2W42A

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt dna duplex.
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMGYEGTKVKLSSKRYLLTLLQMVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPIRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enhancement of the Seed-Target Recognition Step in RNA Silencing by a Piwi-Mid Domain Protein
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein/dna complex
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN
total genus 137
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2w42A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2w42A01
3L2QA 4MR8B 5J2NA 2L19A 3OLVA 4KHUA 5FWXB 3C3KA 4YNQA 2RPIA 1KLNA 1KRPA 1LJUA 5IUNC 3EZ5A 3QLUC 4CJ4A 5J1EA 1EP4A 4DTJA 4DG1A 4RS3A 4MFBA 5TPZA 5I42A 2RGYA 4ZTJA 1A04A 1K68A 4DSIA 3H5WA 1ABFA 1Z12A 4EUKA 3G0ZA 1FXXA 3DLHA 3TWHA 2PUBA 1NKCA 3A0RB 5CNJA 3QEIA 2XO7A 2VYCA 4ICLA 5EWJA 3RMBA 4RV5A 1NK8A 3KHTA 1QHTA 1JDPA 5HRSA 2E4YA 1DBWA 4HCBA 4DQSA 2BANA 4R5PA 1U2QA 4EYGA 3C95A 3MM4A 3QEWA 3BILA 1RXIA 1RT7A 2PZSA 4HHTA 1CHNA 3CYMA 3PO4A 3K5OA 4IF4A 3RH0A 4IBNA 4YFUA 1S1TA 4AHSA 4CF8A 3I45A 5KRTA 1GLGA 2DFHA 2E4WA 2X74A 2CHEA 1IKVA 4RDCA 5GOTA 2B1JA 2FBTA 4G0ZA 2E6MA 4YGXB 3D45A 4WZZA 3RVOA 4CGJA 4S05A 2QSJA 1Z16A 4W5TA 5CYMA 2WONA 3RVNA 6CHYA 1A5VA 4TSXA 2D0AA 2IGIA 3H5OA 4CJLA 2QK9A 2HB5A 1QMPA 4HTUA 4AHVA 3U6FA 1QNLA 1S8NA 4FLUA 4RG8A 3OYBA 5JNUA 3FGZA 2G8UA 2ZWMA 3JPYA 2WRZA 4YRZA 5SWMA 2H3HA 2P9HA 1JFTA 4DU3A 1N6QA 4KHQA 5TE9A 2O20A 1CXQA 5HBMA 3NFAA 3QX8A 2ZAYA 1ZH4A 1IO2A 3QLVA 2KFNA 1ZVVA 2PJUA 4RSMA 2X6NA 4RWEA 3GT7A 2HHQA 1L3UA 3OMWA 5EWLB 4RW4A 3LAKA 4BACA 4OJRA 4UQGA 1BDHA 2M1ZA 3P9YA 1A2OA 1B9FA 2BDPA 4B3OA 3K2PA 5JS2A 2DY4A 3SPZA 2E4UA 2IPLA 3NH1A 1ABEA 1RZRD 4H4MA 2CD7A 3V9XA 4ZMSA 4FK2A 1HQEA 3PY8A 1JLBA 1Y1LA 3CKMA 4CJSA 2LBPA 2QVGA 4FVMA 4NCAA 4JS5A 5TQ0A 3AA3A 4E7PA 1KCFA 3ROTA 4G0MA 3SV4A 3VQ6A 1KTQA 1HEYA 4HNSA 4Q6WA 1L3VA 4OGEA 1MU2A 1PHRA 2JK1A 4HUFA 3OYCA 5TPZD 3L2VA 4EY3A 3CFPA 4HUEA 3ZCMA 1WN7A 4LE1A 3DOLA 3GWGA 1VSLA 4NYFA 4S04A 4OKEA 3DI6A 4PQUA 3SQ2A 4KO0A 2XRIA 3HT3A 2A1RA 1TMYA 4LDZA 1C1AA 3AO1A 1SUQA 2FSPA 2FBXA 3NGZA 1LWEA 3HDVA 3V81A 5FRMA 1NXPA 1BVHA 1ZAYA 4OBBA 3LWLA 4H8KA 3TANA 4DLEA 4MR7B 1YK1A 3WNEA 4KKOA 3OS0A 3H1EA 1RILA 1SL1A 2AJQA 2PAFA 2FBYA 3DM2A 1Z15A 4KI6A 4F8JA 1D1PA 1NK7A 1L3SA 4PWDA 4NV3A 4OPJA 3VNAA 3A2FA 3NAEA 1APBA 2ITGA 3ILHA 4PEVA 2LPMA 1HRHA 1D2AA 3OM1A 2ID9A 3DBIA 1BCOA 3MA0A 1SV5A 3BDPA 4LX8A 2WWVD 4PYRA 4GMJB 3OQOA 4F2RA 3N0XA 3OLWA 2E4VA 3OJUA 2FLKA 1SRRA 4RKRA 3ULDA 2XHBA 3FFIA 1B00A 1E2BA 1KVBA 2GBZA 1EHCA 1DTQA 6ABPA 1J53A 4W5QA 1UOCA 3E61A 4LE0A 3H6GA 4Y1CA 3B6PA 4AILC 5C5EA 3OY9A 1VSDA 5E3JA 3OS2A 4KREA 4CJ5A 1NXSA 1U48A 3O4QA 1EAYA 2JVJA 4FJMA 2JRLA 4RW8A 3OJSA 1UDRA 2M98A 1GUDA 3HUUA 4DTMA 4FZXC 3B6OA 4CIFA 4KHSA 3LP1A 1D1QA 1M2EA 4G1QA 3CG4A 4O1IA 3K5NA 1KFDA 1WSHA 3AVBA 1YTUA 2JVIA 2X7XA 1DCMA 4MS1A 2QKBA 3DRPA 3KIOA 4H4OA 4RXUA 4CJPA 3QLUA 3HYFA 2VWKA 5EWMA 1TKXA 3MYYA 3L6UA 3NBMA 2HPHA 4I2PA 1KSPA 1SKRA 2P1JA 1XI1A 2PUFA 1WAJA 3SAJA 2VUHB 1TK8A 1T7PA 1TKZA 2GX6A 4MQFA 3IS9A 3LP2A 1DCKA 4O55A 3VA3A 3KLEA 2OENG 2QXFA 1TL3A 3F73A 3LUGA 3LALA 4CJQA 1QKKA 4KB0A 4RXTA 5DTEA 1QQAA 1S1XA 4G0OA 4L4UA 1RT5A 2IOCA 4QYMA 4DSLA 4OLBA 2L17A 3KTQA 4FLVA 7ABPA 4M3WA 3HS3A 4N0PA 1TAQA 1USKA 1XWWA 3TAPA 3CZCA 2I6FA 4RK1A 1KLMA 4FM0A 2G8VA 2G8FA 1PNRA 4XFKA 4XASA 2LP4Y 4KQ9A 4P98A 4J2DA 4W5OA 1P8AA 1IKWA 1XC9A 1FFSA 4CJWA 2OPQA 1SL2A 2B4JA 3SG0A 1J5OA 4KMRA 3ZSXA 2J48A 5C42A 3OYAA 4JB0A 2Y1IA 3A0UA 3OO1A 1BQNA 2L18A 4ELTA 1USGA 1XHFA 1Z2DA 1TAUA 1PNTA 4DU4A 3BRSA 2YNGA 3V1OA 4OKKA 3I8DA 3NDKA 4KV7A 3LP0A 1IKYA 1RDDA 3CM6A 2NZVG 3NF8A 1U8TA 3C97A 4F11A 1QQCA 1HYVA 3OYMA 1SXIA 4HCCA 5BR1A 1TM2A 1VSEA 4KRFA 2OPPA 1QP4A 2NT4A 2WJAA 2DTUA 3I09A 1S1UA 1WSFA 4YLEA 4KTZA 1FK9A 5TQ2B 2PUDA 3QEPA 3E01A 3LUJA 2PYLA 4EZ9A 5IULC 3AO3A 4FXDA 3H5IA 5KQGA 2RKIA 1LJLA 1X1PA 3RVJA 3SJJA 4FJKA 1C4WA 2HHXA 2A9OA 4M3TA 3O4NA 3LZIA 4XARA 4O1HA 3ZT0A 2A9PA 4WT7A 3SQ1A 1YS7A 2WB4A 1JXBA 3PV8A 1C0UA 3VQ8A 5PNTA 2XDYA 1ZYQA 1RTHA 4CFCA 4F06A 2PE5A 3A10A 1LBHA 4JLHA 1P6QA 3BRQA 4N47A 1QSLA 4CJVA 5E41A 2KTQA 2F8SA 5T7BA 4CBVA 4FZYA 4B8CA 3I42A 3HK2A 4BDPA 1CZBA 1U2PA 4FJ5A 1B9DA 3VQ7A 1DTTA 3SUOA 4DTNA 1JLCA 3VQ9A 4MQEA 1TVRA 3KS9A 3SQ0A 5K14A 1HYSA 2PUCA 3H5TA 3ZT4A 3QEVA 4OGCA 3F7NA 2IPAB 5F64A 1JH9A 3M8QA 4CEQA 3A3KA 3DLGA 3VQEA 2E4LA 1NTRA 3UUGA 5J2PA 3OYJA 4H3HB 1WSEA 1Z13A 1QP7A 4FLXA 2KFZA 4Z0NA 3QO9A 2GBPA 1Q8IA 3WNFA 1URPA 4EYKA 1JL1A 4MR7A 3SQNA 2YKNA 1W25A 1EXQA 4Z9BA 4KNYA 5DK5A 4RU1A 1DLOA 3QELB 4M41A 5C25A 3UIQA 2IPMA 3VQAA 4MS3A 1ZGZA 1WSGA 1ISSA 4I2QA 1LV5A 1M2FA 1TVMA 1P2FA 2KQ2A 1DC8A 4M45A 5FRNA 1RTJA 4AHUA 3TR8A 4NCGA 3AVMA 3AA2A 1LWFA 4E7JA 3CU5A 3T6KA 4LE2A 4CECA 4I9QA 3K9CA 1B92A 2PL1A 5HSGA 2FKAA 3MIZA 3LDSA 1P6UA 4ZPJA 3JTEA 3NGYA 4ZTFA 1NK0A 3P1GA 4RKQA 1RDAA 4N03A 2FW0A 1ZH2A 1VRUA 3KCNA 1C1BA 5FWXA 4H60A 2PUGA 3PO5A 5DGCA 3S9HA 4E7HA 4FJNA 3QEMB 2HW3A 4CF9A 2YNFA 1EWKA 1KGSA 4BE2A 4YR7A 