2W43A

Structure of l-haloacid dehalogenase from s. tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
201
structure length
201
Chain Sequence
MIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 2-HALOALKANOIC ACID DEHALOGENASE
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 87
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 3.1.8.2: Diisopropyl-fluorophosphatase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w43A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w43A01
4UM7A 2AH5A 1NF2A 1RLTA 4NWIA 3SF0A 2ZXEA 3L8FA 5AI0A 4Y2TA 2YMPA 1YS9A 4HYTA 5AI4A 3KOOA 5ALXA 3UMGA 5AM5A 1L7PA 3L0YA 3N07A 5ALSA 3E58A 2YBDA 5AVVA 3U7EB 1CR6A 5AK6A 2G08A 2ZBFA 1Z88A 1XP5A 2Q5EA 4O8CA 5ALGA 5ALMA 5IT0A 2BDUA 2FUCA 4Y2PA 4NABA 2EARA 3IJ5A 5ALKA 1O03A 2QLTA 4XQ0A 1RPZA 2D2VA 3OTQA 4AS2A 3QU2A 1Z4QA 1CQZA 2R8XA 3WK6A 3I1YA 2RBKA 1RKUA 3QNMA 3BWVA 2JAWA 2YFYA 4I9FA 1YMQA 5FP0A 5AVYA 3QUQA 5AM0A 3L8EA 1U2TA 1TJ3A 3WK9A 4UASA 5AI5A 2GHTA 5AVXA 1ZRMA 4BX0A 4EELA 2OA0A 3GYGA 2C8KA 3EPRA 3AR4A 3ZVMA 3AR2A 2ZOSA 2R8EA 1ZRNA 3KZXA 3DAOA 1XVIA 5AK4A 5AVWA 2ZBEA 2I55A 3IB6A 2HEGA 4YIKA 5AVRA 5AKJA 2P11A 4Y2JA 4KX3A 3SKXA 3QU5A 1U02A 3NRJA 4CF4A 4H1WA 2FPRA 2I54A 4MUMA 2MU2A 1JUDA 3DV9A 4PNHA 5AKLA 4Y2YA 3OCUA 3QU7A 3QGMA 3QUBA 3FPSA 4BX3A 3SLRA 5JJBA 3N5KA 5AVZA 5A3SA 5AM2A 3R4CA 4Y2QA 1QQ7A 2ZBDA 4GXTA 5AHXA 4RESA 4BEWA 3W5CA 2YJ6A 2HCFA 3ZWKA 5A3QA 3I76A 2G80A 2CFRA 5AW1A 2FI1A 2QYHA 4EX7A 3AR5A 3QYPA 2AUTA 2FPSA 1SWWA 3PGVA 1Z4MA 4CF5A 3VAYA 4BKMA 2WF8A 4UMVA 4UU0A 1LVHA 3WKBA 4CE6A 1N8NA 4AS3A 3U19A 3CZ4A 4C4SA 4Y2XA 1U7PA 4HGRA 1VFPA 4YCNA 3KBBA 5ALFA 2G06A 3FVVA 1QQ5A 3WK8A 3M1YA 2B8EA 1RKVA 3NIWA 4HGOA 4OD0A 3MMZA 3U7HB 1Z4IA 2C4NA 3HYCA 4ZEWA 4UMFA 3A3YA 1J8DA 5ALIA 2YY6A 2W4MA 2IA5A 4GIBA 3ZVNA 2HI0A 5AW7A 2WF5A 4OHFA 3WKEA 1IWOA 4OFZA 4OCZA 3PGLA 1KYTA 1T9ZA 3ZTWA 3N28A 3QU9A 1ZS9A 1XPJA 4C4TA 3WKCA 2WHEA 2FUEA 3ET5A 4G9BA 5A3RA 1X42A 5ALJA 5AESA 3DNPA 3HLTA 2FPXA 5AK5A 1Z4NA 1J97A 5ALLA 4YCMA 1Z5GA 4IG4A 2HF2A 4KYTA 5AKKA 5IT4A 3E84A 1QQ6A 1WZCA 3L1UA 3AR7A 5AKIA 5ALYA 3U26A 2IYEA 2CFSA 3B8EA 3FPBA 3R09A 3PCTA 3AR6A 3ZTYA 1F5SA 4UMEA 2BY4A 1RMQA 3L7YA 1RLMA 2G07A 4KX5A 4BNDB 3ZU6A 3I28A 1RLOA 3J7TA 2O2XA 3A1CA 4FYPA 1YDFA 3L0BA 3ET4A 2W43A 4BYGA 2JAOA 3OCWA 5AW8A 2I7DA 4UATA 3L1VA 4XOUA 3ESRA 1VJ5A 4MWOA 4BEVA 5AW2A 2WF7A 4UW9A 2B8JA 5AI8A 1ZD3A 3AR8A 1Y8AA 4EEKA 4FE3A 3UMBA 4L57A 2O9JA 2R8ZA 3A1EA 5AKGA 3W5BA 5ALRA 2YN4A 5AM4A 5AKXA 1ZD4A 3FGOA 3M9LA 3OPXA 4I9GA 1LTQA 2HO4A 3ZI4A 5ALHA 5AI9A 4BBJA 1ZD2P 4AP9A 1TJ5A 3ZVLA 4Y2UA 1YNSA 2B1QA 5AVSA 3K1ZA 2IOFA 5ALQA 5ALOA 3FM9A 2ZBGA 1L7OA 3L0CA 4F72A 4UAUA 3L8HA 1RQNA 2JAUA 4Y2VA 2YJ3A 2I6XA 3KC2A 3NALA 2G1AA 4EZEA 1L6RA 2HOQA 4IFTA 3SKYA 1VJRA 5ALWA 1S8OA 1L7NA 5AICA 2B1RA 3ZWDA 4FFDA 1L8OA 2JARA 1U2SA 5ALUA 2B82A 1Z4PX 4ZEVA 3BA6A 1ZD5A 1Q92A 2NO4A 2OYCA 2B0CA 3D6JA 3QU4A 5ALNA 4L6AA 3KD3A 1RMTA 3QUCA 3N8GA 4J03A 5AIBA 1ZOLA 2P9JA 2RAVA 2WM8A 1QYIA 3QLEA 4UMDA 2EATA 3NANA 3MPOA 5ALEA 3AR9A 1SU4A 3U7GA 2GO7A 3FZQA 2GMWA 2HF7A 2DQSA 1K1EA 2YMMA 2GFHA 2P69A 4NFLA 1RMYA 1T5TA 4Y2RA 4HGNA 1SWVA 4YIHA 2Q4TA 2WF9A 2OBBA 1T5SA 3SMVA 4B6JA 4RETA 5AVTA 1TJ4A 5AKYA 4DWOA 4G63A 3P96A 3ZUPA 2NO5A 3NASA 3A1DA 4CF3A 5ALTA 4J2TA 3L5KA 4JDPA 4ZEXA 2C8LA 1S2OA 3CNHA 1N9KA 2MSNA 4XE5A 1NRWA 4BNDA 5AK3A 3EF0A 4KN8A 3U13A 4E88A 1L8LA 3W5DA 4YGYA 2YJ5A 4XPZA 4QJBA 2PR7A 3ONNA 1Z4LA 3WK7A 2CFTA 5ALZA 2CN1A 4UAVA 1L7MA 4QQFA 2ZG6A 1U7OA 1WR8A 3QX7A 3ED5A 4HGPA 3QXGA 2I34A 3E81A 5AM1A 1NNLA 1YV9A 5AW4A 3N1UA 4KNVA 2R8YA 3ESQA 3IRUA 3KDPA 3OCXA 3NUQA 4CNQA 1RRCA 3WK5A 4L6CA 2C88A 2X4DA 2W11A 2IOFK 3WKAA 3MC1A 2EAUA 2GHQA 2FPUA 3PDWA 4NAVA 1WVIA 2MU1A 1Q91A 5AIAA 3AR3A 3F9RA 2IOHA 1YJ5A 1TA0A 2FPWA 2RB5A 5T41A 2YMLA 5AKEA 2FDRA 3ZX5A 5AM3A 1TE2A 2FEAA 5AVQA 2HDOA 5AW5A 2AMYA 2HHLA 4EENA 2G0AA 1RKQA 3OCZA 2AGVA 4BX2A 4C4RA 2Q4RA 4EX6A 4DW8A 3WKDA 2P27A 4KNWA 1Z4KA 1WPGA 1PW5A 4HGQA 5ALVA 3RF6A 5AVUA 1EK2A 3EF1A 5IS2A 3SHQA 5AW6A 2NYVA 4UARA 2BDEA 3NAMA 1RC8A 2HSZA 2VKQA 5AW3A 1MH9A 2HX1A 3E8MA 3SD7A 5AKHA 3ZW7A 4UU1A 3W5AA 5AKZA 2C9MA 3OCYA 2PQ0A 4UM5A 1RQLA 4DCCA 4DFDA 3OCVA 3UM9A 1Z5UA 2ODAA 3I6BA 4F71A 1Z4OA 5ALDA 3U7FB 3WK4A 2I33A 3S6JA 5AW9A 2YMQA 2B30A 1QH9A 3WGVA 4YH1A 2OM6A 1O08A 2WFAA 1EK1A 3EWIA 3QUTA 1Z4JA 2YJ4A 3L8GA 4NV0A 3WGUA 3DDHA 4HAIA 3R9KA 1ZJJA 3ZX4A 3RFUA 4JB3A 4YCLA 1FEZA 5ALPA 4Y3UA 5AI6A 1AQ6A 2G09A 2PKEA 3TLMA 2RARA 2JGAA 3B9BA 3B9RA 5E0OA 2WF6A 3MN1A 4Y2SA 1RDFA 5AW0A 3UMCA
chains in the Genus database with same CATH superfamily
