2W42A

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt dna duplex.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGYEGTKVKLSSKRYLLTLLQMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPIRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enhancement of the Seed-Target Recognition Step in RNA Silencing by a Piwi-Mid Domain Protein
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein/dna complex
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN
total genus 137
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2w42A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2w42A01
1RTJA 2OENG 5IEJA 1SXHA 3HDVA 3V9WA 3QLVC 1N6QA 4EZ9A 4JLHA 4OBBA 3H08A 1C1AA 5E3JA 1VRUA 4H8KA 4PZ0A 3AVHA 4IFVA 3CG0A 4G0ZA 4EUKA 1FFGA 1WSJA 3OYHA 4IG0A 4PY5A 4I2QA 3TAGA 1NXXA 3F9KA 3DOLA 3OLWA 1WN7A 2OA8A 3H1FA 2IPMA 2EX3A 3IP7A 2WJWA 4DTJA 1W9HA 2FEKA 3E3MA 1JLBA 4KV8A 4DS4A 4NV3A 3RVNA 3F73A 4Z4GA 3P9YA 2CHEA 2DRIA 3ZSVA 5FROA 4ETIA 5KI6A 4B9SA 1Z16A 1UOCA 2XY5A 3AVMA 1U47A 2QKBA 3V9XA 3L2VA 4M88A 1RXEA 4DSLA 4GVMA 1DBQA 1TMYA 4CJRA 3DZDA 3U3YA 3O74A 3T1AA 2LIVA 2R4QA 3CG7A 4JS5A 1Z2EA 2MYUA 3IP6A 3OO0A 5BRAA 1QQAA 2KTQA 4ICLA 4YFUA 1VKRA 3LANA 3GL9A 4H60A 3SZ2A 4CJ4A 4W5NA 3IPCA 1KRXA 3WNEA 4DS5A 1QO0A 1NJYA 4O5BA 1WSHA 2PKXA 4MR8B 1JF8A 4AHTA 4OKKA 1CXUA 4CJWA 2H3HA 5C24A 1YMUA 2FQYA 3OYMA 4KTWA 2BDPA 2WB4A 2XRIA 3FFIA 5HRNA 1TKTA 4ID1A 3GBPA 3K5NA 4M3XA 5HM6A 4KHQA 4GPAA 2OYQA 3ZT0A 2P5OA 2QV0A 4JOQA 5IBQA 4DLEA 4B9UA 3UIQA 4FM0A 2AYZA 4WXMA 1LBIA 1ASVA 2FBVA 5J2NA 4IF4A 1KRWA 1JLEA 2HHSA 3JY6A 3KK1A 3SNKA 3UK0A 2VK2A 1ZH2A 3VQ5A 6ABPA 2RGYA 5CNKA 1WSFA 2JVKA 1UWBA 4N41A 3OLYA 4KHUA 3BRQA 3OYEA 1B9FA 3DLBA 1S6QA 3TMYA 3GT7A 3SQ1A 2VUHB 1CLQA 1SUQA 4C8MA 5CZ1A 4CIFA 2VWKA 4LH4A 1SL1A 1PHRA 3TAPA 3O1IC 1W0HA 2CD7A 4RWEA 4L8RB 1QSLA 2YNFA 4MRMB 4DG1A 4E7JA 3LKVA 1LWEA 3RVPA 3O75A 4PWDA 4WWHA 1RBRA 2FBTA 3SQ0A 3HSTB 2ZE2A 2JGUA 3K2PA 3V1QA 1ZAYA 3ALYA 3PO4A 3MMNA 3LUAA 1KFSA 1U48A 1W25A 2VYCA 3VQ7A 2FVYA 4BWMA 3KLNA 3WNFA 1TVMA 4CJKA 2JBAA 4JASB 3C97A 3LZIA 1RTIA 3HM9A 3NDKA 4ZHRA 3C6QA 1BIZA 4M3ZA 1DCMA 2FBYA 3QLTA 2Y1JA 4CERA 4EVQA 3TX6A 3SQ2A 3KIOA 4ETNA 2I6FA 4FLXA 1CZ9A 3L2WA 2D0BA 4E7LA 4KPYA 4QPJC 3SUOA 5I4CA 3ZSXA 3HPHA 4KFCA 3L8BA 4DF8A 4Z4HA 3BDPA 1UDRA 2OZMA 2MSKA 4CEBA 4CK1A 4NCBA 4Z0NA 4ZYLA 3RVRA 3TR8A 3SV4A 4TMYA 4LSLA 2HQBA 3OQOA 3QNNA 5DTEA 1NJWA 1APBA 2MSLA 4AILC 2XY6A 5EWMB 1EX4A 1A5XA 4O0IA 4CEQA 3Q7SA 5DGCA 3S99A 4FJ9A 3OO1A 4DADA 4YCSA 5KGXA 4KVFA 3DLGA 2MYNA 1CYEA 3HXMA 3OJUA 1RT2A 2FN9A 2Z1IA 2G8IA 5PNTA 3BREA 8ABPA 1TM2A 4MS4A 3V9UA 4F8RA 4YR7A 2WMYA 4JS4A 2FTKE 1VRTA 4H3KB 4CJEA 3N6VA 1NK4A 1NXSA 1QHTA 3SG0A 3LUCA 2ATQA 1X9WA 4RG8A 1BIUA 1LAVA 4RKQA 1Q9XA 2HPHA 3JVDA 1AB6A 1JBEA 3MAQA 1JX6A 2PUBA 1NKCA 1JL1A 2PL9A 2O20A 3ZT3A 4LRQA 1IKYA 1DLOA 2J48A 3F7NA 5D3GA 5DMRA 3JTEA 4RS3A 1VPWA 5DK5A 3VN5A 4CF9A 3N8IA 4IMJB 4MS1A 3H75A 1JFVA 3S3NA 3AA3A 1SRRA 2E4ZA 3RR7A 4N47A 2HQRA 4NQRA 1B9DA 4IRXA 1Z13A 3RVOA 1EXQA 5SWMA 3I0RA 1ISRA 2A1RA 4FJ5A 4LE0A 3VQQA 4YRZA 4C8KA 4DQIA 3MA0A 2IS3A 1TLFA 3HL8A 3QEMB 5C5EA 4DU4A 2HW3A 4RK6A 1BDIA 2FEWB 4BWJA 3V9ZA 2ZQBA 1JFTA 5FWXB 1D9DA 2IC3A 3R0JA 1SD5A 4YGXB 4LDAA 4CIEA 2JVIA 4FW1A 3QX9A 4EGSA 1QSYA 5HRPA 3BRSA 4Z0UA 1BCOA 4FLUA 3M8PA 2OPQA 3KHTA 4XXHA 4E19A 3NH0A 4E7KA 4BDYA 2NZVG 4DSJA 5TQJA 4KTQA 3IRXA 1GCAA 1ITGA 4B08A 2DFHA 4GMJB 1KLMA 3LALA 4IDKA 3IDOA 3MF4A 1ZESA 3LWMA 4OPJA 3V9SA 4F11A 1GUBA 1IKXA 4RW7A 4CJSA 4CHYA 3RVMA 3AO3A 2QKKA 3RR8A 1J5OA 3CS3A 2A9QA 3QEWA 1JL3A 1N5YA 3I8DA 4CE9A 4B9LA 3EULA 4KHYA 3M6MD 4MR8A 1EHCA 3CM6A 2LSNA 2VG7A 1LWFA 4G0YA 3FFWA 1Y1LA 5CNIA 2IDMA 4Z4CA 3LAKA 4RW4A 4CJUA 2FW0A 4CFDA 4CFBA 4F3TA 3MXIA 4KFBA 2DY4A 4DQPA 3NHMA 1VLZA 4ZTFA 1S1TA 1ASWA 1FKPA 5KRTA 3CKMA 2E4VA 3CG4A 1BI4A 4MS4B 5C25A 4OKJA 4DTPA 4CESA 4JB2A 3N0WA 1NATA 2M1ZA 5KWSA 4CJVA 4TLLB 3E61A 4E3SA 1S8NA 1AB5A 3S9HA 3M8SA 5CZ2A 3VQDA 2B4JA 3O2SB 4CGGA 5TPZA 1ZBIA 1FXXA 1BCMA 4B3OA 3EQ2A 4F2RA 2GUIA 1C6VA 2KZMA 3THVA 4MLCA 3O1JC 2HSGA 4Z4FA 4HNRA 4YS6A 3TABA 5FBKA 2QR3A 3I09A 3QK7A 1VSEA 5DLEA 4E7HA 1JFSA 3ULDA 3MEGA 2MYTA 3OJSA 3ILYA 3I5AA 3LP0A 5KC8A 3T6KA 3MEDA 4R5PA 4N76A 4XLTA 2G8HA 1QQBA 1GOBA 3EDCA 2L17A 3K59A 2QXFA 1SXIA 2A9RA 4DTUA 1D1PA 3AVBA 1ZH4A 1D5WA 3VQEA 1L5YA 2R47A 4CHPA 1S9EA 3EYZA 4KREA 1EP4A 1JLCA 1C0EA 1RXIA 4G0QA 4FZZA 4ZMRA 4EYOA 3KKSA 3V4IA 1QNLA 3SUQA 2A1SA 1D8YA 2R25B 1TKZA 1NJXA 3Q7TA 4Y1DA 4CEEA 4UHKA 1T03A 3QLUA 3DYAA 2OPSA 3Q41A 1KLNA 2JB9A 2RDMA 4NYNA 3NF7A 4MAAA 3Q7RA 1NY5A 4YLEA 3AO2A 3L49A 4FCYA 2YHBA 1F4VA 5HROA 2B4AA 3S3MA 4FJ7A 4Q0BA 1JH9A 2KFZA 1DCFA 3HJFA 4CK2A 4FZYA 4L4UA 3P83D 3AO5A 4EYKA 5BR1A 3JVIA 5D2CA 4M3TA 2PUGA 3H5TA 3TI0A 5J1EA 3AVIA 2H0AA 4CIGA 3EZ5A 4F12A 1JLAA 1IKVA 1E6MA 2X7XA 3PV8A 5GOTA 2RN2A 2HMIA 3SAJA 4OATA 5J2QA 5FRMA 3OM1A 2KW4A 2PZSA 4B9MA 3G0ZA 2KFNA 1LAWA 3UUGA 1MB0A 4LDZA 3LUDA 3NBPA 4UQGA 4CFCA 3JPWA 2YNGA 3DI6A 1RBVA 3LTEA 4CECA 4OJRA 1NXOA 1B92A 1BL3A 2V0NA 2PMCA 2RJOA 3O2JA 1U04A 4EZ6A 3OVNA 4PUOA 1XC9A 