2W43A

Structure of l-haloacid dehalogenase from s. tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
201
structure length
201
Chain Sequence
MIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords HYPOTHETICAL 2-HALOALKANOIC ACID DEHALOGENASE
total genus 87
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 3.1.8.2: Diisopropyl-fluorophosphatase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w43A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w43A01
4DFDA 4BX3A 3HYCA 4EENA 3IB6A 1ZRNA 1QQ6A 3QUBA 1RQLA 3UM9A 3ED5A 3AR9A 4L6AA 4UAUA 4YCLA 1RQNA 1TJ4A 1Z5GA 3EF0A 3ZX4A 3P96A 2AMYA 2OYCA 3NALA 3IRUA 2X4DA 4UMFA 1U02A 4FE3A 1Z88A 2YJ6A 4CF5A 1NNLA 1QYIA 1Y8AA 2C88A 4NABA 1ZS9A 5E0OA 1WVIA 2C4NA 2HDOA 3WK8A 2IOFA 4EZEA 1N9KA 2B1QA 4NWIA 2W11A 2G80A 1QH9A 1QQ5A 3FGOA 1S8OA 1SU4A 5AM1A 3AR3A 2FEAA 5AW0A 3E8MA 3KOOA 2NO4A 2GO7A 4IG4A 3MN1A 2Q5EA 4L57A 3R4CA 1TA0A 4NAVA 3M9LA 2I6XA 4BNDB 2CFTA 2PKEA 1RMYA 5AK4A 3WK7A 3UMCA 4GIBA 3KD3A 4XOUA 2YMPA 2YY6A 5IT0A 1J8DA 3W5CA 5ALNA 4KNVA 4AS2A 2HI0A 3U26A 3HLTA 2JAUA 3MMZA 4F72A 3PDWA 5AKHA 3UMBA 1ZD2P 2HF7A 4CF3A 2GFHA 3U7EB 4ZEVA 2W43A 3L8EA 3RF6A 5AW7A 1WPGA 2FPUA 3L8GA 2FPRA 5ALVA 3OCVA 4DW8A 2G0AA 1ZOLA 4UARA 3DNPA 5AVWA 4NV0A 1RKUA 2G07A 3QXGA 3S6JA 3PCTA 2G08A 5ALJA 5AK3A 3SMVA 4XE5A 4BKMA 3ZVMA 3QU5A 2HHLA 2Q4TA 4HYTA 3NANA 2C9MA 3AR6A 2D2VA 2VKQA 3NUQA 1YMQA 3M1YA 2AGVA 5IT4A 1YV9A 2YMMA 2ZBEA 1K1EA 2MU2A 1Q91A 3SKXA 3I76A 1TJ3A 3WGUA 2HCFA 3R09A 4ZEXA 3ZI4A 5ALYA 4YH1A 4BEVA 5AI0A 2OA0A 3N07A 5AK5A 5AVSA 5ALSA 5AIAA 1RLTA 2EATA 5AKEA 1RPZA 4BX0A 3WK6A 1FEZA 5AM2A 2W4MA 1Z4IA 1RLMA 4Y2YA 4DWOA 3L8HA 5AVYA 4E88A 5AM4A 4Y2XA 2FI1A 2YMLA 3SKYA 3W5DA 4UASA 5ALFA 5AI5A 4CE6A 3B9RA 1L8LA 2EARA 4YCNA 3QU4A 1RKVA 5ALXA 1F5SA 4RESA 2YMQA 3MC1A 4UAVA 4G9BA 1ZD3A 3ZU6A 4Y2QA 1TJ5A 3ONNA 2WF8A 4OD0A 3QU7A 2WHEA 1SWVA 4YIHA 3L0YA 5AKGA 4QJBA 1O03A 1L6RA 4F71A 3ET5A 3CZ4A 3L7YA 3EF1A 1LTQA 3A1EA 4UM7A 4OHFA 3A3YA 4UW9A 3QYPA 3L0BA 5AW8A 2YJ4A 4NFLA 5AKZA 3FZQA 3E81A 5JJBA 1LVHA 3QUTA 2I34A 3A1CA 4I9GA 2WFAA 5AESA 4BYGA 4JB3A 5A3QA 2HX1A 5ALEA 5AM0A 3CNHA 4Y3UA 2GMWA 3QGMA 5ALTA 3NIWA 2I33A 3SLRA 2FUEA 5AM5A 5A3SA 5ALOA 2IOHA 2OM6A 3QU9A 2O9JA 2QYHA 2JAWA 1S2OA 3I28A 1XVIA 3GYGA 1XP5A 2YJ3A 3DAOA 4Y2SA 2FDRA 3IJ5A 3AR4A 4PNHA 4CNQA 1MH9A 2YBDA 4YIKA 2I7DA 4KYTA 2ZBGA 4FFDA 2WF9A 1Z4MA 3QLEA 3ZW7A 4KNWA 3U7HB 3DDHA 1T9ZA 2RBKA 1L8OA 1TE2A 3ZTWA 4IFTA 2CN1A 5ALRA 1J97A 1Z4OA 3MPOA 1AQ6A 2B8EA 3OCZA 4Y2PA 1QQ7A 4B6JA 1L7OA 4GXTA 2WF5A 3U19A 2MU1A 2AH5A 2YN4A 5AI9A 1T5SA 4AP9A 5ALDA 2FPXA 3SD7A 5AIBA 5ALHA 4BX2A 2MSNA 4J03A 4J2TA 3DV9A 1U2TA 2FPWA 2DQSA 3EPRA 3EWIA 3ZWDA 2YFYA 4EX7A 3L0CA 2OBBA 3VAYA 3RFUA 2IA5A 4I9FA 2QLTA 4KN8A 2B0CA 2R8YA 3R9KA 2R8EA 2JAOA 3L1VA 4BEWA 1CR6A 2BDEA 3OCYA 3D6JA 5AVXA 3ESQA 3OPXA 1N8NA 3WKBA 4UMDA 3FPSA 3WGVA 1IWOA 4KX3A 3I6BA 5AVQA 2WF6A 5AW4A 1JUDA 4L6CA 2HSZA 3NASA 2R8ZA 2YJ5A 2RARA 3WKEA 1L7NA 4O8CA 2PR7A 1U7OA 1WR8A 4XPZA 2IOFK 3B8EA 2IYEA 4OFZA 3E58A 3ET4A 2WM8A 5ALZA 5ALLA 4CF4A 2RAVA 3UMGA 2B1RA 1U7PA 2EAUA 3W5AA 3OCWA 5ALIA 4UM5A 2BY4A 3L5KA 3WK5A 1XPJA 2C8KA 1RLOA 4C4SA 5AVZA 5AW1A 2I55A 5AKXA 5AKJA 2G06A 1O08A 3BWVA 5AKYA 2FUCA 2WF7A 3A1DA 4MWOA 1ZJJA 2P69A 1RC8A 1X42A 5AKLA 2RB5A 5AI4A 4EEKA 3ZVLA 3SHQA 5AKIA 3QU2A 3FPBA 1ZRMA 2HEGA 1U2SA 2P9JA 3KDPA 2ZOSA 3PGLA 3ZX5A 5ALGA 2B30A 4HGQA 1Z4NA 5AHXA 5AW3A 4RETA 2FPSA 5AK6A 2P27A 4MUMA 3ZUPA 4AS3A 4BNDA 3OCXA 3E84A 3N8GA 2GHTA 4BBJA 3N5KA 4HGPA 4YGYA 4HGRA 2R8XA 4EELA 2HOQA 3AR5A 2G09A 2CFSA 1NF2A 1L7MA 4QQFA 1VFPA 4JDPA 3U7GA 4UMVA 1WZCA 1VJ5A 2ZXEA 3I1YA 3AR7A 5AVTA 3OTQA 2ZBDA 1YDFA 1Z4JA 5AVVA 1ZD5A 3KBBA 2JGAA 5ALMA 3AR2A 1VJRA 2I54A 1EK1A 4OCZA 4G63A 5AKKA 5AVRA 5AW6A 5AM3A 4Y2RA 4HGNA 4KX5A 5T41A 3TLMA 3QUCA 4C4TA 2G1AA 4FYPA 1Z4KA 1T5TA 1Z5UA 2P11A 2ODAA 3WKCA 4UATA 5IS2A 5ALWA 1YJ5A 2ZG6A 2HF2A 3L8FA 2HO4A 2Q4RA 1RKQA 1Z4PX 3FVVA 3ESRA 3BA6A 1Z4QA 4UMEA 3F9RA 5ALPA 4HGOA 4Y2JA 2O2XA 4XQ0A 1PW5A 1YNSA 5FP0A 4UU0A 2B8JA 4H1WA 1Q92A 1SWWA 5ALUA 4DCCA 2C8LA 1ZD4A 2PQ0A 3B9BA 3OCUA 2NO5A 1KYTA 2B82A 3ZWKA 1RDFA 3NRJA 3W5BA 1YS9A 4YCMA 4ZEWA 3N28A 2JARA 3KC2A 2CFRA 3SF0A 3NAMA 5AVUA 3QX7A 2GHQA 5AI8A 3U7FB 2ZBFA 2AUTA 3K1ZA 5ALKA 5AICA 3J7TA 5AW9A 5ALQA 5AW5A 1Z4LA 3ZTYA 3QNMA 1EK2A 4Y2TA 2BDUA 1RMQA 3L1UA 1RRCA 1L7PA 3KZXA 3ZVNA 1CQZA 3QUQA 4EX6A 5AI6A 4C4RA 3AR8A 2NYVA 3WKAA 4Y2UA 3WKDA 3N1UA 4Y2VA 5AW2A 3PGVA 3U13A 1RMTA 4UU1A 4HAIA 5A3RA 3WK9A 3FM9A 3WK4A 1NRWA
chains in the Genus database with same CATH superfamily
