2W42A

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt dna duplex.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGYEGTKVKLSSKRYLLTLLQMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPIRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enhancement of the Seed-Target Recognition Step in RNA Silencing by a Piwi-Mid Domain Protein
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein/dna complex
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN
total genus 137
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2w42A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2w42A01
3HDVA 1BISA 1CHNA 2P5GA 1NTRA 2LUOA 2KFNA 2R25B 1L5ZA 3QK7A 4F8JA 3KIOA 3K4HA 4ICLA 1F4VA 3ULDA 5IUNC 4LZLA 4DF4A 3LUHA 4OLBA 2HNDA 4DSEA 3BRSA 1LBHA 4DSFA 2IS3A 2RGYA 3I09A 4Z0NA 4DF8A 1ZESA 3F6PA 1BAPA 3BGRA 4E1NA 1SL2A 4OGCA 4CEAA 4TMYA 4DMNA 1KFSA 3VQCA 3WNHA 4OLAA 4KI6A 2OPSA 2P1JA 1Z25A 2P4UA 4ZPJA 4DTMA 1KVBA 1ZAYA 1A5XA 4N56A 4JAVC 1RDDA 1G15A 1NOZA 4FLUA 5DLEA 2R4QA 5DTEA 1M2FA 4EUKA 3CQ8A 3K5LA 3KYIB 1H9CA 4IG3A 3RVJA 4NV3A 3A0RB 2HNYA 4MS1A 5HRSA 4CIEA 2PYJA 4FXDA 3EQ2A 3DGEC 2JVIA 2QVCA 3NCIA 3TARA 3ROTA 4E7HA 3PX4A 5KWSA 2PY5A 2OZMA 4CEFA 4NCAA 1PEAA 1RBSA 2RPIA 5IUKC 5CNKA 4J2AA 1T34A 4IBNA 1NK7A 3I0SA 1I39A 4KVFA 2G8IA 2IC3A 4IKFA 4D6XA 1VK0A 4WXEA 4OJRA 1QKKA 2QU7A 2DFFA 4CJTA 4YP9A 3QLVA 2PL9A 1DRJA 2PUBA 1NJWA 1RXEA 3TD9A 3V9WA 3JSMA 3ZSOA 1NXSA 4OPJA 1J53A 3ROFA 3EAFA 1RTIA 1BL3A 2YKMA 2AYZA 3OYEA 3K59A 4OGEA 4BACA 3D45A 2J48A 5SWMA 2D5RA 1NXPA 3KLHA 3Q15C 4C8NA 4GPAA 1BQMA 3Q7RA 4MQFB 4CECA 3C6QA 4E7KA 4FZYA 2NZVG 1XHZA 3O74A 1L3SA 3PX6A 4J2BA 4CF9A 2MYNA 1VSIA 3RRHA 1Z17A 4XAQA 5TPZA 3SQ2A 2R47A 2GKGA 1RCHA 1C6VA 3GRCA 1JLBA 1VSMA 3EJWA 2BGGA 2OENG 3QNNA 1HQEA 4FE4A 4Q6BA 3OLWA 2ITGA 1ASWA 3ZSYA 1NXTA 1QP7A 1LV5A 1CLQA 3OYGA 4XASA 4Z4HA 3LZJA 4MYRA 1O1WA 5FROA 4O5BA 5KGXA 4MR7B 1USIA 5D3GA 3RRGA 2NZUG 4FJ5A 5EWMA 3ZSQA 3Q41A 1WSIA 1E6MA 2MYUA 3AVBA 3CG4A 5EU7A 4RXMA 1HRHA 5BRAA 4EYOA 3ZSRA 6ABPA 4OG2A 3MYYA 3TAQA 3OS2A 3SQ4A 3LUGA 1UWBA 3TAPA 4JRPA 2MYTA 1XWWA 3OS1A 2CHFA 3L6UA 1JDNA 2PMCA 4DLEA 2A9RA 4LH5A 4J2DA 4MS3A 1IH7A 3V1QA 1ISSA 3HPOA 4OKJA 4DQSA 4DSLA 3H6HA 5FRMA 4Z0UA 3O3GA 4ZTJA 3H5IA 3E3MA 3FDFA 4B9LA 4QYWA 3L2UA 1NXWA 2WJAA 3QIOA 2IPLA 2JBAA 3B6OA 3VQ7A 1KVAA 4E89A 4EYKA 1DZ3A 3THVA 2P51A 1WETA 2JBAB 3OLVA 4R5PA 5T3YA 3KSMA 4OKKA 4Z99A 3LDSA 4CEOA 3GT7A 4FM0A 3DLHA 1SXHA 2CD7A 3I5AA 5DMRA 3RVSA 2M1ZA 4S05A 1BCMA 1QS4A 4KB1A 4BE1A 2OZSA 3ZT3A 1KGSA 1P6QA 4IGAA 1F21A 3G10A 4MGEA 1LWFA 2PUAA 4DSJA 3DRPA 5EWLA 2QSJA 4FJKA 3LUFA 4Z9BA 5HP1A 1VSHA 3OLZA 1B9DA 2I6FA 3QEVA 3OYKA 4K8XA 1CZBA 1VSLA 1B00A 4AILC 1XHEA 3GWGA 4FLVA 3O3FA 1B9FA 1JFTA 3HDGA 3HK2A 1RBVA 1TVRA 4RS3A 1L3UA 5DCLA 2WOMA 2B5JA 2Q3SA 4DFPA 3EODA 3KG2A 3HPGA 4Z4IA 4F11A 3ZSZA 5T7BA 2R7YA 1U47A 1EWTA 4QAGA 4QICA 1W25A 1S1VA 4RZSA 2E4VA 4UHKA 1TJYA 1E6KA 3NH0A 1LWEA 4O0IA 2JCGA 1PUXA 2QW1A 3KYJB 5C5EA 4CHYA 4YRZA 3HP9A 1RBUA 3DYAA 4KQ9A 1C0EA 4O1IA 4FJ7A 4O44A 2XY8A 4P1ZA 1VSDA 4DADA 2E4YA 1MB0A 4BWJA 1U04A 3NNDA 4PE5B 3Q7TA 2E4UA 3JS5A 1USKA 1QSSA 1TAQA 3CKMA 3NAEA 2XDYA 2RDMA 2HHSA 4M3YA 4LE1A 1C4WA 3C94A 1RDBA 2A9OA 2JGUA 2F8SA 4FK0A 1DCFA 2PUEA 4CFBA 5DKFA 5K14A 1TMYA 5TPWB 1L3TA 4RW8A 3VNAA 9ABPA 3LUDA 1ZH4A 3C3MA 2GBPA 1EWVA 1EHCA 1A5VA 1WN7A 1TGOA 5EWLB 5TQJA 2YNIA 3K5NA 4O1HA 1RDCA 4FJ9A 3ALYA 2KYRA 3HVRA 3BBLA 2O20A 1VRTA 1NKEA 3EZ5A 4H3KB 3PO4A 3KKRA 1Z15A 3SUOA 5JNUA 3I42A 3KD1E 2M98A 2PUDA 4PEVA 3QEMA 2PUGA 1Y97A 2NUBA 3NF8A 4JB2A 2VUIB 4OVLA 1SXGA 4E19A 4C8MA 3ILYA 4PYRA 3SQ1A 1SRRA 1RT4A 1J56A 3DLRA 4DQDA 3QEMB 2A9PA 5HRPA 1JH9A 3HL8A 1KTQA 5KQPA 1TKDA 4E0DA 4KNYA 4BDYA 3U3YA 3OQOA 1ZVVA 4Q6WA 4I7FA 3LWLA 2LP4Y 3CG0A 2EHGA 2ZD1A 4YV7A 1WLJA 1CYEA 4RG8A 4W5RA 3KLNA 1GOAA 2LBPA 1MU2A 2E4ZA 4CIGA 1MB3A 4YO7A 4CJQA 3T3FA 3KTQA 4CF2A 3KS9A 1DC7A 5FRNA 3CFYA 5I4CA 3OMXA 1SV5A 3QO9A 1JX6A 4YR7A 1W9HA 1TLFA 3KLEA 1PHRA 4ELTA 3GV0A 4QOZB 1RILA 3T38A 2OPPA 3IP6A 2JVJA 1J5OA 4JB0A 3QELB 4OBBA 2HMIA 1LW2A 4RY8A 1VRUA 4EZ6A 4DQPA 4IFVA 4KQCA 4RK4A 3LP1A 4Y9TA 4FJJA 2Q5CA 2VG7A 3LTEA 1N5YA 2ZWMA 1HEYA 2YHBA 2FN8A 3I0RA 4CHZA 4CK1A 2QV0A 1S1WA 4B3OA 4E7PA 2YV0X 2DFEA 2ZAYA 2FW0A 3RMBA 2B6AA 2IOYA 3L3UA 4PZ0A 4CGHA 4ETMA 2G8KA 4N47A 1ZY2A 1VPWA 4L8RB 2A1SA 4CFDA 3DZDA 3F6CA 3VQ5A 2GBZA 2WRZA 3WNGA 2IKSA 2PZSA 4LD0A 4GVMA 3BREA 4N03A 5EWJA 1U49A 3L2VA 3IPAA 1LWCA 1JLAA 1TK5A 1EAYA 1JYFA 1P8AA 3SQNA 4E7OA 4KTWA 4FW1A 3E01A 4HYEA 4RK6A 1LK0A 1JF8A 3N75A 5KQGA 1EX4A 1HQUA 2F96A 1T8EA 3VN5A 4CJWA 3SZ2A 2JB9A 3MIZA 4W5OA 1USGA 3QIPA 3EY1A 1MAVA 1NATA 4CJVA 4RY9A 3CM5A 2O4GA 1BIZA 3AVAA 3SUQA 3KKSA 3CFOA 3HUUA 4WXMA 4NQRA 1HMVA 5B3JC 2VG6A 3D0PA 1UAXA 2Z1JA 1QQBA 1AB6A 1LJLA 3RVKA 4C8OA 4N0QA 2HNZA 2FLKA 4G0QA 1RT5A 4HCBA 4MLDA 4DTOA 1R8JA 3QLUA 1B92A 3QLHA 2GV9A 2RKIA 1WSHA 3OYAA 4G0OA 1VSFA 2IYNA 2KZZA 4M3RA 3OVNA 1RBRA 1A0OA 2HQBA 3TI0A 1QO0A 1ITGA 3KTOA 2FMIA 4WE1A 1XHFA 4D6YA 1C1AA 2WONA 5HM6A 5J2MA 1NXOA 4EP4A 2B4JA 1TL1A 1EFAA 4JRQA 1JHZA 1ASUA 