6UA 3ZT0A 1LW2A 2PL9A 2Y1JA 4G0MA 3K9CA 4DG1A 9ABPA 3SG0A 1QSSA 4DU3A 1S5JA 4FJJA 4CHPA 4YFUA 1VSHA 1EETA 4PY5A 3PV8A 4N41A 4N0QA 4KHSA 3FGZA 4N03A 4JS5A 3SQNA 2F96A 3RMBA 3S3OA 1YK0A 3ROFA 1GCAA 1C0TA 3P1GA 4NYNA 2GV9A 2PUAA 3S99A 4NCGA 4F11A 4O44A 3ZSXA 3LUCA 3T8YA 3A2FA 4CGGA 4PQUA 2DFEA 4DSIA 3L8BA 4EVQA 2PUCA 4E89A 3H5TA 1NK9A 4QCLA 4KREA 2XY8A 3DZDA 3Q7RA 4E7KA 4JA2A 1U4BA 3OS1A 3UKJA 1FFSA 4P1ZA 1VSJA 1J53A 1D5AA 2PUFA 4CIGA 2VG5A 1L3SA 2JBAB 2A9OA 2WJAA 4AHSA 1PNRA 1C1CA 3OLZA 1NOYA 6ABPA 5B3JC 1LAVA 3HSTB 3JYTA 4DFKA 4PYRA 3DGEC 3LZJA 1RILA 3EGCA 2YNIA 1R8JA 1Q9YA 2AYXA 1BAPA 4G1QA 4DQPA 5CNJA 2JBAA 4ZYLA 1PNTA 4DFJA 3NH1A 3KKEA 2M98A 4CK2A 3N6VA 4CE9A 4EUKA 5DGCA 5GOTA 3ZSZA 4H3HB 4MLCA 2ZWMA 1DJMA 2F8SA 4G97A 3LOPA 4PA1A 3HP6A 1DBPA 1TKTA 4KB0A 4MQEB 4CESA 4RV5A 4N47A 4HYEA 4S05A 4B9VA 1DP4A 3MAQA 2I6FA 4FLYA 4DQDA 1T03A 4ZMRA 5FBHA 1ZH2A 4OKKA 3RVLA 1QS4A 1ZBFA 3NAEA 5CYMA 1XHZA 1J5OA 3RWUA 3HK2A 4QPJC 1SKRA 4B9MA 3V1QA 4MQEA 5J2NA 3NHMA 4W5OA 3QLUC 2L17A 1KVBA 4KFCA 3VQPA 1HNIA 1DLOA 1BA2A 3QELB 4CJ4A 1T8EA 4MR8B 4WT7A 4KNYA 3KK1A 3I09A 5PNTA 2RN2A 1TKXA 2YV0X 5EWLB 3O3GA 3LAMA 4EP4A 2W42A 4W5NA 2FEPA 3MEDA 1DCMA 3MECA 1WAFA 4YS6A 4KFBA 5CZ1A 1U8TA 3NFAA 3CNBA 3ROTA 3QELA 4DS4A 2M1ZA 1Q8IA 4MR8A 1UWBA 1LJLA 3LUDA 1NJXA 3T3FA 2XHBA 3QINA 5EWLA 3LP0A 4YV7A 4F3TA 2PZSA 2P1JA 3H6GA 2LP4Y 3LUHA 1Z25A 3C6TA 1QKKA 1IKXA 4E7IA 3LP1A 1SKSA 5BRAA 5CYQA 3VNAA 3L3VA 3OYCA 3HVRA 4BDYA 1NXXA 2G8WA 4CECA 3IP6A 1CXQA 1YMUA 2WY2D 1TAQA 3TANA 3AO3A 4FJ7A 1K6YA 1Y1LA 2IOYA 4EGSA 4KVFA 3T38A 2IYNA 1S1WA 2HQRA 3M9XA 1ZITA 3SUOA 2FEKA 3KD1E 3TWHA 4DSEA 3BREA 2X7XA 2P4UA 4Q6WA 1RPJA 3RMCA 5D3GA 2HHWA 3RVPA 1D1PA 3OYMA 1CLQA 3E3MA 1LW0A 5EWJB 2G8HA 3O2JA 5E41A 2HSGA 3OS0A 4KAZA 2QXYA 3ZT2A 2XY6A 4KZKA 1ZDMA 3CKMA 4L4UA 2FXIA 1FKPA 3OS2A 1WSEA 5C5EA 1IKYA 4KK3A 2KW4A 4Y1CA 4LY7A 4O1HA 2X78A 3CM5A 1B9FA 3KHTA 2HPHA 1ZBHA 2DFHA 1RCHA 1QSYA 1Z13A 1BQNA 4RWEA 1EHCA 2AYZA 1ISSA 3RVOA 1KRWA 2PE5A 1NK5A 1TL3A 1LAWA 4CEEA 1NKEA 3AA3A 1NOZA 4DFPA 4FZZA 1H9CA 3D45A 3WNFA 3OYKA 3VQ5A 1WSGA 3ULDA 1JDPA 4F06A 4I2QA 1BL3A 2EHGA 3NGIA 3M8RA 1NK8A 4Y9TA 1UDRA 3V4IA 1ZGZA 4FJIA 2FN9A 1GUDA 2VWJA 3VQ9A 4FJ5A 3OLYA 3LFTA 3Q9SA 3B6OA 3LKVA 3O4QA 2HNZA 3ZSRA 4DF8A 3VQCA 1Z15A 3NBPA 1YTAA 1VPWA 4NCBA 2N9UA 5IEBA 5J2PA 1ISRA 4GNRA 4Z4IA 1B9DA 3QIOA 1JBEA 5I3UA 3GA5A 2QVCA 3AVNA 3LDSA 3OJUA 2YKMA 4KTZA 1TK0A 2OA8A 3BGRA 4CFBA 5SWMA 4OPKA 3OYEA 4QYMA 3VQ7A 4OPJA 4KRFA 4G0PA 3SNNA 4M3TA 5KQGA 3H5LA 1GOBA 4DTNA 3MEEA 4IDKA 4MR9B 1WSHA 1BDHA 1BGXT 1CZBA 3RMAA 3HPGA 5C25A 5HKOA 2YHBA 4FLVA 5HRRA 3SQ4A 4OBBA 2A1RA 3LUGA 2FEWB 3OM0A 3OQOA 4KTQA 3OQMA 1EWKA 4Z9AA 4F8JA 2TMYA 4XFKA 3PX0A 4DTSA 3W9SA 2KYRA 3V9XA 4M45A 2WWVD 2MSWA 4I9QA 5FDLA 5HLFA 3D02A 4BE0A 5CNKA 4B08A 4G0QA 5IULC 4ZPJA 4ZMSA 2LUOA 3DLKA 3AO1A 4J2BA 4G86A 4CF0A 3NNDA 3U6FA 4OLBA 1KVAA 4IKFA 1RDCA 1Z18A 4DN6A 2R4QA 3BBLA 3BRQA 2HQOA 3IP5A 4TMYA 4DU4A 2IPLA 3KK2A 3ZSQA 3OO0A 4MGEA 1USGA 2NZVG 4WXMA 4KI4A 4F12A 3H5VA 1M2FA 2OZMA 1FQWA 3LMKA 2HNYA 4FE7A 2JRLA 3N53A 1VRVA 1E2BA 3OYNA 2ID7A 4LE1A 1O1WA 1LBIA 2JVIA 4I9LA 1QP4A 1JLQA 3QEPA 1VSLA 4M3ZA 2PUBA 1L5UA 4KHUA 4CJLA 4LE2A 4AILC 3HEBA 3O1HB 1TVMA 1JF8A 1I3CA 1JX6A 3Q7SA 1QP7A 1QTMA 4CGDA 5JS2A 4BE2A 4B3OA 1TKDA 1HQEA 3AVGA 1P8AA 3DLGA 3OYDA 3SCXA 4CJRA 1ZBIA 4R5PA 1KLMA 2HQBA 1WETA 1WSJA 4H8KA 1NJZA 1HMVA 4I7FA 4N56A 1QQBA 1IO2A 3AO4A 3PUFA 2XY7A 5KQPA 5C42A 3GBPA 3LPTA 1KRPA 1M5TA 1HYVA 4OLAA 3ISNC 1F21A 3K58A 3SI6A 3FFTA 3K5OA 2X6SA 1HJRA 2JVJA 3OM1A 3GV0A 4DQRA 3PY8A 2QV0A 5EWMB 4FLZA 3ASMA 3PX4A 3K57A 4RW8A 1P2FA 3QEWA 3BDPA 3OYJA 3L2UA 3CS3A 1N6QA 4CEZA 4UHJA 3MA0A 3SV3A 1S1UA 1BIZA 3AVKA 1RT1A 5DK5A 4E7PA 4FJHA 4DTPA 3JY6A 4ETNA 4AHRA 1LK0A 3SPYA 4ZHRA 3SUQA 1FSPA 5HP1A 3C3WA 5KGWA 5IUNC 1L3TA 3T95A 3TARA 2WOMA 3QESA 1B92A 2FMHA 3I0RA 3VQEA 3MXIA 3UUGA 4YR7A 3H6HA 3EULA 4RY0A 4FXDA 5TPZD 5J1EA 4YCSA 4HTUA 5DKFA 4B9NA 3Q7TA 2FQXA 4DSLA 1NKCA 2VWKA 3C94A 4RZSA 1DTQA 4PE5B 5FROA 1LWEA 2QVGA 3OVNA 4RKRA 1HEYA 2VUHB 4MR7B 1KVCA 3B2NA 4O5BA 3SPZA 4M3YA 3R0JA 3HP9A 4DTJA 3V1OA 3CLKA 4EYKA 1VSKA 3QNNA 4YWHA 4N0PA 4LSNA 4FK0A 4HHTA 2HW3A 1C4WA 2P5GA 3QK7A 2OPRA 5DMRA 2NT4A 5HROA 2MSKA 4MR7A 3C3MA 1YMVA 4LSLA 2QK9A 2BE2A 2X6NA 4JP1A 3V81A 1DCKA 4G0XA 1APBA 4OGEA 4OGCA 1EP4A 2KTQA 3QEXA 2FLWA 1W25A 1JYEA 4CIEA 3EQ2A 3DRPA 3O3FA 2Y1IA 8ABPA 2BDPA 3DOLA 1U2PA 3KLFA 3ZCMA 5KC9A 3CM6A 4TN5A 4ZTJA 3CTPA 5JNVA 1U0SY 1RBSA 3HXMA 3H5WA 5IBQA 4MRMA 4W5QA 5T7BA 4W5TA 1EKEA 4ELTA 1KCFA 3THVA 4BWMA 2XO7A 