2W4CA

Human common-type acylphosphatase variant, a99
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'NTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4cA00
3HHLA 1GXUA 3HF5A 2CRLA 2QIFA 1LQ9A 3I9ZA 1P8GA 4A4JA 2GA7A 2KKHA 2ROPA 1APSA 2BYCA 1URRA 1Q4RA 2QLXA 4Q2LA 2IYGA 1IUJA 1V3ZA 2FHMA 1MWZA 1N5TA 3FRYA 3LO3A 1YJRA 4A46A 1TR0A 3TOQA 2ACYA 1FVQA 1CPZA 2OMOA 5B09A 1FEEA 1Y9OA 2HLUA 5B0FA 4NPOA 2K7JA 3HDSA 4Y2IA 4ZA1A 1W2IA 2OD6A 3QGPA 1SI9A 2BJDA 1SB6A 3GZ7A 3HX9A 3IWXA 2GFFA 2K1RB 2AJ0A 1OQ3A 1Q53A 3MZIA 4EFAC 1X7VA 4ZOSA 1N5QA 3BGUA 4DL0C 3TNVA 3HHLC 5B0CA 2EW9A 2LXFA 2PD1A 1KQKA 2W4DA 3HHLD 4HI1A 2RILA 2QLWA 1R6YA 4Q2MA 1N5SA 4A48A 1K0VA 2XMVA 1SQEA 2N4CA 3F44A 4HL9A 2GGPB 5B0GA 2Q3PA 3FGVA 5B0DA 1VQSA 1S6OA 2N7YA 2PGCA 2G9OA 2LQ9A 4YDXA 1CC8A 4FNIA 2IYIA 4Y2MA 2OD4A 3DXSX 5F0UA 1X8DA 3T9NA 5B08A 3TRGA 1AW0A 2AP6A 2RMLA 4HI2A 1Q8LA 1YG0A 1YJTA 5B0EA 3BN7A 2HFNA 2LQBA 2W4PA 4OJ1A 3CJKB 1S6UA 3E8OA 5A6WA 2L3MA 1WD6A 1OPZA 2GCFA 2XMMA 3BF4A 3KG1A 3KNGA 5K9FA 2K1RA 4DN9A 1ULRA 2BUNA 2ZDPA 3KKFA 2ROEA 2OKQA 2QYCA 3CJKA 3UDCA 3VTIA 5B0BA 3FMBA 1YJVA 2ROGA 2KYZA 1OQ6A 2XMKA 2HLTA 4U9RA 2XMWA 1X0PA 2OFGX 1RJJA 1OSDA 3KG0A 5F0WA 2FB0A 2ZDOA 3BR8A 2OAUA 4A47A 1KVJA 5B0AA 4OJ3A 2FIUA 1FVSA 2LDIA 1TL5A 1KVIA 1N5VA 2XMUA 2GGPA 1AFIA 4YEAA 3DCAA 2AW0A 2AJ1A 2RU9A 3LGNA 4OIXA 2KT2A 3K7RA 3QMQA 4Y2KA 1Y0HA 3BDEA 2N4DA 3HFKA 1FE4A 3BM7A 1JWWA 1FESA 2JDJA 3LGMA 2HQIA 4NL5A 5IXUA 5KAKA 1GXTA 2OFHX 2BJEA 2IFXA 2XMJA 3WDOA 5A6PA 1MWYA 2HIQA 1Y3JA 4FNHA 1CC7A 2K2PA 1P6TA 1VQYA 2W4CA 1YJUA 5T7LB 1TZ0A 1JK9B 4HH0A 1QUPA 1XBWA 2GO8A 1YRXA 2OP5A 2VH7A 4QOTA 2GV1A 2K7KA 2XMTA 3BB5A 1FD8A 4OJHA 1AFJA 1FE0A 5T7LA 3IWLA 1TUVA 2KT3A 4HH1A 1Q8BA 2BBEA 2VV5A 2RSQA 1Y3KA 3MCSA 4DPOA 3HHLB 2FTRA 4F67A 1U7LA 4OJGA 2HFOA 2ASYA 1TL4A
chains in the Genus database with same CATH superfamily
2FGCA 4KRWA 1IJFB 1LEOA 4DUZF 3G8TA 4H54A 3MM6B 1IKWB 2AYBA 5LXYA 2G1HA 2WK4A 5HMZA 4ED4A 1R0AB 4X66J 3FJ2A 1TFYA 4GKKJ 1N54B 4Q44A 3J81Y 2N7YA 2YWEA 1YGYA 1H7XA 2YWGA 2KO1A 3AAWB 5J2NA 2BKNA 3OUYA 4ETXA 3I0SA 2KYXA 2AYMA 3HI9A 3JYTB 1U6FA 1JXLA 1XR6A 4ED1A 4ANCA 1XC9A 5E3CA 4JI0J 2V8VA 3DHXA 4O44A 3GP9A 3GJQB 4OHZA 3NWGA 1RBLA 1FESA 2YWFA 4U67Q 4NL5A 3CJSA 2ZHBA 2ERRA 1HD0A 1VISA 3A1YG 3EMTA 2EI5A 2COLA 4QQBA 4PPZA 2U1AA 4FDFA 3K2YA 1YBTA 3M9MB 1D09B 4C2MA 5F8GA 2DISA 2OEMA 3IS9B 4PPDA 1H2VZ 3ONQA 3A12A 4ZP9A 3MMBB 3JTPA 3PRBA 4Q0BA 2DNMA 5J2NB 1N5YA 2X3DA 3DU6A 3W1YC 3IRXA 3I0SB 5A8RB 1CULB 3DLEA 2AMCB 4LF1A 1UVLA 2V8HA 2PC6A 3VGUA 1X4DA 1HYSA 4O44B 3AB2B 2WHOA 3DI6B 4X65F 4X4OA 1F9FA 3H4DA 3TA2A 1S77D 2ADBA 4HACB 4P2XA 3QLHA 3MM9B 4DV3J 4CQ1A 3DXBA 4AXIA 3PIPQ 1BXNA 4ZS6A 3R5JB 4NEZA 2IVFB 2FJVA 1QLNA 4M5IA 4ECZA 3GV8B 2QFJA 3CCRS 1FE4A 3R1LA 5D4PA 4AL5A 1VGYA 4GRSA 2BRLA 2H9ZA 2XZDB 2UXCF 1G2EA 2AGPA 5KT7A 4DV6F 3SCJE 1RA7A 3BEGB 1LOUA 4NCAA 1QAIA 4W4MA 2ZH2A 4N7TA 5IT9Y 3ZNJ1 3MEEB 2HNYA 4KIAA 1HBMA 3WIVA 4LIRA 2G4BA 3LAKA 1SPBP 3GR1A 2JHEA 2RJZA 4ES1A 4UZBA 2R7UA 5B0EA 4UY8T 4RBTA 3SXLA 4RWXA 5EDWA 5L9XA 4DQQA 1VJQA 2JEGA 4ICLA 4ZVFA 2F4FA 1KVIA 3THVA 1EARA 4I6WA 5GAGU 2NR0A 1S1UA 5L1LA 2DHAA 5L1IA 3D1QA 3QJPA 3BGLA 4YQWA 2I8EA 3SDEA 3G87A 3OTBA 4Y65A 1RTIA 1BD6A 2HK2A 2N7CA 5DQHA 4TQSA 2DNGA 2ZOGA 5KFXA 1RLCL 1WKKA 1IKYB 4ZLNA 3H40A 1KS2A 3KUGA 2XMAA 1AB8A 3OTOJ 1IXKA 4ETZA 3R7NB 2V0NA 3DDNA 2OD6A 2BKPA 2LKZA 3R6LB 2DNHA 3BPDA 5E33A 1ZH5A 2VIHA 2FHJD 3T41A 1UJ5A 1FNXH 1RT6A 1VRTA 2CPDA 2HHUA 1R0CB 4U96A 3J7YI 2B7BB 4ECUA 1RTIB 3TUIC 5GVQA 5FD1A 3G6ES 5LSRA 1WKJA 1FI4A 4WXOA 5K14B 2UUBJ 2W9AA 4LF4J 1U1RA 1J5EF 1UL3A 2CDRB 2OPSB 4QWDA 2R7QA 4DL3A 5ETRA 1MWYA 1N88A 2ZH5A 2MYFA 1AA1B 1VQLS 5L8RC 5FLXY 3Q89A 1X4CA 1Q8IA 2MKIA 5A76A 4EU0A 1ZTTA 1C1BA 3D4JA 1LQ9A 1TTHB 2WCXA 2BVZA 2J7UA 3KK1B 3BQ2A 1BC6A 3K5LA 3A8EA 1SH0A 4NA2A 3QIDA 5LJ3Y 1LW2A 1FTRA 4B3MF 4AQYF 2KFNA 1RAJA 3TQ1A 2G13A 2V5HG 1FJCA 1X5PA 4LQ9A 3PEHA 3G86A 3RBZA 5KG1A 4GVLA 1WHYA 5A6WA 1NM2A 4F3QA 3SSSA 3MM5B 3TZWA 5J2PA 4QJVA 1ROFA 1C0TB 3SV3A 4ED8A 3UQSA 3PY8A 1C1BB 3F41A 2F8HA 1H72C 4F02A 1X5OA 2EKNA 4Y2KA 2WW8A 2N4DA 3M6XA 4M1KA 2MDAA 5F8JA 1DAXA 2MQOA 4LSZB 4G1IA 4BC9A 3OXGA 1JX4A 4PXDA 3OL9A 3UN5A 5AXNA 4ZLLA 3EGNA 2FJEB 2Y1LB 2RKIB 1HWJA 1LWCA 3D68A 9ATCB 3L7OA 4PQUB 4C3LA 2R8KA 1Y11A 1VRUB 3D0GE 1VCTA 4O0NA 4B9SA 3NGDA 3KUEA 4ECQA 3DM2B 4NLTA 4X4TA 3W9JA 3TA1A 3LA0A 4B3OB 4YS2A 4H4KA 1WNEA 2PI5A 3TVKA 4B3RF 2C2DA 1YITS 3CJ5A 2YNHB 4KPCA 4DV1J 2CQBA 3HSGA 3UVJB 3MECA 2LP4A 3CJKA 5F0WA 1TKTB 2DT9A 3I31A 2G0JA 3SSRA 