2PE5A 3NF6A 3G10A 3TWHA 4G1QA 1A5WA 3QERA 2AYXA 4AHCA 3HPOA 1A2OA 1A04A 1JLQA 4B8CA 2WOMA 2PUFA 3T8YA 4H4MA 1JHZA 3ROTA 4QOZB 5HSGA 3PUFA 3RVLA 1HQEA 4RK0A 3L2RA 4CF1A 2OZSA 1ZGZA 1Z26A 5BRJA 3QELB 1WETA 4CHNA 4Z9BA 4KRFA 3RMBA 2LPMA 4RK5A 4AHSA 1SKWA 3ZSWA 3NNDA 5JNRA 1M5TA 2PJUA 3KTOA 3OQMA 4E1MA 4BACA 3T38A 3C6TA 2CHFA 3MEEA 4EYGA 1Z17A 1KGSA 1RDAA 1QP4A 3TB6A 1C0UA 4DU1A 4Z9AA 4KNYA 4HCBA 3K5OA 4JRPA 1T05A 1VSFA 3OLXA 4MQEA 2GBZA 3ZCMA 1M2EA 3QO9A 4MS3A 3JS5A 3HVTA 1P6QA 5IUJC 4MS1B 1RT3A 1L3VA 3A10A 5TQ0B 1EETA 1Z25A 4OVLA 5EWLA 2ID9A 3S3OA 3RMDA 1VSLA 1JL2A 1RCHA 1BGXT 5F64A 2FKAA 4G0XA 1E2BA 4UHJA 1L3UA 2YNHA 4CGHA 4PA1A 3C3KA 1NK6A 3VQ9A 4CGJA 3M8RA 3VA3A 4F4KA 4DTSA 4CEDA 3TAFA 1U49A 4DQDA 1VSIA 3KLEA 3NBMA 2BANA 4FJHA 4MQFB 4BDZA 2AJQA 1NOZA 3DRRA 3G1WA 2QK9A 4ZMSA 1NXWA 3C94A 3FFXA 3L3UA 4FE7A 2HHUA 1SKSA 1HYSA 1VRVA 4FLTA 2FSPA 5TE9A 4QICA 3ITHA 2TMYA 5FWYB 5HQJA 4CEAA 1D2AA 3TAEA 1QTMA 3IP5A 4MFBA 1E6KA 1ZDMA 3DGEC 1MB3A 3QESA 2GKGA 2XHBA 2GBPA 3FMVA 1YMVA 4P98A 3QIPA 3OQNA 4O55A 2E4LA 1USIA 1HPZA 3SI6A 2PAFA 4F8JA 3O4NA 1WSGA 4CJTA 3WNGA 1GOCA 1E6LA 4CEFA 3AVNA 2RJNA 4OKEA 3ZSYA 2Z1GA 1IKWA 3OYAA 3H6GA 1WAFA 1XHZA 3SQNA 4GNRA 3KD1E 4DWIA 5IUNC 3LUKA 3HEBA 3CFOA 5JNWA 3OYFA 2E4YA 4M3RA 5KGWA 3MIZA 1JXEA 3HO1A 1GCGA 3P5JA 5EWJB 3LP1A 2PYLA 3NH1A 1TJYA 3BGRA 2FN8A 4TLMB 3PO5A 5IULC 4G86A 1RT4A 3EGCA 3N0XA 1RZRD 4I9QA 1ZGGA 1YIOA 4MPTA 1QQCA 4KTZA 1J56A 1P6UA 1PNTA 4FJJA 3QEMA 1Y97A 3O4QA 1UAXA 4ZTJA 2LUOA 4CHZA 3TANA 1QO0D 1Z2DA 5TQ2A 4DFKA 1L5UA 2D0CA 4C8OA 2GI4A 4QYMA 4YP9A 4CJLA 3I42A 3NNSA 4O1HA 1PUXA 4KB0A 3N53A 1WSIA 4FJIA 1DG9A 1NXVA 4DTRA 4B09A 3I45A 3EQZA 3GYBA 1BDHA 1C1BA 4HUFA 1S1VA 1YS6A 3KKRA 4MS3B 3FDFA 4DTNA 3IPAA 1S5JA 3NNNA 3EY1A 2HNZA 1DC8A 3SYZA 3V1OA 4FM2A 4RK4A 1EAYA 4M3UA 1JLGA 1YK0A 1S1XA 3ROFA 1DC7A 2FMHA 2LBPA 4FJ8A 2YHAA 4DFMA 3HUTA 4KQCA 5CY4A 1SL0A 5KTQA 5EU7A 1VK0A 4C8NA 4HUGA 3URMA 3RVKA 1D4ZA 2PY5A 3H5VA 2X6SA 2Q5CA 5CHYA 3NF8A 1X9SA 2QW1A 4J2BA 4MR7A 4ELTA 3OS2A 1EWVA 3K58A 1QP7A 3EJWA 4YWHA 4P1ZA 2ITGA 4G97A 1NKEA 1TAUA 4IFYA 4HCCA 4TSXA 1A5VA 4OPKA 4RSMA 3JPYA 2A9PA 3NGYA 3CNBA 1C1CA 3KG2A 3D45A 4BDPA 1U0SY 3HYFA 4I9LA 3CM5A 5HRRA 1HEYA 1DRKA 3HPGA 2WWVD 4N03A 3NAEA 2IAJA 3UKJA 4BE0A 1FFSA 3QX8A 3QETA 3PY8A 4Q6WA 1KRPA 5JS2A 3N75A 1X1PA 1DRJA 4N0PA 4JB0A 4RXTA 1VSDA 5CYQA 3HDGA 4E7PA 2FMIA 4K8ZA 4FJMA 3NF9A 4HHTA 1GLGA 3DOKA 3O1HB 3SM9A 3LPTA 3F6CA 3ISNC 3LAMA 3QELA 3MM4A 5T3YA 1EKEA 4CJ3A 3OYGA 4RY8A 1C4WA 1NJZA 2ZWMA 2IYNA 3D8UA 3K9CA 3MXJA 3IP9A 2P51A 4MGEA 3T3FA 3A3KA 3OYCA 4WZZA 2P4UA 1Z12A 5EWJA 1KFDA 3KYIB 4LE2A 4M42A 4DQQA 3L2UA 5BQ3A 1VSKA 3LP2A 1BISA 4LSNA 4XAQA 2YV0X 1NK0A 2WONA 1O1WA 4J2AA 3IG1A 2IPAB 2RF2A 1MAVA 2XY8A 4KAZA 5FRNA 2E4XA 4BE2A 3OMWA 2B1JA 1NK5A 3NCIA 5EWLB 1G15A 3DM2A 4FVMA 2KQ2A 1FK9A 9ABPA 1R0AA 4G0MA 4CBVA 3ZSRA 1TK8A 4KHSA 3MYYA 4CCHA 1S1WA 4O5AA 1JKHA 1WLJA 1JYFA 3LKBA 2R48A 5CNJA 4Y9TA 1I3AA 4FLZA 1OXBB 3RVQA 4KK4A 3EAFA 3C3MA 3JSMA 4DQRA 4PE5B 1DTQA 4HVJA 3QINA 3K5MA 3PX4A 4J2DA 2X6NA 3E01A 5KRSA 4XIUA 3H5IA 2KYRA 4E7IA 2HNDA 5FBHA 4GW6A 4RXUA 2YNIA 3QLVA 4LX8A 3FFTA 3KSMA 4IMIB 4IGAA 2ETJA 1VSMA 4PICA 4LZLA 4WT7A 4DSIA 1USKA 3AO4A 4D6XA 3CZ5A 4B9VA 3SQ4A 4EP4A 2X74A 4Z4EA 3RMAA 4KI6A 1QP0A 1QKKA 1K66A 4NCGA 3SCXA 4OGCA 4FJGA 2FEPA 3CFYA 5I3UA 4DMNA 1IH7A 1HYVA 4DFJA 5SZTA 3HUUA 2O4IA 3V6DA 4W5TA 1T34A 4MR7B 4KO0A 1RZRA 5TQ0A 3KJVA 4RW9A 4MQEB 1T8EA 5IEBA 2P5GA 2XDYA 2BGGA 4Z99A 1RBUA 4YO7A 3O3GA 2PUDA 3OYIA 2JVJA 2L2QA 1NK9A 1KTQA 3T19A 1LV5A 2ZD1A 2PLNA 4YNQA 4N5SA 2IDOA 1LJLA 5KC9A 3AA2A 3QEXA 3KCNA 4KV7A 4OLAA 4H3HB 1GOAA 2XY7A 4AH9A 1RNLA 1JXBA 2MSWA 5DCLA 1K68A 2E4WA 4DFPA 1HRHA 4FZXC 1HNVA 5HBMA 1LW2A 2D5RA 3B6OA 5HKOA 3LUFA 2F96A 5HP1A 4J2EA 5GQSA 3N0RA 1ZN2A 4JAVC 1UA1A 3V1RA 1NKBA 3AVAA 3K5LA 4CEOA 1C0TA 4DQSA 2I5JA 1MIHA 2HHWA 2X78A 3LUHA 5ABPA 1GUDA 1U2PA 5T7BA 4AHVA 4MR9B 3ZT4A 3KK2A 4FLWA 3KLOA 3M9XA 3Q9SA 1JLFA 4RKRA 1ABEA 3DLKA 4CHQA 3AVCA 5TPWA 4CGDA 1PEYA 4PYRA 1PEAA 1C0MA 4FLVA 3SNNA 5CNMA 1X9MA 2DTUA 1KCFA 5DKFA 2G8FA 3CU5A 3HZHA 2KZZA 3KK3A 4S05A 3O3HA 4WXEA 2VG6A 4I2PA 4HNSA 4JP1A 3HT3A 1TKXA 3TARA 2Z1JA 1HQUA 1RT6A 1JDNA 1BDJA 2OPRA 2HHXA 4N56A 1YS7A 3DMJA 1RTDA 1CZBA 3ASMA 2F8SA 4WE1A 3NHZA 2G8VA 2L19A 5CYMA 3HVRA 4ML3A 4OTZA 4MQFA 5TPWB 3DGFC 4O4GA 1ZY2A 4RK1A 2JRLA 3V81A 1TKDA 4MRMA 3D02A 3IS9A 1HJRA 2WY2D 3VQBA 1JWLA 4NICA 1J9AA 4ETMA 5C5CA 1LBHA 2E6MA 4HUEA 3C95A 2PYJA 1NTRA 3KYJB 4QAGA 3P1GA 1CEYA 3HK2A 4Q5VA 1F21A 4CFAA 5JNTA 4FJXA 3OYDA 4CK3A 3KS9A 1KSPA 3JYTA 1ZITA 1RDCA 2XO7A 1SL2A 3KTQA 4E0DA 4RY0A 5KQMA 1Z15A 4CHOA 1LJUA 4EVSA 3HCWA 4S04A 1SXGA 4FXDA 4OG2A 4OGEA 5FWXA 1I3CA 5B3JC 1MVOA 3QNOA 4CF2A 4KI4A 3TAMA 2LP4Y 3DRPA 2IPLA 3U6FA 5K14A 1DP4A 4Q7EA 1SV5A 4HYEA 1BA2A 2R7YA 4FW2A 4M41A 3RRHA 1IG9A 4MR9A 1K6YA 1XHFA 2Y1IA 3AA5X 2N9UA 2RKIA 4FJKA 1CXQA 3O3FA 4KQ9A 3KLIA 4MYRA 1DBPA 3H1EA 2QVCA 1DZ3A 3OM0A 4CGIA 2ZAYA 4W5QA 2VUIB 1M5UA 3FGZA 1CHNA 2JCGA 2G8KA 5HLFA 2FXIA 5JNVA 2F8TA 1U8TA 2VWJA 1F51E 4CF0A 1JLKA 3VA0A 4O1IA 