2HJ9A 4IRXA 4J2EA 2QW1A 5C24A 4B9LA 1SL2A 4DQIA 4WE1A 4FJ8A 3AVAA 4DADA 5KTQA 1IKWA 5JNWA 2VUIB 3ITHA 2IPMA 4RY9A 1DRJA 3SNKA 1JL3A 3AVMA 1SL1A 4Z99A 3I8DA 3KG2A 2A9QA 5FWYB 2BGGA 1JXBA 1RT7A 3L3UA 3QIPA 1PEYA 1UA1A 1E6LA 3LAKA 2HHXA 1Z17A 3LKBA 2GX6A 4DSKA 3V6DA 1F4VA 3OLVA 3GBVA 1MB0A 1D1QA 3SUNA 2FBVA 2O4GA 1S1XA 3F73A 1Z12A 5FWYA 3VQQA 4XARA 2PJUA 3BRSA 2MYTA 1C0UA 4GW6A 3ZT1A 4JRQA 4ID5A 4CIFA 5JNSA 3SYZA 1I39A 1DBWA 3HV2A 3KTOA 1UA0A 3KLEA 3C97A 3KLNA 1XHEA 1NJWA 4RXMA 4EP5A 4C8MA 3OJSA 1ASVA 4E0DA 1S9GA 3QLTA 5BQ3A 1A5XA 2L2QA 1DG9A 1XI1A 3WNEA 3OYFA 1JLCA 4QAGA 3TD9A 3KCNA 2RF2A 2VYCA 3EZ5A 3K5LA 1JLGA 4Y1DA 5KC8A 3G0ZA 3TAQA 5HRPA 4RK4A 1K66A 2G8UA 2CHEA 3NGZA 4RW6A 5BRJA 1X1PA 2JLEA 4FJGA 3QX9A 5TE9A 1LWCA 4B09A 1RDDA 3LP2A 1SUQA 3KK3A 1XC9A 3MEGA 4M41A 3N0WA 1RXEA 3N75A 5IUJC 3SQ0A 3H1GA 1D5WA 3K59A 1Z16A 1BDIA 1CXUA 4YRZA 1J54A 4C8NA 4FZYA 3AVIA 1BVHA 1DCFA 4CF2A 3AVBA 4AHCA 1Z2EA 4WUTA 4K8ZA 3VQ4A 3U3GA 2FBYA 3GRCA 2FVYA 4DTUA 4AH9A 2R7YA 5D2CA 4MYRA 1JLEA 2WMYA 4C8OA 1A04A 3E01A 3OLWA 3C6UA 1IIBA 1LJUA 3IRXA 1C1BA 3F7NA 1M2EA 3H1EA 4ZJPA 4LDZA 4F2RA 2NZUG 2HMIA 3JS5A 4C8LA 2E4LA 1DRKA 2R48A 5HBMA 4RK0A 3JPYA 4QICA 1NJYA 5IUKC 4DMNA 1QSLA 5JNTA 3I0SA 3NH0A 5TPZA 3ZT4A 2PKXA 4KV7A 3RRHA 1ZESA 4FZXC 3V9ZA 5I42A 5I4CA 1C0MA 3H5OA 5IC5A 2HVIA 1EAYA 4HVJA 2J48A 1C6VA 1SKWA 2FN8A 5FBKA 1RBVA 3CZ5A 2YNGA 3QETA 3RR8A 3M6MD 4M3UA 5TPWA 4LH4A 3ZSWA 4O4GA 4DWIA 2GBPA 2A9RA 5KGXA 4FLWA 3AO2A 3VN5A 4CEDA 1RTHA 2RKIA 1JDNA 4Q5VA 2KQ2A 1ABFA 2OENG 1GLGA 2A9PA 2YKNA 4RSMA 2B4JA 4RK5A 2JB9A 3NNNA 5SZTA 1X9WA 2JGUA 1VSFA 1XHFA 5CNMA 3JVIA 3KKRA 4KK4A 4RDCA 1CYEA 3I45A 1YK1A 4WWHA 1QQAA 3SQ2A 4F2SA 2FLKA 3B6PA 1DC7A 4FJMA 4CF1A 1E6MA 3LUKA 1BIUA 3CYMA 1XWLA 1BI4B 2VK2A 4FJXA 3LANA 2WRZA 4XLTA 3ILHA 3CFOA 3AA2A 3SUPA 2IPNA 3MMNA 2PUGA 4CJTA 4DTXA 3O21A 5C5CA 2PAFA 4Z4FA 1YIOA 4FJ9A 3DLRA 1ZN2A 4IILA 4JB2A 4E1MA 3D8UA 1BI4A 3ZSOA 2QU7A 4M3XA 4E19A 4Z0NA 3FFIA 1NKBA 1RT6A 3HJFA 1KRXA 3UK0A 1RTJA 4G0ZA 1ZGGA 1FXXA 4RW4A 2IDOA 5DTEA 2L18A 3CG0A 1RTDA 2MSLA 1NTRA 3M8QA 2YNFA 1WAJA 3M8PA 3HS3A 1JWLA 5E3JA 3VA0A 1JL2A 2JVKA 1NK0A 3KLGA 2DFFA 3AVFA 2GKGA 4KHQA 2QKKA 4H4MA 1EWTA 2E6MA 4GPAA 4XIUA 3ILYA 4H60A 3CG4A 3I42A 3HYFA 1JLAA 1FK9A 4YLEA 1RT3A 1NXVA 3EDCA 4PZ0A 3TMYA 1MAVA 3S3MA 2FQWA 1VK0A 3RVKA 5EU7A 4HUFA 5J2MA 2GI4A 4D6XA 4P98A 4RK1A 1C0EA 4PWDA 3A0RB 2E4WA 2ETJA 1P6UA 4CJ3A 4BDPA 1Z26A 1QPZA 2IDMA 4LDAA 1U04A 4D74A 2FSPA 4KKOA 1GCGA 3LTEA 3DMJA 4DTMA 2D5RA 1PUXA 1NXOA 1QP0A 3RVRA 3NCIA 1UOCA 4FJLA 5CZ2A 2ZAYA 4RY8A 4UHKA 1ABEA 2G8KA 3AVCA 5BR1A 1NXSA 3C3KA 4PICA 4RXTA 1RDBA 1W9HA 2P51A 2LSNA 3IPAA 3RVMA 2HHQA 4RW7A 4RKQA 1JLBA 3LWMA 1DTTA 4GVMA 3QO9A 3OMWA 4M88A 1XHXA 3KSMA 5TQ0B 4CHNA 1D9DA 4ETMA 3DYAA 3OYGA 3NF8A 1RT5A 3OO1A 3CRNA 4E1NA 2OPSA 1RXIA 1FFGA 2Q5CA 4ML3A 4JAVC 3SV4A 4TSXA 5TQ0A 3TAMA 3JVDA 4IMJB 1C1AA 3SY8A 1D2AA 4NCAA 4RK6A 1R0AA 4FLXA 3JTEA 2O20A 4CJSA 2RJNA 3SM9A 3NHZA 1SXGA 1TMYA 2E4ZA 3V1RA 3RTVA 3M9WA 1HYSA 2IC3A 3VNBA 5JNUA 1TKZA 1LBHA 1JFSA 1NXPA 3O2SB 4CCHA 4ELUA 2DRIA 4MS3A 3L2VA 3IS9A 3N8IA 2H3HA 1EFAA 2ZQBA 2NUBA 1DZ3A 2XY5A 3QEIA 3Q41A 3EQZA 4OJRA 1T7PA 1WSFA 3HZHA 1WNSA 2DTUA 3OYAA 2CD7A 2QZJA 3RVQA 4DLEA 3E61A 2MYUA 4Q0BA 4IGAA 2E4VA 4FM1A 4HNSA 1YS7A 1KTQA 2GUIA 2IOCA 4BWJA 2PLNA 1VRTA 3KJVA 3KKSA 3EY1A 3TAGA 3O1JC 4FK2A 1QE1A 1WSIA 1TVRA 3URMA 3V9SA 5TQJA 1RT2A 5DCLA 2XRIA 3M8SA 1S6QA 2ID9A 4MS1B 1URPA 2JCGA 3H08A 1ASUA 3O4NA 1NK4A 3GT7A 4O1IA 4PEVA 2L19A 3KLOA 1RDAA 2IGIA 1KFSA 4DSJA 3GL9A 1T34A 1VSIA 2IPAB 4JASB 3TAFA 3NNSA 5T3YA 4CEBA 4AHTA 5JNRA 4RW9A 1RT4A 4ID1A 5J2QA 1JFVA 1S6PA 4AHUA 1TL1A 4Z9BA 4NV3A 3MXJA 4HCBA 4CJWA 4Z4GA 1DBQA 3KTQA 1ZBUA 2OQRA 1RZRD 4MS1A 4PUOA 1CHNA 1DC8A 4UQGA 4FM2A 1VLZA 1JL1A 3C95A 1BISA 3P5JA 4CJ5A 4CJFA 4MS4B 5HQJA 4G0OA 3QLVC 1J56A 1FKOA 2FKAA 3TX6A 1AB6A 1K68A 4OKEA 4KO0A 5FWXB 5CNIA 4AHVA 4CK1A 2E4YA 3C6QA 2VG7A 2P5OA 4MRMB 3D0PA 2WJWA 1MB3A 3DRSA 4CBVA 3QEMB 3VA3A 4LH5A 4BDZA 4MS4A 2FMKA 2KZMA 2ZE2A 4EYGA 4YP9A 2PYLA 1T05A 5FWXA 4OTZA 2FC0A 3SQ1A 4CFDA 3WNGA 3KS9A 3NF6A 1ZY2A 4WZZA 3OYIA 4E7LA 3H5IA 3QEMA 5GQSA 3CHYA 3OQNA 3MM4A 2R25B 4M42A 3O2QB 1SRRA 4DSFA 3NGYA 2PL1A 5CHYA 1LWFA 4DTRA 4MQFB 4IBNA 2Z1IA 3LP3A 3DOKA 5ABPA 2PUEA 3HM9A 4NYFA 4EVSA 4W5RA 3HT3A 2ITGA 2Q3SA 3SJJA 1Y97A 2RPIA 4FK4A 3DBIA 3NDKA 1I3AA 2MYNA 3HPHA 1NK6A 5KI6A 3V9UA 1WLJA 1U45A 4HNRA 3N0XA 4MPTA 3O74A 3NF7A 4CEOA 2CWDA 3NE6A 4MQFA 3S9HA
chains in the Genus database with same CATH superfamily