2Z1HA 5CNMA 4AHTA 1RT2A 4DSKA 4KI4A 3JPWA 1NXVA 4CGGA 4CERA 4KHQA 4RY0A 2G8HA 2JVKA 1DJMA 2FEPA 1NOYA 3RVRA 5TPWA 2Y1IA 2IOCA 3DOKA 5EWJB 1IKVA 4TSXA 1XI1A 1URPA 4WZZA 3O2QB 2HHVA 3H1GA 5FDLA 3DGFC 1RT6A 3AVKA 2FMKA 1Z12A 5I3UA 4ZYLA 4Q5VA 4EYGA 1QMPA 2EX3A 4L85A 2QZJA 3K58A 3I45A 5FWXA 5CHYA 1DBPA 4RK5A 5CYQA 2YNGA 1UA0A 1JXBA 3Q7SA 1ZH2A 1YVUA 4B9VA 2IAJA 1BIUA 4MFBA 4CEEA 4IG0A 1HYVA 1K66A 1S9EA 2HJ9A 3NNSA 3F73A 3CLKA 2H3HA 4CJSA 3VQ8A 3RWUA 5CYMA 1BA2A 3JVDA 4KV8A 1Z18A 3SAJA 4UQGA 4B9TA 1SXIA 4XXHA 1VSJA 2JK1A 4KHUA 1PNRA 1I3CA 4JS4A 3KD5E 4DTJA 4IMIB 3P5JA 4JASB 3CYMA 1T03A 1TL3A 5CNIA 1EXQA 1NJYA 4EP5A 3N53A 1D4ZA 2QVGA 1ZBUA 1NXXA 2YNFA 2RJOA 1BDIA 2MYPA 2N9UA 3AVHA 3BRQA 1ZBIA 4AHVA 2WMYA 2G8UA 3KLGA 3LALA 1TK8A 2AYXA 1LAVA 3OYJA 2G8VA 2WWVD 4CJ4A 5DK5A 1QQAA 2WY2D 3CU5A 3T6KA 4DLGA 3O21A 3RVQA 2L2QA 2D0BA 4PY5A 4RKQA 4TLMB 4FJLA 4JP1A 1SUQA 4DTNA 5PNTA 1D1PA 4CFAA 3HEBA 2OPRA 1TKXA 5FBKA 3JYTA 3OM0A 3ZT2A 3QNOA 3DLEA 3V9XA 1EP4A 1JXEA 1ABFA 4DSIA 3FFXA 1S9GA 4I2PA 1FK9A 2V0NA 1J9AA 5IEJA 3SV4A 3TWHA 4F06A 1FFSA 1HJRA 4MQFA 3VQ4A 2G8FA 3RVPA 3TR8A 1J54A 4MS4B 3SNNA 1K6YA 2IPNA 2YNHA 1E6LA 3AVLA 4IMJB 4FVMA 3H6GA 3U6FA 3ISNC 3RVOA 1FKPA 1JYEA 4FLTA 1MVOA 2DRIA 3V1RA 2IGIA 2ID7A 3A0UA 4EVQA 1ZDMA 3RMCA 5JNWA 1U0SY 4GNRA 2X6NA 1NK4A 2HSGA 1ISRA 3CZ5A 2Z1GA 1P6UA 4RW7A 4CJLA 3LFTA 5KC9A 1KLMA 1ZGGA 5ED4A 4KPYA 3TAFA 4KK3A 3QINA 3MM4A 3V1OA 4G86A 4GMJB 1HNVA 4MLCA 2XRIA 3AVGA 4IRXA 1SKRA 4FLZA 3HJFA 2MSWA 4BE2A 3JPYA 4B9MA 1D8YA 1SD5A 4MPTA 2D0AA 1APBA 3CNBA 4DTSA 5HROA 3AV9A 1AB5A 2BDPA 3TX6A 3RQIA 1Q8IA 4HCCA 1A2OA 2R48A 5JNTA 4QPJC 1U2QA 2L19A 4KTZA 4LDZA 2FBXA 3T19A 2XO7A 3HV2A 3CM6A 1GUBA 4IDKA 3CTPA 4Z9AA 5IX8A 3FFIA 4W5QA 1S5JA 1JL1A 1WSGA 1F51E 3QESA 3RR8A 3PY8A 4Z4FA 2RN2A 3A10A 2LPMA 3H1EA 2PJUA 4KHNA 4IILA 2B1JA 4ID5A 3HVTA 4PWDA 3QEXA 3L3VA 1S1UA 3K9CA 3LANA 5CY4A 2FMFA 3H5LA 4G97A 6CHYA 4JLHA 8ABPA 3NGIA 3ZT1A 2E4WA 1D9FA 1L5UA 1S6QA 1ZYQA 4MR9B 4RSMA 4CK3A 1ASVA 4ETNA 3CFRA 4FLXA 3WNEA 2P5OA 1DRKA 2OPQA 3DM2A 5TQ2A 2E4LA 2BANA 3TO5A 3ASMA 3B6PA 3MAQA 4NCBA 1ZBHA 4AHUA 4ELUA 5KRSA 1YK0A 2I5JA 3M8SA 4KV7A 1HYZA 3VQPA 4FZXC 3V9ZA 1U4BA 1DCMA 2Y1JA 1TV6A 4RK0A 2YKNA 4KFBA 5E3JA 3FGZA 3SM9A 2HQRA 2HVHA 1GOBA 3EYZA 2XY6A 1QO0D 2FVYA 3K2PA 1Z13A 1WSEA 3TAGA 2MSLA 1KRWA 4B8AB 1TM2A 3LP0A 1NKCA 3VQ9A 1VKRA 4CESA 4N0PA 1Z16A 4C8LA 1U45A 2L17A 4M88A 3AVCA 3WNFA 5GOTA 1ZBFA 5GQSA 1ZBLA 3T8YA 3BILA 3A2FA 3NHZA 1LW0A 4B9UA 1RTHA 4MR8B 1EKEA 3SV3A 2FSPA 4M45A 4G0XA 1RT1A 3KK1A 5JNSA 4P98A 2KW4A 4KO0A 1M5TA 4NICA 3ITHA 3O1JC 4PA1A 4KHWA 4BWMA 3S3NA 2TMYA 4FJHA 3NE6A 1S8NA 2KTQA 5IBQA 1RDAA 4LE0A 4HNRA 1KRPA 1TKTA 3URMA 2FBYA 3C97A 1IO2A 3KCNA 3NGYA 4ZJPA 4Z4EA 4AHCA 4CEBA 4MR9A 3EGCA 3F7NA 3AO5A 3HZHA 1M5UA 1HYSA 1DG9A 4DQQA 2A9QA 4YLEA 2GUIA 3LKBA 1Q9YA 5BQ3A 3TABA 3MXIA 3CFPA 1YK1A 3KK3A 3H75A 4DTUA 4EVSA 1YMVA 4FCYA 4DN6A 2FLWA 3BDPA 2A1RA 2HPHA 1X9SA 4JS5A 5FBHA 4LSLA 1VSEA 3C6UA 2HQOA 4DTRA 2IDOA 4ELVA 2QXYA 5BRJA 3M9WA 2QR3A 4O0JA 3HO1A 4NCGA 2DY4A 2VWKA 2VG5A 1RZRD 3M8RA 4CHNA 1QPZA 3OO1A 4KHYA 1NK5A 3H5TA 2DFHA 3LP3A 1DBQA 4H4OA 2NT3A 1VLZA 3PX0A 4B08A 4CF8A 4WT7A 4E1MA 1JL3A 4RK1A 4RU1A 1S1TA 3RMAA 4Q7EA 5F64A 3IS9A 3OQNA 1C0TA 1DTQA 3CG7A 1T05A 1ZITA 3PV8A 1X9WA 3NGZA 3SPYA 3U3GA 3NHMA 2HB5A 1NJXA 3AVJA 4G0PA 1JLFA 2FXIA 3NBPA 4Y1CA 4G1QA 1LBIA 3L49A 1BGXT 4F3TA 3QLTA 3SI6A 3HCWA 1M2EA 4CJPA 4ZHRA 3EULA 4MRMA 1D5AA 2P9HA 3DLGA 3NH2A 4F4KA 4KKOA 4C8KA 1A5WA 3O1HB 1U2PA 3GL9A 5JNRA 2FTKE 2FC0A 3RVNA 3MECA 3OYLA 1L5YA 4M3ZA 3AO1A 2W42A 1WAFA 1NK8A 3RR7A 4DQIA 2JRLA 4HUFA 5FWYA 4AH9A 3AVNA 5I42A 2HHWA 3LOPA 3MQ4A 2F8TA 4FM1A 3LAMA 4F2RA 1TK0A 4CGDA 1KSPA 1QHTA 2Z1IA 1MIHA 1KVCA 2ATQA 4G0MA 3HT3A 3NH1A 1QSYA 4MS4A 4S04A 3AA5X 5IUJC 3TANA 3MMNA 4M3XA 1DCKA 4W5NA 4CJUA 4B09A 5J2PA 4KZKA 3GYBA 4CJEA 3AVIA 2FEWB 1NK9A 4N5SA 5C24A 1Q9XA 1UDRA 4FK4A 3T95A 3MEDA 1ZHHA 3TMYA 3HPHA 4TLLB 3HYFA 3OYIA 3LPTA 2KZMA 2XHBA 1DP4A 1GLGA 3F9KA 4MQEA 3N0XA 3HS3A 3GA5A 3NHGA 2RJNA 5KGWA 4UHJA 5HRNA 5CZ2A 5J2QA 4M3WA 3OYCA 1K68A 3QEPA 5BR1A 1TVMA 4MQEB 1IKXA 4FJ8A 2PKXA 4E3SA 1IKYA 3NNNA 4O5AA 3AO4A 3V6DA 4CCHA 1DLOA 1X9MA 4RW6A 1RNHA 3AVMA 4FW2A 3FFWA 1U8TA 3NF7A 5FWXB 3OJUA 3CHYA 1JLGA 4XARA 3EQZA 3AVFA 1T7PA 2PL1A 3OLYA 3AA3A 2FEKA 3TAEA 3SY8A 1JLKA 4RV5A 4F12A 1C1BA 3JTEA 2E4XA 3H5OA 1HNIA 2HHQA 1S1XA 3I8DA 4PQUA 1WNSA 4CF1A 3MEGA 3KHTA 3OYNA 4LE2A 3UKJA 1RXIA 4OTZA 5JS2A 3KLIA 2KFZA 3LZIA 3HSTB 4DU1A 3N6VA 4O4GA 4M42A 3LUAA 5HRRA 5JS1A 4JA2A 4LY7A 3QERA 3MXMA 2HW3A 2GX6A 4W5TA 3VA0A 1NJZA 5C42A 4NYFA 4MR7A 3P9YA 4WWHA 2IPMA 3RVMA 3ZT4A 2PUFA 3OYDA 1IIBA 4ETIA 4FJGA 1U48A 3DBIA 3O2SB 5E41A 2X74A 2H0AA 3TAMA 3NFAA 2FKAA 4Y1DA 1IG9A 4DFMA 3N0RA 1JDPA 3OLXA 1C0MA 3VQ6A 4HNSA 4RW4A 1REVA 1VSKA 1BI4A 4EZ9A 5IC5A 4ZMRA 1XHXA 3IRXA 1EWKA 3VQDA 3KK2A 4F2SA 5HKOA 3O1IC 4CHOA 3M6MD 2PYLA 2LIVA 3CS3A 4N41A 3P1GA 2X7XA 5J2NA 1QP0A 4YNQA 3H5VA 3IP9A 4IFYA 4D74A 1IKWA 4M3UA 3NBMA 4NYNA 4DTXA 7ABPA 1D1QA 3O75A 5C25A 3C3KA 1Y1LA 3SG0A 1RBTA 3UK0A 3OM1A 4FJNA 