4JD5A 5FPTA 3K0BA 2W6CX 4IYRA 5C35A 2X76A 1DIOB 1NMZA 2G1KA 1XKTA 4Z3KA 5AHWA 4I1RA 3QIAA 1GYRA 4B2PA 2IYZA 4J0DA 4DLZA 2ESRA 5A3JA 3MSCA 3LHDA 3AF6A 2FQYA 4JJ7A 1J25A 3SJCA 4A27A 2WYOA 4I2EA 4TTQA 2GZSA 3H5OA 4FHZA 4ID9A 4FGZA 3WK9A 2EKQA 1G1AA 3M9WA 2IZ7A 4QLOA 3LWDA 3DB1A 2MA1A 2YN2A 2DPLA 1L2TA 5LMCA 1OMOA 3L0DA 4NYIQ 4EECA 1WBBA 3DVAA 2A19A 1N6OA 4RTJA 3SLRA 4XTCS 3H6HA 3ZHCA 3HADA 2GNPA 2XY4A 4NHOA 4MQBA 1W96A 2W6IA 5A9SA 2E3JA 3CF2A 5LQAA 1UMDA 4JI6B 3I76A 1YD7A 4WY5A 3G2IA 1KC3A 1JECA 4QQNA 4PYOA 1PUIA 4IW3B 1CG6A 4ZIRB 3ISCA 1D9ZA 3ER6A 4HADA 2JVIA 3QA3E 2A84A 3FHJA 5DN6D 3V8EA 4IVNA 4I5FA 1TTHA 1VLVA 3ZKAA 1KYTA 4LJSA 3K0AA 1JW9B 3N28A 3FKQA 4E5NA 1ZS9A 4QHTA 1L5HA 4NDAA 3P45A 2R4UA 4DMKA 4ML3A 3HB0A 4AWBA 1X0VA 4MR9B 4RSGA 5CDFE 2C1ZA 2VTBA 3O1IC 3AESA 1NJGA 3ZYZA 3VSEA 5K2MA 1NQUA 3RU7A 2ARKA 2QU7A 2XYVA 4N12A 1GTZA 3DMYA 2I29A 1V5GA 1IAVA 9ICOA 4N03A 1YCDA 1EUQA 2JIZA 3O8DA 3WQSB 4MF2A 4Z54A 1BVUA 2ZUVA 4GWLA 1WNFA 4FGUA 2BN4A 4UCWA 5IZ4A 2E48A 1YA6A 4OUDB 2GBLA 4BNKA 4KR2A 2F1HA 3G2OA 4I55F 3HJGA 3UC9A 3LVWA 2FGKA 3I2HA 3PUWA 1EZZA 4L5AA 1GTMA 4ER7A 4JCOA 2FAXA 5BWMA 2UZ4A 1KZ6A 2FXVA 1ELOA 2CUNA 2L5YA 3KJIA 2CFOA 3Q7IA 5H3CA 1VHWA 4O25A 1E8DA 2RGBA 3B3FA 1X3SA 5KYWA 4P3KA 3D81A 1XXHB 4JT9A 3DDNA 1ZJYA 3IDZA 1CE8A 4CDNA 1YU6A 4FEEA 3SSAA 3KBOA 3ZDQA 1Q20A 4PCAA 5EHGA 3N2ZB 3ADOA 4BTEA 3E61A 4LXUA 3W0LB 4HNRA 4XFDA 3EB9A 2FKNA 4W8HA 1NW4A 1ECJA 5IJ0A 4B6JA 4FT2A 4LVNA 5BPFA 1KI4A 5J59A 2NSJA 1A1SA 2K87A 4E22A 3KPJA 1DEXA 1ZU5A 2FZVA 1S77D 2PMZF 4RPZA 2RHJA 2BEUB 4B6FA 2XMRA 1C41A 1XO0A 3FZGA 1KAMA 2ZB2A 2XGSA 1EWVA 1ZR2A 5KFVA 4ZQFA 3R5KA 3QX8A 2DQ4A 1SQ5A 1TTTA 1ETUA 4ESEA 4I2VA 4MARA 4MHTA 1NOIA 2FWNA 4TQGA 5EIOA 1ZMBA 1WNTA 4UFPA 5C8VA 3MEQA 2J3HA 5K8IA 3H0EA 2ICAA 4A10A 4ZOQI 4QO8A 4V2IA 2E1FA 4GLLA 2W6PA 3TZKA 1S01A 4ND4A 2PQ0A 1GNVA 1LF0A 4I9UA 2P1RA 1K8XB 1TLFA 1W36B 3LRTA 3F47A 3R6GA 2PI4A 4BMNA 2AOUB 3VZDA 4P4OA 3KZ1E 1SUAA 3S8YA 5BYJA 4I3HA 4GXQA 1ML3A 1N0IA 4WFIA 1X7ZB 3RFUA 2WI8A 5K6AC 1ST2A 2RARA 1JFSA 4JBXA 5DZSA 1SQ0A 1PJTA 1ZJ5A 4UVIA 3IPLA 4CUJA 1I5EA 3TRHA 3WAKA 5AM5A 3EXHB 10MHA 1T2FA 5KIAA 3W34A 1PBNA 5AVVA 3CJTA 5ENDA 3Q7PA 5C1OA 4JIMA 3FDZA 4WN9A 1DAEA 3ONWA 3ELWA 3N7RC 2GBIA 2XXAA 3WK6A 4E2XA 1IOVA 4QEKA 3RASA 3VOBA 3GRYA 1M2HA 1O6ZA 5AM0A 1DE0A 1TU3A 2FVYA 5BW4A 3OESA 5I7FA 1KH1A 2EFJA 3OF2A 3T3GA 4B6PA 1ZRNA 5JT1A 1COOA 2GERA 5JSZA 4YXWA 5DSZA 2RGGA 5C51B 2O1WA 4L5IA 2J7PA 4F8RA 3LW7A 3MMSA 5HS6A 1NBME 2L18A 2C20A 3N5KA 4HS4A 5I8ZA 5IKMA 1D5CA 2J3JA 4WLOA 4HNHA 4LYHA 1SCKA 4LC9A 4V24A 3GHHA 5JS6A 1GCGA 1TCUA 2C5EA 4TLCA 3GV7B 5TT0A 1UZUA 3ZW8A 5GAJA 4EAAA 1M9NA 2MJLA 3C6QA 3LHSA 4B0OA 3U0BA 2W4MA 3OPYB 4KTVE 3WR5A 3H8WA 1ZITA 5KTOA 1Y3DE 3MCUA 2O2GA 2Q7XA 1KU6A 2MMCA 1AV6A 2FSIA 4J9OA 1XZCA 3O4HA 4PG4A 4G0ZA 2DPJA 1ED1A 3SF8B 1KZYC 3E84A 4H35A 4QG3A 1E9CA 2SICE 1Q77A 4RHEA 3A2MA 3L1UA 4P84A 1K6MA 2IHMA 1I3NA 3PV0A 3FPBA 2TRSB 4MRSA 1S0VA 1XAGA 3G0BA 3SZGA 2JH9A 4WCFB 1CY1A 1RHQA 2BMAA 4CTJA 5KFOA 2ATIA 3DBHB 2E1PA 2FUG6 3ET4A 2A67A 2ZT8A 4PPYA 3SBOA 2HHTA 4G3XA 4TMXA 1V16B 1Q3KA 2W8BA 3NLLA 5CLGA 3PGJA 1F2UA 1BX1A 2O9JA 1CZRA 4CKBB 1N2CB 3Q7TA 2JI9A 4WNAA 1ZD4A 4L3WA 1FJ2A 2WVAA 2PJUA 4F9FA 3TEFA 2HJSA 1AQNA 4J91A 3ZDEA 1NUTA 2VHWA 1OUQA 3FMFA 4U5QA 1YBMA 1VKHA 5KT3A 1BO6A 3ISVA 3H8SA 5IM5A 2XICA 2IUFA 3K0CC 3ESCA 1LFDB 5CHEA 4BNNA 4WZZA 5BYBA 1MPTA 4OGKA 5JY1A 4KBFA 2QTMA 3VBEA 4RLHA 3B1ZA 4JT2A 3I01M 3RWBA 1JFVA 2IBMA 3AJRA 1Z7BA 2Q9UA 1JT9A 4TSFD 3KR2A 3B8HA 3FZQA 4NFHA 3IT2A 2ZS8A 2YY7A 2KE5A 2FMHA 2FP4A 3GJYA 2OWOA 4DQQA 1HDRA 4RWEA 3H83A 4R1QA 3B7GA 1WHSA 1DJPA 1K9SA 2JGKA 3LY9A 1UC4B 2X7HA 4X5OA 2Z1MA 5FUYA 5CD9A 1ORTA 4AG3A 4QUKA 3W2HA 1A98A 3HACA 4L8WB 1IVNA 1Z5WA 2VJNA 3A28A 4ZJPA 2C00A 4R5HA 2HUPA 2VYVD 4U4AA 4OKSA 1NNLA 2ZPUA 3M5CA 1D07A 3S5JA 1X9IA 1F2TA 3KKKA 2VFAA 4AG5A 1RG6A 2JFZA 5KAMA 2FPWA 4LAFA 1IN8A 1L5UA 5JATA 2Q8NA 3Q8WA 3OKFA 2G0AA 2H17A 5J0QA 3IUEA 3P71T 3I1JA 1WF3A 1TL7C 2PXCA 3PD0A 5D00A 3P2OA 5GY7A 5KL8B 1XD8A 4BN4A 2H6EA 4LF6B 4BQSA 2L2QA 2W8LA 4GEKA 4X24A 1RQGA 4IUCS 2G28A 2ODAA 1PK3A 2P91A 3W5UA 3HUFA 1NRJB 3WNDA 2COEA 2AJCA 1PR6A 4N76A 4EUNA 2K8CB 1JILA 3BN3A 2R1TB 2RBGA 5DN6A 2XOKD 3HEAA 5EJ8A 5DEIA 4C07A 5FA8A 4N82A 4ERNA 3STHA 4WBNB 3E58A 5LQJA 2ZRPA 3TW8B 4N3BA 2EAOA 4G0MA 2I3ZA 1GN8A 4AJ4A 2R5NA 1QP0A 5GTDA 3R3SA 3BZWA 4RT2A 6Q21A 1TYEB 3EFOA 3W77A 3TXXA 2DU8A 5JNSA 1W0KD 2ORWA 1CJVC 1ONPA 1BPDA 1ZN7A 2PPVA 1P73A 1GGKA 2KOBA 4F04A 5PNTA 2A9KA 2VJYA 1X8KA 3G0DA 3ZS8A 3DMTC 3ITEA 3QUBA 1PNVA 3UXOA 3JALB 1BG6A 3PQFA 2ZWAA 3NP7A 4RV4A 3WB1A 2W0MA 3QVWA 2BGIA 4IQTA 4W1RA 1WZ2A 5EKUA 5B53A 3KHGA 1Q0RA 3NHKA 1GXSA 2DUJA 4DYVA 3IUMA 4UHFA 5KNCH 4M6WA 4CG0A 4IJWA 5DTQA 3MMZA 4IXMA 1QFJA 3DBIA 5AVKA 5D3KA 4YJ2A 1XTVA 1YCFA 1HT3A 4F6LA 3C70A 3FSJX 3TKYA 1O94A 3IJRA 2OBXA 4HQKA 1GPYA 4EG4A 5K20A 1MT3A 4K26A 4CCSA 3BTOA 1XFAA 1OLUB 1J07A 5A7HA 1U0BB 1SG9A 2NSYA 4HQNA 4UZFA 3EY9A 3HKDB 4ZHQF 3K53A 2IE0A 3I6ZA 5AWFC 4XJXA 1YFLA 4TMFA 4R0NA 2D0OB 4PZZA 1GV0A 1BMQA 4FKBA 1QYRA 1TUGA 2Q3JA 4HH1A 2W37A 1IVYA 2HDWA 3WHLA 3HKCA 2RH5A 3MK31 4HQ0A 1H8ED 2AFVA 4HVCA 4EFKA 1A5SB 4UEWA 1KW4A 3AC0A 3QEKA 4MP6A 3W5BA 1TK0A 2ISCA 4PG5A 2DUYA 5AMXA 5BN3B 1E6MA 2DULA 3K2IA 5DNEA 5C81A 4YV1A 4OU4A 2QD2A 3TDKA 5EHIA 2PX0A 3WYBA 2CDAA 4LVSA 1A2KC 2HRCA 4BNTA 3ZE6A 3GUHA 3LWZA 3RT9A 1PNRA 1WLYA 2AF4C 3JTMA 1K7XB 5HUQA 3KQUA 1Y80A 3IM1A 3AG5A 5FUVA 4KI7A 4ZV9A 4HWKA 4MMZB 4WOJA 1RBQA 1ESEA 1GQFA 4NG4A 1VCIA 1JIQA 