5KFIA 2LDIA 4HTJA 2PA3A 1F9EB 3C6UA 4OIXA 2ZH8A 2MSTA 2B7CB 4ED7A 4L74A 1XMQF 1XWLA 5H9FK 3M2UA 2V4QA 1L3SA 3E3XA 3PHTA 4QOTA 1QTMA 1VQ4S 4NZ6A 3F73A 1R6VA 4U8YA 2O3DA 3POTA 4KHPF 1S1TB 5IWAJ 2ASYA 3HHLA 4L72B 3VAIA 2Q6BA 1S48A 5HMYA 2V9KA 2DXDA 4LF5F 5HK4A 2NYHA 2FUG9 3KLFB 2R42A 1R0BG 3MECB 2CUYA 4WE1A 4MFBA 3L95X 2VJUA 4R5PB 4ID5B 4XDDA 2H4WB 3Q8YA 2FJDB 3DXSX 4OZLA 2B5JA 2G2YA 1SV5B 4MMOA 2JEIA 1ULRA 3TUJC 1ZOTA 2VD3A 4E0DA 1GNKA 2E29A 1T7PA 5AXLA 3U02A 1T9VA 1XN9A 3JXOA 3GTYX 2X3GA 1T95A 3VAJA 2XY7A 2OFHX 1KNZA 5A8KB 3TUPA 5HN0A 1XTZA 5DGBA 4S0MA 3OVSA 6FDRA 4WP9A 1RT5A 4RW4A 4WXWA 3W2VA 3WBZA 2E1AA 3TOQA 4ALZA 4IG3B 5F41A 1C1CA 2QLFB 4JI8F 3T6JA 1X7VA 3MAAA 1B64A 3TNVA 1S9EA 1OYEA 5AE2A 5F3ZA 2QA4S 1UWBA 4JI5J 4DG1A 2ZJPQ 2VF3A 4O23A 2OPQA 5IZHA 1N48A 3ZTSA 2XC9A 4X4PA 2E5JA 1HLWA 4O3NA 2QE5A 1HFEL 1IWAA 3M8QA 4K7QA 5K8MA 3ITHA 4IOBA 2PI4A 2HURA 1IBLF 2ATLA 2ZNYA 1S9FA 1OQ6A 4DU7A 4TYAA 1N0VC 1RT1A 3RJMB 2C2ZB 2YQ1A 1PAUB 3NKYA 2POKA 3PX0A 3HJFA 4RJVA 4LJMA 1NDKA 3US5A 3C15A 1L3UA 2FC8A 1IBKF 4P73A 3RU0A 2G2ZA 1M1GA 3PTWA 4FN5A 1RHQB 3W66A 3CCJS 3FRZA 2ASJA 1SJ3P 1ZPVA 3DDIA 5E3RA 3DOKB 1KD1T 5F8LA 5J2QA 1UWBB 4DG1B 2P6TA 5L46A 1F2GA 1S6QB 2DRDA 2MSSA 1FXDA 2UXBF 4L76A 1RYSA 3RR7A 1TAUA 1SI9A 5HLFB 3NG8A 3OSNA 4W90B 3KFWX 4ZMMA 1Q81T 3GWCA 3A3PB 4HYKA 3GLJA 3T9ZA 4ZVRB 1OPIA 2YKNB 2VPWB 1RT1B 5HMWA 4ECTA 3HD1A 4B3SJ 4DR4F 5K8OA 2CZ9A 5ETPA 1OY6A 1FDNA 1YX2A 4OYXA 4FVMA 5H1SV 3DRSB 1U1QA 3ICLA 2Y8WA 1X9MA 2AJ4A 2IDEA 3DLKB 5F8MA 5J2MA 1AYEA 2GHWA 3PX4A 3DFEA 4UOFA 3ENWA 3HCXA 2Y1IA 4KY3A 1HMVB 1REVA 7AT1B 1PO6A 2DHXA 2ZM6J 2DJWA 5DLGA 2KT2A 4P2FA 3NEKA 4PAAA 1BQMA 3MPWA 2L48A 1FK9B 3GQCA 4TY9A 5EWGA 4G1PA 1TMJA 4NCBA 4OJGA 1CJTB 1S1XA 4I68A 2GA7A 3W62A 1VQ9S 1DARA 2EFOA 5BXIA 4KGMA 5GAHU 1SL2A 2OO4A 4URQU 2BABA 2GQCA 3DN9A 2VOPA 5J2MB 1EAYC 1Z4UA 5L39A 2UVRA 4USIA 2GJ2A 1KDNA 1NZ8A 1REVB 3OL8A 1ZETA 1WSRA 4NLPA 1S0OA 2V68A 2FVPA 1JXEA 2KDOA 2QYCA 2JX2A 4DZ6A 2XMWA 4MKVA 2ZD1A 4Q7AA 4EK2A 1FDBA 3EE3A 1R7IA 5D8HB 2DIUA 3TANA 1KHVA 3HXMA 2NQPA 1XMOJ 2WVCA 3QFWA 2CQPA 3T5HA 3EPIA 1H38A 3W8GA 2EFPA 3BBFA 1MW7A 1Y5IB 3PG9A 4OYMA 1E6VB 4KGZB 4G1QA 1U1OA 1NXIA 3KJVA 4UOHA 4QPXA 3FBEA 1RHKB 2WW4A 5G4DA 4C8YA 3K89A 4USVA 2HRTA 3NNAA 3P5TL 2Y8YA 5ETLA 2WOMA 3ZZTA 2GIQA 3FNNA 3FEXB 2M4MA 2XO6A 2DEIA 2PGCA 2MQLA 1MNEA 2VBYA 4KT0C 4F4XA 4C4WA 1S1VA 2HYIB 4MH8A 3R2DJ 3KNGA 2PDAA 3FSXA 3IC1A 1QVFR 5IS2A 2ZOFA 2OFGX 3VGVA 3MCOA 1KVJA 3A8JA 4IFVA 1TV6A 4LFCJ 2PFDA 1PCAA 3UDEA 3UN3A 4DX5A 3V4IA 3G71S 1ZAXA 3IM8A 1SL1A 4ZVEA 4ENOA 3MPYA 1U7LA 4OYPA 4G65A 2DHGA 3O3LA 2ZC4A 2QIFA 3GB0A 1HNWF 1V3ZA 3QPIA 3LO3A 2HHPA 2CQCA 4O3OA 3T5KA 2DO0A 4Q43A 3TARA 1MMNA 5KFBA 4J9UE 1RWKB 1KQGB 1HR0F 2MHNA 5KFGA 5CZXA 2W1BA 4XPCA 5JVHQ 3VZIA 1I6JA 2KZZA 4EO8A 4V19J 3RRKA 1RE1B 1HNVB 1MU2B 3RB6A 2B9WA 1CJKB 3BSCA 4K8RA 1N36J 2AT1B 3IA0A 4LT6A 4JI2F 3CC2S 4KKOA 4ZN3A 3I5BA 4OZNA 2KYZA 1SJ4P 1RT2A 2DHSA 2JFKA 4QR1A 2XB2D 5E5NA 5HP1A 2IM2A 3UR0A 2KU7A 2UU9J 4CLWA 4LRBA 2XI3A 5BYSA 1E6YA 3LWMA 5CQGA 3M8PB 1FERA 5IT4A 3J81U 3BB5A 5DRKA 3HZGA 2HHHF 3BKUA 4OX9J 5IT0A 2HS4A 3IBFB 2ASDA 2J5AA 4RUCA 4JI3J 1R3NA 4YP3A 1Y9OA 1KRPA 2FVQA 4DHVA 5IFMA 3H42A 2VPYB 1RCOB 1X4HA 2RILA 4UUXA 4J37A 3D3CJ 2W9BB 1FCAA 5B0GA 3NS5A 3CPWR 1NSPA 4XIUA 4O3SA 1DLOA 1UZHA 4UZCA 4DL2A 2FZGB 2HBQB 1VC6A 1KSPA 3QWPA 2DNZA 1WD6A 3KG1A 4FYYB 3PJ9A 4QIVA 5ETMA 2YX7A 1JLQA 1SC4B 3MM8A 1HHSA 3K58A 4OZJA 1NK7A 1HI8A 4N56A 1PYSB 2BJ1A 2GZOA 2CQDA 1YJUA 4JV2A 2Z58B 3K5NA 3KLGB 5JUMA 2HZCA 2X7IA 1NJYA 3N6MA 4FBTA 4RW9B 2GJFA 3OSPA 1FKOA 4LR7A 2OMOA 4DR1J 5KG7A 5B0FA 5KFAA 2IPOB 4LR9A 3H4BA 4X66F 2F8EX 2H5EA 2UV8G 3KMQA 3MFIA 1I3OB 1S9GA 4GKKF 1EKRA 3OV7A 3LP1A 3KHGA 2HK3A 2QLBB 1HNZJ 3HVWA 3QIPB 3EZOA 1IKXA 2CVEA 2MZTA 2QMXA 4M5DA 5HQ8A 3MM8B 2W8KA 4G3IA 3JSYA 5MAOA 5GADU 5IOLA 1X5TA 3E01B 5GAEI 4LRFA 2W4PA 4DSIA 1RA6A 1ZPWX 2W9CB 1SCJB 3DOLB 2MGZB 4RW7B 4K4YA 5AJ3J 5IT9U 1QD1A 4OHWA 5KFSA 3L7UA 2XULA 3IR5B 1JLFB 4WIIA 4O4RA 5JJBA 4LF8J 4FF3A 4DWIA 4LIWA 4EYHB 4NXMJ 3QZ7A 3D0HE 3MMCB 1U0SA 1RADB 4C11A 1IKXB 5DGAA 4AFFA 2WVBA 4A4JA 2MKSA 5H9EJ 1VDHA 2CPHA 5F9NA 2JLGA 1W2BR 2C3OA 4Z7CA 4CO4A 5HQMA 3ZZUA 1HBNA 2CPJA 4EZ6A 4ED3A 2F40A 1QTNB 5I4MA 2W7PA 2Z2ZA 4I0WA 3B78A 2PD1A 3VVUA 2YNGB 3HKZD 2WAQD 2B4UA 1S97A 1RT7A 4MJKA 3LGHA 5AXMA 1HNXJ 2CXEA 3DRXA 4HKQA 1YJNS 2LQBA 2QA1A 1VRQC 4GO7X 4ZJOA 2YPYA 3ISND 2AV5A 2OGUA 2MLYA 2VDIA 2HBYB 1PSDA 2IAJB 2DGUA 4AL6A 3W60A 4M5JA 3BDEA 2BR0A 1LWEB 5CABA 2BANA 2HQGA 3TA0A 4CP5A 1HQEB 3RG6A 