2W42A

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt dna duplex.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGYEGTKVKLSSKRYLLTLLQMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPIRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN
publication title Enhancement of the Seed-Target Recognition Step in RNA Silencing by a Piwi-Mid Domain Protein
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein/dna complex
total genus 137
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2w42A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2w42A01
2KFNA 4HCBA 4FJMA 4B8CA 2JK1A 3V9SA 1VK0A 3F73A 4OTZA 3A0RB 4DQPA 3RVSA 3VQEA 1RZRD 1SXIA 3V1RA 1RCHA 5DKFA 4B9VA 3OMWA 4OKKA 1YIOA 3TAQA 1WLJA 4DU3A 1JYEA 2FMIA 2NT4A 1F4VA 1J53A 1QE1A 3LZIA 4C8NA 4E7OA 3FFIA 4EY3A 1WNSA 4CF9A 2LSNA 3AVGA 2DFFA 3NGIA 4HCCA 1Z15A 3FFWA 2RDMA 1UWBA 2B4JA 3CLKA 1ZYQA 3SCXA 1EWTA 4C8OA 2DTUA 1DCFA 2J48A 1RDCA 3KK3A 4DTMA 1UAXA 2RKIA 4KO0A 4NICA 4HNRA 3VQQA 4M3YA 4C8KA 2R48A 2IPLA 2LUOA 3OY9A 2WMYA 5J1EA 3K5OA 4CF0A 1R0AA 5DCLA 4YV7A 2PUAA 3QLVA 4DTJA 3WNHA 2A9OA 3KLOA 4FK0A 3RR7A 4IF4A 2LIVA 3KKEA 3SPYA 1DG9A 5TPWB 3ROTA 4Z0UA 3AVAA 4YR7A 1F51E 4KPYA 4N03A 5C5EA 4MPTA 2QXYA 3RVMA 1TAUA 1KVCA 2QKKA 4MR8A 3OS1A 2FLWA 3BDPA 3R0JA 3QEPA 5DTEA 3KTOA 1A5XA 5IX8A 1JDPA 4Q0BA 3HDGA 4E3SA 1TL1A 1D9FA 3LP0A 4LSLA 1JX6A 3VN5A 2P5OA 5HRPA 3KD5E 2HQRA 1P6QA 4RWEA 4DQIA 1T7PA 3OYCA 4E7JA 4WXMA 1C1CA 4CEBA 1TKDA 4CFBA 3Q9SA 3V9UA 3SJJA 4J2BA 3LP1A 3JSMA 2PYJA 3NH0A 4DF8A 4KK4A 4HYEA 5I42A 2VG6A 4OPJA 3OMXA 4CFDA 4HUGA 3RTVA 3LFTA 1R8JA 3PV8A 1ABFA 5FRMA 2V0NA 1BDIA 3H1EA 3QX8A 1LV5A 3O3HA 3I8DA 4FK2A 5D3GA 4GW6A 2E4UA 3O21A 1RDAA 2HHUA 4G0YA 1VRTA 1ABEA 3QELA 2M1ZA 3FMVA 4QICA 1TL3A 4DSFA 1RT5A 1VLZA 4C8LA 3OYEA 4RK4A 1HNVA 4Z4EA 4L8RB 3HCWA 3VQ5A 4TSXA 4IMJB 4CGFA 4F8RA 1UOCA 4N47A 1REVA 4ZJPA 3DLBA 3W9SA 1NKEA 3SQ4A 3RR8A 4OKEA 1HNIA 1ASUA 2B6AA 1QO0D 4CFAA 3EODA 1KGSA 3NF9A 4D74A 3SUQA 3UIQA 3O1JC 4XAQA 4NCGA 1L5YA 3OQOA 4KHNA 3H5LA 5T3YA 4M3RA 4KQCA 1QP0A 2GUIA 3NNDA 2H0AA 2ZD1A 4DTNA 2JRLA 2GX6A 2B5JA 3SUNA 2IGIA 4CJLA 3JPWA 1NJXA 4M42A 3OYNA 4IGAA 4JRPA 3S3MA 3LOPA 4HNQA 4FJ5A 1JLEA 2Y1IA 3VQ6A 1PNTA 3NBMA 3NCIA 1VSEA 5KWSA 4BDZA 4OATA 3M8RA 2G8KA 4TN5A 1GOAA 4J2DA 1JL2A 1JF8A 1BI4A 3CG0A 5EU7A 1KVBA 3QEMA 1FK9A 2ETJA 4B8AB 3KTQA 4AILC 1X9MA 1U0SY 7ABPA 1XI1A 4KV7A 2FW0A 5FROA 3RVPA 4FJNA 1A0OA 4DWIA 4JB0A 4E89A 4CFCA 1LK0A 1VSDA 4EZ6A 3NHMA 4O0IA 1TK0A 4GMJB 2M98A 3NF7A 1HMVA 3KLEA 1BQNA 4P1ZA 2OZSA 3V4IA 4FVMA 3CKMA 4RXMA 3PX0A 4ETNA 4PICA 3GYBA 3M9XA 2YHAA 3MEGA 3NGYA 3RMBA 2FSPA 4CEZA 4HNSA 1CYEA 4Z4CA 1ZVVA 2GV9A 3EGCA 4L4UA 4QPJC 5GOTA 4RKQA 2A1SA 1ITGA 2IOCA 1APBA 2QW1A 4MRMB 1QSLA 3OYDA 1MB3A 4KK3A 1C0TA 4DSJA 1SUQA 4O1HA 2FEPA 3F7NA 1MVOA 3AO4A 1B00A 5TE9A 1KVAA 5TPZD 1RT3A 3CYMA 2D5RA 3QEIA 4KHQA 3LTEA 1W9HA 4FE7A 4G97A 1KRXA 1JL1A 2HNDA 1TAQA 4JP1A 1DBPA 3H5OA 1NXSA 3QNOA 4DQSA 1P2FA 2L2QA 4FJLA 3HPGA 1ZITA 3QETA 4M3WA 1I3CA 4M3TA 4Z9BA 1BVHA 3CRNA 4S05A 2AJQA 1C4WA 3ILYA 1HYSA 2NZVG 4BWJA 4GNRA 4FM1A 4KFCA 1QSYA 2IPAB 3H75A 3S9HA 4YO7A 3LUKA 2E4VA 2HHWA 2A9PA 3H6GA 3A10A 3L3VA 4EUKA 3HPOA 4OBBA 4KV8A 5CZ1A 2X78A 1TVRA 5IUJC 3O2QB 3SG0A 2IDMA 3IP5A 4DN6A 2TMYA 4JRQA 1GCGA 2ZE2A 4MR7B 3VQAA 4B9MA 1ZBHA 3KHTA 4IKFA 1RT7A 1JLAA 3SV4A 5B3JC 4CJWA 4FLWA 2FMHA 4GVMA 1SL2A 3L2RA 3QERA 3LANA 1RBVA 2PUEA 3I42A 3ZSZA 4MQ3A 3DRRA 4FJ9A 4RY9A 1PEAA 4RDCA 3KCNA 4PZ0A 2WONA 4OGCA 1C0MA 3V9WA 3L3UA 3AVMA 1JXBA 4Y9TA 2PE5A 3N0WA 4Q6WA 4RY0A 1EX4A 2RPIA 1Z2EA 3O75A 3PO4A 3CHYA 4DTPA 1ASVA 3QESA 1TK8A 1BQMA 4E1NA 5CY4A 4RY8A 1BA2A 4RK0A 1DLOA 1IH7A 3AA4A 1MB0A 2WJWA 5IC5A 4J2EA 4EZ9A 2FBTA 1VSKA 2D0AA 1WSHA 2P51A 2Z1IA 1RTIA 2IOYA 4FK4A 1WSGA 4E19A 2VG5A 3SAJA 1S5JA 4D6YA 1ZH2A 1RILA 1L3UA 1WETA 4BE2A 4M3XA 3T3FA 1H9CA 5DGCA 1CHNA 4K8XA 3HSTB 2G8WA 2NZUG 3OYFA 1YS6A 2XDYA 3H6HA 3DLRA 4E0DA 3IPCA 2FMKA 4CK3A 3DBIA 1MIHA 5FWYB 2MYPA 4G0OA 3KIOA 4XLTA 4WZZA 2G8FA 2L17A 1SD5A 2PY5A 1TK5A 3HO1A 3MM4A 1DTQA 4N0QA 3AO1A 1YK0A 1TKXA 2HHSA 4MS3B 4DFJA 4B9SA 3KS9A 4FM2A 4IG3A 1NK7A 3T1AA 3V6DA 4DLGA 2HHXA 3OLXA 1RTJA 1NXTA 1LW0A 2F96A 2HMIA 9ABPA 3V9XA 3GT7A 2HNZA 3AVNA 4BWMA 4KVFA 5SZTA 1BIZA 3LAMA 4KI6A 1TJYA 4CF8A 3BBLA 3N6VA 1XWWA 4Q7EA 2PJUA 1EAYA 4I9LA 1SKSA 2RN2A 4MFBA 1SXHA 3DOKA 2KQ2A 1SL0A 2HVIA 3GL9A 2YV0X 4DSEA 3ZCMA 4E7PA 4RSMA 3DGEC 4RW4A 1WN7A 4MR9B 4CJ4A 3G85A 2A1RA 1UA0A 1L3VA 2Z1GA 3CFYA 1HYZA 5B3JA 3C6TA 1LJLA 3ZSQA 2LP4Y 1JBEA 3IPAA 3MXMA 1S1WA 1NXOA 3H1GA 5CHYA 1DRKA 4XIUA 2AYZA 5IEJA 4FZXC 4ID5A 4UHKA 3D0PA 2PL1A 3N0XA 1CZ9A 1RT6A 5SWMA 4MQEB 1A2OA 3AVKA 5CZ2A 3GBPA 5FBKA 3QEVA 3MECA 4BE0A 4ZMRA 3N75A 4CJ5A 3HJFA 4CGHA 2KFZA 3AO5A 3OLWA 3EAFA 4OPKA 4J2AA 1ZBFA 3NH2A 3DLHA 1QP7A 2JBAA 3KYIB 1GLGA 3ZT4A 4DS5A 5DLEA 2XY5A 1QTMA 3RMAA 3I0SA 5KC8A 4FJKA 4B3OA 2O4GA 3Q7SA 3CTPA 3PX4A 5ABPA 3GV0A 4OG2A 1IIBA 4KREA 3B6PA 1Y97A 3RMDA 1WSFA 3O2SB 2E4YA 1J5OA 3KKRA 3K9CA 1C6VA 3LUDA 1Y1LA 5J2NA 1QQCA 3NHZA 3SZ2A 4CJPA 4JS5A 1RNLA 3DRPA 5HQJA 1TVMA 