2Z4TA 2TMDA 4PLZA 1VIVA 2QVBA 3E7XA 1MORA 2CFIA 3T0IA 3WK4A 2RHOA 4CUZA 1KWKA 1T5OA 4W5JA 5ALWA 4F8RA 2ZCJA 3E1YA 1CJCA 4JHLA 4KUHA 2IHBA 3PGXA 4TKUB 2Y2VA 4JU9A 3RUIA 3GVIA 3MN6A 4EK9A 4PVDA 4D9MA 4HGPA 4TVKA 1C3VA 3HXTA 3EZ2A 3FOFC 1C1XA 4CRWB 1M8FA 2ORYA 2JA1A 3LPDA 2V7QD 3AHJA 5B12A 2IH4A 3A3KA 5A7FA 5AJXA 4MVCA 1CJTC 1L5HB 4Z4HA 1ZH4A 4DDWA 1CUJA 2QKBA 4M1YA 3ZTTA 3H4IA 1EP9A 1QFXA 2NUAB 5KRTA 1PV4A 2BMEA 3M5RA 1VTKA 3O82A 1JU4A 4J49A 1SL0A 3LO5A 1BH2A 4MUBA 4TSFA 4NDNE 1PYOA 3U39A 2SICE 2HWWA 1CQJA 1GKIA 2QLFA 4DW8A 3H75A 1VE3A 4CHZA 4HQKA 3VM6A 3GXBA 4I4CA 2Q2QA 4BJ5A 3DVSX 5IEJA 2W00A 3NDIA 5E8RA 4BP8A 3INYA 3MBIA 5DHRA 1IC6A 2KFNA 2UXDK 3RAJA 1TW3A 1NVTA 2VR1A 1OX4A 3MJVA 1MU2A 4MQ3A 1P2DA 2AI3A 4NDZA 2WF6A 4XVCA 1B74A 1HG0A 1Y4UA 5KOHB 1X1CA 3HSCA 4CD1A 4G0YA 1MJGA 3C1OA 5E7JA 4DUPA 3DFKA 4IIBA 2ZUCA 3ORRA 2O6HA 3U7GA 2ODTX 4GPIB 4J3FA 5FEMA 5GZ1A 4MI9A 3K2PA 1H85A 2Z8YA 5FV4A 2KLHA 2VPZA 4TSKA 1VC2A 1N5YA 2Z2KA 2GAJA 2DKFA 4YIHA 2ESRA 3HKDB 1J99A 3WS7A 2CHGA 4IJVA 3SC2B 5U9CA 1V6CA 3T3MB 1M6WA 2X4IA 2OK7A 4YT2A 1FYDA 1Y81A 2Q3DA 2RJOA 2HU8A 1YZKA 2OL4A 5AQYA 4QG3A 2RMKA 4CE6A 1D09A 1Z4OA 2P7HA 4IY1A 1KAEA 1FS5A 4NRDA 3UK7A 1TK3A 3LCVB 5J1TB 1H65A 3NDRA 4UM9D 5F2EA 1YT3A 2QBYB 5IBCA 2I6UA 5AVUA 3SBEA 3I01M 1YDMA 1ZUD1 5FRNA 1UK8A 2CHQA 4C3OB 4J2HA 1TFRA 4LW8A 3QKSB 4FJNA 3UV7A 2F1KA 1OLSA 3LFHA 1N9GB 2FDRA 5EFOA 3IOBA 4QUAA 2ZJZA 1RFQA 4AZWA 5IJ9A 1EFDN 1NXTA 1EFRD 5BWCA 4FM0A 1ZNYA 1NMZA 1T1JA 5B7GA 4QM7A 3IR7A 2EWMA 3OWOA 1AGPA 1BWPA 5FOTA 5KYYB 1YOVA 4DMKA 2AE2A 4DUGA 3DKVA 1XRRA 4OQFA 4RVUA 2HRBA 3MWKA 1JECA 3FHTA 1JPJA 3W5IA 4KBOA 5CTJA 4FQ5A 3OFND 1Y4SA 4DDTA 4JKHA 4ZJUA 3RYIA 3UMGA 1KLNA 3B3FA 3LUJA 1NQOA 2IS2A 1OT5A 3CNOA 4P82A 2RARA 4DWOA 5C10A 4Y0WA 2WFLB 4B6PA 3DLEA 1UC4B 4IUDS 1X1BA 4E2YA 4BXOB 1B6RA 1IBSA 5LSAA 4HUTA 3WMRA 1U65A 2XEXA 1OVYA 4FLTA 4GWLA 4B1ZA 2GWRA 5IAKA 3AL2A 4HI0E 1JKHA 2FPPB 4H5NA 2ZTLA 3QITA 2M6SA 5HJ2A 4PL7A 3MJSA 3ESAA 1NATA 3DE2X 1J8MF 4ENSA 2XITA 2I4LA 1Z35A 3HDGA 3H1FA 4HB4A 1E0DA 4O3MA 4F4KA 3SHOA 3QEBZ 2FPIA 4M8IA 3BA6A 3DEYX 2HTFA 3WJ1A 2F6RA 2QUZA 4X54A 3LSYA 3T7JA 1SUBA 4PQYA 4KIFA 4REQA 3WIEA 3RJ5A 2GK6A 4CLRB 4K26A 2ATQA 3U3DA 3KYDB 3EXEA 4OM7A 1D4FA 5FHQA 3PC8A 3ALYA 5J2UB 2OO7A 1D04A 5JCJD 2ADFA 1H2AS 3V48A 2RHMA 1P6QA 4DFMA 5IJZA 5SV2A 3V5NA 3VOVA 2G63A 4RPKA 3B3AA 1YB7A 4HLDA 3PV8A 1QIGA 2ZBFA 4B4DA 1KOGA 4AKGA 3O0DA 3VDNB 5HA5A 2GV9A 4DAEA 4PX3A 3HBAA 4EHDA 3E9LA 4PQUA 2ZQYA 1K4MA 4Q01A 2RGNA 3L02A 3EWNA 4Y1FA 3WBJA 3BCRA 4L6CA 4K9KA 1LWNA 3UWDA 3UKJA 1F9EA 3ZTYA 3AU8A 4E5NA 5J3JA 3BCUA 4EW3A 4NULA 3J80O 1NOYA 1ENZA 4CIDA 1XU7A 4R7TA 3KSAC 1STOA 1JG4A 1TJ3A 1ZU4A 5BREA 1CQIB 4PYRA 1EFCA 4RIGA 4A8JB 3PV0A 1RILA 4GL2A 1GRRA 2CLHB 2XBMA 5THXA 2TECE 5FX2A 1YJ9N 3N6VA 3THWB 2QQFA 1NR5A 3VBCA 2ZXFA 3ZQ6A 3BJMA 5B7PA 1CDOA 4GS5A 1ZN8A 4PPQA 2EW1A 2CXRA 4HYEA 4PX5A 2ZBRA 4QBIA 3CX6A 2H5EA 2WU4A 2EYQA 1NG1A 1PF7E 1J5OA 3DOHA 5FPMA 1GZHB 3U0BA 2PQ0A 2SECE 3NV7A 4F46A 2P1ZA 4WCVA 3PEVA 3ELBA 1VA5A 1QPGA 2O4CA 2A9FA 2C5HA 3FPBA 3IDAA 5HP4A 2EP8A 3ZEUB 3FI0A 2Q3CA 2I5PO 4HN9A 3ESQA 3TQFA 1VJ0A 1J9GA 4DFDA 1S2GA 4EPRA 4L4RA 4DS4A 1TJ4A 1NJXA 3FTCA 4DSUA 3QINA 3CZ9A 3O9RA 2QD5A 2XKJE 4YV7A 3NI2A 3SZMA 4YMVA 3WO0A 1E98A 3WLTA 1PLLA 3ZBUA 4RHCA 4NZ9A 1Q14A 3F5MA 1BUPA 1XAJA 2R5FA 1HE8B 2WY2D 4TV8A 4FJ7A 1VSBA 5EUCA 1UC5B 3TW8A 2IUEA 2AI1A 4QREA 3E7DA 4UOQA 2VJMB 4DTCA 5CA0A 2UXDB 2V0CA 1AMNA 1EUYA 3HY3A 3OZFA 5C31A 1CLQA 5HXAA 2H63A 4KQIA 4DWWA 3O2JA 3H42B 3UWSA 1DWPA 3W0LA 1J24A 4DSAA 3ZT2A 2AJ8A 3TVYA 3PWZA 1XNRK 3H8SA 1VMEA 5DNUA 1IKYA 2BFCB 1FTNA 3L0OA 3O73A 2JGNA 3DL0A 2PLWA 5KBYA 1VFPA 4RWEA 1HT1E 5BO5A 2NU7A 4DC9A 5K3AA 1T2EA 5THKA 3AMVA 1T8SA 2G82A 3ZVNA 4CEEA 2M6KA 3DZHA 5TDHA 5L7WA 1UKCA 4A2AA 4RPLA 2AC2A 2LZ0A 4I2QA 2O3RA 5FI3A 5K0GA 4J2OA 3WLSA 3ZX5A 4FJIA 2VWJA 4UFPA 3B6OA 2RBKA 3L8ZA 4A8PA 5HOEA 2I6QA 2IU6A 2AL7A 1L5KA 4OKNA 4DLYA 4FD2A 4FJ1A 1SUEA 1ML4A 2FW8A 4F6CA 4JXKA 1E1CB 4Z4IA 3OJUA 4KTZA 2G1AA 4KN9S 4INAA 4X5OA 5LZ8A 4DV4K 5GINE 4Q9IA 4IJQA 4FOIA 4IIJA 3W8RA 3SSOA 1E1QD 1UJCA 3SQ4A 5HRRA 3RSHA 1SQFA 2FPGB 3OM0A 2VJKA 1P33A 2K7ZA 2TMYA 1A95A 3JALB 1JLSA 3WDSA 2ZWPA 4XEIA 1JVNA 2HAEA 3LDLA 1E6UA 3G89A 3DLKA 2KMLA 1Z45A 2YRWA 3DWFA 2BGNA 1KVAA 3OURA 2UZ4A 4MSUA 1PJRA 4QJ3A 3R5XA 1WXQA 2CXXA 3HBTA 5FP0A 3QA9A 2IV3A 1MO6A 1NMQA 4NY1A 3KK2A 4FW9A 4PC3A 3HCFA 2GJ4A 2NZVG 2PSEA 3FGUA 2GD1O 3RK0A 4YRMA 5I5GA 1FP7A 4NMHA 1I13A 2OBXA 4ZRMA 2ON6A 1HDZA 2J8ZA 1E2BA 3ZV5A 2C97A 2J0VA 1XZBA 2ID7A 2H2DA 3E03A 3VU1A 4ZOBA 4J07A 4G5HA 1VKHA 