5TMPA 3I2IA 1W36C 3TL6A 3CRNA 1BQ4A 2BJVA 1J8YF 2XQIA 2DBYA 2ZJ6A 1U2QA 1X3SA 1XXHB 3NYWA 4OTZA 4G8CA 1MFPA 4O2BA 1XK7A 4CMHA 3LYLA 4LC0A 3QJYA 5E2BA 4RWEA 3DBOB 5TGTA 4I3GA 1G2IA 3E3LA 3BHNA 3EGXB 3O9ZA 1N6LA 1UPCA 2J5QA 2XB8A 2G17A 4Q8EA 4TRMA 4YBRA 3S1LA 1N2CE 3DLHA 5DIZA 4M9ZA 2FMQA 3KJHA 1PZGA 1Y7LA 2ZBQA 4ITRC 1AMOA 1I14A 1XLTC 2OFPA 1YZ6A 4Q4AA 3TEMA 3CLRC 5C9ZA 3ER9A 2H4YA 1DBSA 4LRYA 4X8LA 5F21A 4UB8U 1L1EA 2ZRAA 3QBJA 1QP0A 1PV1A 1B76A 1YE5A 2HAEA 3UQ0A 2C8JA 4BNGA 3UZUA 4F4XA 2VA9A 3OZEA 2VP0A 2I3GA 4JEHA 4B8WA 4Z9YA 4F6CA 2PL1A 1PQWA 1RIIA 1DAKA 1JLSA 1WUIS 3EFHA 4ZVPA 1G8FA 1KVRA 4EMSA 3KIPA 4FFOA 3FW1A 3LNTA 2X0EA 3WNVA 4EO9A 1E3QA 2DKNA 2AV6A 1QQ5A 2NACA 4O2RA 3MCVA 2OGTA 4WEQA 3QX8A 5CVCA 1QR6A 4QHSA 3DQQA 3G2NA 3QE4A 3SZLA 3B13B 3C1TA 2UZ3A 1KBUA 4J75A 3FYTA 4TKVB 3ZDXB 1A3CA 1GPLA 3ILVA 3MILA 4RZHA 4XCXA 3H7IA 3A0UA 1VRCA 2IUSA 4P4TA 1QTQA 1O87A 1N3IA 1OX6A 2BPGA 1EBUA 4L73A 3ZCVA 3CN9A 5HOQA 1NVKA 2VZLA 3HU2A 1KRPA 1ODIA 3C74A 1YI1A 3IQXA 3M3PA 4JLKA 1SNYA 1M2KA 2DM6A 2IW1A 2Y4NA 3L93A 1Z82A 2BWJA 4E15A 3DA8A 1ZK2A 4FGJA 2VNKA 2FP3A 2H7VA 3EARA 4MR9B 3G7SA 4D79A 4IUYA 4R54A 2BH2A 2HA5A 2INGX 4H7FA 3C3BA 4IDHA 3W6NA 4RMHA 4ROSA 2QZSA 1FRFS 2BJHA 3G2IA 1YZFA 3I5XA 2E55A 3T7TA 3PE4A 3FTCA 1SMKA 3I37X 4PAOA 3DBVO 5CHEA 1HTTA 4N9QA 2A1UB 5EN4A 3T52A 3TVTA 4DLYA 4YFVA 3UT0A 3HLTA 3U4AA 1NW8A 1YC5A 8ICYA 1ZH6A 1ZLXA 5KDLA 3SYNA 4ZV4A 2GXSA 1QH1B 4BBPA 1Y63A 2NTNA 5HDQA 2R8IA 4FGUA 1XK6A 2PGJA 4U5XA 1AM4D 3EEBA 3CURA 3RF6A 4DF4A 1JVNA 2FRDA 4ENQA 3CVWA 1RRPA 2FSGA 4BWFB 1IONA 4LF6B 5ALVA 2YX8A 1MC1A 7GPBA 3H9JA 3JZDA 3WWCA 3GFQA 4D4GA 3EULA 4DA9A 1HQYE 2R5NA 4YY3B 3IV6A 1LVGA 1X9SA 2FEMA 5KNIA 3ND6A 2RKBA 2ZBPA 1JT2A 4QNNA 3C5WP 3LCVB 3HMQA 5LQCA 1GQYA 1ZYUA 3JAMA 3NDIA 5BV0A 2VTKA 2CNDA 3L6EA 1PD0A 3IXQA 3CHYA 3T3EA 3OFVA 5KFNA 1XHFA 4C06A 5A9TA 4LKOA 3JWHA 2R7NA 5TMEA 2C04A 1E1RD 1SKYB 4NXNB 1PYDA 2PXAA 3QFRA 3DF7A 2HEIA 1YMQA 9ICLA 1VMEA 3M1YA 5FLXA 3K70B 3SXJA 1WCLA 3TLXA 5IT4A 2WM9B 3MM4A 2WT8A 2D1RA 5FUXA 1L5ZA 2WLSA 3ZIUA 4CIYA 2CB0A 1AQUA 1ZHFA 4GL4A 4TN5A 3U9SA 5LXTA 2LYBA 1U7DA 2A5DA 3W6ZA 3WGUA 5A5VA 4RPKA 1X2BA 4ZQHA 3DTNA 4BXOB 3HA7A 5CW2A 3DEJA 2EGHA 2AE1A 1W8IA 2OCKA 4EI2A 3M5WA 5BVHA 5B66U 1MX5A 3RUCA 2NNWB 3KM0A 3S2EA 4NLZA 1F6DA 2ZIVA 3N0TA 3D8RA 4F4ZA 2Y9UA 1ZNQO 5LU9A 1CUSA 1XU7A 2UYGA 3DYBA 5CYPA 3NJRA 2P66A 1FEZA 5EKTA 3WL6A 5CG1A 4U2GA 3TLKA 8ICNA 2CZCA 4BX9C 3OPMA 3V6JA 3V42A 4U6PA 2J6UA 5JSHA 4KQKA 1JHAA 5BQFA 3BZCA 5C32A 1ODFA 1ZAKA 1M5UA 2QROA 3IBFA 5K1ZA 1NOKA 3QSYA 4GSKA 5AVYA 5AM4A 1K3UB 2FI1A 2BGMA 4RDHA 2HRQA 4RJLA 4WHMA 2XUHA 4AY5A 5JMPA 5HCUA 1XJ5A 1V4NA 1G8HA 4CEJA 1BJKA 4J9PA 1JMSA 4WJ3B 2X58A 3ZHZA 5KKCA 1UDRA 4QOIA 2PVPA 3PJEA 1SFRA 3IKMB 2ZIWA 1TO2E 2PMWB 4JLVA 4L4RA 5FF9A 4AECA 4AP6A 4F2RA 3KKOA 1VLBA 1OLXB 2YXLA 2OP1A 3OU2A 5HIMA 1EBBA 2WA1A 3OTOB 1XRLA 1XVAA 3BORA 4OHVA 2I2FA 5A7FA 1KIAA 2VLBA 3E22A 3IOBA 4JHLA 3HTXA 4CKZA 3E03A 4B73A 1XNHA 1H69A 3ROEA 4Q4AB 4C0KA 4Y30A 3UWPA 2V3WA 3LGAA 3QNUA 4RS3A 5IF9A 4OAPA 3QEMB 2YWJA 3ZV5A 4LQ4A 1AH2A 1RAEA 1YB1A 2EJTA 1PJLA 5C1PA 5FUBA 1C7FA 2ZANA 4YD1A 4L27A 1S9HA 2VEDA 3IVXA 5CXQA 3MTDA 2HXGA 3PHGA 3USZA 2DECA 2HIGA 4I1OA 3RRYA 3ZWCA 4DNQA 2VWPA 3PO5A 5BOSA 3FZQA 4FMDB 1EFPB 4KR7A 3ER8A 4NXMB 1G8MA 3JPQA 1ADYA 3TD6A 5KHAA 3A1CA 3WGOA 4F5QA 4JLOA 5LJIA 3GYBA 3GU3A 4A8JB 4OFBA 4FVTA 2AN9A 4OHRA 4TX1A 4ZOBA 1SZJG 4Z99A 4I2GA 3F2IA 5J4VA 5KVQA 3E1GA 4BPBA 2G9UA 4BHTA 1TM2A 1Y3AA 2HZBA 2I33A 4PYQA 3RHTA 3ZLBA 5JYEA 4A6EA 2W8KA 1PWEA 3K8YA 1Q3KA 4W6ZA 4ICIA 1D2HA 2IXEA 4I3FA 2Y4OA 2YS6A 2E4VA 3AFGA 2QYHA 2X13A 3EGDB 4RE5A 3VYRB 5L9AA 1GD1O 3PSFA 1XVIA 2VDNB 3AFMA 5K7SA 3FYDA 2ILVA 2X9QA 5D3KA 2PMKA 4HDAA 1GLNA 1N7JA 4CM8B 3ZD9A 3JPYA 2WB2A 1Y5MA 3LOPA 4URYR 4MW4A 1ZQDA 2I4OA 3DMHA 3H0CA 3VZDA 4HMPA 4EPXA 3HP1A 3NMUF 3G1TA 1IM4A 1AC5A 4C9BA 3H42B 2C83A 3MGGA 5FLKA 3ZKWB 3UVEA 4EI9A 1Z4MA 2J3HA 2RGXA 3FPFA 1N8KA 2WZBA 4UDNA 4BRUA 1OAAA 4R1LA 4D6PA 2BKLA 3LT5A 1N2BA 1Z2DA 5KTTA 1JSZA 1RAIA 1GAEO 3GVXA 4HYYA 3LKVA 1DBVO 2CWDA 1PYGA 1N92A 2HJVA 1T2VA 4B6JA 4KVFA 3U4HA 2EGGA 3DE3X 4E22A 2WF5A 2QVBA 1M1YE 5HF6A 3M4XA 3RABA 3E7PA 4AURA 4I6GA 4FS3A 4F04A 2QMEA 2QRVA 4FW8A 4F1KA 1OIVA 1G5HA 1XRPA 2WHRA 4J16C 1NKSA 2BFEA 4WKPA 4QQNA 1KGDA 3HCCA 2Q6TA 3RR7A 3DXXA 5PNTA 4YT8A 1HFWA 3OHPA 2O1XA 2PIAA 2XITA 5ICGA 2DXIA 3E3MA 2O1SA 4KLGA 1AZSC 4B4KA 4ED8A 9ICQA 1M2VA 1R0SA 2I3ZA 4AJ9A 1FS6A 5EJEA 4JBHA 1I2ZA 5L95A 1QVVA 5ELXA 3V4OA 4NU6A 3D5QA 1Z0SA 1JR3D 3JQ6A 3TMAA 4D0LB 1VI6A 2FJUA 1DBPA 2B4YA 3NEYA 2R00A 2UZAA 1YKSA 3KXPA 3GGGA 5IMSA 1LQ2A 3R5TA 4EB0A 3HJCA 3L77A 1YRAA 3V7FA 1KPHA 4N0DA 5IZ4A 1UMBB 3RYCB 4ENVA 1P61B 4DT1B 4EJSB 2A9FA 2OECA 1S5LU 5ELMA 4E51A 2P3LA 2ASJA 3NASA 3AIKA 2WSIA 3R5SA 1KMHB 4RHUA 1RYEA 4S3MA 3ZDAA 4RQ1A 1DXQA 1HDZA 1G60A 1Z6TA 3ETCA 3KQTA 1N7IA 4LBVA 3GO4A 5F4BA 3WWEA 1E0SA 2IDJA 4BMDA 3N2GA 3KAJA 4CU5A 4C7VA 3NZEA 1IN6A 1SA0B 1JHPA 4C5AA 5JNWA 4RJKA 5IJXA 1YF3A 2NU6A 3HXKA 2XECA 1CW2B 3DVSX 4PVDA 5LD2B 3RAQA 3R23A 1G8KA 1U7PA 3E9NA 5K0LA 5G1NA 3H9BA 4RQAA 2BCGY 1LLUA 2CKDA 3D3WB 4L9AA 3C5FA 2KHVA 2VPQA 5PGMA 3HJEA 1HUQA 1P2SA 2C2WA 2J3MA 4ZPJA 5DTRA 1I30A 2JZCA 4PZ0A 1J6UA 4MVJF 1TNDA 5BN4B 5FEUA 3ME5A 1KFDA 3IEMA 4USAA 4LMRA 1PZMA 3DCYA 3PXBA 2B25A 2C3PA 2H1LA 1MVNA 1NX9A 3GOHA 1YL5A 1KQQA 4HH4A 5SICE 1JROA 1NPYA 1DTSA 2ALJA 2C54A 2VBCA 3F6EX 3HCNA 3KTAB 3GXBA 1ZMOA 2HH9A 4G3IA 4ZANA 2ZKIA 1SIWA 4F5EA 5TB5A 2JV3A 3CA8A 1T0UA 2TMYA 3UICA 2XT0A 4E46A 1UEXC 4MCJA 2QTHA 