3KK2A 1RBVA 3SZ2A 4E89A 3PX6A 2GKGA 4PUOA 4F3TA 1TKDA 3TARA 4KFCA 2D5RA 3TX6A 3QERA 3NHGA 3IP6A 1LAVA 2OA8A 4MQ3A 3LUHA 1WETA 1MAVA 2Z1IA 2OYQA 1NJZA 4EYQA 2IC3A 3LPUA 1Y97A 3EYZA 1F21A 3TO5A 1ZHHA 4FJLA 3IP9A 3KLHA 3W9SA 3OQNA 3OYGA 4MQEB 3RVRA 4KI4A 3U3YA 2NZUG 4RK0A 2VG5A 4Y1DA 3GV0A 5TPWB 1EWVA 5IUKC 1NXXA 4E7IA 2YKMA 3C6UA 4B9NA 4B09A 4BWJA 3QLHA 5EWLA 1LW2A 4ID1A 1R8JA 3V6DA 3OLXA 2OZMA 4DTPA 4ID5A 3O1HB 4CE9A 3ZSVA 4E1NA 4CF0A 1TLFA 3VQ4A 4RY8A 2AYXA 2FQXA 3N75A 4IFYA 4DADA 3L3VA 1S1WA 3OM0A 4NQRA 3KLGA 3HO1A 4CF2A 2B4AA 4RW7A 3IRXA 4CIGA 3QELA 2IOYA 4RK5A 3Q7RA 3S3MA 1ZBFA 1BA2A 3KKSA 1K66A 4E7LA 2YHAA 4LSLA 1ASWA 3AVCA 1QO0A 1FSPA 4CERA 3SUNA 2FQYA 4Z9AA 3VQBA 2LSNA 2VG7A 4N0QA 4OPKA 4DSJA 4M3ZA 4OG2A 4AHCA 4CGFA 2NUBA 3S3NA 3NF7A 3TD9A 1TKTA 2ZQBA 3L2UA 3ITHA 3N0WA 3Q7TA 3F6PA 1NKEA 1ZBIA 2VK2A 1XHXA 5KRSA 4M3YA 4DS5A 3KYIB 2OPRA 2ETJA 4YP9A 5IUJC 2HHTA 1JL2A 2G8WA 5C5CA 3HZHA 2IDOA 1T05A 4GPAA 3T38A 3TMYA 1HYZA 3NBPA 4O0IA 3L2WA 2JBAB 3D02A 1NKBA 3UK0A 4O44A 2B5JA 9ABPA 1DC7A 4FCYA 3ZSRA 2QVCA 4MS3B 3CS3A 3RTVA 4ETIA 1HNIA 1RPJA 4Z99A 3DGEC 1QQBA 1IG9A 4E1MA 4DQDA 1BDIA 3DLRA 1OXKB 4C8LA 3CLKA 2R47A 4N56A 5HP1A 3AVIA 1BL3A 4J2BA 4ELVA 3VNBA 3OVNA 3N8IA 2AYZA 3UKJA 4B9VA 4CHOA 3LUKA 1Z2EA 4XIUA 1A5XA 3SYZA 1ISRA 3LMKA 3N53A 3HPHA 5EWMB 2IKSA 2JCGA 4WXMA 1D5AA 3CRNA 1RT1A 2MSWA 3IP5A 2WJWA 4O4GA 3SV3A 3LUAA 1QPZA 4Z0UA 3T19A 3VQDA 2OZSA 4FJHA 1VK0A 1TL1A 3FDFA 3O3FA 3M8SA 4JRPA 4GVMA 5IC5A 1M5TA 4OVLA 3QLVC 4Z4CA 2G8KA 4B9LA 2ZE2A 3OLYA 2YNIA 2IPNA 1RBTA 3MAQA 5KI6A 3KK3A 1NJYA 3O2QB 1QTMA 1HMVA 4DLGA 1Z17A 1USIA 4E0DA 3OYKA 1ZBHA 3OYFA 1BI4B 5DKFA 1HPZA 5CZ1A 1S9GA 4Z4GA 2X6SA 1NOZA 4PA1A 1XHEA 2PKXA 1RZRA 4YV7A 5JS1A 3LWMA 1E6LA 1UA0A 4CGDA 3NE6A 3KLNA 2MSLA 2QV0A 1M5UA 4IKFA 3MECA 4FK4A 4KAZA 3ZT3A 4ELUA 3SPYA 4CGGA 1BISA 3DLEA 4LD0A 3ZSZA 1BCMA 3RVKA 3VQPA 4DMNA 3TAMA 3JY6A 3KKRA 4RW6A 2NT3A 4IGAA 3EAFA 1TK0A 5I3UA 3KTOA 2VWJA 4Z4EA 5FWYA 1NJWA 1ITGA 1SD5A 4RK6A 4KZKA 3I0RA 4KTWA 1JF8A 3SCXA 4G0XA 4IMIB 4WUTA 1QSYA 4IILA 4CJRA 4UHKA 3EGCA 3KJVA 4AH9A 3PX4A 4E7KA 3PUFA 2KW4A 1D5WA 3V1QA 3HV2A 2MYPA 2Z1GA 5CYQA 4ETNA 4IG0A 2HNZA 4DQRA 1BIUA 1PEYA 4CFDA 1RT3A 3MXIA 4BDZA 4D74A 4FLTA 2XY7A 2IYNA 4Q6BA 1QSSA 3HPGA 5BQ3A 1IIBA 4FE4A 3LOPA 1NXVA 2MYNA 3L2RA 1FFGA 4FJXA 4JA2A 3OQMA 3H6HA 4FB4A 3ILYA 3KLIA 3JPWA 1ZY2A 1YMUA 2ATQA 4CJFA 1RT4A 1JX6A 2FXIA 5FBKA 2B6AA 3ZT1A 3WNHA 2P4UA 2WY2D 1S5JA 2GWRA 4DTOA 2A9RA 3M9XA 1D9DA 3Q7SA 4HVJA 4G86A 3M8PA 4DTSA 2FVYA 3QEMA 1XHZA 1FQWA 3MXJA 3O3GA 1EFAA 3CZ5A 1BHLA 4KQCA 3TAQA 3MQ4A 4L85A 4CHQA 1VRVA 4FJ9A 1JHZA 4DTXA 3LAMA 4TLMB 4LH4A 3CQ8A 3BREA 1RBUA 2FBVA 2HHVA 1I3AA 1DZ3A 5CNIA 3AVHA 5B3JA 4HYEA 2HNYA 1L5UA 4OLAA 4ETMA 3IPAA 4CJ3A 3CNBA 4FK0A 1SKWA 3K59A 4DF8A 2Y1JA 4F4KA 2QXYA 1CXUA 1NY5A 2PLNA 4CEZA 3IP7A 5HLFA 2N9UA 2PMCA 1JLGA 3JSMA 1EKEA 3F6CA 1RTDA 4FW2A 4B9MA 1DBPA 2F8TA 1DRJA 4MR9A 2XY5A 4MR9B 1SL0A 4CFAA 2P5OA 1NOYA 4C8KA 2E6LA 1X9WA 3LUFA 1GOBA 3HPOA 1SKSA 5CY4A 4JRQA 4FJGA 2G8IA 3BBLA 3DGFC 4KK4A 1BAPA 5FDLA 8ABPA 3H5LA 3L3UA 5DCLA 4FM1A 2ZD1A 3F9KA 3OYLA 4IMJB 3TI0A 3AO4A 1MB0A 2D0CA 3AVNA 4MYRA 1SXHA 4TLLB 5CZ2A 2PUAA 4K8ZA 3GRCA 1QE1A 3AVAA 2MYTA 3EY1A 3DRRA 3GBPA 4H3KB 4I9LA 3U3GA 3QX9A 4MPTA 4AHTA 3I5AA 4NCBA 4KVFA 1DJMA 2R48A 4B08A 2JVKA 2FQWA 4F3OA 3QNOA 3HXMA 2PYJA 5EU7A 1FKOA 5IX8A 2LIVA 1F51E 3ZSYA 1D4ZA 3JYTA 4LDAA 2FN9A 3VQCA 2KYRA 1VSFA 1TV6A 2FMIA 1QP0A 4JOQA 1L5ZA 1IKXA 5JNRA 1JFSA 1NXWA 3S3OA 4J2EA 2FTKE 3QNNA 1GOCA 3V9ZA 1TGOA 2KZZA 4EP4A 4MGEA 4PY5A 5TPWA 4B9UA 4YWHA 3TABA 3BGRA 1CEYA 2RDMA 4EGSA 2H0AA 1HQUA 3CG0A 3V9UA 3TAFA 3D8UA 5FBHA 4KHNA 3QEXA 1CLQA 4LRQA 4JS4A 3QIPA 3P83D 1WAFA 2A9QA 4P1ZA 1NK6A 4CESA 2QU7A 4ZJPA 3DYAA 1U4BA 4CEDA 3K5MA 1HNVA 1REVA 1MIHA 3QEKA 3M9WA 2IS3A 4DFPA 2MSKA 4Q7EA 5CHYA 1JLKA 3OYIA 3DRSA 1U0SY 2QW1A 3HVRA 3GBVA 4MS1B 1L3TA 3KD5E 4B9TA 1RDBA 1PUXA 4M3XA 3OS1A 3ZT2A 3VQQA 1EWTA 2JB9A 3AV9A 3AVKA 1YS6A 1NJXA 1I3CA 4FZZA 2O4GA 4OKJA 4ML3A 1E6MA 2PUEA 1G15A 4DQIA 2W42A 3LPTA 3E3MA 3HL8A 2GV9A 1RT6A 1W0HA 1UWBA 5KC8A 3RRGA 4DSEA 3RR8A 3MEEA 3SUQA 2HVHA 4JP1A 4YCSA 3JVDA 4MLDA 4OTZA 4NICA 3EDCA 4YS6A 3C3WA 1J9AA 5JNWA 5HQJA 3N6VA 4EVQA 1N5YA 3O1IC 2HJ9A 4DQPA 2Z1JA 1RDCA 4MS4A 2GI4A 4KK3A 4O0JA 1KMIY 3RVMA 4RXMA 4LZLA 4FW1A 3DZDA 3M6MD 4CF1A 1RNLA 3KJXA 4Z4FA 3MMNA 4PE5B 3NH2A 5EWJB 1NXTA 4M88A 5IEBA 1I39A 4DQQA 1JWLA 4G0PA 1Q9YA 4LSNA 3HP6A 4CHPA 3VA0A 2Q3SA 3LKBA 2HMIA 1R0AA 2R4QA 1ASUA 4C8MA 3K58A 1ASVA 4E19A 5SZTA 2FEKA 3QIOA 4CHZA 2TMYA 3V4IA 5ED4A 4C8OA 3N0RA 1RCHA 1WSJA 3EQ2A 3FMVA 5HRPA 3RWUA 4RW9A 4ZYLA 5I4CA 1EETA 2WOMA 1VSKA 2D0BA 4IDKA 3M8RA 1U49A 4FJ7A 3LUCA 3AVLA 4BE1A 4PZ0A 3FFXA 1ZBUA 1JLEA 1LAWA 3AA4A 3VN5A 1A0OA 3OO0A 4XLTA 1JYEA 4CEAA 2YHBA 3JS5A 3KKEA 2CWDA 4WE1A 4CK3A 4QPJC 3RR7A 1VSJA 1X9MA 5HM6A 3KYJB 1NK9A 1ZGGA 1JDNA 3THVA 1JLFA 1NK5A 1T03A 1ZDMA 1VSMA 3HP9A 5BRAA 1FFWA 5T3YA 4B8AB 2FMKA 4EVSA 1RXEA 3RVQA 4DFMA 2HVIA 3LTEA 4FJJA 2FMFA 1JKHA 1YIOA 5GQSA 4UHJA 3AVGA 1DCFA 3ZSWA 5C24A 4CFBA 5DMRA 1LK0A 3B2NA 