3LAKA 3NF9A 2VYCA 1RT3A 3UUGA 3QLVC 3VQBA 1W0HA 1NY5A 3Q9SA 2FBTA 3VQEA 4CIFA 4RK7A 2RF2A 5CZ1A 2GWRA 4GW6A 4YFUA 3QLUC 3V9UA 4ID1A 4FLWA 3QETA 5SZTA 5KTQA 1A04A 3KLOA 1NK0A 4FYDA 4CGIA 3R0JA 1EETA 3AA4A 5TE9A 3OYHA 3N8IA 4JOQA 3OYFA 1GOCA 3DMJA 3SQ0A 1CEYA 3C6TA 4BDZA 4FJIA 4CEQA 3OQMA 2E6LA 1XC9A 3OO0A 4WUTA 5CNJA 4HUEA 4MQ3A 4XLTA 3SUPA 2E6MA 2WJWA 3G0ZA 3ZSXA 4KTQA 3N0WA 1TKZA 4CFCA 1SL0A 1DTTA 4XIUA 4DU4A 4Z4CA 1NK6A 4CJFA 3D02A 4XFKA 4KMRA 4DFJA 2WB4A 3KJVA 1BQNA 5EWMB 4M41A 1JWLA 1R0AA 4AHRA 2VUHB 1LAWA 1BHLA 1RZRA 3K5OA 4DFKA 1ZN2A 2ZQBA 2FQYA 2VK2A 2PE5A 2FQXA 4YS6A 3S3MA 4CF0A 4E7JA 1DBWA 2X6SA 3MEEA 3B2NA 3VQAA 4Z4GA 1C1CA 2KQ2A 3O4QA 4I9QA 1QNLA 1RT7A 3FFTA 3LMKA 4H8KA 3DLKA 4KAZA 1D2AA 4ML3A 3ZSVA 3HXMA 3IAYA 3O4NA 3OYBA 1WAJA 1DC8A 3SCXA 3RVLA 1RNLA 1KRXA 4CEDA 4FLYA 4I9LA 4DU3A 1NKBA 3HP6A 2PAFA 4QCLA 1S6PA 4EVRA 3LPUA 4HUGA 4KB0A 4DTPA 4YCSA 3SNKA 2ID9A 2AJQA 4KRFA 4M3TA 1LJUA 4J2EA 4QYMA 3L2WA 1GUDA 5HLFA 2NT4A 3IPCA 2YHAA 4O55A 2FQWA 3PO5A 3V4IA 4FZZA 3GBVA 3IP5A 2L18A 2PLNA 1QSLA 1YT3A 3P83D 3CRNA 1PNTA 3W9SA 1KMIY 4YWHA 4EGSA 1JKHA 3NF6A 3LUJA 3OYMA 3H5WA 3V9SA 2CWDA 3KJXA 3O2JA 4LX8A 3TB6A 1FFWA 3HSYA 3SJJA 1YTAA 4OATA 1QQCA 4CHQA 4E7LA 2O4IA 5D2CA 4BDPA 2XY7A 4KREA 4KHSA 3ZCMA 3S3OA 1CZ9A 3MA0A 3M9XA 1RTJA 5KQLA 1XWLA 4DS5A 3OY9A 3ZSWA 4CEZA 1BVHA 1SKSA 1L3VA 3PUFA 4RWEA 2QXFA 1YTUA 4KFCA 2HVIA 1QP4A 2ZE2A 1D9DA 5ABPA 4B9SA 2DTUA 3SYZA 2QKKA 4DQRA 3RMDA 3AO3A 4FE7A 4E7IA 3M8QA 5J1EA 1I3AA 2QK9A 3DOLA 3MF4A 1CXUA 2LSNA 3S9HA 4OPKA 1BI4B 4CGFA 4MRMB 1TAUA 1CXQA 4LRQA 3T1AA 3QEKA 3LWMA 4RXTA 3KLFA 3OMWA 2ETJA 4HVJA 3HUTA 3GBPA 3QX8A 4H60A 4H3HB 1SKWA 1YS7A 2X78A 4ZTFA 3QELA 1KLNA 3IDOA 2B4AA 3QX9A 1RPJA 3CZCA 4H4MA 4MS3B 3L2RA 3OS0A 2QKBA 3OJSA 5KQMA 1KFDA 1C0UA 2OYQA 4RKRA 3ZT0A 4EYQA 5HBMA 4HHTA 1UOCA 4CBVA 4I2QA 4HTUA 1UA1A 2IDMA 4RW9A 3E61A 1Z26A 4PICA 3MXJA 4OKEA 1YS6A 3A3KA 4CJRA 5TPZD 1FXXA 5TQ0A 1QTMA 5KRTA 1HPZA 1JLEA 3K57A 5C5CA 5KC8A 2BE2A 2FBVA 1WSFA 1Z2EA 2G8WA 1YIOA 3UIQA 3G85A 3C3WA 4LDAA 2D0CA 5TQ0B 4LSNA 4DG1A 3QEIA 4RXUA 4FJMA 2HHUA 4CJ3A 2IPAB 3G1WA 3LP2A 4RDCA 5HSGA 1ABEA 1JFSA 3C95A 4AHSA 3H1FA 4PUOA 4L4UA 4IF4A 2MSKA 5KI6A 4CGJA 3QEWA 4LH4A 4FK2A 3AO2A 2FMHA 2HHTA 3LUCA 1JFVA 3D8UA 5B3JA 3SPZA 1QE1A 4F3OA 1BCOA 1JBEA 3DI6A 4MR8A 1SL1A 4KK4A 5IEBA 5IULC 1N6QA 3LUKA 3K5MA 3IP7A 1X1PA 3AA2A 1FFGA 3LKVA 3DRSA 1OXBB 3O3HA 4MS1B 4ZMSA 1E2BA 3RH0A 2PUCA 2JLEA 3KKEA 1FSPA 1BDHA 5DGCA 3HM9A 4MAAA 4CJ5A 1WSJA 4DWIA 1ZGZA 3JVIA 3DRRA 4TN5A 4B8CA 3L2QA 5JNVA 3ILHA 5FWYB 3S99A 3VNBA 4B9NA 4BE0A 3M8PA 1FKOA 5HQJA 1VRVA 3EDCA 3L8BA 4G0ZA 4K8ZA 3RTVA 4CE9A 4FM2A 1JLQA 3JY6A 3DLBA 2OQRA 1FQWA 3SUNA 4FJXA 1BDJA 4CJKA 3IG1A 2OA8A 4CHPA 1JLCA 4G0YA 3NDKA 2VWJA 1YMUA 1KCFA 2GI4A 2HHXA 4CK2A 4FB4A 1JL2A 1OXKB 4F8RA 1GCGA 4N76A 1P2FA 4DS4A 4Q0BA 1PEYA 5TQ2B 3V81A 1GCAA 3FMVA 3H08A 2XY5A 4HNQA 2FN9A 1Z2DA 1D5WA 3VA3A 1RTDA 4YGXB 4EY3A 2CHEA 3VQQA
chains in the Genus database with same CATH superfamily
3HDVA 2VP6A 3QX3A 3O8CA 2V97A 1SVNA 1NU0A 1XK6A 1KXPA 1HKUA 2P3OA 3HE3A 4G84A 5DI3A 5E7MA 4U1RA 1YR7A 1T2DA 2JFZA 5IBCA 1GSAA 3TLGA 2LUOA 5T57A 1OGJA 1OTHA 4RV4A 4BE4A 4EGCB 2H2HA 2KFNA 1RM0A 1TVCA 3G49A 4JJ8A 2WJ3A 3RFUA 2VRNA 3IVXA 3BIFA 3OZCA 2I67A 3QWBA 4ZYVA 1V7QA 2XWSA 2I71A 4RV9A 3WP0A 4FL9A 3TSQA 4F8JA 5I9LA 4IJWA 4X6XA 5EZ6B 1F4VA 3P9PA 2O8BB 3ULDA 1JDSA 1SB8A 1V2HE 5LZ7A 4DF4A 3DFUA 4OLBA 5JC1A 1IOZA 4FT2A 3C98A 3SVZA 3DVRX 3BD7A 2JIPA 3HJRA 1B6RA 2ECKA 2F43A 3ZTWA 5TIIA 3ZGZA 3L7MA 3PUZA 2RGYA 1HRDA 3WGYA 4V1CA 4CTMA 4I99A 3FCXA 5DULA 3UUEA 3F6PA 1NOKA 1S8FA 1YZGA 1BAPA 3UCFA 3DAGA 3BGRA 4CTOA 1ULUA 2KBFA 3OPQA 1SL2A 4OGCA 1K97A 2X3FA 3VVBA 4YX9A 4CEAA 2Q3BA 1M1YA 5TKWA 4IJNA 3LQKA 1GQYA 4LF8B 4CI0B 2PFSA 1K2VN 1KFSA 2CJWA 2FSSA 2HA7A 2REBA 3WNHA 4OLAA 4KI6A 2VNJA 4MYCA 4P38A 2CLFB 5K0NA 821PA 1ZZEA 3KQYA 1E1RD 1W6UA 1P0PA 4HRVA 4JBGA 2P1JA 4A4DA 5BSKA 1AUVA 3SXJA 1YNSA 3U31A 2PSFA 5BN4B 4D79A 3AM3A 1NYQA 3WNVA 4A8PA 2I80A 2BONA 2CVZA 5KSZA 2FR0A 3ILVA 2HUPA 4QDUA 4N56A 2ZXFA 4KWCA 5EUCA 3VH4A 1TD1A 2ZYGA 3UANA 2NM0A 2XRFA 4D26A 2JGJA 3QXGA 1RDDA 1BHO1 2FQQA 3WO1A 2DR2A 4FLUA 4EI7A 5JICA 5DM6L 2RH9B 3EMKA 3C4VA 1T9HA 4DSUA 4AZTA 2BTOA 1M2FA 1TUBB 4MH0R 4EUKA 1IXSB 3OFVA 2J3EA 2XECA 5CBKA 2X4LA 2OZKA 1H9CA 2G71A 2ZIGA 2VDJA 4JYMA 3WLIA 1QHAA 3CCUN 1RRFA 3DMNA 2P3SA 3A0RB 2EJBA 3QXSA 4I8DA 3TTYA 4EIWA 5C4MA 2HNYA 4TMTA 4CKZA 4KHZA 5GPBA 1PFWA 2EX1A 1J42A 1LSJA 1RD4A 3O38A 3EG9A 1UXJA 3PXEA 3Q3VA 4LTNA 1Y63A 2R1UA 2VI5A 3UMJA 2R9VA 4D0RA 5FUQA 3WLHA 2JVIA 3TL2A 1P7CA 3REQB 4GOLD 3RTBA 3NCIA 1IEVA 4M8SA 1T1GA 1X92A 2R6AA 1EXNA 3EFHA 4LHXA 4BNDB 3CVJA 2Z8ZA 4BNLA 2VF2A 2PY5A 5C0OE 1RYBA 3UC9A 3R8XA 2F3UA 1PS0A 1SG0A 2GNAA 4A91A 5KINB 3EPHA 1GUYA 1PEAA 4X84A 3LIIA 2HIMA 4PR0A 4D7AA 4J2AA 4PCVA 2E82A 4Z7OB 4Q9DA 3ZIDA 4DR1B 4OHKA 4IBNA 2BFWA 4XVQA 2OXCA 3GQVA 3EPJA 3NHYA 2G7ZA 4OH1A 3WGOA 3AO0B 4DCCA 4KVFA 1CUWA 3GEIA 3ROMA 3VUEA 2AXEA 5K0ZA 2ZUTA 3SYRA 3AR6A 4CDRA 2WILA 4IKFA 3K9FC 4KNWA 3ZDCA 2YZ7A 5LR6A 1BX0A 