4C1NA 1EUDA 1E2GA 3ZLVA 4WXRA 4QUIA 1U9JA 2FZWA 3RTDA 3UJ8A 2EG5A 4CJRA 3PRKE 3FSRA 1S22A 3JAWB 3QVKA 4KRXA 4RACA 3RFFA 1NZDA 1DPFA 2P9BA 4PZZA 4MGHA 1CZNA 3A2LA 1WB6A 3QWFA 4EPXA 1XROA 1OKJA 4XCVA 2O4UX 1N6QA 4WINA 4GI5A 1WUYA 4CJ7A 2AK3A 2NU8A 2I2AA 1T5IA 2E8AA 5HQ3B 1AXEA 3BXHA 3C3WA 3YASA 1R15A 2VH5R 2Q0XA 3F7OA 4XGIA 1W9MA 3HCCA 4Z7OB 2NTVA 1WNTA 1FRVA 3DZJA 1TFUA 1E99A 1DTQA 3A7EA 1KY4A 4GXQA 1IU9A 5CCEA 2FFHA 4AF6A 3QNNA 2IXTA 2RHRA 5JC8A 2FFJA 1DKLA 4FK0A 3AFMA 3GDGA 1DTWA 3SAHA 3HUDA 3JQQA 1VE5A 3F4KA 3IDQA 3PE3A 2MSKA 4QUKA 4Q3AA 1ATZA 1HNWK 1JCFA 5E4TA 2PXHA 1DRUA 2AX3A 3E9EA 3Q85A 5DM70 3BH7A 4X1KA 4DDKA 1ZISA 2BDPA 4B3MK 2NN3C 5EZYF 3ZWDA 4WGFA 2C95A 2WEKA 2ZI7A 2XYVA 4ZGGA 4R16A 1U2DC 3X43A 4LVUA 1J8VA 2XO7A 3AXTA 4JCOA 4RZQA 3ME5A 4WE1A 3STHA 3OT1B 4A2PA 1PR4A 5H5JA 1C3XA 3SJCA 1DRJA 5CGZA 1KNXA 2W6QA 3PGMA 4FWQA 1U4NA 4R1QA 3BZCA 2RK3A 5KTPA 2JNWA 3MN7A 3O2NA 1P2GA 1JXBA 2AFHE 3GUUA 3JR3A 3LAKA 3GT4A 3V6DA 5CVDA 4EY4A 3NB0A 3KJIA 1R4MA 1CUXA 1FC0A 1C0UA 5HCNA 2GCIA 1QBKC 4YOUA 3C43A 1J97A 3I6MA 3F96A 3T1NA 4MV4A 4R2LA 1HYBA 4XVQA 1CZAN 1TM1E 4BNWA 3UB3A 1P44A 2VNIA 4FMPA 4QAGA 5BT8A 3KCNA 2HCTA 4JLOA 3V1UA 4E31A 4TL8A 2C2YA 2WE7A 3G0BA 1V5WA 4YIKA 4MVJH 3N8KA 5KTKA 4YMGA 5LQKA 3X1MA 1PL7A 1N2IA 1ZHFA 1FNSA 3BKWA 1ZICA 4PXYA 5FBZA 1COZA 1UZAA 1GQYA 1LEHA 4FPBA 3H4MA 4Q0MA 2WOJA 3CZMA 1V45E 4ONEA 1PBTA 3SJ7A 1DIRA 4JQSA 1Y6QA 4KXLA 1MB4A 4ND8A 6GPBA 2EZ8A 1DTEA 1BFUA 2LV8A 3OPYA 1Q1BA 3BAFA 2GK7A 1ZUIA 3TTXA 4MQUA 1GNTA 4DPMA 4M7RA 3U26A 2O3JA 2NSHA 2H18A 1NIJA 3L1UA 4H4EA 3ZS9A 4DKJA 2IKQA 4C0XA 4ER0A 3N8GA 4XR4A 1XRNA 2BEJA 4YQYA 4P2GA 4A10A 3J7AC 1YHNA 1MA0A 5KYGA 5JVDB 5IC5A 4F4UA 3ROXA 4R84A 3K1TA 2UYHA 3BB4A 4FGKA 3WDKA 4XGKA 1Z0DA 2E3JA 1GA4A 2VF2A 3ZQKA 1COWA 1XNRB 2YMQA 4GF5A 5A4MS 2HBKA 3SS7X 3MELA 3LHKA 1M2WA 1K63A 4Q5VA 4D9BA 2W2XA 3SN6A 2OENG 1GLGA 3RHZA 4P3XA 4M7YA 5CNMA 1F38A 2WVGA 3H2JA 3F98A 1GILA 1YK1A 2JCSA 1UOPA 3HXLA 3WSTA 4LMRA 2YV5A 1XWLA 2A5FA 2LWIA 1KRHA 3D2FB 1CVLA 2ZR9A 2EGGA 5LJIA 1HFEL 1YR9A 3MBKA 2PLRA 2ZATA 3IBSA 1TVKB 1JZTA 3D8UA 1TM5E 4Z0NA 3BSYA 2PZ8A 4KLNA 1ZC6A 4F4FA 2XE7A 4WQ4C 5NULA 1AKWA 4HH3C 1ZXBA 4O4HB 3H2BA 5JAUA 1ZGGA 3T4PA 2IDOA 4OM8A 1I0IA 2ZUVA 1NJFA 4DV4B 3HHPA 3WGGA 2YNFA 4GOLD 3RNLA 4H1HA 2BEVB 2YXNA 1JP7A 5DN6D 1U9YA 1DO0A 4LF8K 4INJA 3HYFA 2XWJI 4DA0A 4E32A 3G0CA 1CUBA 3AEQA 3ZY4A 5KNBA 5C7LO 1YR2A 2C4WA 3ROQA 3U4CA 2BTEA 1WZNA 4I55B 1W7AA 1VHTA 1XAHA 3EEYA 4HG2A 3OZXA 3NDBB 1FLAA 1QC5B 3NCIA 2DBVO 4FJLA 3NVAA 4HUJA 4BVHA 2VP0A 3ZBTA 5FTWA 4PICA 1Z37A 2Y2UA 3LC1O 2Q28A 5IARA 2R1TA 3ZU3A 4YUVA 1LQTA 4RTPA 4Q4JB 3A5NC 4M88A 3KSMA 1D9DA 2X2EA 3UXEA 2CY0A 2ZVQX 3ZDQA 1AQYA 3C65A 3QXJA 4OXKA 1UBEA 3CNLA 1UCFA 4DCGA 5E95A 3ZJYA 4RGBA 5FPSA 2HNAA 2VBGA 4U2BA 5SY6A 3K6SB 5BN8A 2WAMA 3R9PA 3BWMA 3WWYA 3GF4A 2OANA 1QLHA 4AKHA 4F4IA 4MI1A 3V55A 2QRZA 1X9HA 2XRYA 3V1RA 4TX1A 4TV8F 2PFGA 2XDWA 1DDOA 2IC3A 4GZ3A 4X6UA 2ZTMA 2Q4TA 2R6HA 1F1JA 3O2SB 1QVFM 1IWBB 1DEHA 2H2IA 3CH4B 4MS3A 1AUOA 2ZQBA 1Z6AA 4BGUA 1ZBQA 5DM4A 3M6AA 2NUBA 1X8KA 3CXUA 1DZ3A 3QEIA 3NVMB 1FLDA 5J5VA 3AG6A 1J9EA 5M29A 1KI7A 3RT1A 1WNSA 4GVLA 1QJ4A 3MK31 1HURA 4ZAXA 3OD1A 2Q5IA 5DM0A 3WIOA 4BWJA 4L51A 3EY1A 1RLIA 4NZMA 2VZLA 2R6GA 1VQPN 3FWYA 4RMGA 4BAGA 3H08A 2HZBA 3GT7A 1R88A 4XUEA 1RDAA 4AP6A 1NW4A 2G4LA 4AHTA 4DLUA 2HH9A 4J91A 3S8EA 1DL5A 1Z0IA 4HCBA 2BH1A 1XU9A 4CU5A 4EJMA 5SICE 1I2AA 2P3LA 2O19A 3N3BC 2DR0A 3KT8A 1JL1A 3BMNB 4MS4B 3W05A 2O2DA 3TX6A 2QTFA 3DAGA 3R5TA 1HC7A 4JT9A 1HNWB 4PRZA 2WM9B 3GL1A 4B1XB 3PQ5A 4EPTA 3LDHA 1T4GA 3G8CA 1WVIA 1IEWA 2HYDA 3VR3D 4I1SA 3RS7A 2O3UA 4Y6PA 1H2WA 4B3MB 1VJTA 3AHDA 4NR0A 3GJ0A 2FC0A 3UK1A 4FR5A 1VKJA 4IIJF 5KJ6A 4W9NA 4ALIA 2R6ZA 4O4JF 5I7OA 1V4VA 3KZMA 4WZZA 1NKSA 1JFLA 5B6IA 1EZZA 3HUFA 4QGFA 2AKAB 1H0HA 2QN7A 1ZGHA 1QF7A 1ZBDA 5TGZA 4UOEA 2RHBA 3R2JA 1NBIA 3WJAA 1E0JA 2WICA 4YH1A 5FFNA 3IX7A 4FCCA 3KC2A 1QQOA 5DHUA 3QFPA 3L6BA 1JDBB 4MQFA 2EDAA 1M6NA 1YB2A 2C9ZA 3AY7A 3QLVA 2VJQA 4Y6GB 1PGJA 4YGXB 5GP1A 2I9PA 2C9MA 2C2XA 3QV2A 3PNOA 5FADA 1GU0A 2OZSA 1VBKA 4G09A 4HUEA 2AH5A 2PMFA 4DZRA 4IHJF 3EHEA 1GOAA 4J0DA 3NBMA 4Z8XA 4HQ0A 2OC9A 2Z6UA 4HWGA 1SEVA 4DM3A 3PQFA 1RHMA 2F1OA 2IYRA 1RP7A 5J2TA 3TO5A 4J0QA 5FOVA 3IIIA 2ENUA 3NUQA 3UGKA 2P4HX 2H3EA 1Q1QA 2ZRGA 3MIIA 3EXFA 1E3QA 2OXCA 2O6LA 3AETA 5LZ9A 3HVKA 2CK3D 1I1OA 4M9XA 4DBLE 4C04A 1Y3BE 4MV6A 1BXZA 1QKJA 3LHSA 4BDSA 1FSGA 2GF0A 1SEPA 4JOCA 4KYTA 3HN2A 1QB8A 2FMFA 4QPZA 3G71N 2QROA 4IO0A 1Q7TA 5EIBD 3C8DA 1KAQA 2JJ2A 4PGGA 3CN9A 1SXHA 