3ALYA 4CJTA 3TB6A 4YO7A 3ISNC 3AO5A 4N41A 5HKOA 4G97A 4BE0A 2JLEA 1RT2A 2EHGA 4MAAA 3IAYA 2CHFA 1YMVA 3LFTA 1JFVA 3O1JC 1E6KA 4F2SA 4XXHA 1X9SA 4MS4B 3SNNA 1LBIA 4WXEA 1EX4A 1NK4A 2ID7A 3NNDA 4CEBA 4QAGA 3DMJA 1DP4A 4FLYA 3SY8A 5J2QA 4TN5A 5B3JC 1HJRA 4CJEA 3P5JA 3H1GA 4OATA 5HRRA 4DS4A 3MEDA 4DWIA 1ZITA 4GNRA 1Q9XA 4JAVC 1KFSA 3T95A 1F4VA 3DOKA 1T34A 4TMYA 4O5AA 3NNSA 1J54A 3RMDA 1U04A 3ZSOA 2QR3A 4DSKA 4QOZB 1TJYA 3RVLA 3GL9A 4MRMA 3KLOA 1GCAA 1C0MA 4FJIA 3H75A 3TAEA 4D6YA 3H08A 3URMA 3C6QA 2QKKA 1C0TA 4FLZA 1JLQA 1FKPA 4W5NA 2PY5A 1BDJA 2FMHA 3RVPA 3CHYA 4IG3A 4JB2A 5D2CA 2A1SA 2EX3A 1YT3A 4DSFA 3CTPA 3NF6A 4F8RA 3HVTA 1WNSA 4CHYA 3AA5X 3MF4A 1C1CA 1VKRA 1VLZA 2I5JA 4CJUA 4E7OA 1U45A 4RZSA 3GA5A 2XY8A 2DFFA 3O75A 3Q41A 2IAJA 5JNSA 5J2MA 3QLTA 1Z26A 5FROA 3CFOA 3QESA 2HSGA 3V9WA 3CFYA 1XWLA 1H9CA 4EP5A 3NNNA 3LKVA 2FEWB 5BRJA 2GUIA 4C8NA 1KVCA 3EQZA 3C94A 1QO0D 2RJNA 4FJ8A 5JNVA 3LANA 4WWHA 5TQ0B 1ZBLA 4LH5A 4AHRA 1BI4A 4RY0A 1RBSA 4ZMRA 2DFEA 4DFKA 2E4ZA 3C3MA 3IDOA 4BWMA 1NATA 2V0NA 3Q9SA 4JASB 1DRKA 2MYUA 5CNKA 2R25B 3OYEA 4EYOA 3DLKA 2HNDA 2G8HA 3NCIA 5HROA 3HSYA 3HSTB 3AVFA 1RBRA 3QETA 3O2SB 5KGXA 1U47A 1PEAA 1YVUA 3MXMA 1ZESA 4E3SA 4EVRA 3IG1A 2P51A 3OMXA 2PL9A 4CCHA 1LW0A 5KWSA 4KFBA 5KQPA 1CZ9A 1S9EA 3KK1A 1ZN2A 1AB5A 4MQFB 1VSHA 3C6TA 4KHYA 2LUOA 4N5SA 4NYNA 3HJFA 2IDMA 1D8YA 3L8BA 4KPYA 2E4XA 2OQRA 4MLCA 3SQ4A 3NHZA 3R0JA 3RQIA 1J56A 1RTIA 3Q15C 1QS4A 1S6QA 4EZ6A 3H1FA 3V1RA 4KHWA 2KZMA 3IPCA 3O74A 2BE2A 1RNHA 3T3FA 1NXOA 3GYBA 4RY9A 3O2JA 3HCWA 4DN6A 4CK1A 2OPSA 1VPWA 3K5LA 5IEJA 3OYHA 3MEGA 4CJKA 4KB1A 2QZJA 4L8RB 5TQJA 1LWCA 2RN2A 3SNKA 4HNRA 4BDYA 3AVJA 3RVSA 3RRHA 1K6YA 1YTAA 3NF9A 3NH0A 4DFJA 1JYFA 1AB6A 4RK7A 1MVOA 1C0EA 3V9SA 4B9SA 3OYNA 3HUTA 4D6XA 2X78A 3ZSQA 5IBQA 4N76A 1O1WA 1JL3A 3OYDA 2L2QA 2BGGA 4DF4A 4CHNA 1UAXA 3CM5A 4CGHA 3O3HA 3G1WA 4M3RA 4CIEA 3T1AA 3EODA 4J2AA 4Z4IA 2JBAA 4XAQA 4QYWA 3HDGA 4LY7A 1DBQA 1GOAA 3G10A 4IRXA 3I0SA 1W9HA 1TK5A 2F96A 3JVIA 3CFRA 3ASMA 1C6VA 1BQMA 4GW6A 3CG7A 2VUIB 4Q5VA 1BIZA 1VSIA 4F12A 4IFVA 5DLEA 3T8YA 1UA1A 3ROFA 3QINA 2O4IA 1IH7A 4MR8A 1JBEA 1CYEA 2WMYA 5JNTA 3K4HA 3EJWA 2HHSA 4HUGA 5KQLA 1S1VA 2R7YA 4FYDA 4MRMB 3LZJA 3OLZA 3AO2A 1WSIA 5D3GA 2FC0A 2P5GA 3DLBA 4KV8A 4DTRA 3TAGA 3L49A 1D9FA 3WNGA 4Q0BA 3NGIA 3O21A 4RK4A 2XY6A 3EULA 3G85A 2Q5CA 4G0QA 2Z1HA 2HQBA 4CGIA 1YK0A 1Z18A 3HM9A 2YNHA 4KTQA 3FFWA 3KSMA 3KLFA 2JGUA 1GUBA 2DRIA 3RMAA 3H5VA 3KD1E 3LP3A 5KQMA 4QICA 4G0YA 1KRWA 2HQOA 5KGWA 5HRNA 4ZHRA 3SI6A 1S6PA 4CEOA 4DU1A 2VG6A 1MB3A 1KVAA 1JLAA 2YV0X 1L5YA 4HNQA 2RF2A 4O5BA 1KRXA 2FN8A 2HQRA 5ABPA 3SM9A 4CEEA 3VQ5A 4M42A 5KC9A 4PICA 5KTQA 3NHMA 4K8XA 5TQ2A 2FEPA 2HHWA 4W5RA 3PX0A 1GCGA 5FWYB 4CK2A 3S99A 3HEBA 1SXGA 4FLWA 4M3UA 1OXBB 2HHUA 5CNMA 1BGXT 3K57A 1T8EA 1WLJA 4FE7A 3D0PA 3KG2A 4QCLA 4DTUA 3QK7A 3RMCA 4Z4HA 1Z25A 3SUPA 2FLWA 4CEFA 3FFTA 4FM2A 1VRTA 4Y9TA 1DG9A 1JXEA 3LUDA 1A5WA 4I7FA 2RJOA
chains in the Genus database with same CATH superfamily
2HX1A 3IDFA 3B1XA 5KYXB 2VBFA 3OF2A 1KQNA 2L19A 4H0VB 3NUZA 4I5FA 3NB0A 4RGYA 1VG1A 3K9BA 2XV1A 3IKJA 3QBWA 1O57A 3GDQA 1XXLA 3HZOA 5E95A 4DKXA 4BR4A 2RPIA 1X80B 1HBJA 1V8DA 2GBGA 2J3QA 2RI0A 1HPMA 3D4PA 1XNJA 2IEZA 2E85A 1KRPA 2JGJA 1Q16A 2V59A 4IFIA 4JEMA 4W99A 1YQXA 4PYLA 2XOKA 4IUCS 1LJUA 3K16A 3M6VA 2SBTA 2WC1A 3WGYA 3QU7A 4BGEA 4BQOA 3DWIA 4OGGA 3FKJA 1YQUA 5J1EA 1Y6GA 5GIPE 3DEIA 2V3CC 2R6DA 3WA7A 2QL7A 3DBLB 1Y1RA 4NMWA 4DG1A 3GB9A 4H0CA 1UZNA 4B8YA 2VDPB 3GRAA 1KZHA 1GDTA 3C6YA 1YJ8A 1FP2A 3PYXA 3K0EA 3O84A 1A04A 4EY7A 2E89A 3I3SR 4QDUA 5E8RA 2B6NA 4D4KA 1CPYA 3E0QA 1E99A 3H5WA 1ABFA 4DB3A 1U8ZA 3R2JA 4Q4HB 1U0HC 2GEDA 2MU1A 3LU1A 4Q93A 3TWHA 3K6JA 4QWWA 3UJBA 4C0QC 4MRSA 2Y0EA 4OOEA 4QRIA 1N32B 4AJNA 5KMGA 1KAYA 5TB5A 3BFKA 1IEWA 5HX7A 4F1KA 3T9EA 1NONA 2VDNB 2XYPA 4O2AF 4FCCA 3S3TA 3A1NA 1XJCA 2H59A 1QZZA 3BRCA 3D8SA 2ODNA 3C1UA 3E5NA 3ETJA 1ODFA 3R0XA 2EZUA 4NJMA 1MQ9A 2R1VB 4KBOA 3CCFA 4J3NA 2VJKA 1G8FA 1EUDA 1N7JA 1JDPA 5HRSA 3E3LA 3J7ZO 2VPQA 1TK9A 1KH2A 2HNBA 4YRSA 2Q29A 3FHLA 4MUGA 2E4YA 5A3VA 1K75A 4U2EA 4FIDA 2J30A 3IR5A 1E5VA 1EI9A 2UXCK 4HVTA 1AKWA 2GARA 3FYCA 4R5PA 1N9GA 3D8TA 2PLRA 4FSHA 2XVMA 3C95A 1CJSA 2VHVA 1NP7A 1PI3A 3QEWA 3WJ1A 1WOQA 1RT7A 3PO4A 1AMOA 2J08A 4IF4A 3B8HA 3RH0A 4IBNA 3KFLA 1G3MA 1CJTC 1WZUA 4WIAA 4KQGA 3SEQA 5BV2P 1XZAA 1YB4A 3OEED 3CQXA 4AHSA 5AQGA 3ABOB 3AR4A 4PZYA 3UMJA 3TDNA 1Y64A 2X3UA 3ZWVA 1O94D 3I45A 3U4MA 5A0VA 5KRTA 2J3HA 4FYPA 2PZJA 1K97A 3RUCA 2V6IA 4MIYA 4RVOA 4D0SA 2CLCX 3TNFA 2DU8A 2CHEA 3BF8A 1LJ8A 5GOTA 3KR1A 1GADO 3GH1A 3SAFA 3IJPA 4U7HA 3RK0A 2FBTA 3RQSA 5L53A 3EIWA 4BX2A 1NSYA 1E60A 3CLHA 2A57A 3DBHA 3A5OC 4LG1A 2VF4X 3GFGA 3GN2A 3RVOA 3MTGA 3EWAA 1PNOA 3ESDA 4B83A 3U4IA 2QSJA 1Z16A 4AJIA 4W5TA 5CYMA 1O3YA 1KRHA 6CHYA 1QDEA 4ZK6A 4WKGA 4CJLA 3OZIA 3EN9A 5BR8K 3ENNA 2G67A 5FOXA 2JFBA 1UT6A 1FDIA 1G2PA 2NTVA 2XVZA 3R74A 4BZPA 3RFFA 1S8NA 1WB5A 3SC2A 4D57A 2XUJA 2PKCA 3ICVA 4FLUA 4KWCA 1OPXA 2FOXA 2JEOA 4R4JA 5JNUA 2G8UA 1RYDA 1ZQ9A 3QE9Y 2V5UA 2YWGA 4DABA 