4MS1A 4EHAA 2SECE 3CC8A 4C20A 4QW8A 3RUCA 5P8WA 1GKYA 4TS9A 4JJFA 2X0NA 4ZOLA 1TAMA 4EG6A 4R71A 3MB8A 1W2WB 2GN9A 3ORQA 1DKRA 1RYHA 2E5SA 5LOVB 1CY6A 1QVVA 3AVQA 4LXYA 3DBVO 4KXVA 3OOHA 2XT0A 2H1WA 4Z5XA 3HVHA 1K6IA 4I27A 1EE2A 2NO5A 3NASA 4DXHA 5DBEX 2MSNA 3W9SA 3N97B 4PHHA 1SVSA 4HWOA 1Q0SA 8ICOA 2DBQA 3QA9A 5EUCA 2GARA 2YYZA 1TA4A 1EGAA 1IE3A 1GR1A 2VJKA 3TX6A 1M7BA 2I34A 4QOGA 4J0JA 3C1YA 4UNRA 4GI5A 2PMZC 5IAGA 5DULA 4US9A 2JJYA 2I9KA 3TGPA 2QX4A 3NWEA 3UK2A 1TU0A 3HA2A 1YRYE 3NBQA 4CLRB 5E9QA 4XFKA 4REMA 1JU3A 4J76A 2B34A 4P5PA 3LVRE 3M6ZA 2YCLA 3EPLA 1Z0JA 1GAEO 4C5BA 3WZ2A 5EIWA 5EXEA 1MSWD 2ZJYA 2IOYA 4B3HA 3V1TC 1B41A 4B3TB 1CIJA 5IVIA 4O3MA 3F5DA 3ZCXA 3QXSA 5F21A 1ZSYA 5JFGA 1G8MA 4BN0A 4LRTB 1ZQIA 4ARSA 3ONFA 4FONA 4UJ5A 3RRNA 3NATA 1SZJG 5KZMB 2B4RO 2JFBA 4YMGA 4GWKA 3FSGD 4FKZA 1D1SA 3GCGA 4JVLA 3O31A 1NBAA 1XAJA 1CEZA 2VAMA 1OGJA 1VYTA 5IF9A 4HAOA 2Q4EA 4ZZ3A 5J1SB 5EOZA 1VBFA 4UD2A 3DEYX 2J6HA 2OZKA 3SX4A 1CQZA 3THRA 4W4TA 4OQLA 5F52A 2I65A 5FP0A 2AXQA 1VCMA 1WOMA 4OMUA 4D2IA 3C8ZA 4KLEA 4RENA 2H1OA 2V6BA 1LQTA 3G89A 1GARA 4DOMA 1R6AA 1NL3A 1CJUC 1NR7A 1QFXA 2IYSA 1ECGA 2B9VA 3T94A 3NS1A 3F53A 4YMSA 5J5AA 4MDHA 3KKOA 4M83A 1NU8A 4OHYA 4U2BA 2FQQA 2ZBDA 1W48A 3CLTD 3FGNA 3ZWKA 3DG9A 3ICVA 1X7YB 3AF3A 1OA1A 2H16A 1CEEA 3Q4GA 3BMXA 4C0LA 5H68A 3P27A 2QRGA 3F6CA 4KVAA 4BO8A 3G8AA 2OPHA 3QH4A 3WFIA 2BEVA 5CD1A 2XBLA 2ATCA 4B5LA 4H0NA 5SY9A 2VP0A 1NKTA 1UFVA 2HWKA 3LA8A 1IAQA 4R2IA 2ZIWB 2J6TA 4G9EA 4ECWA 2WWVD 3AKZA 1TZKA 3K9GA 4FDUA 4Q43A 2FPXA 3BF7A 1J97A 4WLNA 3ZHXA 1HBJA 4DR2B 3KQPA 4KYTA 2PFGA 3AHHA 2ES6A 3MJFA 1GGMA 4OYRA 1U0SY 4ZZIA 2O0MA 4ZKDA 2XNKA 3NTVA 6ADHA 3ZWAA 1P80A 2Q9AA 2O8CB 5H59A 5D5HA 3U1TA 4D4LA 4LRYA 1UPFA 4P7BA 2WAYA 2BTEA 4YD2A 4M37A 3TPZA 3R3YA 2QRVA 5KVCA 5BR1A 2QY6A 5DB4A 3N2NA 4DSZA 2J33A 1OTHA 2VYVA 4DJEC 2P4UA 4P4LA 4GLXA 1XDSA 2PX6A 1QNLA 2VYQA 4EP1A 2HCJB 4MGYR 4JIGA 3E82A 3ONDA 4GBED 4RJKA 4CV1A 1CPYA 2VJMB 4H31A 2D59A 3STUA 2HMYB 2I6XA 2F1IA 1EK5A 1XRNA 1OTYA 3GOQA 3Q9SA 1Z1VA 5J1TB 4BBAA 2WFMA 3U4MA 3KJGA 1JGTA 1HUQA 1AA6A 4CIYA 4F85A 1M2KA 4YUYA 4B31A 1O97C 2H0AA 1XRJA 3EGXB 3QSGA 2OGUA 2HU2A 3T8YA 4U9HS 3R74A 5K3BA 1MB2A 3TBHA 3UT5A 3NDRA 3AFIA 2O2DA 2EBHX 5LKAA 2FSVC 1B93A 2XD4A 1MB0A 3BYZA 4O5KA 2G4LA 4NBNA 3HDGA 3LT1A 3SR3A 3C85A 1VJDA 3DL0A 4ZANA 1N9KA 3THYB 2ATXA 4Z0NA 3GH1A 1P7WA 1TYBE 4ZCLA 2EDAA 1N61A 2GPSA 2ODNA 2NRWA 5CNMA 3H17A 4NU0A 4YDQA 5G0TA 1TT7A 2P2GA 2IITA 4BLVA 2UYHA 3G7SA 3ILXA 4KWHA 5DBFA 1WXIA 5C7LO 3DE4X 4LZNA 3DDCA 5DLGA 4JV5B 3PDWA 1NMSA 3LUKA 2UVPA 5KTKA 2NMVA 5CCXA 3GIKA 1BOFA 4R2MA 4FOSA 2AGVA 4FCVA 4ARIA 3LKZA 3QENA 1R4NA 1KI8A 4M21A 2PSFA 2VKQA 1WWKA 4Z99A 4DIUA 1LBQA 4DCCA 4Z4HA 1VG0B 1RAIA 4MQ4A 1YJQA 1V8OA 2EZYA 3AGPA 1DXYA 2AEJA 3AXTA 2JFXA 4IGFA 2KBFA 5C5IA 1ECFA 5AH0A 4JELA 3B9RA 2C2YA 4ZODA 3KE8A 1SUBA 3ZHOA 1T0PA 5CVJA 3BD7A 1G2PA 3I37X 1OB2A 1MDFA 1QCDA 1NJ6A 5KNBD 5CNJA 1S7GA 3SZOA 4K1XA 2ASEA 1KJ8A 2XIDA 2AMVA 4EKYA 2DX7A 1EM8B 1NHWA 2EGHA 3SDBA 4BO4A 2XE4A 1XG5A 4PG7A 4TLAA 1L5KA 4X64B 5TARA 2Y92A 4P7KA 2P2LA 4CKYA 3L04A 4RKQA 1YR7A 4GL4A 4GQBA 3N2EA 1KSFX 3R44A 1H8EA 4FC7A 4HZGA 3BORA 4ZYTA 2P11A 3ASUA 1KPHA 1EFVA 3NBXX 2VDMB 1E1YA 4QBKA 3K5PA 3GJ0A 5CH5A 1SCNE 2RGYA 1UAAA 5DNVA 4O63O 5AXAA 4EUKA 4C0BA 1EVZA 1KWGA 3GIJA 3EPJA 5BV8A 4CR7A 2ONKA 1KOLA 4X9XA 2HMAA 4UMVA 3CZQA 4ZKEA 2J45A 3K0HA 2G63A 4JC0A 3RLFA 1XTTA 3QG1A 3NV9A 4O4IB 5C3UA 4OOEA 4MV3A 1KDPA 3KJNA 2W2KA 5LKRA 1Y9JA 4ZCTA 3JPYA 3ZTWA 3EMBA 1KEVA 4F4DA 4V02A 1YE3A 3G2MA 1PJBA 5ADVA 1QYCA 1Q1ZA 1SBHA 3RBZA 3KOZA 4ECTA 2X0DA 3DA8A 2VDRB 4A2QA 4UHBA 1ZYUA 3CT6A 2OQ2A 5LP6F 1RJFA 3FTNA 3BILA 1JP7A 5L40A 2JLUA 1GR0A 2CK3D 1H4VB 2H1FA 3LAWA 3GEDA 1UBJS 4Z3DA 2RG7A 1JQ5A 4AXBA 2PEZA 2FN4A 4FMPA 5AI8A 4GPEA 2O20A 1TIBA 1QO7A 2FFBA 5LCXA 4BIIA 4F3TA 4QUAA 4E2WA 3WDSA 4W9RA 3KRTA 4FGJA 4HD8A 3JSXA 1EI9A 3VR6A 1XO1A 5CT9A 1QIMA 3M8KA 1QM5A 1EE1A 1BFKA 3O9VA 4UBCA 5I7SA 2XB2A 4KJZA 2C9CA 4M1ZA 3U37A 4Z4IA 1V4VA 1BFUA 5K4GA 1ECBA 2VJLA 4JBWA 1SOWA 3ODGA 5A4KA 2B92A 3WGZA 1O58A 1L8OA 3L4BA 5HE9A 1IC6A 2I6FA 3PR4A 3UENA 3RRGA 2OB2A 2YXEA 1U0EA 3HCBA 3KJEA 3OA2A 3KPWA 4RVCA 1KSPA 2F67A 4Z4GA 4WD3A 2AKEA 621PA 4QX6A 5CRIA 3PXGA 5FTLA 3T1NA 3VNQA 1FSZA 5J63A 3GP8A 3BJIC 1KZGB 2AGQA 2ZPTX 2C8LA 2B2NA 5IZCA 5F9NA 4F4IA 3UIEA 3QE4A 2YQEA 4EGAA 2HQBA 2W2TA 1Z4LA 1BPYA 4AJHA 4LHVA 2BZ1A 2HUNA 4EG0A 2CLSA 1YIAA 4JN6B 3SVZA 4JQCA 4K9NA 3PNOA 2FZKA 3D0OA 4JYPA 3IGFA 2WNHA 3MWLA 1XYGA 2O8DB 3O94A 2WHPA 2IOFK 3HVRA 4FBLA 3FW1A 4BY9E 1W88B 2A5DA 4CKCA 4NCJA 4V0LA 3FWYA 3HCRA 1C9EA 3BK2A 1C3OB 2HDOA 2OY0A 2XX3A 3K0KA 1XHFA 1WPGA 2O2JA 2XRMA 1SCAA 3HKEA 2JLQA 1JI7A 1FS5A 2FR1A 5TRTA 3FB1A 1RC8A 3QXXA 4DMUB 1D8AA 2W6JA 2HIMA 4M8LA 1F8UA 2VHJA 3U7FB 1ILEA 1KKXA 4INAA 5AUNB 5KJ1A 3EWIA 1FMTA 4HAIA 4C7BA 4KMSA 2PKEA 4TYWA 3RU3A 4H3VA 4CQMD 4KAFA 2IPNA 4H59A 5A2GA 1K2WA 4AM8A 4P0QB 4U2FA 4F9EA 1YFKA 4X7RA 5KTMA 3TANA 4B4KA 1H2BA 4PNEA 1DGJA 2XEDA 1XRLA 2EZTA 2NUPA 4JJKA 3KXPA 8ICQA 4JLJA 4EYEA 1VLQA 