6CHYA 5TQ2B 1NK8A 1ISSA 2P9HA 1TL3A 1IIBA 4CJ5A 4MQ3A 3SJJA 2HVHA 5FDLA 3DBIA 2HHVA 1PNRA 1D1QA 3U3GA 3LOPA 3AVLA 1S9GA 2JBAB 2HJ9A 5KQGA 1YT3A 3L3VA 1S6PA 3C6UA 4Z4IA 1EWTA 4IG3A 5IUKC 1TVRA 3K4HA 3OLVA 2NT4A 2WRZA 4YV7A 4KHNA 1WNSA 3MECA 1IO2A 2PUEA 3TAQA 1KVAA 3BILA 1TL1A 4XARA 3LZJA 4F2SA 3A0UA 4KMRA 4DU3A 2E4UA 1P8AA 4NYFA 4PQUA 5J2MA 4D74A 5ED4A 5EWMA 3IAYA 3SUNA 2PUCA 1NOYA 1QE1A 1ASUA 1RBTA 1P2FA 3OYBA 3PX0A 5I42A 4W5OA 1FQWA 3HP9A 2QU7A 1DJMA 3ZT2A 2FQWA 3NHGA 3LWLA 2PL1A 1XWLA 2IOCA 4M3WA 4FB4A 2M98A 3OYNA 1QSSA 4CJQA 4QCLA 3H1GA 4K8XA 1Q9YA 3HP6A 1JDPA 3PX6A 1YTAA 3KJXA 4IBNA 4JRQA 3LFTA 3QEPA 3O21A 2QXYA 1YVUA 2HHTA 2BE2A 3AVJA 4FK4A 3D0PA 1QS4A 2QVGA 5JNUA 3NH2A 3B6PA 4RV5A 4OLBA 3SUPA 4F06A 3M9WA 3SY8A 4JA2A 3CFPA 4E7OA 2NUBA 3KD5E 4LH5A 1UA0A 1U2QA 1WSEA 4DSKA 3OYLA 1S1UA 1HNIA 4FK0A 4FM1A 2Q3SA 3VQ6A 5KQPA 3AVKA 4O44A 2JLEA 3ZSOA 3MQ4A 4DN6A 3EODA 3RH0A 1HMVA 3LMKA 3LUJA 4DF4A 4CF8A 4DTOA 4O0JA 4IKFA 2E6LA 3RQIA 4G0PA 3CYMA 3QEVA 1Q8IA 3OLZA 4IILA 3VQ4A 2IKSA 3SPZA 1HYZA 1D9FA 3F6PA 1J54A 3ZSZA 1RT5A 2GX6A 3DLRA 2YKMA 3H5OA 3NFAA 4G0OA 1DBWA 4EYQA 1DCKA 1ZVVA 1NK7A 2FBXA 1RILA 1TK0A 2HVIA 3GV0A 2GV9A 2FQXA 4D6YA 2Z1HA 4N0QA 4CJPA 3CQ8A 3OYJA 2HB5A 1B00A 5E41A 4ZJPA 3K57A 4ELVA 4DSFA 3O2QB 2QSJA 2DFEA 2ID7A 1RDDA 1ZBFA 1EWKA 1TAQA 4L85A 1BQMA 1L3TA 5C42A 2FMKA 4EY3A 2IPNA 1BVHA 4B9NA 3A0RB 1U45A 3M8QA 3DLEA 3LPUA 4RW8A 4ELUA 1L5ZA 3H5WA 1USGA 3ZT1A 3KLFA 4CGFA 2IGIA 1L3SA 2HNYA 1OXKB 4ID5A 5IX8A 1FFWA 4BE1A 4W5RA 1URPA 3L6UA 3LDSA 1VSHA 4DSEA 4C8LA 4QYWA 3A2FA 4DTMA 1LW0A 4LD0A 4M3YA 3QLHA 1LWCA 2MYPA 3OS1A 4F3OA 5JS1A 4LE1A 4B8AB 1JYEA 3VQAA 1KVBA 1EFAA 1BQNA 1ZYQA 5JNSA 3H6HA 3TO5A 4FE4A 3NE6A 1BI4B 1I39A 1RDBA 4NCAA 3BBLA 3SV3A 1ZBHA 1WAJA 1TK5A 4Y1CA 3OS0A 4ZPJA 3VNAA 3KLHA 1KMIY 5J2PA 3LUGA 3VQ8A 2O4GA 3NGIA 4XFKA 3H5LA 1U4BA 1MU2A 2L18A 3GA5A 3RVSA 3LP3A 4FJNA 2FLKA 2QZJA 3L2QA 5IC5A 5HRSA 4FYDA 4CEZA 4TN5A 3GWGA 4EVRA 3QEKA 3GRCA 4FK2A 4Q6BA 4EP5A 2HQOA 4KZKA 3Q15C 3ZSQA 4HNQA 2FC0A 4RK7A 1XWWA 1XI1A 1FKOA 3NGZA 4LY7A 2P1JA 3OYKA 4H4OA 1D5AA 2B5JA 2RPIA 4AHRA 1BAPA 3ILHA 1A0OA 4E89A 4AHUA 3I0SA 2D0AA 1KVCA 2WJAA 3QIOA 3AVGA 3TD9A 3HSYA 1RTHA 3SPYA 3VNBA 4I7FA 2FMFA 1R8JA 2G8UA 2A9OA 4HTUA 1RPJA 4M45A 5B3JA 4B9TA 1ABFA 2OPPA 3CFRA 7ABPA 3RMCA 3KLGA 4RU1A 1RBSA 2GWRA 3CTPA 3CZCA 5FWYA 1RT7A 4KK3A 4XASA 3KKEA 4MLDA 1J53A 3DRSA 3T95A 3G85A 2W42A 3HS3A 3WNHA 5KQLA 4WUTA 1XHXA 4RZSA 1RNHA 3RVJA 4KKOA 1XHEA 1TV6A 4DLGA 3AO1A 1DTTA 3OMXA 1BHLA 4E1NA 4RW6A 1QPZA 2YKNA 2NT3A 4RDCA 3AVFA 1T7PA 2VG5A 1YTUA 1TGOA 4FJLA 3MXMA 2NZUG 1Z18A 3GBVA 3W9SA 1ZHHA 3B2NA 3VQPA 1ZBLA 3AV9A 4KHWA 4DTXA 3QLUC 3CLKA 1SKRA 4RXMA 1LK0A 2CWDA 4RY9A 2PUAA 3C3WA 4FLYA 3CRNA 3RWUA 2IOYA 1YK1A 1M2FA 3AA4A 2G8WA 2JK1A 2EHGA 1ZBUA 1QMPA 2B6AA 5TPZD 1NXPA 1REVA 2HHQA 1H9CA 3RRGA 1RT1A 1NXTA 3QEIA 2DFFA 4CJFA 2OQRA 3VQCA 3CHYA 4PEVA 4KB1A 3DLHA 3RTVA 1FSPA 3OY9A 3HV2A 2FLWA 1VSJA
chains in the Genus database with same CATH superfamily
2WNIA 1RTJA 1JSLA 3U7EB 3HGMA 4LVUA 4QUJA 2OXIA 3P7MA 1QGUA 2DVMA 3VR5D 3WR5A 1SUSA 4AN1A 1VSBA 4FWQA 1NYLA 1M6NA 2UYGA 5EUBA 4OBBA 2IQIA 1OBHA 2UVPA 2GO7A 3D0KA 1GFIA 5EHGA 1XZ8A 1UK6A 1FFDA 5BREA 3NMUF 4PZ0A 3P9XA 4BL5A 4EQ6A 2W22A 4DEVA 4DMLA 1XG5A 3VC7A 4H5WA 2NACA 4XVUA 3DAOA 3A3OA 2EF0A 3BVPA 2QWOA 4QELA 3CG0A 1COWA 3DHYA 3FTDA 3LXXA 5ILQA 4EUKA 3ND5A 4TROA 3VPGA 3JD1A 4C7OA 3E9OA 2H31A 4YNBA 2CDAA 1SKUA 2AKAB 3ZKWB 2QBYB 3JQGB 4AZ0A 4PY5A 4I2QA 2D5CA 1KVTA 3ZH2A 2O2CA 1CG6A 1YRWA 4I36A 1U7UA 4INJA 2HDHA 4IIGA 3IUYA 4OEHA 2PSFA 4XDHA 5FOUA 5F5LA 2A5FA 2W6LA 2IXFA 5BWCA 1P4HA 3OLWA 4JKCA 1ZKMA 4QULA 5ALJA 2OA8A 1BHJA 3B6IA 4NYMR 4LK3A 3UHPA 1Q0ZA 1L8AA 2OD9A 5JZVA 3IP7A 4WQ4A 1PL6A 2GR9A 4OQPA 4E31A 5FJIA 3TUJC 1M2VA 1JLBA 3EIFA 2AN5A 3ENNA 4E88A 3KSAC 4AKHA 5CXQA 4TTQA 1GNPA 1MEJA 3C8HA 3PC8C 4HFRA 3RVNA 4EY7A 4Z4GA 1JV2B 3R3JA 3SIWA 2QUHA 4E14A 2CHEA 2O8BB 2I4NA 3UKUA 3EUEA 3FDJA 4BR5A 1E99A 2DRIA 2PCJA 3Q4GA 4CTNA 2P4SA 4ETIA 1I2MA 1Z16A 3DLTA 1V4BA 3NG1A 4QL3A 1N5IA 2XY5A 2QYSA 2IU0A 3GEEA 3EPPA 4ZYYA 3TM5A 1K92A 4FZVA 3AVMA 3KT8A 5AKYA 3WXLA 3V9XA 5HCUA 5D7BA 3ROMA 2PX0A 1A8PA 2PGIA 4FUQA 4MUGA 5F7OA 1N6RA 4HZUA 3MRSA 1RXEA 4BZZA 1D2MA 1N2EA 4GVMA 3R5XA 5HEKA 1WXIA 3DFZA 3P2MA 5EQTA 2RCNA 1M6WA 3AEUA 4EAAA 2ZB4A 1SQ5A 2LDXA 4EEKA 3DZDA 2AOTB 3T1AA 2PR2A 5JWOA 3T52A 3G59A 3SJUA 4ESEA 2X22A 2O3JA 3CG7A 4JS5A 1N2XA 1Z2EA 2C9CA 1DV2A 3UV6A 3WK6A 5BRAA 5CFLA 1LV8A 3MSCA 4RKWA 3DOIA 4CEHB 1XWIA 1ZNQO 3Q7BA 3FI0A 1Z5ZA 4KQEA 1ZN7A 3HU1A 4O29A 5KHAA 4ICLA 1VYVA 3G8BA 1AGRA 1H3FA 3RRFA 4PNEA 3A6FA 2ECKA 1CUUA 3JZDA 4F2WA 3LS2A 4M7RA 5JISA 3LANA 4H60A 3OJXA 2JHFA 3I2HA 3L1JA 4Q16A 4D8TA 3KVOA 5IYZA 1A8QA 4RJIA 3SF8B 4PYLA 1VQ1A 1QHFA 1QO0A 3F6BX 2A57A 2ZDQA 3W3AA 4BEVA 4MR8B 4W5JA 2XCIA 3P2KA 4YECA 2X0FA 4CJWA 1H6CA 1VHJA 2EGUA 3OI7A 1YMUA 3MRTA 3AH8A 5JPDA 2RG7A 1AV6A 1SCUB 5ARDA 4D8WA 2N3ZA 4MRNA 1IY8A 2PQ6A 4XFDA 3DNPA 3ZWKA 1F7VA 1U3WA 5DM6L 1TKTA 3JQ7B 4I6JA 3L04A 2FFBA 3F5MA 3HXPA 3QWBA 5JBNA 1G7SA 5DX8A 3Q6MA 