1K68A 3AV9A 3GRCA 5TQ0A 3I0RA 3I45A 3V9ZA 1EFAA 1QS4A 2BGGA 3UK0A 4C8MA 3HUUA 5BR1A 1LAVA 4KTQA 1YTAA 3CZCA 4ICLA 1F21A 4DFPA 4FW2A 3AA2A 4H4OA 4CHYA 4MLCA 3LKVA 4BACA 4R5PA 3RWUA 1D2AA 4LZLA 4CJSA 3D8UA 5DMRA 2XO7A 4LX8A 4F06A 4F2RA 1LBHA 1W0HA 4F3OA 2FMFA 1VSIA 5IEBA 3E01A 3EY1A 1OXBB 1IG9A 1PUXA 4FB4A 2X6SA 1U04A 1NXVA 2FBXA 3SNKA 4IFYA 4Z4FA 1SKRA 4MRMA 4O5BA 3VQ9A 3RRHA 4ZYLA 1JLCA 3OJSA 3AVBA 2PAFA 1TV6A 1BCMA 2BE2A 2ID7A 3G1WA 2YKNA 3RH0A 3H5IA 3RQIA 4QCLA 3SQ2A 2E6LA 1BGXT 1QNLA 1RT1A 1S9EA 3K2PA 2DY4A 3E3MA 3FGZA 3EQZA 2VWJA 4DTOA 3QEXA 4ETMA 1RZRA 3OJUA 3QLHA 4DMNA 4BE1A 3C95A 3KJXA 3DMJA 1QP4A 4Z4GA 4CIGA 3JPYA 2ZQBA 3H1FA 2OZMA 4YNQA 5C42A 1TKZA 3P9YA 2GI4A 3MEDA 3FFXA 2RJOA 4N5SA 3PY8A 3IG1A 1S1UA 4PWDA 4UQGA 2WOMA 3ZT0A 4WT7A 1HYVA 1A5WA 1TLFA 1Z12A 1FXXA 4MQFA 3K5NA 4P98A 3JVDA 3MIZA 4NYFA 2FQYA 3AVJA 3T95A 3D02A 4Y1DA 2I6FA 1RBTA 3CM6A 3LP2A 4MR7A 4QYWA 3L2QA 4ZTFA 4Y1CA 4G0MA 1E6LA 5TQ2B 2OPPA 2WRZA 3RVNA 3C94A 1FKPA 5DK5A 1YK1A 3OO1A 4QOZB 1BDHA 4O55A 4DTUA 1NK4A 2A9RA 1X1PA 1S8NA 4KNYA 3MA0A 2DRIA 4JOQA 2VWKA 4MS4B 4NV3A 3H5VA 4DG1A 5EWMA 2R25B 3S3NA 3MYYA 4AHUA 1W25A 1BL3A 3IDOA 4KAZA 3HSYA 3OQNA 3JVIA 4OLBA 1ISSA 1Z16A 4N76A 4CJRA 4ELTA 3DM2A 4M88A 4AH9A 4CJ3A 5FWXB 1JLGA 2X74A 3WNFA 1ASWA 4W5OA 3K5MA 2A9QA 3TO5A 5HM6A 3O1HB 4CJVA 4EYGA 5EWLB 3KK1A 5KQGA 3OS2A 2OYQA 4B9NA 5I3UA 2L18A 3HVRA 1JKHA 5KGXA 1T03A 4CK1A 8ABPA 4KMRA 1KLNA 5KC9A 2MYNA 4EVSA 5FWYA 1SL1A 3S99A 4MAAA 4M3UA 2N9UA 1L3TA 1KFSA 4TLMB 4FYDA 1RBRA 4FJXA 1ZBLA 3ZSYA 2P4UA 5IBQA 3ILHA 3ALYA 1USGA 3HXMA 4MS3A 4YWHA 2R7YA 1YS7A 4RG8A 3NNSA 3LWLA 2HB5A 4DTSA 2FEWB 1VRUA 1YT3A 4MYRA 1NKCA 3V81A 2CHEA 5KI6A 4N56A 3BRSA 3TABA 2G8UA 1GUBA 4ELUA 4KTWA 3PX6A 2QR3A 2WJAA 2HNYA 4AHVA 1FFWA 1S1TA 5J2QA 1N5YA 3U3YA 1QPZA 1XHXA 1JL3A 4CEOA 1M2EA 4DSLA 4CHOA 4CJEA 3IP7A 1KRWA 2O4IA 4IDKA 1QO0A 1JFTA 3LUGA 1JFSA 1NJWA 5KRSA 2QV0A 4MR9A 4JAVC 3NF8A 5TQJA 4AHCA 3RRGA 3LZJA 2VG7A 4PYRA 3QIOA 1DTTA 1GUDA 3ZSVA 4RU1A 3H5WA 1U4BA 1JDNA 3K4HA 5F64A 5E41A 3CG7A 3L49A 5JS2A 4ZHRA 3JTEA 1ZGZA 4IMIB 5CNMA 4IRXA 3MEEA 1XHEA 3IS9A 4Z0NA 1J9AA 1L5ZA 4MQEA 4FJJA 3O1IC 1WSJA 3ITHA 1RBUA 2HW3A 1HRHA 1RNHA 3O2JA 3AVCA 4CHPA 2OPQA 2YNIA 1NXWA 2I5JA 4F4KA 2F8TA 3QLUC 3QEKA 1RPJA 1CXQA 3TD9A 3QEWA 2FQWA 4MS1B 5HRNA 2QKBA 4CHNA 3NFAA 3B6OA 3ZSXA 1FSPA 3LUHA 5KGWA 3OYLA 2GBPA 4AHRA 3B2NA 3VQBA 3O4QA 3CQ8A 4RK5A 2GWRA 1EXQA 4RW9A 1Q9YA 2X7XA 1NOZA 4XFKA 3GA5A 5J2PA 4H4MA 4W5TA 3OM1A 2YNFA 3RVJA 3P1GA 3EYZA 3KG2A 3UKJA 2RGYA 2FC0A 3PO5A 1L5UA 1VSJA 1BDJA 1J54A 2VYCA 3QELB 3O4NA 3C97A 4KRFA 2JLEA 1D8YA 3KKSA 2IAJA 2FLKA 3NGZA 3JYTA 2RF2A 2R47A 2VUIB 1CEYA 1PHRA 3QO9A 4IILA 5TPZA 3I09A 3TAEA 2FKAA 1C0EA 1VRVA 3ZT1A 4AHSA 1JLQA 2WWVD 2ID9A 5FDLA 3EJWA 5ED4A 3SI6A 5IUKC 3OS0A 1P6UA 1Z26A 4RV5A 5KQLA 4HUFA 3LAKA 4RZSA 4DFKA 5HROA 4UHJA 5TPWA 2JGUA 1NATA 5HP1A 4F11A 3U3GA 4O0JA 4FE4A 2HHQA 2HVHA 1ZGGA 4YRZA 1AB5A 3DI6A 1USIA 1SKWA 2IYNA 3TAMA 1SXGA 1U48A 4CCHA 4I2PA 4JS4A 1A04A 3LUJA 3OO0A 3DLEA 4TLLB 5CNKA 3FDFA 3P5JA 2F8SA 1BI4B 1X9SA 1EP4A 3NAEA 1TMYA 3VA3A 3QEMB 1UDRA 1JLFA 3C6QA 4QYMA 1G15A 4CHQA 4N0PA 2ITGA 4BDPA 4YCSA 4LH4A 3CFRA 2Z1HA 3V1QA 2FXIA 3DGFC 3T38A 1KCFA 1TGOA 4TMYA 3DOLA 3BGRA 5T7BA 3IAYA 4M3ZA 1C1BA 3KLIA 4ID1A 4NQRA 3AA3A 3P83D 3T19A 2IPNA 1QQAA 1GCAA 3IP9A 2E4LA 2XRIA 1QSSA 1ZDMA 1CXUA 3KD1E 4E7KA 2PLNA 3KYJB 1U49A 1D5WA 4WUTA 3L6UA 3HP6A 4DQQA 1T34A 3O3FA 2BDPA 2AYXA 3QLVC 3HYFA 1U2PA 5EWJB 3G0ZA 2QVGA 5D2CA 3OVNA 2WB4A 3KJVA 1T05A 2E4WA 3AA5X 1EHCA 5GQSA 1KMIY 3URMA 4FZYA 2IC3A 5TQ2A 2HJ9A 4NCAA 3TAPA 4B08A 3IRXA 4Q5VA 3AO2A 5JNVA 1Z25A 3TI0A 1WAJA 5JNWA 1BISA 1ZY2A 3LPTA 2PKXA 1S1XA 4MS4A 3OYGA 2IKSA 3QK7A 1RXEA 4M45A 1RDDA 1BHLA 3QNNA 3SV3A 3MXJA 3M8PA 4G0ZA 1IKXA 4RK1A 2XY7A 1DC8A 3BREA 3I5AA 2R4QA 4LH5A 1J56A 1HEYA 1RTDA 1D1PA 2OQRA 2NUBA 4DSKA 1DBWA 4LE2A 4DSIA 4W5NA 3L2VA 5FWXA 4IBNA 4CEEA 1S1VA 2MSLA 2ZAYA 2Y1JA 5EWLA 1VSFA 4KHSA 2FTKE 2JB9A 3SPZA 1IKVA 3M8QA 1ZBIA 2PUGA 3NNNA 3NBPA 3A3KA 1MU2A 4NCBA 2PMCA 3M6MD 3RVLA 2JVJA 4Z4HA 1D9DA 3WNEA 4CK2A 1ZESA 1B9DA 4FZZA 2KTQA 4RK6A 1O1WA 1EETA 4LY7A 2PZSA 4CF2A 2FQXA 1NKBA 2RJNA 4G86A 4DADA 3KLNA 4H3HB 3WNGA 4G0XA 1M5TA 2OPSA 1AB6A 4FLTA 4EVQA 2OA8A 2KZZA 1VKRA 1E2BA 3LKBA 4CERA 4KTZA 2HQOA 2FBVA 4RXUA 4CJUA 3KK2A 1Z18A 1NTRA 1NK0A 3DLGA 1SRRA 2HQBA 3O74A 2HSGA 3RVOA 4ETIA 4FJIA 4DTXA 1EWKA 4JASB 2P1JA 4KB0A 3BRQA 3F9KA 4KQ9A 4RKRA 5HRSA 3TR8A 3LP3A 3M8SA 2G8HA 5K14A 1RXIA 3CNBA 4RW7A 3AVFA 1RDBA 2PUCA 4B9TA 1KSPA 1FFGA 3ZT3A 1JYFA 3DLKA 2QK9A 3H08A 1DCKA 2B4AA 1D1QA 4HVJA 3L8BA 1Z13A 3HP9A 3NE6A 4Z99A 1M2FA 3N8IA 2XY8A 4FLUA 4KFBA 2QXFA 1NJZA 3EDCA 5HBMA 3LUFA 4EP5A 3SM9A 2PUDA 3VNBA 4FJ7A 4LRQA 1LBIA 3ISNC 1LW2A 1YMUA 1ZN2A 3KSMA 5HLFA 4YGXB 2H3HA 3A0UA 4KB1A 2YNGA 4FLYA 4CGJA 1XWLA 3TX6A 2GBZA 4XXHA 2OPRA 3V1OA 4FLVA 3OYIA 3HV2A 4Z4IA 2BANA 4LD0A 3CS3A 4MS1A 1BAPA 3VQ7A 1VSMA 2KW4A 1QMPA 1CZBA 3OYHA 3C3KA 2EX3A 3VQ8A 2G8VA 3F6CA 4IG0A 4EP4A 3HL8A 1XHZA 1NK8A 4FJGA 4M41A 3NHGA 4PE5B 3T6KA 3SQNA 3K59A 3GWGA 4BDYA 