5KFHA 2ODBA 4HNHA 4X64B 4BE7B 3IQZA 2Y1CA 3Q0EA 3RVKA 3AVUA 4FS2A 4M9LA 3PWSA 4RORA 5EHGA 3Q0IA 2CK3A 2P9JA 4KAXA 4MB6A 1KE2A 3T5AA 1CLEA 3NQ41 3OLCX 4HAVA 5TIIA 4RFVA 3VR5A 3HXOA 4RD6A 3N8IA 1T5HX 3QFSA 1QAOA 1P7WA 5AK6A 1PL0A 4M46A 4XGKA 1AV7A 1G4HA 2XUGA 3G9ZA 5J2BA 3HKBB 4N7RA 4G09A 1LF0A 5TF0A 3OX2A 4DANA 4M99A 3TO5A 3COZA 1NNEA 2GASA 3HNOA 2VL7A 5HPYB 4TKUB 3ISCA 1SU8A 3K1AA 2COKA 2NO9A 3P9QA 1SBQA 4GQAA 4MLCA 4QPZA 5KSWB 2QTTA 2WYOA 4PIVA 5KQPA 1XKQA 1WWUA 1L7MA 4UBLA 1XFAA 2FMFA 1ACLA 3CZAA 3LLCA 3ONWA 1QZ3A 1U94A 2V6BA 4INPA 4MAMA 1LI5A 2Y1DA 4H27A 4RIEA 4RQ6A 4UVEA 5ENZA 5FNZA 1LS6A 3P71T 2GPSA 1WCIA 3IMCA 3JWEA 1Z0FA 4M04A 4FU0A 3SAGA 2QJWA 4B4VA 3ZZMA 2CVQA 3D8TA 3LHSA 4IOLA 5EUQB 3M5DA 2W5UA 4O4IB 2PJRA 2G9QA 3O1LA 1BX0A 4NOMA 4RC9A 5E9JA 3PT5A 2OXFA 3I9JA 1BHJA 3RWOA 3KL4A 5ALMA 4FJ2A 2B4TO 2I54A 3PX2A 1EK1A 3BCSA 2FSVC 2VXBA 1Q2UA 2QVYX 1R3DA 2O59A 3G8AA 9ICMA 3OD1A 4X1KB 4DMKA 4DLSA 1W6RA 1YR1A 521PA 1FU4A 1L4GA 2BM1A 1SVKA 4YRPA 1KEZA 1LPNA 1ZQVA 5TC4A 5DPMA 2R8GA 1P7DA 1W581 4AJJA 3TB4A 3JVVA 3SE7A 1TKBA 1I1QB 3QRWA 2GO1A 3NJ4A 9ICIA 4H7HA 3RIHA 1P0QA 3QX3A 3FJYA 2GSDA 3V2UA 5A0FA 1E5QA 3H6GA 1G38A 2AKEA 1E9SA 1O77A 3FDJA 3DZ8A 4EH1A 5TDHA 4GPEA 1WDMA 4FZRA 4LY9A 2KFNA 2P41A 3IVRA 3BTVA 4FGSA 5I4IA 3T7DA 5LD2C 3WO1A 2H3IA 5JUWA 1GADO 4DR1B 4J0EA 4PYMA 3BL8A 5KYXB 1Q92A 1COKA 2H2HA 3OIVA 1K0UA 3W06A 3HGTA 3ZLTA 1ZD4A 1UBKS 2PQ0A 1B43A 3C45A 4HDQB 7ICRA 2BBTA 2J48A 4I5EA 4LOKA 2IS2A 2QN9A 3TJMA 2BEKA 2H4XA 5J4YA 3NRJA 4CEIB 3RJKA 3AIIA 3GIWA 2PA3A 1L5SA 5BT9A 4XB2A 4YCMA 5G5GA 4QDKA 4F3YA 5HS4A 2JKZA 4L76A 3NDBB 3P0HA 4IVQA 4EQ6A 1CKEA 1CT9A 3WY9A 3SBDA 1ZQNA 5HIAA 1H2BA 3NAMA 4YYEA 1G6OA 2DHRA 2WLTA 2RB4A 1A7UA 4HYEA 4BVLA 4OMUA 4QBGB 3AUKA 3EX7C 2AUTA 2AX3A 1E1YA 3EGXA 5CFOA 5HWSA 3QOWA 4KQGA 3DHWC 2H7XA 4RD0A 3GGCA 3F6CA 3TKAA 2WINI 1V1RB 3PBKA 1E60A 1EWRA 5HHIA 2BGJA 2CXOA 5EXTA 1LI7A 5KT2A 1N5IA 2AFIB 3ONVA 4UE3S 2PAAA 4EZ6A 1TCBA 3A1UA 2CBZA 3I2FA 3IDOA 1ODSA 3M49A 2X1HA 2QTRA 2ZYAA 1W47A 1ZJYA 3JQ8B 4TV9B 5C5EA 1U8EA 4F5RA 4YV0A 1CS0A 1M0EA 2Q3MA 5JE8A 3PHJA 1TYEB 3NX4A 4DSKA 2QDXA 2VJCA 3S3TA 2ZWIA 3R8CA 2XVXA 5KOYA 1GVNB 5FOSA 3R44A 4KFSA 2ZYIA 4A27A 3DLBA 2PL9A 5JDCA 4ODIA 2HPZA 3IAAA 2A58A 2P6PA 5EVJA 3N7PD 4KN9S 4UTNA 3U39A 1EFHA 1RQLA 4JV1A 3CJTA 1QLHA 1TZCA 2VBGA 1XQ9A 3QY9A 1JQBA 4HAXA 4L6AA 3VNBA 3WAKA 4AMBA 3O3NB 3H8MA 4DR2B 3GP8A 5H02A 1DO0A 2GILA 2FJPA 3E9QA 4G26A 3Q6NA 4EY8A 1AG9A 1YI0A 4QGFA 1XTTA 4F5NA 3I9V6 1JHXA 4Q7EA 1VFNA 1WTAA 3UXYA 4WN9A 2IIVA 3M8KA 1GFSA 1IVNA 1Z5GA 4W1PA 1JZSA 3ZHUA 1QLJA 3TI7A 4D8UA 1YU6A 1NATA 3OA0A 1LWOA 1XA3A 4XB1A 5DLEA 5C3UA 2JRLA 3RVJA 1C1XA 4DLBA 2NT4A 5B3JC 1ODKA 3WBJA 2AWNA 2JGJA 2ZRPA 2PANA 2P1RA 4G86A 1E61A 4DC1A 3FDFA 2VK1A 3BQ9A 3RI3A 2QAIA 1KKLA 4QFBA 4US2R 4ISBA 2HOIA 4FMDF 3TR6A 2OV4A 2RH9B 4MYDA 5AXDA 1HBJA 2ZJ4A 2RDMA 3ABZA 4QDTA 1CDOA 3QFCA 3GNSA 5FJJA 4PQYA 4CBVA 3E0XA 1ESZA 3U3RA 2Q6LA 4NEGA 1Q15A 1W4RA 4HSGA 4OYYA 5GOZA 4X9XA 5KU7A 1T36B 1R27A 3CUYA 1YHNA 3WGLA 2Z8ZA 3ZWYA 2GXAA 4L5JA 2QSUA 2XJ4A 3NAGA 4FYXA 3LL4A 3DXZA 3N6RA 5CDFA 3UPQA 3IELA 4DXAA 4ALMA 1ZGCA 4AMGA 1JN3A 4KKVA 1ORDA 1NGSA 1ZVQA 3RTCA 3VVLA 4TKZA 4DLVA 4BTEA 3T1TA 3G89A 1DP4A 3V34A 3PUKA 5ESWA 3BJYA 1YR9A 4KXUA 2E3TA 1L3IA 2AK2A 4WJKB 1R5NA 3OOYA 4NG4A 1UAYA 1DBIA 2EZUA 3FWYA 3OLYA 3O74A 4OP3A 4XOUA 1XNRB 2F44A 5ES3A 5CDUA 4RU1A 4WQMA 9ICRA 2UZ4A 2YB4A 2FR8C 2HXSA 2G25A 2VDWB 4CKWA 1H6BA 5AJUA 5A0VA 1SKQA 2ZAOA 3IAEA 4AZ3A 4JDUA 2PO7A 2XBLA 1EJ6A 3EVTA 8ATCA 1X13A 2PVCA 3N8NA 1BX3A 2OHHA 2SKDA 4Q37A 5HUJA 5J2GA 2LHTA 1DEHA 1U9YA 2Z1NA 5JDCC 3N76A 4C88A 3B6JA 2BR3A 3ZK8A 2WWIA 1J2TA 4CKCA 1WUYA 4R2MA 3EYWA 1JVSA 1B14A 4MPTA 5DGDA 3L8GA 5FTWA 1YRWA 2XKBA 3A1SA 4RPYA 1KFTA 1MZPA 2VDPB 2IHJA 3K09A 5FH9A 2F2AB 3DNPA 2VYVD 1NRIA 2IY8A 3DEEA 2OCBA 4MVCA 4KXQA 3V2GA 4LVUA 3VTFA 1FUKA 1W0JA 3JD1A 4F96A 3FPKA 5CW1A 2ZSJA 2I29A 1OGYA 2OMEA 4NK4A 1Q44A 1NONA 3CM0A 1E18A 4DVGA 4DB2A 3E0QA 1G1MA 1JZQA 3O1JC 4F2HA 3ZVMA 4J4BA 4QLOA 5E1BA 3WZMA 1LS1A 1M8KA 3AR6A 1H2HA 3C97A 4Z9FA 3U3OA 3V8EA 1TK8A 3HB7A 3Q3HA 5I7OA 5I7RA 1PT7A 1Q3TA 5FUWA 4EAAA 4FB4A 4JITA 2YINC 4BNJA 3FZGA 1HDIA 3CZ9A 2FWPA 2WI8A 5LA6B 4RFSB 3F90A 4PCVA 1T35A 4B9EA 5K0JA 5EG5A 3CRZA 4XGQA 1Q12A 3ZI4A 3ANTA 4HNGA 5LZ7A 1JT9A 4BEVA 4J07A 5F2KA 1H8HA 4JUBA 4EABA 4DG5A 3HZRA 2Q0ZX 2DCUA 1Z3IX 1ZONA 1M76A 1SG6A 1HLPA 3JVUA 4R8SA 3K6JA 3X1KA 1UK8A 2VHYA 5TJHA 3DOUA 4DJJA 2NG1A 3WK6A 2A9VA 2R5WA 5AM2A 3ONFA 4CM6A 3GIKA 4Z3DA 1TCCA 2YV3A 3STUA 1PIWA 3IBTA 4NZZA 3Q8XB 4D9HA 4WNAA 1ZHHA 3PR4A 2VCYA 4Q3BA 1PGNA 4BJHB 4GKAA 4W5TA 1DJQA 2YMLA 1KF0A 2Q21A 3PITA 4QNMA 2E0IA 4G84A 4GQBA 5ALFA 1XSPA 2X7JA 4PLTA 3HYLA 5DN6A 5H80A 3RH5A 1YCHA 4XRGA 4NLKA 3MLAA 4DADA 2JBWA 1JR3E 2BM8A 1A98A 2VF8A 2ZRIA 3OJWA 1W96A 3MQ4A 1IOWA 2I65A 3HU5A 3SQMA 4YCNA 3IERA 4BECA 2XMPA 2V3CC 3K2BA 2IEAA 4HDCA 1X66A 4HR7A 1VDMA 2BL4A 4LKRA 5EOZA 1HL7A 3RF7A 1ZK1A 3D6MA 3E53A 4R5MA 4BQQA 2O2JA 4KDFA 5CDHA 5B1SA 2A0WA 4X61A 3SBXA 1E96A 2W8ZA 1S1CA 1Q57A 