4ILRA 3D2WA 1U26A 1FJ7A 4DCOB 1S1WA 5ITHA 2V4RA 2QTWA 4OI0A 3CIZA 1KOOA 2ZZMA 4MIBA 4OI3A 1SUQA 1RT7B 1U09A 2W2OP 2H5IB 3BGRA 3L7PA 3H59A 3MEDA 1Q82T 2JJ4D 1SKSA 2KTQA 2J9EA 1CQMA 5F3TA 2C42A 3TWZA 1T0TV 3BV8A 2OPPA 4ZHRB 1YJWS 5LM7E 3WIUA 3CD5A 5LJ5Y 4CH1A 1AROP 1WC3A 5CZVA 5FLXU 5IV3A 3CMQA 5F0UA 1UWAA 3HFVA 1N8RT 1RACB 2FLNA 1YJTA 2J9CA 1RHRB 5EX0A 1S10A 3VCDA 2V94A 2ZFHA 2AQ4A 2BXJA 2KFYA 3GU0A 2GGPA 3W5XA 1I94J 1SUQB 4NX9A 3OFHA 4ILMA 2QMWA 2RF2A 2X1BA 4ITSA 3MMAA 1DZ5A 2HBZB 2N82B 1ELOA 2B6AB 1TUGB 5HQLA 1PJ5A 3GCXP 3SCLE 1XQIA 4F2RA 1ZS6A 3OTOF 2R2RA 4PKDB 3S1TA 1Q7YT 4P72A 4TU9A 5BR8J 1GMUA 1SVDA 3SFGA 5JMNA 1SB6A 1EZZB 2HS3A 2VUGA 2GMLA 3BGUA 2VB6A 2K8GA 3EXYA 2M3DA 4DV5J 3SV4A 4A48A 2E7XA 4LVNP 2GGPB 2JH3A 2XNQA 3OFFA 2MKKA 3DMJA 2ZE2B 2HQDA 3HT3A 4YR3A 2EFQA 1PBUA 3EZ5A 2RF2B 4ER8A 3MMAB 2FJAB 1OMSA 3BF4A 2KVQE 2UUBF 2ROEA 3NNHA 4ZPTR 4LF4F 3N6LA 4XPEA 2NS1B 1OSDA 3BR8A 5IV4A 5DO2A 2VG6B 4QWEA 1HBUB 3OLBA 2B9YA 3OPKA 4HHUA 1FRJA 2XI2A 1SXLA 5A8WB 4JBCA 1GQEA 3FFIA 3SMZA 1X4GA 1FRKA 1FA0A 3MUTP 4K2JA 5CXTA 2M88A 5HVGA 3B6BA 3GFXA 2QA2A 1PYOB 5C25A 1HI0P 1RAEB 1XEZA 5HO4A 4BWMA 4DMZA 4P9SA 3DMJB 4NLSA 4Q2LA 5CCMA 2J7WA 1S59A 1EB0A 8ATCB 4JV5F 1OIAA 3GFYA 1D9FA 3H5SA 3M8SA 2AGQA 1QUVA 3M2RA 3EGVA 3M2VB 2P9CA 1K9MT 1NJWA 3QT5A 4DR6J 3J80Y 4MYUA 2BM0A 2YKQA 4F4WA 4FF1A 3BKTA 1BQNB 1VIXA 4OHXA 1UPMB 5I3UA 3CCVS 3G4SS 2B8QA 2YPZA 4NLVA 3N01A 2BX6A 2VODA 1DTQB 3SQGA 5GADI 5KFUA 2HWHA 2ROGA 2HMIA 5C25B 1VS3A 2MPUA 5HBMB 3GFHA 2PO4A 1VBKA 2HSEB 3I0RA 4K4XA 1V9OA 2DR8A 2MZ1A 1CC7A 2LFVA 3TVZA 1I1GA 4PG8A 1RUSA 3R1HA 4C3MA 2AGOA 5DM6Q 5DQIA 1YRTA 1GT8A 4QIWD 3I9ZA 1WEYA 3LF0A 2BYCA 3R5BA 1LW0B 4I2PB 1U2CA 4DX8H 5I3UB 2HLUA 5KG0A 4NOHA 1HPZB 2D9OA 1RWWB 2J0XA 1U8SA 1YHQS 2XO7A 2G0CA 4YMEA 2HVDA 5KOWA 3KK3B 4TVAB 2XBPA 5DS7A 3R5GA 4NYZA 3CIMA 4QWBA 2XMVA 2K06A 4FPIA 4DV1F 2JVOA 8AT1B 3WX4A 3QO9A 2GIRA 4C98A 2IA6A 2N3OA 3PW7A 2OKQA 4H4MA 1M5PC 3RB0A 2BQ3A 1X0PA 3AXMA 3P8BB 3C6TA 3I4PA 3HSZA 5LMNJ 4O4GA 2P2CB 2B4PA 1SJ1A 4OI4A 5HI7A 2AHOB 1VLYA 2MZQA 3GFZA 3OTCA 3RW6A 1HI1A 2RRNA 1HWKA 5IWAF 1KHWA 5F9LA 3OR2A 4PWDA 1TL4A 2WSFC 1ZBTA 1N33J 4WCEQ 2XYGB 1SQGA 2IIHA 4RZRA 1N34J 2VU5A 2XWYA 4RUAA 2M70A 2XLKA 5L9NA 2Q43A 4KE5A 4MIWA 4H4MB 4HHJA 1YIJS 1KQKA 2O66A 1NJZA 2E1CA 1WHVA 2WBMA 3ZZOA 2ZC3A 1M90T 2Q3PA 4QW9A 2VFUA 4O4GB 2QL9B 3KJQB 4AYBD 4RU2A 1UFKA 3VQTA 2GVDB 3MR6A 3R27A 3QAUA 1FKPB 3ZC4A 4KGVB 3D54A 2IMWP 3TZYA 4ZCIA 1TL5A 3TW0A 4C6AA 2MZRA 3T1YJ 3V81B 1SC3B 1RWUA 4DFKA 2NUHA 3EDQB 1UMJA 1XERA 4M95A 4DN0A 2W4CA 3DOMA 1PILA 1V5VA 3MPDA 3A3OB 4I7FB 4EGLA 2W24A 3OR1A 4DCJB 2VG7B 1KEKA 1Y3KA 3GIRA 4A8FA 3D6MB 4QYZK 2HFOA 4YHHJ 4ECVA 2MTLA 4J9RA 2GIFA 2DGSA 3NXZA 1EP4A 2KVIA 4QWAA 3D6HB 4GO5X 2GFFA 3ZZPA 4JI5F 2G2OA 3UO0A 4HHHA 4FYXB 1Y00A 2RUSA 5KFQA 2J0WA 4U6PA 4F2SA 1DHMA 1JMTA 1WG4A 3KG0A 3PV8A 1Q8KA 1NSKL 3MUMP 3P6YC 4Q8EA 2I2YA 1TL7B 2VKRA 4PQAA 2BE9B 4OQJA 1IN0A 2H48B 2QL7B 2YKMA 4X4UA 3B4DA 2E5LJ 2RIJA 1JK9B 3UR3C 1WJ9A 1U47A 3TAPA 2EC0A 4A8OA 1RAOA 2I0XA 1X4AA 3OVBA 3PR5B 4A46A 1RT4B 3AJDA 4CO2A 3K5PA 1JJHA 1RWOB 2KXHA 2MLZA 5KFTA 3CJTA 2Z57B 3PHEA 1RHJB 1JLBB 2R9LA 2EBEA 2NSCA 1NKBA 3RRHA 1AZSA 4B3SF 1UW9A 3FMWA 3NBPB 1MMDA 2BACA 1CC8A 2QGFB 1O6XA 3GILA 2UUCJ 3AD7C 3L4BC 2OH2A 4ED6A 2HAFA 3RW7A 1RAAB 3OHBA 3GYNA 4ELVA 2A3JA 3ENAA 2ZM6F 2F3JA 2ZDOA 3ZZZA 4LSLB 3QJJA 1S49A 3QMQA 1NU4A 3GYGA 3G82A 4RL1A 1VC5A 3GG0A 1NK5A 2KG1A 1Y3JA 2M5YA 3OLAA 2MQ8A 4B17A 4HVZA 1RTJB 3NRBA 1RTDA 3NGUA 3AXKA 4CO1A 1WEZA 4CI0B 4USUA 4LF6J 4B08A 4CO3A 2WVEA 5HSPA 3CF5Q 4B3TJ 1D8YA 3ET6A 1JJCB 3S8SA 2V9WA 1M1HA 1K0VA 3OTDA 1VQSA 1FRXA 4L73A 3VAMA 2H5JB 2FY8A 5CA5A 4X4VA 1SJRA 1S6UA 3DLBA 4JYAJ 3MDFA 5K9FA 3VTIA 4Z7YA 4H4OB 4ZJQA 2Q79A 2ZVIA 1UA1A 4DX7A 1B99A 3V6DA 3U1MA 1OJ4A 4JP8A 2HVIA 2F7VA 3KJFB 2Z56B 2HHQA 4ZPCA 3LGNA 2DITA 4V1Ak 1XMOF 1RBAA 3CSKA 3TJAA 4ID8A 3HVTA 2KL8A 4O3PA 3O44A 3DRPB 1UVIA 4CO5A 4IFYA 2XY5A 1ZA1B 2IM0A 2AKWB 2DPJA 1RU1A 4N8NA 3QAEA 1K0TA 2DHHA 1NK4A 3RZAA 1U02A 5JXSA 2R4FA 1F6TA 5G0RA 3IG1A 3ZZYA 3PIOQ 3U7JA 1R27B 3C16A 4IRCA 1YVFA 5KT3A 4FBUA 1N4LA 3HPOA 5F8HA 4DPWA 3BKFA 1BY9A 4QZVB 4WWSA 2YWKA 2W7OA 3CO9A 4IG0B 3HSJA 2G9OA 2MQPA 1U1KA 1DTTB 1AW0A 4R8UA 1BLUA 3HKWA 3W61A 3KUHA 5H9FJ 1HBOB 3S01A 4CLUA 4P74A 1PGZA 3JAMY 3RRGA 3C66A 2HFSA 1M0SA 2FD2A 4WZMA 4RR5A 4XK8C 4LFCF 4OZ5A 5HATA 2QT7A 4USWA 2GAHC 3SFUA 2XWXA 2E1RA 3D9BA 1NK6A 4XTTA 2FVSA 4IUFA 1TL1A 3O6QA 4TLQA 4FZVA 3H25A 1WELA 5KG2A 1RWMB 3UD5A 3GCWP 5I42A 2VHGA 3TJ8A 5KT4A 4NASA 5D15A 