1YMVA 3LALA 1DCMA 4FCYA 4HHTA 5HKOA 1TM2A 1B92A 4LE0A 2HHVA 4ML3A 2E6MA 3HVTA 4CGIA 4H60A 1XC9A 2X6NA 3C6UA 2P9HA 1XHFA 5KRTA 4ZTJA 3EQ2A 5HRRA 2YKMA 4KHYA 3HPHA 3LWMA 3N0RA 4H8KA 1RT2A 4I2QA 4PY5A 4FLXA 4CJKA 3OM0A 5I4CA 3JS5A 4DU4A 1LJUA 1SV5A 2JBAB 1PEYA 3VNAA 3U6FA 3BILA 4N41A 1CLQA 3SYZA 3HUTA 4EGSA 1Z2DA 3TARA 3TB6A 3Q15C 4PA1A 4PUOA 3KLFA 1P8AA 1NK6A 1YTUA 4NYNA 3N53A 4EYOA 3EZ5A 3K57A 2FN8A 3HT3A 3VQ4A 3LDSA 4S04A 3FFTA 1KTQA 2PUBA 4AHTA 4B9LA 4CECA 1RBSA 4OVLA 1K6YA 3Q7RA 4O5AA 1S6PA 3CFPA 3EULA 1PNRA 4YLEA 4O44A 1NOYA 1GOBA 2OENG 3D45A 2FEKA 3Q41A 1N6QA 5JS1A 2NT3A 3MMNA 3QX9A 2DFEA 5KTQA 4CGDA 2JCGA 4MGEA 4CEDA 1JH9A 1VPWA 4YS6A 2JVIA 1C1AA 1WSIA 3HK2A 4DTRA 5TQ0B 4CF1A 5JNUA 1RTHA 2CHFA 3A2FA 2Q3SA 3OLYA 3RVKA 3OLZA 2VK2A 1FKOA 5BRJA 4RW8A 5KQPA 1L3SA 3OYBA 4H3KB 4G0QA 4RK7A 1HPZA 4CJTA 4E7HA 3HM9A 3AVHA 4CHZA 1Z17A 5JNSA 2O20A 4F8JA 2MSKA 1HQUA 3TMYA 1JWLA 1K66A 4O1IA 4JA2A 1NXXA 2IDOA 5KQMA 3JY6A 4I7FA 2ZWMA 2Z1JA 3H5TA 3CM5A 1U47A 3NF6A 3MF4A 1M5UA 1MAVA 4FJ8A 4IFVA 4LDZA 5EWJA 2EHGA 5IULC 1JFVA 3VQDA 1U45A 4B9UA 4JLHA 4MR8B 4EVRA 5HSGA 1IKYA 1DBQA 4W5QA 1LWEA 1DC7A 4F12A 4QAGA 4I9QA 4FW1A 4RS3A 4ELVA 1C0UA 1NXPA 3UUGA 3DZDA 3SQ1A 3ZT2A 3MQ4A 3F6PA 4CIEA 3SY8A 3LMKA 5BQ3A 5JNRA 3SQ0A 4FM0A 5FRNA 1ZBUA 3PUFA 4HUEA 4LE1A 2MSWA 1ZHHA 1EKEA 5FBHA 1WSEA 4LSNA 2G8IA 3OYJA 1VSLA 3RVQA 3TWHA 5C24A 3VQCA 2IPMA 4CJFA 4ZPJA 3KLGA 4MQFB 3RVRA 3CFOA 4F3TA 1NJYA 1IKWA 1HQEA 4DS4A 3LUCA 4KHWA 2D0BA 1QQBA 1USKA 2E4ZA 2PL9A 4JB2A 3HZHA 1FQWA 3ZSRA 1LWFA 3QINA 3TANA 1TKTA 4CEAA 1NK5A 4OLAA 4FLZA 4CE9A 3OYKA 4F2SA 2W42A 4WE1A 6ABPA 3LUAA 3M9WA 3VA0A 3SNNA 5C5CA 2VUHB 1HJRA 2XHBA 3MAQA 3SUOA 3T8YA 3HS3A 1JLKA 1GOCA 4DFMA 3TAFA 3NDKA 2MYUA 2WY2D 2D0CA 3HEBA 4KI4A 4CEQA 1A5VA 5EWMB 3NH1A 3ULDA 1U8TA 4CESA 1I3AA 1QKKA 3QLTA 1S6QA 3THVA 3RMCA 1D4ZA 4CGGA 4ZMSA 3S3OA 4Q6BA 3LPUA 1FFSA 2FVYA 2DFHA 1DRJA 2L19A 5CNIA 4RW6A 1KFDA 4OGEA 3E61A 3ROFA 4KZKA 2QVCA 2QZJA 4YFUA 4FXDA 1E6KA 4MLDA 5JNTA 2FBYA 2CWDA 1URPA 1UA1A 2HHTA 3VQPA 2IS3A 3GBVA 4CEFA 4L85A 1ISRA 4G1QA 4DU1A 2YHBA 3ZSOA 4XARA 4OJRA 3C3MA 1RT4A 4WWHA 5C25A 6CHYA 1D5AA 4CIFA 3Q7TA 1DP4A 4RXTA 2KYRA 3TAGA 1IO2A 1Q9XA 1JLBA 4FJHA 3CZ5A 1OXKB 1B9FA 3HDVA 4Z9AA 2MYTA 3IP6A 3AVIA 3KLHA 4DQRA 1Q8IA 4DF4A 1ZH4A 3QLUA 1JXEA 2CD7A 1LWCA 3DRSA 5CNJA 4G0PA 3G10A 2YNHA 3K5LA 1DJMA 3ASMA 3OYAA 4O4GA 1BIUA 3OQMA 1NK9A 4B09A 1E6MA 1WAFA 1VSHA 3L2UA 1I39A 2E4XA 5E3JA 4YP9A 1S9GA 2ATQA 2FN9A 2LPMA 1JHZA 4DQDA 2GKGA 2QSJA 1U2QA 3CG4A 4E7IA 5BRAA 2LBPA 1KRPA 3C3WA 2Q5CA 2HPHA 3AVLA 1ZAYA 4EYQA 5PNTA 4W5RA 4E7LA 3QIPA 4K8ZA 4CBVA 3L2WA 1KLMA 3MXIA 2P5GA 1QHTA 3AO3A 4LDAA 4EYKA 3K58A 5CYMA 3OLVA 1LAWA 3ZSWA 2QU7A 4E1MA 5IUNC 4KHUA 2B1JA 2PUFA 1NY5A 1YVUA 1EWVA 4GPAA 4OKJA 4XASA 3DYAA 4PEVA 2KZMA 2PYLA 2XY6A 4HTUA 1DZ3A 4PQUA 5J2MA 1X9WA 2JVKA 4KKOA 3SUPA 3OYMA 4DLEA 1T8EA 1BCOA 5CYQA 3CU5A 4CJQA 3O3GA 4D6XA 4WXEA
chains in the Genus database with same CATH superfamily
1H2WA 4E5SA 3CJ1A 4EOGA 4FJMA 2AF3C 5ITVA 3VR0A 1MZVA 1ZJ4A 1Y7IA 3AR4A 2P2CA 4PLGA 1VIYA 2ZR7A 2VYQA 3VZPA 5AESA 4OKKA 4MTCA 3CEHA 1P33A 2ZYWX 4B1ZA 2QLMA 1Y3DE 1JPUA 2CH6A 4N3CA 4HS9A 3WEEB 3RVDA 1ZSYA 4KQFA 2IIQA 1XG5A 3TTVA 1HF3A 2VH5R 2DKOA 4MLZA 1UWBA 3R2JA 3T5BA 4UD6A 2K6GA 3CCUN 3KK3A 3IUSA 4O3MA 2QG4A 3EIHA 4E70A 3C6ZA 2V54A 2OE2A 5FNZA 3STTA 2B8JA 3QH4A 2D7CA 2ZJQL 1WDWB 3TJMA 1NI4A 4QT0A 3SMSA 3R7NA 2MR5A 4O4JA 4Z8YA 3FVTA 4RHYA 4DTJA 4TTTS 3NASA 1L4FA 1XRRA 4XWKA 1WCYA 1RBMA 1QYIA 3P71T 4ZOLB 4X64B 4POOA 3JD3A 3L4EA 2ORED 1RRMA 4IHJB 3MXOA 4LVCA 3ZHOA 3OS1A 4GBJA 3TUZC 3KTOA 1GL9B 3VPXA 1LLUA 2ZWAA 3PUYA 4H0NA 5K0EA 3D4OA 4S0XA 2P5OA 5CYOA 3OD1A 1P6QA 4JT8A 4GX0A 3H13A 4RWEA 1L9XA 3FCXA 3AUKA 4FZ5A 1DWUA 1MDUB 1DG1G 3BIWA 3PA8A 2R1VB 1PGOA 4CMJA 2ZIXA 2R00A 3UO8B 4GKAA 1K0FA 4RSRA 2VATA 2IP1A 1UDXA 4A57A 4AKSA 5CXXA 4BUJA 4E13A 1I36A 4BNMA 1AUVA 3PV8A 3UKDA 2XKKA 2BKXA 3NEPX 4NE2A 2PKCA 3SQLA 2GSWA 4D80A 3H1EA 1FJGK 1THMA 2JFFA 5KQRA 1NMZA 2D8MA 1Y48E 2HHUA 4G0YA 5C7IO 2HK8A 3FMVA 2Z57A 4M7XA 3A58B 3C2QA 2VJCA 2I33A 2XGGA 4OHWA 5EE3A 2P9NA 2JHAA 4URVR 1SXJE 1KGSA 4IJUA 3SUQA 4NNPA 3L1VA 1DBIA 1J0CA 4ZI7F 2ISQA 4OI1A 1L4NA 5ALTA 1N5RA 3BWDD 3O8DA 1ZD3A 1T2AA 3QVUA 2XZPA 1K3UB 2X1LA 3NHAA 1JLEA 4NU8X 1WU7A 3GRKA 1BVRA 1RWQA 4TN5A 1PFKA 1DAEA 3DD5A 4J2DA 4HAVA 1VPDA 1V16B 3E5RA 4JLKA 1HQYE 1OXVA 2XCQA 4BZZA 3U56A 1Y3IA 1XI1A 5IG2A 4NAVA 1M0WA 1M6YA 2YWGA 4PZUA 4TYNA 3LP6A 1HMVA 1U2RA 3D8HA 3MC1A 4F6RA 3AOEC 5BNTA 3RC9A 4ETNA 1BFUA 1SA0B 1Z4IA 5EXSA 3IQEA 1PEDA 2NVOA 3WDSA 2FCRA 5BT9A 2P9PB 4A6EA 5EE5B 1LDGA 3EGCA 5JJIA 4TMFA 2B1QA 2VHQA 3AC0A 1IHXA 4WFIA 1EYZA 1S96A 3CCVN 4TKVA 2FEPA 5CTAA 4I4TB 5LQUA 3AO4A 4GPIB 2GF9A 1B0ZA 5EP1A 4NONA 4K25A 1HNXB 1DEKA 3RV3A 4BOYA 1B8PA 1YI0A 1JJVA 3O8MA 3ZHQA 3GP5A 1IE3A 1WA5A 3P39A 2BUAA 1TZBA 2L2QA 3A04A 3T3HA 2NSDA 1K8RA 4A0HA 2HHLA 3PDIB 4MB2A 1E0SA 1H0HA 2J8ZA 1ORVA 1OU4A 1QQ7A 2JH8A 4EIAA 4GNRA 4ZRMA 1W4ZA 2VPIA 2ZIZA 3EPHA 1H0RA 4QDUA 4J9VA 3RO7A 1N5LA 2IDMA 2BFFB 3IP5A 1PU2A 1RYZA 3ZLTA 