1A7JA 1I51A 1DRVA 1O9BA 1RQPA 4LAFA 5C1BA 4XDGA 3E05A 3FF1A 2CLDX 4RPJA 4D81A 3CKLA 4GYWA 1XMSA 2VQFB 3F3SA 1FY2A 1HYGA 1W46A 3MOGA 4O08A 4HWOA 1PLJA 5JJIA 4X8OA 1LTQA 3G59A 2I3DA 5FQNA 4QXPA 5FA5A 9ICSA 3THYA 3HNPA 3ZS8A 2ZETA 2O0LA 5AW8A 5HOEA 4QUEA 3H4MA 4GMFA 4YK7A 4DR4B 1JU4A 1DOAA 3W5CA 4QM6A 5AK0A 2HSDA 2XUZA 5HJEA 2OL4A 4HBZA 3UMMA 1X7HA 3OZIA 4X85A 1CY8A 4K4HA 3A4TA 1G6HA 1YQWA 5H3CA 1G7TA 1Z26A 2X5OA 1DJPA 4JLUA 2V74B 4LXTA 2DFTA 4RHFA 4PU0A 1XALA 4IL5A 1U49A 1C0KA 2QL5A 3VBCA 3TW8A 4PZEA 3HO1A 3RTGA 4JGIA 1SL1A 4JJIA 3NM4A 3MGVA 1TK0A 1VPVA 2J46A 5DIFA 4P08A 4DY6A 1PHPA 3DDCA 2CVPA 2ATCA 4E1AA 4MUJA 2P2YA 2ZW9A 1RJ9A 1THMA 2J32A 2V65A 2YYZA 1TRKA 2BKAA 3KPYA 1EVIA 3GEEA 3MK31 3KR2A 2IEYA 1MABA 4Q1AA 1JFFB 4JA0A 4IXWA 4JB8A 3DLPX 4LSZA 5FOVA 3G49A 3PNOA 2ADOA 1E58A 1RKBA 3BGDA 4CQLB 3RVLA 4RVUA 2Q6OA 3RWBA 2O8BB 2K4MA 1ZWLA 2ZJ1A 1I7LA 3G68A 4KIJA 4BMYA 4KYTA 4IIJF 1YZGA 1JQDA 4JR0A 4OJQA 2X8WA 4TSKA 1VG9B 5K3CA 2YR0A 4BKOA 3ZWPA 1HGXA 4C5CA 4JEUA 3H1BA 3THWB 3AQFA 1FFWA 2EC5A 8AT1A 4BO7A 1HE3A 1CUDA 4H31A 3AOEC 4QXQA 4WGGA 4A0FA 2GZDA 3B6IA 1U2ZA 4Y2PA 2B2NA 3OSZA 2PGAA 1U4OA 1FP2A 1QE3A 2W9XA 1DT5A 1C8BA 1GA4A 2O7SA 3SZOA 5IHPA 1V1JA 1NV8A 3L3BA 3LC0A 2Z83A 4NYMR 5JAMA 1XTRA 4L4SA 4KH1A 4P0QA 3QVTA 4V1CA 5JSFA 1XTSA 1CQWA 3E5HA 2PRYA 5BWNA 1E5DA 4XX1A 3ZE6A 4QD3A 4GPD1 4P7BA 3ZE1B 4EI7A 2ZTUA 4NLGA 1FQKA 1XZFA 1TECE 3EAGA 3L79A 5JU5A 4R81A 3X44A 1XAIA 3RAFC 3VAYA 2W3SA 5I5EA 1HZZA 2JCGA 4DFJA 2Y1KA 2I71A 3T9DA 1KYIA 1PNOA 1WXWA 3ACBA 3JSXA 3GAMA 4RCZA 1VBMA 4D8XA 5KFUA 3P7MA 1N2XA 3PNYA 3TFRA 1VE9A 2YRFA 1VKRA 4HH3C 3KXLA 3R76A 4BEWA 3IT2A 5GONB 1AURA 3ESQA 3M4YA 2B5VA 1AGRA 1ZPDA 2JI9A 2VDUE 3EW7A 4MW6A 1P4SA 4KPUA 4B0OA 4DOAA 2PWYA 2C2DA 5IIIA 4OV6B 5FWAA 2PX5A 4QGGA 1ZNXA 3HT3A 5CXUA 1A9XB 4KLFA 3RG2A 4BV3A 3S28A 1UBEA 3AU6A 5KFTA 4CLEA 2JPDA 3NW9A 5EIBD 4PAQA 3UEOA 4D4IA 3LIIA 3R24A 1VMIA 3HUTA 4WAUA 1JPJA 5EJ7A 1UMDB 3ILYA 3HXQA 1U7OA 2YOHA 4YAIA 2P79A 2YL2A 3VU9B 3F5DA 4Z0HO 1GG9A 2ONJA 1ZKMA 4BX9A 2V0CA 4LHXA 3ZQ4A 4CIVA 2FMKA 3E8SA 4JELA 4ZALA 3R3HA 3OIFA 4CFSA 4D96A 3O75A 4FJ1A 4A4DA 2AC2A 3AT1A 3EMBA 4MXDA 4D46A 4OP2A 5ALZA 1ADBA 4KLSA 1PW7A 2C00A 2F8KA 4TWRA 4ER0A 4RTMA 2FGKA 4B9AA 3HV0A 4PWYA 2KHQA 1SXGA 2XYRA 3FSJX 2IBMA 5TARA 4F06A 2ZM5A 1PJSA 4N40A 3OCWA 1HQKA 4ED6A 1XKXA 3CIFA 3KKNA 2QTZA 5J0RA 5K4LA 3ZQ6A 4C2AA 1LLFA 4FOPA 4A6XA 4O3SA 3HACA 4B5LA 2X22A 1D0IA 1JR4A 1H8EA 1KDPA 4KWIA 5AVZA 5J0XA 3IKJA 2NWQA 3QJ5A 4NBTA 2OKCA 2YH2A 3D3KA 4EJMA 1KLNA 2A7QA 4QT4A 2GOLA 1YAJA 4KCGA 1Q3VA 2AK3A 4WTOA 5KI6A 3EJ6A 4CGZA 3GF4A 4IIEA 1ZJJA 1L5UA 3V32A 1H38A 4OHZA 4LZOA 3M8RA 2E87A 3R7WB 5LXTB 3SYMA 3ZW8A 1NKCA 1Y6FA 5AKLA 4P34A 5JH7B 4LJ9A 1SCUB 3SF8B 3SHQA 3BE4A 1K4MA 1IZ9A 3NXKA 4N0MA 5GPBA 2KHZA 5K3OA 3SOZA 1R66A 2FZ4A 2KBEA 2QTWB 1IOVA 3C70A 4JQOA 4N54A 3UXMA 5C8DA 3PE6A 2NTEA 4NYIR 3AVXA 3ZCSA 1WXDA 5EPOA 1A72A 1LJ8A 2I99A 3PGLA 3C8UA 1RI4A 3BRWD 4D44A 4EG4A 2C59A 2B30A 5KWJA 1PR9A 4G56A 2RG1A 4K9PA 3GLIB 4NL9C 3L18A 1LI4A 3R5JA 3OCXA 3UNXA 4XRHA 3W7AA 3C15C 2IU0A 1K2WA 1RM6C 4GP9A 3ESYA 1GQSA 3RO7A 4WZAB 1ML4A 1X7XB 3GLGA 2D6FA 3P26A 4U6QA 5LWHA 4DKJA 5KTQA 4PZ9A 4FGKA 1QR2A 1QGOA 2JI8A 3A0BU 1XKTA 2IYVA 5BORA 1LKYA 3B1ZA 3IDSA 5F7ZA 3KXDA 3CVVA 1A04A 1ZSYA 2MSCB 1C9MA 2EAOA 2VEOA 3EG9A 1X1EA 4NAHA 4YRIA 2YTZA 4KSBA 3NIDB 4GICA 3G5MA 2CD9A 1VJ5A 3MD0A 3QLJA 3P9ZA 3RT1A 1AT1A 4CT4B 2CLCX 3OTQA 1T3LA 1Z7WA 3BERA 4IXTA 4RIIA 1N56A 1T13A 4N8EA 5EQTA 2O8DA 3GH1A 3QEOA 4CMJA 1JXMA 5SYAA 5LQAA 1RRMA 1AD2A 1BGWA 3TECE 3IX7A 4L0DA 3RC1A 4UB2A 4YRAA 4PHDA 1DC6A 2AHOA 2HMWA 2IEIA 1HZJA 3NHSA 5A6SA 3R3XA 3RS4A 2XZDA 3FHLA 4NLNA 4M0DA 4JJGA 1G7RA 1JV2B 2G5HB 3MWKA 2WP0A 5DU2A 3RYTC 1SURA 1JG2A 1GDDA 4V2IA 1GPKA 4AIRA 2WYVA 3OZAA 3JQ9A 3TLMA 3L41A 4F60A 2XMQA 3OQOA 2RC5A 2NOAA 3B9QA 3G2QA 1KXJA 3HUFA 5LA6A 4LRWA 2OWEA 2PLAA 4TMTA 1TAHA 1Z5UA 1XQ1A 3TOCA 4AQ7A 3Q6IA 5FUQA 4DM4A 2JLVA 3RJEA 5GONA 2LDBA 1DTEA 4HGZA 3WICA 3WHKA 2ZBVA 2DLCX 3VFDA 2QVGA 2C4WA 3DAHA 2P6OA 5FBHA 3BE6A 4FYKA 2X3YA 4WKCA 1Z29A 1P3DA 4XGNA 1UDBA 4Z8XA 4DNXA 1C30A 1KI6A 2MSEB 3TM5A 4JY7A 1ZHOA 4B4UA 1DG1G 3VV3A 1YNSA 2B92A 1ISIA 3LY5A 3ZLVA 4HT3B 5CA1F 3O3CA 1EWYA 3A4MA 2P3SA 2XYHA 2MINA 4J9KA 3A1VA 4GI3A 4E2XA 2V58A 4RD1A 2AU0A 2HVHA 1HFEL 3Q10A 5BN4A 3AM9A 3IUYA 3WA7A 4J0HA 4R3WA 4UPEA 2WU1A 3HM2A 1WIWA 1JHYA 3OETA 5CDGA 3FG9A 8ICCA 1V1MB 2CNWD 3RBEA 1CZNA 1JAHA 1RE1A 3BB3A 4GHWA 4WKBA 4ZH4A 4R0MA 4G0XA 1TLFA 1Y1PA 2XY4A 3EZ7A 3ZEIA 3OIYA 1YK1A 1ID1A 1CU1A 3PV8A 1E6KA 3LFUA 4FD2A 4KO3S 2VQEB 3TRDA 3EVCA 2V5VA 2CFRA 3TD2A 3ND9A 4MGKR 5HF8A 3TLGB 1GTZA 3QKIA 1N75A 4QXRA 3W4IA 4AY4A 1E4OA 1EEHA 3NS7A 3NTQA 1L3CA 3KZMA 4L5AA 1USGA 7ICJA 2F59A 4ED2A 3OZFA 4WNYA 3VHLB 4JLMA 3IIEA 5TQ0A 2PKRA 2IYQA 4XFKA 4KLAA 2FFHA 2WNIA 5L7YA 4JBNA 3EY4A 5CK4A 4P54A 4Q5IA 1BE6A 2IHBA 2YUIA 3AHCA 1E9FA 3NT2A 4KWHA 3FOZA 1ZJWA 1S4QA 3K53A 3RT9A 1FA9A 4YP1A 3PSHA 1QG4A 2ECOA 2DVMA 3FOEC 4ZDJA 3BULA 4AZ3B 4DLKA 3DDSA 4C8KA 4PRZA 3RDPA 3CKYA 4G07A 1SCUA 4QWCA 