4B8CA 2PX3A 2HA6A 1FDSA 2G7MC 1E7YA 3ITDA 2F55A 5K3FA 3ANLA 5HR5A 1JEOA 3PQ8A 2YRFA 4UUNA 3T9BA 1AKVA 4MQLA 3R76A 2HXGA 2P69A 3WZMA 1KO7A 5ESDA 5IAAA 1BN7A 3DFFA 4YQZA 2ZXUA 2VC2B 3CNNA 4J90A 4X1YB 5IDVA 3O4GA 4F3NA 1OLUA 2PLFA 2DBRA 5FDFA 1NW6A 1UT5A 4XAQA 2BLLA 1QO7A 1G20B 3WLJA 3OUZA 2F7SA 3UJDA 1WS6A 4ZYTA 3IUEA 3EFOB 3DLBA 1LTKA 1PNQA 3AVQA 4U0KA 2JGAA 4M87A 3CB2A 5E0OA 2FF3B 5KX5B 4JVMA 4G8CA 1UFQA 2A9KA 2BJHA 2Z56A 2ZPAA 4BFUA 5AMXA 3BHJA 2W9XA 3U9ZA 4I4TF 2QTTA 4YY3K 4OOFA 1FEZA 1O6ZA 1TTPB 1U2RA 5H3CA 1QGUA 2NSJA 4CMIB 2QL5A 1N25A 4WBNF 3N07A 3VMFA 4CLOB 3HXQA 4TWZA 3DOIA 1OWMA 1Z2DA 4B8ZA 3BEOA 2JIBA 4LF8B 1G5IA 3DRRA 4BRGA 1SXIA 4AJKA 1IVSA 3SPXA 3DNMA 1NUPA 1RJDA 2C3MA 4ZT4A 2PSJA 3QF4A 4OAOA 1AQNA 4OX9K 5EIAA 4KDRA 3FXAA 3DVQX 2P9IB 2QOEA 4KJZA 4O8ZA 3R4VA 2WYOA 4DKXA 3RMDA 3WA6A 1GQSA 1GOCA 3PQ3A 1V16A 4BMDA 2C2ZA 5CDUA 3EGXB 3WIUA 3PUKA 5K3SA 1L7NA 5JD6A 1A5VA 2C4TA 3BWBA 3O9TA 5K6TA 2V7BA 3DM2A 2Y4NA 2G17A 3H0EA 4MDYA 3KX2A 4WFJA 3T99A 3B5JA 3OLXA 4YJHB 1E2JA 4MYHA 5LWHA 4FHGA 3SYNA 1NDHA 5ALJA 2I55A 5HJ7A 1JEAA 3K4HA 2CDNA 4CEHB 4GV6A 4IJ6A 4PY2A 2ZRCA 1FLNA 2F1RA 4DEXA 2IWHA 1JNYA 1EVKA 3PEEA 3GT0A 2NPOA 6CHYA 1EB9A 3W5AA 2ATVA 1CIVA 4BN4A 1K2VN 4GVPA 1J00A 5LD2B 2D2VA 3VU3A 3AIKA 5P8WA 1VQ5N 2YN2A 3GI1A 3IPXA 3ZEIA 2XIJA 1IY2A 4FVMA 2R8BA 4JHDB 1HSOA 1AGXA 4L2IA 1IY1A 4JQCA 4Z7JA 1MBZA 1S3IA 1XZPA 1DMSA 4UTPA 4KI7A 3D4IA 1PX0A 2K6GA 4IEFB 4G1UC 2PKCA 2CH5A 3MOIA 2G5CA 1CUYA 4MA0A 4Q03A 1Y1RA 4NF2A 3TOZA 3T1OA 3FYUA 4R1UA 3VO9A 3CZCA 4GRAA 3CH5A 1YJWN 3Q3IA 3FFWA 3L2QA 4FZRA 1I7DA 4ZO8A 4CJXA 5E4YA 3EODA 1U2QA 2V5UA 1P6XA 2XCRB 3P4IA 1R6XA 3SF8B 5EMNA 5H4HA 3NCHA 3U7QA 1WKCA 4HX5A 2GVDC 5L3QB 1U6IA 1D2HA 5HRSA 1GUBA 2VDJA 4O0MA 2J59A 3RUEA 1Z38A 4DG1A 9ABPA 1B73A 1OPRA 1T43A 3GPDG 3BGOS 4HMPA 4MCJA 4UCFA 3FGZA 3K6JA 3HM8A 3RMBA 3R5HA 1SELA 2XT0A 4MRPA 5JIBA 1BU8A 3IDSA 4YHHK 3TSUA 2FJPA 4BGIA 1RRGA 1W96A 5KNDA 3ROKA 2Q8NA 1F8GA 4NBUA 1N7GA 1YWGO 3Q98A 3FKSD 5GIPA 2CNBA 4BNYA 4DFKA 4ZCPA 3DC7A 1W5AA 3ZXUB 5BSMA 5BR9A 2QQEA 3TM5A 4R9SA 4XWGA 2VRNA 3EY9A 3L04A 1C81A 4DLTA 2AZMA 2IHUA 3HL0A 4PZLA 2XD4A 4BR0A 3GW8A 4RV5A 3P2MA 3L8YA 4S05A 1P5ZB 2JJYA 1XQVA 5F2OA 5KSPA 3PHLA 3FH0A 1NBAA 4X45A 1MV5A 4BIIA 1VL5A 1VPVA 2B1GA 4FOLA 1A8QA 4YRLA 4M8LA 2OXFA 1KQPA 2C0PA 2FLOA 4HTFB 4B43A 1GDTA 4UAGA 3MGCA 1JIJA 4PLPA 3UVEA 1NG9A 3ABOB 3FNQA 1B8PA 4MR8B 1KAXA 5PNTA 4K6OA 3LAMA 2PS9A 4ISCA 4UAJA 1O0BA 4MDEA 1VIYA 3IUMA 3I4FA 3FWNA 5KMGA 4FHDA 3C45A 1Q18A 2FX3A 4ENRA 2E2NA 1JIQA 4RYDA 3FYSA 2QYHA 5FWNA 1QKKA 2AOTA 1YC2A 4Y0NA 5EUBA 4WKNA 3BMXA 3QWIA 1XRQA 3Q40A 4L72A 2RB4A 2XOKD 5D3KA 3U6BA 1WHTA 3HKEA 4N18A 3VEOA 4EBFA 3UKDA 5I7SA 5TT1A 7ADHA 1V71A 1HNXK 1AKRA 1R0BA 3L7CA 1C0PA 1PIWA 4DSEA 1RHRA 4BC2A 1WSAA 3QM1A 5F1OA 1NF3A 3REFA 3FZHA 4BFTA 2JG3A 1GO2A 1NOKA 1UOQA 3KQQA 1ZNWA 5DNCA 1NRIA 2QXYA 3GEPA 1G3MA 3CKMA 1OH7A 1ZVMA 1GSOA 4K87A 1UMKA 5DM2A 4LI3X 4W9RA 1J2UA 4I6JA 1FU8A 4HUQB 4YDSA 1RQXA 1BC5A 1JMVA 1KRWA 2QAGB 2VA8A 1L5QA 3JZDA 3PQ6A 4NJEA 2QN9A 3IVRA 2PAAA 2VSYA 4BE9A 3VZRA 1BL3A 1U6ZA 4DNQA 3BE4A 4Z49A 3NGIA 3M8RA 4NARA 3DMFA 3QJ5A 5EUMA 4A1FA 3L2OB 4E3WA 1QYCA 4RSRA 3G6EN 3LQYA 4YY3B 1QGED 5E2AA 4QRDA 3W5UA 4F6LA 3FOCA 1BRMA 5LMZA 3VTKA 4H5TA 1PDOA 2QB5A 1RE1A 3P0HA 3U44A 2VTKA 4N8DA 5I9EB 4O4IB 3KPUA 4QYMA 2QTRA 1TNDA 4DCPA 2C4MA 1B6GA 3PNVA 3HPGA 3WRXA 4LZZA 3PYLA 1FMJA 4OBBA 2FEWB 3OUUA 3WQRA 1U7TA 4F8JA 4E4YA 4EA9A 1G8AA 6LDHA 4MITA 3L7BA 1AD2A 5HLFA 4AG3A 4OX9B 1R6VA 4LY6A 4ZMSA 1T6BY 2AG0A 3QKWA 2P9SB 4OLBA 4C0AC 4IKFA 1LCIA 2XMBA 4RF4A 2IU4A 4MKRA 2YDYA 2YCLA 1A8HA 3QBDA 4UTZA 3TRIA 1JMYA 2CJWB 2YJZA 5DI9A 2IA5A 4XVHA 3K8OE 3FPFA 4BO9A 2P4QA 3OECA 1ZGBA 3LX8A 3H5VA 5G1OA 2V6MA 1B6SA 2YOGA 3LUBA 1Y37A 4K2AA 3P27A 2V8BA 4N3AA 2GK4A 2EKBA 4YCDA 1JIVA 2PUBA 3IHKA 4CQMB 4CJLA 1I4LD 4LE2A 2QX8A 2DLDA 1UC8A 1C7JA 2QN6A 5JO9A 4Z7NB 4J2TA 1JX6A 1CRPA 2BMJA 4Z1MD 5ARCA 2X8BA 1IBRA 3AVGA 1J2JA 1P8AA 1UFOA 1ZIXA 4MTCA 2H9AA 1U02A 4P4SA 3IQHX 1L6IA 2F59A 3PJFA 1ZM9A 4EEKA 3OQIB 4QGHA 4MDHA 2RHHA 4FYMA 5C42A 3KUXA 3KB6A 1XA3A 3EUFA 1CNEA 4IG9A 4EAAA 3C6YA 3GV0A 4NCNA 2WM3A 3K6RA 3TB4A 4B2IA 4RJKA 4AKIA 1W75A 4FLZA 3FX2A 5AJTA 4OYHA 2PH5A 4A3SA 3EDQA 3NATA 1GAXA 1S1UA 5COBA 4ZVNA 4MKXA 1E89A 1KEEB 1E0KA 1TRHA 1KYYA 2IHYA 4IVRA 1VYHA 3PTZA 4OIFA 3CLUD 2WA2A 3TOSA 2G3YA 1R66A 4U7PB 1J7JA 3VJRA 3GH3A 1N4AA 2EV9A 4J7UA 1F6WA 1M66A 3KP1A 4JUBA 4YEDA 3ITNA 3JD4A 2D0DA 4J4BA 3DTVD 1LI4A 1EK6A 2AHOA 4DLLA 3QSYA 4TMXA 2A0YA 3R9WA 2HUPA 4FLMA 2YICA 3O8BA 2N42A 