3ZDCA 3HL4A 3OA0A 2WQ6A 1H22A 2VK8A 3KVYA 4WDQA 5MFZA 5DXFA 3TDMA 1J9GA 2PUEA 1NU8A 4PZ9A 2EYUA 4JKBA 1C4OA 5BN3A 1PWZA 2YZ7A 4TYQA 4RDCA 4HRXA 1PR3A 3C6KA 2FQQA 5BP7A 4Y9TA 3JQGB 1MAHA 4DJAA 3ROKA 3MLAA 1TYZA 1KH1A 3VR5D 2AZTA 2CJWB 1C9YA 3TXYA 3EYWA 4Y6SA 4C03A 4I5FA 4XVQA 3WOVA 1PCXA 4JI4B 1C3OA 4IFEA 4LF5K 2IP4A 2WKQA 2E49A 4Q82A 1U7OA 2G36A 3ANTA 1FX0A 4DR3B 1N57A 3T9DA 3DLRA 1PEKE 4TV8B 3DBIA 5CA1F 4DRXA 1V3TA 3S2FA 4X6XA 3HO1A 2F2TA 3B9BA 2BR5A 3ZWMA 5LWQA 3IESA 1QWOA 4LISA 2C8KA 5LP6B 1RTJA 1Z5UA 3O93A 1MV5A 4M1YA 1PK8A 3BH7A 3GXOA 4AJHA 1TJYA 3EAGA 1HE5A 1QKJA 4P82A 2A5DA 1L5WA 5GONF 2RN2A 1G2OA 1YZVA 4GECA 2AN5A 4FPXA 3N4QA 1CS4C 2KQ2A 2H4ZA 2I4OA 4FFPA 3L1UA 4PSCA 4MR9B 1KMHA 3JQ8A 3BF1A 4X84A 4TLDA 4ARCA 4LPKA 1NMXA 4PIPA 1PQ4A 5BV1A 1IIRA 1SUCA 1DRKA 3D2FA 5DXJA 2Z2ZA 2GASA 3BSWA 2A5GA 2IHJA 3CRZA 3OZRA 2RE2A 1A2OA 3W0LA 1U80A 3NBAA 3R6GA 4I1SA 4CJXA 4L08A 4CGHA 3ENNA 5CDSA 4YY3K 2ZRJA 3W5DA 1CFZA 1GLGA 2V03A 3E70C 2UUOA 1SCUB 1VI2A 5DBHX 1UZMA 4B6EA 1KZ9A 1W8IA 3B6PA 5HE8A 1XPUA 1JHPA 4CVNA 3U16A 4P3PA 3JAWB 5I47A 4BNNA 5J1TB 3CCBA 4MP3A 1FP6A 1HKUA 3LGSA 4DC9A 4YRBA 5SY4A 4TV9F 1YQEA 3HWRA 1E18A 4ICIA 3H2BA 4BQIA 3GARA 2J4FA 3C1TA 1CR2A 1NF9A 3O9QA 4JYZA 3GCGA 4MKRA 3EVTA 2VDNB 2IY9A 4G1FA 4OB8A 1E6UA 1SKRA 5FIUA 3CQYA 3BVPA 3RRHA 3TWOA 3GP8A 821PA 2WVGA 1E2PA 1UBJS 5HGJA 5K8CA 2ID7A 1DRVA 1FCJA 4IDOA 4UAUA 5NULA 3LDLA 4MV0A 4GOXA 1RT1A 4DIKA 2DY4A 2BFNA 2C2BA 1G21B 5DTIA 1O87A 4FJ2A 1AHIA 3I2IA 1SG9A 1I2ZA 2VHVA 1UWKA 4FLEA 2C7QA 2QRKA 1NJ2A 2W40A 4NDZA 3TLGA 1S1UA 4JENA 4NYMQ 2MDTA 3LBIA 3VKGA 2ECPA 3F5FA 4TVBA 4QG7A 1FXXA 4RE6A 2WUSA 1M6NA 4EHDA 5TMEA 2NRXA 2I6FA 1OV4A 2ABWA 1P1JA 1SG0A 4J8PA 1VJRA 1K4MA 1GR0A 3ZYCA 3QU2A 4QFMA 4P4SA 3A70A 3VR4H 3ZLBA 2ZJ7A 2QWRA 1EIZA 2Q0XA 4A36A 3LCUA 3L1KA 1UMDA 4YCAA 1GILA 1YUWA 3QVTA 3HSYA 5TT0A 5FR1A 4D79A 2C5BA 1H23A 2CL7X 1ZQ9A 3BHMA 2YXEA 1R88A 2H4YA 4W5OA 4IJAA 1CRPA 3H46O 4BN5A 3T0IA 3ZLUA 3LDHA 4B0OA 8ABPA 1KLNA 2YR0A 1M83A 1TA0A 4GI3A 4FYDA 2J0EA 4U7FA 4WEOA 3A5OC 1MX3A 1GGHA 1USGA 3DUFB 5E0OA 2Y66A 5D3MA 4EM6A 2R7AA 4EHIA 1P5ZB 2WYUA 1CQWA 3BRSA 2ZDQA 4P4UA 1PFYA 1SWWA 4BRWA 4QUIA 2OAGA 2NGRA 1Z6TA 5J2QA 5L7YA 1XXHE 1R10A 1NGBA 3BXHA 2J7KA 1JFSA 2CHUA 3HCFA 2F62A 2QM7A 3VVCA 3DEKA 2GBFA 2HDHA 4CBXA 1Z0IA 4D0RA 1XLVA 2RHMA 3H5WA 3FOEC 3NDIA 3OIYA 4NDAA 3EXEB 4X24A 4IIEA 3DL4A 3HBAA 2B92A 1YZFA 1E69A 2B4TO 1HSZA 3VH3A 4FJ1A 3QITA 5EA2A 1C8BA 2VDUE 2ZR8A 3N2GB 3HA5A 4D9EA 1EX9A 3TIIA 3EZFA 3QEKA 1JLMA 1KO7A 1VI6A 3L07A 2O3SA 2Z95A 1V7ZA 1PZGA 1XMXA 3JSAA 2CFSA 2YFKA 4AHRA 4GPBA 1NJ6A 4BAUA 4ZVPA 1XJWA 1H5UA 1HX1A 2QSYA 4HNTA 4DSNA 2ZSKA 4KFRA 3JQ9C 1JQ3A 1Q7BA 5ERYA 2HB6A 3UCXA 5LQCA 3Q3EA 3CLTD 4EKYA 4FQ7A 4DG9A 4F4IA 1LRJA 4D9BA 3U9SA 1M34B 3EJWA 4N9WA 3VMFA 1TCVA 4YCCA 2BMDA 1MC8A 4HLDA 3WXMB 2JRCA 3RBZA 4QUEA 3TSOA 4DFKA 2JH3A 2BFEA 1NATA 5EPOA 1AHPA 1U11A 3ORFA 1LK5A 1WDKA 3IQHX 3PWKA 1RAGA 1JFRA 4I2PA 5KSZA 3M1FA 3UAZA 2EQ5A 2IU4A 1PGQA 4I6MB 5LMCA 3CC8A 1BS9A 3DOFA 4AJ2A 4DDWA 2AG8A 4BFSA 1WW8A 1ODIA 4LRXA 4LY0A 3QFCA 4PXSA 1UWVA 1TKAA 3KXKA 1G15A 1NWKA 2ZYIA 1HWYA 5AVOA 4N0PA 4YCSA 4FHDA 2Z1HA 3DGFC 1TGOA 4KR2A 4X1KB 4C3OB 1QG4A 1S9HA 4GV3A 5I7AA 2QVZX 1S4QA 1AQLA 1WTCA 2ZSJA 2LVBA 2C99A 4UXHA 2V9CA 2V7WA 4BMNA 2V8OA 3HVIA 4M8SA 4DUPA 3ESDA 1BSVA 2BVNA 3O95A 4DQQA 2I78A 1WEKA 3HA2A 1SCJA 3I9LA 3FZMA 4MOWA 4BNGA 1N34B 4RTOA 1JHRA 3OU7A 3OVNA 2G72A 3E0XA 4YOYA 5GZ3A 3TTYA 1T5DX 1O7JA 3W8DA 2C83A 4Q9NA 2IC3A 2D0PA 4TQ9A 2GT1A 4NBKA 3TI0A 5I7UA 3DCIA 3GY0A 2MSCB 4B4OA 3QK7A 1WBBA 3CLUD 1RXEA 3ZK7A 1PWXA 1SOAA 3QNNA 1C7IA 2YCHA 3VTHA 1WXXA 3PQEA 4RHUA 3ZUGA 4JI8B 4GKBA 4AF8A 1OXXK 4FVTA 4MIEA 2V7VA 5EESA 2Y1JA 4EHNA 3EVDA 4EIWA 4IVQA 1RLMA 3MSXA 4JELA 1G7RA 4G5YA 5CG2A 1WEHA 4GWKA 3JQEA 4CK2A 1ZWLA 2NUAA 1Z63A 5BRNA 3EGVA 2P9IB 4OHOA 1HA3A 1H65A 4DNPA 3VRHA 3SWWA 4L3VA 2WUGA 3AESB 3BIFA 4D9FA 3LKDA 4ZZ1A 1JCFA 3DYVA 5L3SA 3GU3A 2PQ0A 3RUAA 1GO2A 4PHGA 1SPXA 2VJLA 4YRLA 5K6TA 1PWEA 4P81A 4B7XA 5IKPA 5JY6A 4DTXA 3S55A 1P1FA 4NF2A 2MU1A 1HT3A 2IWHA 4CIVA 3OLCX 5TARA 1Y89A 1RDBA 3F7MA 4R8SA 3DLKA 4NV1A 1AY0A 2YMMA 1EWYA 1Z13A 3C41J 4A2PA 2XY8A 5HKKA 1NJZA 2X42A 1SBQA 4KX3A 2PUDA 4I81A 1W36C 1YL7A 3QNWA 5A4AA 3H1AA 1LBIA 4AJIA 2GA8A 4NENA 3R0IA 1YZNA 1W2WB 1QFSA 2WIFA 4A91A 4FWQA 4XXHA 5JQGB 3NATA 2OBXA 3B5IA 5FBQB 1EK5A 4K86A 3RIHA 3GRVA 2FFJA 1L4MA 3N4PA 4JIMA 5AW4A 3VQ8A 3WFIA 3F3MA 4M41A 4YI3A 3UW3A 3GGPA 1E4OA 1DHTA 3ECAA 1VQ8N 1C7ZA 1S3XA 4OLJA 2VTEA 5H0IA 2Z9CA 2E6MA 3KWJA 2WVAA 4JYMA 4X54A 5JLJA 3HBTA 1CVLA 1W73A 3K2EA 3PXDA 2C7PA 4K40A 2NZJA 2RH4A 3GJYA 3ENZA 2VSOA 3PRJA 4ZK2A 3KUXA 1RWWA 1VLHA 2DJ5A 4FLXA 3F0TA 3JS5A 3V7UA 3QTTA 1EP1B 3TL3A 2DFKB 5KB3A 3FPEA 3HUTA 2HSZA 2JI7A 2Z4SA 1T5HX 3E81A 5EPUA 1CS0B 3SKVA 1Y6GA 4BGDA 2QYSA 2OORC 5HUJA 4K6FA 3IVCA 3PXBA 4IPTA 2Q1YA 2QUKA 1JG6A 4CECA 3Q7RA 5J2TF 5DIZA 1SXJA 1XZAA 5DYTA 3NLLA 2NT3A 4CM9A 4CGDA 1X15A 5HFAA 4FEEA 3W5CA 2ZJ5A 2M6KA 1NGEA 1WSIA 5TQ0B 1KPHA 2Q3SA 3KQQA 5KNCA 3U49A 4B33A 5EE1A 3REGA 4N3AA 5EJFA 