3PDIB 1OFTA 1QKKA 5DO9A 3AGPA 4X64K 5K8VA 2QU7A 3GC6A 3K05A 4QHSA 3HUDA 4RGBA 3CR8A 4GXQA 3VVMA 3IKMB 1GYQA 1JVBA 2JI9A 4P84A 3L4BC 2FPWA 2YOGA 4E88A 3QLEA 2PL9A 1STOA 4F2HA 4MKGA 2PUBA 5IAAA 3TQCA 2XMDA 1D2MA 2EJVA 1E9FA 3THYB 3QVJA 4P33A 3M0EA 2BC9A 1OVYA 4EPVA 4JJAA 3M89A 1AN0A 1PZGA 1Q21A 1UQUA 2GJKA 2I87A 3QVKA 3ZCRA 1K8ZB 2PHZA 3BWBA 3GDGA 3PFBA 4TMFA 1SA0B 3ASVA 3ROFA 2HEIA 3VDXA 4OUKX 4EO9A 4RTOA 1K4KA 3HCCA 3DE7X 1CUCA 4JITA 4F45A 4JKOA 2F9FA 2I3GA 4HTAA 1XNGA 5F77A 1DGQA 3ACDA 2HJRA 3LQ2A 1AS3A 4IGEA 3WLRA 2XOEA 3LP5A 4R3NA 5JMVA 3NS7A 3ZHZA 5KVSA 1ATIA 5KWEA 4JEHA 1YHQN 1KK1A 4EI9A 1NXPA 3KK0A 2D0OB 3IEXA 3MTDA 3WKEA 4KXXA 3FYSA 2IS1A 2JI6A 3GH3A 4QJ4A 2P9BA 2R2GA 1IBKB 4C8NA 1TCBA 4PHCA 1UL1X 1Y33E 4TT3A 1BQMA 5JYDA 3Q7RA 1CSEE 4X6YA 3LLVA 1CF9A 2D2VA 3U13A 1S4MA 1HKHA 4E7KA 5K01A 2PDAA 5G0UA 1VMAA 2XAAA 4ZZIA 4NU5A 3HG7A 4ZYTA 1CJBA 2XE4A 1LPMA 4OOEA 4R2MA 4GIBA 5J23A 1L3SA 1CEQA 1RPAA 1EYZA 1XLVA 1ZW6A 2IW1A 2MINB 4MVXA 5EE9A 5A4FS 3WB0A 4AO6A 5IXSA 2GKSA 2H29A 3L05A 2MYNA 2G06A 3AF6A 4EIAA 1EU1A 1NYLA 1NM1A 2XODA 1PKXA 3PS9A 1VBFA 3RG8A 3DPSA 3RFXA 3H7AA 3EVGA 4JI5B 1TO2E 4BCCA 5J4VA 5FH9A 1DQYA 3ABRB 4RLQA 4RCZA 2P2LA 3FYHA 4M1KA 1JGTA 3SQ2A 4HGOA 4M21A 5CH3A 2WUVA 2JFGA 3L8MA 3E22B 3KFXA 1C6VA 2AN9A 3C15C 4BB0A 5FFFA 1JLBA 1LWNA 2Z30A 3N8KA 1IUPA 3SYNA 4KGVA 3VTZA 1MO3A 2P9LA 2J7PA 4BBJA 4Q6BA 4FE4A 3FRIA 3IMFA 3OLWA 4MQ4A 4OCZA 4J4TA 4WNCA 5KDOA 1EFRA 2ITGA 1ASWA 3PLNA 3ZSYA 1T43A 1NXTA 1YC5A 4HGYA 4YJHA 2Q4TA 1GEEA 2DETA 2O0LA 4LF4B 3EVDA 4B2YA 1IXKA 2IHTA 1M1YB 4BG9A 4NULA 1SXPA 1QHHB 3C4JA 3G8DA 1U2GC 1DAKA 1U7UA 1SCJA 4MYRA 1C8KA 2ZRMA 1RLTA 1CV2A 1FMJA 5FROA 3PPIA 4PPNA 3BXGA 5K5EA 2V3CC 4MR7B 1O6BA 1CLUA 1VZ3A 3QVWA 4KQ2A 1TQDA 5DI9A 3BIJA 4KXFB 4EJFA 3RRGA 1H6DA 1WHSB 2GCIA 4OQMA 4JP2A 5FWDA 4FJ5A 5EWMA 3ZSQA 4YONB 3LA6A 3SIPA 3VYUB 1U99A 3W2TA 1F2UB 1Z05A 1Q12A 3OCCA 3KJGA 3GRZA 1P91A 3KTFA 4RXMA 2CKMA 3I8OA 3NIBA 3ZCXA 5BRAA 1UC4B 3G17A 5J40A 2DPLA 5B57C 3VF2A 1PQUA 3P4IA 3DB2A 3TDMA 3VYWA 3OHRA 121PA 4ZT6A 3I61A 1GR1A 3BWEA 3KZNA 1GZ6A 4JRPA 3ADCA 2XVZA 3IAM1 1WZ2A 1QRRA 1UBNA 1Y1QA 1YB7A 3R5KA 3EGVA 4F2GA 4BC0A 1PTJA 2Q31A 3ZVLA 5L3ZA 4EPXA 3UT5B 2FWNA 5G4LA 1J7KA 1IWPB 1U0GA 4MMYB 3WQTA 2A9RA 1TL7C 2VUUA 4ZVPA 3I33A 4YREA 4BEWA 4LQLA 2Q6LA 3ZX4A 4C6TA 2XNDA 1MX9A 2BCGY 3ESBA 3EVFA 3MWEB 4ZYUA 4MS3A 2V7EA 4GH5A 4W82A 1IH7A 5T64A 4LKOA 3DOOA 4XR4A 3BEDA 4ESVA 1ISSA 1UUFA 1DWOA 2KHOA 1KO1A 5E95A 3ZV5A 3ZKWA 3QOXA 4BR0A 3H6HA 4NP6A 1GYPA 2WVGA 4P7KA 4R9NA 1E3DA 4MCJA 3O3GA 4H7EA 4Q21A 4DJJA 4Q9HA 2N1BA 2IU0A 2GTPA 2XDWA 4B1VA 1KZYC 4NHEA 3LW8A 3E3MA 1UWVA 4UEOA 1FC0A 4ZAVA 4G09A 3ZNPA 2W0MA 4FR5A 1IHXA 3PIOL 4GRIA 1V1JA 4EFLA 4DSAA 5FOQA 1IZ0A 1UQTA 4IJAA 2YTZA 3D4IA 1R59O 1V96A 1QH1A 3JSAA 1IN8A 2CLMB 4FYJA 4GLJA 1RWOA 4V03A 4E89A 3C7AA 4QT0A 3JQPA 1EJ0A 5A0TA 3EVCA 3AY7A 3INRA 1X7WB 2QDXA 1EZZA 4FEAA 4I3HA 2QWNA 2VL7A 1YRBA 1V3VA 1KJJA 4X93A 4L8WB 4YALA 4ZOLF 2P51A 2H9IA 3ZQKA 4YT4A 4OXRA 2BDEA 4UBIA 2GZHA 4WLEA 2GZSA 4XCXA 4D9CA 1Q17A 2BOVA 2C4KA 2ETXA 2WT4A 4JJ4A 3SQOA 2PRSA 5BR8K 3I6MA 1T6BY 4R5PA 1EFUA 3FFAA 1J20A 3HKDA 2IHYA 4Q24A 3BMCA 5LBUA 3RFVA 3S5UA 2AR9A 5KSOA 2P9IB 5LMNK 2F1JA 2FFBA 4REQB 2Z5VA 1G64A 3TEJA 1HKGA 3GT7A 4OUDB 2E88A 2FWMX 3M1FA 2IJGX 2PS1A 3DOEA 4HTFA 4ITVA 2F9LA 2YHXA 1E2FA 4KNVA 5B1IA 2AI2A 4AWAA 5DZSA 4OMDA 3OZBA 1IY1A 1EQUA 3TW8A 5FL7A 2C4MA 3FOAA 4AKHA 2OSBA 1LNSA 4BJ5A 1PK8A 2IYZA 1RDWX 4N6NA 5ALGA 4KB1A 1TK3A 2X3YA 1E32A 2XT6A 3NEPX 5A2GA 1F5NA 1XZPA 3R44A 1O6FA 1U11A 4ZRNA 3CSSA 3NVMA 3U3KA 1W75A 3RJTA 5C10A 1XZHA 4MEAA 1CWUA 2YNMC 1ZUIA 4XM0A 1G8YA 3RG2A 3HR8A 1B7GO 4UOQA 4CLOA 4CLRA 5IKMA 3RWMB 4BROA 2MSEB 1JKFA 2FP3A 2YNMD 3GLVA 3O9RA 4GR9A 4LYGA 5F4BA 2GN0A 3ZHTA 5BWLA 5HP1A 4FJ2A 3RFFA 3OTHA 5A0VA 4WQMA 3OP4A 1NC1A 5F7ZA 3WBJA 2B37A 1KYXA 3VAAA 4CI6A 3LIPA 4FT4A 5BVGA 5CLQA 1B00A 1HY3A 3C5VA 3D6VA 1XHEA 2DCMA 3EXHA 2C0CA 4FLVA 4R6WA 3W3AD 3ZLJA 1GTRA 1Z74A 3GLGA 3KSBC 1NX9A 2AEEA 4Y2HA 2ZBPA 3HB0A 1RE1A 4BKOA 4MYHA 3GRKA 2P6MA 4OA8A 2BIFA 4PYQA 1ZJ6A 2VYFA 3EZLA 4Q1CA 4OJTA 3NUZA 5LMUB 5DCLA 4ESHA 2GEUA 4M87A 3ZIAA 1QIIA 2Z2YA 4DT1A 2B5JA 2Q3SA 2Y1KA 3CINA 3N2KA 4KLCA 4RA6B 2CL6X 3ZSZA 5T7BA 2YFQA 3C4QA 3VC1A 1U47A 1EWTA 4Q34A 4EW6A 3Q88A 3ICOA 3S70A 4CWAA 5L40A 4L9SA 2AJ8A 1W6RA 1L1RA 3HMQA 2W0SA 4G81A 3HRKA 4JKAA 1HYBA 4XH9B 4BNJA 1U7PA 1LWEA 3PQCA 3Q8WA 3ZBPA 3ZY4A 4F85A 2WD7A 1I7DA 4RPJA 1Z68A 4LYHA 3HP9A 2Q0HA 4KIFA 4BFCA 3VESA 1RBUA 4MV4A 4D99A 1L7AA 1BU5A 3L0CA 2REQA 5H5JA 3FOEC 4LIPD 1L5MA 2EKBA 2QTFA 3W9BA 1J2TA 4G23A 4HX5A 1ZIOA 2XY8A 4Y2GA 4LRXA 5KAMA 1KKUA 1YVPA 4OGGA 1VSDA 4ZO9A 5L7YA 1EIZA 5ESWA 3WA7A 3IDQA 1Q83A 3PV0A 1OHHD 5DW3A 4ZAXA 1AE1A 3KKZA 4XDGA 4XYMA 5AI5A 3JS5A 3GIWA 4TM8A 1VIAA 1DAIA 5A06A 1W36B 2Q29A 2OANA 3INTA 4NZYA 3G9UA 3ZD9A 4BKMA 1RHQA 4YOUA 1DOZA 1OZHA 5CR9A 4M3YA 1C4WA 3V8EA 2WJGA 4QUBA 3JARB 5IDVA 2Z5GA 1E3WA 1UINA 4KJZA 1VL0A 1F7UA 1Q1GA 2VHYA 4N5DA 3C94A 2HA4A 1SG6A 1U7OA 3K09A 1ZD8A 4EA6A 1ESEA 4PO3X 3KKQA 1LC3A 2QU8A 3BCUA 1E2JA 