4R8KA 2CNNA 1V4BA 4UM9B 4URFA 4MVJD 5FBLB 1N0UA 2AT1A 2PEYA 1CUAA 2Q41A 3PEUA 3WLAA 4O2RA 3USZA 3DOEA 3HZZA 1NW8A 4K9PA 1IQRA 4A5OA 2SBTA 4PRYA 1T0HB 1W25A 4QLBA 3I1JA 4GP9A 4JI7K 3IVCA 2X13A 1Z2PX 3PLRA 3GFSA 4YHHB 2QWQA 2H7YA 3ZCQA 2O0LA 3EQ7A 4MB0A 1F17A 3CNHA 1T0JB 2Y67A 5AIAA 1K3UB 3CV3A 4L3VA 3BE5A 4RY9A 3SDZA 2PSDA 4MGZR 2DJIA 4B75A 4FN5A 3GJXC 3DMRA 2P40A 4JJEA 2C9CA 2HWKA 4BWGA 3KWFA 1P1HA 3IHWA 1Z17A 1EO1A 3LKBA 4CLXA 2P9NA 5HUHA 5DEOA 2J3IA 3T52A 1U11A 3F73A 1A8PA 3CR7A 4G8BA 2A0FA 2EP5A 3KB2A 2EGHA 1Z6XA 2R65A 2BHNA 1MF7A 2PL5A 1AG9A 4MUAA 3JVVA 4EQ6A 4C23A 1ZZEA 4FD3A 4M1OA 3OYFA 4EI9A 3DTTA 3FWZA 3RK4A 2X2OA 2VJOA 4BUZA 2RGRA 2PNJA 1FW6A 3N8DA 5H82A 1P3Y1 2CL0X 3VR5A 3OTHA 3KSZO 4FNOA 2ZAGA 3L92A 3RSSA 4C0QC 1ORRA 2GBFA 5JYBA 3R1IA 4HWPA 5AW3A 4OUDB 4J7AA 4Y18A 4FKBA 2EAUA 3H8JA 4OHUA 2UUOA 4M3NA 2CNWA 2NM0A 2C4UA 4MYRA 3CQXA 1CC1S 3VESA 3EO3A 1XX6A 1DIAA 2BJWA 5BN5B 1P5JA 3FHOA 5FNZA 3U7EB 2D7JA 3HKCA 1HNXB 1JAXA 2GZ1A 1RC1A 1IL0A 5JNTA 5KNCA 3AC0A 2OPBA 3ND8A 4FE3A 5DZSA 2R97A 3GLIB 2SHKA 3VHLB 2ZT7A 3SP1A 2J48A 1C41A 4CMEA 5FBKA 2I3BA 2B8NA 4BPBA 3RR8A 3IP1A 1RTTA 3UB2A 1PR5A 4O4GA 4DWIA 2ST1A 4OXNA 1QRSA 1PJ4A 4Q9NA 5JJ5A 1Y9EA 1CHDA 1EVLA 4BNFA 1VLQA 5IF3A 3IEIA 4TQAA 5EPEA 2V7VA 1MUUA 3PB3A 2H06A 2CMGA 1CYEA 4F2SA 3C6BA 4A5AA 5ALOA 1BIUA 4KAXA 1EDBA 4O5FA 1K0FA 1MB2A 1ECLA 2PQ6A 5AFUA 3FPCA 4GC5A 3ZWYA 4ESOA 3LDNA 3P38A 1F0YA 2OZVA 1XFDA 1WUKS 3INTA 3FDZB 2EFJA 4IF6A 2B36A 4H1TA 5IRCD 3NC1C 4YT8A 4M3XA 1QH9A 2PYIA 3BWDD 3VSEA 4TWIA 3K3PA 2KHZA 1VM6A 1MD9A 1YF5L 1Q50A 2VJYA 4DANA 3CUUA 1NN0A 2OQVA 2HMVA 3TG2A 5DTEA 2ZR0A 2IBTA 1AOXA 2ZRNA 3EIHA 3K4QA 5EMJA 1Q11A 1ST2A 1SIWA 4RFSA 4WQMA 5EZYA 1JZQA 3KLGA 1N3BA 4AROA 4WZBE 4KHQA 3IKMA 2JFXA 3CLRD 2OLJA 4XIUA 3HN7A 4KOEC 2AQIA 1A2QA 4N7RA 2OZKA 2ZRQA 3F8WA 4XYGA 4D3SA 1ISIA 3F46A 3CMAN 5A5GA 2TYSB 3LF1A 5CJPA 2KSQA 1SHUX 3S3MA 5IT9A 4C4XA 1BCRB 3ENBA 1DQZA 4F0JA 1PG0A 4K6HA 2IZOA 5EQDA 4PBSA 4PCAA 4BRIA 4LDAA 1U04A 2UUPA 2C4HA 3RVRA 3JYHA 1PT9A 3BAZA 1YXMA 4HAZA 3ICCA 4RXTA 4V1CB 1P90A 4P8RA 1KSJA 2P51A 4YBZA 4G65A 1C9NA 4D9CA 4GVMA 4XD7A 2PGXA 2QM0A 1CX9B 1X2EA 3OI7A 5SYNA 4ETMA 3DYAA 2UVQA 1DRWA 3MEQA 5HZMA 2PBLA 2A5XA 2EW8A 4GOKA 4HWTA 4K86A 2OQIA 5TEVA 2NG1A 1WP4A 1D2AA 1MPXA 3Q7IA 4FR2A 2YW2A 3EXG1 5CDGA 1C1YA 2H1WA 3NTLA 1BMFD 3DBRA 1A7AA 3L5OA 4YRQA 4XCXA 2MMGA 1YQ9A 1PCXA 3L4QA 2PUVA 4GYYA 3RC1A 1WD5A 4HYTA 1U0EA 4TTIA 3CMMA 2AVNA 3L2VA 3COWA 4HN2A 3UNXA 2OD7A 5I9IA 3N8IA 3PL5A 2XY5A 3BBPA 4QPDA 4FBMA 4JC8A 4KR2A 2GPBA 3R5SA 2E4VA 1EEXB 1EE9A 5FNVA 1FFAA 1WTAA 1AQIA 3JYOA 4ZQFA 2GUIA 4DIFA 2W7TA 4JENA 1YT5A 3O6WA 3UAYA 3V9SA 5C5IA 1S1MA 1GIAA 3DWLA 4Y2YA 3D7LA 4HVTA 3V9AA 2Y8EA 4EY6A 5I3ZA 5J2QA 1JFVA 4OPMA 1YZLA 4BNJA 4Z9BA 3LGSA 1MWKA 2XJ9A 3X0DA 4AZ3A 1BISA 2BELA 1JU3A 4M36A 4Z94A 1PD1A 3CETA 2YXEA 4HLQB 4ZEOA 3MMXA 1G8HA 5T6BA 2JKYA 3IMKA 3QOXA 5EJMA 5BP7A 2Y1XA 1EH5A 4JI7B 1GVNB 4QU8A 1H93A 1Z7BA 3ZWMA 3NF6A 1ZIPA 2WQ6A 2AEFA 5GQSA 2I71A 1LPOA 5EE3A 3J8AA 3AKCA 1L5GB 2O9JA 2BBWA 1SXJC 2BE7A 2HUNA 4TT3D 3W79A 2Q97A 2LW7A 2AN3A 5DRYA 2FUNB 3RS2A 4XRRA 1U45A 4EJSC 4C87A 4JX9A 5AQHA 1ODLA 4R1OA 3CC2N 4Y1RB 1T36B 1OTYA 4A15A 2VAVA 2GELA 4V3BA 4KW7A 2IV2X 4M49A 3G2HA 1ACMA 3C3BA 3PHGA 3T19A 4NDAA 2H85A 1BXRB 3CNEA 1VB5A 4K3VA 5B6JA 4EG5A 3ZXIA 2MHCA 5JJCA 1N33K 4X1IA 5EG5A 2DP4E 2H0AA 1AT1A 2OPPA 2VT6A 2E4UA 4KV8A 1MNQA 4JHXA 2JLUA 4L6AA 4M89A 5EZSA 2OYRA 4M9SA 2Z2JA 1C9KA 3VNUA 3LKZA 2ZI6A 4LZNA 4RGVA 1O4WA 2Y77A 1ZPDA 3O1BA 3VR6D 2VTEA 5F52A 3KLIA 1DJNA 5UKDA 4GE3A 3R6LA 1E61A 1WDWB 3DMTC 4WCEL 5DULA 1FRFS 1GXSB 5JEDA 2H2WA 3RYHA 1QORA 5CA1A 1C0LA 2J31A 4WZAB 2N1MA 3STYA 5FV7A 5HUQA 4HMOA 3GFPA 4PSDA 2O52A 1MIHA 2R6DA 1UDAA 4RZXA 5EY4A 3PEFA 2YUTA 4HNQA 3ZT3A 1RFLA 1CJUC 4B9SA 4OI1A 3GJZA 2GO7A 1YRYE 5KQSA 3LL3A 2FBTA 4AJ4A 4HF7A 1ADGA 2QX4A 1LVUA 1H42A 3ELUA 3IQZA 5JZVA 4RPIA 2VAPA 1K92A 3OU7A 2Y1LA 3D2EA 1UK7A 1NJGA 1GLAG 3BIJA 1ATIA 4CDGA 3O91A 5CMLA 3DXYA 1EVIA 3BK1A 1SZJG 3ESBA 3IQEA 1S1CA 1Y3CE 4BS9A 1J9AA 3R5JA 3P9YA 1L7VC 4ME6A 3KYJB 2X7HA 4DMFA 5JUWA 4A0SA 3KOYA 3GCXA 4LRTB 3EZYA 2REOA 3LT4A 1GA6A 1R4NB 4IMPA 2J09A 3FUXA 3U9LA 1K6MA 1USWA 4L8FA 2RK4A 4KCGA 3EA4A 3CW8X 3MTGA 1CNMA 2OD2A 3GJ8A 2JL1A 4YJ3F 5CLHA 4CKWB 2GB4A 2RCYA 4Z0UA 5EKDA 1KFCB 2AG1A 1IN8A 5CE3A 3ATUA 2EJWA 2XMQA 4DBLC 1EK1A 4AICA 2HU2A 1PWEA 4RXUA 1N8NA 4CK3A 2A35A 3H8VA 1ECJA 2XLBA 2A92A 4BBJA 5CVTA 3VF4A 5LQJA 3AGKA 3O3HA 2XODA 1V1MA 3LFUA 4O4JA 4IWVA 1G66A 2J5KA 3FSGD 4AF8A 4IQFA 4O0JA 2AJCA 1SIUA 3JZAA 