1VQ6N 1DDIA 1E18A 3AHHA 5KUTA 5EJ7A 5JZMA 3FLAA 3QB0A 3GVCA 3MJSA 4H0FA 1SVLA 3U7IA 3SEFA 4YRZA 2WM9B 3KQYA 1T4CB 2Q8NA 4CDNA 3W6OA 2JLRA 2QNRA 3T9CA 3W5SA 1XCGB 5CM2Z 3WZMA 1PT7A 5EZ6B 3UXYA 3E5HA 5IXYA 5IM4F 3DZIA 1DAEA 1ZI6A 4CLOB 2Y93A 1L5FA 3DQQA 3H0CA 5TE9A 1X3NA 3REOA 5MFZA 1HE5A 3GHHA 4EUHA 3ICPA 3NFAA 2H8GA 1BYIA 1DRUA 3F1LA 2Y27A 4K6CA 4J43A 4OHRA 5FWDA 2C5BA 4FWBA 4LBYA 1DQZA 4O25A 2Y1GA 4YRNA 2QRVB 2R6HA 4AZSA 4DUZB 1ZH4A 1WB6A 2NTNA 3FZYA 4HNTA 3ITNA 2KE5A 2GS9A 3GFBA 3IC5A 3PRJA 2GM5A 4FCWA 3STHA 2X6NA 3A27A 4BFWA 4BN0A 3NOQA 1Z5GA 4BO8A 3BSSA 2ZR7A 2WF7A 3CW9A 1ZBSA 3ORQA 1KI7A 1UANA 2GNAA 1H4QA 5E1BA 4U7JA 1TJ3A 4R2LA 4B48A 3SKXA 3WNZA 5ALTA 3OMWA 4RMGA 4CLRB 4B33A 1QK5A 4OP1A 4XR9A 4W6ZA 5EWLB 1XDZA 4AJEA 4BACA 4OJRA 1PT5A 2CHUA 4A5BA 4JJFA 2C0QA 1DC4A 1FFXA 2GF2A 2BDPA 3B48A 1GLBG 1DEJA 3LVQE 3VI4B 1EEHA 4MDEA 4DW8A 3K2PA 1BX0A 3KWFA 2DY4A 4PO9A 1NW6A 5DEIA 5LZ8A 4AY5A 2VUSA 2EQ5A 1RZRD 1F06A 2OFOA 2Y1LA 3AR5A 2GEMA 3VYVA 2HZ7A 1NVDA 1K3TA 2PZ8A 2XRFA 2PZGA 2ZIZA 4M0KA 4W1RA 3T1VA 1HQEA 4PWYA 2Z2IA 1JS1X 4DBVO 2ZJ8A 3CTMA 1FVXA 1Y1LA 3MCVA 1ZA2A 3CA8A 3WSWA 5KNBD 3RFUA 3A3OA 4GBJA 4I4CA 2QVGA 4CM1A 4Z7JA 4NCAA 3A2MA 4YY3K 3NFRA 3ZU3A 4O8UA 3HLKA 3AA3A 2WICA 1KCFA 5JCPA 3JD1A 4G0MA 2JIDA 4BRCA 3CCMN 3L5KA 1F8GA 3VQ6A 1KTQA 1LOTB 1S3GA 4HGRA 4HNSA 4JHLA 5EGNA 1HLGA 3RBXA 2V6JA 3JAMA 2DTDA 3OQBA 1X94A 4EJ6A 3A3PA 4KIJA 4RCYA 2YWXA 3OYCA 5TPZD 5I9LA 2PUTA 2J31A 1WMFA 1CUVA 4KP7A 2YHWA 5KWVA 1LF5A 3I4CA 4HUEA 1TL7C 1R6BX 3ZCMA 4GX2A 2JAOA 3BK2A 4GEKA 4Q02A 4EQZA 5HQTA 2J4CA 2QI2A 3NHPA 1GOTA 1XN1A 4IQ0A 1TYBE 4JLVA 5AKEA 3UIEA 4D99A 3SC3A 2WC9A 1G9SA 4L5YA 3U3JA 3MN1A 2E9SA 4TTPA 4DCGA 2P9QA 3E70C 4UD2A 5AK5A 4OKEA 2VWBA 1RWOA 2YWFA 1M8GA 1JCEA 1UBGA 3SHQA 1ZVMA 3AVYA 2XDQB 3QFRA 4JVSB 4BFXA 5DM4A 3HT3A 2XRIA 1Y4UA 2FH5B 4LDZA 4KRGA 3ZHCA 1OGIA 2V4ZA 4U2FA 1SXJD 5DGDA 1EBFA 1TW2A 4J2OA 2G6BA 1Y9AA 2R7LA 2FSPA 2H1CA 1PR5A 4HQRA 4Y30A 3QBEA 5BYJA 2RGCA 1VSQA 4HMPA 1UJ5A 5CM9C 1RPNA 4KQ6A 4C88A 5FRMA 2NPOA 2IZZA 2W71A 2QL9A 1U8AA 4RKWA 3OWHA 3PF8A 4J7AA 3LWLA 1Z2OX 2FPKA 2HCBA 1DT5A 3PV0A 4OK3A 3RVMA 3SBDA 4OXRA 1U2DC 3FUCA 4XYGA 3TI9A 4EBBA 1RILA 3FUTA 3SIXA 1N34B 1O03A 2AJQA 3C7CB 2PAFA 3FTQA 1XU9A 4MQLA 1WULS 3X1DA 4LY6A 4B85A 1Z15A 1N1MA 1DWPA 3ETNA 4XRGA 1FXSA 1DAHA 1XXHA 1X2EA 1YQGA 2CXHA 3ITKA 4TS9A 3ZBQA 3KEOA 3TTSA 1Y8RB 1Z6GA 2ZBGA 3ZE6A 3A2FA 3PE6A 5JQGA 4CM3A 4PEVA 3AJDA 3QBJA 1D2AA 3OM1A 4EFDA 3ENWA 3SMVA 2BLLA 4ABYA 1BCOA 1J21A 3MA0A 3Q3GE 3CSDA 4YJHA 4CHGA 1SV5A 3CBGA 3KUKA 3ONWA 4M9CA 4LX8A 4NC9A 3UMGA 2MT9A 2OG1A 2QUHA 3PLNA 4BJ6A 4CR8A 4PYRA 3IEVA 1XHLA 3RW9A 1EXMA 3U4QB 3K09A 4WE3A 3OJUA 1N2XA 2BPOA 5B57C 1L5QA 5JS6A 1XZNA 2VSQA 2AX3A 4ALLA 3D4IA 1IWBB 1XRJA 1Y5RA 1EG2A 3D7KA 4NU6A 1SHZA 2JZCA 3B9QA 2HJGA 3OPNA 4JZYA 4EO9A 3FFIA 1RADA 3U7GA 5AQTA 3FCSB 3K70D 4KIWA 4UARA 2WD8A 4R0MA 2GBZA 2EL9A 1HRDA 4MITA 3ZV3A 1N34K 4DILA 3GHYA 4Q00A 3D4BA 1MXHA 3GD7A 2G17A 3OJWA 4MZDA 3IEIA 3U49A 5DYYA 2EIHA 3DNMA 4IDFA 3ZH9B 3L3BA 3B6PA 1Q0SA 3NJ4A 2GHQA 5E0OA 1L3IA 2EJUA 2FA9A 3KHSA 4FBMA 3SXUB 3WNCA 4OD0A 1MABB 2D7CA 2JCVA 3C48A 3TBFA 3WLTA 4V2UA 4OP3A 3EW7A 3U8XA 2B20A 3QQPA 3I32A 3CUYA 1DQRA 1J9ZA 1FC0A 1PK7A 1LK7A 4V0KA 3MCWA 4Y98A 4KW7A 3OOSA 2GKSA 2Y3IA 1NOIA 3E8SA 3TRHA 2BUBA 2JRLA 3S70A 1GNSA 2I1LA 3ZI4A 3Q8KA 3MELA 4Y2JA 3N7AA 5M1NA 1UDRA 4G5YA 2RG7A 3DJYA 4ZYZA 1WY7A 1EK1A 3FPAA 4UTPA 1EVKA 2CLLB 4I6MA 4FZXC 1YZYA 3R3UA 4DZTA 2P2SA 3A1SA 4JI6K 1NBEA 2V65A 3WBJA 4G1QA 2KBFA 3K5NA 1KFDA 5F2NA 2X5JO 4F4JA 3AIOA 1VQ4N 2H1FA 4DCHA 4GMXA 4HSGA 4MA4A 2VZLA 2G3YA 3JQBC 1MNQA 5AKLA 2MSCB 2IDJA 3ENOA 4I5EA 1RCUA 4H4OA 3PPWA 1KC8O 1IEVA 3CT6A 4MV6A 4WJLA 2QN3A 4LHWA 1JEYB 2FZEA 1WV1A 2VGMA 3LSYA 3HM8A 2VXBA 3HDJA 3RBAA 2IZ5A 3KZNA 5KPJA 2Z43A 3I8SA 1T4DA 5L4LA 2XDWA 5EWMA 4ER5A 1Z5PA 1TKXA 3MYYA 1QV6A 5BPMA 3G0OA 1L5NA 4CYMA 3ND7A 4HZUA 3RIXA 4DV6B 4I2PA 4C89A 2BBWA 2CNDA 2NTYC 3QWFA 4YUYA 1NGHA 1WAJA 1W4ZA 3GEPA 4LY3A 5EHGA 4LMBA 3PZRA 5CEEA 3I6MA 3E4CA 5K3DA 4JR0A 3WKCA 4JLNA 4DR6B 1TKZA 2GX6A 3IR7A 2TMGA 2DM6A 3ZCQA 4YN3A 3F4LA 5BORA 4ZTZB 4A82A 1FW6A 3SLCA 1U9YA 2CGJA 2IODA 3VA3A 3DEHA 2NVUB 3KLEA 2ZBPA 1ZVQA 2BGRA 2P8SA 2Q1SA 2H2IA 4MMYB 2X0KA 5EKXA 2OENG 5HCIA 3AXSA 1TL3A 4WXRA 4AO7A 3P38A 5E6UA 3NXKA 3LUGA 4RZ2A 5LC1A 2AR0A 3I1YA 4RXTA 1E2UA 1K1EA 3UJNA 2CXNA 5LQDA 3KTAB 1XTBA 5DTEA 5K01A 4OJTA 3P0EA 1C9JA 4G0OA 4JN6B 1FLNA 4O2LA 2QP3A 4ARBA 4N12A 4B0OA 1QTNA 3KTQA 4FLVA 1JG6A 3FDJA 4ZYXA 3VC2A 5L4SA 2NUPB 4M3WA 2WTMA 1C1DB 4D3YA 2OCBA 2PRIA 1YXMA 3CVJA 4B3TK 3AL0C 1JMVA 1OX6A 1XRPA 2JD2A 3N2YA 4URWR 4B0PA 4F3NA 4MYSA 1KFKB 5K0ZA 3ID6C 3ULEB 4ZTBA 1QMGA 1KLMA 2J45A 1YQQA 3ZJVA 2WHRA 3PJFA 2G8FA 4Y6OA 4XFKA 4EYSA 1CUEA 3BCRA 3CZ4A 1PQ4A 3EQ9A 4Y9SA 4LCEA 4DLYA 2HCFA 1N77A 3N2KB 1S3IA 3CH5A 3MUOA 4B75A 4EB0A 4GM4A 4BVKA 5C5DA 2CVFA 3AW8A 3H4IA 5CVJA 3RYHA 4N7JA 4IDHA 4W5OA 1XTVA 3FSRA 3FW1A 3ORFA 2PSHA 1RWPA 1H05A 3QEBZ 3NEAA 1D2RA 2I76A 3KT6A 2ZTLA 3OJOA 3OT4A 2XRYA 1YZVA 1W2WB 2AG5A 4LBZA 5FJJA 4CL2A 3VVBA 5ITZB 