1HPZA 1ZD2P 1VA4A 3AVHA 1G291 3IDFA 3FIUA 5D6OA 2GYVA 4QLBA 4GICA 4EABA 4A0FA 3BWVA 4O1IA 1IUPA 3HYCA 3H9JA 3JY6A 3H5TA 1WUYA 1U8FO 2O3JA 3S5JA 5IXSA 2W2PA 4X62B 2AI2A 2K7FA 4JLHA 3UMJA 3RFCA 3PC3A 3RFTA 5SYAA 2P1RA 3IIEA 5EY4A 3KQUA 3NVMB 1P62B 3UUGA 3B3QA 4E5YA 3P2EA 4YT2A 4JQSA 1TF2A 3SQ1A 1MH9A 2IOHA 4E08A 2XWJI 1TT7A 2XUIA 4QPCA 1L3BA 4XQ9A 1ZJYA 2W8ZA 2Y92A 1GOTA 3N5CA 3ZLVA 1BWQA 1LX7A 2R4UA 4BRSA 1GPAA 1UXIA 2V7EA 1OLUA 4IINA 5EPEA 1PWHA 2AS0A 2HMSA 3CLTC 3EXHB 3C1AA 3RS3A 3TSAA 1GXSB 5DBIA 1W35A 1XI2A 3QMPA 1YJ5A 4LXUA 5FA5A 5E84A 5I9EB 2B61A 4EF6A 1Q7YO 1HMPA 2M6SA 4BU1A 1CJTC 4KPGA 2HHCA 2YQ4A 1UMKA 3M83A 4YAUA 1GWNA 2IUUA 3C6XA 3TU5A 2HV8A 2J9ZB 4GDFA 3E9OA 4GKJK 2DSTA 2ZYDA 1NUSA 3D4IA 1SKBA 3WGMA 1QGZA 4BB9A 1A9XB 5LKAA 1ZD9A 2M2IA 4BHTA 1A9SA 1V7CA 4X65B 5EWMB 2CL5A 4P7FA 4Q1FA 2R751 1KBQA 2J07A 4YK7A 3RUIA 2JGRA 2QLFA 2BFPA 1CUYA 2C9DA 1T2EA 2VJQA 3RCBA 3DBLA 5AZJA 4GMGA 3EQ7A 1L5FA 2CLEB 2LNDA 2QBYA 4IGIA 4Q3LA 3TUIC 2X4GA 3JXUA 3E9EA 3WA6A 1RT4A 4H4CA 2WYVA 1LKZA 1S0UA 2RBKA 4XWOA 1IBMK 4RXTA 2F59A 4QNMA 4LCJA 3EN9A 5C2DA 3IMEA 2C04A 3U6BA 3UZUA 4DF4A 4G9GA 1NGSA 2O8FB 4P38A 1Y1RA 3C16C 5FADA 3L6OO 5F1KA 1KXPA 2OFFA 2WWRA 1ZNYA 5TXGA 4OYLA 3EF3A 4IZ9A 3CLUC 2VHYA 1JHZA 2KPOA 1E61A 3RYFA 3CG4A 3ELYA 1V7PC 2GUGA 2WHPB 3SDZA 3KNZA 4ARUA 1ZH8A 2XT0A 3OZWA 1RKBA 1KLMA 1DWPA 4EMUA 2W22A 3HU3A 3O7WA 3SC6A 4YTEA 1ZIPA 1WDTA 5GIOE 1FDUA 1FQKA 2IEIA 3AY0A 3LPNA 2VTKA 4HAYA 4KKOA 2QJTA 1YZYA 5DGXA 1EUDA 1VI5A 2W11A 2AD5A 1IC6A 4ENPA 4P93A 1QVGM 4W1PA 5DKFA 2BHSA 2C92A 4C6TA 3AO0B 1CR6A 1X7WB 3ETNA 4TWZA 3AONB 4CF9A 2FSUA 4OU4A 2CLKB 2P9KB 3DZFA 1Q0HA 4KGZA 2FW8A 3I92A 2TECE 1MNAA 1YRYE 1J20A 4NICA 4OPHA 1VKHA 2HU2A 1SURA 1FXWA 3EH2A 2PD4A 1XMQB 2LUOA 3U13A 2YJTD 1OA0A 5E4FA 4A73A 1RGIA 3ZZNA 2A9FA 4RPLA 2B36A 1O8BA 1NYQA 1PQPA 5JH7A 5JICA 4NEGA 3OX3A 4KFTA 3MFYA 2HBLA 4IJMA 4R51A 5BMVF 2QKKA 5F2NA 3NALA 2WABA 5H4HA 3LP0A 1U8YA 3K4PA 1XWFA 2XYQA 3QOWA 3RAFC 2YHIA 4GMFA 3SR3A 5B36A 2BE9A 5JS7A 2JI9A 4L5CA 1I3MA 3RIMA 2PYJA 3NH0A 2G08A 3U4IA 4TKUA 5I42A 4CMBA 2V7QA 3JVVA 1NFRA 3GAFA 5F12A 2W6CX 1WU8A 3OE7A 2BP7A 2Y99A 1YAJA 2FUG1 1E0KA 1P9OA 3RNOA 1W97L 2B35A 2JAWA 2VNJA 5BRHA 2DPNA 3L84A 3GG4A 4YT8A 3VEZA 3ULEA 1Z8DA 2NSJA 1NSTA 5FLEX 3VQ5A 3OURA 4PQGA 4EJSB 4CGFA 3C7DB 4YRMA 4C0JA 2BJWA 4DYDA 1TA9A 3EODA 4EJ0A 3DAGA 3V7FA 1EUQA 2CMHA 2A67A 3QVLA 3KJNA 1EWQA 1UZNA 5IJ0A 2ZFUA 4A10A 4BKPA 3E1SA 1Y1PA 5I4BA 3VX3A 3GCDA 2IGIA 2ZSHA 3HCEA 2W4QA 5ALRA 2BBOA 2IEGA 5T6BA 2VJAA 1BU5A 4O08A 1JKJA 1KJZA 3NKVA 3GVXA 4K05A 1JF8A 2YINC 5H3LA 4K41A 2YIVX 5A0FA 3CVYA 1JVBA 2FW0A 3O3MB 4M22A 1R74A 1L5VA 1L4YA 1WR8A 2M98A 2HBKA 4XI9A 3UMMA 5AOAA 5KX5B 1GGKA 5KVCA 2YRFA 3HB4X 2GK7A 2JLCA 1RKVA 3MEGA 5IFLA 4BUZA 3KM0A 4JUAA 4H5VA 3MWYW 4S3MA 4BZPA 3EE6A 2HU8A 4RKQA 1NBEA 1Q91A 2UXBB 3WYBA 3B51X 3GGOA 1WKCA 4RNDB 5AJYA 5TE9A 2GPTA 2XCSB 4DMCA 1LC3A 5CR4A 1NBOA 3IEPA 4HMOA 1PJQA 2VAWA 4PNZA 3P0RA 2V45A 4D4LA 3DFIA 3M6IA 3IBFA 4PO3X 5G3ZA 4PVDA 5TIIA 4ZD6A 2DH6A 5TMDA 1XXHA 1ZGAA 4NYIR 3OCUA 1ISPA 2QTNA 4ENRA 1GLBG 1BD4A 2R6ZA 1NQTA 4EJ6A 5ESXA 4S05A 5U4QA 1WLYA 4BWJA 5AUOB 5T4BA 2HBZA 2Z04A 3PF8A 3KYDB 2XCRB 3EFOA 2P1DA 3H6GA 3L3VA 3RFFA 2EW8A 2IHTA 1ECFA 3HOSA 3KBOA 4PQRA 3SG0A 5FPYA 4Z0TA 1QZ5A 3ZS8A 4HFMA 3ZWKA 2ZE2A 4OMCA 4B9MA 1QHSA 1NVVQ 1JLAA 3SV4A 3WP1B 2FMHA 3IMXA 3WLPA 4JSYA 3HR7A 4ANFA 4LV5B 2P2DA 3PEUA 3V2UA 4LJ7A 4UHFA 5I5GA 3ZSZA 2H1CA 4LKRA 3DRRA 4FJ9A 4JU8A 5CM2Z 1S22A 1P4AA 5BUSA 5ES4B 2QRVB 1EB8A 2ZT5A 3F67A 3N0WA 5DN6D 1N8SA 3KWLA 4Q6WA 3L2OB 3PI7A 3T5CA 3BULA 1A72A 1R6TA 3IBSA 2BYTA 3MWTA 3GGDA 1M67A 1DLOA 5H02A 2ATEA 3TCXB 4LOIA 3H9GA 1AJEA 1WWKA 4KBGA 5JFTA 5HZMA 1ADJA 2H9AA 3DO5A 4YRRA 1L3UA 2YV5A 3SZ3A 1CHNA 1KAZA 5A4MS 3K9BA 4CK3A 2Y6UA 2ITMA 1PQYA 3DAHA 1KYWA 2O7QA 5HJ2A 1V39A 2FJUA 9MHTA 1OWMA 1D4XA 4UNNA 3O5AA 5DHTA 2ASPA 1B43A 2GJ8A 2C20A 4P3XA 5JCOC 4BX3A 1KI4A 1Z4PX 2ZI5A 4QFDA 3VPFA 4YRQA 3A1UA 5IRCD 7AT1A 2XAUA 1N0UA 1H4QA 5KCZA 3TIGA 3QPUA 1YCHA 4TT3D 3TMAA 3U81A 3K3PA 3C6YA 4RW4A 2YZKA 3II6X 2FR1A 3A0IX 5A2QO 3RRXA 4FNGA 3VF4A 2BJHA 1JBEA 3MXMA 2OP0A 1W76A 3QKTA 4CTMA 4IH1A 4XIUA 2AYZA 4FMCF 1EGMB 2I8AA 1PR9A 3MFQA 1CY0A 2ZRKA 1Z6RA 1G0OA 1ECCA 2FRDC 1JLLA 1CZ9A 1W46A 3Q7BA 2F43A 2VS1A 2NAPA 2ZAGA 5LQRA 1XTTA 2V97A 4Z2AA 3FOZA 2Q6VA 1BW9B 2QE7D 2I6XA 4U5QA 4YJ2B 3C8MA 5DLEA 2XY5A 2GKSA 1B0PA 2X0DA 4I7EA 3QFRA 1G2QA 1O94A 4QXPA 1PSWA 4B3TK 2CNWD 2EFGA 5FP0A 3D1VA 1LCUA 3LUDA 1UAAA 4OAOA 4I55A 3B1FA 1G4AE 4CJPA 5LOVF 3PQ2A 3DRPA 2F3TA 3UJ6A 3GQBB 5IWAK 2PBLA 1PNOA 4AQYB 1YTAA 3ABOB 4BJ5A 1L8AA 1JHXA 3DEYX 4FW2A 1CF9A 3K9HA 1GPJA 2QRQA 2Z8YA 3ZY6A 4MLCA 1MUUA 4M7PA 5A9TA 5AKLA 1QIJA 4ERXA 4UM5A 4K6HA 3AB7A 3A4IA 1VSIA 3NMUF 4ZGBA 1KK0A 3EZGA 1QBKC 3WA7A 3AEUA 1K7XB 3O7MA 1P2BA 1J25A 3FX2A 5B6PA 4NX2A 1YB6A 2SICE 2DFDA 2QUHA 4YFVA 2BE2A 3GFQA 3UY4A 5EKSA 1M7HA 1A4RA 1U28A 1BN6A 3EQZA 4BX2A 2W58A 1KAQA 1X3MA 5BWNA 3WXKA 3FPSA 4AQDA 4FSVA 1E4EB 5FPNA 3WLFA 4Z4GA 2ZQBA 1G6HA 2QK4A 1RPAA 1CZKA 2E3JA 3VERA 5FWNA 2FEMA 