4PBRA 1XP5A 3X2EA 5IT0A 3ZKWB 3GJXC 2HA5A 3JZDA 5L9AA 2BM8A 3LVFO 1RPZA 4DDHA 1IN1A 3H0LB 2C2RA 2ID8A 5LYJF 3QY0A 3UXMA 2E8MA 2AZMA 3O26A 4QTZA 1ZQCA 4QGGA 5KC8A 3V55A 4F5WA 1MFPA 4WZAB 1BJRE 1UBMS 1PWYE 3E0FA 2D1QA 1U8YA 3IP7A 5BSEA 4Y6GB 3AUKA 4K9OA 5EJFA 5BOVA 2EKDA 3K70D 4E33A 1EQ2A 1TK8A 1DBIA 1OH6A 1WOYA 3QE3A 3RBAA 4HRAA 1VRCA 4X71A 3O6VA 3JD0A 4RY8A 5IVKA 4U0KA 4BNYA 2PGOA 2Z2KA 3ESBA 4MR7A 5DASA 3BHIA 2XGGA 3AETA 2GF0A 4FO6A 4CFSA 2C28A 3C5HA 3OVMA 3WL6A 3VX3A 4AMBA 1RTTA 4R40A 1AS3A 2P4EA 2A0UA 3WA7A 2OGSA 4OKNA 4IQUA 2W22A 4MI1A 3LHIA 2WIKA 2BI4A 1U99A 2VPXA 1XWWA 4JY7A 4HTAA 3GEIA 2ECKA 3R6WA 4G5GA 3IDSA 4L27A 5MFPA 3NI2A 5CITA 4QWAA 2V45A 1K6EA 5EIAA 5EKSA 5BQPA 3IIMA 1V9LA 2RKBA 5IABA 5LIRA 4AMGA 1ZO8A 4RBNA 4CL0A 4PPXA 3L0ZA 1Q50A 4C8NA 1J21A 4Y9SA 4AMVA 3STWA 3PLAE 1MFZA 3WADA 3FTFA 1QVAA 4XARA 1SXQA 2ZSBA 1KNQA 1ZXIA 5GJVC 1UBKS 4RPYA 2RHOA 2O3QA 5AICA 1SB8A 3ZY6A 3RB8A 4GZ6A 7MDHA 5KFAA 2HK7A 2E8NA 3EBLA 4YRIA 1SHKA 4N3GA 5DLEA 2D3DA 2NV3A 4NOJA 1YR8A 1QDEA 1H9AA 1JMVA 2DKOA 4EVQA 4K4HA 2I4IA 1NN3A 1SUDA 2OCPA 3T5MA 1LDMA 2W42A 3QLVC 1ONOA 2Z4RA 4RFVA 4OHXA 2C5FA 5ECGC 3EPKA 1D6JA 9ICWA 5DV9A 3K6SB 5C0YA 4C6TA 1LPBB 4A5SA 4C6SA 1DT5A 2ZATA 4TL8A 5ARDA 4AZWA 5H02A 3QV1A 1G19A 3R7DA 3RS7A 1SKUA 4DV6B 5AD1A 1T3SA 4IDBA 1V8DA 3OOWA 2VUHB 5FTNA 1MPXA 3JQAA 4KDCA 3W8NA 1YOBA 1DHRA 4DA6A 4XUEA 4FHEA 1XEWX 3I5AA 3MC1A 5BMVA 3SLGA 4NE2A 5KG2A 4EYIB 1GRCA 3LPCA 1E2PA 4BLSA 1PFQA 3UMYA 3CGWA 4HZUB 1KI6A 4QHSA 2E4WA 3AM4A 3E0XA 1CU1A 1OYWA 3TARA 4HQRA 2Z2JA 1PP4A 3BEOA 1Z13A 2J7KA 3RF6A 2I99A 4ZZ0A 3SHQA 2JJ1D 1Z29A 4DYHA 1PJQA 4HUJA 1PL8A 3ZNPA 5B6IA 2C0QA 4DEVA 2XXBA 3X2SA 2YMQA 1ZN9A 2Q6KA 1VLMA 4RTKA 4WN3A 2ADMA 2R6ZA 3E2PA 2JGRA 3NPMA 3IAUA 1K68A 2IU3A 3EVGA 3QHQA 4W6QA 1NY5A 5K9ZA 5KVVA 4WXYB 2VOJA 5E0OA 4AZ0A 2QYTA 1WCNA 1ZQ1A 1USGA 4KQEA 1CFJA 1J5EB 3C3EA 5BN5A 3AI1A 3IYLW 5G1OA 3NHPA 4A1FA 3O82A 2WINI 2OCEA 3G5UA 1UK7A 5ALSA 1QUEA 1UDCA 5T4BA 2IXDA 4KP7A 4U0JA 1SHUX 3ZOKA 3EG9B 3HB5X 4TSRA 2NQ8A 2OFXA 1RJGA 2GCGA 3KTFA 3UFXB 1JHRA 2NO9A 5LBTA 4JMPA 2VHCA 3BMQB 4MYHA 3FCUB 3NDPA 3BKXA 1XRMA 5H3LA 4GOLD 1XZEA 2QQ0A 4J9LA 2BFAA 4YA6A 5IJXA 3OTIA 1P9NA 4BQPA 1JIXA 4IDEA 3Q0TA 5E6RB 3OE5A 1I0ZA 1O5OA 2J0UA 2VDUE 4II3A 8ATCA 3COZA 1A7AA 3QVSA 2R6GA 3W5CA 4MW9A 4WOPA 2C57A 5FTWA 4KQIA 3M2TA 4AUEA 1N7JA 4BWFB 5KTYA 5KYYA 1ZCBA 1SKAA 1OXTA 2NADA 4IC9A 4C0SA 4LJAA 4JYAB 2V7WA 4LE2A 4FUTA 1DFIA 2C4NA 4G41A 3KQWA 4CW7A 2Y1KA 1CNEA 4MOWA 3QPDA 3ZLTA 4CFYA 3S40A 1CXZA 5G4KB 4E51A 5L3SA 2QG4A 1LTHR 1RWNA 4XX1A 4M0PA 1CUSA 3HWX1 4ABTA 4R81A 3O5AA 2EYUA 1QQ6A 4DOAA 5HILA 2BGMA 1ORIA 4WSOA 3G6KA 1MO2A 4RPCA 3WVNA 1KBUA 2C92A 2WSYB 3H4VA 1V35A 5LP6C 3EXAA 1L4BA 2Q5FA 4KCGA 4BX8A 3CH6A 2G0TA 1LRKA 4D4MA 1P6QA 1U47A 1YS7A 2O06A 3CBGA 1XQWA 5EERA 3BMCA 2W9BA 2YTZA 5JQGF 1G1MA 4A8PA 1UMBA 2ZCVA 5EKTA 3UXHA 1DUVG 3PE6A 3AFMA 4CM4B 1M2VB 1EK6A 2QTLA 1J2EA 4BWMA 5ESDA 2EP8A 5ARBA 5A7GA 2X42A 4IFTA 3ICQB 2O7QA 4P22A 4XQGA 2QBYA 4IWNA 1Z12A 4I2AA 4F3NA 4IIXA 4JROA 1XDZA 1R18A 4LRWA 1PFVA 1RAGA 1S9DA 2P7HA 2W04A 4WESB 1BGXT 3ZDDA 1ZL2A 5KHOC 5CLIA 1MP0A 3BXZA 1DPGA 4GAEA 1W4RA 2PA3A 3B1VA 5BT8A 2PKCA 1X1SA 5CXXA 1YVRA 4BX9A 4DT1A 4CQMA 3TQCA 1YDGA 4CTNA 5A9RA 5J2CA 2IEGA 3H84A 2FOIA 3FKSD 3SZLA 4LX8A 4RUAA 5ENZA 5JCOA 2V6FA 5E95A 4M49A 1KPGA 4MVCA 3M9NB 9ICNA 3IT1A 5BQXA 4IIUA 3AHEA 2QD4A 1DADA 2XLCA 5B57C 1AKVA 1STOA 4HYKA 1U63A 1Z74A 3F4BA 2C5HA 1MN6A 1K92A 5BW5A 2ZXHA 4I5GA 1OAOA 3FJYA 1G2QA 4R69A 5K8CA 3UCFA 5IYZF 1U48A 4EX6A 3UATA 4K6MA 1ECCA 4HHEA 4IBOA 5G0WA 1WXDA 2H4HA 2QRMA 3RAXA 1QC5A 1IWPB 3ZLUA 5G3ZA 3RYTC 5DGCA 3E6AA 4BCCA 3O03A 4RHFA 1AOXA 1E3TA 1LI4A 1EZ1A 5ALDA 1U8FO 1P2SA 3RW9A 1UXIA 1P6UA 1O9GA 4LGCA 4RNOA 4E94A 3V8BA 1FW8A 2B78A 2Q0SA 1Y63A 2BGUA 4DNPA 3EGIA 2ODBA 5NLLA 2BFEB 4DIMA 2FUG1 1G20E 3GZ4A 3IAHA 2AE2A 4BC1A 2CE2X 2HJGA 2EH9A 1V97A 1P77A 5AK6A 3IQIX 4BV8A 3OUZA 3EZ5A 4UHEA 2IP2A 2YWRA 1O03A 4KAAA 3ZXIA 4W5NA 1HG0A 1XJQA 3A2LA 1TFRA 2R8XA 2D7JA 1ZA1A 3WTCA 5GIOE 1P1CA 4PAWA 2HRRA 2PGDA 1C8KA 4PX9A 3R77A 4L22A 3I9KA 1B0UA 1FX1A 1PEYA 2ZS9A 3EQ7A 1PG5A 1E2JA 2ODPA 4WK4B 2N46A 3WTBA 521PA 4ARBA 4GRIA 5AKJA 4XIGS 3JYLA 4QJ4A 2A35A 3DLPX 1JA0A 3NETA 3SC6A 2ZBRA 4I2IA 4YFYA 2XYRA 4P0PA 5EXDA 2ZT6A 2PT7A 5JNWA 4KO3S 3A7EA 1VQ1A 1ANKA 1P7VA 3TIGA 2YX1A 3U17A 4RVDA 2ACKA 4XQ9A 4OAQA 4F5QA 2QQGA 3JQGA 3VHRA 3CP8A 3DC2A 1YIDA 3LIPA 5FOXA 2JH3A 1QGDA 4YPOA 2VQ3A 2QRLA 2X0FA 1KEPA 4C2TA 5GGYA 1UAYA 3NHWA 4XRHA 5BVHA 3QWAA 1UK6A 3WKCA 2QRUA 3ADBA 2Q3EA 2FQWA 1WSAA 5HS4A 3ZE2B 3T38A 3UAYA 1NLYA 2A1JB 3GAZA 4QUBA 2B7BA 4MDYA 1M6YA 1FFDA 3SC2B 3ORHA 4LFBB 3BQTA 2X13A 4Z86A 4ZC1A 4L74A 5T6MA 2FPIB 3GLUA 2GDZA 2XWQA 3FIUA 1U5CA 1CDZA 2QPTA 4ECUA 3RS5A 1N5RA 1WAMA 2J9FB 3ZBQA 2ZJ8A 4Y2UA 4U9UA 3WWYA 5H16A 5BNFA 4BN5A 1KSJA 3M4JA 3CF4A 1EFPA 3C0KA 4P0TA 3W6OA 4EW2A 3RO7A 3PFIA 1IEWA 3CF0A 1MV5A 2EFDB 1EQAA 5B58C 2ZAOA 1NUHA 4HXFB 1ZIOA 4AF7A 3MQ4A 2YB1A 5J2IA 2HPHA 3B36A 5EWLB 1LBIA 4Q02A 1LK0A 2VWQA 2HHUA 1EX9A 7MHTA 3Q3EA 