3VKFA 3X0DA 4Z7QB 4KMRA 3ZSXA 2C98A 2NG1A 4J9VA 2MSEB 4Q7JB 5HG0A 1SC9A 1MJNA 4MVJP 4P2GA 5FV4A 1PTJA 4JI8B 3RROA 2QPTA 4JB0A 5DASA 5JMPA 3LZ6A 1T24A 4I1PA 3KOOA 4OX9K 1IG0A 3T3OA 2P6OA 3HBFA 4CFZA 4S2UA 1XNRB 2XITA 2M6KA 4ELTA 1USGA 1WEKA 2VF7A 4I3FA 4BO6A 2XUIA 1JIXA 2Z5GA 4ZZ1A 1FXWA 3ATVA 3GX1A 4LZOA 1AKVA 1YRWA 4P54A 4PQEA 3LNCA 4UBNA 3RPEA 4DTIA 3ST7A 3SJUA 1P9LA 3RF7A 5AVOA 5FL3A 1QUEA 4J0FA 1MGOA 1NUUA 1T9GS 4KV7A 1P3DA 1WKBA 4BZWA 5A3RA 4XCXA 4CG0A 1WTAA 1Y3HA 1ZBDA 3CM6A 2JHPA 2WZCA 1U8TA 1U3FA 4HYYA 4BNUA 3F98A 4CM5A 4M7PA 4F11A 2ZPTX 1LLCA 3NWBA 2NYVA 3K1JA 4KVAA 2ITMA 1RAHA 1HGXA 3VX4A 4GE3A 1YUBA 2E7ZA 4EW2A 3DW1X 3GVXA 3OYMA 4AURA 4PIPA 3I9FA 4OL9A 2BCJQ 4U6NA 1RJFA 2FOLA 3JQ6A 1Q0QA 1SULA 3NHFA 2QVYX 4NENA 4BUCA 2HFKA 4KAAA 4AB1A 1ONPA 1V8OA 2E1RA 2GAJA 2OPPA 5AR0A 3L7IA 3IQFA 2IOFK 4ZQIA 4KR9A 1ZJ5A 4QT4A 1AA6A 1QP4A 1KPGA 2Z2KA 2GBCA 3OCCA 3HHPA 3SC4A 5HIJA 4EH1A 1MGPA 4FFDA 4EG5A 4KTZA 4EUFA 5L8VA 1FK9A 4CRWB 2I2WA 2PUDA 1ZONA 2FP4B 3QEPA 5J2UF 3QA3E 4GY2B 3IQIX 3E01A 4KLCA 4PFSA 4GI5A 2REXB 1XAGA 3E7FA 3QE2A 3WLJA 1YR8A 3KZMA 4X20B 5IULC 4DBLE 5JADA 3DV2A 1KHHA 3H5IA 3O4FA 4X7MA 1LJLA 5DHAA 3RVJA 3HY3A 4X61A 5CIWA 4W7HA 1Q3TA 2GZDA 1YC2A 2WOJA 4JLBA 3M3DA 3USZA 3BTOA 5C3UA 1Q0LA 5ECGC 4DUZK 1PJBA 2VYQA 3CUSA 4GXTA 3RRFA 3QDKA 1NW9B 2XUOA 4OQPA 1W35A 4R16A 4OV6B 5JFOA 3LZIA 1NVKA 2UZ4A 1PEKE 2QYOA 4FZ5A 3ZT0A 1BO6A 3IA2A 4QBTA 4B9QA 1JLSA 3WBFA 3PUZA 4BQFA 2OQVA 1P1HA 2ZGVA 4WT7A 1TJ4A 2P30A 1CF9A 4PO1A 2Y1FA 2WB4A 1PR4A 3UWDA 3I52A 8LDHA 3O83A 1C1XB 2OL4A 3HYRA 4RIEA 4YY3B 1TF2A 4OM8A 3VQ8A 1YQ9A 2JDID 3GNQA 4GBGA 3GPIA 4NYIR 2E2WA 3PEUA 4ACBA 4G1VA 1EFUA 4F06A 1Q7CA 1JKMA 1TM5E 3EUAA 4NIMA 1ZS9A 3L04A 1TRHA 2ZYIA 4JLHA 3MJFA 3SNHA 4JJ8A 3BRQA 3QJGA 2XZLA 5DCWA 1PYGA 1FF9A 5HF6A 4B82A 4CJVA 4W9NA 1H69A 4ZVRA 5B58C 3I8OA 1AGPA 3AKZA 4EZEA 4ZYYA 5H8WA 1CVLA 1ZM4A 3M4NA 2ZJYA 2I22A 4O4LF 1K27A 3KBBA 4D56A 2XCLA 4FZYA 4FGUA 4NDZA 4UU1A 4HGZA 3GMIA 1WBJB 4MO9A 2W8ZA 3PLAE 1Z34A 4U5XA 3O91A 4UUMA 1U31A 3OJFA 1D2CA 1H1VA 1LSJA 5LR6A 1KWGA 1NU6A 4FSDA 1D6NA 2P9IA 1WX1A 3A04A 3PIIA 4EAAA 3SVZA 2FPOA 1N4DA 2CL7X 2CLMB 2H5JA 1A27A 4AK9A 3WXKA 4MQEA 1E5TA 1LPBB 4DV0K 2ZCVA 4O4HB 4IOMA 3ZBPA 5AD1A 4B76A 2IU4A 4D4MA 1OV6A 5LWQA 1Z22A 3SQ0A 1HYSA 1YIJN 1X7YB 1ZMBA 3H5TA 2ANBA 4H1HA 4JKYA 4YMHA 3KV3O 3OQ1A 5IF3A 3GLIE 3ZDDA 1W75A 4M0PA 4PHHA 2GRJA 3HJRA 2IPAB 3ISJA 3UUEA 2A9JA 2AUNA 2XQVA 5F64A 1UBTS 4CIXA 1K7SN 3I5UA 1OYVA 3PQ6A 4M49A 1F6BA 5GTDA 2C58A 1QCDA 2XB9A 1XZFA 4O1MA 5JAHA 5TMPA 1LS6A 5JG7A 3VQEA 5DBFA 1HKCA 2QB5A 4HLDA 4A2CA 1CY1A 4L3QA 3OYJA 1DB3A 1C7ZA 3FJOA 3QY0A 3L6OO 3J80A 4M3NA 1HDOA 1YCFA 2X3FA 2D1KA 4F93B 1JEQB 3O9SA 2PUJA 2KFZA 3L8HA 4X6YA 4JJEA 4XGKA 3KXDA 1KMHB 1L8XA 1Q8IA 3WNFA 1URPA 1H66A 1WXIA 2GBPA 2RH5A 1IPHA 3F0TA 3OU7A 1O7JA 1LBEA 3H4TA 2N46A 4JS0A 4NBUA 1Y4DE 2BFOA 3EH1A 5AFUA 4NYMR 3RKRA 5EE9A 1OVMA 4BN5A 2YKNA 4FWLA 3MW8A 3X44A 2PRSA 4Z9BA 2X6TA 2NQ8A 3MUEA 1PV4A 5DK5A 4EHKA 2NAFA 4G25A 1G7CA 1JQEA 2RH4A 3QELB 4Y2XA 4M41A 4F9TA 7MDHA 4KO8A 5DFAA 1C7RA 2D5IA 5H16A 1IBCA 2XGOA 2I65A 1YJWN 3QVOA 2X5NA 3RC2A 2DFKB 4WKNA 4MQ6A 3ZU5A 4LYGA 3L18A 3WWOA 1T3TA 5AQNA 4YIKA 4HWPA 3L6RA 1P2FA 2WHXA 3NC4A 2ZITA 3PQFA 4EMUA 2I91A 2KQ2A 1RI1A 2FSVA 3QHAA 3V8MA 1DC8A 2CMDA 1TYZA 4UHDA 3GCDA 5HKKA 2XADA 4WNAA 3QM1A 1N36K 1IY9A 3SAHA 1MC8A 1Q91A 1W59A 1RTJA 1CIJA 3CNQS 3KJHA 4P32A 3VYUB 4B84A 4DIEA 2ZI5A 1J49A 2R1TB 2FEXA 3DCYA 3TR8A 1OFTA 3IILA 1I01A 2B99A 2YX1A 5DXAA 3SIRA 2JI9A 1BUPA 3IT2A 5LZ9A 2AVDA 2O1WA 2OC9A 3P94A 3ZWDA 1PFVA 1V45E 4ZHQA 2ZJZA 3QVGA 3CU5A 1NN5A 4LE2A 4LF9B 4Y0WA 1NGJA 4M6WB 4Y6PA 4X65K 1JKFA 2HSDA 1GQFA 2PL1A 3MIZA 1ODCA 3K1ZA 4GI1A 1MAUA 1D7AA 4BV8A 2IYXA 2D4HA 1P6UA 4RHXA 2XD4A 3AG6A 4YDUC 3N2LA 3R5FA 4YRRA 4BJ1A 1K2WA 5CEFA 1NU0A 3MWTA 3P1GA 1G5HA 3COYA 1X0VA 1XOIA 2FW0A 1OLXB 1ZH2A 1ICEA 1FMJA 3KCNA 4MI6A 1C1BA 5FWXA 1CUIA 2HPAA 4H60A 3VSCA 3O2NA 4HWSA 4LYYA 3S9HA 3IB3A 2CXTA 2NUAA 4REQB 2QDKA 4A16A 3FTPA 3UJHA 4EJ2A 3W1EA 2GPAA 4ZOQI 1CZAN 2ODAA 1W87A 2HW3A 3VQTA 3DQZA 3GJ5A 4BE2A 2E1YA 2VF5X 2BV3A 2F17A 2PH3A 5CD9A 4JGIA 3SZ2A 2QM8A 2ZSBA 4LNUA 1VMAA 1KK2A 2FUKA 2OECA 5JWHA 1P8JA 3WGHA 4BGUA 1L5RA 2F00A 10MHA 1KQPA 2G83A 4A0QA 2HSWA 4MKZA 2P3OA 4OU4A 4DMUB 4XA8A 3JQAB 3C43A 3RADC 3DPUA 2B92A 2Q27A 2GYYA 3P2YA 4OU5A 3AIMA 1I7SB 4UD6A 4XQ0A 1YXQA 1DT3A 3OZWA 5T4FA 5JHHB 1WMSA 1FYWA 2H1VA 4HFRA 3UYLA 1QE5A 3RYIA 3PVSA 5M7EA 1DWQA 2CDAA 1UPAA 1XMPA 3HWRA 4XQCA 5E2BA 1UAAA 1WETA 2GM4A 4HNAA 4WXHA 3G2QA 2C78A 1MAVA 3AZPA 2ZRLA 3FPHA 1CKEA 3LBIA 4H7FA 4IVPA 2IY7A 3I53A 4OMCA 1PHPA 2XF8A 4JUFA 4TYPA 5EI5A 1G1AA 5GVSA 3EYZA 3EUWA 4NX2A 3FSJX 2XDAA 3LKZA 1SOUA 4HAYA 3DV9A 3VR6D 1L3CA 4FS3A 4LYHA 2YN0A 2CJWB 5ALFA 3KLHA 3A5LC 1J8DA 1V6AA 2DWQA 5HPYB 3DLLL 5A7HA 5CHIA 4H7IA 3PDCA 4BX9A 1TNDA 2VNSA 3PA8A 3CWQA 3MTEA 1I13A 1NN3A 4U1RA 2WSLA 2NZUG 2V97A 3K5WA 1QGAA 2OK8A 2HRBA 4KOAA 1OV4A 4MJ7A 4KFSA 4ED9A 2Q8PA 2VG5A 4DT1B 2J7KA 5IT5A 4ZVLA 5EIHA 5J2TA 2HM7A 2Q3JA 2UYTA 3FZHA 4JUBA 2X77A 5CRIA 5TPWB 