5GJCA 4NL4H 3LL3A 4AF1A 6GPBA 1KZ4A 1AO0A 4JCOA 4R05A 1FDUA 3GJSA 4WASA 3ZD7A 4ILGB 1VJTA 2WWIA 3ZWMA 1L3TA 3Q3IA 3D7KA 3K32A 1E4FT 1E4YA 3VNAA 9ABPA 4EAHD 2AN3A 1ZH4A 3UXEA 3GA7A 4FCCA 1NJ2A 4FFMA 2CLDX 4YAUA 2J32A 1MHTA 3TR5A 1A5VA 1WN7A 2OAQ1 4BFXA 3AL0C 3W5JA 5LQSA 5EMMA 2YNIA 1A9TA 3BVPA 3K5NA 1IXRC 3FYDA 3IEIA 1XCLA 3KWJA 4QNRA 5IYZA 3ONVA 3ALYA 1KQNA 2I4TA 4ZT2A 2YASA 3MWPA 1X15A 4HAZA 3RAFC 3BBLA 2V7TA 1J24A 3EUEA 1QSGA 1GKIA 2X0JA 4H4EA 3V2GA 1JALA 1CDDA 1EFKA 3I05A 3QKWA 5FPMA 3T35A 1WG8A 4WBSA 3GLGB 3PO4A 2QWMA 2AD5A 3UJDA 4E5PA 1SNYA 2IY8A 1TAGA 4JHXA 2IOHA 4FDVA 4JC0A 4IIBA 4ZI3A 1F14A 3RC8A 2ACVA 2CDBA 4IOKA 4PEVA 1E3QA 1KAGA 2PA3A 5LC1A 2PUGA 2R11A 2NUBA 3ERCA 3NF8A 3E5MA 3O9VA 4JB2A 2HBMA 1S1CA 3HDQA 3EDMA 4JQZA 2VUIB 2X9GA 4OVLA 1KJ8A 1JIUA 2VOEA 1GGNA 3RTDA 1SXGA 4CLDA 3N4QA 4WQ4C 2PFKA 2Y8EA 4PYRA 5LQUA 3TQQA 1NONA 1RT4A 5BV7A 1J56A 5DHPA 4YAWA 3GLHE 3SIWA 3QEMB 3HBLA 1TQHA 3OIUA 2ZP1A 3HL8A 5F4ZA 3W3AH 1ZGCA 3Q1KA 2O23A 3BJIC 2ZRCA 4E0DA 3PC7A 5H02A 5AQRA 3DDSA 2JASA 4WY8A 5F23A 4OHBA 5CHIA 1SR8A 1G98A 2GYVA 3LX4A 4BUCA 5DNUA 5E6SA 1BFUA 1ZVVA 3OCZA 2JIZA 1E9BA 1YJWN 2EKPA 1T5TA 2RSLA 3CG0A 3D6TB 3MN6A 4RPIA 4YV7A 1WLJA 3C3XA 1U3CA 2YINC 5I48A 1Z88A 3IH5A 3MT0A 3FCOA 5ICGA 3FKSD 3H0KA 5CK5A 4A3SA 2VIIA 1ZNWA 1T0IA 4A62A 1IB0A 2DFDA 2WBLC 3BCRA 4IGIA 4KE8A 2RKBA 4O2BF 1KJ9A 4TMXA 5KPRA 1RVDA 2AT1A 2M32A 2Y0PA 2ZR9A 3MJEA 4OHFA 1MU2A 1OYVA 3CB4A 2R44A 4CIGA 1J07A 1MB3A 3ENKA 2QTDA 3HKCA 3KJIA 4YUVA 1AQJA 1NVMB 3T3FA 1TIKA 2V6MA 3NASA 3UFXB 3WICA 1FDTA 4WLFA 4ETWA 5JXJA 1C7FA 2IU6A 5K09A 1NP7A 3KWGA 5FCDA 3PXGA 1KARA 1USVA 1O0CA 4M63C 4Q3DA 1E20A 2OZLB 2M9MA 4FLMA 4WFJA 4MAMA 2FW1A 2QQ0A 5JQWA 3QO9A 3KZMA 1DEAA 1UKEA 4CBWA 1E0KA 3FPFA 2R00C 3KU1A 3PWZA 4MKXA 3EMBA 3ZWCA 2W9XA 4KYTA 2NXNA 2J0UA 3DWFA 4YY3K 1O97C 4YP6A 1ZQ9A 1VSUA 1ZVKA 3OX1A 1XIVA 2V59A 4ZT5A 1PFKA 3K0SA 3GV0A 5F9HA 1L8QA 4FEEA 1WB5A 3KJFA 4XDZA 1I2BA 5JJCA 2A0UA 3GDFA 3IV9A 3MWDA 2HV8A 1EE2A 1RM4A 4OBBA 3ZZMA 4BKQA 3R5TA 4ILEA 1GSIA 4OMUA 1YFKA 2JGLA 1DEJA 3ELBA 5LM3A 1VLJA 3O0DA 3HVUA 4N5LA 1I3MA 3CUSA 3X1JA 4MGKR 3BDIA 2YMMA 4KQCA 4Z0HO 3LP1A 3EMDA 3OQHA 5CBPA 4GUAA 1PKEA 2YDYA 3WL3A 1ZUHA 3B1KA 1WA5A 3VGLA 3FVRA 5J1TB 2FN8A 1O95C 5AUNB 2G17A 3BJZA 3EZ2A 3W6PA 5CVTA 6Q21A 1BH2A 1NBEA 4KB5A 1J0EA 4E7PA 3FUTA 1O58A 3KALA 4G26A 1IUOA 3CJTA 1SCDA 4GV9A 1ML4A 1MQ8B 1QG6A 1W4ZA 3HFGA 3IEUA 4F7WA 1A50B 1IH8A 5DISB 1C0KA 1IMJA 3G5UA 4MPJA 5K8LA 2FW0A 2VLIA 4HGPA 1HOTA 3L3UA 1R0LA 1ZL0A 2GF2A 2O2HA 4RIGA 2GLUA 4UUPA 2PT9A 4BQLA 1GKLA 3QG1A 3O9SA 5AJXA 5LMZA 4R1MA 1G8PA 2A9KA 3JARA 4IOJA 5AM0A 1CF2O 3TQFA 4B40A 1VPWA 2B8TA 3ICEA 4L8RB 5AQWA 2UUOA 2CHGA 1ATNA 2VZ0A 4GBED 4B6EA 3HRGA 1ZYUA 2ORYA 1CDZA 1C30A 3GLFA 1YCGA 2ORED 1AUOA 3ZGVA 4DR4K 1KH1A 4KLNA 4F5EA 2NTVA 2H4XA 2O52A 3QPAA 1Q7TA 1MC4A 2JAUA 1PJRA 2WAOA 1MJNA 3F5QA 3ZYZA 2EGUA 2QWLA 3A3PA 4GG1A 2VF8A 4HXYA 4F6CA 2DXIA 5A7FA 3WK8A 3C8ZA 3TYXA 1TA0A 2ES4A 2VNHA 4XFJA 1FNSA 4GVMA 3ND8A 4N03A 1LKZA 4PYNA 3P9IA 3AHJA 3QIVA 5KYUA 1A69A 2IEGA 1FVFA 2QZ4A 2O8DA 2NV6A 2O8VA 2WUGA 4O63O 3D2AA 5DGHA 5BSVA 3SD7A 5A2QA 2HQSA 1CFZA 1UXHA 3KJQA 3N6RA 1E7RA 4UULA 2GO1A 5DNVA 4F7DA 4FKMA 2FSIA 1ICIA 1I5OA 4GLOA 1TK5A 3ASYA 5DI3B 1WXWA 2IZ6A 1DXOA 2B61A 4KTWA 1LC0A 1QYWA 5GADP 1W94A 1ZXXA 2HSDA 4O25A 4DIFA 1JAIA 2NTEA 5ERGB 2ACKA 4RK6A 3T54A 1LK0A 2W71A 4IBOA 1GPKA 1NV9A 3EIQA 4AM7A 3MW8A 4XZ3A 3T9CA 4AYWA 1VHXA 1DDIA 3MVEA 5EKUA 2FSVA 1EX4A 1NIPA 3I12A 1ZUWA 3U7JA 1HNZK 4BFLA 2F96A 1R0XA 3MT7A 2D13A 3OW2M 1FX0A 4I50F 4QBKA 2GM4A 2UXBK 1FU4A 4M7PA 2CF6A 2E7ZA 1D2NA 3GEGA 3OFJA 3G02A 3ZV6A 4W5OA 1USGA 3DZCA 2I4RA 3JYNA 1MAVA 3WXJA 4GZ6A 4MWDA 3A32A 5EZYB 4BZXA 5JAOA 2HY7A 2OB1A 2J6HA 4D4IA 1BYUA 3V32A 2K2QB 3UYKA 4HEQA 3ROEA 1JPUA 4F4HA 3P9KA 3KE8A 3TN7A 3W1EA 4PSDA 1MABA 5HIIA 4UCQA 3KKSA 1YZNA 1KZGB 3NBQA 3CCSN 1E2KA 2XWJI 1HMVA 2ZJ5A 1ZGHA 4HZUA 3BMNB 4JLKA 1BE6A 5YASA 1XQYA 2AUNA 5EY4A 2QSYA 3KYDB 3TAUA 4A1OA 1UAXA 1WV1A 2R66A 1RHRA 1NWCA 4O33A 5IARA 5JWOA 2C99A 3CW8X 4KUHA 4JGIA 2QGZA 2BEKA 3ZTTA 4C4SA 3FZEA 3JZAA 4JS0A 4H6XA 5ECWA 3O9QA 1AN9A 3QE4A 4DANA 1JJBA 2Z3VA 1FXWF 3UGTA 1IN1A 1ZK1A 5E1BA 5CCBA 2Y1DA 1VTKA 4BRMA 4C0XA 5D6OA 4G85A 1I4TD 4QM7A 3UB3A 4GOMD 4QTYA 1B92A 1XCMA 5I4IA 2PZFA 4K42A 2WWYA 1MLDA 4Q1DA 5BN5A 5JJIA 4O8KA 4DV7B 1CETA 4Q19A 3GLUA 4YCAA 4Q7MB 2P67A 3PFKA 3RIMA 1IZ9A 4H1UA 2Q99A 3I6YA 2I3ZA 5CCXA 1QV6A 2DT8A 2P78A 2W98A 1QO0A 1YRHA 2YVUA 2BFFA 3KTOA 4HQKA 3ANYB 3W77A 2FSGA 4YHHB 2B2NA 2NU8A 4YBRA 1XHFA 2Q1YA 3A8YA 1HDXA 2P1DA 3TZLA 4AL4A 1ZMXA 1WZEA 5JV5A 2IOFA 3AJ8A 2WONA 4D44A 1EDDA 2NO1A 4TMZA 1V3QE 4B5LA 2ONZA 5BW4A 4YJ2A 1WP4A 2WWTA 5JZVA 2B4JA 2QB5A 2QYHA 4US1R 3JQAB 1F2TB 1PZMA 2N46A 4JRQA 4P2GA 5J2TF 5IDWA 1ASUA 1EFAA 2XBMA 2WT8A 3K9HA 2R85A 1YBVA 4J76A 3DQZA 4AHTA 4JYAB 3E8XA 3JPWA 4DSKA 2W37A 4LA4A 2Y77A 4RZUA 4DA8A 2W8BA 3UMRA 4Z94A 2HPVA 4CERA 3PYMA 2G83A 1ZIYA 4MHOA 1KE2A 1CUHA 5C7IO 4MDBA 4BMDA 2G8HA 3OWXA 2QRJA 3SZMA 4N4AA 3ZOKA 1EFRD 1TMGE 4RADA 1QFJA 4J6EA 4A82A 5TPWA 4RGQA 