4C0BA 2HFZA 1RKIA 4J9LA 2C22A 5AT1B 1JLGA 2VBXA 2NCKL 2J7KA 4ANDA 4L3KA 3MD1A 1WDTA 2RHSB 1UEUA 3F56A 1QSLA 5CYMB 3W63A 1GAOA 3Q8VA 4I4BA 5ETOA 1BGXT 1M1KT 5D0EA 2FC9A 1N36F 4PYDA 1L5UA 4DUZJ 4Y2MA 2OD4A 2JZ5A 1U6BA 1Q8LA 1YG0A 3BN7A 4CDIA 3MTJA 3TVYA 1B4SA 4F4ZA 3GPAA 2DH9A 4DFPA 4I56A 1V6HA 5GMEA 1GH8A 2UU9F 3M9NB 4F26A 4BS2A 1NK0A 4AXJA 5ETKA 1R8AA 2A2DA 2VZ9A 4ZLJA 4GKJJ 2HIQA 5AE3A 1HQUA 1JLGB 2DR5A 1VBXA 2Z30B 2CJXB 2EXUA 4OX9F 4NLQA 2XCPA 1S4EA 2KT3A 4M5HA 2J9DA 1CJVA 3NGRA 4JI3F 4M5KA 2GW8A 2QA4G 2IM3A 2V67A 2FHMA 2KM8B 2ACYA 4TY8A 3LP0A 1UVJA 3A3NB 3IWXA 2ZH7A 3BO3A 4DV2J 2YH1A 3KLEA 3V6KA 4ZITA 2XM3A 1F3VA 4E2FB 1SQEA 5LSLA 1SC1B 2C3MA 5D0GA 4QPTA 3M32A 3GIMA 1H74A 1GTEA 2HQ3A 1GK8A 1NDPA 2BUNA 4DQRA 3RBEA 1I51B 4I67A 1XK8A 3QZ8A 1WWHA 2I1RA 4DV7J 3HFKA 5HMXA 1F1BB 1TUWA 1TVRA 3HHKA 4X65J 1RKJA 2EBGA 3N4WA 4ZCLA 4TY8B 2BV3A 4TXSA 3LP0B 1U8WA 3FEZA 2GHPA 1VI7A 4CNYA 4QYRA 3LP2B 1EJ7L 3KLEB 3QJLA 2G1DA 1VC0A 1BHNA 3UCGA 4DR1F 1Q4RA 2LEPA 3F0NA 3M32B 1QAXA 3HP6A 3MM6A 1IKWA 1HNZF 2HNDA 5D3GB 2DY9A 4NCGB 4M5MA 3GONA 3TYTA 1M5HA 1R0AA 3I82A 2F8MA 2AF6A 2Q66A 4CLTA 5M2RA 4DV6J 3PXGa 5SUHA 3VHQA 3P49B 4E98A 1N6QB 1TVRB 3U1NA 1WC0A 2QZ8A 2DVIA 4CCHA 2QSWA 2DNPA 4HT7A 5AJ3F 2CYYA 3FMBA 4MK7A 3AOAA 1DQAA 2KG0A 3JYTA 2HVEA 2EK6A 4KB7A 2GO9A 2H54B 4LF8F 1T03B 1CLFA 4WFZA 2EWHA 4NXMF 4IR9A 2YQ3A 3R9LA 4HH0A 3NGSA 4XO0A 1AFJA 2HNDB 4DBQA 1X4BA 1U1MA 1RI7A 3FUYA 4DPOA 1RAIB 1HL6A 2OIHA 3IS9A 1U2RA 4UF4A 5GMKa 1BE4A 3MMBA 3QGPA 2M8HA 1HA1A 3UE2A 3QSYB 3W7BA 2OHDA 2V8GA 2EW9A 1KLNA 2LA4A 5A8RA 1CULA 2DNYA 2UXDJ 1HNXF 4P10A 3W9HA 1F60B 3Q2SC 8RUCA 2HRUA 2WVFA 5DDPC 4NE9C 3NP5A 3BDPA 3DI6A 2E66A 1KOHA 3G6YA 1XNRF 1RTHA 1FRHA 2VL1A 3WX8A 4HACA 2DNRA 2DO4A 1TP7A 3MM9A 5B0AA 1WI8A 3TZZA 3CO0P 2CAJA 5CCLA 2WONB 2CPFA 1NLKL 4R0JA 3GYXB 2JLFA 2ZNZA 5D0HA 2ILZA 2R3VA 4NLDA 3W65A 1PC4A 3PW4A 2QV6A 1ZM2A 2E5HA 4WK3A 3OL7A 1RTHB 3A8IA 4ZA1A 3KK2B 4TNOA 4O3QA 3MEEA 1ACMB 1JLAB 4OYZA 1FFGB 3SIPB 2VQEF 4J9VA 5BYQA 2RE1A 1SC6A 3OW2R 2YY3A 2IRUA 5IM0A 2J76E 4NMLA 2VG5A 4KH0B 2YQ0A 1VQMS 4ATNA 4F7VA 3OVAA 4IDKA 1L3VA 1I94F 2DD8S 4ILLA 3D67A 2DR7A 4RU9A 1QE1B 4DV0J 2XSFA 3J80U 2RQCA 2QFIA 2RVJA 2FZCB 2D3O1 4NZ0A 2VC1A 5D4NA 5KFKA 1YBAA 3Q8UA 4DLGA 1VLOA 2Z0GA 1YDLA 2K7KA 4OJHA 2RU3A 2N3LA 2E5GA 4MT1A 2VICA 1Q95G 1IKYA 2CJKA 2WRMA 3W5YA 5LMUJ 5IM0B 1RXOB 4NXNJ 3JSMB 2VG5B 5KG3A 4OL8A 4X64J 4DV5F 2ZBCA 1T3OA 3KDNA 4IDKB 3IR6B 5EWFA 3OQ2A 3GJRB 4FVCA 2R2TA 5K8PA 3RUBL 2VOOA 2R7SA 3CW2C 3P3DA 3EWGA 2XSJA 1FF2A 1LWFA 5CYQB 2W2QP 9RUBA 3DNCA 4CZCA 1NPKA 4F4AA 1U0HB 4DEZA 3RAMA 1PIEA 3R3TA 3CCES 3JQMA 5K14A 2ZZTA 3PDNA 4B3RJ 2DGXA 2I9SA 1P27B 1T9YA 4F04B 3MURP 5EWEA 1UPPA 2OPSA 3Q8RB 3MTKA 4K4SA 3DGPB 4EO6A 1YRXA 1QVGR 2V4JB 3G96A 3RB4A 1YK9A 2KJVA 1LV5A 2WB4A 5ETNA 2MQNA 2K7JA 2XSJB 3KK1A 1LWFB 3LALA 4DR6F 2MJUA 4FKYA 2RRBA 3H5UA 4IRDA 2KXNB 3K17A 1WTFA 5JVGQ 4B9TA 2NZCA 4WYLA 4UY85 4DF8A 1PG5B 3I5AA 4LF9J 3AD9C 4DOZA 1FFSB 3H2UB 2YVSA 1EETA 2ZEJA 5J1EB 2EVZA 4U9RA 4DSLA 3MM5A 2VFSA 1N5VA 2C2KB 3MXHP 1TKZB 1C0TA 1KLMA 3Q24A 2IRXA 3CE8A 2CNOB 1R8HA 1NHKL 3HD2A 3MD3A 4Y0FA 2AEJA 4RUBA 2IVMA 3BR9A 4ZCMA 4WFYA 2SXLA 2I5JB 4DR7J 5F8NA 2RKIA 2CRLA 3KMSA 4PQUA 4M5GA 4ECYA 2ZH1A 2QG9B 3MR5A 1VRUA 2OPRB 3AQOA 3UN2A 2RAQA 2IVYA 3HDSA 4OZ0A 2L9DA 3QT8A 2FHKA 1EETB 3UWTA 3DM2A 4WZQA 2LU2A 2V2QA 4LFBF 3M30B 1M5SA 1RP5A 1F5AA 4B3OA 1K73T 2A0FB 2B4OA 4RW6B 1KLMB 3IBWA 2KM8C 5A0YA 1X8DA 2DXEA 2BZ2A 4P2SA 2ZWOA 1YJ9S 2PA8D 2YNHA 2HW3A 4JI8J 1X60A 2CQIA 3UVJA 5E41A 2O1PA 2V34A 1TKTA 1RT3A 4WF9Q 3DKDA 2XYPB 3R8YA 4NLWA 3ULHA 3BJYA 2QC3A 2CA9A 2YKAA 4ZJLA 4O0IA 1WUUA 2IRYA 3VWSA 3AY0A 4Y2AA 4RLEA 4J90A 3CCWA 3FCHA 4MYTA 1S1TA 5HJXA 2ZHOA 1N34F 4IO9Q 1Q0NA 5A0YB 2OMLA 2CQGA 2R8IA 4ZIWA 4PXCA 1IBKJ 3CWJA 1LNQA 3DRRB 4OZ1A 1RBOB 4PZVA 3KLFA 2BQUA 4K5RA 1U1NA 1XMBA 2D69A 5DG7A 2HFUA 4WU3A 1FJEB 1RT3B 2IM1A 2PMHA 2HZVA 4F8RA 4ZVPB 3AH6A 1EX8A 1GXLA 4ZPWR 4R5PA 4ID5A 4WKRA 4CLSA 1Q86T 1JLEB 1SV5A 1CJUB 2CADA 2V63A 2XMKA 4JV0A 3ZZ0A 4PR6A 3T1YF 4J5OA 4NI2B 3VAFA 2OEKA 4IYQA 2EG2A 1U4BA 1MG7A 1IM6A 3LGMA 3TR5A 5KAKA 2IJNA 1NDLA 4Y34A 4C97A 1RSCA 1IKVB 4MK8A 4DZDA 2FJBB 3MF5A 5A8KA 2GV1A 5I3QA 2XGPA 3M05A 4JI4J 4RWWA 1HNIA 4YHHF 1NK8A 1GMWA 2KZMA 2A6MA 1FXRA 2HWIA 3RB3A 4DR2J 3D7SB 2V6AA 2O5DA 2CQ1A 3ZZRA 1UEKA 3BS9A 4NLOA 3MUVP 1R89A 1N56A 1RWNB 1IR2A 4IG3A 1VQKS 2P9GA 2VBZA 1NHVA 3HT0A 2P6SA 2C3UA 2UZAA 1ZM4A 2J6TA 2EEYA 4NMXA 4R0EA 3I32A 4BLGA 1QM9A 3QQCD 3NLCA 4W98A 3AJ1A 1BQXA 3ZXWA 3L09A 1HNIB 5DETA 1OY9A 