1KO7A 1BEZA 5DGIA 5BSGA 1EWVA 4LXHA 5MHTA 4DV6K 1RYBA 2H92A 2YKMA 3C6UA 5KJ1A 2OA0A 3ICCA 4YALA 5EWLA 1JFFB 3GEMA 4LCJA 4XOIA 4C87A 3ACDA 4CKEA 3A8YA 2MSDB 1R8JA 2ZAMA 3HRKA 3OP1A 2DE0X 1NNEA 4HFJA 4OSPA 4Q7KA 3MS4A 1RWKA 5C18A 4DTPA 3BF3A 4ID5A 5AQLA 1DWUA 3ZSVA 1OXSC 3AQIA 3D6VA 2CFCA 3O1HB 3QE0A 1VKOA 1SCUA 2E5FA 1Y9JA 5JE8A 4D82A 4DSUA 5JTUA 4CF0A 1P1CA 2BR3A 3ACBA 4UU8A 4P5EA 3GLHB 3WR5A 4YIHA 5C9ZA 1VM6A 1CJCA 2AYXA 4TQUS 2OHJA 2Y71A 1A98A 3JAWB 4XM0A 5KKCA 2QI9F 3DMPA 1Q1ZA 1TYQA 4FFBA 3ZHQA 3L3VA 1S1WA 5LMNK 4LF4K 2YJ6A 3D3WB 3ET4A 4J0JA 4R1PA 1ITZA 3BWDD 4NQRA 2ZM6B 3ROPA 4ZVUA 2F3UA 3UV6A 4TMFA 3VOBA 4KYUA 4P86A 4EYEA 3FBWA 1HR0K 2HHCA 3HZZA 5IXJA 4F8YA 3THYB 1QFZA 4ZO7A 1QQMA 4KN9S 3OF3A 1BA2A 4NOLA 1DUVG 3WOHA 1RDFA 1Y33E 2IOHA 4Q7LA 2HBQA 1O0SA 4B3TB 4CLHA 3TSYA 1XLTA 2ZJ6A 2YHAA 5FFMA 1KJQA 2QHXA 4LPKA 5TC4A 3UT5A 1XU7A 1AQ6A 2HCJB 1ULTA 1IN7A 1IUOA 4CERA 1IN4A 2J09A 1DEXA 1NVVQ 4C5AA 4E11A 3T1HK 3OKFA 4TT3D 1OF1A 5B1IA 4PXAA 3W2GA 3EXHB 5L45A 3Q9NA 2X8BA 3OFKA 1XPUA 3V1UA 3O3OB 3DXZA 3UOGA 4Z49A 1K92A 1WKCA 4MZXA 3T41A 1PX0A 1SKAA 1PDVA 2PDAA 4TTIA 5LQMA 4UMEA 1W93A 4EG1A 3VPGA 1CJKC 2R86A 1PZFA 3DPIA 5BVHA 5CM8B 4LFAB 3UB4A 1L0BA 4O4JA 1BOTO 3LLCA 1Z8FA 3N8GA 4CGFA 3AG5A 4LF7K 4KV9A 1YBVA 4H0NA 1LB1B 1TKTA 1CZLA 5I7EA 3L2UA 3RASA 2J3KA 1SQ5A 2MSNA 4KR3A 3ITHA 3N0WA 3CW8X 3SOZA 4PAOA 3PQ7A 1GZUA 2R6JA 3HDHA 3Q7TA 3QFUA 1NKEA 1ZBIA 3JD3A 1XHXA 4R9SA 5AQPA 1RHUA 2V5VA 2W6NA 2Y1EA 3TLCA 2MINA 3ZDCA 3ZY2A 4DLPA 3TIFA 1T6ZA 2KHOA 1KEUA 2YVKA 4OO1J 1OW3B 2MJLA 3AYXB 3BHMA 4TV9F 1JMYA 1V8BA 2I29A 4YUAA 3QPAA 3DLPX 1GPKA 4ZP1A 5C80A 4N3CA 1A7JA 3GFRA 5KYNA 1Z9BA 1MO3A 4D5EA 1AGXA 4BVEA 1JEOA 3MCPA 1U9IC 1V26A 2X86A 3LP5A 4PVCA 4GPAA 3T38A 4R0NA 4YONB 4IIVA 3T54A 4DJDC 2Q5EA 3TMYA 4O0IA 1ULAA 2GM3A 4BIMA 2A92A 2JBAB 4P35A 1Y89A 4TKVB 1Y3FE 4BAUA 4P4NA 1PR1A 5FPSA 3UK0A 2TS1A 4M1YA 4ZK2A 4Y18A 4LFAK 1MDUB 2B5JA 4KLRA 3GFPA 1DC7A 4NKRA 4TV8F 3X1WA 4DB4A 2WUFA 3FOWA 3N3AC 2RKWA 3CJCA 2VYVA 5ADXA 4FCYA 3B1KA 2EKBA 4Z5XA 3K0SA 2J5KA 1YJ9N 3DLTA 5I4IA 3RS7A 5AT1A 2Q5HA 4MS3B 4P7GA 3VU1A 4CM9D 3U6KA 3BMQB 2BHRA 5HF8A 2WTAA 4TPKA 4OXIA 3NXSA 1RPJA 5GJWC 4Z99A 3CNOA 3E66A 1K6MA 1IBSA 2ZLBA 3H99A 3KKPA 4P53A 3HKEB 3VHLB 1Z83A 2I8AA 3W7AA 4BVGA 2Z9CA 2ODQA 4LPSA 4MVJF 4BZQA 1W6RA 4AXBA 1KAOA 3EDMA 3EPLA 3PQEA 2QTZA 2VEDA 1LTHR 1OXKB 3B53X 1UPBA 5TS3A 3CVVA 2C5LA 5CUQA 5T57A 5KCMA 4C8LA 4DLLA 4QPNA 1UH5A 2V7XA 3CLKA 4Q19A 4U2CA 1U65A 2PQMA 5DLQC 4N56A 3TW8B 1I1NA 3VR4A 3C6MA 5JT1A 3TLMA 2X9VA 3Q0IA 3AVIA 4KWEA 1BL3A 3DS8A 4UUAA 1G1MA 1KQGA 3RYIB 4URUR 3UANA 4YPOA 1ZD2P 3TM5A 1MFZA 3KSZO 1HLPA 3DBLA 5K3AA 2B8EA 2V74B 3N8IA 3Q3JB 4BKPA 2ARKA 4D43A 5LQJA 4DRXB 3ZWBA 3CKYA 3F71A 4QO8A 4PXYA 2NZ2A 1RXYA 4GRIA 1XYYA 4EFKA 1ZD5A 3T7TA 2CXOA 2BKEA 2OV3A 3K35A 1I7QB 1V6CA 4IYJA 4LWOA 2UZ1A 1U5AA 1JPUA 2EV9A 3SYZA 1ISRA 1J0AA 1CE8A 1DWOA 3C7KA 3FOCA 3FZEA 3WGOA 3ZDZB 1U2VB 4I2NA 3C7NA 4WXMA 1D5AA 4JK9A 4ZDKA 4CIDA 2MSWA 3IP5A 2V45A 4N3NA 5A4IS 2P8JA 1TE2A 3SV3A 2CCGA 2WG1A 2XMPA 3DEKA 4D8YA 4Z0UA 4Y6GB 1SVMA 3QOFA 4U02A 4YUVA 4CM8A 5TGZA 5KDOA 3JXEA 1YACA 5EXEA 2HA0A 1AD2A 1IHPA 3KZ1E 4GBED 2ZBVA 3NDPA 3QLVC 4XVCA 1M67A 3QUCA 3K4PA 2QJTA 3O4RA 4Z4CA 3UJ7A 2MIIA 4QGHA 5AQFA 4RTRA 1A7KA 2E37A 3B1FA 1C81A 2GHTA 5FBQB 3LW8A 5BWOA 2P9LB 1KOFA 3VETA 1GQSA 4U67L 2VNAA 4HWGA 2P2ZA 4V0ME 2IPNA 1RBTA 4D8XA 2W58A 2DPMA 4P7JA 1OGYA 3K9WA 2P4EA 4PC7A 4PW0A 5D00A 3L4SO 2KKZA 1JQBA 2XCIA 3FUWA 3NIWA 4PHGA 1U8XX 4WLUA 4ZD6A 2ZXEA 4B3RB 2BKXA 1TO2E 1KIAA 2GAAA 3SS7X 2AYYA 2H52A 3DOUA 4DM4A 1RPZA 2VT7A 3ABSB 2Q9UA 2QBYA 1QTMA 5AM5A 1XMOB 4KIGA 1HPLA 1PUJA 3GNTA 2TMKA 1UDCA 4YJ2B 2H4ZA 1PG0A 1X7ZB 3I05A 3EOAI 1QKIA 4TTQA 4XSGA 2KJQA 4DPKA 4EI8A 2R85A 5H68A 3HKDB 5M34A 1Z0AA 1NJSA 4ZAWA 4KI7A 2JWLA 4TXLA 1BI4B 4RY2A 5DKFA 1QYRA 2GAIA 4FC7A 3WB0A 3GELA 1A5SB 4AUMA 2IC5A 1DKLA 2VUUA 4N5IX 4BTVA 1U3CA 5F3DA 1HPZA 5FP0A 1S9GA 1Q22A 3NIGB 2V6BA 1BMTA 1SQ6A 4HX5A 1XAJA 1X3SA 5AI4A 4PA1A 5D87A 1XHEA 3FYUB 1RZRA 3DT9A 4JNCA 5AQWA 2GYVA 2Q3BA 3BEXA 4YV7A 1YZUA 3T5GA 1D8TA 2HA5A 4QASA 2FFRA 2FSVC 2HA2A 1SCUB 4FHDA 4NBKA 3LQKA 1OBVA 4H6WA 1JDZA 2VGNA 4C6RA 2MSLA 3A9VA 3AERA 4GICA 1RLMA 2HD4A 3S81A 1M5UA 1TK3A 2V8OA 4FQ7A 3L0PA 2ZRPA 4P3YA 3WQTA 5EXWA 2NTJA 2VP0A 3EZXA 3H1AA 4FK4A 4Q1CA 4YC7A 4IDGA 2C04A 1QAOA 4ELUA 3QYFA 4CIWA 3GLHA 3W5CA 1BISA 2UUBB 2BVNA 5HHTA 4LD0A 3B3GA 4URFA 5EN4A 3VU8A 1P7PA 5AXBA 2GCNA 2UZ3A 1IQRA 4AN0A 3R9XB 1QU3A 4QVKA 2BTEA 3VQPA 1IJKA 2Q5JA 4LZWA 3KKRA 4RW6A 1Q1EA 1WUYA 2VOJA 4TGLA 1N36B 4DV5B 1X7YA 4PSAA 1HDGO 2X13A 3MT8A 3R6MA 3M49A 4GT1A 3LM8A 3QXHA 1FNSA 2CV1A 3QUAA 3R5XA 2JFPA 4WN3A 3R9IA 4QEKA 1FPMA 1AKQA 4CEJB 3EUFA 5FWYA 2NO5A 1Z6TA 5JXIA 2CXRA 1BXGB 4DV5K 2HHLA 3TKYA 3I0RA 2AE1A 2V3WA 1CDOA 3O8QB 3SGLA 1CS4C 3S8EA 2I7VA 4HRYA 3KUDA 3WX0A 1Z2NX 3UYKA 1QSYA 5JPIA 4CJRA 5JS7A 4HO1X 5CU7A 4DXAA 3EGCA 3KJVA 4AH9A 1KARA 1T43A 2P9FA 1G99A 3CPSA 4F84A 1F38A 1UXJA 1T8RA 3ZGYA 2VP9A 2UUBK 1KOJA 4E7KA 2B7CA 2CWWA 1D5WA 4TMZA 1XMXA 2NV6A 1GNVA 4MYDA 