2VEDA 4CCSA 5HM6A 1MV8A 3SJHA 1BGVA 2PO5A 3BXPA 1KYQA 4YJGB 3PJEA 5CJJA 4BGIA 1VMAA 3G1TA 3GJ6A 1DWOA 4F04A 1OLXA 1ODIA 4YK7A 4YEDA 4ZU6X 1CLEA 3ZT0A 1E6UA 1G5FA 4FMDF 5SV2A 2LV8A 2P5OA 1JILA 2OHXA 4JOQA 5J4VA 1C1DB 1REQA 5E4YA 4DLEA 2GBLA 2Y6UA 3KQVA 2HD4A 3ZUPA 1RQXA 3D54D 4OQZA 1TVEA 1J5XA 4EUHA 2AYZA 2D13A 3IV7A 3OPXA 2HDOA 1LBIA 4IUYA 4ME6A 4MW9A 2PBZA 3ZTWA 3CW2A 2XVYA 3RUPA 1T1RA 2FBVA 3B1JA 2VDQB 2JFWA 2ZTSA 3A2NA 2R7LA 2AA4A 1FMTA 1RWBA 3QYPA 4FFBA 1Z2OX 2FRVA 1JLEA 3JY6A 4YDHB 2EWSA 1K7SN 3BMXA 4I6GA 1QTNA 4IUBS 1RVDA 3KK1A 2KBEA 1XD2A 2J6HA 1SS6A 1D9XA 2QGZA 2YC4C 2HNAA 3KYDB 5CXXA 3TL3A 4BVAA 2QQGA 2WFMA 3VQ5A 3OCVA 6ABPA 5ALLA 5CNKA 1WSFA 2JVKA 4UUQA 5AKJA 3BC1A 4BLSA 1OXSC 4B7CA 1VHDA 3K8YA 2YN0A 4QUAA 1BDBA 1R4MA 2XWJI 3GD5A 1DELA 3NVKI 1DWUA 3IURA 1E98A 1SU4A 2XQGA 5E6UA 5BT9A 3OYEA 3DPUA 3MB8A 3OQVA 1DIRA 3PC4A 4H59A 5DISB 4PCAA 1DOAA 3K4QA 4QDUA 1ETUA 4X84A 4BLOA 2LW7A 3I4FA 4BTVA 1XKTA 5CFPA 4P08A 5BN4A 3L7DA 3SQ1A 4KGZA 1R0XA 1D07A 1RKQA 1UFOA 1CLQA 1XALA 5H80A 1GZDA 1ODSA 1Q82O 2Q45A 1UZAA 1Z37A 3TUIC 1NMDA 4ZVQA 1JXMA 1Z6GA 4J16A 2ADFA 1YJBA 2RBGA 3TXAA 4BAZA 4LH4A 1SL1A 1PHRA 5LYJB 1NDHA 3TAPA 3HM2A 16PKA 3O1IC 4CEJB 1GG9A 1RQ2A 2WILA 4L8RB 2QN6A 3AVXA 4NZYA 4DG1A 2NSJA 4OMCA 1LBQA 5FBRB 4MULA 3RRYA 5KINB 5LD2C 2NU9B 1K6IA 3O75A 4OHYA 2BGNA 1MGOA 3BICA 4HH3C 4PWDA 4JVNA 2P9LB 3PDJA 2YV5A 4B33A 5AW7A 3OEED 3K4PA 3Q87B 2NP7A 1XTVA 3FUVA 3G8CA 3VPHA 1X15A 3HSTB 1S2OA 5LQNA 4K28A 2PNFA 4RH0A 5I6DA 3ALYA 3KZCA 2H4ZA 4EG3A 1YA6A 1QYCA 5CAEB 2P4EA 2B2CA 3C6KA 4TYPA 1HDYA 3A36A 1RDUA 1CR2A 1AA9A 2AX4A 2ZSBA 1C1XB 3VQ7A 3O5AA 2QXUA 4JJEA 2NRVA 2FVYA 4BWMA 1W7AA 5I7SA 3ZVKA 2I7PA 5GONF 4D26A 4YDQA 3QUSA 4JB8A 1LTQA 4HWTA 3WNFA 4NAUA 4RD6A 4QPCA 3OPMA 4CJKA 2CCKA 2ASPA 2PGAA 3HGQA 4MVWA 4Q9NA 1ZUD1 2ZJ3A 1JLLB 3VPDA 3C97A 3LT1A 1T5DX 3HM9A 3GGPA 5ALMA 1VE6A 3D3JA 1BIZA 4L4RA 4XYBA 5A02A 3F7OA 1AK9A 4AM6A 3PHIA 3Q7QA 4D82A 1UAYA 1XLVA 3PUZA 1XRJA 2WWIA 3ENBA 3SQ2A 1HDCA 3IIJA 3KIOA 2M32A 2QUJA 1CZHA 2X0JA 3BE4A 1RWPA 3QM1A 1DG1G 4FTWA 4BVGA 1CZ9A 5FR2A 1TGVA 4DR6K 1Z5NA 1NGGA 1SXJB 3H2SA 3WMWA 4E7LA 1Y8QB 1A97A 1T3GA 2E9SA 2QTRA 4L2IB 4M49A 1Z82A 3PQ8A 4TZTA 5CIQA 3JYLA 3G8YA 3HXTA 1DEKA 1BHO1 4R3WA 2ZT7A 3UANA 4WIAA 3V3KA 2ZT6A 2JFQA 3INNA 3BKXA 3AR7A 3H2KA 4YLGA 3ZDCA 4WZBE 2VTEA 1JSXA 3QIVA 3HPHA 5DHSA 3AM4A 1QSGA 4DLLA 1G20A 2R6DA 3IJRA 4QQRA 3RTAA 5JAIA 1CF9A 1CX9B 2I1WA 2X5NA 4CEBA 4GSKA 2DFNA 1YDFA 2BKUA 2CXOA 2R6GA 4NCBA 2H1RA 4KB5A 5JWHA 2K87A 1O5OA 2YBDA 2OZVA 2GEMA 1C9MA 1NNUA 1ZJYA 2JFZA 3AJRA 5ALDA 1ML3A 2IIVA 1BWFO 3AVQA 2GA8A 2HMAA 2HWKA 3FMPB 3O9VA 2P62A 4KYUA 1V4NA 4FGJA 4LSLA 1QH9A 2NV2B 4TMYA 4MO4A 5EE3A 2OGSA 1L6RA 3QTLA 2JJYA 1VKNA 1APBA 2DMRA 1RM3A 2MSLA 1BHQ1 4TXMA 4UAGA 1I2DA 3CT6A 3CCEN 1EX4A 1PR0A 4MI9A 5FA5A 4L95C 1Q2UA 1B76A 1NW3A 2JFGA 2R6FA 3SKVA 4ZOCA 4CL0A 3OO1A 2XQVA 1LKZA 1Z34A 5KU7A 3LM2A 2FG6C 3WWEA 1U2VB 2CW5A 5JEDA 4FHZA 4DQ0A 2ZB7A 4B3RB 4CZJA 3DLGA 1PGPA 2OBFA 4GRAA 5JMWA 1E5VA 4JNCA 4G5GA 5C1DA 3OJUA 4LF7B 5E2IA 3MIIA 4RVCA 1Q5PA 4AMUA 3OUUA 3CRMA 4UC0A 4BJ3A 4BNDA 3A3NA 3VR3D 1LD3A 3PGLA 2IHKA 3UG6A 2J5BA 2QTGA 1Z88A 5FEMA 1WDKA 4RJLA 4WGFA 4IR7A 2DPHA 4YR7A 2FZCA 5JCPA 4I5FA 4WK4B 1MO4A 3N2IA 4EARA 3BY5A 1PQ4A 3QVKA 2IYQA 4TTPA 2I0FA 2VBIA 3QUQA 4X8HA 1QHTA 4RW0A 2C00A 1X9WA 2YWGA 3LUCA 3NHKA 3FHOA 4XPZA 2QUKA 1OE0A 4MCIA 2HPHA 4RKQA 4XGQA 3D4OA 5BYJA 5I51A 2J46A 2AIRA 4K9SA 2C07A 1JBEA 1QAMA 1BEUB 2XXBA 3MAQA 3JRWA 3UJ8A 1PTJA 1RWKA 3V4RA 4KACA 1GXSB 2FGJA 1V1MA 3IEPA 3NYIA 4DLNA 5A6SB 3KOYA 1NQVA 4FFNA 3PZBA 1KK2A 3JRNA 4RVGA 1OA1A 4B9QA 2Y3IA 3P2OA 2HDWA 3SLKA 1V47A 1MU0A 4WCFA 1RZUA 1AE1A 5JW6A 4INZA 5D3GA 1ID1A 3FX2A 5B1IA 4QLBA 4RS3A 3TD2A 3D2FA 1HX1A 1QV6A 2ROQA 2HN9A 3VPSA 1BXZA 2CJWB 2GA9A 3CVJA 2PT6A 3MOGA 2F7TA 3N8IA 2SICE 4UEOA 1ETHA 2O0LA 1UFRA 4PG6A 2B78A 1WDLA 2YDYA 4QXPA 4F5WA 2B69A 2P75A 5JYEA 4UNRA 2FN3A 3G68A 2BFFB 1VSVA 3GMSA 4CD3A 2PGXA 3P52A 3LDFA 3VI3B 1QH0A 1XZMA 3K5HA 1UJNA 3GGDA 4HXGA 1B9DA 3WI7A 1J5EB 1NX6A 1RT9A 2DBRA 1KYXA 3QP9A 4J4TA 1DI0A 4BAGA 4ZI3A 3R44A 3DCIA 1LPNA 4K46A 1HG1A 3CONA 5LWQA 4LFAB 4ZT6A 1T8UA 1VP3A 1EXQA 1XQ1A 2B6NA 1NT4A 2BONA 5SWMA 2Z9BA 3LP6A 4A5OA 5T4EA 1YR9A 3FYUC 4FJ5A 1L1QA 1NE7A 3MRVA 1RHUA 1PDOA 4LZJA 4EUEA 5ICFA 4R98A 5HE8A 3VQQA 3PIOL 1CJMA 2G5GX 4ZGGA 2Z0MA 2ZYIA 4CV2A 3LQFA 2IS3A 2XHZA 4Q9JA 3AIOA 5KSPA 3QEMB 5C5EA 1M8PA 1PHPA 3NTUA 4FXOA 3SQXA 1E3QA 3PQCA 1E3EA 1OLUB 3V48A 2NVWA 4GBGA 4GRIA 3SXUB 2FQQA 2ZETA 2R2AA 3FNIA 3P5SA 3STYA 1O6BA 1YONA 4XUDA 3SXPA 3VJMA 3JWJA 1BDIA 1U0RA 4JYAK 2ZQBA 1NWKA 3VEXA 3R6MA 4Q4AB 3T3HA 4WBSA 3WRVA 4BFYA 4C4AA 1F1BA 2J0UB 4JLKA 1LW6E 3U4LA 1TQ8A 4JHXA 4OSPA 1KO8A 2ZIZA 2HA0A 3KQHA 1PEKE 3TW8B 3WFJA 3Q5DA 3ELWA 3RSLA 2JGRA 5KTNA 1Y4AE 3GLHA 3L7CA 4Y3UA 5F2NA 1GWNA 3BZBA 2HGZA 1E2PA 4IPTA 4WOPA 4DM4A 4W9MC 2X2PA 2DULA 4PSAA 3LLMA 3QX9A 4C6RA 4EGSA 1WXEA 2KLHA 1RQ7A 5HIIA 4EYSA 1AK1A 1S22A 2A92A 1PR4A 2P35A 1CY6A 4NYJQ 5HNKA 1XPRA 5C7YA 5TMEA 2ZZNA 5GV7A 1YI2N 3RK1A 3I6YA 1C9DB 4L73A 5DM7L 