4TN2A 3A8KA 3HMJG 3BQ0A 5RUBA 4MAKA 4UUWA 4GVBB 1T9UA 2E5LF 5IXUA 4PG4A 1VK8A 3VZHA 4JI6J 1XR7A 4O3RA 1VYAA 4USHA 1FE0A 1H7WA 4IQXA 4PUOB 5C24B 2MLXA 4M5LA 1RISA 4F4YA 3CCZA 3ZTOA 2A10A 3DOKA 1APSA 2BJ3A 5LT5A 2R8JA 4X4RA 5KFOA 2Y9HA 4L3NA 2YWWA 4X62J 1S6QA 3IN5A 1A7GE 4K4WA 3MM7A 1MMLA 4A8XA 4ZOSA 3EVWA 5KFYA 5HLFA 2BJ7A 4F4KA 2YKOA 1REGX 4HL9A 2VJVA 1WDDA 4RUHA 2YKNA 2D7SA 2UUCF 3D5MA 1FKAF 3H2VE 5DDOC 2DNKA 4K2XA 1KWMA 2FLPA 2DBBA 4DV4J 2UV8A 4KYZA 3DRSA 1S72S 2DPIA 3DLKA 3JTOA 4QIGA 1VOMA 2F63A 4OZ2A 1HMVA 3OHAA 2MB0B 1SL0A 3D28A 2X51A 3NCQA 1ZYQA 3MM7B 2C3PA 1FK9A 1FD8A 1IQTA 4DUYJ 4LF6F 2FHJA 3ZO7A 2YNFB 2XY6A 1CJTA 2DGVA 4CNZA 3JAMU 3TEHB 1Y10A 2ZVSA 2JL9A 4EBCA 1Q53A 1S6PB 2O67A 3HULA 1R6YA 2BE7D 2VA3A 1Q5VA 3IFEA 1SH2A 1P9QC 4JYAF 3PW2A 5L1JA 2A1BA 3VAHA 3KNAA 1YI2S 2WVDA 2FJXA 1G3OA 4JI7J 3BBCA 3N9UC 3M4XA 2Y1JA 2E1MC 4P7TA 3T3FA 3RBDA 1RJJA 4I6YA 2LQ8A 4OI1A 1HHQA 4QIFA 3QT6A 5KOXA 4RBVA 2VQFJ 2PSZA 4YOEA 7FDRA 3BSAA 2IDLA 4P6QA 1J27A 5KT6A 1UVKA 5C42B 3VAGA 4PABA 5T7LB 1QUPA 4Q5VA 4V19X 3SEOA 1VBYA 4K0KJ 1ZM3A 2MXYA 4CLKA 2UP1A 4FF2A 4LMZA 5GAEU 1NHUA 3P4UB 1MROB 4UQTA 2XS7A 4CLFA 4PCQA 1V3SA 1E6VA 2NXJA 1YTYA 1W2IA 1WI6A 4FXWA 2AEMA 2DGTA 2W25A 4DS5A 1SKRA 2PIIA 4HT5A 3PFEA 4QR2A 2P8IA 2MMYA 3GSDA 1QY7A 5KFRA 1FX4A 4DDFA 1IR0A 1NMEB 4CO0A 2PMWA 4IOCQ 1X31C 2IMOA 3TEGA 3UD3P 3PW0A 2GCFA 3R7SB 1X9SA 4KAIA 4PWUA 1XJWB 2ALYB 2HLTA 3A4TA 1S57A 4M63A 1UJ4A 2OSQA 1H6KX 1OS5A 1HHTP 1WOOA 4ZVGA 3C3LA 3LUYA 4C8ZA 1WKLA 2UUTA 3IRWP 2F4VF 2R8HA 1TKXB 1OWXA 3MR2A 3KHHA 1PC5A 3CUNA 3SBMA 1BWVA 3QT7A 1Q5YA 2XEXA 1GMVA 3HVRA 3K0JA 1IVZA 2KKHA 1URRA 4IH6A 5EN1A 5HAOA 4IKAA 4G6VB 2QYGA 5C7PA 1C2PA 5E2QA 1O5JA 2KN4A 2GVZB 1VBZA 5HROB 1EQ0A 2OLWA 2KB2A 3S6EA 2HNZA 3H5YA 3JQKA 2LECA 5A2QY 4OV6A 3CDUA 2LYVA 2R8GA 2BE2A 2OJ3A 3LANA 1F5CA 1HNVA 1MU2A 3DLJA 4YDXA 4FNIA 2YWHA 2CQHA 1TK0A 1CJKA 2ZITA 5DLFA 4USMA 3HFZB 1UKUA 2HAIA 2HHVA 2QSFA 1WEXA 2BW7A 5D4OA 1NK9A 1R31A 1RTZA 2GJIA 1UZDA 4N8OA 4TLRA 3C19A 1ZAWA 4QYZJ 2D3UA 3IP0A 1AUDA 4JB8B 4GKJF 1JKHB 3M1VB 2HQIA 4IQMA 2AZ1A 5ADZA 2U2FA 3FCVA 3PYDA 4U7CA 5HANA 3MEGA 2X1FA 1J5OA 3M8PA 1VQ8S 4KO0B 4KV8B 2HNZB 1WOPA 4FYDA 2VDHA 3WC2A 2RSQA 1MWQA 3I4HX 3VR1A 4PXBA 4OHVA 2BE2B 4DPTA 4Z37A 4C3KA 4DL6A 2KJWA 1FEEA 1RZMA 1IBMJ 4F0KA 3OTEA 3PM9A 4DV2F 2W01A 5C2GA 4ZP7A 4M94A 2IC3A 5J1NA 5B0CA 2XZWA 4LF2A 3HHLD 4NLRA 3KXDA 1YZ7A 3UCUP 5IQ6A 3IAM9 2QN6B 2W9BA 1FJGJ 4C8LA 1Z2ZA 3BSOA 3NGKA 3OUYB 4HI2A 5E3QA 2HKEA 1YJ7A 2E44A 1GMWD 1D1UA 4ECRA 3MEGB 1J5OB 3ZTRA 3C2PA 3CC7S 3D3BJ 4DV7F 1D8ZA 4U7UD 1NDCA 2NXCA 2E9RX 3H7HB 2C28A 4NYOA 1F3FA 2E9TA 4ZCKA 3QFHA 4GC7A 5AE1A 4K4ZA 3U27A 1SKWA 4OHYA 3HSDA 3BYRA 1T94A 4C8OA 4CH0S 2W2PP 2XNRA 1K1QA 3ADAC 2IC3B 3RBXA 5KFDA 3KLGA 2CDQA 2CKWA 4UQGA 3C14A 6FD1A 3M7VA 2HHXA 4Q0BB 1YWXA 2EK1A 3R97A 4RW9A 1N5YB 3KHRA 3IRXB 3DLEB 2P5VA 3PJWA 4TU7A 4ZPAA 1Z2LA 3K57A 1HYSB 2XHCA 4B9LA 3NGTA 3QIPA 3CC4S 1I5OB 1PJ7A 3FGVA 1SH3A 3M8WA 3I56S 4KTQA 4DL4A 2R7XA 3E01A 3QLHB 1PBAA 3IGVA 2RS2A 1IR1A 4ZP8A 4MKYA 2H3EB 2HQFA 4MK9A 2W9CA 1MLAA 3DOLA 1EQMA 2MGZA 4RW7A 1KVKA 1RLDA 3BGOP 3C14B 2AJ1A 3M6UA 1ZAVA 1LFWA 3CVKA 3HHEA 3GIJA 1DRZA 1JLFA 3NOGA 1DURA 2UUAJ 2M2BA 5BYRA 1Q16B 4KQZA 1Q8BA 3A13A 2AJFE 2YX4A 3Q0AA 2LU1A 3B4MA 3BO2A 3MMCA 1B70B 3AD8C 2IJFA 2ROPA 3JSBA 1DFDA 1FNMA 2HNYB 4WFAQ 1NKCA 2DR6A 1CPZA 1HBMB 4NPOA 2LVWA 2UXDF 2E5IA 3NY0A 1SJFA 4HI1A 3QRRA 4ECXA 2LDYA 2VFTA 4JI0F 2YNGA 3GV7B 1CEZA 2CZVC 4XDCA 3GMGA 2LMIA 4C7QA 3CJRA 3ELHA 4ICLB 5C5JA 1N0UA 2J6SA 2RB7A 1BWEA 1YZ6A 3ETMA 1S1UB 2AW0A 1H2TZ 3PO5A 2BKOA 2IAJA 2MY8A 2NLWA 3SDEB 4AL7A 4P52A 3D6TB 2LA6A 1LWEA 4DJBA 1NEEA 3GR0A 2WTFA 1HQEA 2ZBRA 4WP3A 1JLCA 1IBCB 5L38A 3PNIA 3D0IE 1J2VA 3EX7B 3CMES 2A2CA 3BPSP 4QR0A 4Q45A 4RX6A 1UCNA 3LPEA 5M2UA 1T8EA 1FDDA 3ENVA 3HX9A 4DV3F 5DZ6A 4CIOA 3J81j 4WTOB 4F3OA 4ZHRA 3UI3A 1RT6B 1VRTB 3V2UC 3KLVA 1WHWA 4K4TA 3HO1A 3CJ2A 3KYLA 2HHSA 4Y3CA 1KKHA 4JV5J 4WIQA 2JC1A 2EPIA 2MKYA 4X4QA 1U1PA 4LFAJ 2YX1A 1NUEA 4I6AA 4DN9A 3ILLA 3O5TB 4BBYA 2OEJA 1JLCB 1RWPB 4DV0F 4R25A 2V2KA 3DCAA 2AEFA 4DR3J 2JWNA 3LWLA 3TZXA 3AA9A 2XMJA 2K2PA 4U8VA 3EVOA 2F9JA 1UEVA 1KQFB 3K8WA 4LBHA 2FTRA 3B82A 2B6AA 4U95A 1S7HA 2HIYA 2JC0A 2MQMA 1RCXB 1VR6A 1WF2A 5LMUF 4ZPDA 2YTCA 4HLBA 4NXNF 3MFHA 3BH7B 5T41A 4X64F 2W7AA 1WORA 2AYGA 1H73A 1LW2B 2KI2A 3GZ7A 5U47A 4BCAA 1CBKA 1W25A 1UVNA 4YY3J 2V2ZA 4F0HA 3EZUA 4C0OC 3K5OA 1S6OA 5M2PA 2KT5A 3BSNA 4ZPBA 2HWTA 2ZE2A 1JXVA 4C48A 4OJ1A 2ABYA 2C1EB 2FPHX 3V6HA 2Y0BB 3H5XA 5J2PB 5KFPA 1Q79A 2Z8QA 