1OVGA 2N47A 3H19A 2VJBA 1Q12A 2IC5A 1JEOA 1UJCA 1YWGO 4D96A 5FH9A 2C03A 2ZRJA 2IU6A 4F6RA 4QZGA 1G64A 2IZ0A 3N6RA 1LU9A 3L77A 1K8RA 4TX1A 1HFWA 2BE9A 4EJ6A 3GLVA 4PLZA 2Q2QA 1AGNA 4HDQB 4O2AB 1UQRA 2C29D 2VJQA 5C46F 2JLCA 1FUYB 4JU9A 2M9NA 3KSZO 3SR6A 3FTEA 3AERB 1B76A 3P9NA 421PA 2HJWA 4B9MA 1H38A 4IHQA 5MGBA 1CBUA 4NCIA 1NJ8A 2D1SA 1GZUA 1T1EA 4A8JA 4DNXA 4PRYA 4AUMA 1U28C 4YAUA 3O8NA 3PI6A 3W2IA 1WXHA 1K4MA 3R6LA 2BH2A 2I0FA 3JQ8A 1J42A 1R37A 3WRYA 1T9BA 2YIVX 3GLIB 4JV1A 4GX1A 4KGZA 2OHVA 3UH1A 2G09A 3PXDA 4TL9A 2G1JA 1I3LA 1E9AA 2AH5A 1KYIA 3IVAA 3IE1A 1H2HA 1UJ2A 2RGXA 3JZIA 3QJGA 1AG9A 9ICAA 4KLLA 1SPXA 3V4VB 3KUXA 5L6LB 1VECA 1M2NA 3C28A 5JH7F 4ZO7A 5J2UB 5KX5A 3VR6H 5J2TF 3JAKB 4B8YA 4UBOA 5EIBC 1MENA 1YK0A 2Z3VA 1XNHA 5ILGA 4A0FA 5TQJA 1Y8CA 3H6KA 4WDQA 1Z6YA 3CH4B 2Z8ZA 2UVWA 2HLDA 4IY1A 3VVBA 2IUSA 2QMHA 1JEAA 3RM3A 1BXGB 3SU8A 3BJMA 5GIPE 3W6NA 4WQMA 4TTRA 1UBTS 4YV7A 4DR7B 3RB4A 5AKLA 1PGPA 2BDPA 3OIYA 2I91A 4NP6A 4IIGA 1ZQXA 3KT8A 2Y93A 4OQZA 1QG2A 5IBRA 1YKFA 3NH6A 1ZN2A 2IHZA 5LDGA 1JMYA 4ZRNA 4MVJG 2LV8A 4PR0A 3LCJA 4XGRA 2A59A 3H7AA 4DHWA 3E2IA 4GFJA 4D3FA 4PC6A 1G291 5DGIA 3P0FA 2XSZD 3IOCA 2REQB 2BGKA 1FUUA 4E08A 4P7JA 4O0LA 1WCWA 4HYYA 4NH0A 1OA0A 1F44A 3DXYA 1X40A 1RPTA 1E3DA 1OH7A 2K60A 2GNAA 3KXLA 2F8TA 5INTA 3HABA 2VP6A 2HNBA 4LHEA 4NATA 1E66A 2VWPA 3AVYA 3OZCA 1PR5A 3MGKA 1E9EA 3QFTA 5BSMA 1XXLA 3PVCA 5HTOA 4ECAA 2R751 3G5MA 4N0MA 4TXNA 5BRJA 3FKSA 2AI2A 5CA1B 4MV9A 4JMUA 4CG1A 1E2NA 5JSFA 2EHJA 4XGNA 1DTSA 4C7OA 2Y0BA 2NYRA 3VHXA 4PO9A 2I2XB 4UW9A 1KJNA 4UNPA 3EC2A 1PJSA 7ICFA 3KPYA 3WB2A 4U2GA 5AUOB 4BKOA 3PSFA 3RH5A 1ZX1A 3S5UA 3CYMA 3NDIA 4I28A 3S2SA 1OPXA 4DDTA 1L5GB 4ZREA 1NMQA 4ZAZA 5KJFA 3UCXA 4FYWA 1P1RA 4QFCA 1NJXA 5FBWB 5KMGB 2IZ5A 2JFFA 4PTZA 2ATVA 1BC5A 4R64A 4I8IA 4KV9A 4BUZA 4LYYA 1J2MA 1YMVA 5J58A 4OGLA 4DA4A 4M9ZA 3C4QA 3GMSA 1L5RA 2AJDA 1IL0A 1MABB 4X45A 4ZDKA 3CLUD 4KIUA 2BI8A 2HTFA 1GUZA 4ZI7F 1CJKC 1EUDB 2VK4A 1SKMA 4UMDA 1L7RA 4L0MA 2LHTA 3VYVA 3OEYA 4MGKR 1RWVA 1WPXA 4EO7A 2VXYA 4HGNA 4JXKA 4KG7A 3DBLA 3QYFA 3GJQA 4EW3A 1UP6A 2O7NA 4DWOA 1LNSA 4O4LA 3S7TA 2MSEB 2BBSA 4PX2A 5JD6A 5JECA 4EKNB 4I5DA 1TM1E 4EIWA 4Z6EA 3DBRA 2FRDC 2ZIUA 4YP5A 3TZHA 1HRDA 3WMGA 3HX0A 5LWQA 3LRXA 2F8SA 2WYHA 3QTLA 5EPUA 1S2LA 3SJAA 1AGPA 1ZKDA 3A1WA 2O5EA 4S1PA 2LPMA 3MUFA 1Q7CA 1ORWA 1E5TA 3DFIA 1NAHA 4CCYA 3VJRA 1KI1A 2QE6A 1D9DA 2AGPA 3RB3A 4XWYA 1ZQJA 2WFLB 1V1MA 5AVUA 1JHDA 2A30A 5AO9A 2F44A 2FF5A 4WKGA 1R5BA 3O93A 4JJ6A 3VR5D 3NFRA 3MUNA 9ICGA 3NYQA 3TQRA 5T4FA 2ERYA 3O1JC 1L4GA 1U7UA 3I01A 1QK4A 3QKRB 4IMIB 5CFRA 2YJ4A 3MCAA 3CS3A 3HH8A 4X93A 2EBWA 1NDUA 4AYWA 5HHIA 4LS3A 4K9PA 3F97A 3IODA 1IQPA 1ZFNA 1Z8DA 1YZNA 2QAGC 3N05A 3C5VA 2XWSA 5IVPA 4QXPA 5HR7A 2HPAA 2PT9A 2HTEA 4NEQA 1OZAA 1DBSA 3NTQA 5AQEA 3QPBA 2H3ZA 1CX9B 3QK7A 1KSGA 2ZRIA 1DDOA 3RAEC 4UPVA 3QU2A 1IXRC 1JALA 4HX2A 2X7JA 5K45A 1ND5A 5DT9A 5BVGA 2QE7D 4MZDA 1N8SA 4AKGA 3Q9NA 3SYRA 2GYVA 4B9AA 4J9KA 1QQAA 3WX0A 1O9HA 2IVFA 4CDMA 1BA2A 1PFWA 1R1DA 3V2IA 1AO3A 2FRVA 5AQ1A 4YR7A 4BDPA 5C7IO 4X6LA 3AJ8A 4ODIA 1NOJA 2GBCA 4PG6A 4EX7A 3MCWA 2Y4NA 1J70A 4RQ4A 2XY5A 1Z4MA 1GU0A 2C0CA 3PQ5A 4R1MA 3WKBA 1VI2A 4W5RA 1P4HA 3TQTA 3T7IA 1KWKA 3ULKA 1SBTA 1BXZA 4TXMA 4I36A 4BC0A 2N0SA 2ZWMA 4AXXA 3EVCA 2WJIA 5AKKA 4LXHA 1H2XA 2P90A 2ZPAA 5JHHB 2FQ1A 4KU4A 5TB5A 3L92A 1XDDA 3IC5A 2HXYA 2VSOA 4MWCA 1DKPA 3IP9A 1E77A 2O2XA 4OQPA 1P4JA 4QWMA 1ZNWA 3ZCQA 2VCEA 1YQXA 2R8ZA 1E2HA 3BWMA 5YASA 1NDHA 2C7RA 4TZ0A 4JUIA 4TOIA 5FWNA 1U2GA 2FPMA 4FNMA 3KUUA 4ENQA 2D2FA 4JWNA 2NP6A 4YTEA 3PF9A 3V7LA 3WLFA 5J0WA 1VA5A 1W8IA 4JOSA 2IEYA 4FFVA 3JAWA 3KC2A 1AK2A 4UCXA 4BNLA 4RDIA 3SQXA 2B5VA 4YR0A 5AUQA 3NC1C 3NIBA 1Y4UA 1XZFA 1WABA 3WDKA 3MS2A 1DLJA 4UXHA 4LZJA 1KFKB 2Q4BA 3CN7A 4UE6A 3GLFE 2C2HA 3TUIC 3N8GA 4MP8A 5B3LA 3E7DA 1C8VB 3NHRA 3K8OE 1JYFA 1ACMA 3RJ5A 4RA6A 4BL5A 3EGEA 2V6MA 4Y2RA 2V4QA 2VLBA 4CV0A 2ZE7A 3K92A 4RQ2A 4D74A 1YOVB 5GV7A 5F73A 1H2ZA 4AC9A 5HZGA 3L5KA 3IP4B 1MIHA 3DHWC 3PDCA 3SEIA 1CRXA 1BN6A 1NVVQ 1XYYA 3JX9A 3P0JA 3RS3A 3G59A 3ENQA 2O57A 1FUEA 4MWDA 5JMPA 4YB8A 2BQ3A 5FRDA 4PXSA 1RACA 2Q7OE 1CR2A 1WJGA 1MRZA 1Z2DA 4KQFA 1U7XA 4ZYZA 1XX6A 2P3LA 3PQ3A 4MR8A 2HT6A 3BUSA 3NHAA 4CPDA 3K15A 2D7CA 4UNQA 3G68A 4IJKA 3H8VA 5KHAA 4CV3A 4KO8A 2RQ5A 5FHRA 4Z7NB 3OUTA 1WZEA 1PJLA 3RNOA 2J3LA 4RZSA 4HT3B 4HB2A 5IM4A 4IR7A 3GLQA 3LO5A 2I8AA 1M0SA 3EPHA 3IP3A 2HBJA 3S44A 1UIMA 1T25A 5IN4A 1K97A 4URYR 2H1RA 4DZRA 3KWMA 3NW9A 2XSZA 2VSQA 2ZU6A 4G09A 5J4YA 4BVAA 4TSFA 4WAUA 1NN1A 2GKOA 1P8AA 4ICIA 4N1AA 1CY0A 3DEAA 2UVQA 4JNCA 4QGHA 2WICA 3AILA 4GVPA 3QFRA 3RANA 1ATZA 2UUPA 1ULHA 4PQRA 2ZYVX 4NMHA 4FM9A 1LFAA 1MNQA 4Q7MB 3FUCA 1T9HA 4AIRA 4EJMA 1KFSA 3VTAA 4DE5A 3RU9A 1WXXA 1BDBA 2IHNA 3MBKA 1OZHA 1CZKA 2HRBA 3L7MA 3AB8A 2YWEA 2HKIA 5D7BA 4RMIA 2BH9A 4ZYVA 3DXXA 5JJBA 4OM8A 1TD1A 5KFZA 4WEOA 4KOEC 5CTJA 1NX6A 5BQ3A 1GL9B 4TM8A 1JROA 4Z2YA 1VJ0A 3NQ41 1B1AA 4GR5A 3KQTA 3W7AA 1UDAA 4C04A 2C3PA 3ROEA 3AEKA 5IKOA 1OFUA 3U3XA 1CD5A 2HNAA 3AUFA 3HYRA 3BFXA 8ICWA 