4RH1A 2P5YA 3FCOA 1U7HA 1XTIA 1RMTA 2V55B 3KLNA 4YV7A 1YA4A 4GT1A 4WCFC 2Y1XA 4AZ0B 5SZJA 2WUWE 3DL7A 3EVDA 1VYVA 1ZXXA 3GPBA 3IB6A 4TTRA 5F98A 4JI3B 1YB2A 2GCGA 3GJ8A 4PNZA 3ZR4B 4D0RA 4CETA 2A1JB 1VLLA 3JPPA 3BFKA 3BEOA 2JLAA 3AXTA 2RCNA 3GFTA 2O2DA 5FD8A 3L0PA 6REQA 3USES 4WV3A 3VO8A 2AFVA 1XTUA 2ZYGA 3AP1A 7ICQA 3TAUA 1ED1A 2H9YA 4FZLA 4P4OA 3OMWA 2A4MA 2GBLC 2NPFA 3RJ9A 1DPGA 3PIDA 4NMXB 3FKSA 3TPZA 3C7KA 4ITUA 4BU1A 1HEUA 2OHOA 3KP1A 5KX5B 1KQFA 3CISA 4MUNA 1QO0D 1ISRA 5JXIA 1XMPA 1PG5A 4Y2HA 3BCHA 2IUTA 5DYTA 3RRGA 3V1MA 1NNLA 1PSDA 2EJCA 3IO5A 3PYXA 1T4CB 4IHJF 2GUGA 2CW5A 4LECA 4RGYA 4EJFA 1G4UR 2AEEA 1NJ2A 1WVIA 4G9EA 4KDRA 5DI3B 3VBEA 4KQIA 1AOXA 2XCLA 4RKYA 3LC7O 3F46A 5CITA 4MYUA 3ADKA 5DBOA 2IWRA 3N53A 3QI2A 4IXMA 4HF7A 5CB0A 2XE6A 3TZHA 4Z4IA 4IBOA 4F0JA 2FX3A 2RBEA 2CF5A 1KZ6A 2E8MA 5AM1A 1DK2A 2HQ1A 4MW1A 5H8WA 1JRPA 2K87A 1WQ3A 2ZVDA 3HVHA 2YTUA 5MN6A 1W0JD 3ICVA 3L01A 3P97A 1V9LA 1BGVA 1IQUA 2UVQA 5KG3A 1JXLA 3OZRA 1KOFA 2B9VA 5DASA 3SX0A 1G7CA 1G2QA 2GN4A 1M33A 2E18A 3KBOA 5B3AA 2QIOA 4KH0A 2PX8A 3E7XA 4K9NA 3ZV4A 4E5VA 3CC8A 5JTTA 3ROMA 2J6SA 3FCUB 4QDUA 2PMEA 1NBMA 5IVKA 4HWPA 2DUUA 1SBHA 3ZEAA 1KIMA 1JIUA 3EXAA 2DFLA 1VHWA 4WXMA 4G2NA 3DEIA 5IU6A 2FE1A 4UB3A 2IY7A 2GYVA 4JOCA 4RY9A 4S05A 1ENOA 1PZHA 2VTVA 4FZVA 4F6LA 2Z3ZA 2ZTEA 4NLCA 4POAA 1A4XA 3QYJA 2O5VA 8ICEA 1V97A 1O97D 4LYEA 4IFEA 2HHSA 3HY4A 4MYHA 1KRXA 3CONA 4UC0A 5DFAA 1S2GA 3O2QB 3AUJB 1MH1A 1QC5B 2QGZA 1BPYA 4BB6A 5J4LA 3S8EA 3A6PC 2J4CA 2FNAA 3U81A 4LRUA 1IG6A 3GP5A 2ZAMA 2XSZA 3U7RA 4BOYA 3C14C 5B57C 2KMLA 5CB1A 5F9NA 1J56A 2FPRA 1NFFA 2G0AA 5A1JA 1T15A 3GZJA 3K8OE 1X8XA 1KJYA 5EJAA 3UK2A 3WMXA 4DSFA 4OHMA 4Q9LA 3FPLA 4EBEA 3JQFC 2XB6A 4X7MA 2Q7OE 2O3UA 5EMJA 5BPFA 3QXGA 4UDYX 4X65B 2KD1A 1SL0A 2KSOA 4OJKA 2XA9A 4BCCA 1CIJA 4FB5A 1QYXA 3DUFB 1QGUA 5FCDA 4MVJA 4TMVA 4A1FA 2SKEA 1FK8A 1N2ZA 1ORVA 2XD4A 4RHYA 1ZINA 3MTEA 1U1GA 4DFPA 1J2YA 3UAGA 5CP8A 4PINA 8ICJA 3ZU3A 3H16A 4UEQA 3TUZC 3ODGA 4PSCA 1NN3A 1ZQZA 1ORRA 2VK4A 4YJFA 5H4HA 1GYPA 4XQ9A 5E6SA 4HNSA 3G3EA 5BRNA 5DT9A 1VE6A 4IQUA 1VM6A 2G1UA 1K1EA 4QGHA 1KI2A 4QUDA 3RH4A 4RPCA 5JCPA 1N1DA 2MUTB 4GX1A 3VH3A 2ODTX 5JCZA 3NG1A 2HCFA 3LBYA 4KVAA 1BNPA 2YNMC 3R09A 3RBZA 4I9NA 2V9PA 5A1TA 3ACDA 1XL1A 4OGWA 3U80A 4ENTA 2G83A 1Q0LA 3VYWA 4UBCA 2FZKA 2P2NA 4MGIR 1BQEA 5F5LA 4EVSA 4D98A 4KLCA 2YJTD 3NP9A 1J24A 1A96A 1JEAA 4J9QA 1GSAA 3IJRA 4H3HB 2WT9A 5T64A 3AVWA 5I01A 2BGKA 3MJCA 4TXHA 5M29A 1Z33A 1L4EA 4TS4A 1CG6A 3LBIA 2OQ2A 1P1BA 1U8TA 4F3OA 5GV7A 1X2IA 5ER6A 3C6MA 4DWOA 1RI1A 3UMFA 3UW1A 3G6XA 1VBKA 5IBCA 1SVOA 1KJQA 1H2EA 1JAXA 1RTTA 3QVUA 2VTBA 1BVHA 3OHBA 2G5PA 1RQ2A 3C3DA 2BFMA 2W6PA 1SVMA 3PCRB 1SCQA 3RUHA 4OXNA 1I2CA 4CGYA 4IIYA 1ECPA 4YAFA 5KYWB 1WDTA 2QJTA 1Z68A 3QU4A 5DGBA 2JIPA 3U60B 3QLTA 1PFWA 5BSRA 1VCOA 1M5RA 2AOTA 3AZPA 4KLUA 2W2KB 1NQUA 4TKMA 5IDXA 4QZVA 4BO0A 2WTFA 5U4XA 5J2JA 1SH7A 4D9JA 5BXYA 2Z6UA 2H1IA 2JASA 1NM5A 5CX4A 2AVNA 4OD0A 1E3SA 1SC3A 4K9QA 1GCUA 2Q2WA 4EGFA 3EUB2 3P9YA 1FNSA 4RT3A 2ZGVA 3PDJA 4P2GA 4PCLA 3DEFA 2ZXUA 2BBWA 3I4FA 3RVMA 1EAMA 1ZESA 4LJ6A 1PQUA 1YL6A 3NTVA 4MJ3A 4P4PA 4RIFA 1HSOA 4QDJA 4WVLA 3BIXA 2FZGA 2FPPB 1GKKA 1WUJS 4CWAA 1VLQA 1HXHA 3A27A 3IAUA 4DLRA 1PVDA 2XRYA 3EFEA 2VCHA 1V5EA 1WO8A 1GGKA 2JZBA 3IM1A 4P3NA 4RY8A 1VZ2A 5DM2A 5AYVA 3QBDA 1FX1A 2GK3A 4C7OA 4LQDA 3UAZA 3NHYA 4P93A 1YZTA 1C1YA 5EJ8A 1MB2A 1VBFA 2QE7A 1WHTA 4Q01A 3D1VA 2D7JA 1OTXA 3MWDB 3DMDA 2HK6A 4F12A 3OZCA 1KNXA 4GMXA 1UJCA 1GG2A 4IIVA 1JG6A 4X6LA 5CYOA 3V1YA 4DQQA 4DAOA 2VHZA 4Y6SA 1EINA 4C78A 1NJYA 1O6BA 1E7YA 3GGOA 2HREA 2JAWA 3K4QA 2QI9C 2W8BB 1RQGA 1USVA 2H2FA 1IG3A 3I0MA 1GKYA 4S35A 2EH9A 1ZRSA 2OD7A 1TM4E 4EKGA 3KYJB 1WXHA 4WNCA 2FDRA 2GZ1A 3BYZA 1Y3FE 2RHDA 1CUIA 1HQDA 3HBNA 3L02A 2O8EB 5IAJA 3GJ5A 4MCIA 5ITZB 1R0RE 1TEHA 3DJFA 3C6XA 4FEGA 9ICTA 1FTQA 5J8YC 2H0QA 3M6MD 2KS6A 3C2QA 3PG5A 1LBTA 3PWZA 4RKFA 4Q9IA 3ZNOA 4BRWA 3VNAA 4ID3A 4M1WA 5FIUA 1TE2A 4EJSA 1U4SA 3CPHA 4IFTA 1GQOA 2CN1A 4HWTA 1YDMA 3BMCA 2BT4A 1QQ7A 2OHXA 1QGED 5K4HA 13PKA 1YXMA 5EWMB 1RFLA 4DM7A 4AP9A 1LSSA 1XVTA 3ZY5A 3BWCA 5AIBA 4QQKA 4YDSA 2X86A 3KQSA 4CL2A 2Q3HA 2HW3A 1ICIA 2P1DA 3FRHA 2JKVA 1IBCA 3UBTA 1NULA 3HS3A 4EX7A 1R8QA 2P9BA 1FP1D 3BS4A 4JJ6A 4NMLA 5IP5A 2AI3A 1FFXB 4B84A 2B6HA 2XB4A 1IH8A 2G9NA 1NM5C 2WMOB 1GZVA 4MW7A 4OH1A 3A4VA 1OFVA 3GJRA 3U3ZA 3UUEA 3W8NA 3L07A 3RF9A 3PW7A 2PLNA 1JBQA 5H0IA 1IULA 3ZLUA 1ZQFA 1ESCA 4L4XA 4M3NA 3AQIA 1KHTA 3HEMA 2QW8A 4B9NA 1T36A 3O8BA 3TNJA 5FRDA 3I6BA 2FW1A 5LZ8A 4ZJUA 4L16A 3PEEA 2RHLA 2MR5A 4G65A 4UBJA 3N4MB 3HKEB 1NASA 1JUDA 3C5VA 3VX3A 1O1YA 5AHOA 3WSVA 5DNDA 5CHYA 1DBQA 1QCYA 2IXBA 2PS0A 3LLVA 3MWLA 3OE1A 4M6WB 1JJBA 2HBYA 4ASUD 1NQVA 2AUMA 4O8CA 2M9NA 2LXNA 3I9FA 4FZJA 2HU2A 2C98A 3WWDA 3T38A 4DWIA 2FFJA 2VNIA 3NWJA 2XCTB 1Q3HA 1CR2A 4OQLA 4Y6GB 1EM8A 2DFDA 4FZMA 3NBYC 1X40A 1DX4A 2J3EA 2Z5FA 4Y7CA 5IBPA 4YACA 1ZQXA 3IAS1 4QYIA 4MQFB 2K7FA 4O3RA 2XGQA 2RGWA 4KLRA 4UHEA 3RB8A 4YCSA 5T67A 4AN4A 2YWDA 3GFPA 4IFBA 5LN1A 4GWKA 1IUPA 1MN8A 