5DOZA 2ZYVX 2PSFA 2WLSA 1I80A 1L7XA 1WE2A 4MWBA 2QEXN 1QS0B 3LDAA 2DAPA 2WKPA 1SVOA 1BYIA 1Z5OA 3ZCVA 3ZNPA 1VG9B 1QXSA 5E6SB 2JLWA 1DS6A 1ANKA 1RHQA 4R0NA 1M74A 2VNHA 5LQUA 3TW0A 4ZAVA 5TXGA 1N4DA 1PJTA 1QVAA 3IOCA 5KYUA 4AZVA 5CRIA 3V00A 1L8LA 2FSHA 2WU1A 2EBUA 4XCQA 4DLBA 3CQ8A 1JIXA 5C1DA 1RBRA 4FLUA 2JGKA 4GXTA 4LYDA 3E05A 3UHOA 4OXRA 3CCMN 5IWAK 2NVUB 4QTTB 4Q3EA 4IHJA 1CEXA 1L8OA 2HHVA 2XV1A 4DGSA 4O8KA 1TK5A 4NG4A 4CCWA 3OYLA 1U8FO 4YP1A 1KTVA 3CC8A 4LTDA 3HYLA 2H17A 4GX0A 1E5VA 1X9MA 4IEEA 1PGPA 3ZSVA 1K98A 2QL6A 1M1NA 2EQBA 4TSRA 3DOJA 3R20A 4RJIA 3P4YA 2OGWA 3IC5A 1N6NA 5BQFA 4CZFA 3QVLA 3SQDA 4LYGA 2OORA 5D84A 7REQA 2EX3A 3ZW9A 3M6IA 4IJUA 3QICA 2GSDA 4XJTA 1MQ9A 2IYYA 2WUEA 2ES4A 1QK4A 5DCUA 2ZRHA 1HF3A 3RSEA 2RHGB 4ESEA 4NYIQ 1JHDA 3UEOA 1V39A 5DGDA 2XMSA 4DCHA 5EE1A 1P1IA 1RI5A 3UKOA 3IODA 3HTVA 2AN1A 4D44A 1RGIA 4M6WB 2VFAA 4OXQA 1RHJA 3WXJA 5H9WA 3A4IA 4G24A 2O2GA 3PHIA 3BFJA 3EGDA 4AJ1A 5KQMA 3NGXA 1U49A 1IOWA 3HCWA 1TUEA 3LCRA 3E5HA 1RDWX 1OAKA 2JAOA 2BGMA 3NG1A 5FQNA 3O9SA 3NWBA 1W1UA 3RE1A 3ANNA 4V24A 3T69A 1BHO1 2JD0A 4TQ9A 2D0AA 1C4KA 2N3ZA 4BJHB 4DR6K 4W8HA 4FU0A 1GGKA 2YN4A 3VPXA 3PICA 4D3FA 1A1SA 3FMOB 4OVKA 1CERA 5AKIA 4QULA 2I7XA 3B82A 4DMCA 1NGCA 4XIYA 3M1YA 3A2NA 1G1MA 2MU1A 5ADHA 2PGJA 3HA5A 1ZNXA 4OP2A 5LMUK 2W2KB 4I4NA 2C59A 1NK9A 3LXXA 1H22A 3OU2A 4I4TA 1U4BA 1WSDA 3EG5A 4QS7A 1XB2A 4AHSA 4OGKA 6ABPA 1RKVA 1K27A 2GDJA 4WBNA 5B1HA 3RJZA 5BMVB 1ZGAA 4KNVA 4CKEA 3I5YA 1P7VA 4ZYLA 1FFDA 4QS8A 2R68A 4CK2A 1TKRA 2XA1A 2PUWA 3S7TA 4HH1A 3MC1A 5A62A 4Q05A 1E1RA 4PA1A 1XT6A 1U9IA 3ND9A 4RHEA 4WECA 2BFEA 1WCIA 1BEZA 5AVZA 4TOIA 3O84A 1OW3B 4HVCA 1N33B 5AW5A 4FLYA 1T03A 1ZH2A 1DGKN 4I19A 4EGJA 3TUZC 3S68A 3IH5A 3LKDA 1Q0PA 3LGXA 3ZK8A 4CLEA 1AMOA 1JEYB 1NBHA 2Q9AA 1JLRA 1W47A 2REBA 5DM1A 3W2TA 3F1LA 4Z86A 4BMYA 5AW4A 2HFJA 4I1VA 3OCJA 3BWVA 5ADXH 4IXNA 4H0XB 1TKXA 3C3JA 2ITMA 4KIWA 4YCMA 1E3TA 4A4DA 3G0GA 1HNNA 1TCUA 5KZMB 4DS3A 1XPJA 2XHBA 4X20A 1UFRA 4FMDB 1XMXA 2C9BA 3VC7A 2VQ6A 5GPBA 3GLSA 1IKXA 4E7IA 4RD4A 2CDRA 3NONA 4WF9L 3U48A 1M8KA 3HVRA 2J3HA 4FT4A 2FFAA 4Y2VA 1WZCA 3MAGA 4XDHA 16PKA 5FNVF 3ZUGA 1OXUA 2ZDQA 3F5TA 3CIOA 4M2LA 1M0WA 3QPCA 1XF1A 3M81A 3E3AA 3EXIB 5BN4B 5A3SA 1S9DA 1EGHA 4OQZA 4L57A 3BREA 4CCAA 1IQUA 3E23A 3FOAA 3SLGA 2WD7A 3H2HA 3ZD6A 5L3SB 3K9NA 2BUBA 3KAKA 2I7CA 3B9RA 1A5AB 3TIGA 1HDIA 5FUXA 2D1SA 2UYYA 4G9ZA 3ETNA 4GNKA 3KHTA 2D3WA 2OV2A 4CVNE 1QTIA 2YVQA 4ZT2A 2ICAA 5F7ZA 3U9SA 1O9GA 4PIMA 3IKTA 3UPDA 3ESRA 3PL1A 2AFIB 1TL3A 2BFBA 2XA9A 1JYSA 3P7MA 1QGOA 4DFPA 3QXCA 1OYOA 1QHHA 4F04A 2BHRA 1JHYA 3QVTA 3T0FA 5IHXA 3AIIA 4JROA 4FJ5A 4FGUA 3W6PA 2YZ7A 1J7KA 4UZSA 4B1FA 1MVNA 1OIWA 3DCNA 3I0ZA 4UARA 1H05A 2Z2XA 3K1AB 3T9CA 3KT3A 2YKMA 5IVIA 4OPJA 3WLHA 2GVZC 4JS0A 3M4JA 3KTAB 3TZBA 2B99A 1TUUA 4LJRA 2D7DA 1XTPA 2VWGA 1XI2A 4HGNA 4H7IA 2KYRA 2WC1A 1T0UA 1O58A 3EY4A 4U7JA 5KAMA 3WQTA 1T0BA 2IXFA 4ZA2A 1QF6A 3AH8A 4CW7A 3U1TA 3NNDA 4DYDA 4S24A 4LISA 1IZ7A 3C3PA 4ZI2A 3G6KA 2VQEK 4A59A 4PX2A 2GXUA 1GFWA 5AH0A 5C35A 4E22A 3FOBA 3B1YA 3M6WA 2DGDA 4BRFA 4Q24A 5FOXA 3H4TA 1NY6A 1V6AA 4KWCA 2NO0A 4PSCA 5CA1F 2SKDA 3W1WA 1V7PC 4XH1A 5IWAB 2XUJA 3HXOA 2QRPA 3OPNA 4AKSA 5M5BA 2XPCA 5ICFA 1Z5GA 1K1EA 4REOA 5JS2A 5EINA 4XLLA 2MT9A 1P8ZA 2NRVA 2BP7B 2W6ID 3P4UA 4BB0A 2DR2A 3TTUA 2VDLB 4X8LA 5LNK1 5KQPA 4PLWA 1NJ5A 3ILVA 1Z07A 5I4IA 1PQWA 1W85B 2GOYA 3HU1A 3O3OB 1FDOA 1P2FA 5DLYA 5A05A 4MW9A 2DQKA 2IZZA 4UM8B 4IICA 2ZB7A 4J0EA 4TRNA 4ZHRA 3KK0A 2Q3HA 2Z98A 4EENA 2V5VA 2O06A 2GGSA 5AOVA 2CLIB 3UUGA 4MH0R 3JSXA 4PHGA 1V37A 1F7VA 4FXDA 4D42A 4IQ8A 4B9NA 2ZU6A 4DSLA 1JG3A 1KJIA 1T6DA 3ZGNA 3FHCB 1JAIA 3KQNA 3TPCA 2VJLA 3CUWA 1EQYA 4BNXA 4MINA 1X80B 2WHQA 3JVEA 2ZRJA 3H05A 2AXEA 2P5GA 2CCGA 1CUCA 5ELZA 3JYLA 3M49A 1YSCA 3Q2IA 5A4DA 3BRCA 4DR6B 4P9NA 4R31A 1SBZA 4KXNA 1BHJA 4F38A 1K7EB 3DE1X 5BOSB 2VEDA 4CIEA 5LP6B 1O96A 3I9LA 1XR3A 1L3BA 2QUIA 5EOYA 5KC9A 5LMUB 4JB3A 1MXHA 1YF3A 2PRJA 2DKNA 2HIMA 3IIKA 5JNVA 1JKMA 1D6NA 3KR0A 5AUOB 2IHZA 2M9MA 3USCS 1SVKA 1T5TA 4CEIA 4DQIA 3NP7A 4MV7A 3VPSA 5JNWA 2X14A 2QQGA 3ITHA 4P84A 1B43A 3TGWA 3DKPA 5KHLB 2I7DA 4GP6A 1PSWA 3KG2A 4CL8A 5FWYB 4Q18A 1R59O 4KMOA 4ZDKA 3EUEA 3KVNA 1KJWA 3V8NA 1K8KB 4OK3A 5B1SA 1GHTA 2X8WA 2OCDA 2ZRAA 1J20A 2PKQP 5H3HA 1C3OA 4B3SK 3I1IA 1LOTB 3IV7A 3KVGA 2RF2A 4B6GA 3FR8A 1Z4MA 4DCMA 4RLHA 4FZ5A 4LY9A 4N3CA 2BDTA 4NATA 5GMOA 1U8CB 3NGZA 1KD1O 4CQJA 5BW5A 2ZT5A 2JLEA 1LWCA 5GVSA 1WM1A 5TF4A 4N3NA 2NVBA 1U5CA 2ONCA 3SQ0A 3K59A 1Z16A 3OIWA 3CCCA 1DCFA 1UOEA 3AVBA 2P78A 2NO6A 