4Z3OA 4JSTA 2XJ9A 5HCIA 4D5GA 4ZQHA 4BJQA 2D0IA 2SCUB 2O6HA 2GR9A 2DVMA 4FDMA 3KELA 2JCYA 2KV2A 2FW1A 3C23A 2ST1A 4I8XA 2DFPA 1KL7A 2P5YA 3K1RB 4D5EA 5TQ0B 2AYYA 4B3RB 4Q1BA 2BFFA 1C8BA 4QOIA 3RUAA 1U31A 3DAPA 3Q6NA 2XOKA 5KFGA 3PVXA 4NBSA 5CJJA 3RRHA 3M5PA 2ZJZA 3NT2A 3JW8A 5J2BA 3R2JA 1SBYA 1D1QA 1WB9A 2OHOA 3U44A 1JA1A 4BYGA 1PN3A 3H4BA 1PUXA 3A6LA 4J07A 1FA9A 4IKOA 3NHUA 1FDUA 3DE0X 2PTGA 3ST7A 3K9WA 3PKZA 9ICRA 1EXMA 3FPCA 3W3AD 1AKTA 5KFKA 4L75A 1DWUA 3MMXA 3A1TA 3H5AA 1D2MA 4ZAXA 1W0KA 4K6FA 4G5RA 2REXB 1UMKA 4UAJA 1EVQA 2GDJA 2O52A 2JCGA 1W36D 4DY4A 3WE7A 2WAAA 3OMXA 1QP7A 1ZZEA 4QRDA 4UUMA 3ASZA 4EPWA 3IPAA 4F91B 1RHUA 1ISJA 3MMPA 2X0KA 4Z1OA 1H6CA 3FLMA 3C21A 4Q7QA 1A5BB 2JL1A 3RWMB 2W70A 4EMTA 2OYCA 1FK8A 1SA0B 1YQWA 3IKTA 2G88A 4D57A 4NM2A 5IANA 4GRDA 4JR2A 4AJKA 3U7GA 1SFRA 4CMEA 4DB4A 2PL1A 4KVZA 4LNHA 1HNNA 4ZCRA 1P17A 4D02A 5FEMA 2Q6IA 1ISPA 2QWXA 1X8JA 3FNIA 3GZNA 3RABA 2ABWA 1JHOA 4S3MA 4Q4JA 1A0OA 2IKQA 1FOEB 2Z83A 1DX4A 1DCTA 2BL4A 4GOMD 1FFAA 4HFJA 4YRTA 2IOQA 2VUTA 2YIJA 1IUKA 2JKZA 3I4FA 2ZRBA 3D2NA 3ED5A 4LY6A 2XBUA 4WJ3B 4I3FA 3OURA 3QNUA 4BXOB 4GX5A 4EJFA 2FJ6A 1C3JA 3EVBA 4FCCA 5IIJA 4XYGA 4N0QA 2X4DA 3I39X 1OTXA 4E7PA 1Q91A 1QH1A 3V8PA 2F9FA 4DCGA 2IDJA 1PCXA 3ER9A 1WDTA 3BICA 1LRJA 3KQYA 4RM2A 1IK4A 5CB0A 3BE5A 4CM6A 3FZEA 4OL9A 3HDYA 1P1FA 4WCVA 1E6LA 1EVLA 1N25A 1JEYA 4OQMA 5G2OA 4J7CA 2JV3A 1EX6A 4RD3A 1ADYA 3SFTA 2B6GA 2CSXA 1VZ2A 4WJKB 1FFWA 3NCHA 3PW5A 4WY8A 4PAOA 4B85A 1NM5A 3OEHD 4XR4A 4JI7B 3WMEA 5HKOA 2G9UA 1I6WA 1P1HA 1FO4A 3ZUGA 2CV0A 4CKWB 4KN4A 2WDZA 1QGUA 5B37A 2WZBA 4XA8A 3MJHA 4WE3A 3IP8A 1PZHA 1P7CA 3N74A 2VZ9A 5AI4A 4HCJA 4PZYA 2X14A 1EKXA 1P91A 4BAGA 3RV4A 4X7MA 4BVKA 1GAXA 5D49A 3TLYA 1JF8A 3EIWA 2PLAA 1NE2A 1X87A 3G2KA 5DNYB 3OE7D 4MW2A 3BTUA 1PYOA 2PZMA 4N01A 2JD2A 3AM3A 3OZBA 3IO5A 4DMFA 3QVMA 3I2IA 4QZCA 4PEVA 3TIFA 5KQLA 3GBSA 5DF1A 3CE6A 3I9LA 4JH0A 1Z6TA 3GCDA 2H8KA 2MDTA 3QBEA 4ZGBA 2C5LA 3OQIB 2GX6A 4U6QA 1B73A 1XZQA 1HQCA 2XF8A 3GIMA 5JEDA 4YRSA 3HJAA 4EOGA 1LXCA 2ALZA 5AHXA 1WMSA 1V1JA 2CNNA 2RIPA 2CJXA 3GAMA 3OJEA 3SIPA 3EN0A 2H52A 4ZO9A 3D0KA 5KCMA 4KHPB 5AXDA 5F2KA 3VAYA 2RC5A 4M0DA 4HX5A 4AS3A 4R2WA 4JI1B 1OH5A 1PD0A 1NC1A 2UU9B 1FW6A 1YVPA 1DJLA 3B3GA 1DP4A 5A1TA 5CFMA 3NIWA 3VO1A 2GWHA 4H6VA 5JXGA 1QUFA 2H7XA 2VP9A 1JJAA 1XZKA 1RBMA 3PDIB 4N5IX 1OROA 3LUCA 4PCLA 2B37A 1Y9DA 2QN7A 2EYQA 4RA9B 2O8NA 3H2SA 1PFKA 3W8FA 4QOJA 4J0GA 4AURA 2HF2A 3FSGA 3JPPA 2UYGA 1Q7GA 4AF8A 4YUVA 3ETCA 3DHVA 1Z7EA 3BL6A 4K5QA 5E79U 2J31A 1KI7A 1N8KA 2YZNA 3D7KA 1LPSA 1NSTA 4MSUA 4DA8A 2JLYA 3PR3A 1IEVA 2CFCA 1XMVA 1QZXA 1JXEA 3CBQA 4D6PA 4X97A 4XDYA 2FPLA 1TK3A 3ZCPA 2CXPA 5I8PA 3ZR4B 3IHKA 4WVLA 4ZIRA 1FP1D 1UJNA 1ZQAA 3R8XA 2VF4X 1U90A 4LBWA 2QXTA 2M6LA 5GONF 3DDZX 3K2QA 4UFOA 4FE4A 4DMHA 2NSHA 1MJNA 4YMIA 1P3DA 3LNCA 3OJWA 4U9IS 2IV3A 3DXFA 1NW6A 3U62A 1JMSA 1KVRA 1NNI1 4FWBA 5KFIA 4P53A 1Y4AE 4ACAA 3HRIA 3CV3A 1ZQMA 4BVEA 2DWCA 4V38A 3PXXA 5LJLA 1MVOA 4MR9A 5TC4A 4B75A 3PGKA 3HY6A 2XLBA 4NNOA 4B6OA 1C7RA 5LZ8A 3CSSA 1GDHA 1NQXA 1TM5E 2F9MA 2XODA 3VCBA 5EXXA 3TS1A 2VZ0A 1TVEA 2JZCA 1Q0LA 1W19A 3PV8A 1MU0A 3V48A 3HJUA 2ZI3A 3MAGA 2IV2X 5DLPA 4OUDA 5EJIA 4R9SA 5BWBA 2C22A 4FFSA 3NUQA 5F12A 3AIMA 3WYDA 3GN2A 4JC5A 1Y3FE 2J3KA 2Q46A 1G98A 5CK4A 2BGRA 3BRCA 3LY5A 2DMRA 3PNBA 2HA2A 4MYCA 1IHOA 2YRXA 5L3QA 1P4AA 2BVNA 1TDJA 3NC0C 2WPDD 3C6BA 1L1EA 3CLSD 4QREA 1H22A 2OFPA 5DYGA 5B1EA 3S8EA 4WVFA 1ZH6A 3PPXA 3H18A 5EXSA 4MUEA 3OGUA 1LQ2A 2YL2A 2BQUA 2XUPA 4L5CA 1QF9A 3MABA 1B8NA 3D8BA 1TF2A 2CVFA 5CFLA 1L5OA 3C8DA 3KZKA 1TYCA 1E5DA 3PUIA 3E1GA 4KFUA 2QW1A 1ZGJA 1I4WA 4G6ZA 1RAEA 4NH4A 1A8UA 2A86A 1ES9A 2TMGA 4UULA 4J29A 4CMKA 2XQFA 3TFQA 3V4OA 5DOZA 3W90A 3KHTA 4C5AA 2V7VA 5THQA 2E4UA 3RVQA 3FFBA 2R6HA 4KRGA 5JD4A 4ECRA 1XKXA 1D9FA 3WRXC 4GH5A 2O54A 3T5BA 5F7XA 3QUQA 3VH1A 4F45A 5AVXA 3IT3A 3KYCB 1NXWA 3NIFB 2C3YA 1E7RA 3RD5A 4K9LA 2CSUA 5BT9A 4HDOB 2QTBA 1S7CA 4URZR 3CRZA 3I5YA 1U02A 3W3AA 1CB0A 3B78A 4NY1A 3FPSA 3RYFB 4Y2QA 3JQ9C 2AOVA 4BEWA 4JMLA 3BWCA 2PS9A 2QZSA 3ZZ1A 3KZNA 4BO1A 4M1EA 3NDJA 4IDPA 1X7ZA 1DO8A 5J4VA 1M5TA 1S6YA 1YB7A 3NS7A 1GNPA 4CT4B 1V3UA 5IVDA 2IY7A 2C3UA 3VR1A 3UAXA 4C7ZA 1Z18A 3UJPA 3ZCSA 4GICA 3EXHA 4RH3A 3UAWA 4ZT6A 1BRTA 1OJ7A 3DUFB 3LCUA 5JDCA 1NUAA 2ZROA 4AN1A 5CTAA 3AF1A 4D8VA 4YUWA 5IFLA 2BM9A 4N18A 1W9MA 1E0DA 3K2EA 1GOTA 2F64A 4K28A 2R1VB 5KNBA 2QKQA 1VSTA 3NOVA 1JHVA 3D6MA 3T5JA 7ICQA 2FWBA 4G24A 4M0CA 5FI1B 8ICSA 2R1UA 5B3JC 2VQFB 2PL5A 4PGGA 1AMNA 3ZTTA 3DLCA 2ZSUA 5FUQA 5IT9A 3HSSA 4QRHA 4WKPA 4FZ5A 3KOXA 4NM1A 5E6SA 2F8MA 1DIAA 1QH8B 5IN5A 4RK4A 4BLOA 2YYAA 2W7PA 4P7FA 1CYDA 3WICA 2UYOA 2A0YA 1FFXA 2UZ1B 1QQBA 5TXGA 1S8NA 3FOZA 2PFOA 4K3UA 2R3SA 1SXJE 2FWMX 4A1OA 3PEWA 2EL9A 4FMCF 1NPYA 4Q1EA 1NR5A 4YPFA 4UVEA 3L93A 2GMWA 4DIDA 2E4ZA 1TX4B 1LZLA 1E0KA 1XWIA 4LSGA 4P4PA 3DFMA 5G40A 3ZU4A 1G6OA 3BSFA 3PWKA 3AINA 1VBKA 3QVXA 4H2DA 5KJEA 4F93B 2J6CA 1V37A 5KWEA 2A33A 4BNIA 3P19A 1V16A 5JW6A 4D3YA 3MNFA 1WR8A 5EG5A 4E13A 2C04A 2BIFA 4Q15A 4RD1A 