3TAMA 3FBFA 1QSYA 3MMJA 3G2XA 3CJQA 3EUNA 4FYWB 3WQPA 3IWNC 3P5BP 4OI6A 2HHWA 2VG6A 4OYIA 3HK2A 1HBUA 3MPUB 2UVWA 2B43A 1FNOA 2DB1A 5A8WA 4WU2A 2ZWPA 1VJWA 1IWGA 3J7AN 1IM4A 3TAQA 1PJ6A 1LWCB 4LR8A 2BW2A 1T3NA 2ZUGA 3EJMA 4RW8A 4Y2CA 4DXLA 3FC9A 2OSRA 2XYHB 1TMMA 5HVHA 1LK5A 3H8YA 2M8DB 1Y5LB 1WHXA 2L9WA 3L3CA 4EYIB 5CHCB 2HGMA 3I96A 4PWWA 1VMBA 2J0QD 2ZKUA 5AXKA 3QSIA 5KFNA 3M2VA 2B8PA 3TAMB 2DH8A 2KH9A 4LF9F 1VIOA 3NNCA 2LQ9A 4ZVSB 1TFWA 2MQQA 3R7BB 1BQNA 4C0HA 3CJKB 3Q23A 4NEYA 2AYEA 1RAGB 3WZ0A 4OX8A 1T05A 1KQSR 3G6XA 1DTQA 3DU5A 3TP2A 1UAWA 1M5VC 2W8LA 3C6UB 2FIUA 2MJNA 4CTAA 4RW8B 2EG1A 3QBCA 1TK8A 2F9DA 3M2UB 5HBMA 2RDJA 1XNQJ 4EZ9A 4DR7F 3FBCA 3POTB 4K59A 4EUVA 3AT1B 5K8NA 2VV5A 3MCSA 3HHLB 4J9KA 2QRRA 2ZH9A 4RNFA 1P8GA 3CCSS 2O01C 1OY8A 5GAGI 5KFZA 1FVQA 1LW0A 2CPEA 4I2PA 1FO1A 1G1XA 4HR2A 2GQQA 4WE1B 2FLOA 1HPZA 3PACA 1T05B 5DJBA 4MFBB 4BHQA 2C2OB 3NL0A 3KK3A 3PYGA 1B0TA 2FVCA 4CTAB 3MAQA 2B5JB 2ACMA 1YQHA 4ZKAA 4IH7A 2CFXA 3RAXA 2UVVA 1FRMA 3EICA 4ZPVR 3QYYA 1D9AA 4B02A 3I5CA 3THTA 4ZVOB 1O8BA 2OTJS 2FLLA 3KOAA 2WBRA 4USKA 2C3YA 3NOCA 3DHWC 1S12A 1OYDA 1Q1KA 1TUVA 4B9NA 4QU7A 1FHTA 1RT5B 3LOUA 2A6OA 4RW4B 4QIEA 3FKBA 4YR2A 2G0IA 3VGTA 3W2VB 2VKZG 2D3OR 3CD7A 4OYAA 4QBUA 1WC4A 3D1OA 1N5TA 5CD4H 2KXFA 4Y6IA 1YRUA 1C1CB 3CDEA 3MAAB 1S9EB 2CJ9A 2CIMA 1JNZB 1T9WA 4A8WA 4M5NA 2HBRB 3MGJA 4ZK7M 2GNKA 4FYVB 2OPQB 3QWUA 3ILJA 3S7RA 2X1AA 3M8QB 3NS6A 4WBFA 4IRKA 2AP6A 4LUBA 3ITHB 2RHQB 2GVDA 2KFZA 3TUZC 2DGOA 2R7OA 3CXCR 5ETSA 3O1LA 1FKPA 3NWRA 3VAKA 4QU6A 2FJWA 3C15B 3R2CJ 2P9EA 4QWCA 1NAQA 1FWLA 3V81A 4URSA 1XR5A 4JI4F 1HWUA 1TZ0A 4J9MA 2VH7A 2WB1D 3MAHA 2FZKB 1VQ5S 1K44A 4HH1A 4OX6A 2BBEA 5J2QB 1PYTA 3OFGA 4I7FA 4AT1B 2VG7A 1W26A 4X4SA 3VALA 4DR2F 5IC6B 4N76A 1MWZA 1YJRA 1PAEX 1K1SA 4QW8A 5DM7Q 2B0GA 5EHHA 3LPYA 3M8RA 1RABB 1K8AT 4F36A 2W4DA 1LXNA 1RK8A 4OV1A 3D66A 2HS0A 1Z1ZA 1RYRA 3Q22A 3CTRA 3B8HA 4DSEA 3ILOA 3EXCX 2NPIA 1NPRA 5KFJA 1A0OB 4I2QA 2VONA 1D9DA 1WF1A 2RQ4A 2ZDPA 3TO8A 4W92B 4A47A 4A8MP 2CJBA 5HJYA 1BQMB 3SSQA 3GJTB 4JI6F 1TL7A 1KN6A 4J9OA 1YKWA 2MKJA 4FXDA 4Y28C 4J9NA 1NCLA 2BMBA 4RKUC 2DXFA 3FDSA 2JFDA 3SYZA 3PRDA 2HGLA 1S1XB 1O0PA 1ITPA 2PT0A 2RH3A 1M5OC 1M5KC 3DRYA 4X62F 4AE5A 3H0PA 5CYJA 1FT8A 2HEKA 1NH8A 1RT4A 4I2QB 4WFBQ 4LF7J 2BJDA 5ETVA 1U48A 1JLBA 3TI0A 6AT1B 1Y7PA 4EWTA 3NCPA 4TQRA 2Z2YB 2V8DA 4HEA9 7FD1A 3NBPA 4DV4F 2NSBA 4CWBA 3MCMA 3CJ4A 4WJBA 1KFDA 5LOQA 4Y00A 2R2SA 3R5DA 4WPAA 1T11A 3OFEA 2ZD1B 3HZEA 4J9PA 2R7VA 3DGVA 2XLJA 2JVRA 5K5MA 1N32J 5EGYA 2V69A 3W64A 4LSLA 3BYPA 5KFEA 4ZP6A 3PW5A 3RGIA 2HQCA 5KFWA 2ZH6A 3HM9A 1R43A 4DUYF 2OTLS 2DGQA 3FCWA 1RTJA 1TQLA 2CWXA 4USJC 4G1QB 3MHYA 1RHUB 3KJVB 4RBUA 2PN6A 1SIZA 3RR8A 1TR0A 3CGIA 2CPYA 3GV5B 4KR0B 2FDNA 2B56A 1SQFA 3IGNA 4ERDA 2WOMB 2BM1A 2XG8A 3J7Z5 1RAFB 2IBKA 2Z2MA 2GS8A 2L08A 2AIRB 1NBEB 2DNOA 5B0DA 2QMUB 1NH7A 1GEHA 1S1VB 1X4EA 4JI7F 2MY7A 1VHFA 3JB9k 1KTQA 4N47A 1WC1A 2XS5A 1NNDA 3UDCA 3N0VA 3BQ1A 4URGA 3CDBA 4LBPA 4IFVB 2CNLB 4H4OA 2VQFF 4CLZA 1TV6B 3P96A 5T14A 1TL3A 3VV2B 4WFXA 3K7RA 2R7TA 1Y0HA 4JI1J 3CDAA 2IFXA 5A2QU 3V4IB 2NZ4A 4PYAA 1WTBA 1CQNA 1VHIA 4K0KF 3RYLA 1UA0A 4DU8A 4DX6A 3VQSA 3DRPA 2DCLA 2IJRA 5KT2A 2LXUA 4NA1A 4KJIA 3HHDA 4WP8A 4LSNA 4DR5J 4CRJA 1OQ3A 4I1TA 1RQ0A 2ZH3A 1GFWB 4UTGA 1CVJA 1QJHA 1WG5A 3OD2A 2CJYB 1F0XA 4DPYA 2CNKB 5C2CA 2BA9A 1TL3B 3FSYA 3N79A 5B7WA 1V3RA 4IG0A 3Q8PB 4KKOB 4A8KA 2HFNA 4C8MA 1DTTA 3G8QA 2DTJA 4H4KC 1RT2B 1C0UA 5HL7Q 1HBOA 2I38A 2B9EA 2EFNA 5HP1B 2J0SD 4F3MA 2DYAA 5KFHA 1E6YB 3B54A 1U25A 2CG8A 1FFWB 3I55S 2YBVA 2PEBA 3JTNA 4FPRA 5A6PA 4HDHA 4ES3A 3T1HJ 2C2MB 4LSNB 1ICEB 3DLHA 2V50A 5IC4B 4DL7A 2CPXA 3LW5C 2VBWA 4KFBA 3VF0B 5F8IA 4YDDB 1PKUA 3UNGC 2PEHA 4RNMA 3AQPA 3ZFVA 2KHCA 4J9SA 2M0GB 4UT4A 3E2EA 1A9NB 1B0PA 4Y2IA 3ILIA 5EUHA 1JQGA 1P1TA 2ZBPA 3Q8QB 1C0UB 5DQGA 3HHLC 4A8YA 4WFNQ 3AB4B 4Q2MA 4CM2A 5CYMA 1DLOB 4X2BA 1LWXA 2HPUA 1LFPA 3EGWB 2IYIA 4RNOA 2JSXA 4F25A 1S99A 5E0OA 1OPZA 3NMRA 3MCNA 5GAHI 4LRCA 5KG5A 1U24A 1NJIT 4I64A 1JLQB 1VFJA 3MOJB 4AD6A 1RB0A 4KFBB 2ADCA 3HLUA 2CQ3A 2Q1LA 5LXRA 1KC8T 2NXNA 2GMJA 3M8ZA 3FZBA 1HIYA 4WK1A 2CPIA 4FKXA 2RDDA 1UP1A 1RDRA 2DIVA 1GX5A 4L75A 2DKOB 2CG4A 1FKOB 1HD1A 1FRLA 1IBMF 3BZQA 3CT9A 4P7VA 2XGQA 2ZJRQ 2CJQA 5B09A 4XAKA 2Z2LA 1S9GB 3BH6B 4ELTA 3LP1B 1JIHA 4YN3B 2F1FA 3QRQA 3TQEA 2IBOA 2J8AA 2RUGA 4M5DB 1FJGF 3THPA 4DFMA 2N4CA 1LXJA 5KFCA 2CPZA 3H2LA 4LRDA 4NWBA 2IHR1 2JEJA 4YFUA 3PRVA 4Z2XA 3KG4A 2ZJQQ 3AOCA 1HQ2A 4CT9A 1H3DA 1KR4A 3CCQS 4MKAA 3GG1A 4JV1A 1RWXB 3WDOA 5K20B 