2J9YB 4R8VA 3BWYA 3VEWA 3OUUA 3KZCA 5T4FA 2MR6A 2P2GA 4AROA 4UMDA 1OFHA 1OGIA 1Z4NA 3GCWA 4Y2VA 5A06A 2WNHA 1PR0A 1K3FA 3GPLA 4Y1DA 3K9WA 4B74A 5K3EA 2A7XA 1JHVA 4NFLA 3REQB 4UULA 3VGMA 4TXNA 4XX1A 1FNCA 3E5NA 2MMCA 5K0JA 1ZR4A 2PA3A 2VCHA 4GSLA 2HA3A 3CJ9A 4JV5K 1L8LA 4FNOA 4D4HA 5FTNA 1CBUA 2XUHA 3DAWA 4DDKA 2CEAA 3QEAZ 4QVKA 1DI0A 4N3BA 3TSUA 3M6UA 1GSOA 3MOSA 4AMUA 1W29A 4YN3A 3UG7A 3ZJYA 1OB5A 9GPBA 4N76A 1OC2A 2VHTA 2WU3A 5ALSA 5K9ZA 1IJEA 3AHIA 2F9LA 5TS3A 1RI2A 1ASWA 5HM6A 4HDMB 3O1HB 3PKZA 4B3GA 4CJVA 2B83A 1GNQA 2G5TA 2OYQA 4RPCA 5KTNA 2ZDHA 3KQKA 2DLCX 3PNBA 5BW4A 2COEA 1IDN1 1UL1X 1UFQA 2E88A 3R5KA 2JLQA 1YDEA 2X3UA 1ZBLA 2PZFA 1A5BB 1VB3A 1RAHA 1HDRA 1IG0A 3W2FA 2Q4DA 3NNSA 3LWLA 2FEWB 4XPIA 3EMKA 4OXKA 3NDPA 4PNHA 1W0CA 3TNJA 2R8YA 1V6AA 4KTWA 2AX4A 5K45A 2HNYA 4G5GA 1UQRA 4YA6A 4KI0A 4AZ0A 2W2KB 4CJEA 4B4KA 1QO0A 1TNDA 1CUAA 2HPAA 4AHCA 2I66A 2ISCA 4AMGA 2V6BA 4IO0A 4WUVA 2E8AA 1GUDA 1H2AS 3ZSVA 2PZ8A 3CPWM 3ZJ4A 3GLQA 4RGVA 4AMBA 4PQFA 3GGGA 1QQOA 5K7SA 1USVA 4B6SA 5J2UF 1T0PA 2BELA 4EHBA 1RBUA 4KVZA 3DPUA 4CL0A 5IMSA 1FLDA 2R8PA 3DXXA 3P2KA 1WXEA 5A02A 2CVOA 2F8TA 1L4HA 1JQEA 1CXQA 2IPOA 4BVFA 1EHYA 1PT7A 5EJ5A 2QKBA 3D6VA 1XZHA 2UYCA 2Q3CA 5AIAA 1RYFA 4F6LA 4C89A 2XHZA 5TVKA 1LS1A 4RW9A 1NOZA 4D8VA 7MDHA 1PX2A 2POQX 1AUOA 4Q1AA 3P1GA 3H1PA 1XOIA 5H1SQ 4QX6A 3MMZA 1JVNA 3T69A 2Z1DA 5IVKA 5CFPA 4DGSA 2QDKA 3T52A 4OI2A 3NGZA 3D0RA 3TPCA 3KQLA 1VZ3A 2O2EA 3DOCA 1W5FA 1JRLA 4E0BA 2OHXA 3PHLA 1Q82O 4G09A 5EMKA 2HBYA 2BGTA 5BSEA 2PRIA 2WJGA 1KDVA 1VQ5N 3RT7A 3JARA 1TM4E 2Q6LA 4BE9A 2IP2A 3F5QA 3GCXA 3X1ZA 2FOIA 2HHQA 5LPNA 3COJA 4RETA 1V8BA 2Q1TA 2NU8B 4JXXA 3DLEA 2H31A 1OHHA 1ODLA 5D3ZA 2E87A 4J90A 2HUNA 5ALNA 3BF7A 4LH4A 4CJ7A 2JDIA 4AUMA 1MJNA 4BROA 4Q4AA 1Q50A 5JBIA 2AUNA 1QZXA 4WACA 3NHUA 3IP9A 2PIDA 4H6WA 3BRWA 5AM2A 3IVMA 3NAGA 4QYXA 3ZWOA 4CV2A 1LBSA 3D2BA 2HYDA 1Q5PA 2BDPA 2AYXA 1BXRA 4AJ4A 1IV0A 4DQKA 2GYYA 2QVGA 5ALEA 1GSAA 4M1TA 4N7MA 4W1RA 4ECEA 4HUQB 4GY2B 4FS3A 3URMA 4BP9A 3RG8A 3DKPA 4PIMA 2X5XA 1Y5RA 1ZUWA 4MRPA 2VLBA 4OIMA 1Z45A 4HSEA 1WAJA 1JT2A 3Q2IA 4M45A 4H0PA 3ESAA 2GN9A 1PN3A 2AWNA 3BFKA 3OAAA 5F2EA 4ZTZB 2JEOA 3BREA 1VDZA 2A57A 1KO5A 3L4BA 1IN5A 1NQUA 1UEIA 1R64A 1T8TA 4QYTA 3NV9A 1NMYA 3M3PA 2VJKA 4R7TA 3WB2A 4U6NA 2Q5JA 3B1YA 3SKXA 2AG0A 1XNRB 1VGRA 4RPHA 3NNNA 1QRRA 2LKDA 4LGVA 4RTKA 5GIOA 2PMCA 2CGEA 3KQPA 5KAPA 2OZVA 4E2XA 1KFCB 4BNLA 2VR1A 4FZZA 3R6WA 4MAFA 5K20A 2OZEA 2GRUA 4AZTA 2GBGA 1BMFD 2CK3D 2ODTX 2RGAA 5JMWA 1AB6A 2OA8A 1YA6A 2R8EA 2DFNA 3U0BA 2GCOB 4YC7A 1C0PA 1UOPA 4LPSA 3RYIA 1JXQA 2V8BA 3V55A 4L5AA 2AN4A 2OKCA 1WSBA 3SC4A 3BRQA 5HRSA 2PQ6A 3LP3A 3M8SA 3VDMA 4AP5A 1VBKA 2V58A 3NTLA 4LXXA 1JYFA 3H08A 3EISA 5C9ZA 2ICAA 2ASMA 4W5JA 2EATA 1OH8A 4QOGA 5COQA 5C53B 4WOCA 4PO8A 2PLRA 3T54A 5AW9A 1SC6A 3W79A 3ROZA 3OHSX 1N6NA 5A5GA 4FWRA 4KV9A 2P6PA 1RCUA 1TCCA 1OWNA 3HM2A 4OL9A 4E4RA 3X0DA 3O91A 3KJIA 2ZRPA 2OPRA 4DBLC 3OYIA 4B80A 4I3FA 4IO9L 3UOWA 3W8RA 3A3PA 2DETA 5I7RA 3F9IA 4XM2A 4PM4A 2WDPA 1U3TA 4BNFA 4FJGA 1E2EA 1H9BA 1T9GS 4WLOA 2GM9A 3S4YA 1KC1A 3W2TA 5ALOA 5LXTF 1F38A 2PS3A 2HD4A 5LWHA 2FW9A 2RHHA 2O2GA 2XD9A 3QKRA 3WFZA 3FBTA 3KQWA 1ISMA 4A6PA 4M1EA 1H1LA 3VR4A 2YQ5A 1SD2A 2GTPA 2YC2C 4J94A 1B2LA 2P6UA 1ISJA 3SS9X 3NUQA 2G1UA 2W2LD 3U6FA 3ZQKA 1WX1A 3QUAA 1CQZA 5CIQA 4RTRA 2PZGA 1E1CB 2HJVA 2JA1A 3WIDA 1OE0A 3IAS6 3JR3A 4Y9UA 1GGVA 5EHNA 4BBZA 2ZSAA 4UE2A 5EGNA 1V11B 2FEKA 1FP4A 3BGIA 4EPRA 1MCZA 1IH8A 2ZZNA 4PRKA 4CF1A 4YB8A 4YIKA 3EVZA 2A35A 3BB4A 4OY3A 4PX2A 4HZUA 2ORYA 1L3SA 4Y1RB 2E1RA 3EWIA 3GT4A 3REOA 1SAZA 1RRGA 3DC7A 5IYZA 2PGIA 2FK8A 2HRZA 4GI7A 4DG8A 2PA0A 3T5AA 4IFVA 4BX9A 3W6NA 1PHPA 3VQDA 4DQXA 2ALJA 4DR7B 4MR8B 4EVRA 1D9ZA 1ICIA 3LXMA 4QGGA 1I2BA 2WSYB 1ZJJA 2JIZA 4A0RA 2XE4A 1V0JA 4QU5A 1KYZA 4CM4A 3CNLA 1XQXA 2X6TA 3IYLW 2BC9A 1WUHS 1E6WA 4Z3KA 1VRCA 5KTTA 3U37A 5LYJB 3SJ7A 5E6UA 2V51B 4RENA 5DGDA 4EPTA 4DV0B 4URWR 3UMYA 3JWGA 4TL9A 2D2IA 1HQEA 2AJBA 4X97A 2ADOA 4JB2A 4DNOA 4HKTA 5MLCQ 4BJ3A 4CE9A 1KFEB 3WLKX 4M9XA 1QCCA 3L92A 2JAHA 4U2EA 4KYTA 2EKDA 4I19A 1EHIA 2VUHB 4QXMA 3W78A 4MA4A 1FVXA 2XIJA 3B3AA 1I5RA 2NG1A 5AO9A 1K7YA 4JR2A 2WY2D 1J5XA 2GNAA 2FSVA 4NZOA 1N2HA 1NJIO 1ZIDA 2ODBA 1SOMA 1XR3A 4YUVA 1YH3A 2UVQA 1H6BA 1MC4A 2D06A 5CLJA 2YVKA 3Q7IA 4E32A 1FFSA 2DFHA 3MD0A 1QH0A 2LCIA 2XT6A 2YNMD 3VFDA 1W6UA 5KSOA 1OIVA 3L0DA 2JASA 3QNUA 3IO5A 4L28A 3D0OA 4CEHB 2A4MA 4YAWA 1D2RA 1VQ6N 3E7WA 2QL5A 4CIFA 2IHYA 2FG6C 1CIJA 1GLLO 4RVCA 3L5OA 4KQ1A 1RLUA 2EIXA 2D1YA 1L4LA 3FHTA 1TQ8A 1HT0A 1OI7A 3W04A 1BIUA 2GEFA 3I6IA 1I7NA 4W1QA 4Z9YA 2VJYA 3Q3IA 3VPDA 1PJTA 4BTLA 3ZBQA 1TZKA 1E4GT 3TTDA 4X7RA 5L3VA 4B3BA 5NLLA 4HQ6A 1LPOA 2LPMA 2BZSA 2GKGA 2WTBA 1YQWA 4XSGA 2Q5CA 1FFXB 3PK0A 4EYQA 5PNTA 1M6VA 4ND8B 2DWUA 4GQIA 3P5SA 5LCXA 3AO3A 4ZI5A 4IVPA 2I29A 3BEDA 2QU7A 2B1JA 1X3LA 3HDJA 4JL8A 1NY5A 3CMAN 2QLNA 3QP9A 4OKJA 4HV4A 3R0QA 3ND7A 3KB8A 1P73A 3D0QA 4D0NA 1QYDA 2D1FA 2JGKA 3WMWA 3ZCVA 4D5GA 2ZVDA 4X92A 3UC5A 1S6YA 4RLFA 3RSQA 1SQ5A 3GDQA 4KLCA 1UC4B 4U2DA 3BE6A 