3OE7A 3TBFA 1IZ8A 5DBIA 1LV8A 3IUJA 1B14A 4CKBA 3IX7A 2CCJA 3RTBA 1I3OA 5IDQA 2CK3A 1U8ZA 4RVNA 4V0NA 4B3FX 1GDTA 1LLDA 4J2OA 4HNAB 4FZJA 4DFKA 4M0FA 2L19A 3WV5A 3C7AA 4WZBA 2WR8A 1JU4A 4MRNA 1A76A 3KPUA 2P66A 1Y8RB 2YMLA 5BSVA 4QWBA 4MZXA 2W6QA 5LB2A 3WL8A 1YR3A 4F2RA 2WM9B 3A2KA 3LE8A 4NZMA 1YQUA 5IS2A 3UQ2A 3I09A 3W8DA 1HA3A 3SD7A 3G3EA 3Q6IA 1CUAA 3P2YA 2QNIA 5U4QA 1VG9B 5CA7A 1UM9B 1HQYE 3VPSA 4EW6A 5EZYF 3OECA 4NLZA 1EIZA 3PHHA 5FA5A 1ZQLA 2JGNA 1GQQA 5ALPA 2I6QA 4JT8A 4NDZA 1YACA 1G21B 2W8ZA 5KYXB 3P26A 2G9QA 1RJEA 1FPQA 4DOCA 3H2HA 5EXPA 2FN3A 2WAOA 1GPNA 5CFQA 4TUYA 1NF2A 1A1VA 3PQ2A 1NT2A 2C9ZA 2P30A 3JPWA 3OKCA 5EWJB 3VU1A 5JARA 4Q7EA 4M98A 1ECLA 4TMVA 2VF2A 5CIWA 4ENUA 1PR1A 3K0SA 2BFNA 2WJVA 4J7XA 4ZN6A 2NZYA 2YUIA 3HMKA 4TV8B 1BEEA 1T1JA 3RVOA 3S2FA 1IDN1 2ZYDA 5HZKA 1TMOA 3O92A 4LA4A 4ED1A 4A16A 1M66A 4PYRA 2PZAA 3DOOA 2IEDA 3VMFA 4ED3A 3N5CA 2HCRA 5EJ2A 3RTGA 1DWOA 2Q2NA 4WWHA 4I1VA 4FIZA 5DG7A 2PGIA 1E1CA 3LNTA 3O7WA 1NF8A 3KQNA 1DEHA 2K89A 3G5TA 1XDBA 3WHKA 3Q15C 3CF6R 3R23A 2MR5A 4OHKA 1NK4A 5CB4F 3COSA 1VXOA 1URJA 3LI2A 5LQNA 2II6A 3VJKA 2AMJA 5T4EA 2W9AA 3WC4A 4DDKA 1A96A 4JI0B 2YHAA 3RU2A 5IW8A 4WBNA 1SHTX 4E7OA 5BOMA 1U1CA 2QVLA 2CDCA 5IAKA 1HDGO 1P44A 1IIBA 1L5MA 2H4JA 1LWOA 3ID6C 1KMHB 4UQGA 3HCPA 4M0KA 2LCFA 1E1LA 4PXAA 3ZXXA 3IQGX 3GRRA 2RLTA 3V6MA 3AL0C 2OUIA 4MULA 1GM5A 1E89A 3Q8RB 3QNWA 3NZEA 1Y7PA 3ZG6A 4C3ZA 2MUTB 3I52A 2VUUA 4MKRA 4NYMR 5LXTA 4D9BA 1EDDA 4M8KA 1T1IA 2VK2A 4USAA 4FFBA 3PJRA 1B8UA 1LPOA 3SAFA 1O7JA 3QTTA 4L4UA 3H99A 1CJCA 4ZQBA 1ZQNA 2C2WA 3FFTA 2HSGA 4BJ6A 5JNVA 4Z4CA 4YY3B 1X92A 3C3BA 4HKTA 3KOUA 1C1HA 4RNDB 1ESCA 3PC2A 1PLLA 2EX0A 3NCTA 2ACWA 3PB3A 5AJXA 4KGDA 5D5QA 1FY2A 2WPDA 4MQFB 3VAZA 1M33A 1Q92A 4BFZA 3ZHRA 5JAIA 1AZLA 1GUBA 3EUWA 1EX1A 3T3NA 3SAHA 5TT1A 3VO8A 4PZ9A 2I4MA 4X85A 1OLUA 2BR3A 3FDJA 1U8CB 4F3KA 3V9PA 4AWXA 1M6NA 4AYTA 1OQAA 4ME6A 4NLNA 4I6JA 4UTRA 3DMHA 2AK2A 4UHKA 3REFA 4N0PA 4MKIA 1ZQOA 1L7QA 4KYIB 3T9EA 5T4HA 3BXXA 3MFIA 5EZSA 2A58A 2YJ5A 1G8KA 2PANA 4WKCA 4LY0A 4RU9A 1B3RA 1VG1A 3M7IA 1CDOA 4Z7QB 3Q88A 5IINA 3DKRA 3EJ6A 4YRBA 2IFTA 4M4SA 1C81A 5BN3A 5BSHA 4MKZA 4EA7A 3GROA 3C98A 1KO7A 1OXVA 4HNVA 1X3LA 4NX2A 3FR8A 1JLSA 5BV7A 3BMOB 3IEIA 3AVOA 1II9A 3H5VA 4LVOA 3TCKA 3LC7O 3OQPA 1RWKA 3H2ZA 1KS2A 2KE7A 1JQLB 3LW8A 1QF7A 1Z4KA 3UB3A 4C3OB 3M6VA 3NAMA 3CUWA 1J2UA 5AP9A 2C7PA 4HH0A 8ICRA 3VNUA 3I61A 4JVNA 4KEAA 3TEMA 3D0QA 1QPZA 1CKEA 1M6VA 3TSWA 1YI1A 7ICPA 1OI4A 1PKXA 5HGJA 2V3CC 3L8GA 1CY7A 5DGAA 2J5QA 2RHDA 1JQKA 2BCUA 1NULA 2CLFB 4LSMA 5JUMA 4P3NA 2QVXX 1KERA 3GNTA 4AY4A 2KHQA 3WL5A 1P0MA 4NULA 4ZQIA 3A1NA 7ICRA 3MLEA 2CLDX 2A3RA 1H8HD 5LB4A 5LD2B 3CEHA 2AHOB 4RQ3A 1CUUA 2FE1A 4AKEA 1Y6RA 2ZR8A 1G4AE 2AFHB 2IEIA 1QHHB 1CJTC 4C4ZA 1T0IA 1R00A 1IHPA 3F8TA 5K0CA 1LBTA 4U6SA 3RUIA 5G1PA 4I7EA 2XYHA 2AV6A 1FRFS 2GETA 3C3AA 5L3RA 5JAZA 4XVUA 1FBTA 3DE7X 3KVNA 3MT0A 2HFJA 4C30A 4M9QA 3LWBA 2WOOA 1CETA 1U4OA 3LPAA 4WTOA 4OLBA 4IJMA 1SM4A 1XLTA 4PO1A 2AYXA 4Z6FA 3BXGA 1Z00A 2VDVE 4N3AA 2B6NA 3BWXA 4EUEA 3GFRA 2VANA 1K7SN 4BOYA 2FLWA 3TNJA 4RT3A 4KACA 1CR0A 3K73O 4JGGA 4PHAA 1CK4A 1VCHA 3IUSA 4RMHA 2HA3A 2HXGA 3TD6A 2JJ1A 3HJTA 1C30A 5ALFA 4PTLA 1JSRA 4LZDA 4AP5A 1Q46A 2OQIA 5IVHA 4GSYA 2VNAA 4NZYA 4EW1A 3EA4A 1V0JA 5JNTA 4Y1GA 2VJ4A 4P4UA 2KLBA 5KQSA 5DDYA 2HA0A 2QUBA 3K75D 3BQ0A 3A3PA 4I08A 1W44A 1Z19A 4YAJA 1NP6A 4Q3LA 5TVGA 5IBQA 2K8BB 2HO5A 3PX4A 4J0QA 2JEIA 3WXBA 1HWYA 3ETGA 3INGA 3FWPA 3CUTA 1BCRB 4Z51A 3QVUA 2ZJ2A 3UK0A 1RMQA 4NYJQ 2QQEA 2W43A 5AW8A 1CT9A 3LX4A 2G7MC 4FHDA 5B7GA 3UGKA 2DL0A 2UVVA 4P92A 1Y3IA 1SUPA 4MFCA 1B74A 4RZIA 4UDYX 2F43B 4G07A 4MAMA 1E5VA 2NU9A 4PFQA 2KIWA 4INOA 5FORA 2QRHA 1GILA 3LUGA 4ECYA 4TMWA 4EUSA 3QKSB 5KU1A 3RS0A 2C2GA 3ZVLA 5KG5A 2ZI5A 4YLGA 3C8UA 3ERCA 4Q7KA 4OQNA 4FWIB 4C89A 2D0DA 1QWSA 1X7YA 1N9GB 1OLSB 5BRNA 5LBUA 1QO0D 3H2BA 4M0MA 1CI4A 3ABZA 2MINA 4QJ5A 4IZ6A 4Q9HA 2IIPA 2EWMA 1CF9A 1WEKA 1VPVA 4B6SA 2OT3B 3EGCA 2L69A 3KU4A 1M2OA 2QM7A 5F9FA 2A0FA 1QIKA 4PO8A 5CH3A 2PKQO 2ZIWA 4QL3A 3GV5B 3TM4A 2DQZA 2QJOA 4FSHA 2ZIVB 3HBAA 4PIPA 4N8DA 1V8PA 2IBSA 1BW9A 3HSKA 3VNRA 5LMNB 4M89A 5IDVA 4EA9A 2RH4A 1X8XA 1P6XA 1XEXB 1DELA 2WYUA 2O8CA 3J81k 4IS2A 3ICXA 4K86A 3O8QB 3M89A 2E9SA 2IXFA 4YQWA 2ZRDA 4LECA 2CFTA 2PZFA 2YICA 4OG2A 2JMGA 2OV6A 4WDRA 2DUMA 5DPMA 5FNVF 1KVUA 3T7JA 2HWXA 2Q3LA 3W5HA 5CA0B 4KLFA 4NNPA 3DTNA 3ZGZA 2IL1A 2XADA 1RLUA 2VJMA 1JG7A 4DB2A 3BC1A 2X8LA 2JLRA 5HNKA 1S5PA 4TPKA 4XUGB 3QVTA 1WXWA 3GAAA 2CXXA 3OZTA 5DG8A 5IP5A 1UXJA 1Y82A 2WG1A 4W8OA 4QHYA 5K0GA 3EGXA 4G84A 2OCXA 2ZUFA 2IQIA 1A4IA 4ILEA 2JIBA 3EY4A 3KTAB 2XQIA 5AHKA 4BKRA 1NXVA 4QSHA 5K3FA 5JASA 1NW5A 1UADA 3HRKA 2GZHA 4IKPA 4HNSA 1AKWA 5H5JA 3B20A 3SM9A 1T43A 2AVDA 3QQPA 2PWAA 1DUSA 2HIHA 4JLKA 1ZKMA 1P72A 4HYTA 3ZVKA 1EFKA 4ZI5A 2V6IA 3THYA 4EHHA 4MMXB 4J1QA 1C4XA 1X1BA 4LCBA 3RVRA 3H0MB 3OQOA 2NTNA 2XV1A 3VNAA 1AQLA 3OWHA 1Z6XA 4KXQA 4ZCMA 1P31A 3RSQA 8AT1A 1D2EA 5AFSA 4IOJA 1BX3A 5A4IS 3T1YB 1JG1A 3ENWA 4B3CA 2VYCA 2ZE8A 3DTTA 4ZDIA 