1NV9A 4K8ZA 3B3QA 3I92A 3U3GA 3U7IA 3UWMA 5LIRA 5AHOA 4G0NA 2D06A 1H0SA 4X44A 2M6LA 1YCDA 5DGHA 3K0FB 1TPZA 5T5QA 4WADA 2C83A 5FPEA 3AP2A 4LDZA 3P52A 3KPVA 3U9DA 5FO0A 5IANA 3TIIA 4UMDA 4CTKA 1GD1O 3V9ZA 1MW9X 4YMLA 3B13B 1C0MA 5IAGA 2Q6VA 2R11A 5CD1A 1JSRA 1NF8A 3H2IA 3BB3A 4PTYA 4YUXA 1FYFA 3ZSWA 3ZHTA 2JHGA 2G1PA 3E0XA 4H6WA 4WNAA 4JFRA 2G9ZA 1ZFNA 1ABFA 1P7WA 5FD8A 4OLHA 1OLXA 5BXYA 4K9QA 3DOOA 5DHTA 3NXKA 1ULAA 3SQ2A 2FLKA 4XX1A 3DDSA 1UPAA 3J81O 4YRNA 3DB2A 4MA4A 2YS7A 3ZJ4A 3OLCX 3G59A 3O21A 3B9QA 2PAFA 1OBCA 3OZRA 4IWXA 1YIOA 4FJ9A 1IHPA 1FX0B 4DJDC 5D51S 5BSWA 3EG9B 4N0EA 3SSMA 1QO9A 3FCAA 3MWYW 2WC9A 4M0UA 3TZKA 2MSLA 4P86A 1XXHE 3F9CA 1LPNA 5EA2A 2V9CA 4JJGA 5E3JA 4ZTZB 4RDHA 1Z7WA 4FUQA 4F6RB 5JLHA 3ILYA 3I42A 3R0ZA 1N6HA 3FYHA 5JD3A 3PFHA 1AA9A 5THQA 3MCPA 5LWQA 3QVWA 2JJ8A 2CXPA 4HAYA 2IZ0A 3FIJA 3LQFA 4CKZA 3I01A 1SRQA 3DD5A 1P7ZA 4CJ3A 2ZB3A 2WJZB 4KPUA 2R62A 1QQ5A 2QLNA 1F2UA 2N75A 3RS3A 2VQEB 1M1KO 1M8GA 3RM3A 3TINA 1QIEA 4OI2A 3DBOB 4U9UA 3G13A 4Z8YA 3ABZA 2J3LA 2NU6B 4AP5A 3KFLA 2AB0A 1WUJS 3CF4G 4NV0A 1JNXX 5I4BA 3CRNA 4X6YA 1GTRA 3A1NA 2R00C 3BXOA 4NZPA 2J32A 1JSXA 4Q37A 1LVGA 5HNKA 1G59A 4HQ6A 3S40A 4FDVA 5PGMA 1E2EA 3O4IA 3GNLA 2PO5A 3F5QA 4Z54A 1Z8NA 4AJEA 3RTVA 4MKZA 4L5IA 3VNBA 2JLSA 5A6SB 1TKZA 5E1MA 1QIHA 1QYRA 3D7KA 1E6EA 3EVDA 3HDHA 2LVBA 3Q41A 4IHQA 4Q47A 1KP9A 4FYYA 3PDHA 4HLNA 3BXGA 1R0CA 2YWFA 3IL2A 4ESVA 4GLJA 4LNAA 2HW8A 4PW0A 3KZXA 1FS6A 4KMMA 3A9SA 4HWKA 3WL8A 3SX4A 5J23A 1CS0B 2F90A 2P30A 5DCLA 3WKDA 1S6QA 2ID9A 3TR0A 1K5DA 3C4JA 2BUAA 3ZHCA 1VSIA 1N5LA 3OHPA 4QL3A 2JIZA 2QVYX 3NHSA 4WNCA 3U13A 3AOEA 3MAAC 1HFWA 2H8KA 3FR0A 4ZI5A 4MS1A 1TUIA 4PUOA 4IX1A 1DC8A 1XLTC 3OCCA 4P4TA 1GPDG 4GYJA 4YP5A 4QDTA 1BEUB 3WFJA 2XOXA 1K68A 4OKEA 3L01A 3ZDYB 5K20A 2ASVA 3HYNA 5DYWA 3B3GA 4MRMB 3SQWA 3HNOA 3DMHA 3JATA 4TMFA 1U8AA 1HKBA 5HF5A 1NPDA 3M5DA 2QRVB 3PFCA 2V52B 3ADBA 1K8ZB 1D5CA 4G9BA 1VSUA 1GAEO 5IJXA 4EZEA 3W4IA 1P91A 1XZHA 1R5OA 2RJ3A 3QE4A 4FK4A 4C08A 3ZDRA 4PF1A 1FU4A 5FPHA 1MH9A 4PU0A 2R85A 1A5SB 3CRRA 3FTPA 3N39C 2WHEA 1RLOA 3PI7A 5LLDA 4NKRA 1VZ3A 3DFIA 1CZ9A 3HI4A 5EKTA 4URYR 3OE7A 4UU0A 3MPOA 3HCAA 5LDGA 2VO1A 3CA8A 4DBZA 4Q66C 4HDRB 3SMQA 1QONA 4OF4A 1AB5A 4X1OA 1EFHA 5CEJA 4HHEA 4KUEA 1H2FA 2WKWA 4B3SB 4QUGA 1X8LA 1WZ2A 1KF0A 2CXUA 4QX6A 4FWLA 2K2WA 2P2CA 5LNK6 1RJFA 4YJGB 1HLFA 5AIBA 1AJEA 1FZTA 4XYEA 1PUIA 5HF6A 4UHBA 1AS0A 3C7TA 1VZ2A 4EY3A 1Y7HA 3GRRA 3O1IC 1PK8A 2GCNA 1BNCA 5J5AA 5B58C 2BAGA 1SKAA 3L40A 2OZPA 4BOYA 3PD1A 2JZOA 4FSXA 1RRCA 2JIMA 4NSNA 4ENWA 4AS2A 4EA8A 4BNVA 1D2RA 5CT9A 1TQHA 4OL0A 1OU0A 2P75A 1SD5A 1TLFA 3FLMA 1QZTA 5DYYA 1KZ6A 1EUCA 4F4JA 1FFWA 3REQA 3IR6A 4J0CA 3HVTA 3F67A 1OWLA 4MYUA 3IPCA 5JASA 3HP7A 2CFTA 4KIGA 3UA3A 3D4OA 2WHPB 1DXOA 4R79A 2AG8A 3PQCA 2O8FA 2FR1A 1XOIA 1LK7A 1OMOA 4UE6A 2HF9A 5LLSA 3RS4A 5EGNA 1XKXA 2HBLA 3FZNA 4EHHA 4EEZA 6REQB 2ZF5O 3L6OO 1OY1A 1IH7A 4EYSA 3DDUA 2DUNA 1U80A 3HRIA 4R1NA 2H92A 4ZV7A 2ERYA 3FMVA 4BEBA 1J2YA 1UR5A 4CGZA 5J2UF 1OAOA 4L0DA 5IVDA 3UYLA 2HB5A 4CGIA 2EKZA 4KH0A 5AR1A 5D3MA 2VHWA 3FVQA 2YFQA 4JLVA 2KZZA 4Z2AA 1XN4A 5IJAA 1HBJA 2QGNA 4E4TA 5K0BA 2EBHX 3DE4X 5BW6B 1WHSA 3A6JA 2JCVA 5LYYA 3FJ1A 4KFTA 2EBWA 3CQ9A 4HL6A 3ZXXA 4H6VA 4TTVA 2N47A 3UANA 5FI1B 4BCCA 3X1WA 4JKDA 2D1RA 1IY9A 4XE5A 5A4FS 4PKHA 3WL6A 4BX3A 1DEJA 2W6JA 2O48X 1IQ0A 4IDAA 3ICWA 4BNNA 4CTNA 5JZSA 1TGVA 1G7SA 4JXZA 3VQDA 1U47A 3DT8A 1F51E 4RHTA 2W83A 3TB6A 2EARA 4MQMA 1HFKA 4UHHA 3B7GA 4KO8A 2OHIA 1I32A 4CL2A 4QXPA 3HA2A 4FIDA 5HKAA 3VU9B 3KXKA 1AKNA 1IG3A 3RSCA 2C2OA 3WB9A 2ZZKA 4DQQA 1TKCA 3KVOA 4IJMA 4BYMA 1NX6A 5A4JA 2QJFA 4JMPA 2I2BA 4JI8K 1EWVA 2BMVA 3T1AA 1XZEA 1ORWA 1XTBA 1O95D 4WN9B 1SD1A 2CJPA 3ZJTA 3Q2OA 2B5JA 1C8BA 4P83A 2FRDA 1DEXA 5F35A 1JHOA 5CU7A 1ONBA 1T3VA 1JLMA 5B53A 3VYRB 3ZX4A 3FCCA 2EYUA 3QH4A 5EJ2A 2VLIA 3BERA 3H1PA 2MINB 3CPWM 3WYBA 5F9MA 1VQKN 1NGHA 3D81A 3EXHA 4YDRA 4D96A 3QFSA 2X2PA 3MN1A 1RTIA 3PRHA 3ZY2A 1U94A 2I62A 3BF1A 1NNEA 1FDWA 3T6KA 3IP7A 3WL3A 1Z5ZA 1PFKA 2B1RA 3EZ9A 4IDEA 4NECA 3ZTWA 4YV1A 1X1TA 1YZNA 3KU1A 5K0ZA 4KQMA 1I7SB 2GYVA 3HJBA 4BAZA 4IFVA 3JQGB 2C5SA 3GJ5A 2NRZA 4AIIA 3MIZA 1FJHA 2Q7XA 4O2AB 4R83A 4BP3A 4K3UA 4J1QA 4C8KA 1RRFA 2ZCVA 1CEQA 1XDBA 2BGIA 3FZEA 3TR8A 1N3YA 3RVBA 1USIA 1ZD4A 4FSVA 1X7DA 4F3OA 3QRWA 1JDJA 3LBFA 2PA0A 3EZ7A 4KI6A 3LECA 3I56N 4J0GA 2EX1A 3UJNA 3IIJA 3UTCA 2Y1JA 3SG0A 4NENB 1ZUWA 3WGUA 5F2NA 2ZSUA 3U3KA 1QP8A 2FWMX 2Q49A 2Q2WA 3KVYA 2LIPA 3ROFA 3P1GA 4DC0A 3UAXA 2DHCA 3S99A 5EXWA 2YCHA 3K30A 1UOOA 1IM2A 5EJ7A