4JJIA 3L8DA 5HIKA 2R1VB 4JV5B 3C4VA 1XA0A 2ATIA 3THRA 4BDYA 1IUOA 1GUZA 1F3OA 3ORQA 5TQJA 1XXHE 2W11A 2A5LA 2VF7A 1ULTA 4IDOA 4G5RA 2LE0A 4MPDA 1GCAA 3IDZA 2VDJA 5A3VA 5IXJA 3IMKA 5TT1A 4B08A 3E7WA 2AQIA 1D0SA 3LALA 1V26A 3EHEA 3B52X 1GL6A 3MF4A 3RVDA 2KLBA 1CZNA 4RFVA 2CJYA 3DL2A 1KKLA 4O5FA 4OPJA 2RBEA 2XB9A 3CLTD 3DXZA 1GUBA 1ICEA 4IHJF 4LQ4A 2IZ5A 4OQYA 4A0SA 4RW7A 2W8BA 4DQ8A 1QVZA 3LX5A 3DTVA 3ULKA 3EZLA 2CV0A 4U2GA 4MWSA 3PTZA 4LI3X 3AO3A 3LK7A 1WY5A 1XD2B 3KYDA 4ILHA 1SGWA 3N2YA 3HJCA 4DLZA 1QQMA 1OT3A 1X39A 2LZ0A 2CFCA 4WNYA 5LP6C 4EG7A 3B6EA 4YLYA 5JZOA 5HRUA 1WUHS 2CMDA 1IOLA 1Y9AA 1CRWG 4FKBA 3D6FA 3EAGA 3EULA 4KHYA 2QMYA 3GA0A 4A8JA 3PNOA 3T3NA 5BV2P 3M1FA 1IN8A 1NKSA 3ZETB 3VKGA 2OZEA 4XGIA 2VH2A 3CVXA 3L0DA 2NYRA 4MYCA 3ISTA 1U7WA 1OLSA 2AJDA 2Q4BA 3C41J 4HF7A 4BO7A 4FZJA 3FFWA 3DFFA 4W8HA 1MOSA 4HCJA 3TSCA 4RGYA 2QZ4A 3GLSA 1PJ2A 2FZGA 3SC2B 1BMDA 3GLKA 4XDZA 3H5AA 2JLSA 3LAKA 1G8GA 5KU1A 3QSGA 1AXRA 3NWBA 1PS0A 1VM6A 1ZI9A 4HNUA 2H2HA 3RRBA 3JZMA 4CFBA 4F3TA 3MXIA 2R7KA 4KFBA 1JHOA 2X0IA 1Z6PA 2PKYX 3BIFA 3CX7A 1NOKA 4WZBA 3NHMA 5NULA 4JAXA 1VLZA 3CVYA 4B7UA 4WF9L 2C1EA 2MT9A 3PQ7A 3QV2A 5BSHA 1R0SA 2HJSA 2HRRA 2ID8A 2AT1A 1H2BA 2H07A 3AF5A 2QRJA 4WASA 5HK8A 1S1TA 3WX0A 4AG3A 1QYVA 1TEXA 2VP4A 4MGHA 1P45A 4UDXX 3IULA 1T8YA 1T2CA 2CXHA 1LWOA 3ID6C 3OCXA 1W48A 4LGMA 1RRKA 1OKJA 1X1DA 1FKPA 5KRTA 2J9YB 2VQ6A 2VRCD 3IDQA 4UDYX 2NADA 3TBFA 3CKMA 5AW0A 1HTWA 3G5UA 2IS4A 3KL4A 3MELA 5AM2A 4OHOA 4MS4B 3PCXA 2E3JA 4GKAA 3RIGA 3ZX2A 2RGDA 1EBFA 2C0PA 2WU1A 1DTEA 3I6IA 3LBFA 3D6HA 1TT5B 4PQYA 4BYGA 1G3UA 4F45A 1X92A 3OTOK 4YHBA 2IDZA 4DSNA 2IU4A 3WGUA 4WAUA 5HKKA 3QV1A 3ZJVA 2WZQA 5AHKA 3PC8A 3AFGA 3DYBA 5KQSA 5TGTA 3U3RA 3OEWA 4F60A 3GLGB 4AJEA 3C3AA 4S2EA 1YFJA 1TRKA 4Q9HA 1UT6A 4CM8B 5F9HA 3BFJA 5AXCA 1E1RD 4DCSA 2AFIE 5IG2A 1Q0QA 1L5NA 3OJFA 4FJ0A 4AROA 4QOEA 3PQ2A 5I9IA 2GKOA 2PANA 5CHEA 5JCXA 1G19A 2EIHA 121PA 1XYVA 4BR0A 3OZTA 4OAPA 3SI7A 3ZU4A 1FPMA 5JXWA 2J31A 4EJSC 1FXXA 1BCMA 3AP2A 3RU3A 5IT0A 2DBYA 4HDNA 2ZANA 4PYIA 1TZKA 2YZMA 1L0BA 3K6KA 4PPGA 5CU7A 3HP7A 1YKGA 2BFEB 5FUWA 2X86A 4IIHA 2J6CA 2ZR8A 4M60A 3BL8A 4FKMA 4FR0A 2QT1A 3MT9A 2X42A 4FDUA 4AF7A 4UUOA 5FR1A 1SPXA 1KTVA 1W4CA 3DCJA 4X92A 3IPYA 4ZT4A 1C7RA 4YCNA 5ALKA 2HSGA 5JAZA 1ACJA 5K6TA 4MIOA 4Z4FA 5EHIA 2V0CA 2FPPB 4JL6A 1MH9A 4NE2A 2BUCA 2YYYA 3OU2A 2VF5X 4XDGA 2J3KA 2QR3A 4JBHA 4B5LA 4GLLA 3C65A 1B3BA 1QGAA 1UBSB 2PD6A 3I09A 4IJ6A 5CH8A 3QK7A 1VSEA 4EUNA 3PPXA 5JXIA 1LCIA 5FLXO 3A9SA 3AGRA 2IL1A 3OJSA 2MYTA 3QE3A 2H4HA 4K6FA 3R76A 4BASA 2UUCB 3TI9A 4C7BA 3NH6A 5ULLA 1JR4A 1VLHA 2DHRA 4YRBA 3F2IA 2G8HA 4IZIA 1EFLA 2ZWPA 1QQBA 4IXTA 4WINA 5AKZA 4C76A 3BSWA 4PZEA 1W5SA 3EGEA 1E3LA 3FH0A 5JSUA 3NKLA 5LMZA 1EFUA 4FYHA 2JGIA 4D96A 1NGFA 1VE7A 5KQRA 2I6GA 4QPZA 3AVBA 1ZH4A 4CMAA 3CO0S 2Q07A 1E9RA 4MVXA 3E4DA 3UFXA 5DHPA 4BVJA 1G3QA 1MHPA 1Q20A 1M1YA 5BNFA 1I7DA 3VQEA 1A9ZA 1J2YA 1OLOA 3MAGA 1TTHA 3B20A 2GZ1A 4QG7A 4RLSA 5C18A 1SKYE 1U02A 2GPTA 1IXZA 3VYRB 5KSOA 4IYRA 3EYZA 3VPXA 4EECA 2P9NB 2AB0A 1OX4B 4BX0A 4HH4A 1R0RE 4QUBA 3DTVD 3UPDA 4DLAA 3DE1X 4XM2A 3CNQS 2CXSA 3WO1A 1CS0A 4FZZA 2RHGB 4CZFA 3L2OB 4U4AA 3WYDA 1MQ9A 1CR0A 4BWFB 1D8YA 1RIFA 2O50A 1WXQA 3B1FA 4UBNA 1Z7YA 4XTRA 5JQWA 2JGNA 5B6JA 2F1RA 4Y1DA 5A6SA 4UHKA 1C3XA 1C41A 4KP7A 3KB1A 4GXTA 3IE2A 1HLFA 2DLCX 1YRYE 1XR3A 1DADA 4JROA 1JQ5A 4F4HA 4MAAA 4ZYXA 1C3OA 2HCTA 2EL7A 2FRDC 3BFVA 3RV3A 2LXNA 3M4ZA 4BC0A 4LOAA 2HF3A 1XNJA 3VU0A 2XBLA 5HROA 2OFWA 4WJZA 3VDXA 3TJRA 4LW8A 2B4AA 1E7YA 5JY6A 4DV5B 2OB1A 3DFUA 5F12A 4DIOA 4Q0BA 3VO2A 3L46A 3DQZA 4Y2JA 4AW9A 2G04A 2WINI 1IHDA 1ZO8A 1RS0A 3QFPA 5HKKD 3HJFA 2XSZA 1X13A 4L5CA 2GHTA 3OFSA 3PNVA 4MKXA 1IZ7A 2FP3A 3I9V6 1DPFA 2BEVB 3UJ6A 5JJLA 3BIXA 1A69A 4NCNA 1B2LA 3P83D 4A1FA 3PJRA 4B81A 4EYKA 5K6AC 2AP1A 3GU3A 5AUQA 3DDUA 3V97A 4R54A 1S2DA 3EIEA 3BA1A 1GZHB 4DB3A 4RCHA 1J49A 2I8LA 3R7SA 1ECBA 3GUCA 3AK4A 2G67A 5CJPA 5J1EA 3AVIA 5B8HA 1KVUA 1XVIA 3D81A 3KBOA 4KWHA 4ZP1A 4CIGA 4LXIA 1JA0A 1TM5E 3VHXA 2OVBA 4BQRA 2EX0A 3W8NA 1VSUA 1ZH0A 3E7XA 3MOSA 1ZOPA 4MIYA 1TUBB 1M8JA 3P4YA 3IA7A 4YOUA 1I33A 3C6YA 2OHVA 5G0SA 2DJIA 4YREA 4BX2A 4D4GA 1IHPA 4M0KA 4EFLA 4HTLA 1Z2CA 3CQ9A 1I80A 1W46A 1YQQA 2D62A 3EQ7A 5JHGB 4QFCA 2NQTA 4QS7A 2DX7A 2V1XA 3QU4A 4LWOA 1RYHA 1ZCZA 5J2QA 5FRMA 1T2AA 2KW4A 1PS9A 2IW3A 2XE4A 3JAWA 4MW0A 4NKRA 4L8VA 2AD1A 2JFBA 5HG0A 1AKWA 3TRFA 4B76A 5DWVA 1LUAA 1VDZA 2EFJA 5C5DA 1KXPA 3JPWA 4P54A 2QRPA 3F3KA 3IBCA 3KAPA 5DBEX 1KH2A 4P3KA 3V1YA 2BBSA 4KEAA 3QBTA 1OFVA 4TOIA 4CECA 3RIEA 5AI5A 3HHPA 3WEEA 1QGZA 1QHGA 2QTHA 3FUXA 3BK7A 3H2IA 1KR2A 1NFRA 3LVFO 1XCMA 1LZLA 1R9JA 2I3BA 3S5UA 1W96A 4ZVMA 4EMTA 3O2JA 2PXAA 4MV8A 1M83A 3GDHA 2ZSFA 1FP4B 5GOZA 1DJPA 3OVNA 1EFKA 3BEXA 3LQ2A 2J7PD 4GR5A 4CTMA 1HT0A 3UAVA 1XC9A 5TGDA 4ZK2A 1U2TA 5M34A 2DU8A 4IJMA 4JBNA 2P4HX 1FJ2A 4G41A 4X65B 4EQ6B 4KWEA 3D4IA 3ZK7A 1AHHA 3QERA 4LSGA 3KD3A 1N57A 4KBFA 5K3BA 2NIPA 1T0HB 4HLDA 3VC2A 4HAUA 1GL9B 5EERA 1GCIA 5EZQA 4H4MA 3S68A 2DG2A 1TW3A 1EHIA 4R9RA 3C15C 2OAEA 4LYDA 