4DLKA 1RCHA 5C7OO 3DVSX 3TIXB 3VR6A 4N39A 3EKUA 2UUBB 3ENOA 1B14A 3OOSA 3AVGA 4KO2S 2ONKA 3DZCA 2J48A 3LYUA 4DTMA 3JALB 1GFSA 4KO0A 3IQGX 2PUTA 4DCHA 3KUDA 3RRJA 4BY9C 4ID3A 5I9NA 3E66A 1GLCG 4BRNA 3L8GA 1CUIA 3EGDA 5ARBA 5C15A 4TYYA 4IF4A 2P9ZA 3NYRA 1A9QA 4Z0UA 4WIAA 1W5EA 4GMDA 4JJKA 2YJ5A 5JRDS 1UF9A 5C5EA 2KHOA 2C9MA 1OX4B 1SO8A 1YDWA 4Z49A 1R59O 1BOFA 2GWKA 2JGLA 2W2TA 1CIVA 4CT0A 3UBTA 4CWAA 1VE1A 4RIEA 1AUXA 4A8JA 3TQSA 3T3GA 2D2VA 4CEBA 3V9UA 1BX1A 3D1JA 2IHUA 1KH3A 1XP5A 2OSBA 1PDOA 4M4SA 4C9BA 4DZTA 4QS7A 3ORQA 4YBZA 1OF1A 4TLCA 3RTVA 5F51A 3PIPL 3TAXA 3U6KA 2DC1A 3DXKB 1Q3KA 1V4VA 5D3GA 2OCAA 4EW2A 4I50F 5HF6A 2YVAA 1G20B 3D6UA 2HT1A 2FE1A 4GMXA 3NWOA 2V74B 4C8LA 1EJ0A 5IN5A 4RK4A 4TWAA 3T9BA 4BXOA 2YOGA 4L8RB 4TSXA 4F8RA 1UOCA 4KXXA 4LYJA 2XA1A 3HADA 3RR8A 4R1LA 3BXXA 3QWFA 1LLQA 1VQNN 3TKAA 3UJ7A 2DPMA 3AVPA 1IULA 2ACWA 3SBTA 1JIKA 4UXJA 3HGTA 3VESA 2ECFA 4QU8A 3E6AA 1PJCA 2PXHA 4KMSA 4XH5A 2PU7A 4XWGA 2NO7A 1E2JA 4BDZA 1EFDN 2EARA 5I8ZA 2GZ1A 4KMOA 1NU6A 1FK9A 3QBEA 3QI2A 3ER8A 5J4KA 1E9CA 1VZ2A 4CNQA 4QYIB 2AVDA 3HR4A 3PPIA 4CFCA 3GUZA 3GYGA 1SVUA 1R6DA 2C3OA 1CF2O 1IOWA 4DBZA 1CK4A 2C4UA 4CE6A 1EQ2A 4IVRA 3NF7A 2P9SB 4KPUA 2DBZA 1NNI1 4RIHA 1JDUA 3M6WA 2C0PA 4FZJA 3IT2A 1C80A 3IAXA 4QS9A 3ECCA 3ZEUB 1XZIA 1Y9AA 2Z58A 1KKMA 4BMPB 2GV9A 2FA9A 3RM3A 3VPGA 5AQMA 5A5EA 4JSTA 2QW1A 2JGFA 3URKA 2GFHA 1MB3A 4DV4B 5A7HA 4BEBA 4MYDA 2I7TA 3NIFB 4M46A 3ZVRA 1TE2A 1Z8HA 2RI1A 1RZUA 4FHZA 1RZ3A 3KRTA 2OKGA 1LDMA 2Z1MA 3UKRA 5ALYA 4JP1A 1TTTA 1DEXA 5CB8A 2C00A 1YR8A 4PGGA 4NU6A 4YLYA 1ZITA 3TQIA 2OFPA 4Q3AA 5T8KA 2IPXA 4CLRA 1HETA 4MGYR 4B1XB 2AJQA 1T9AA 1YJ9N 4HNAA 1RE1A 5JSQA 4YASA 3V3KA 4WL0A 3GHYA 2X9GA 3FNQA 4BC3A 1HKCA 5AQXA 4KV8A 1SM4A 2X78A 2PPLA 3WLHA 3AMVA 3PU6A 2J3MA 4CZJA 4DN6A 3WJ7A 3JQAB 4O4IB 2JFPA 2MJLA 5B3JC 1VL6A 4FLWA 5FBVB 4Q9IA 4K6GA 1M3SA 3VEVA 2SCUA 3EW7A 2GD1O 5EJIA 3THXA 4RY9A 4V0KA 2YNMC 4XZ3A 5IJWA 1MAUA 2F3UA 2H59A 1BHO1 1JXBA 4BVOA 3U7IA 2KM1A 5F4ZA 1MJGM 2DJIA 4D02A 1BA2A 2VDJA 4IQ4A 4DR1K 5AFUH 2YJ3A 3L8YA 4WQ4C 1MBZA 1K88A 2P4SA 5KYYA 5JV5A 4PZPA 2GEJA 2PSSA 1KWKA 2YJGA 1HDOA 1QLHA 1QS0B 3UENA 1YUBA 3P2MA 4E14A 1L2TA 4US2R 4Q47A 4UEJA 4LFAK 4WZZA 2G8FA 4Q1DA 2VHCA 3MM4A 4MYHA 4A5AA 3KS9A 3DZJA 5A71A 3T1AA 5DFAA 3WY9A 2XH8A 2F96A 2R1TA 2ZAIA 3ZU5A 4ZEWA 5ILOA 1DE0A 3AUTA 3ZHTA 1TTQB 2VBGA 1TFUA 2PPVA 3QFPA 3AJ9A 4M8KA 3GL9A 3KUUA 1MT0A 4KODA 1S1CA 2Q6KA 1WVMA 5IABA 4DV3B 4K0RA 3DL2A 2X0RA 3AJDA 1L1EA 4W8HA 4EW6A 5L3RA 3WVNA 2YJFA 2HMUA 3EXIA 2E48A 5DHAA 2F9FA 3VVMA 1II9A 3QV1A 3RUHA 2RG1A 2KFZA 4O2BF 5FPQA 3AO5A 1E0JA 3OLWA 1YXQA 1F8XA 5DASA 1EESA 2QP4A 4E4TA 1YD7A 1ZN7A 3INGA 3LDNA 4OOEA 3VVBA 3OQHA 2DU8A 4X8LA 4YX9A 1EE1A 4LC9A 4F92B 1IIBA 4DZZA 3FCYA 3LXRA 4O4LB 3O8OB 2XR1A 3UXEA 2J5RA 4JS5A 4AJ1A 1P7ZA 1YT5A 4BVLA 4F0JA 1VLLA 3L6DA 4BGBA 1BKDR 3I1YA 3EKSA 2AG1A 5JW6A 1F21A 4B34A 3UAXA 1XKXA 4DW8A 1R15A 3UAVA 2OB2A 2AXQA 3ACDA 4QVIA 4UOEA 4F06A 4C3ZA 1BDGA 4IZ6A 1LY1A 3FWZA 1IG9A 4WXRA 1QVWA 4WE3A 1XQ9A 3L4JA 2Q3DA 5A5VA 1M8JA 2YKNA 3H5IA 2OXIA 4QTTB 1S9EA 4XGIA 2GLTA 2Z8XA 2V6JA 4QQKA 2B99A 3QEXA 1OKKA 4RJKA 1ADGA 3WBJA 2WZCA 3TM5A 3WDKA 3C95A 5A04A 3KJXA 3DMJA 4XEHA 3V1NA 3G2KA 2H4JA 4YNQA 2C8VA 4N5SA 2BFOA 3IG1A 3W3AD 2FB9A 3VF2A 4KG7A 2FY8A 3ZZ1A 1KZ6A 1GDDA 4HYYA 3SLCA 3V42A 1T24A 1FS6A 1VGQA 4CCYB 1JV2B 4MQFA 2HIGA 4HFRA 3HZOA 4H1HA 4BEWA 3L1IA 1B8VA 1RWBA 2YJZA 4RWZA 1B6RA 2O1SA 3DF7A 1U1IA 1ZUIA 2CUZA 4FGJA 1M90O 1L8QA 3DW3X 4Y1CA 4FD2A 1J2EA 2JL1A 1V1RA 4D82A 2NRWA 4JUBA 2NU6A 5AQQA 3E53A 1II8A 3KSRA 1TKCA 3DMYA 3K0HA 3E27A 3F5DA 2C61A 4LVOA 4RHEA 1L4UA 5K0BA 1GL6A 4GUAA 3JYHA 2PRKA 4PZYA 1O0CA 2EVWX 1ISSA 3F98A 1EM6A 3E3OA 4LWZA 4N6NA 1X13A 4OVKA 5HVNA 5FA8A 3KQSA 5BV7A 3NT5A 4WF9L 5FWXB 1T5IA 4R98A 2H7XA 4CL8A 1KR5A 3RS9A 3A36A 5JYDA 2J4RA 4UCWA 1SU4A 3VNUA 4EY6A 1SL1A 3CBQA 4B9QA 2CF5A 1XELA 3S2IA 3FYTA 2P4UA 4XKJA 2W7TA 1QTIA 4FZVA 2E5WA 5C2JB 2VJMB 3BJMA 2R7YA 2JJYA 4YWHA 4BGUA 2EG5A 2KW5A 4M8LA 2JFHA 3V81A 2XT9A 2Q0UA 1VL0A 3ZQJA 1I33A 4DJ5X 1G4HA 4B3CA 3T7JA 1HT2E 3TW8A 3KT3A 3G2LA 4EUFA 4Y2UA 1FFWA 1OZHA 5DK6A 4G41A 4DS3A 5EJ9A 4HOYA 4KH1A 3B12A 5GAEP 2IU0A 4AYWA 1MOSA 3G49A 3KDAA 4R8RA 1ORRA 1XHLA 2OXEA 4TS1A 2HJHA 3NB0A 2B25A 1JDNA 1OFGA 3S2YA 3TR6A 1B6TA 1RM0A 3GOIA 1UBCA 2GCIA 3KZKA 3AVOA 2WT8A 4IDGA 2CDCA 3ROEA 1HG0A 2OPQA 3RHSA 2QJWA 3CLSD 4MV4A 4XWWA 1J6UA 1PYDA 3A1CA 1GEEA 1WHTA 2Y1EA 5E3IA 2OHJA 3E3LA 2Q45A 5CEJA 3ZSXA 1QIFA 5KGWA 3LGXA 1GQ2A 2HDNB 4D0GA 1K27A 5DM70 2FPXA 4GGOA 4ALMA 4US1R 5T6MA 4J1TA 4L74A 4M7YA 2Y1FA 4BO6A 3F71A 1CHDA 2IAJA 3AZQA 3WV4A 2C4NA 2QN7A 3DT6A 1BH2A 1OU0A 3RIYA 2ONYA 3ZE8A 2OB1A 2RHGB 5BQOA 3DZ8A 5TPWA 5DM6L 5HP1A 4PC6A 1SZJG 1XU4A 4U67L 1A97A 3G2IA 1GRRA 3A9TA 5DOVA 4R1QA 2GM3A 3W9YA 3K8OE 3FKQA 2OCEA 3K9QO 2P8SA 1PJ2A 1QQNA 1C9DB 3OO0A 3ZGNA 1X1SA 1W4BA 4GM1A 2R2AA 1BI4B 1T0JB 3LFUA 3IULA 1C2YA 5KYTA 1OVQA 2J5XA 4EGAA 2CXQA 1CQIA 3V1QA 3WYNA 3P4UA 2RB5A 5L51A 2FN3A 4DA6A 4D9KA 3EX7C 3LVQE 1KO1A 2Q2QA 3ED1A 3TOSA 1IVSA 5HKBA 4TXJA 3I04A 