1RWBA 3AKDA 5DGHA 2ZITA 2NV0A 1D6SA 3VU0A 3ZZMA 1NX9A 4ZICA 5BPHA 1X8LA 3PVZA 2XY6A 3BS7A 2KBEA 5LZ7A 3BK7A 4YJFB 2OENG 3M0EA 1PYGA 4BFCA 1E2UA 4B7AA 2C3MA 1F5NA 3RCBA 3E9NA 3GN1A 3SOPA 1JI0A 3FMOB 3LG2A 3K9CA 1W8DA 2ZREA 4YP6A 4YX9A 3F49S 2QYHA 4FGKA 1U0RA 1Q16A 1TU4A 2V8BA 4YRGA 2E8PA 2FG5A 4ND6A 5DCYA 5EMKA 4IRMA 3SZ3A 2JAXA 2FX5A 3D6FA 1BVSA 1WVGA 3PXCX 3WZMA 4DSIA 3PLRA 3N0WA 2DHQA 1IHDA 2XTAA 4MS4A 1WMAA 4DDMA 2ANCA 1WUTA 1M1YB 4P8RA 1SXJC 2QM0A 2CKMA 2QW0X 3UMJA 1TTQB 2ZDGA 1G3MA 2H07A 1EH5A 1NXXA 3CM0A 3K6JA 1JLHA 2WVJA 3B8EA 1PQ4A 1XSEA 3ZTYA 2J6SA 3VQTA 1GUAA 1WMFA 1I2ZA 4CLDA 3U16A 1OVMA 2OO5A 3RF9A 4RFLA 3X43A 2IDZA 5C8DA 4XSHA 4X3PA 2ZIFA 2HHAA 1KZ7B 2R8HA 4D26A 3DVLA 1GITA 4FX5A 3DQZA 3V3KA 5DHQA 1IPEA 4Q9NA 3VNBA 4CEHB 3SR0A 5ER6A 3DE3X 2OV4A 3U3OA 4R8SA 1XA0A 1SCQA 2O8BA 3SHFA 4UAUA 1KEWA 1KYQA 3GLSA 4PGQA 1K3FA 3OHAA 4RXTA 4KSYA 4S35A 1SUCA 5KT6A 4O4IA 2X1MA 3HN7A 1EBFA 4AJJA 5A5GA 1U9IA 1NQWA 3QZ7A 2CV2A 4GX0A 5FADA 3IDAA 4O2BF 4F4HA 4UE3S 2QJWA 4X1YB 3KWJA 2IPMA 1T5DX 2P69A 2Z4TA 1AO0A 4F21A 2GJSA 5EEGA 3H1PA 2C99A 2Y99A 3KAJA 1LK5A 2FFHA 4GDFA 3SM3A 1BNCA 1GNSA 1GQSA 2PZ8A 3SS9X 4DMCA 3LJKA 1Z0UA 3W3AH 5A06A 2ZDHA 2GYWA 1Z08A 4C7XA 4RLSA 3DF7A 5A04A 1C2TA 1JJ7A 4MUJA 1V25A 3PA8A 3DLTA 3VKHA 2C88A 3AEUB 1D04A 1C1DB 3RKSA 3PKJA 1NQVA 3HEBA 4PQEA 4GRAA 2BPOA 1GZVA 1QG6A 4HMQA 4NCHA 4D6XA 5K0BA 4L78A 3DOJA 1OZ0A 1YE5A 4XDGA 2P27A 4KNWA 5IAAA 2YHUA 2HIAA 4WADA 2NN3C 4ND8B 1V5FA 1YS4A 4KXYA 2AI3A 5MN4A 4RQTA 2PVSA 1VXRA 4N5LA 4Q4AB 4LF5B 5KAFU 5TV2A 2AIRA 1SIWA 3DEJA 3GMIA 5TMEA 2FMXA 4NFSA 1QKJA 1SUEA 4RHCA 3DGEC 4W6ZA 3IR7A 3FYUB 1ULTA 4D9JA 4FNAA 5KNBH 2ZVQX 1S0OA 3LRPA 2CMHA 3E4DA 4FB4A 4D4IA 2YMPA 4J3JA 5ALXA 2O48X 1L7PA 2Q6VA 2DG2A 4MA4A 3DKKA 5MN6A 2YFKA 4PZOA 3MCTA 5GZ3A 2X40A 2DERA 4JGIA 3A0UA 3RTAA 4L9WA 5D01A 4HLUC 2P9HA 1VP3A 2OOKA 3KJFA 3KL2A 4DQKA 1NW8A 4NICA 2BR5A 1KJZA 4YWJA 3MUOA 4AS2A 3A9VA 2VZEA 4ENPA 1V7PC 3KUCA 4B9VA 3P32A 1PJ4A 4HOYA 4OSPA 4TV9B 1W88A 3H2IA 2O8FB 1DKQA 1I2CA 5FTMA 4KV7A 2DQKA 2IF2A 4GKKB 1H3EA 4UEQA 1SXPA 5SZKB 1C3OA 4I50B 3DCNA 3RJZA 3SIWA 2C9DA 2RB4A 1Y4ZA 2O8VA 4TRMA 2FJ0A 3TUZC 3LFHA 2JPDA 3MTEA 2OZEA 1O54A 4PWZA 1G7TA 4ZEOA 5FHQA 3EG5A 1U0JA 4TZ6A 1V38A 2YJ6A 5CLQA 5HIIA 5JYDA 3TPCA 3VC7A 2XUOA 3DOHA 4IXTA 1Q0TA 5HZMA 3GGSA 3GFGA 1W5SA 3TMYA 3T5TA 2JFGA 4YJ3A 1YB5A 2GH1A 1Y5NA 3ADPA 4AJEA 4EYHB 2GHRA 4MEXA 5EC8A 4XB2A 3IMEA 3OPMA 2J8ZA 4PW0A 2M9MA 5FAXA 4EMUA 4MYRA 2WF5A 4FFMA 3GLHA 4I46A 4MB2A 5DM0A 1QE3A 2CL0X 2Y3IA 1QS0B 2BF7A 4NS1A 3PNMA 3ZKWA 2YKGA 5TEVA 3RRJA 1GTRA 3A6HA 3NTOA 3UH0A 4UJ3A 3M83A 4C0AC 4W9NA 1QKKA 1E3EA 4O4JF 1H94A 2VP2A 3MWEB 2RHTA 5E8JA 1P2DA 3HA7A 5LA6B 3LYSA 3OA0A 3SOZA 1Q5PA 3HG7A 4DR1B 1Y98A 3PFFA 4OXRA 4WZAA 3V1YA 5KVAA 3AVPA 1DDIA 3A06A 4B7XA 1KFCB 1JZTA 1U4BA 2CNWD 4B3XA 3W4JA 2QR2A 4KKXB 3ESZA 2XHEA 3FNHA 3TQHA 4DLSA 3TEJA 3ZWPA 3N7AA 4EKEA 5C8YF 1XDGA 1YSCA 3EEQA 4YO7A 5I9LA 4M87A 3G8YA 4B7UA 2AFIB 3DAHA 5BMOA 4YACA 2JXJA 2Q4DA 1IEXA 4KLRA 4MUXA 5AHOA 1GVNB 2I7TA 2X15A 2PJRA 4BWJA 3CSUA 3V42A 1M34B 1DRVA 5KT4A 4Z7OB 3VFDA 5CCEA 3EXEA 4ZAFA 4CM3A 4UAGA 2R8RA 3V1UA 2QRQA 1QYXA 1K3TA 5EGNA 2QT0A 3TLCA 2OCGA 4GSKA 1BWSA 5JOQA 5LQRA 4LMRA 1Z25A 4BUGA 4JI2B 1CFZA 2MR6A 5IWCA 1SXHA 3FCCA 3E5HA 3HBMA 1ZJ4A 4FLEA 4GZ5A 4Y1RA 3SNKA 1G6HA 5EZ6B 4EI9A 1O96B 3R7FA 3V34A 4DWJA 3EVDA 3TAXA 2QLBA 2VT2A 3LZDA 3SR4A 4OFWA 2CUKA 5GQSA 3GGGA 3CPJB 5DCUA 1II0A 2WU0A 1PZGA 4CHTA 2W03A 3ZDRA 1R9MA 2JFPA 4CIDA 2I22A 5KCZA 3ZXSA 2BFCB 3P52A 4G0PA 2COKA 3CUUA 2IUTA 3HI6A 3OT4A 3VUFA 5FWXB 2EFHB 2I3DA 4Q8FA 3PRYA 1K1QA 3ZDFA 5C2JB 1NJYA 4JEIA 2R9VA 4YJGA 4QD3A 1KEKA 3CVVA 3IPYA 3WGUA 3ICPA 1C0KA 3KTOA 3NBUA 4WACA 2WJYA 2PKYX 1JDBB 1J56A 1VP9A 2HCBA 4QUHA 1ZGCA 1I33A 1XAHA 1AQJA 5E9WA 4P3OA 1KDRA 2FW9A 5F2EA 1SKBA 4FFLA 1PV1A 3ZBUA 3K6SA 4DLKA 4TRJA 4PSAA 3H87A 4E1BA 1ZCAA 2OAGA 2OWDA 4B73A 3OX1A 1GSAA 4QLAA 3W6PA 2F7SA 1PJ8A 3JPTA 3SZUA 4DF4A 1Z35A 1Y48E 4OJTA 5B2ZA 5BXYA 3Q1KA 4XJVA 2OWEA 3LBHA 1DUIA 3K1TA 4L0QA 3WBJA 5EMLA 2NP7A 4LDQA 5AJYA 1K5OA 2ZTEA 4EELA 4PLHA 3A1VA 4K3VA 3PSTA 1FXSA 2B0JA 4HZUA 4BFVA 1HLFA 3T3EA 4F9GA 1KA9H 1PDOA 4EQ6B 1WUKS 4PLWA 2UZIR 3HXQA 3OCUA 3QGMA 4PYIA 2K4HA 3FPJA 3WG9A 3L43A 2G80A 1VC2A 2BW0A 4OBBA 3OQMA 1UBOS 1WVMA 1SVIA 4JVSB 2W54A 4JT4A 2V7QD 1RZTA 4DC1A 1X7DA 4WKOA 5CXSA 4IX1A 4JYCA 4RMNA 3VR5A 2P6NA 5F9HA 1W5AA 2VJPA 2RI6A 3GUUA 1E4VA 4PWYA 3VOAA 3N7TA 3F5FA 1SV4A 5B5EU 5C4GB 2D1TA 4HWTA 2X5JO 5L1JA 4LDJA 3G7UA 5A3RA 1YBFA 4FEYA 2WC1A 5E1BA 2JHGA 4ZT4A 4ALNA 4W1QA 1QRUA 5JALA 2HSJA 3DLHA 1RI1A 4TZKA 2D0PB 4JLPA 4QNLA 3O4GA 1J5XA 1Y9EA 5E7JA 3MFHA 3ZNOA 4GYJA 3IJPA 4UMEA 5LC1A 3A26A 3VV2A 3E7XA 3M1IA 2G07A 2A1AA 2JEJA 5ESRA 4XM0A 3OU2A 5I4KA 1WZNA 3PD7A 2H2HA 3KT3A 4MQEA 5EJ6A 3DMDA 1PFYA 4JV2A 1SRQA 2VRCD 1U8EA 2JFOA 4B74A 5IK2D 2HMWA 1DAPA 4DF8A 2QE7A 3PNPA 1CHDA 3M49A 1OUMA 4Y6PA 2WD9A 3AW9A 1ZQZA 2MSLA 3WS7A 5AYVA 4OTZA 3L8HA 1RQNA 3OX4A 4UHCA 4R3WA 3UMFA 3TTSA 1TF5A 5DQHA 5EUMA 3ITKA 4LZOA 5DCLA 3ESXA 3R7AA 3R9XA 2PRIA