1XNRJ 1H2UX 5BJRA 2YKPA 4DSFA 1FX2A 4KBIA 3IWLA 4C11B 2HGNA 2R7RA 2EKYA 3LP2A 1RWVB 4DS4A 4CYUA 4YB1P 4AUKA 2IA0A 5DDRC 5DG9A 4C8NA 2IYGA 1HBNB 3OJSA 4LVOP 2L9NA 2D41A 1LKZA 2DEJA 2ZZNA 2Y1RI 4K50A 1T9TA 5CD4A 3IAS9 4EBDA 5D3GA 3KLIA 4NCGA 3T19A 1UETA 4KSEB 2QLJB 3H90A 1XIQA 3H98A 4ZIVA 3QGGA 2QX0A 4DUTA 4JUZA 1N6QA 2L3MA 2NXEA 2ZBIA 4P2MA 5B0BA 4J9QA 4GC6A 2CQ4A 3PJXA 3EPGA 2VQEJ 1VQ6S 1AFIA 1W7WA 2RU9A 1X0FA 3ETOA 2BANB 4CYUB 3SCKE 2H1YA 4YR0A 4E8UA 1T03A 2UUAF 3BN4A 1OSCA 2JRSA 2RS8A 1S1WB 2BOAA 3UPFA 1S4FA 3FZ2A 3OXFA 5D0RA 3IO1A 1SBRA 3KLIB 3V4MA 4DCPB 2UXCJ 3BGRB 4BWJA 5KFVA 3MEDB 2CWKA 4ZDNA 3FBBA 3K8VA 2DRAA 2LXIA 2OPPB 3PX6A 3AHPA 3N5FA 1G7CB 1JNRB 4KGXB 1N5QA 3MI7X 1UFWA 3ISNC 4NA3A 1FD2A 3N28A 3RTVA 3FQLA 2FVRA 4UW2A 3UCZP 4ANEA 2AU0A 5FDLA 3GJSB 3AODA 5KG4A 2VPZB 3TRGA 1T9XA 3GIIA 1DQ8A 3CCMS 1SIWB 2CNNB 2XMMA 4MKBA 1DY3A 1N52B 2HRYA 3BBBA 2JLEA 3G6VA 1FWPA 5E7OB 1AT1B 3R5AA 2WZ1A 2BEFA 2M52A 2FGOA 1NO8A 2NYIA 1L3KA 3MOZA 2WONA 2WSEC 5KFMA 3IMQJ 1V5IB 2EFGA 1MN9A 4HTIA 1JJ4A 1R8CA 1S7IA 1C4AA 2QJ3A 2V2VA 1HKAA 1URNA 1SKUB 5FDLB 2NXUA 2L41A 2BQRA 1SJQA 4UOGA 2QEXS 3J7A1 3CDWA 3IM9A 1TK5A 4EFAC 2MEWA 1KTVA 3KK2A 1JLAA 4DI6A 1FTCA 3PR4A 1N5SA 1UJ6A 2AJ2A 1UTAA 2DNNA 1K47A 3UW1A 4LFAF 2OUGA 2CQ2A 3T9NA 1U45A 3NCRA 2B3TB 1QSSA 4DF4A 3R5CA 2ATCB 3PKMA 1IQZA 3BGFA 4F50A 1YBUA 4DR3F 4YB5A 2W2MP 4GMKA 2NPFA 5DG8A 2FYXA 3N5BA 3FFIB 1QE1A 1J5EJ 2NUUG 4OLOA 1ZZNA 4ES2A 3SQOP 4IOAQ 4N5SA 3W2WA 2AWZA 5LSOA 1NPPA 3DLLQ 2KRRA 4DSJA 2AX0A 3ISZA 2CZ4A 2LQ5A 1X9WA 3HF5A 1HW8A 2GX8A 1H0HB 3ZTQA 3M2RB 3M9OB 4ECSA 4KH1B 3FVYA 4YY3F 4ECWA 2AJ0A 3C46A 3JSMA 4DL0C 3CD0A 5MLCV 4MIAA 1U49A 4B3MJ 2Y0SD 4AQYJ 1X4FA 2AX1A 5DZ7A 5B08A 4RPFA 4YB6A 3SQGB 2M9KA 3CD6S 1QAYA 2HVZA 1GTHA 2HMIB 2K1RA 3W2WB 5CYQA 2VA2A 1X5SA 4LFBJ 1VQOS 2MHEA 2HG4A 1DBDA 1U0HA 2QL5B 2XMUA 4NLYA 2PFFB 1EHWA 3CMAS 2V8PA 3I0RB 4B9VA 2LCWA 2JDJA 1P9YA 5BR8F 1D3WA 4FS1A 5DDQC 1Q7LB 1VQYA 3K59A 3ENQA 1BMQB 4IH5A 1NRKA 2X1GA 3DGPA 1EKSA 2V4JA 3K5MA 4L6V3 5D6GA 5GMDA 1GXUA 3T5JA 3HVAA 4RNHA 3JSRA 2XLIA 1LK7A 4EEYA 1EIYB 4FXVA 4ED0A 2K1RB 2RQMA 5FIIA 2KHDA 4N77A 2F65A 2ALZA 3QGHA 1VQNS 5L1KA 3PKYA 3QRPA 4I69A 4ELUA 2ILYA 3LQVA 2RDIA 4D3GA 3QO9B 4OMFG 4YUDA 3I87A 3EYZA 3PCOB 3QNWB 3C6TB 2GC8A 4NRTA 4DLEA 5KTQA 1WOSA 2FB0A 5J1EA 3QGIA 5KT5A 1HWIA 1XNQF 4NLXA 1TKZA 3I6PA 2Z4PA 4PG6A 2DK2A 2BJ8A 1XMQJ 1XBWA 3M6VA 3OR2B 3GSIA 4PWDB 3CJ0A 2APOA 1B7FA 2OELA 2I5JA 2KRBA 4KHPJ 3PO4A 3V6JA 2E1PA 4UOCA 4ZN1A 4ZVUB 2OPRA 4LF5J 1WF0A 3MZIA 4EMDA 3WHIA 1MN7A 2HFVA 4X84A 3LAMA 2D1CA 3E51A 3PFOA 4CT8A 5KFFA 4NLUA 3M30A 3BREA 4N41A 1Y4ZB 4RW6A 3C8YA 4WTYA 5KG6A 2IY5B 3M8YA 4OYWA 5D77A 1FWKA 2LLZA 3TX0A 2ZUAA 3W8PA 2E7WA 1RU2A 4TKTA 3J7ZT 4K4VA 1DJ0A 1NZAA 1L3TA 2DNQA 4B9MA 4K4UA 3BM7A 2H65B 2GQ2A 3NAIA 1NSQA 3DOMB 3T5LA 2NREA 2AD9A 4Q8FA 5IQQA 5CH7B 1KFSA 1P6TA 4NLGA 3OR1B 3KHLA 2FY1A 2XZTB 3NS7B 4USTA 4KC5A 4YB7A 2D3ZA 3SCIE 1KBRA 2JEFA 3CB4A 1WC5A 3CNQP 2FHOB 1IJEB 1QDUB 2MKHA 4ZVTB 3W3SA 1B3TA 2H4YB 1EP4B 2GMHA 4RNNA 3Q2TC 4PRFA 2PE8A 3LTOA 2XCAA 3D1HA 4TYBA 4FNHA 2DGWA 3IBCB 2HZAA 3DRRA 2MZSA 4LBIA 5LMNF 5I3PA 2JOQA 3PZPA 3KLHA 4OLPA 1U1LA 2HHTA 4FS2A 4J91A 4CLYA 3GIKA 4DQSA 3CCTA 2C2EA 1TELA 3CJ3A 1JLEA 3OXLA 1CJUA 3MEKA 1IBLJ 1UFLA 3NMAA 2VFVA 2GAGC 1N33F 2CVIA 3ZTPA 4RO0A 4NI2A 2YKMB 3IR7B 3AFGA 3PEJA 3Q83A 5D4LA 2BJEA 3OT9A 3LH2S 1NB7A 2E7VA 3QATA 3L9ZA 1IKVA 1RHMB 4D3HA 2BJ9A 3T6BA 3O2IA 2PMZD 3OL6A 2M7SA 3PYFA 4CM0A 1IUJA 3FRYA 2D9PA 2H51B 3KLHB 3RAQA 2YH0A 2MKCA 4FF4A 3VVTA 3SZ2A 1AZSB 3OJUA 2DNLA 2UXBJ 3NAHA 1KONA 2J8SA 1P1LA 3FEYB 3M6WA 4LREA 2RD5C 4DPXA 2AZ3A 3F44A 5ETTA 2Y3YA 2DH7A 2C2NA 5J1PA 1FRIA 3MR7A 4DR4J 3ZNUA 1BUXA 3TJ9A 2LEAA 4DL5A 4QCLA 1VQ7S 3U1LA 3PYEA 3KWMA 3EDRB 4KGKA 3JS9A 3HHNB 2RRAA 1FVSA 4YEAA 3G82B 2R7WA 3Q86A 1UVMA 3IXQA 1Y5NB 1JWWA 3EM1A 4GVBA 1MSWD 3KTQA 1ZM9A 3FQKA 3TX8A 4P71A 4U7UK 4LRAA 2RQKA 1RTDB 4JOUA 4OX7A 2DCUB 1YLXA 1H98A 2HVHA 4PUOA 5C24A 3UDVA 4X4NA 4NZ7A 4LF7F 1G4CA 1S5ZA 2F5GA 3UD4P 3ET6B 5E3AA 2ZKTA 2W2NP 4EI2A 3OBIA 3P45B 4DSKA 2ZHAA 1NJXA 4M8LA 3W5ZA 2QLWA 3DDKA 1U6ZA 2YNIA 3R6GB 5H9EK 1NSAA 1R8PA 1A6LA 2DR9A 1RAHB 2Q6CA 1FDAA 4C8KA 1S79A 2RMLA 1S0VA 1Q78A 3X3UA 2LQJA 4C9DA 4PG5A 1N32F 2LEBA 1KP6A 2XHWA 3V6DB 2XQCA 2RT3A 1NB2A 5ETQA 1WC6A 2EFVA 4PG7A 5CAAA 3CULA 4KPYA 4KHRA 2I6WA 4J7CA 1QAJA 3HVTB 4CH7A 4BC7A 4IFYB 2ZH4A 1R8BA 2YNIB 4NYPA 4EBEA 1B0VA 5G0RB 3IG1B 1TKDA 2B9XA 5EX3A 3C16B 2AJQA 2WSCC 2YNFA 1B7YB 2F4VJ 2BRKA 2B4VA 3CJ8A 2DY1A 2MZJA 3CEDA 4DFJA 1S6PA 3DYAA 