3K9KA 4H0CA 2O6HA 3AETB 4L51A 3VR5H 2BONA 2QT0A 2GCPA 2Y1XA 3H2YA 3UCFA 3O3FA 1HUQA 4BP8A 3DV0A 2ATCA 1N25A 4EHLA 1EHCA 3W5BA 5JOQA 1G8AA 2WSSD 1JSLA 3OEHD 7GPBA 1O13A 3QU7A 4QT4A 1KC8O 4WLNA 1MA0A 5HIAA 1U2SA 1K8KA 4YGYA 1Z25A 3M8KA 2NP7A 1ECLA 3GLHB 3TX2A 4HEHA 2P4HX 3I9JA 1BKSB 4Q1BA 2EWMA 1KP2A 5JECA 1GTL1 3OIDA 5TEVA 3FUCA 4MVYA 2Q2VA 1BG3A 4BVGA 3FYHA 4J7XA 1FDTA 3ZJUA 3DCJA 3THYB 4GLJA 4DSIA 1HRKA 3L2VA 4IBNA 1O4WA 4C43A 5FPMA 4NPCA 4H16A 5I8WA 4RABA 4MUKA 1R1DA 5AQWA 1RADA 2VF5X 4U7BA 2C7VA 2Z2KA 4QJ4A 1TCUA 4PZDA 4DQ8A 2J9FA 5C10A 1U2EA 3I2HA 4KLAA 2NTJA 2F48A 4EHJA 2ZUEA 2VYVA 4KO4S 3UMBA 2JZNA 1CNEA 3QTBA 5HQTA 1HNZB 3WNGA 5EIWA 5EKXA 4UUNA 3A6FA 3RYCB 1YUMA 4G0XA 2OPSA 3JQFC 3A9UA 1V7QA 3KJZA 4R1UA 1FBTA 3R8XA 1CT9A 3AP1A 4CJUA 1P1IA 4U0JA 4LGCA 2R6CA 3G5UA 3CV3A 2NADA 5AQHA 1QIDA 4QUGA 3MUOA 3O8CA 3KKMA 1LTQA 3LS2A 5G1OA 4IV8A 1NLFA 1PO7A 3EXFA 2UZIR 4ZTUB 1T26A 3O4VA 2FEXA 3WBFA 3N87A 5AW5A 3HP9A 3NE6A 3LQ2A 3T9FA 1MAAA 4HX2A 4KFBA 4KN6A 5BVHB 3C8DA 1QRAA 1T29A 4ZYYA 1EBBA 1LW2A 4GV9A 3CWCA 1KS2A 1LD3A 3LRPA 4IKOA 4CGJA 3CXRA 2IU3A 4BYMA 1U7DA 2ZJFA 1VSMA 1GPNA 3OYHA 5HS4A 5B1YA 4M0KA 1XHZA 1DAGA 4JITA 1CTQA 1T9KA 3MTIA 4RIGA 1DCMA 4FWKA 3J7AP 3NG1A 1P81A 3T5TA 3A2KA 4LE0A 2DHEA 1QORA 4ML3A 3HVTA 1B0AA 3C6UA 3AY9A 5KDLA 4BMSA 4RQTA 1LPAB 4GKKK 5JQWA 3K1AB 2IQ5A 2O59A 4L6IA 4CT5A 4FVUA 4AULA 1BQ4A 2IH5A 1LJUA 3VNAA 3WLNA 5ALVA 4ZYUA 5BRDA 1Y8AA 3BY5A 5IH3A 2FXUA 5JAQA 5K2OA 4R05A 3CKLA 2CUTA 4AKHA 1NG9A 4ZVOA 3ZE9A 3VYVA 2X22A 4I99A 4HDSA 2VP9A 3TB4A 4FOTA 4ZEXA 1RACA 4YUAA 3MGAA 4WZAB 3NC0C 3EBLA 3SKYA 1ANKA 1OZ0A 3CCQN 1NGAA 1WO8A 2DFEA 4MGEA 2OXRA 2VSNA 1XDDA 3T1YK 3EDQA 1E4VA 5CXSA 1KZYC 4D97A 1N2IA 1NZJA 4G0WA 1PQUA 2O20A 2MSKA 1ORDA 2YH2A 2NNWA 1Q92A 4G4JA 4N8EA 2J9GA 3TECE 1JR3D 4IH9A 2KJQA 1ECPA 2CC2A 2Q5QA 4GC9A 4BTEA 4LOKA 3UH0A 5E2IA 4B83A 2W2QA 4CKWA 4B9UA 2JHGA 2WKWA 5CD1A 3RBVA 3U48A 4BL5A 1RFQA 3CLSC 1QHHB 3SIPA 3A1TA 4FILA 1TM3E 4RS3A 1MO6A 2R7MA 3LX6A 3TOZA 5L40A 2HLDD 2VF2A 4LN1A 2WC1A 4GVLA 1DIGA 2IXFA 4DMKA 3DWLA 3I3SR 3DH0A 3C6MA 2QR2A 4CCSA 3P9IA 1L3IA 1ILEA 2KE5A 1G9XA 4YCLA 3R77A 3IA7A 3DDWA 1XZGA 2XNDD 1C1DB 3TWHA 1WS6A 3PQ8A 4BRHA 1WY5A 1UZLA 1JLRA 2J59A 1IG3A 3OYKA 4C4RA 2Z4RA 3TDKA 1KH2A 4JD2B 5CGZA 5CB4A 5I9BA 5LQSA 5HMMA 4A2QA 2VQDA 3MAQA 3ZX2A 2LGJA 3BAFA 2JA2A 4RJLA 2BI8A 3CRRA 4OL0A 2A0XA 2CXRA 3E9PA 4JNKA 1YNOA 1XTJA 1LLFA 4WCEL 5AQJA 3LT1A 3A27A 1U7UA 3QLTA 2AR9A 1S6QA 2X4IA 4WLFA 2OZLB 3W90A 3UPDA 4BDSA 4WOBA 3IBYA 3JSXA 2FVYA 5CNIA 2BGJA 3M1YA 1FS5A 1KFDA 4UMVA 4MCAA 1Z5NA 3M81A 1ESMA 3T1TA 5AVJA 3HI6A 4YMUA 3GG9A 1EE2A 1Y37A 4L85A 3MNFA 4KPFC 1HEUA 1SZ2A 1TVKA 2RI0A 3LIIA 1S2MA 4WADA 2LDXA 4HH3C 1XZJA 3LDAA 2I62A 1NUTA 5EQJB 1N9GB 4BGAA 5GV7A 3L01A 5MHTA 3KZMA 3C6HA 4A82A 4RDIA 1Q16A 3RKRA 5U9CA 3NHKA 4BFTA 5KOJA 2W93A 3K5LA 3L40A 3V1LA 3ASMA 2H4WA 6PFKA 1G64A 5LA6F 1SCAA 5KYKA 3OQMA 2IVZA 2GD2A 5DYNA 2V7YA 8OHMA 5K0LA 4YJDA 1NV9A 3KUKA 3CSSA 1XD9A 2CLSA 4Y30A 4DJJA 2GPSA 4LJ8A 3T9AA 4BO0A 1RS0A 2BEJA 3CXCM 3NHYA 4LJRA 3AVLA 4X0EA 5GM2A 1RRFA 4K9DA 1KA9H 1AZTA 3OZSA 4ERNA 1JDSA 1SUIA 3Q3CA 1WB6A 1JQAA 4I4CA 1N7GA 4CQJA 2Q9AA 2FHPA 2Y0DA 3OP1A 1WOYA 1WZEA 4HTUA 5TRTA 5TS2A 5KMGA 4ZKDA 4BFLA 5FV4A 3ANLA 1Z33A 4K9SA 4D6XA 5AKHA 3A6GA 3FYUB 5LB4A 1F2UA 4PAGA 1EFVB 2NTNA 2PGDA 1VHQA 2XTAA 3PGMA 3N8GA 3DVLA 5EZYA 5F77A 5HOQA 2O05A 2O8NA 1YV9A 4WQ5C 2DFFA 4X71A 5BVGA 2OFWA 1JDBC 4PCAA 4C8OA 4TS9A 4DLTA 3ZOKA 4RQBA 1U90A 5KWJA 4QDXA 5HZHA 3G9QA 4ZC8A 4JVSB 1T4CB 2VDWB 2C7GA 1E8DA 4PS0A 3ZDBA 2CBZA 3T3OA 4X61A 4E4YA 3RR7A 3ZI7A 4ER5A 2VZLA 3KKEA 2GVZC 3ROTA 1NE7A 4YR7A 1F51E 2V65A 3MB8A 3QXSA 1H4VB 3E82A 3O8LA 2D2EA 1E6CA 1XFDA 4CF3A 4QOJA 2NQ2C 1DEOA 1WSAA 4KLZA 5HXAA 2IC5A 3R76A 1XAIA 2FPRA 1TYBE 4B4DA 5BSMA 2XOXA 4MP8A 1TKDA 2IXDA 3EGOA 3LHIA 4NBNA 1ZVJA 4KAJA 4NAHA 2EGUA 4KK4A 4HYEA 1KNQA 2O3RA 4TWBA 2QQGA 2NQ8A 1CUGA 2QRMA 3GDGA 4IFBA 2ZJ4A 1L7MA 4RNCA 4CIAA 1ZI8A 2QZ4A 2V0NA 1KORA 3HCBA 3QX8A 3ER9A 4MQ6A 3H7IA 2NU7B 2RB4A 3FPAA 4QBFA 4DAOA 4RMHA 1M66A 3WWOA 1VLZA 2CHGA 4Z4EA 3L8CA 2OV2A 5AJHA 2XRZA 3FZQA 2G9RA 2I1LA 3TLAA 3MGCA 4J91A 5AUNB 1QHFA 2XB4A 3QPDA 3KHYA 3HABA 1YJAA 2PX8A 5BT8A 3O1JC 1Z0SA 4EI9A 2P0AA 5FFNA 4HTFA 4PXAA 4KHNA 3N9IA 1D2HA 1GZUA 5B2ZA 3OWXA 5LDHA 1DO8A 4F1KA 1P4HA 4CEJB 2EBHX 5KHAA 1ODJA 4WLEA 4N1AA 1NR5A 3GJQA 3NBMA 5A7GA 1EMDA 1JKXA 4E1AA 4OATA 4XOIA 2ZU6A 4TTIA 4M7WA 4UCXA 4B8AB 3ZX5A 2B4QA 2Q27A 5K8LA 5B37A 1V8FA 3JD4A 2HWYA 2GPJA 4F2GA 2OCGA 2X2OA 3MN1A 3NHMA 1ML3A 2G3YA 2HF7A 1LU9A 1BJTA 2Z2JA 3STYA 1D2CA 2B5VA 3BXFA 4AWAA 3TLJA 2CCGA 1TD9A 2YYSA 3ET5A 4ABTA 2QWXA 4TXLA 1WHSB 1G3MA 4PICA 4URUR 3M9XA 1BCSA 3E7XA 4HLUC 3TR5A 4FOPA 4CEZA 2QTVB 2IBMA 4QPJC 5I7OA 5AJTA 1OT3A 2GEVA 2ZAMA 3IKJA 5HR5A 1PD1A 1G5PA 3ZKAA 3LBYA 1VKZA 1H85A 1E20A 3KR2A 3L0ZA 3DMHA 4D41A 4KHQA 2XRYA 3OBBA 3FCUB 1KRXA 4LYHA 4FFMA 2HT6A 4EKGA 2HNDA 2R6R1 1T4MA 3X1WA 2VA8A 2Q1SA 1WUJS 1M1YB 2ZIWB 2G0TA 3HCDA 721PA 4RMIA 4DQSA 3IEXA 1A8SA 2J6BA 4M3WA 4BVBA 1IJBA 3GQVA 3PTZA 2N75A 2PUWA