1H94A 1JG6A 3HACA 4F71A 3GF4A 2YMQA 2YQ4A 3GIDA 5BRFA 3N74A 1L5LA 3SHTA 4C5BA 1KI4A 1Z4MA 4TSXA 1XI1A 2BDTA 2IVFA 2PS3A 3DTVD 4BQRA 3VOBA 3O4WA 1QH8B 3IBFA 2Q2VA 2YN2A 2VO1A 3OZVA 2QWQA 4X1KB 3V8PA 3WAGA 1Y3HA 4IXNA 4X1YA 1YD7A 1QS0A 5ALDA 3H1GA 3BZUA 3U1VA 1FUEA 4ACAA 4YDQA 1P4HA 3A1VA 3GAAA 1SIOA 4O4HA 4U0KA 5IHPA 5GZ3A 5JDIC 4O3MA 4M3NA 4Q3AA 4AZVA 8ADHA 3OJLA 3NXKA 1RT6A 3ZY6A 1DC6A 2YIMA 4EG1A 3L4JA 3D8RA 3ZCSA 3LCVB 4X91A 1X9IA 1Z6TA 2I76A 2B5OA 4NEGA 3RREA 1WOMA 1Z4OA 4OM7A 4IV0A 4MVCA 3DE1X 5FEMA 3TR6A 2G9ZA 3LRPA 1QMPA 4RPLA 3EN0A 1AZSC 1W4CA 4D3YA 2JLXA 4EITA 2XSZA 3ESAA 1T4CA 2C03A 3PXXA 1JLHA 4CLXA 4TV9F 5FWXA 1DBPA 2QLBA 4HD8A 4NIMA 1C3LA 4DVJA 1YCDA 2YNGA 3WLOA 3UGJA 3I6IA 3U4QA 3MCAB 2A35A 3L0IB 2VCHA 3BG5A 5EZYA 1Q11A 1U5BB 1JXBA 3Q7SA 4H5NA 1QIJA 2B6NA 1L6RA 1B74A 3DBLA 3F3KA 4L3QA 5B7PA 5ICCA 4OHYA 2K7ZA 1YZLA 3RHTA 4R71A 4CEEA 1GKYA 1RQLA 2RK3A 4CCSA 4TLAA 1XMOK 4IOCL 3AINA 3C74A 2IX3A 4BIIA 1K66A 5BNFA 3ZPXA 5A1JA 4GV6A 2ZRIA 1S9EA 3AL3A 3LQ1A 4G9ZA 4JEIA 1RJ9B 1QHNA 3NIDB 1ENOA 1PL7A 4WCFA 4A5SA 4DGQA 2C5FA 4PNPA 3QMLA 3DZIA 5FF9A 5KHAA 4KQXA 5I8WA 3R3XA 3CLKA 3OQIA 2ERXA 4CQLB 2VTBB 1D0IA 1Z0ZA 2D4AA 4IDOA 4FFSA 1QH0A 4MA0A 4CJSA 2OHFA 3G7SA 3TLAA 2HYIC 1O95A 1W1IA 2WJIA 4KYUA 1V4VA 2CVQA 3DVQX 1FLNA 1XNRB 1D6JA 3WB1A 1PL6A 3GGGA 4X3CA 1BA2A 3D3NA 3G5TA 3KSDO 4KV8A 1Z18A 2ODPA 3QVXA 4LBVA 3HXPA 4RHXA 4B9TA 1W52X 1FYFA 2E18A 1J8YF 1J1ZA 4QBGB 2Y4NA 3ZHBA 3UB2A 4EPTA 6NULA 1DPFA 1VSJA 1LZLA 4POAA 2JK1A 3VR3D 4LF6B 3F9RA 4KHUA 1X7GA 5DCUA 1ENPA 1G66A 2E2WA 2O3JA 3OSUA 4Q03A 2WA2A 4CKWA 1PNRA 4DMKA 4CN8A 1B16A 2K7FA 3P5JA 1LVHA 4GUDA 4WN9B 1KIMA 1O0SA 4XGQA 4QSHA 1JIIA 3CSUA 3CYMA 1Q1AA 2VSXA 1UPTA 4IZHA 3VR1A 3PXUA 4R01A 1MXFA 4NBWA 4K6HA 1TU0A 1T0BA 1VBMA 4JR0A 5CNIA 2B30A 3UV3A 5HZKA 5AVXA 5JAPA 4R2LA 1E5DA 2IHKA 1XC3A 1WQ3A 4L4YA 3U56A 5K8CA 3F6BX 1YOBA 3O8BA 4KN8A 3ZWAA 2HCJB 1O5TA 3KXLA 3QUBA 4N8SA 1D4ZA 1OA1A 2EQ5A 2F1HA 4QQRA 3SN6A 1KQFA 1KL7A 3TZBA 2ZULA 3GLRA 4DMMA 2YHWA 3L9XA 1CE8A 3DFZA 3SX0A 5JCJD 2RJOA 4Q01A 1UH5A 3UAWA 5HKLA 2FK7A 5E7QA 2W6ID 5GZ6A 3AVHA 2ZWAA 3BMXA 4CMIA 3TTSA 4AHVA 1BN7A 2WMYA 3OTIA 1E4EB 3WWPA 2G8UA 1JLLB 1KJIA 1PG0A 3BSYA 3M7IA 4J1TC 5FPEA 1M6YA 2DULA 4QDTA 4W8GA 4V3CA 3V4PB 3HGTA 4BGBA 1N8SA 4JA0A 2XVXA 4NAHA 4S0XA 4LC9B 3WB2A 3A5NC 1O8CA 4LF9K 1AURA 2HLPA 5E6UA 4CJ4A 1NLYA 2WWVD 1IL0A 2O57A 1QQAA 1EUZA 3R4CA 3ENWA 2OQIA 2AOUA 2WY2D 1M74A 2O14A 4PG7A 3RTGA 3W1VA 4MCIA 1JR2A 3ESXA 4DLGA 4LJLA 3T6KA 1XQ1A 4CUZA 4BC4A 2O4UX 3O21A 3BKXA 3KNZA 4LV6A 4MV9A 5INTA 2FPXA 4AKEA 10MHA 3RYFB 4WFBL 1PWEA 4PZCA 3DDHA 1XZGA 4G2TA 1S2MA 3KWIA 5FTLA 4YFYA 1E62A 2DLDA 3TVDA 4FJLA 1UAGA 4JP1A 1M6HA 1SUQA 3COSA 3G0BA 3R24A 1KOGA 5PNTA 2QLMA 3WWCA 3EDYA 2H48A 3I9OA 3TH5A 1DB3A 1M9NA 2QXUA 1RHKA 1V48A 1ZD1A 5A4MS 1QR6A 3Q0IA 2AVNA 4BNYA 5I8PA 2ZT5A 3OM0A 2C92A 2HCTA 4XLLA 4BNIA 5EJ8A 1W35A 2IITA 4DR7B 2YWHA 1RQXA 1ZNZA 3FB4A 4DB3A 3B7GA 4JI8K 4PHFA 1U4OA 2E4AA 5H7XA 5IEJA 3W8FA 3WMGA 1FNNA 1JT9A 3ECCA 2FNAA 3PRYA 4B6RA 5IZCC 4F06A 3FGPA 3N2NA 3HO6A 3B6EA 5M1OA 2V7XA 1BSVA 2C5SA 1ADYA 2CVPA 3U9DA 4MQFA 1Z06A 4AMYA 1PQWA 4JLJA 2GFQA 5AM4A 4DOMA 3QPVA 5C18A 3IAAA 4D4JA 1GKKA 4L7QA 4G65A 4M1ZA 3MQFA 2VUSA 3UMCA 1VQ6N 1IBCA 4S2EA 3TCNA 4E09A 3LPMA 1K6YA 4N18A 1ULAA 2XBLA 2YNHA 2A2ZA 4FILA 4IIGA 4II3A 2P2NA 2FPGB 3STHA 2GAFA 3L79A 5DASA 4C0LA 4KE6A 1GNVA 2QEXN 3ID6C 1YXQA 1G1AA 1IE3A 3M3ZA 4J0DA 5EJIA 1N33B 2XUKA 3KUCA 4A0QA 2YBEA 3VEYA 4J2HA 4X45A 2H7CA 5TEVA 2IYEA 2ATCA 1HL7A 2ID7A 2JI8A 4FOSA 3A0UA 3UK2A 4RD2A 4Q4LA 1DEXA 3GR6A 1XD2A 2G4VA 2ZRNA 3SM3A 3P96A 1Z3IX 1WTCA 2WABA 4PR3A 5C51B 2ZT6A 3AR5A 3MK31 1H0SA 5JNWA 3DXZA 1GOTA 1U0SY 2GF9A 4IH9A 4MV0A 4EOGA 1NK4A 3KHYA 1JECA 1ISRA 3CZ5A 3Q7IA 4JK8A 3LYAA 4XX0B 1JRLA 5CDHA 4J16C 5CFZA 3WJ2A 5KIAA 2AR0A 4V0SA 4JEMA 1C7ZA 3LFTA 1ID1A 1RBQA 3NWPA 2VBCA 1I3OA 2P77A 5KC9A 4UU0A 1BDMA 1ZGGA 5KX5A 4QOHA 3KQUA 1V37A 3QWIA 5DIFA 4KPYA 4A7PA 3TAFA 2J9YB 2ZJ1A 4X62K 1MWKA 1Y37A 3PC8A 4I55B 1J2UA 3FDXA 1NP3A 4AG5A 4V1CB 2NOAA 3RANA 2QRZA 3VF4A 4UATA 4WEOA 1NVAA 2X77A 2ZRLA 1DQRA 4MLCA 2XRIA 2GXQA 4CLHA 4KQFA 2FB9A 5GVRA 1P4AA 3U4IA 4G0VA 1SKRA 3WC4A 1U2DC 4J7XA 1MD9A 3EOBI 3HJFA 2ZJFA 3LDFA 4G1FA 2FWJA 3JPYA 1LS1A 1BEZA 1G60A 1D8YA 1LTKA 1SD5A 4YI3A 4F96A 3OIDA 4ENRA 3ROPA 3THWA 4WW0A 3CLUC 2LVBA 1XCPA 2O8BA 1AB5A 3HDHA 4WN3A 1JLRA 2D4WA 2PMFA 1U0HC 2QQEA 3C3CA 1XB2A 3DEFA 4GYWA 4LDNA 4RACA 1JKJA 1X94A 3TX6A 1HMPA 3RQIA 3E7DA 4NZMA 1XU4A 4HCCA 4N5MA 3RB8A 1XEXB 1I4OA 1KJWA 2HBZA 4HRXA 4QPJC 3DONA 4Q93A 3MLBA 1YHZA 2FBXA 4DLBA 3RS9A 1HZJA 2OXTA 3I9MA 4P6VF 4IWNA 3H3FA 4QXMA 1QQ6A 1ZISA 2PXHA 1MC1A 1GUBA 4IDKA 3DDZX 1MU0A 2ERYA 5AZIB 1FRFS 3CH7A 1K5DA 2FN7A 2BHSA 3IKLA 4WZBB 1ZSNA 1R0KA 1YJ8A 4Z9AA 5K2OA 2VQSA 4CUJA 4HO1X 2I4OA 4M37A 4R1LA 2D1FA 1JL1A 4B1UB 1U1FA 3WYGA 1KVSA 2XCQA 5BPHA 1F60A 1LI7A 2OOKA 3DP9A 3H17A 3RROA 4ISEA 3NX4A 4Z4FA 2MDTA 3GLHA 1Z8FA 3EGEA 4MVJG 4ZVVA 4FOIA 5MHTA 4AF8A 1N2CB 1H1LB 1WXFA 2GJ8A 4LBZA 4AZWA 3A10A 2O19A 1KP2A 2VH5R 3LRTA 2A78A 