1CEYA 1PVVA 3I6MA 3EZFA 1LSOA 1RVV1 4XZ3A 3L7JA 1MAUA 2BFBB 2BY4A 4G81A 5JXWA 1FDTA 2YHSA 3IAXA 3P9IA 4LRQA 2VYNA 4WJZA 4FE4A 3REOA 3FKJA 3TIFA 4NNOA 2D00A 3UTDA 2NXEA 2XUFA 1S0VA 4O02B 4RLHA 1YFLA 1XSEA 3I2HA 3I12A 3P4YA 1M10A 3TADC 4R3NA 3KWJA 2JLSA 2OEPA 9ICUA 2HBKA 5CDYA 1OJLA 1EM6A 1ADCA 4KDEA 4NKRA 2WNHA 4MWOA 5EHQA 2JAPA 1MD9A 5JS8A 1GHTA 2VT3A 4Q9HA 1N0UA 3WLQA 2PJDA 3OZTA 4FDMA 1NKBA 3NO4A 5AKIA 2ZEJA 3X1MA 5LNK1 4ZCQA 4RZ2A 1QG0A 3O84A 2VDLB 3NHUA 4LJ4A 3EFBA 4BB5A 3UMYA 3WIDA 1T4GA 1U2SA 3F3KA 3FTFA 4EATA 3KQMA 3QV2A 4FD3A 1W5TA 4YECA 2WWWA 3AB3A 3GRVA 1RXWA 4HL6A 2HCBA 5DGTA 4LY6A 1HE2A 5KMGB 3UCFA 4IGIA 1W36B 2CL6X 5IJ9B 5LIPA 1PJTA 1Z5WA 2X2PA 4GI1A 2GSWA 2HK9A 4MUMA 3R74A 3RQSA 1YVDA 3R7FA 4GXRA 5IC4A 3GT7A 1YRQA 3T5KA 4OJOA 2ZIWB 2GEJA 2OSBA 1I0LA 2AJTA 3AP3A 1NXPA 3SV4A 2FWAA 4WZBA 5KOIA 3H40A 1T5OA 5KJCA 4DO9A 1HH4A 3D5EA 1YJQA 5K45A 1II8A 3OP1A 2OUKA 2F8LA 1SBNE 3E5MA 1WZEA 3JTEA 1KOJA 1XDBA 2FU5C 3VDMA 5HKKD 2JGKA 2D3TA 1J2UA 2HA2A 2ZIGA 5LQSA 1J7JA 1OMOA 3RAPR 1OXMA 1U6KA 2C7QA 5K0CA 4JDPA 4BWJA 5L9XA 1B41A 3SYKA 1FFYA 3IUNA 2FSPA 5AOAA 4BYMA 2R751 3TSCA 1SXPA 3T3PB 1NQXA 3LQ1A 5JD3A 2KZZA 2VT7A 3B1YA 5IINA 1E1MA 5BVGA 1Y5NA 1OVGA 4OHXA 1D2GA 1VSUA 2Q5IA 1H42A 1WBJB 1FBNA 2LIVA 3AJ9A 4A8EA 3O2JA 4N6GA 1VJRA 4P6VF 4WNIA 1XRSB 4L3VA 2VJLA 5K0EA 4G63A 2IITA 1D1SA 4IEFB 1PFGA 1WMAA 1ZQCA 4QU0A 4BVFA 3A9WA 4RGVA 3TTYA 2FG6C 3NGLA 1FDUA 1SCDA 4GWLA 1RBYA 3RYCA 3G0HA 4WZAE 3WLTA 1Y7HA 2QP9X 2QTAA 3OWOA 2I8AA 5LP6A 2MMGA 2K4IA 1X7ZB 3SE0A 2MMCA 1C1DB 3ROPA 1YOVA 4R2HA 1GPAA 5DNAA 3EBOA 1XQ6A 3R0QA 5GM2A 1RKQA 5EUBA 4EMTA 4YP0A 4CR6A 8ICFA 2C5LA 2IVZA 4WXHA 2P4QA 1DVRA 3GRRA 3C5HA 1NVBA 4GZMA 1KZGB 3VR6D 4FO6A 4OKNA 1N4AA 4DC0A 2C2BA 2JW5A 3C41J 1R4AA 5FP0A 4TUPA 1UBRS 4OUDA 4AULA 4CCWA 1IZ8A 1MJGM 1NW9B 2ZQYA 4QUIA 4TQRA 2RI0A 3DMPA 4Z53A 3G7NA 3LX8A 2NYRA 4HVAA 5DSXA 1C3EA 4LE2A 1E99A 3STVA 3RJTA 1QP7A 1Y7PA 1DIGA 1WXFA 4DR5B 1RAFA 1WS6A 2QN6A 3QHPA 3V7WA 1MX3A 1I5EA 1XT6A 1SZHA 4AYBF 1RWWA 1YULA 2Q45A 3V2HA 2LGJA 1E79D 4BO9A 1PUJA 4EW2A 1Q0UA 1TT7A 4XVCA 4RSGA 5KQLA 2BGGA 4BFUA 2P4EA 4RTSA 4NL9A 1A0OA 3BWXA 4GI2A 2GM4A 4IJMA 4PLGA 3OC6A 3B6EA 3GJZA 3MSXA 4MQ6A 2IV7A 1QFJA 2QRVB 1I4WA 2J67A 1WMBA 4L95C 1IM8A 2H3EA 1H66A 3HWX1 2VJ5A 3MDCA 4G89A 5B4VA 2CXYA 1G20A 1LGYA 2IYUA 3FGNA 2JJQA 3PPXA 3Q12A 4XIJA 5J2TF 5ITSA 1FPQA 4W4TA 5LP6C 4MRSA 3W5JA 3BEDA 1FXSA 1ORWA 5E4YA 2NPOA 1EK2A 4JOQA 3DE2X 4O4JF 1ESMA 2HHCA 3GFRA 4GL2A 4GM0A 1D4OA 1EP9A 2D4HA 2IIPA 1XQWA 5FAKA 4QELA 1DFIA 2HMAA 5KFCA 3V4VB 2OHFA 3O83A 3VC1A 3VPFA 1YBAA 2IV2X 2ODQA 4Y2UA 4OA8A 1IWPB 3WQQA 4DQKA 2A4KA 2ZJZA 4EYHB 1T2FA 4HXGA 2Y0BA 3DE6X 3FNQA 4IKEA 4LDRA 4CLDA 3NGXA 5ILGA 8ICMA 1BCSB 2VIXA 4DJTA 1CUYA 4DOMA 3T95A 2PS9A 2WUEA 3HC7A 2B4QA 7ICLA 1OWMA 2AUNA 3TJRA 2OAEA 2ESRA 3REQA 3QUBA 4OGKA 3BF7A 2CHVA 4B3GA 2XOXA 2YVQA 1H2WA 3PC6A 1Y6QA 2F00A 3H4DA 2HB6A 2YICA 4NECA 3UGKA 5ADHA 3CSUA 4Q1FA 3WDLA 3QVMA 1BZYA 3A7EA 3ILSA 4E5UA 3CW2C 1QBGA 4IQGA 1E1QA 2A1IA 4GGOA 3AV3A 3AFIA 4DSUA 4DSNA 1R16A 2AMLA 1TQ8A 4JASB 1XPOA 2GEBA 3EGVA 4J1NA 3SZGA 5J2TB 2ZYTX 1CX9B 2QI9F 3EF0A 3D4NA 4DF8A 3CMCO 1N32B 4KW7A 1VHJA 2Y0DA 3E27A 3CLUC 3LW8A 5CNIA 5BSVA 7ADHA 1RPLA 1KK2A 1RPJA 1G18A 2H0AA 1X14A 2Y8EA 1GM5A 1RZVA 5JWHA 2RRDA 2FN8A 1H9CA 1LDMA 2QRGA 2ZB2A 3VKHA 2W03A 4C5BA 5B4UA 1DTWA 1VIAA 5BQ3A 1XZGA 4FKMA 2PDAA 3WK8A 2EQBA 2IOFA 5BT8A 4U9IS 3FLBA 2ZR8A 4TTIA 4U2EA 3P0EA 4RPXA 5C31A 2VJDA 4YP3A 3ZN2A 3ECCA 1TB4A 2FJ0A 2BHNA 5JLAA 3K6SA 3FGOA 2CKMA 4IX1A 3I4LA 4EYOA 3RAEC 4JU8A 4W5HA 2P0EA 3PRHA 4BKRA 4GR4A 5J5CA 1NLFA 1RXEA 1CFJA 4PGQA 3CSSA 3MYRA 2LM4A 3ROFA 1C0PA 4YUZA 1KP3A 3GIJA 3AETB 4LDZA 2ZUCA 4V24A 4BP1A 5KINB 2FDXA 1GDTA 3KQYA 4Z86A 1MAVA 2C2GA 1M8PA 3ND7A 3LW7A 4JVNA 4U6NA 4U8HA 2PH3A 2NN3C 4R2IA 3B9PA 5JARA 1K8YB 4K9SA 5TMBA 3SMQA 2CCGA 2FAXA 5BYKA 1CPYA 1AMNA 3AERA 4PH5A 1IM2A 4F4WA 3GARA 1J21A 1BHO1 1MTZA 3IEXA 2CMKA 1GTG1 2BQRA 1WP9A 3GX1A 2POCA 1XYGA 4AI6A 2JR5A 1VOTA 3MJTA 3PVXA 1VA4A 4PVCA 4PFSA 4WFIA 2BKXA 2ODWA 3L1JA 3SBOA 4I50F 1XBTA 5ALNA 1V8DA 3CINA 4J16A 1N2HA 5FUVA 4WFQA 5IM4F 3W3AA 1E0AA 4GOMD 1Z8NA 3I9NA 1X1DA 4HVCA 1P1RA 2PX0A 3HU1A 2PD3A 1HI9A 3FHOA 1U6JA 3UMBA 2XDYA 4JV2A 1TAMA 1BXGB 2H85A 3HXLA 1ZD2P 3KEGA 4IDFA 4R1PA 1N2IA 1XZQA 4TS3A 4K88A 1YS4A 2E4UA 2WMYA 3GNTA 4OREX 1J1UA 1AXEA 3NLLA 8ICPA 1SKAA 1F7VA 4ZCSA 3HDVA 4LJLA 4ZEVA 1GRCA 1CR0A 3X1ZA 4UPDA 3JAKB 4JUAA 3BIFA 4RD4A 4WY2A 3CPJB 1AHNA 2XYVA 4J76A 4TYMA 4XUDA 3SIXA 4A2QA 3NHPA 4CI9A 4TZ6A 2C94A 5JVDA 1KZ1A 5B7NA 1Y0BA 5EIAA 8ICAA 2QP3A 3ANNA 1F2UA 3BZWA 2D74A 2FWBA 2H08A 1QU3A 1QNLA 4RIHA 2G08A 2QUIA 4XSVA 4YQYA 1V5FA 3T7SA 2D1FA 8ICKA 2FHPA 4JBYA 4P5EA 4B34A 2ZR7A 5L1IA 3A10A 3GJSA 4RV9A 5B3JA 4BKMA 4C2UA 1W1UA 3NANA 4DIDA 5EESA 2JLBA 4LZGA 2D2VA 3DE0X 3I6IA 3MHTA 2LWIA 4LDJA 3MAJA 1DRUA 4ELVA 1BEEA 1JIIA 2OM2A 3QPAA 2QMQA 2XI4A 2NPIA 1I1HA 1QHHB 1XCBA 4C30A 4IH9A 1S0MA 4JJ4A 5BW4A 2YUTA 1RJDA 3SKXA 3QVGB 4GPZA 4A92A 4L3OA 1W9MA 4RQMA 5JDIC 2OGWA 1F0MA 1I01A 1NJ5A 