3PUFA 2J5RA 2IQ5A 1Y1SA 1YZQA 1PK9A 1FUIA 2C20A 4HRXA 4UAVA 3DMNA 3WDLA 2ZRAA 3P20A 1LNZA 3BFPA 3ESRA 4IDEA 2H4XA 2W2VA 1FU8A 3KHYA 1G16A 2OFPA 4DCVA 1XRSB 1KJNA 4W5WA 1MV5A 2CYAA 4MVJD 4Z9BA 4KRFA 1V39A 4UXJA 2LPMA 4RK5A 5AFSA 3DFKA 2O8BA 1MMFB 1FRQA 3LBHA 1YS4A 2MOKA 4KQFA 3SE7A 3NRCA 4QREA 3U9TA 1FRFS 3ZDYB 1T6BY 3FPLA 3FMOB 1QOZA 4BACA 3IP3A 3OQMA 1QO9A 3C6TA 1X1QA 2YOFA 3D6MA 3MEEA 2BWJA 4LXHA 4QEZA 1YL7A 3VSCA 4TS9A 4J1TC 2EEPA 3MTAA 2F1HA 3TSUA 2VC2B 3OHRA 1ZBSA 4F4UA 4MW4A 2HW8A 3AR2A 1T6ZA 5KQ8A 3V7NA 3K5OA 4QS9A 1Q7RA 1T4GA 2OCYC 4DDMA 4NBSA 2IDKA 1XNHA 3UT5B 1TX4B 3ELUA 4B4WA 1M75A 1RI4A 4YPVA 3OLXA 1WXDA 2GBZA 4MQEA 4TWJA 1W36D 1ILWA 1PT9A 2CZCA 4LZNA 3TRIA 1UKVY 3HJTA 1Z6AA 2QJWA 4GPD1 1H2RS 3ZWQA 3ZE1B 4ZEMA 5CGQB 3VNSA 1QS0B 1P6QA 1L4YA 5HQ3B 3TL6A 5IUJC 3BERA 5JATA 2O48X 3H9BA 3TMKA 1M1KO 3N5KA 1Q6YA 4DMFA 4OVLA 3SF8A 1DPGA 3I34X 1YF5L 2ZJ0A 4IUDS 5FBZA 1BWQA 2B7LA 3KLBA 4GEKA 4REQB 3KYCB 1E5QA 1G6HA 1N3LA 2ZVDA 1TK9A 4DY4A 3SQDA 5C5IA 2ZIAA 2NU7A 4G0XA 4GPIB 4H4CA 3LRTA 4IL5A 4EHJA 1EEHA 2XKBA 3GRAA 1L3UA 3HADA 1E2BA 3HPRA 3SS7X 3NIGB 1OXXK 4PA1A 3F8SA 4V3BA 4YPFA 2QRVB 4OD0A 1EH5A 5JC1A 3A6KA 4CGJA 3GQVA 2C0CA 4F4KA 2Z1MA 3MJVA 4DTSA 1CULC 4UULA 3R8XA 4Q3BA 3W79A 3WDMA 1Z5PA 1EWYA 3LPNA 2RD2A 3IBYA 3E9EA 2GVNA 5EVZA 4ZU3A 4AY3A 3PUWA 1U49A 3H7AA 4DQDA 2QENA 4AL4A 4EB0A 3KLEA 3WIEA 1GKKA 1VQON 3A6EA 1NXQA 1S8FA 3MWYW 4GBED 4XA8A 5EMKA 1HKGA 4RFLA 2GZMA 3C7NB 1JR3E 3L40A 5M1OA 3QVVA 5DLDA 3HCEA 5EVJA 3SSNA 2JA2A 4RA9A 3UWPA 1AZLA 3O4GA 4LC0A 3TRJA 4MITA 1CNMA 2E2OA 1GYRA 1HTBA 2A1TR 3ZGVA 3U4QB 1DBSA 4OXIA 3C94A 3FFXA 4P36A 4B4DA 4C4PA 1V48A 3EA5A 3DPIA 4GYJA 4J7XA 4PSVA 5DBHX 4CDNA 5ADVA 1QRAA 2GASA 1SKSA 1VRVA 1ZHFA 4FLTA 3HBAA 4QICA 3DM5A 1NRIA 2QMOA 5KWJA 1YZNA 3HB4X 4G4SP 4N5DA 3P4UA 2TMYA 5FBWB 1ESDA 1SNYA 5FBQB 2BP7A 2J1LA 3IQHX 3ZLJA 1DAPA 1EDZA 4PZPA 1YCGA 4UTNA 1ATNA 3J7TA 3NIFB 1ECGA 2VCPA 1ECLA 3V1LA 3WRYC 5KYNA 3TLJA 2WM8A 1CUIA 1D2AA 2Y92A 3K5IA 2QLNA 1FQKA 1H23A 2IT1A 3DGEC 4OAQA 3T5CA 1MB3A 1X70A 3SLGA 1HR0B 1QCZA 3OPYB 2EKQA 3QW2A 3PPYA 1YZHA 2XHBA 3DMGA 3HABA 3NGMA 4HDRB 4N48A 1M2OB 4B6OA 1G0NA 1YMVA 4JQYA 1ISPA 3DAYA 1ULZA 2P2NA 3VF6A 3GO4A 3QVWA 4O55A 4Z2YA 1ISMA 1PJLA 4RYDA 3F3YA 3PUKA 3MDQA 1E3TA 1U3DA 3HNPA 1F4PA 1EFPA 3LX6A 3IQWA 4MVJI 3QY9A 2C83A 1X9JA 5ALYA 3JATA 5CB4A 5LOVB 4UQLA 4OU5A 4NARA 3T4EA 1IPFA 2XLBA 1WSGA 3I4CA 4AUEA 2OQVA 1NM5A 3PU6A 1XOIA 1GOCA 1CZKA 1V2GA 2AG1A 5HKLA 3SBEA 2HRBA 2P2LA 4GX5A 1MAHA 1MPXA 4NZOA 3GR6A 3IV6A 2OG2A 3EHDA 2JIBA 4FHEA 3BF8A 3LIIA 1RMQA 4X97A 3E1SA 3U17A 4G5YA 2RJNA 1RJDA 1P2GA 4JIGA 3ZGZA 4HQNA 5HYVA 2Z1GA 4H6PA 1JEOA 3WMXA 3WZ2A 2D0IA 4LOKA 3K9BA 5EPUA 2EFCB 1TU3A 3VHRA 3B6ZA 1R0LA 3O8BA 4AICA 3TTTA 3OYAA 3O4WA 4L0QA 3VZSA 4ENPA 2DJ5A 2JIRA 2W8BB 1JR3A 3KK0A 3VZDA 5JVDB 1WAFA 3CCFA 3ELDA 4JY7A 3SQNA 4YT5A 4MLPA 1PJ3A 5ER6A 3MGAA 1ORTA 4MIKA 5CG2A 2I2AA 4GL4A 4DAOA 1D9ZA 3TLXA 2OHIA 3AW9A 2PUHA 4HX2A 4QOFA 3ZWPA 3KXDA 5JNWA 2E4YA 3QBEA 3E5RA 3HO1A 1OXTA 1P62B 3ZZTA 4ZQHA 2PKEA 2J7PA 3U62A 3P5JA 3W4JA 4CIAA 1MVLA 2CLDX 4Y6PA 3LP1A 4L8FA 5BY2A 4JUAA 4LNHA 4NCJA 2XB4A 1A1SA 3BGRA 2XNDA 1SG9A 2NO5A 2ON6A 2ZE6A 1WTAA 3R3ZA 1N6KA 3AJ9A 3BXZA 4CU2A 3GDQA 4GKBA 3R9XB 4Q00A 3W5HA 5AQ1A 1SVKA 3O03A 3T7ZA 4K3UA 4MJ7A 4YV0A 2Z8XA 3HSCA 4EEXA 3ZJUA 2D0OB 3GHYA 1YVDA 1ORVA 1IN1A 1AS2A 1J5PA 3EGCA 3N0XA 4OJNA 1NBWA 4OQQA 4LOIA 1W5TA 1YIOA 1SXQA 1MTOA 2BKXA 4EY8A 3RF6A 1GLCG 1O94C 3C6MA 3L06A 3C1AA 2ASOA 1Y97A 4HB2A 3O4QA 3PXEA 3K8QA 4ZTJA 3TJMA 3V2UA 3OU6A 3WLFA 1TT5A 2IYSA 3NUQA 4IZHA 1E69A 2WFLB 1Q1QA 3AL0C 4FHCA 2GBIA 3EWIA 1VKZA 2IFTA 2BW0A 4M1OA 2EERA 4QDTA 1RFQA 3EPHA 1JQAA 2PWAA 5JSZA 1UM9B 1YQTA 3V4SA 4QYSA 2XMPA 1JJBA 3OCJA 2WV9A 1XTKA 2GI4A 2ZRCA 3GAFA 4G1VA 5IKMA 3NHYA 4G0VA 2BGKA 3R20A 3MGKA 1WKVA 4O1HA 2OV1A 4AJPA 4DCNA 5B12A 1WSIA 3CO5A 5KQDA 1AGPA 2FCRA 2AC4A 5D3ZA 4YUZA 1SU7A 2E5LB 3W2HA 4DTRA 4B09A 1XO1A 2ODNA 5ETJA 1NW5A 3I45A 4EVIA 1R9NA 1TOAA 3JVVA 4ZO9A 2IY8A 5TXGA 5AXBA 3RU9A 4LVOA 1KDZA 4OHBA 1HXHA 2CXTA 2K7FA 2GYVA 2A0FA 2A30A 5ALOA 1LDGA 1JECA 1Q11A 4NBKA 1GILA 1MW8X 1FOEB 4HSGA 5B7PA 1BNCA 4BRKA 4WCEL 4V38A 3RYIB 3KKRA 4J0KA 1Q3KA 1U5BA 1IZ0A 3FDFA 4WLFA 3IPAA 4TM8A 3AY9A 1DO0A 3RRXA 1ZH6A 3EY1A 1W29A 5BYKA 3OHMA 1NDUA 3PF8A 3PQ4A 4PLGA 1K9VF 4PONA 4BBAA 5LR6A 1NBOA 2PRZA 4M3UA 1JLGA 3GLQA 2JKVA 1L7VC 3LGAA 2WA1A 5ALSA 1YK0A 2WSLA 1HH4A 1V7PC 4GLOA 3G4SN 5GM1A 1XRLA 5JASA 1FCJA 1M6YA 5TS3A 2X2OA 3C7TA 5DXAA 2IH5A 3KVYA 1F60A 3LC7O 2PIAA 4LHEA 4M9CA 3NT2A 5K0CA 4K9RA 2O8DA 3T7IA 1E6WA 5CY4A 4GXQA 5U4XA 4Q19A 2YWDA 3ES9A 3NVMB 4IFTA 1TEVA 1SL0A 3AM1A 4NBVA 4RTJA 1TKAA 3P2YA 2YIMA 2QWQA 5EU7A 4C8NA 2ZREA 2RC6A 4KPUB 2N46A 3DJFA 3RVKA 5A5VA 5AVRA 3WOVA 2F1KA 4BB9A 1M6HA 3FF4A 1W4LA 2X6SA 1OH8A 4E4TA 3MGCA 1ECPA 3NF8A 4BAUA 5LJIA 3VOAA 1M90O 2QZPA 1KKMA 2V52B 1U6IA 3AEKA 5EIBD 3AG6A 2W71A 4GVPA 2QN7A 4BIMA 3HSSA 1DXHA 2R6JA 1V9CA 4ELTA 1JLMA 1UXIA 5T3UA 5IAKA 5E3HA 4G3XA 4M0LA 1E7WA 4CBUA 2FK7A 2DSTA 3TTVA 3TTCA 2ASEA 3M5WA 2ITGA 2Q6VA 4G97A 