3SX0A 3ZE0B 3W3AH 4U8HA 3KJFA 1RWVA 4DA6A 3A9RA 2WFLA 3AR8A 5P21A 2Z1GA 1P1JA 2RHRA 1IQUA 4MDFA 3DVSX 1GLAG 5TVKA 3SLKA 2R68A 2C77A 1A88A 3SWWA 4C4XA 4L51A 1BIUA 2J5QA 3KD2A 1W0CA 1S6YA 2FE1A 2QPAA 1SCDA 3TE7A 3MXIA 1S4MA 5DJ5A 2Y67A 4HTFA 1KS2A 1NZFA 4BGDA 2OESA 2QTWB 4KBYA 1Q1BA 5CFRA 1Q0ZA 1MFPA 2O2HA 1B8VA 1AXRA 1KYQA 1I1QB 1YB2A 1YD7A 3K92A 6REQA 3DXKA 2IYNA 4ENUA 3HPGA 5BQ3A 1KEEB 3EPKA 1ZZEA 3W5HA 5C81A 3OCYA 4FPXA 3N9IA 4IUDS 4KQKA 4WVFA 2E2OA 4TMTA 4DIDA 4PF1A 4QGFA 3F7MA 1UK7A 1GLLO 2L0XA 2UZIR 4RPGA 3UT0A 2J9RA 1NXVA 5BN8A 1OTHA 1EWQA 1USUA 1YJNN 1XVLA 3W3ZB 1KEVA 3L2RA 3BFPA 3MNFA 2Z04A 1X86B 3O8OA 4O2AB 2QRMA 2FSFA 3M5PA 3MN7A 2C7OA 3HXTA 1NGCA 2AF3C 4RTLA 1NVTA 2FPGB 3H6HA 4L5IA 5AVRA 1EFHA 3DP7A 4R9NA 3KLIA 1VKJA 3FA2A 3OPQA 4D0NA 3W9UA 3PGVA 1OB5A 3QX7A 4PKGA 3AR3A 2I6QA 4NBVA 1GJRA 2XR1A 2P2NA 3O3MB 2FXIA 1PEDA 4FB5A 1FLDA 1GIAA 1GR1A 2C57A 5IXSA 1WQ4A 4OKIA 4TKMA 1NYQA 3OEHD 1AHHA 3K9NA 1VBKA 4DLZA 3A1WA 4PZZA 2QU8A 3M9XA 4FGJA 4MTCA 2IGTA 3PYMA 3FWKA 3DXMB 1QVGM 4U6SA 4E12A 3KVYA 2ON6A 2AZ4A 2F3RA 4BC1A 2K2WA 4D4LA 5ICMA 4F5DA 3MN6A 4D92A 1M2VB 4UCXA 1IZ9A 1P61B 5H3LA 4YP0A 4XYMA 5K3BA 4V0OA 3WLMA 1YA4A 2FVYA 3GDWA 2UVDA 4I55B 4CBXA 3PX2A 4X44A 1OX4A 3C16C 5C10A 1P1BA 2G1AA 2NW6A 1FQWA 1YZ3A 4HB3A 4I4TA 4I6GA 3SDSA 5BMVA 4TQGA 1DBVO 1Z6ZA 4JVLA 5DM1A 4BP1A 4S1VA 4CMHA 2AB0A 2CVOA 1K0FA 4MQUA 3JV7A 3PKIA 1K2VN 4L7VA 1TFUA 2BKVA 1VRVA 5TMDA 1E7SA 4FJ9A 4PAMA 2PQ6A 4OM7A 4PFKA 5JYDA 1ISPA 5FPQA 4O3FA 3SF8A 1EGAA 2VRCA 2JWKA 2FBVA 2BFCA 2BFDB 1I3AA 3O8LA 3AVHA 1PLJA 1PYDA 2X8LA 3PDWA 4B3JA 2WYVA 3DW3X 3G49A 4WW0A 2BCGY 4JT8A 5IS2A 3R1XA 4CD1A 3OQ6A 2WBNA 1FYXA 2B21A 4H77A 1HYGA 2FN7A 1QKJA 3E9ZA 4Z7OB 4JEPA 3C15C 3BEOA 2IZ0A 4URYR 1PDWA 4E70A 1X2BA 2JZNA 1K8YB 1I14A 3C8MA 3N2KA 4TYWA 2ZT8A 3ZXXA 3G0DA 4FK0A 3EAQA 5CAEA 2HUNA 3SFZA 4TKUB 4BRPA 1D2HA 2PLAA 2ATXA 2ODEA 1D0SA 1JJAA 2XKAA 4O4IF 4C0KA 2DLDA 2WDPA 4EOGA 3I4FA 3ZG6A 3I3OA 1CXUA 4MWOA 4GSKA 1GITA 4CEZA 3TEMA 3VYWA 1GDDA 3D31A 1J6ZA 5HLFA 1E5QA 2W2TA 3OE4A 4P34A 3WA6A 3OZGA 4FX2A 2PMCA 4XFDA 3W78A 1S0UA 3BH7A 1SIWA 2X2EA 3KWMA 3SBTA 1Q1QA 3CWZA 1Q7YO 5CVDA 4ITUA 3WL4A 3I9MA 3OJCA 3BJMA 1JMKC 4B40A 2Z5VA 4C20A 5BWLA 4ANFA 2CBGA 1YB6A 4LYDA 1BXKA 4YMLA 1GZ4A 1SU6A 4MR9B 1SL0A 3BHIA 4R05A 1PZXA 4K88A 4CU5A 4DPMA 1NOYA 2QF7A 2ZBRA 1GILA 1L9XA 2F4NA 2GK7A 3QF4B 4NI5A 4WOJA 2SHKA 3LUFA 1LK5A 1SKSA 1OHHD 3DLIA 1QVWA 4XIJA 1YDMA 2G8IA 1YR2A 2FWPA 1QCZA 5L7WA 2I1QA 2W6IA 4F4FA 4GL2A 1JQKA 4LIPD 3T4EA 3UO8B 3ZD6A 1QXSA 3C14C 2N1MA 2XB4A 2XNJA 4ID3A 3H5LA 1OFUX 2XZDA 4OREX 3CE9A 2Q3MA 1SD2A 1XL1A 2C4HA 1QG6A 1UIRA 1E6WA 2Q0XA 2RIRA 3O9VA 3WIVA 5JJCA 3W5BA 1K5DA 1EKXA 4DHYA 3L7LA 3IUPA 2UXBK 1GTG1 3TI0A 2J3IA 3FMGA 3AO4A 4J03A 4XGQA 5CPBA 3AGPA 1CF4A 2UYOA 4FI3F 4MW7A 2OOSA 2X6QA 4MYRA 1BXRA 3TW6A 4NXMK 5BVGA 1X3LA 3RU7A 2FPRA 3LBHA 1SIBE 4HPXB 1LZLA 3L1KA 5DZSA 5AW9A 1QLJA 5J58A 5KQMA 4K8ZA 3ESCA 2ZJPL 2NP7A 5TVGA 3OM8A 3R8FA 4G65A 1P6XA 4HRAA 1CZOA 2MYTA 5C8DA 2JGKA 2NO7A 2YY5A 1CEXA 3AWIA 1XRQA 1AA9A 1V3VA 4FDUA 3WIDA 3ZCPA 3GBPA 1RRFA 2IYAA 1XEWX 3P0FA 3FZLA 4C3ZA 3U3GA 3CGGA 4ERXA 5KU1A 1PLLA 3VF2A 4GRAA 4TN1A 4IIHA 2QGZA 4JLDA 1V1JA 3I5AA 2VPPA 4KVFA 4ZOLA 1DJMA 1YR9A 5DM70 3AONB 3UH1A 5DF1A 1N7HA 1YASA 1YIAA 3A9TA 5AXAA 4OX9B 2JVKA 3GR6A 4UM9B 3F6RA 1LRKA 2FQWA 1TVKB 3U3DA 1UOOA 3ODGA 1SHLA 1FJGK 3HXMA 1JE1A 4OQQA 4B6SA 4YAOA 4EHTA 2ECKA 3RRBA 1FKOA 2PD4A 5DOZA 4ZC1A 4WA8A 3X1ZA 5J23A 2ZJ1A 1RWBA 1F60A 3I9OA 3KPYA 2SKDA 4OBEA 2FG7C 2JI8A 2UYYA 2W2LA 4A73A 4ALKA 2GBFA 3O5BA 1QVFM 1ZQ1A 2HHJA 1Q0HA 4OJMX 3W5JA 1FUUA 1THTA 5DIZA 4IDNA 4ZAXA 3I9JA 3TDKA 2FPIA 2WD9A 3MT0A 3U0VA 1D4ZA 4PYJA 1X6VA 5AUOB 4NONA 1T9ZA 5AJVB 1GAJA 4Q4HA 4JLSA 2QX6A 4LDAA 4B6PA 3USCS 3C6XA 1KZ7B 1RC1A 3C5EA 4KAXA 2X0JA 4NEHB 4QPCA 4QXOA 1ABBA 2XQJA 4DSZA 1QP0A 1ORRA 4HWTA 3RAFC 2QXLA 3D4NA 3PD0A 4C6SA 1L5ZA 3JQ9A 1DO8A 1F48A 1NXWA 1U7DA 3L7NA 1ATNA 3LGAA 4QPDA 1NQVA 4I50B 3CEHA 1M0EA 2ZIFA 5BR4A 1OU4A 1K9SA 1VI2A 4OH1A 4IUBS 2FTKE 2R2AA 2ZB2A 3G23A 3QNNA 1TEHA 2NN3C 4QFCA 3Q7CA 4ZGWA 1RYFA 1IXYA 1RBYA 3MQFA 4BMCA 2KZZA 1PJRA 2BP7A 2QYTA 3A6ZA 4EELA 2PJRA 2E0IA 3ZQKA 2JGDB 3IRVA 2YNMA 2ONCA 3OEWA 4PY5A 1Q1GA 3HU3A 4RPLA 1DFGA 4YWHA 3OWXA 3TABA 2QL5A 2AJ8A 3QI2A 3V8VA 2OV6A 2V1XA 1KSHA 4AWBA 4BP9A 1MWKA 4K43A 2RONA 1NVWQ 2QJOA 4QJ5A 1TCAA 4EGSA 2P4HX 1JLMA 5BRFA 1A50B 1O6FA 5A1TA 5I3CA 2IS1A 1DX4A 1V9LA 1V3QE 2DKOA 3EFOA 4BP3A 1ZN7A 1KAHA 1ESDA 1QP8A 2ZWAA 4MW6A 5GMOA 4YRPA 4HEQA 4A9AA 1J8MF 3OT5A 1IOZA 2PBLA 4KHNA 2Q3DA 3QEXA 4BO4A 1LDEA 1TA0A 5CXSA 4JS4A 2L69A 4Z9YA 2PYDA 2Y68A 4YDSA 1DOZA 1F9EA 2ZB4A 4L74A 1WAFA 1XSEA 1JI3A 4BTLA 1DTWA 1M1UA 3R24A 1R10A 4Z94A 1GLDG 4CESA 2JIZD 1ISHA 1ISJA 1L7AA 2OUKA 4M38A 3ZH2A 3QFSA 5C35A 1VQLN 2PL5A 3AFGA 3I23A 3DYAA 5CA0F 5J47A 3K5MA 2QZSA 4FZVA 3MRXA 4MYHA 3M9WA 4R2IA 3ZE2B 4DFPA 3F7OA 5F52A 5G1NA 5IAKA 5CK4A 3SHWA 3NGLA 4DLAA 2R00A 5I8PA 5KYYA 4PIVA 1ZH8A 2QMZA 5IYZF 3OYIA 4IJ6A 3Q2KA 4CQMB 1IOLA 3HVRA 1QORA 1U8EA 3AF1A 3K6RA 1A5ZA 1GPDG 4XPZA 3U4QA 3B2QA 