2J5XA 2XVAA 1K3FA 4RQ2A 2OVBA 4MQFA 4CKYA 1G16A 1DB3A 4UBBA 1PJAA 1F1JA 2QXTA 3FVTA 3N07A 3A4IA 2A0XA 5BYJA 4NCAA 1PX0A 4KLMA 4AJPA 1SU7A 2H3HA 2W9MA 1U0HC 3EVZA 3CBGA 2JI6A 3RSZA 5JC1A 1TK2A 1LTHR 3M83A 5DNCA 5LLDA 5NLLA 5KFXA 2F62A 5IPFA 1NVXQ 3G82C 3PDUA 1VSVA 3HKCA 3SEIA 1JEQB 2ZE5A 3FCCA 4FE7A 4KV9A 4RZUA 4AZWA 1QF6A 1RRGA 2OVFA 1KEEA 3N2EA 3DHNA 1SC9A 3AFOA 4NJMA 4I7EA 3LYHA 3RTAA 1RLMA 6Q21A 1N6HA 1QKKA 2WTUA 4I2FA 3FTNA 1UIRA 1IAQA 5EQDA 2JF0A 3CG4A 3LFHA 3ZI0A 1KWKA 3G7UA 5G0SA 4TN1A 4S2UA 3WAGA 3TQHA 2Z9CA 3DEKA 4P0PB 1KDVA 1RZUA 2O3SA 3VKVA 3K4GA 5D84A 1ZQLA 5FV7A 1BMFA 1DAIA 5CPBA 1XZIA 2YOFA 3FWNA 3FDXA 3ZZUA 1EFLA 1A4IA 4JEIA 3GEPA 1SB8A 4HAZA 4RHEA 2OXOA 3HILA 1PI3A 2ERCA 1MJ5A 2WSSD 4ZOLA 4MQEB 4GSYA 3WLIA 1F9EA 5L3SB 1TJ5A 4JMUA 3TTXA 3AU9A 4PAWA 1XZCA 5B58T 3DO8A 1XP8A 4NOKA 2C9CA 3HRHA 1J90A 1SWVA 1UBSB 1Q0PA 4A8TA 2JBAA 5AKGA 2GETA 4H2DA 2XODA 3AW8A 3JU3A 3A1WA 3ELDA 3LWZA 3NGMA 3OFND 1I7DA 1DU4A 1QFYA 2RMKA 4F86A 4A15A 4KR3A 1GPYA 4AO7A 2ZRKA 3BILA 2WZDA 2AG6A 3CZ5A 3B3QA 2EFEB 4PY2A 1U7UA 4EARA 4X92A 1JQ3A 3H9CA 4YP7A 3T35A 2QL9A 3ANMA 2H9IA 3R0VA 3QWFA 3RJMA 2QBYB 3OJ0A 1KIFA 1C50A 1DWQA 2Z2ZA 2KSQA 3NV7A 3BK2A 3UBMA 3WWYA 3PEFA 4LHVA 3O73A 3PGKA 4X5OA 5G1OA 2ZLBA 5DSTA 5LC1A 1QAMA 3ZBUA 1KP9A 3CNHA 1R8JA 3BVPA 3D1JA 4MARA 1HRKA 1KAQA 2QORA 4D97A 4HEA1 4U7TB 5CH3A 1MNAA 4RZSA 5DBIA 3BJZA 2OR3A 3IKLA 3SLRA 3UUWA 1NZDA 3GOQA 5JAPA 5KX5F 3W6OA 1U4BA 1UKBA 3GT0A 2W7PA 4KQXA 4AC9A 4YV2A 2QR3A 3L7OA 5CBPB 1CRQA 2I78A 3PEWA 1ESNA 2MYTA 4DYVA 2ZXFA 3TFWA 4UJ5A 3JQFA 1H0SA 2GM5A 5CG2A 1FFUA 1BCSA 1XJWA 1KVSA 1UMCB 2CC2A 2VP4A 4IL6U 2J4FA 3CQ9A 4NENB 1HETA 4KI7A 1K6JA 4KSCA 1YQ9A 1ZQUA 4IH4A 1M2FA 1ZVMA 4R31A 3KVOA 2PG3A 2I7DA 2ZBGA 2Q7XA 5HKOA 2KZMA 1EFRD 1ZU5A 5DI3A 4ESVA 2HOFA 4GZ3A 1CY4A 1FSSA 5I6DA 3PDIA 5CB4F 4PCAA 3BPSA 3JAWA 2XNCA 1ZQOA 1Z4OA 4G5FA 1JJVA 2WA2A 4JBXA 1CUUA 2EX1A 4D80A 2GDZA 3DVLA 4MW5A 4CMBA 1XEXB 5JW6A 4JL6A 4EUNA 1VLVA 2EAPA 2SNIE 1E0JA 2JJMA 4V0KA 4LBWA 1Z1VA 3IG5A 2CUNA 4RZIA 4ZGGA 1IUOA 2EKPA 4LGYA 3RFCA 1KO5A 1KFSA 4JLNA 4ROTA 3ZDQA 5DTJA 1WSDA 3D4IA 3DPIA 1Z39A 4MFCA 2IE8A 4D9GA 1AXGA 3ABOB 4IG9A 4QBKA 1L4FA 3Q8QB 2TECE 3IVMA 4B45A 1NW6A 3AKZA 1K8XB 2RH8A 4W7SA 4YMMA 1KPGA 4AZ0A 4AJHA 1DZIA 4I9FA 2C78A 4NAUA 5ABPA 5LQRA 2ORED 1AA9A 3EXFA 2I7CA 3TCXB 2D1TA 4FR2A 2A0FA 1JXEA 3B85A 3R9KA 2J3LA 2R8EA 3CZRA 3FWZA 3PQFA 3QLVA 3BTUA 1ADGA 3TW8B 4EHLA 5C37A 2OE2A 2R86A 3LXXA 2BHTA 2H1RA 1K7FB 2ZRQA 1N8NA 1S2NA 3LDAA 3BJEA 3DWGA 3WKBA 4KHZA 3SZMA 4IPTA 4I55F 2G72A 3L7LA 4P4NA 1RYSA 4CTOA 3OE5A 1UBJS 1A4RA 3CR7A 2V45A 2XR1A 3NIGB 3V8BA 1KVTA 1KZYC 3H5WA 3IUBA 4L6CA 4FDVA 4ZWNA 2Q0QA 4R9NA 1J00A 5A4AA 1GR1A 4FIZA 5JU6A 5KFGA 4U7GA 2YJ5A 4ZT6A 1Q0HA 5TQ0B 4UBNA 4RE6A 1Z6AA 3ZCTA 3NOVA 4LTNA 1BPZA 4LVCA 2BM0A 4XM2A 5FFFA 4YRRA 4R8UA 1GL6A 2HU7A 3EJWA 4PRKA 1U31A 4EZ9A 4K6MA 5DOVA 4U6SA 1BCRA 2W6ID 5LYJA 4PHEA 3KYCA 4YDQA 3QWBA 4LYGA 2D59A 1P5JA 2DT8A 3EXFB 5L7WA 1SV0C 2ZYHA 2DLNA 5KFDA 1TPZA 3DMNA 5JROA 2NGRA 3HCAA 3ICPA 2JH3A 2YVUA 1XMVA 1F8XA 2OT3B 1OLXA 4Z3KA 5TJ9A 1ZZGA 2HRCA 4GC9A 3S2FA 3S2YA 1UXJA 4BFSA 1PJ3A 4MVJG 2P4UA 3EQ9A 3PR3A 1B0XA 1ZNWA 4O4LB 4BFWA 1NNUA 4EB6B 4M38A 4C80A 2HA7A 1PZEA 2F3NA 4EVRA 6GPBA 2J08A 4YUYA 3THXA 1A1VA 4K0RA 2WV7A 3F98A 1Z47A 2CRXA 1M1XB 3HJTA 4DR7B 2Y2VA 1KL7A 2J87A 3MVEA 2ZIUA 1GQQA 1NDUA 1VMAA 4CMEA 2C97A 4DARA 4P33A 4ECQA 3U5TA 4KQMA 1HNWB 2RGCA 2C7RA 4NU5A 4LE1A 2IX3A 4MVYA 1XZLA 1C8KA 3QBVA 3R0XA 4TT3D 1NF8A 1Y4AE 2OBNA 3OQBA 4Y1FA 5J2IA 1YR2A 5AH0A 5G3YA 2H4FA 2RB5A 8ICTA 4C05A 3I92A 5T6MA 3FC4A 4P5PA 4M8IA 4UTOA 2IH2A 1BROA 3NT4A 3IESA 3OF5A 4P4UA 1I9CA 3UT5A 5A4KA 3NTUA 2GF0A 5DG9A 4ELUA 3O93A 5I8WA 2ZOSA 1ZXBA 3I6QA 4ZA2A 2WU4A 3SHWA 5CJ2A 3OQPA 1XKLA 1EZ4A 1GPWB 5J2DA 2X5KO 2Y1EA 1A5BB 1J0XO 3H5NA 5C53B 3G0CA 1TT5A 4WW0A 3F8WA 3S70A 1P74A 2FPSA 4C04A 5LUAA 3WYBA 2DG2A 1PN3A 4NV3A 4YMGA 2UYOA 1DHRA 2GEKA 2WVGA 2ZI4A 3CF0A 5JFOA 2C2ZA 4HGPA 4TWAA 5CFPA 1QO7A 2BKUA 2KE7A 5EEHA 4P4GA 4UFPA 2I2BA 3BQ7A 4IP0A 5KC8A 4CM4B 2R8XA 5AXCA 2BR0A 1SZCA 3U1BA 4IGFA 1PL7A 3AF5A 1N60A 4QZGA 2IYYA 2XAAA 3B5IA 3BMXA 4UBKA 3GAAA 3W04A 4B83A 2LKYA 2C7PA 4FBUA 2X1LA 3IQIX 4MROA 5DK4A 4EHJA 2WPDD 1Z0AA 3BMNB 1U0TA 2VSQA 3DMRA 3GFSA 2JS7A 3DDWA 4I2CA 4AXXA 5KTKA 2F8SA 3BE5A 1QLWA 2BMFA 1UM9A 2IUUA 5F73A 3TG8A 1NBOA 1PL6A 2ZU0C 4PN3A 5AVTA 3KYCB 2HQSA 3BD9A 5EJ6A 1J42A 3CUVA 1B0AA 1PG2A 3IQWA 3OTWA 1YDFA 4RHTA 4ONEA 3RVSA 2B4AA 1XF1A 3H1PA 4C0XA 1IY9A 4O4HA 4D9CA 4FMPA 4ZHQB 1ECLA 4AD8A 1BPBA 1YDEA 1WW2A 3DTVD 3R7AA 4YT2A 2C82A 4AKEA 5D51S 4BMSA 5DB7A 5ER9A 3KKEA 2K4HA 1U0JA 3QUCA 1MQ3A 2BKEA 4G5YA 3UJCA 4ECRA 2WJAA 3K0KA 5K9ZA 1O94A 4X1IB 5DDIP 5DISB 3KB1A 4IIDA 1FXWF 2Q1YA 1N34B 4JK3A 4XSGA 2WB1F 2I1LA 2UVWA 1GUZA 2BRUC 1C41A 4GR9A 1FL9A 1Q1AA 4DG9A 3PJRA 1ZQGA 1J0AA 1IHDA 2Q4RA 2KEYA 3WL7A 1XLUA 3EXHB 2RSLA 4BMPB 4UMEA 1RQXA 3DYVA 4RZRA 2AKAB 1GU0A 3CH4B 3Q7QA 4M1SA 2F3RA 5BR1A 4CMEC 3RYFB 1RHQA 4C6RA 4ZAZA 4O4HF 1I6MA 2CBXA 4FMCB 4YJHA 5CLLA 5EGNA 4DEXA 3D2SA 