4LOHA 4P1ZA 4RD3A 2QRMA 2JI8A 2ZRQA 1GG8A 4R9SA 4L75A 1N6LA 4M22A 4X1KA 3D2FB 4WQMA 3WAKA 1T6XA 1QRTA 1ZUIA 4PINA 1A5VA 3BZUA 2HMYB 4BFXA 2YIDA 4UEKA 5DLYA 2A9PA 2D7DA 3NGYA 4IQFA 1II9A 3THXA 4I9LA 2K2QB 3CM5A 1VSQA 2OBYA 4GMGA 1ZK2A 1U3TA 5BSWA 5K45A 1E1KA 1ODTC 1EK1A 2AX3A 2B21A 2BFFA 2HT6A 3A6ZA 4FZRA 2VPZA 4AZWA 1OTXA 3CMMA 1V0JA 2YRWA 4AF8A 5I9EB 4QD3A 4D0SA 4DMGA 3I2KA 1EUDB 2V6JA 1GKLA 2JCYA 4OGLA 5LYYA 1LSSA 1FEZA 3VSDA 5EUMA 3L92A 2ZPUA 3FUCA 5TY0A 3EIUA 1TQ6A 1M1NB 3QETA 2PV0A 2EZTA 2DT5A 3K1JA 3WAJA 5JS2A 3HVUA 1A77A 3KPJA 3N75A 3NGLA 3NOOA 1X1PA 4GE3A 1M7HA 2BBWA 3K0CA 2Q0RA 1DRJA 3BSSA 4RZUA 3A6JA 1J8YF 1O9GA 5JAPA 2FWMX 1VXRA 1TCBA 4LJ5A 3UKOA 4Y9DA 1BMFA 1CP3A 5CLGA 4D25A 1GRVA 3KKNA 4CM7A 1U80A 4WNAA 4E7PA 2JJ1D 1C9KA 1JFLA 5LZ2A 1TUGA 1QR2A 5CX1A 2QI2A 3N74A 1X2EA 4BATA 3N8HA 4DR6B 1P4AA 5LZ7A 3GJXC 2Q5HA 3EXIA 4L5YA 3LPTA 1JPUA 1WS6A 2QT0A 1WNFA 3QFFA 2Y8EA 2YICA 4PCUA 3K32A 3T41A 4DIDA 1G66A 3LT5A 3TKLA 4KIJA 2D1YA 2X5JO 3X2SA 5LYJF 1PNQA 2O06A 4ZZ3A 2WTEA 2CLLB 1RJEA 1LPOA 3DHEA 4R9VA 4CJ3A 3OYGA 2R6AA 1JAIA 2V8OA 1TT7A 1XJWA 2QROA 3UBMA 5LDGA 2FHSA 1RQPA 1NJZA 4DMUB 1LC0A 3IXQA 2IYNA 3D8UA 3ZS8A 2H3GX 3TFWA 2V65A 4DA6A 1ZD5A 4JLMA 1AHPA 1SIUA 4BCDA 4WY2A 3KUXA 2EV9A 2IYOA 4WXHA 4D7AA 5AKKA 1N77A 2BSQA 4IO1A 3BUSA 3Q7CA 5EYPB 3U4HA 1KFDA 4YXWD 5EGSA 4KNWA 3C7NA 4PTLA 1C14A 3KYIB 4Y6GB 3RK4A 4LE2A 1QGDA 4ZJYA 4M7YA 1ISJA 2JD2A 3L0BA 3D6TB 4G5OA 1E1NA 4TRJA 3ZQKA 3LP2A 1BISA 1C1XA 3ZU6A 2JJ1A 1J7KA 2E6KA 3W3ZB 1P7VA 3AGPA 4RF3A 3WQBA 1YOVA 4B35A 2DP4E 4NENA 1K8KB 5P21A 4TQGA 2WONA 2DQYA 3OY2A 4GGOA 2WIKA 3GBTA 4I6MA 3TOSA 1UZNA 1OAOC 3ADDA 1JMKC 4PQFA 421PA 3NBAA 2RF2A 3BCHA 3EN0A 4KAZA 3I2FA 2ICAA 3KR0A 5FRNA 3PGXA 1Z7GA 3AGKA 1X87A 2HWXA 2PD3A 4IY1A 4PWYA 2E4XA 4CG2A 1PSWA 1EUZA 2Y1CA 3L1KA 1PQWA 1Q7GA 2B1JA 2HK8A 3AZPA 3E8SA 1J8VA 2EDCA 4R8RA 2YFKA 1NK5A 1R64A 2FB9A 3CX3A 4FC6A 3F4KA 4JEMA 1R12A 5EWLB 4FVMA 4LIPD 4YJ3A 1V95A 3AR3A 2UUCK 1CZUA 5DNUA 3GLGE 4PO9A 1NMXA 4CBVA 3ZSRA 5LY3A 2OP0A 1M2OA 4CCHA 2WJPA 2X0NA 3AF0A 3EF1A 2GEVA 4JKOA 4AZ3A 4A7PA 1WLJA 1GUFA 2JLBA 1BUPA 2GKSA 4D0GA 4Z7OB 5DN6D 2R48A 4XCXA 4FLZA 2XUDA 1JJFA 5FPYA 3N59A 4PKIA 1ZSYA 4KK4A 4K9NA 1NBIA 1EFHA 2JGEA 3L0IB 2BEUA 1NUHA 2G77B 3ZX5A 2I1VB 4WZBB 3RREA 3AC0A 4XB1A 4DPKA 1IIRA 3G2JA 4FFOA 3BFXA 4L9AA 1OTYA 2CNWD 3JSMA 2GXSA 3OTHA 4PXSA 4DLWA 1DAIA 5KBYA 2XGOA 4QT4A 2ZGYA 1DTQA 4HVJA 1NVXQ 2H17A 2QN3A 4FOLA 3ZEAA 3PX4A 4CHGA 1HBJA 5DNYB 1UC9A 1NGCA 1QUFA 4RSRA 3E01A 5KRSA 1IATA 1RWWA 5JAMA 2HC9A 1XTJA 3GB9A 2YXBA 4ZCSA 4JI7K 4C3UA 1YHNA 2QWMA 1FNCA 2WDZA 4FFSA 1KS2A 1XRQA 2FW6A 3IKVA 2PQ2A 1ULHA 1IVYA 4HVCA 1CSEE 5JJBA 3FYCA 5AQJA 4AP5A 3CX6A 1MNQA 4OBEA 4F97A 1HDOA 5CEFA 1KZ7B 2ONKA 3FFTA 4J16C 2ZUDA 3K0FA 2B98A 2BKAA 4A2WA 4BMZA 4CF5A 3CZ9A 1QDUA 3PNYA 1VSMA 3CJ9A 3D0QA 4XGNA 3OZWA 4QGAA 2PAVA 3ULEB 4EX7A 1KC1A 5IH7A 2SECE 3HEAA 1EM6A 2O7QA 4JSTA 2HPVA 1E59A 5AR0A 2C96A 2WVJA 3KBBA 4B9VA 3SQ4A 4C88A 1DKUA 2WUGA 1KZ4A 1ZA2A 4DF3A 2BMJA 5HP4A 3W78A 4P0QB 4LVCA 2D1RA 3TLAA 2MSCB 3WXBA 4YAGA 5L3SB 4KI6A 1Y4SA 3FCOA 3SSOA 4MUXA 2WVGA 1K66A 1LVUA 1X9GA 4Q9AA 3OG9A 4R5HA 1B8NA 3SCXA 1B0ZA 1V1RA 1Z4NA 2A3NA 2O14A 3N7AA 3QFRA 4F2HA 5D8DA 5HQTA 1M72A 2FEPA 3B6JA 1IH7A 1NLUA 5CLQA 1OUMA 1V8ZA 2O5CA 2CL6X 4J75A 2E37A 5AUOB 2VHCA 5BPFA 4DR1B 2YMPA 1SG6A 1SVMA 2Q1UA 2J0EA 2WHYA 1CFZA 1ZD9A 4U67L 2QL6A 3FPHA 2AZTA 2WJIA 2ZJ5A 3H0KA 4KO0A 1DTWA 1JWBB 3V00A 5EJ5A 1SO8A 4L9SA 2PYZA 4UNNA 3FRIA 4AO6A 3HI0A 4RW9A 1KHTA 2C61A 2XEDA 4MQEB 2IS2A 2EFDB 2WF5A 2WAOA 1MR3F 2XDYA 1IPEA 2J3EA 4Z99A 5H16A 1GZVA 1RM4A 4O4HA 3FHTA 3OBWA 2CVHA 4FI3C 1HQYE 3T3MB 3GNQA 1FDWA 3VTIA 1TLLA 1JU3A 3INYA 4G2TA 3T19A 2BUBA 4LBWA 4CF6A 4CEJA 1AKMA 2IDJA 1QU3A 5KB3A 3AQ4A 2WUWE 4XD2A 2ZD1A 3OKAA 2PLNA 3DZJA 4LBZA 1IJKA 2V7BA 2V9CA 4N5SA 4D3SA 1RLMA 1W34A 2HFJA 1KPIA 1C8VB 5KC9A 1DLIA 2CVZA 1FSSA 1M34B 1ENOA 1RYYA 5G53C 3IR7A 4TYMA 5DYTA 5F1YA 3VPCA 2CHGA 5AQUA 1GRNA 3C3CA 1QC5B 1U94A 3IVXA 4WADA 1MFPA 2ZJAA 4H3HB 4AS3A 4O0MA 1QH1B 5AW2A 5ITWA 4ID9A 4AH9A 1JA1A 1C7IA 2V7XA 3CZPA 4Y98A 1YA4A 4Z5XA 4AUNA 2F1OA 1XMIA 4PW0A 1OIXA 2A6AA 2AS0A 4YCAA 3PQ3A 1SIOA 2YVKA 2MSWA 3JW8A 3R6DA 4GO1A 1YDGA 2W2XA 1K68A 1K63A 5I7FA 2WIJA 2CV2A 4G9GA 1ZIOA 1LW2A 4PQGA 3ZPXA 4H0YB 2D5RA 3B6OA 1FRVA 4BX9A 3KO8A 2YWCA 1O97D 2PSDA 1KEUA 2VRCA 3N8NA 4L02A 1W6UA 2C3PA 4QODA 3TRHA 1E4GT 3N0RA 4QAJA 1NJ1A 1ZN2A 2NUPB 2YQZA 3BFKA 1WOQA 4X1OA 4CM9D 5L3VA 3K5LA 3BHIA 2HA2A 3IT0A 4CEOA 1C0TA 3O38A 3SHWA 3W5DA 2WPDA 1QCDA 3EW7A 1Q7TA 3TXXA 1Z07A 3WSTA 5FFFA 3J81k 4RMIA 3MMXA 3REQB 3L8CA 2HTFA 1NMEA 2VJNA 1ISIA 3GEIA 3HKEA 3NEJA 3PLRA 4XX0B 1H0SA 1L5WA 1N0UA 3G49A 1Y1PA 2PUTA 4R81A 8ATCA 1RE1A 2VJQA 3KSZO 1VKJA 1XU7A 4IEEA 4ZOLB 1GUDA 2D00A 2GAJA 1U2PA 3H9UA 2ERYA 4L28A 5AK3A 5T7BA 1ECJA 1AC5A 2FZWA 2UUBK 2I55A 3WXMB 4AHVA 3LY7A 3ODPA 4MV4A 1XB2A 1YO6A 1EA5A 3D9QX 4MKIA 5CW2A 2QRLA 2FMXA 4OI1A 4FLWA 4MV1A 4C5AA 3E70C 2CFSA 3Q9SA 3HCPA 1Z6XA 4IIUA 4RKRA 4YJGA 3R3VA 4E32A 4POOA 3GRVA 8MHTA 1KXZA 4HWIA 1PEYA 3RSZA 3Q9NA 