2BRUC 2J5XA 5H3LA 5TT1A 1N2ZA 1NGSA 1B6GA 2XB6A 1JA1A 2JEOA 4F86A 5F2RA 3MMSA 2YWDA 5K4GA 3VJRA 2SKDA 5MLCQ 2FGJA 4EPWA 4IUYA 2WR8A 3ZYCA 1Y42X 1PLLA 5HFAA 3CIFA 2H5EA 1RYEA 2ZR7A 2X1MA 1P4RA 1Z7GA 4X3OA 1RLOA 4W1QA 3FYUC 2F7SA 5JD5A 1VP9A 1DJNA 2H92A 3AY6A 4JLHA 8ABPA 3R9IA 4JYBA 4PLWA 1T2NA 4YXWD 2ONCA 2F6RA 3K70B 3ZHUA 1D9FA 5EJ4A 4NBSA 3B9PA 3UPTA 3ANXA 3BHMA 1S6QA 5DN6D 5EPUA 1BKDR 2MMGA 1GL6A 5EXWA 1I7PA 1YQGA 2C8LA 2NZ8A 3DM9B 3OZSA 3QHAA 4Z49A 4QG3A 3CRQA 1NBIA 4NK5A 1ASVA 3JQDA 4MV1A 4ETNA 3ZJTA 1RRPA 4Y2UA 4FLXA 2P5OA 1DRKA 1A1SA 1KMCA 4AQYK 1Q3TA 1UMCA 4LK2A 4RLFA 3FZNA 5TQ2A 2P9NA 3IKMA 2JDID 4WBNB 4HFNA 4DLWA 1M2JA 1UEIA 2MSDB 1T36A 3M1LA 3H86A 3ORHA 3EPPA 1ZBHA 4FNOA 4FSDA 4LMBA 1C0LA 4MUJA 4WLOA 1XTSA 5EZSA 4CODB 5KRSA 2V58A 3ZETA 1FRVA 1MGOA 3M8SA 3VDMA 1AUXA 1CTQA 1UEXC 2OFWA 2WINI 5BUSA 2I54A 3VQPA 3R6TA 4LISA 1SHTX 4NBVA 5HMMA 1TMOA 2C78A 2ZSUA 5AI4A 3ZCQA 2BI8A 1RABA 4DHEA 1WEHA 4P32A 4NZPA 3WG9A 3CNOA 1TV6A 1N8KA 3SBDA 3L46A 5AKEA 3OTOK 4X94A 2GZRA 4MUKA 1O89A 1GGFA 3DAHA 2NZTA 3P19A 4GMDA 4ND7A 2XCIA 2HQRA 3D6UA 3DXYA 1GOBA 4ZVKA 3UTDA 2WSSA 2XY6A 2ZUCA 3I1JA 4H7FA 4IIYA 4Q1FA 3RWOA 3CVYA 1J5EB 4GKVA 5EIFA 4K6MA 1SB9A 5AVOA 3BN3A 4PYMA 1KSHA 4YOTA 4IVPA 4TQUS 2OHVA 1JS1X 3F0TA 5TJ9A 3WLKX 5GGYA 3I5UA 1Z28A 4UJ5A 1WMDA 5IK2A 3W5CA 2NZWA 4HDMA 5EFZA 3KXDA 1S2GA 1TZCA 2HH9A 5CURA 4I3GA 1TM2A 2AEJA 4JVOA 1Z5UA 3LNCA 3WEEA 1XD2B 1QRUA 1NKCA 1VKRA 3MYRA 3GUVA 1BG6A 3A1FA 4CESA 3NCTA 4NCXA 4TWRA 3FBTA 1EFHA 5BNZA 1RXUA 1XMSA 2D5LA 3FWHA 1D2RA 3FWPA 3U4LA 3CMEN 4O4IB 5IVPA 2AK3A 3FSRA 3JD1A 2GEKA 1WXHA 1GAJA 1NA5A 1Y64A 2Z1NA 5A4DA 1V8BA 5HG0A 5KMGB 2I29A 2C5LA 1BVUA 5GQSA 2XB2A 1BEEA 3ZEAA 4XX0A 1YZVA 2FPIB 3NBYC 5AIAA 3BILA 1I7NA 1QORA 3EWIA 2WZDA 4AM6A 4Q4JB 1KD1O 2P41A 2PWYA 2X5NA 4HLUC 4MUXA 1NHWA 5FTWA 4Y6RA 2FMUA 2OFFA 3KDSE 2EP7A 3TUJC 2ZWVA 3AY0A 3UE5A 2WAYA 2ZT8A 3SV3A 1FLAA 3ZH2A 3IUNA 3OA9A 5AKYA 3VR6H 3ZV3A 2KBEA 5AZJB 5CIQA 1JEDA 4YOYA 2HO5A 4UTPA 1LDYA 3A1CA 3JVVA 5IFLA 2OO5A 4QGGA 3QKRB 3IHTA 4HOYA 4P98A 5DLDA 5JNSA 2KW4A 1Z8NA 3GVCA 4KO0A 3PFFA 1CUGA 4EG4A 3L41A 3KB2A 4KBGA 2Y6UA 3IQDB 3DZHA 1C7IA 3IVRA 4PA1A 1UKBA 3CD6N 3I04A 3PVCA 4GNKA 5GJBA 1Z75A 5FRDA 2NAFA 1DIRA 1GTG1 4HN9A 1WB4A 3MT8A 1YZQA 5FPPA 2OXIA 3K4QA 3WWEA 3NE6A 4C4PA 4CT4B 2WHRA 3D4NA 4OPAA 2DBQA 1RDAA 3GARA 4N49A 1OX5A 2GH1A 2E5LK 1E1YA 1UM8A 2C1EA 3B1YA 3EK2A 4DMUB 5JAZA 3SE0A 5JROA 4RVSA 3SS9X 3BZCA 1P81A 4NFHA 4KDEA 3BXPA 3C1AA 3L5KA 4LJAA 1CR0A 1GNRA 3O3CA 4ZV4A 4F6LA 3RYCB 1YAGA 4A5BA 4B87A 5LP1A 4AKTA 4JI3K 3NM4A 1PFVA 1WMBA 2KMLA 3R0ZA 3SHWA 5B1YA 2O5RA 3C97A 3FN4A 5CD9A 1ZC3A 2FN3A 2XYQA 4I50A 1TF5A 1JIVA 2HLDA 4ZI5A 4G5RA 1HF3A 5H3HA 4BZWA 5AZIA 2QI9C 3O6WA 4Y0WA 3D8SA 4AHCA 4CEBA 3EZFA 3RBAA 4C7JA 1A4RA 1KBOA 4JKBA 1D04A 2D06A 3K2QA 4KOEC 1G2IA 2FEAA 2HO4A 2OCIA 3AQ4A 5LQMA 4QZVA 1U0OC 3AO5A 3OBWA 3HZHA 2AOVA 3RVBA 3ETJA 2ZATA 2FDCA 3B5EA 2HDNB 5GINE 5F7JA 4BVHA 1HQDA 2A9QA 2JIBA 3DBOB 5M3BA 3VR0A 3Q0EA 2GUIA 4YLEA 2HK6A 4IY1A 3MXIA 5P8WA 2QL9A 3HJHA 3SJZA 3KK3A 1OLUB 4JU8A 3H75A 3WLNA 3QICA 4ZEMA 3EZGA 2QJTA 1YMVA 1PYGA 4RDIA 1RYFA 3NVDA 5KHOC 3FZHA 1B8OA 2XPCA 3ZEUA 1M6VA 3LYHA 4IHAA 5EHGA 3QMVA 2BUAA 3MJTA 1CERA 2G5GX 4U7PB 1MW9X 1PTKA 1WF3A 2YWGA 1GNPA 1O08A 2YMPA 3PNVA 5KNDH 1E5XA 4E31A 2FZVA 1W85A 3KQPA 4C7XA 3DZBA 4MW9A 2B1GA 2P6UA 2AMJA 1Q95A 2IDOA 4US0R 3L7IA 1T2VA 1L8AA 3SE7A 3J8AA 1Z45A 3AUJB 3VR5H 1QPGA 3M9WA 2ICAA 2QPLA 2H1VA 4B3SK 1AIPA 4JLSA 1YUNA 1QTRA 4NCGA 2DY4A 1X80A 2WDPA 4WZAB 4ZI7A 1GGHA 3QYPA 4DBVO 5EJ2A 1XFAA 2WQ6A 2AOTB 1OCEA 1MEOA 1QPZA 3K6SB 2YVQA 3OO1A 5HJ5A 5JJKA 4XI9A 4BKPA 3P9CA 4RJLA 3KT6A 5KPDA 4EA9A 1DBQA 1EDEA 3CR3C 5IBRA 2MT9A 3GEHA 4HK4A 1CUXA 3P4YA 1QANA 3NANA 4TV9A 4ZP1A 1U4SA 4JLNA 1JHUA 2CE7A 4OUDA 2P9UA 4B08A 5AHRA 5FNZA 2ZS8A 4E13A 1K75A 1XJ0A 2IYSA 4XPIA 2D7CA 1EFPA 1JL3A 1DBRA 2JI4A 4RK1A 5TC4A 4WMLA 1FFXB 3E2IA 2CJXA 3KM0A 2Q5OA 1SUCA 2CLSA 1EXWA 4Q7EA 5DHRA 2C2KA 3FDJA 3SMQA 4CKYA 3LQRA 2C1XA 3LL4A 5C8DA 2DPHA 1RFGE 1Z5VA 4L9AA 3OQNA 3CX4A 4KI7A 4ZVOA 3PV8A 5HFNA 1H0HA 1UBRS 3WIVA 1PD1A 1EP1B 1XZJA 2CK3D 3RVDA 3R5XA 4P7FA 5EMJA 5L4SA 3ZU4A 1A76A 4IDCA 4Z7QB 2E3JA 4I1OA 4CLRB 5JBNA 3HP1A 4UE3S 1Y1RA 1U7XA 1XYYA 2CBZA 3GT0A 3L0OA 4HV4A 1DKOA 1WTAA 3LK7A 2W43A 4TMKA 4KE9A 3FPEA 3H9UA 4FC6A 4PU0A 5CYPA 1W5BA 3NT5A 1CG6A 5EXXA 4ZV7A 4V19S 3ZHCA 3NBPA 1NFQA 1RJFA 4J7CA 5BVGB 4DLLA 2YZMA 1ZEMA 3WB9A 4DCSA 2VAPA 5C7YA 4DZRA 2IEYA 2O1EA 3L8CA 1FQOA 3QLTA 3DLIA 3HCWA 4Y1RA 4AURA 1Y82A 2CXQA 3OA0A 2EZTA 3W5IA 3W2GA 2UU9K 2R6ZA 1SBIA 1Y4UA 4Q66C 1T15A 4ZALA 1AF4A 4BKUA 1W48A 5JD6A 2JW5A 2QUBA 1NVBA 2FPIA 4PKHA 3NRCA 4QTTB 5BV1A 2FGKA 3QOWA 4P92A 4F4KA 4CG1A 2PRYA 2XB4A 4D8XA 1QQTA 4C8KA 1JE0A 1Z2PX 2W6ZA 2XF2A 3QFTA 4JI1B 5JTTA 1PNQA 2UUPA 5D5HA 1R6UA 1WZCA 2V3WA 1I4EB 4A23A 4CNBA 2FTKE 1MRNA 4WQ5A 3MECA 1R9GA 1NM5A 4LJKA 2VPTA 1L5YA 3PQ7A 1XX6A 5AVZA 1XQWA 5K0LA 3AO1A 5HIMA 5LJLA 5AZJA 1QK4A 4N3GA 2W42A 3CF6R 1E9DA 3DPUA 3OZ7A 1P9RA 2BGMA 4GBMA 4DQIA 2A8YA 2H4WA 2V7UA 4G4IA 4ZJUA 4HUFA 2DERA 