4RCHA 5AQQA 3ZVNA 2C82A 3H86A 4MHSA 2X58A 4ZQFA 4EA7A 3I2KA 4GDFA 4W8GA 1S1MA 2J9GA 1D9ZA 1O6GA 3OS1A 1QH8A 3KPUA 4FYMA 4F6LA 2OFPA 4S1OA 5K3EA 5B5SA 2WG2A 1M5RA 1V9CA 3QNUA 4NH0A 2IUEA 4QTZA 5UKDA 3AVKA 1Q84A 4C78A 3ZOZA 1YS6A 5C51B 2VHJA 4D7AA 1BH2A 4RDIA 3IBSA 4DAEA 2D7JA 2CUNA 1L4LA 3VMMA 4DQIA 1YZQA 5IT9O 5CLLA 3V55A 1A8SA 2AOWA 3PPYA 3I2FA 4YORA 1UWBA 2BR4A 4FR5A 2WJJA 3ZK9A 1K8KA 1NMXA 2AFIE 2Q0SA 2RCYA 1T4GA 2Y66A 3G7NA 4FOEA 3RR8A 2HVHA 3EF3A 5JQWA 3LF2A 4WCEL 3SR0A 1G16A 3WO1A 2AQIA 2JATA 4IWVA 4OTZA 4ISGA 1YB7A 1WXHA 2E21A 4UASA 1ZKDA 2C7RA 2NX2A 1J9AA 1NQAO 1KD1O 1Q21A 1S3FA 2FETA 2OM2A 2F3PA 1VMIA 2PS3A 2QMOA 4RHEA 3DNFA 3O8NA 3RM3A 4YQFA 1MEJA 4ER3A 5JNWA 3OCZA 2Z3ZA 4JJ6A 2GILA 3O1IC 4MEBA 4I3HA 4MRNA 2ZUFA 1R15A 1H1LA 3B6JA 2HSZA 1MO4A 2XBLA 4FMDF 5F51A 2Z1JA 4WYBA 1VDMA 1RDCA 4MNTA 4XUDA 4B43A 2C96A 2OCDA 2J67A 3GDOA 3K05A 1N0HA 4LZLA 4FW1A 2PUVA 1KEWA 3BTUA 3UPDA 2PXHA 4DIMA 3ONFA 1SVSA 4KMSA 4CF1A 1ZFNA 3RB8A 3FROA 3TNJA 5BSEA 2O8EB 1ZRNA 4G5GA 1IEXA 3HH8A 3ZXUB 1KI1A 3KXKA 4CMBA 2YI1A 3WGGA 3NH2A 4D9KA 2D5LA 2N75A 3SI7A 5BXQC 1IBMB 5EWJB 3E9PA 1PNVA 2R5FA 4BRAA 1RRKA 4HRVA 5BNFA 4CLOA 2HV9A 4ZU3A 4R8RA 1KY5A 4TVKA 2R87A 2GBIA 1TMOA 1QG2A 1SKBA 4XX0B 1SEPA 1U9ZA 2VXCA 3GGSA 4QLBA 3RTBA 5KNCD 2YV5A 4DNXA 2QEXN 4ZCPA 2O19A 2QJFA 4L73A 3COWA 4PRYA 3STVA 4DLRA 1VG8A 4CZGA 2POCA 4OK5A 1JPNA 2NM0A 2RD2A 2GYWA 2NU7B 5EHXA 4C8MA 3R4VA 3K58A 4WH0A 3UA4A 2Q4DA 3I6YA 5SZTA 4KOEC 1Y7IA 3QP9A 3RGGA 4IS2A 3T9AA 3G89A 5DK6A 3V4IA 4K05A 3VPDA 3ZZTA 3N0RA 5EQTA 1I36A 1RCHA 1YH3A 1UJ4A 2H2GA 3EQ2A 3GRZA 4CT0A 2HMAA 3N5CA 4ZYLA 5KTKA 2LDBA 4MJXA 4WK0B 3ZU2A 4UNPA 1WO8A 4UUBA 2F9LA 1N2CB 1PQYA 3BCSA 4RAQA 4TYQA 4IFBA 4IDKA 1NA5A 4E13A 4GPEA 1ZMOA 4YMIA 4B6RA 3UBTA 3PJRA 1PAUA 1AU9A 3IERA 3V34A 3FZKA 2DFVA 1T8SA 1PUIA 4BRIA 4FEGA 2ORED 5ELZA 3DC2A 3LUCA 4JWKA 3WGMA 4DQ8A 3R7WA 1GUZA 2GYUA 1WEHA 1Q17A 2ZI6A 2CNBA 3Q3VA 4HEA1 4OI2A 5DYGA 2QG6A 4JXKA 1VQ9N 3EKUA 1JLEA 1IXSB 2BY4A 3NW9A 3VN5A 2JGFA 4BMNA 3BKWA 3PDIB 1A0OA 3AR9A 2OAQ1 3LOUA 3SHFA 2FWIA 4BVFA 1D1SA 2BFFB 4CEHA 3JS5A 3N1UA 3L0DA 4CK3A 3R8XA 1N6OA 3KAPA 1VSJA 3MBOA 4X54A 1XPOA 3RHTA 1X1BA 2O05A 3KYJB 1WXFA 1NK9A 4Q18A 1ZGGA 2PMDA 3B3JA 4YOVA 2NU9A 3GRKA 2XE8A 2VAVA 3DUFA 4LJKA 1MQAA 1MPXA 2XUAA 2YJFA 3H2IA 4ZCQA 3ZGXA 3W3DA 1T03A 2G8LA 4WZBB 1SOWA 1ZDMA 1BOFA 3UMFA 3SEAA 1XCPA 2ZJ4A 3UY4A 5AYVA 1HLDA 3HXLA 5LDHA 1M10A 4UDXX 3ESQA 3NIBA 4R7TA 2QIPA 5ESWA 1GPWB 3R3XA 3JYHA 2CFRA 3TB4A 5IAOA 5GWXA 4E5MA 3R3HA 1QYXA 1SU7A 4KQIA 4LN1A 2VAMA 2QWQA 3GNLA 1SIUA 4H1VA 1SR8A 2A84A 2FMKA 4AP9A 5JAOA 5DISB 3DMNA 4B4OA 4W1SA 3R75A 3CLTC 4L5CA 4YHHK 1FS4A 5AQHA 4LOHA 2EFCB 3UGQA 4FJJA 3TE6A 2H07A 4CMCA 1R0WA 1QCCA 1Q7BA 3ISVA 1U90A 1JKHA 1I9CA 1EK2A 2W43A 3RTAA 3AVGA 2R6FA 2YZMA 2HTFA 3GJRA 3QOWA 4D3FA 1GU1A 1GL7A 3ZGLA 5AVTA 4OLFA 4R31A 3M81A 1LK0A 5KYYB 2J41A 1WMDA 1XZHA 1Y3DE 3RV4A 4CJTA 3TB6A 2EGHA 3G8YA 3GBTA 4FXOA 3LRPA 1NGAA 4D5GA 4TLBA 3ZWOA 2GASA 4M8IA 3K9QO 4UBOA 2GEFA 3ODPA 1NI4A 4AM7A 4R2HA 1WW2A 4AKSA 2R8XA 4MV9A 4BE0A 4B87A 4B4WA 5B7GA 5BV1A 2EHGA 4JVMA 3WKAA 5IM4A 1QFYA 2HT1A 3FTDA 4H59A 1NVBA 1BYUA 3LLMA 1OFUA 1FYDA 3A2LA 4KACA 4PTYA 1JTEA 4QJ4A 3G1TA 4F2SA 1XR3A 1KF0A 2O3UA 4KVZA 3S8YA 2AVNA 3FHTA 4Z6KA 2PS0A 1H5QA 3L05A 2ACKA 1LWOA 2HU5A 2QWOA 1A4UA 3U3ZA 3JWEA 4MS4B 3WBKA 2IHKA 1QDUA 2G36A 2LD4A 3PFIA 1L1RA 1LBIA 3T7CA 4WXEA 3WJAA 4B80A 4CE6A 2WKQA 4DJFC 1EX1A 2R6ZA 2MOKA 1XP8A 1ULHA 5EZYA 1K86A 3S68A 2ID7A 1CEQA 1O8BA 2JF0A 1KR2A 1QV7A 1XTRA 3GGCA 3OD1A 3KOUA 2C7PA 4NVRA 4L5AA 2GLTA 6GPBA 1M66A 1JKJB 3SJBA 1WG8A 1J0BA 1FDWA 3AR2A 5LA6B 2WF5A 4AZ3A 3V4PB 4CZIA 5EIFA 1Z68A 1O96B 1EH5A 2DF8A 2YRWA 2ZJ0A 4NCIA 4MVJE 5CAEB 4CJEA 2M32A 3QVSA 2J4DA 4QS7A 2DP4E 4RABA 3MEDA 1ILYA 1ZITA 3INYA 2FKNA 1RWNA 1PQPA 1UKAA 1H2EA 4FD3A 1JA9A 5JALA 1AO0A 3AF0A 1T34A 2CN1A 1CRPA 5DWDA 4O5AA 5LP6F 2QMUA 1U04A 2EJVA 2GXQA 4QWMA 4O2RA 4E1BA 3MINA 2F43B 1BXRB 1WABA 1CU1A 4X90A 2FR8C 1D2NA 1GQ2A 2HMVA 3CRQA 4C23A 3GL9A 3GPDG 3LLSA 3UKUA 3PXBA 1FNBA 2WSSA 3N05A 4URZR 3I04M 5C8YF 2Z9DA 3NC0C 4JY7A 4MUEA 4NMHA 1UZUA 3RRZA 1AM4D 2FPIB 3WO0A 3B20A 4FJIA 4RPHA 3RTCA 3GP8A 3H75A 2J9FB 3SZGA 4D6YA 1MTOA 1ZXXA 1Q15A 4DJJA 5K09A 1WL8A 1KORA 2QRQA 3KKOA 4MVJM 1TT5B 5D85A 3U9SA 4ECEA 1F3LA 4JHDB 2Q9BA 1FJGB 1XMQB 4FLZA 2WHPB 1K3UB 3W4JA 4G4SP 3QFHA 3JAMO 1AKNA 1RJDA 1XVVA 2Q2WA 3EBLA 3HB9A 2CLHB 3GJXC 3QITA 4ZIRB 2ZRGA 4LOJA 1KR5A 4CDGA 3WIBA 3DWLA 1VDZA 2H08A 1KMCA 2P67A 4R2KA 2IWRA 4C03A 5J5CA 4CG2A 4DEVA 1G4HA 1YT3A 3CTPA 3L0IB 3NF6A 3OPYI 2P9PA 2Y9MB 3TSCA 4RVDA 3QXCA 3WLIA 4Z7NB 3HVTA 4H27A 1QB7A 1WNSA 3I76A 3IAHA 2I33A 1NVMB 1BFUA 3GXOA 1MJGM 4L8YA 4P3XA 1XZJA 3VPAA 3TOCA 3CLRC 5KCZA 1G7RA 4J16C 3ZZNA 4PTZA 1VKRA 2I5JA 3T5DA 3ZCXA 2JGNA 3I2YX 4GMHA 4JFRA 5CFMA 2LGJA 4B3RK 2XY8A 2OBMA 3HCDA 1Q86O 4MWDA 1ZJZA 2ZUCA 1KKUA 3A1TA 1XMOK 5TARA 5DN6D 3JSAA 2YR0A 3AGKA 4XFJA 3IAEA 5AUPB 3IDZA 2WE7A 3O3NB 3ZU4A 3A6PC 3L8MA 1JVSA 1WLSA 2Q7XA 4CVNA 1JUDA 1EFVA 3LVBA 4JD5A 1PJ3A 5J2MA 1AT1A 1UP7A 1GPYA 5FROA 1M0TA