1U0JA 1JQEA 4FNMA 4IIJF 4FSXA 1ZWKA 2H7XA 4CQMD 1QDLB 1SVSA 2ZK7A 1C0MA 4K8RB 4EI2A 4FLVA 3EUFA 4E5SA 4EPXA 2YIJA 4ZHQA 3GZNB 3VKHA 1K5DA 1KCFA 2IHZA 2G8FA 3M3PA 1L5RA 4PGFA 3HZHA 1ESVA 1RP7A 2ZBRA 1ZCBA 1LX6A 2GM3A 2O7VA 5G3YA 2QNBA 5JS8A 4NE9A 2FDRA 2VRBA 5HIAA 2WJ3A 2OZLA 3AW8A 3IIKA 1CIJA 3JWHA 4H7EA 4I2PA 1M9NA 1TZMA 4ISCA 4WXEA 3GMDA 1NSYA 1E1CA 3ZWNA 4DGSA 4EGQA 3RASA 2ZQZA 5L4LA 3GEHA 3LUBA 4JL8A 4UVGA 2VQDA 1OWLA 2P65A 4PU0A 5J5AA 1LGYA 3QVLA 1RT6A 1XEFA 2BRUA 2QE6A 2V6MA 1YB2A 4BR2A 4RTFD 2QLBA 4RUKA 5EKTA 3K5WA 4ZT7A 4KMMA 4D4KA 2Z9DA 1JPNA 3AM5A 3R5FA 1XU4A 3BH0A 3EIXA 1HDEA 1Q0RA 3P0HA 3RTBA 3DMJA 1RTDA 2YR0A 3QWAA 1U5CA 1CZBA 1Q44A 1M1UA 3ASMA 3FA2A 4BU1A 821PA 1KQFA 3MPOA 3WA6A 3O8QA 5C3MA 4WE1A 1AIPA 1WAMA 2C92A 2J5XA 1Q3HA 3ICPA 4TGLA 5JQGA 2J45A 1A5BB 4XB2A 3WQTA 4X7BA 3T7RA 3ETLA 2W6IA 3TTFA 4M9ZA 2FFQA 2CDNA 2G8VA 3K9KA 1E4EA 5AJZA 4DCJA 3IEIA 2B92A 2JFVA 3OPVA 5AD1A 3LJKA 2QM0A 4OTZA 4BVPA 1TJ5A 3ZY3A 1Z38A 5CDYA 2WVAA 5TPWB 4ZYVA 3KV1A 3QVXA 5A62A 4QPNA 2PO7A 1KNQA 4L16A 3SWWA 4B82A 2WWYA 1NP7A 4RQBA 4CKEB 2VEOA 1GUYA 3V81A 1PDWA 3COZA 4N5MA 2GPNA 1WU7A 3ZX0A 3DW1X 1SHJA 3D02A 2JKZA 3MCAA 4RL4A 4TQUS 3ZHYA 5DI3A 3AI2A 4X91A 3WWCA 1HJRA 3VR2A 2EIXA 4BEBA 4C2UA 3NOQA 5JE8A 2JGKA 1RRCA 4JVMA 4L07A 5I9MA 4LAFA 5C5CA 3P32A 5L3RA 2WF8A 1NTRA 5JNVA 3KYJB 3N0TA 3F1KA 2QM8A 2WG2A 3F1LA 3OEEA 5IARA 1KQSM 4G4SO 1FDSA 1CEYA 2GEDA 3H3NO 3G23A 3GLHE 3F5QA 3OZGA 3QVOA 1F21A 2JFYA 4KH1A 4U2FA 3HA3A 1B16A 2R3SA 4OYRA 3CJTA 4FJXA 3OYDA 4BP1A 2HIMA 4XQ0A 4WE3A 2HT1A 1X19A 1I6MA 1JB1A 1W0KA 1CQPA 1Y8CA 2C2ZA 2R66A 1E63A 2AHRA 1RDCA 2PKQO 4V0KA 3IR5A 1CRZA 2CE7A 2D2IA 4XWAA 3E9MA 5CXUA 4XJTA 2AN9A 2WSYB 2YJGA 3JQPA 4V0SA 4BEJA 4Q01A 4C29A 4BKPA 5FEUA 3AVYA 5E1OA 1Q95A 3PGKA 4L3WA 4R41A 3MJTA 3VU3A 2ZI7A 4MVJP 4ZN6A 2YZGA 1BFDA 2PL3A 5KMGA 1T1GA 4I2NA 4S04A 3AJDA 1OBFO 1SXGA 1X1AA 4FXDA 1NU8A 2FEMA 1MN6A 1UDCA 2RHWA 4OG2A 4KO4S 4UU7A 4Y2RA 4W6QA 1YZLA 4BJ1A 3NM6B 4CTJA 3K9NA 4BBZA 3L0CA 5AR1A 4ZQCB 3VX3A 1P44A 1MVOA 1R16A 3NGXA 3OU7A 4TTJA 5E2AA 5FOXA 3VSAA 3PTAA 3RAFC 1XMOB 2OWEA 4CF2A 3O3NB 4BHTA 1N7GA 5C8YF 5KUTA 3P71T 1V71A 1DKRA 2NTYC 2QAGC 2GZAA 4O2BF 1Y42X 4AUKA 4CLDA 4CMHA 1R9MA 5JMVA 3EXG1 2IPLA 2Y0EA 3U6FA 1IUNA 3GP3A 1E0AA 5KDLA 1VI2A 2ZYDA 4C7KA 2HPZA 5K14A 3ZZ1A 3RGGA 4JNEA 2G1JA 2OKGA 2VPYA 4HYEA 3VGMA 2EJVA 2Y66A 3ZQ6A 4F38A 1S3SA 5GTDA 5K0SA 2C7RA 1O8CA 4M41A 1L4NA 4LNUA 1PV4A 4O59O 3X1JA 1YDWA 1XUOA 4JXXA 3DP7A 1OIWA 5D1NA 1QFYA 3FR7A 4G37A 1SJ9A 2HUNA 3GJRA 1SBIA 4C4SA 3NHAA 5FAXA 1GLAG 1VLQA 5KYYB 4G89A 1J09A 4P34A 2YOGA 2Y1IA 3R3HA 4EKYA 1KAXA 1PJCA 2DTXA 2YHWA 1E2MA 3P97A 2C2MA 4RACA 3PVZA 4KMSA 4V0QA 5IJWA 3OE7A 1RI2A 2I62A 4LQLA 3O8CA 3HZOA 3EC7A 4F8YA 2BEKA 4KQ9A 5EPOA 4Z0TA 3H3OB 3H1EA 5I8ZA 5C10A 4HO1X 5A71A 3AVWA 2Q2WA 2N42A 1XEWY 2YZ7A 4OAOA 4CGIA 2AF4C 4W5QA 2VUIB 2VXCA 2ZAYA 5J40A 1CHNA 1U4NA 5LP1A 4ZTUB 4Y7CA 4MWZA 2FXIA 4YQEA 3CN7A 2F8TA 2FX2A 3AEQB 1E1DA 4GZ6A 3DTVB 3KEOA 1F51E 4GQIA 5A9SA 4LF8B 2ZIGA 2GAAA 3ETEA 4B1ZA 2Q36A 1JLKA 1H2YA 1OX6A 1EM8A 3F5DA 4DLKA 1DQPA 1M1NA 1XYGA 4O1IA 4G4JA 4TWAA 1BWPA 4ZZ1A 6CHYA 2NUAB 3ZW7A 1B7GO 4E09A 1JG1A 2P9HA 3HRIA 1MIOA 2PUWA 5AO9A 4ED9A 2QAIA 1JJAA 1NI4B 1M54A 2R7NA 1OFUA 2WSSD 3OX3A 3MTIA 3T1VA 3T5BA 3T94A 1BA1A 3T0GA 3FETA 1FY2A 3RAPR 3GH3A 4P7BA 4XUGB 5DX1A 2PTHA 1YL5A 3GCXA 4HUQA 2HVHA 2OCIA 3KKOA 3TVYA 4OY3A 3G2MA 3JR3A 5AVXA 2AC2A 1RQLA 1GPDG 1L5MA 3M5CA 5EE5B 4BQQA 2CMGA 1BG3A 1V8OA 1HF3A 4F6CA 3AVLA 3O80A 5EIHA 2UYHA 2Z3WA 3F7TA 3G9QA 1Q16A 1CU1A 4U7GA 2JBAB 3QOYA 3EASA 3O4VA 1DT9A 1B41A 3AARA 1X9IA 3DEFA 3UOWA 2DT8A 1YBVA 1YT3A 1GGFA 3G2NA 4R9NA 3RD5A 2VXOA 1WDTA 2VGMA 4LJLA 4D46A 3D6NB 5IYZB 3TYXA 1S6PA 1FTNA 4Z4IA 2QSUA 2B1RA 1AQIA 2YHIA 3E81A 4L3VA 3SU8A 3LBIA 2BBOA 2PM8A 4KH4A 4DV4B 1UDXA 3A1EA 4HTAA 4LKRA 3OLVA 4ARAA 4I08A 3PSIA 4YY3K 2EP7A 2WRZA 1WUJS 5J2TA 4BO8A 3V7YA 3AAPA 2XKAA 2HUPA 3VNQA 3CLSD 3ADPA 2UVDA 1G5RA 3EIOA 2UKDA 3MECA 1ZD3A 2ONCA 4PNPA 3M6WA 4JI4B 1CFJA 1NVGA 4RFSA 4UHEA 4XZ3A 2DUWA 4CF7A 3TAQA 2MSEB 3O9ZA 3FCSB 2LCQA 3NT4A 1T5OA 2M6KA 4CVNE 2C8JA 1M6EX 4DV0K 1KVAA 3KPYA 3MT7A 5LCXA 3BILA 1TL1A 3FCAA 1WVGA 3LZJA 1ADYA 3A0UA 3MSXA 4MV5A 4S0XA 1RLUA 1TU0A 4R01A 4TPKA 2NWQA 3R77A 3SN6A 4DNFA 4JR2A 4DU3A 4M8NE 2E4UA 4E15A 3ABIA 2QIOA 2QTVB 1CVIA 2WWRA 3HY3A 3BJRA 1E9BA 1F6DA 2FV8A 1KY5A 3IKJA 4IFBA 4ND2A 2EQAA 3EXHB 4WQ5C 2VK8A 3BHMA 1KORA 4QUKA 1W2BM 2WQ7A 1N8RO 2ZYTX 3MTDA 4XVCA 3QUTA 5CFRA 4IO8A 2Y93A 1JR3D 5MDHA 3B9QA 5A4KA 1NOYA 2BSXA 2EEZA 1ASUA 4OGFA 4DHYA 4U6QA 3TNFA 4MIEA 1K8YB 1NUQA 1J0XO 2OVFA 3UGKA 4TRNA 3FTCA 3DVQX 2AVDA 3PYXA 2H1LA 2CCJA 1VB3A 5I42A 2Z56A 1NLMA 4QQFA 2QD4A 4C0HA 3UH1A 2M6LA 2QU7A 5FLEX 4AZ3B 1DJMA 2GPJA 4L8YA 3V5NA 2Z09A 4US0R 5JANA 2BH2A 4CZHA 4LDJA 3GL1A 3TE6A 4GPZA 1C0IA 2FE4A 4C0XA 3WKCA 3NC4A 2IOCA 3OF5A 4G1CA 1YRAA 2IP1A 1OZAA 2P78A 3TQHA 3HHEA 4CJQA 3DUFB 1ZJ4A 3UTCA 4BNJA 5E1BA 4NS1A 1RABA 5IRCD 2H7YA 1GUAA 1DO2A 5AQFA 3FWPA 4WQ5A 3HCBA 3HDHA 2P40A 3MXOA 2B37A 2QVYX 3WB1A 3U81A 1GNRA 2B2NA 4JI5B