3DB1A 4K03A 2YJNA 2FWIA 4AH9A 3RRNA 5I42A 4YMVA 3NHPA 4ARZA 4KR7A 5IS2A 3QTTA 1W8DA 1D07A 3O8RA 3OU6A 1VM6A 2J1LA 1RWKA 2NSDA 2IHZA 1WABA 1ZOLA 4P93A 4PF1A 3S1AB 3O5BA 4CGDA 1GN8A 1T10A 2ZI7A 1ZUD1 4RIIA 1VMEA 3D59A 1JAHA 1O95D 4GZMA 2GBLC 1KVCA 3TSOA 4C1BA 1ADBA 3HT3A 4CFYA 3FBGA 1WO8A 5BVHA 1KEUA 2I33A 4S04A 1MB2A 1ETUA 2PH5A 4TS9A 1F6WA 2VDQB 5G02A 5IUJC 3TANA 4M7XA 4BWYA 3QZUA 4PN7A 2RC6A 1LY1A 3Q7PA 3ATVA 3PPVA 1QFXA 4BUJA 4QYXA 3O4HA 4URVR 1TJ5A 3AG6A 1ULSA 1K6MA 1UP6A 2CXPA 4B09A 4C4OA 3COVA 8ATCA 3F6SA 4KFSA 2NXEA 2CGKA 1BA3A 4KQIA 1G55A 4YJ2B 3D3QA 3R7BA 2B8NA 1SU4A 2IDZA 1K3FA 3ZHSA 3IVAA 5DWDA 4ZOLA 2Q97A 4XW2A 2CNDA 4IYJA 3VENA 4L74A 2I1VB 2GVDC 4FK4A 1MO2A 2R1VA 3QFFA 4V3BA 1OXSC 4Z8YA 2G04A 3T95A 4RQAA 5JWRA 1BO6A 5LQKA 2BF4A 3NC1C 4I08A 4XYLA 1JI0A 1GRVA 2H1RA 2QV7A 4PBRA 3HYFA 1AO3A 1AX9A 3JW8A 4HQ0A 4XKJA 5BSTA 3UJ9A 2KZMA 1UKYA 3NM5A 4QPDA 4AW9A 3KVRA 4UVEA 3IO3A 1ZCZA 2QT0A 2VZLA 3BX1A 3D0OA 2VQDA 2F00A 3WIOA 4DMCA 5JCXA 3V42A 3LWBA 1ZIDA 1M2WA 3PL1A 1GNQA 2GM3A 3HLYA 2G36A 2RJNA 2C0PA 2Y1FA 4UHJA 4XSHA 3IQZA 4JI7K 4DQLA 5J2QA 4OP3A 4UU8A 5AHWA 4M3WA 3VBCA 2CY0A 1EUQA 1NUQA 4PCLA 1ZM4A 3RS3A 4HMOA 3C6MA 1EK1A 2F2TA 1IOLA 1KO4A 1M0TA 1N57A 1G6Q1 2O50A 3ULKA 1FXWA 3FPHA 3K1AA 4MQEB 2XUFA 4IGFA 1H8EA 4UMDA 1BOTO 1NQOA 4CIBA 2VTBA 4E3SA 1XXLA 2VDUE 3IEMA 3II6X 4PAGA 4YMSA 2HA0A 4CCHA 3PGKA 1RLMA 3REFA 4I8XA 1VRWA 3W78A 5B3KA 4H17A 5CA1B 4LGVA 3PEVA 5JHHB 2GCNA 2CHVA 4JROA 1TF7A 4JEUA 4COKA 5FWXB 4L8YA 3CHYA 1JLGA 1JTEA 3IMEA 4L5IA 4OFBA 4RGYA 1YI2N 5GONF 3EQZA 2D1YA 2RGXA 4FW8A 5B1DA 2F43B 1C1DA 1T7PA 2O2JA 1C7QA 3LBHA 3AA3A 3VOAA 1Y9AA 4J4HA 3SOZA 3MD0A 2G25A 1TU3A 2A30A 3P0RA 1YI0A 4EF4A 3A6JA 1WUAA 3BFXA 3PT9A 5EGNA 2YXEA 1PG5A 2H7XA 3H5OA 1HNIA 2GWHA 3QHPA 1S1XA 2GFIA 4ODIA 4OP2A 3RJ9A 4Q00A 4D82A 5JO9A 1ZRNA 3CEPB 2AHRA 5EP1A 4UBJA 4UTNA 3OP1A 2XWPA 4DUYK 3P39A 1G5RA 3DKVA 3PF8A 5DOVA 1IBKK 3UKJA 5D1HA 1RVV1 1ECPA 1U9JA 3HCBA 4F4FA 5BOSB 5A3SA 4PSAA 1SVWA 3HU5A 4U6SA 5EP3A 1RXIA 1T1EA 4BQIA 1SVOA 3IT1A 3RU2A 2OHGA 5EP2A 4E5NA 1OU4A 2GM9A 3HGMA 4MICA 1XJ5A 4A8JC 2FW8A 3VO1A 2PUJA 3G8BA 2XTJA 3RJ5A 3RYTC 3MXMA 2GX6A 3TLEA 1OTYA 4RTSA 3RBVA 1OTXA 4W5TA 5BPNA 1JBQA 3GJ7A 4IKEA 3R09A 1VBNA 4LCJA 3NFRA 1Q3KA 2FHPA 4DMGA 4YMUA 3IDHA 1UXIA 3VHLB 4C0WA 1ZL2A 3DF9A 3TPCA 2ASEA 3P9YA 1AKVA 4IJ5A 4GX2A 1MG0A 2YXLA 1E1CA 2FPKA 1NN0A 1AGXA 3OF5A 2B20A 3RVMA 4DNPA 5JH7B 1FPMA 3QNMA 3K2BA 3MMXA 5KSWB 2GBIA 2WJPA 3DBIA 2C42A 3JWHA 1JIXA 1KYWA 4M7YA 2JFQA 4YHHK 3CX8A 4PW0A 3BEXA 1P1RA 1OIWA 2EDAA 3G68A 3G89A 4FGLA 3ZLTA 1P7WA 5JVDA 4GMXA 5KTOA 1U1EA 4UCWA 3V5NA 3KT0A 3ER6A 4DFMA 2IUFA 1Q84A 1MV5A 3FGOA 1PZXA 3CHWA 1E18A 4OJMX 4RHYA 3I2IA 4BNKA 1REVA 1C3OB 1SUPA 4H0PA 4GU5A 5I51A 4EZ9A 5FD8A 3KOUA 3QF4A 1GV1A 2O3QA 1FEZA 4CIWA 5DHQA 4MVJH 3BZKA 4BNVA 1U9IC 2ZBVA 4PYIA 3AIIA 1SMKA 2TYSB 3OIFA 1UJ4A 2C7RA 3WR5A 3HBAA 1IULA 1CDEA 2GSDA 4QHYA 4WA8A 5B6IA 2LIVA 3T0IA 4O2RA 5B6PA 3T3MB 2MTBA 5GINA 1N75A 1MF7A 2WFZA 2W2VA 1K6EA 1OGYA 1QHXA 1N2IA 1TJ3A 1Z3CA 2JEZA 2VN8A 3IP9A 3IPLA 3MTAA 3OZAA 4M3UA 2ZI9A 3DV0B 4NYNA 1LXCA 1KU0A 3GE1A 1ZJZA 1T1JA 3K30A 1TGYA 4WTOA 4B2IA 2DLNA 3F5FA 1V47A 2O2XA 3GOQA 3FOWA 3PITA 4IX1A 4JX9A 4LPSA 2EG9A 7ABPA 1XTKA 1ZOSA 3S1LA 3WQBA 4FC7A 3U7HB 3N7UA 4JCCA 3HZZA 3BXXA 5ARDA 1FU8A 2IDJA 3O75A 4LX0A 3FCCA 4UFNA 5L3QB 1ATRA 3QFHA 3SG0A 1RBTA 4CVNA 2ERCA 4FJNA 3N1UA 3NF9A 2VYCA 3FVWA 3FBWA 1JXQA 3QXHA 3UUGA 4P4GA 2OD7A 1W0HA 4HB0A 1WUTA 5CFMA 2FBTA 3RWBA 4YJ3B 2IYAA 5JAIA 3KQLA 1T9DA 3L3BA 3P52A 2UUBK 1T9GS 1IEWA 4NARA 2R8XA 4QEKA 2YXDA 1YC2A 4GW6A 5DE3A 3TIIA 3ABZA 1W7AA 3LXMA 4HDAA 1SOWA 5EUQB 4ID1A 3WLJA 3ZD6A 4Z0TA 5A02A 3NKVA 1DJLA 1JVSA 2HOQA 4NXNB 1MORA 3UXHA 1TVKA 5FUMA 4FWMA 1PSWA 3AM5A 5AW8A 2BZ1A 4LNUB 5K8IA 3PI6A 1Z0FA 1OI2A 3B78A 2IQIA 1Q77A 5BRHA 1I6WA 1KR5A 1VE3A 3GB9A 2EJWA 3KR2A 4JODA 4X92A 1YQEA 1NW9B 1T5HX 3QJYA 2OHJA 5KOIA 5FPTA 2CHQA 3LLMA 3M3HA 1Q16A 1YDEA 5J3JA 1Q14A 1UAYA 2SCUA 7MHTA 1FQKA 2OBLA 4KZPA 1XF1A 2CB0A 5I7VA 1ESVA 1TRHA 3C6TA 2W5UA 1UBUS 4FJIA 1U4NA 2O3SA 2HF2A 4EEZA 3WVNA 3OQMA 1AY0A 3OO0A 5BR8B 3DAWA 5AJZA 1V5GA 3PD1A 4GQAA 4G5OA 3ZZNA 2VDLB 3P2IA 2HK9A 4RESA 4HN4B 4A8JB 1N6OA 2BZSA 3ZDBA 1J2EA 2QI2A 1TKRA 3HA3A 3IAXA 3VEZA 3GGDA 1BS1A 1IN4A 3R8FA 1A9OA 1XCJA 5DNEA 5KS2A 1Y8CA 2XUDA 3G1TA 4HBGA 3EKUA 5ITVA 4DU4A 2YC2C 3FF4A 4X71A 3PUJA 5AXCA 5IWCA 4HR7A 3MTIA 4QOIA 4HEA6 1ORDA 4A26A 4CU5A 3AIOA 4IF6A 2C7GA 4MV8A 5IAEA 3W6OA 1IBMB 2HU8A 3LOUA 3IIEA 1R0AA 1IFXA 4KI0A 2PZEA 4QL3A 1GJRA 1G3MA 3QF4B 2FQ1A 4JOSA 3SQWA 4BB5A 2GCEA 2VUHB 2XQIA 2E2OA 1EK2A 3R9XB 3C3PA 4CEHB 3ECSA 4YYZA 2H85A 2XNKA 4OAQA 5K8TA 1BHLA 4B46A 3BHNA 2ZSFA 1U2GA 5I9IA 3OCUA 4M8NE 4QREA 5BR7A 1XDSA 4WFAL 3TBHA 2D7DA 2R97A 2Q5IA 2ZQBA 2Y66A 3DUFA 1JKJB 3GRUA 3MJDA 2JBHA 3PQ5A 5FLEX 5B1SA 3UT0A 4DWJA 4OQFA 1KWGA 3AONB 3OX2A 1FUYB 2FQXA 2VF5X 4YS6A 3ODGA 2PE5A 5K7SA 1U3FA 3GZTB 4HLDA 4CF0A 3EH1A 4HDNB 4P7BA 4W7SA 1DBWA 3MEEA 4B3TK 3HC7A 3VQAA 1JMYA 1WUHS 4L3OA 2IUYA 1LU9A 4X8MA 3STTA 2GAIA 4NEHB 1KFKB 1YR1A 3UK7A