1J99A 3FCXA 4EUHA 4CV2A 4IGEA 3IYLW 3GAFA 2BEJA 1JB9A 3UCXA 5I8PA 4P4SA 1V7CA 3E3OA 5K05A 4O2BF 2HBJA 3TYXA 3HPRA 3EBLA 4ZVRA 2IZOA 4A9AA 5I7WA 5HJ5A 4P22A 3OWHA 4DL6A 4LEIA 5FYQA 2LCFA 3CWCA 2P40A 1KARA 3LK7A 4RF3A 4U02A 5A4FS 2NAPA 4PHAA 4Z0NA 2FPKA 2IHYA 3Q5DA 1EH5A 4HEA6 4QNLA 2RAPA 4DL2A 4TROA 1NURA 4KPYA 3HH8A 3PCXA 4IUCS 3WTBA 4UE2A 3TQSA 5AVUA 2Z6QA 1ZEJA 4ZD6A 1W7AA 2UU9B 5F9HA 5DYGA 4Q1VA 1V7ZA 2BHSA 2D7DA 1SL2A 3NT5A 4MQUA 1GSIA 2NUAA 4ALIA 2I6GA 1NVAA 1L5FA 3Q8WA 1WEHA 4AROA 5J0UA 2QMHA 2GKOA 3L4SO 2ACEA 1CY2A 1NN5A 2YJGA 3CRW1 1MT0A 3MSCA 1O8BA 1QV6A 4EQZA 1EDOA 2VPPA 3L1UA 4K03A 4PTYA 4XDYA 5CNJA 5AUPB 1WTCA 3KL2A 3LYUA 4QGBA 1V1MA 2KB0A 4BCDA 1ENZA 4WN3A 2QQEA 4UTRA 1QCZA 1O7JA 4UM8B 4P8RA 4JLDA 5H68A 4RTRA 4BZXA 1QVWA 3OH8A 4M8LA 1SUDA 2OV8A 4G67A 3IAHA 4XLZA 1NAIA 1U8CB 2C2OA 3C8ZA 5F64A 1VL1A 5IABA 1XAJA 3QF7A 3RVDA 3RRXA 4UU1A 3RVPA 3J81j 3WK9A 1STOA 1V6SA 1WOMA 3TXXA 4ZAFA 2QD3A 3RB4A 3VV2A 1EA5A 2WIBA 4RMJA 2J0UA 5L1JA 4BLVA 4L5IA 4K26A 2QQGA 4Q7JB 1H23A 3CTMA 4GDMA 3UYLA 4ZKDA 1UZLA 3RJFA 3F7MA 3K70C 4IS2A 4BPRA 4ARCA 2VAVA 4FS1A 2H18A 3GPCA 4DA7A 1R0CA 3Q8LA 1TJ4A 4I9HA 4B2IA 1KTVA 1VSTA 1RPAA 1YCDA 2JJ2A 2A9KA 4PBSA 1HORA 2OFXA 1V4VA 2ZE7A 4DSIA 3EBPA 3INRA 5IK2D 2XVZA 3PQ4A 2HVIA 3NALA 3RASA 4H08A 4KP7A 3NTRA 4I50A 3K2IA 4A3SA 3BXPA 4QG7A 2XWSA 1QZTA 2YDYA 4CG2A 4WBNA 4TTPA 5C34B 4DBLC 3OX3A 2DE0X 1DX9A 1OU4A 1ZOPA 5HP4A 2JLCA 2VDOB 4C89A 3VVCA 1T8UA 4IJUA 4EZEA 5LM3A 1JQKA 4Q3AA 4B7CA 1TQ2A 3ZHRA 1JEYA 4UU7A 1GQRA 1IY0A 4Z9XA 2IV3A 1Y5LA 1KO8A 3OZVA 4DRXB 3FAHA 4BP3A 4ITVA 3DTTA 2IHKA 3MRTA 2D0PB 4P5DA 5JC8A 4D8TA 2L19A 2FR1A 4E5KA 4TXLA 5DGHA 3DBHB 4PQFA 2F3SA 4OBWA 3Q7SA 2NO4A 4TV9F 5E4JA 3THRA 1NRXA 1RXCA 3CU5A 5FBVB 2R1TB 2CNLA 3JV7A 1BEZA 5D1NA 4GC5A 4N49A 4KLQA 4C8MA 2FTKE 2IP4A 3ESXA 3KE9A 4KXWA 4GC7A 1H5QA 3HKCB 3R4CA 4JVMA 5T7BA 4W5QA 5AXAA 4R7ZA 1PWHA 3QEAZ 1CR1A 2I6XA 2J6TA 2GB4A 2XSZD 1JJIA 1U8XX 3GJ6A 4ZEOA 1P6QA 3SG0A 5JZOA 4KRFA 1RMYA 2H1SA 1X15A 3WK7A 3UMJA 1HE8B 3H1FA 1IJBA 2JZNA 2W2TA 3I04M 1I24A 2IC5A 2F43A 3INNA 3O91A 2Z9DA 3H05A 1UJ2A 5IN4A 4OHBA 1P75A 4MEXA 1UOEA 2AX4A 5IKXA 4IUBS 5B7PA 2LKDA 4FFBA 1F8UA 3V97A 1BW9A 1TRHA 2FW8A 1NG9A 1GZ3A 4X3CA 3MD9A 4Z6KA 2VHTA 1HNNA 4TZTA 5D3QA 1DEXA 3TJZA 1M2JA 4MLPA 2G5IB 1VHLA 3N39C 4JT9A 2C96A 4TWZA 5K01A 4W5JA 1PV2A 1UBTS 3L8EA 4BEBA 3DB1A 3IO3A 5KCMA 2HTFA 1IN1A 1SC6A 1YUNA 2P77A 3M1AA 4I0WB 2PQMA 1NXOA 2QJOA 4CKEA 2ZI3A 3QP9A 4AWBA 3CEHA 5EIOA 4LC9A 3BBLA 3KAQA 1ZETA 1NK6A 1D9DA 3MCTA 4WKNA 3OOSA 4DS5A 2J59A 4HP8A 4I5IA 1USUA 1M6EX 3IPRA 4HZIA 5B2ZA 4DZTA 4ZYUA 1C3LA 1MP0A 1S2LA 1YZKA 3FVWA 2VTEA 1NLUA 1IFXA 4JJEA 2QR5A 5AK3A 3MXTA 4MV0A 4LXIA 1FFSA 4CQJA 4K9LA 5DTMA 1X6VA 3A05A 4FGLA 4HYTA 1R6BX 2VLIA 5EUMA 2OQVA 4ZJPA 3C16C 1SQ5A 4NYIQ 1Z75A 1N48A 1MG5A 2UZ1B 2VKQA 3NOOA 4MI3A 1S97A 5B55A 2IELA 3PNPA 3IULA 3CLVA 4JP2A 1LSUA 4FWTA 3D0OA 1P2UA 4MRRA 5HM8A 2FRDC 1E79A 3LI2A 4OMFG 2QPLA 4IW3B 5E7IA 2Q9CA 4MP8A 2F1JA 3O4IA 4MCAA 5UKDA 3PI6A 3AJAA 4XIYA 2AOUA 3DD1A 2XUPA 4ZEXA 4JBLA 2G9VA 3M8SA 4RPLA 3WYNA 4C0LA 2WAQF 5LBUA 5TE9A 3F4LA 2VP6A 2WAXA 1B3BA 2DT5A 3KV1A 1KU6A 3GLKA 3MINB 4KPUB 3TIXB 1RYHA 4F4KA 2C1EA 4HQLA 4JB2A 3EZ5A 2WU8A 4RQ4A 3ELBA 1DBWA 5KC9A 2WJZB 2Q50A 3LWDA 4O6VA 5EZ6B 1HFKA 3W0LB 2KP7A 3CZCA 1GCOA 1P5ZB 2CY0A 1DARA 3JQRA 2UAGA 2QJRA 3MERA 1P1CA 2QAGA 4Y2YA 4UUNA 5IWAB 3IEKA 4D4MA 4Y2XA 2BEWA 3JQ9C 3R5XA 3B3JA 4IHAA 3SKYA 3T5MA 4GKKB 3L1KA 1OFGA 1EDZA 2BZSA 2IYZA 5JWOA 3HX0A 4JJAA 4QFDA 1U8UA 3KUDA 5HFAA 1L8LA 1X1AA 1H9BA 3SVTA 1ZLYA 2X5JO 2XUQA 5TMDA 3EUAA 3E9DA 1NSYA 3GJ7A 2MHCA 4JT2A 2ZTSA 4V1CB 4R69A 2O4UX 1IRXA 3LDGA 4BQPA 1IAVA 2VI5A 3DKPA 1ECBA 3H2GA 4H77A 1SQGA 1BKDR 3GA7A 2J0UB 4KRGA 1B00A 3KEFA 4J90A 4PZDA 3Q8RB 2R8HA 1TCAA 4R66A 4IIJB 4Y9SA 3Q7EA 4Q3KA 3FBGA 1MR3F 2IYFA 4GZ6A 3PRYA 4KNYA 5IDYA 2PH1A 1DXYA 2V6MA 4RKEA 2QTMA 4AF6A 3QKTA 4FMCF 4OK3A 2UYHA 1QF9A 2ONYA 3C6YA 1M5TA 4FINA 2ASDA 1JQLB 3N8KA 1JN0A 5KNCA 1O03A 4XDZA 4PAMA 3EPKA 1JDSA 4PG7A 5DX8A 3G5UA 4L3WA 2NUBA 3T0GA 3DZGA 1J39A 1W5SA 2C99A 3NEAA 4QBTA 2XMCA 3A3YA 4ZI7F 1EUDB 4NJEB 3T41A 3L0BA 1Z08A 5CGQB 4I29A 1E1LA 3GHHA 4D3ZA 4EZBA 4O29A 4C8OA 3WV4A 5IASA 4R64A 2H11A 1M2VB 1DMSA 4F9GA 1P1HA 3TSOA 4Z1MD 4OHWA 3A6GA 2FW7A 2WILA 3ZWVA 2V6JA 2V7VA 4FGWA 3KSRA 4PZZA 2L18A 1NZBA 1BMQA 1Y9EA 3WNQA 7REQB 3VJRA 4I36A 2RHTA 2JK0A 3SAFA 2PCJA 5ENVA 1N78A 2QRJA 4D3SA 1HMPA 5KNDA 3RRFA 3ZNPA 5HF9A 3CP8A 3ZV6A 5F3RA 1OVMA 3MQFA 1OFUA 2JH9A 2IYSA 2XUDA 4MGHA 4HVLA 5IJ9A 2TRSB 3THWA 2EXXA 1AKQA 2GF9A 2OCIA 1JIQA 1VMDA 2PUTA 1LBSA 3NJ8A 3WGHA 3HA3A 4Y8VA 3W77A 3EIHA 3BMOA 3BQ1A 4DSLA 3MAGA 1CQIA 1FMFA 4RIGA 2BFDA 4L2IA 2RGAA 2J9XB 3L7DA 1JG3A 2BC9A 1GLGA 2AL7A 3W9SA 3B6ZA 2JJ1D 2YQ4A 4S1OA 2G5CA 4RA9A 3P9NA 4NBWA 2P2GA 5KL1B 5K3FA 3OPYA 1QKIA 2KV2A 1NNI1 4ILKA 4FFSA 3PLAE 5KFVA 1PVQA 5ESXA 4A8PA 3VOSA 1P8JA 3Q3CA 4DIFA 5I9IA 5I5GA 3PW5A 1Z6YA 3F5QA 2IX9A 1H2ZA 3MR6A 3MBIA 1IDOA 2MU1A 3U19A 3M5PA 2ATVA 3P2KA 2RLTA 4PFQA 3FPAA 2KM1A 1ZYQA 3G2OA 5DM4A 5DBBA<