3D6FB 3KDOA 2K3IA 2OI2A 2J9DE 4R8UB 3FSIA 1AUSL 4IO1A 4ED2A 1NKEA 1HWLA 3KKFA 4OFZA 1VK3A 1FEHA 2UVUA 1ZZFA 5HVFA 2CQ0A 2ZBQA 4K5SA 1T02A 2OAUA 3SI8A 1VQPS 4OJ3A 4JI1F 3KJNB 1GX6A 1AXQA 2EC2A 3PVXA 1D0EA 2J6UA 4BDPA 1GXTA 3UFCX 2VPXB 4ZLPA 1TL1B 3G9CA 5C42A 4B3TF 1ZA2B 4DQIA 5T7LA 3Q8SB 2FQQB 4IR1A 2XTJP 5I42B 3DYAB 1F9HA 1ZTWA 3JQJA 4NRUA 4ZVHA 4KHMA 2QLXA 2CJAA 1F5BA 4HDGA 3CCUS 2A18A 3EVMA 2ASLA 4DR5F 1MROA 3MR3A 1U2FA 1HNWJ 5D78A 3V5RA 4CLPA 3UDLA 3N6NA 4P75A 1JB0C 2E9ZA 1HR0J 3H20A 1S76D 4CLLA 4OI2A 4DQPA 4ZVQB 2GHVC 5SZTA 3GE9A 3E8OA 2RNEA 5THWA 3VGSA 4FP9A 2BOPA 3BO4A 4JI2J 1YJVA 3EGZA 5KFLA 2JNJA 4F0MA 4PEOA 5LL6d 1HQUB 3T1HF 3DLGA 2VASA 1S0MA 3DC2A 1UW4A 4ED5A 1FXLA 1F2HA 1JJ2R 1CG2A 1TKXA 2XMTA 1CJVB 3HJVA 2C2RA 4F67A 4WYWA 3X1LB 2HHHJ 1S0NA 4WKYA 2R2UA 1OO0B 3FK4A 1O51A 2B51A 4B9UA 1TAQA 2YXLA 3MWBA 3WC0A 3G8SA 3AJ2A 2GVZA 5HROA 2LXFA 4MTPA 1CS4A 4DPUA 2DRBA 3J7YU 2K3KA 3CCLS 1HW9A 4LQ3A 1HARA 1DQ9A 1CSJA 2D74B 2UUWA 2VFRA 1WSVA 1YSJA 3T1AA 3DLGB 3I9V9 3MPVA 1RGVA 3AA8A 3W9IA 1TU0B 4PXEA 4TU8A 4A8QA 1WG1A 2XS2A 1C4CA 1G6BA 4OZ3A 3AOBA 4OYBA 5FJ4A 1JKHA 1WACA 3M1VA 2BDPA 4A8SA 5E3PA 2GO8A 2OP5A 3UNYA 2ZOMA 3O8WA 4KO0A 4KV8A 2VC0A 1CS4B 2QO3A 4OYOA
chains in the Genus database with same CATH topology
3SCLE 2FGCA 4F2RA 4KRWA 4USJC 1IJFB 4MYTA 1S1TA 4G1QB 3MHYA 3OTOF 2ZHOA 3KJVB 2R2RA 4RBUA 2PN6A 1SIZA 4DUZF 1N34F 4PKDB 3RR8A 3S1TA 1Q7YT 4IO9Q 3G8TA 5A0YB 1TR0A 4H54A 3MM6B 1IKWB 2OMLA 4TU9A 2AYBA 2CQGA 5LXYA 2R8IA 3CGIA 2CPYA 4PXCA 3GV5B 4KR0B 3SFGA 2FDNA 3CWJA 2WK4A 2B56A 1SB6A 3DRRB 4OZ1A 5HMZA 3IGNA 2HS3A 2VUGA 2WOMB 2GMLA 2BM1A 3BGUA 3KLFA 2BQUA 2VB6A 4K5RA 2XG8A 1U1NA 1R0AB 3FJ2A 3J7Z5 2K8GA 3EXYA 1XMBA 2M3DA 1TFYA 3SV4A 5DG7A 2IBKA 1N54B 4A48A 2E7XA 4WU3A 4Q44A 4LVNP 1RT3B 2GGPB 2L08A 2JH3A 2IM1A 2PMHA 2Z2MA 3J81Y 1FJEB 2XNQA 3OFFA 4F8RA 2DNOA 5B0DA 2MKKA 3DMJA 2N7YA 3AH6A 1NH7A 1GXLA 2ZE2B 2YWEA 4ZPWR 1YGYA 4R5PA 4YR3A 3HT3A 1S1VB 1H7XA 2EFQA 4ID5A 2YWGA 1X4EA 3EZ5A 4JI7F 4WKRA 2RF2B 2KO1A 2MY7A 3AAWB 3MMAB 1VHFA 2FJAB 5J2NA 3JB9k 1Q86T 1KTQA 4N47A 3OUYA 3BF4A 2XS5A 1NNDA 1JLEB 1SV5A 4ETXA 2UUBF 2ROEA 3NNHA 3I0SA 4ZPTR 2KYXA 3UDCA 4LF4F 2AYMA 3N0VA 3HI9A 3JYTB 1U6FA 3BQ1A 3N6LA 4XPEA 1XR6A 1JXLA 4URGA 4ED1A 3CDBA 2NS1B 2XMKA 4IFVB 4JV0A 3ZZ0A 1OSDA 1XC9A 4PR6A 3BR8A 4H4OA 5DO2A 2VQFF 3T1YF 2VG6B 4ERDA 4QWEA 1HBUB 4J5OA 1TV6B 3OLBA 3P96A 2B9YA 3VAFA 5T14A 5E3CA 1TL3A 2V8VA 3DHXA 3OPKA 4O44A 4WFXA 3K7RA 4IYQA 2R7TA 4OHZA 1Y0HA 2EG2A 1FRJA 2XI2A 3NWGA 1U4BA 1SXLA 1FESA 2YWFA 3LGMA 3TR5A 5A8WB 5KAKA 2IJNA 4NL5A 4U67Q 3CDAA 2ZHBA 2IFXA 4Y34A 4JBCA 2ERRA 1GQEA 1HD0A 4C97A 3FFIA 3SMZA 4MK8A 1IKVB 3A1YG 1X4GA 3V4IB 2NZ4A 1FRKA 2EI5A 1FA0A 2COLA 3MUTP 4QQBA 5CXTA 2M88A 4PPZA 2FJBB 2U1AA 1WTBA 3MF5A 5A8KA 1CQNA 2GV1A 5I3QA 3GFXA 2XGPA 3K2YA 4K0KF 3M05A 3M9MB 3RYLA 4RWWA 1HNIA 4YHHF 1NK8A 4C2MA 5F8GA 1UA0A 2QA2A 5C25A 2KZMA 2DISA 1HI0P 1XEZA 3VQSA 3DRPA 5HO4A 1FXRA 2DCLA 3IS9B 4BWMA 4DMZA 2HWIA 3DMJB 4PPDA 1H2VZ 4NLSA 3ONQA 4Q2LA 5KT2A 3RB3A 5CCMA 2J7WA 3MMBB 4ZP9A 4JV5F 2LXUA 1OIAA 3JTPA 3PRBA 3GFYA 4Q0BA 1D9FA 3H5SA 2DNMA 4NA1A 2O5DA 3M8SA 4KJIA 2AGQA 2CQ1A 1QUVA 3M2RA 3ZZRA 5J2NB 3HHDA 3BS9A 1N5YA 4NLOA 3M2VB 3DU6A 4LSNA 3MUVP 3IRXA 2P9CA 1R89A 1N56A 1OQ3A 4I1TA 3I0SB 4IG3A 5A8RB 1NJWA 1K9MT 3DLEA 1VQKS 1RQ0A 2P9GA 2ZH3A 2VBZA 3J80Y 4MYUA 1UVLA 1CVJA 1NHVA 1QJHA 1WG5A 2BM0A 1F0XA 2P6SA 2YKQA 2C3UA 2V8HA 2PC6A 2UZAA 1X4DA 2BA9A 1TL3B 1ZM4A 4F4WA 4O44B 4FF1A 3AB2B 1HYSA 3FSYA 2WHOA 3DI6B 1BQNB 1VIXA 4X65F 4OHXA 3N79A 4X4OA 5B7WA 2J6TA 5I3UA 1V3RA 4IG0A 1F9FA 4R0EA 3CCVS 3I32A 4KKOB 3Q8PB 3H4DA 2HFNA 3G4SS 4A8KA 4C8MA 3TA2A 1DTTA 1QM9A 3G8QA 3N01A 3NLCA 4NLVA 2ADBA 1S77D 2DTJA 2VODA 4H4KC 1DTQB 3QLHA 1RT2B 3AJ1A 3MM9B 3SQGA 5GADI 1C0UA 1BQXA 4CQ1A 5HL7Q 5KFUA 1HBOA 2HWHA 2ROGA 2HMIA 2I38A 3L09A 2EFNA 1HNIB 3DXBA 5DETA 4AXIA 3PIPQ 4ZS6A 4TN2A 5HP1B 2J0SD 4F3MA 3HMJG 5C25B 2IVFB 5KFHA 2FJVA 3BQ0A 1VS3A 2MPUA 5HBMB 1QLNA 3GFHA 4ECZA 1E6YB 2PO4A 3GV8B 2QFJA 4MAKA 3CCRS 4UUWA 1U25A 1FE4A 3R1LA 3I55S 2E5LF 3I0RA 5IXUA 4K4XA 1V9OA 3JTNA 4FPRA 2DR8A 5A6PA 4PG4A 1VK8A 2MZ1A 5D4PA 1CC7A 4AL5A 3TVZA 3VZHA 4HDHA 1I1GA 4ES3A 1XR7A 4PG8A 4O3RA 4LSNB 1VGYA 3R1HA 4USHA 1FE0A 3DLHA 1H7WA 2BRLA 4IQXA 4C3MA 5C24B 4PUOB 2H9ZA 4DL7A 2AGOA 2CPXA 3LW5C 2VBWA 2UXCF 5DM6Q 1RISA 4F4YA 5DQIA 3CCZA 1YRTA 1GT8A 4KFBA 3VF0B 5F8IA 1G2EA 2AGPA 2A10A 3DOKA 4QIWD 4YDDB 5KT7A 3I9ZA 1APSA 1WEYA 3UNGC 5LT5A 3LF0A 2BYCA 3SCJE 2PEHA 4X4RA 3R5BA 4DV6F 2R8JA 4RNMA 1RA7A 5KFOA 1LW0B 3AQPA 3ZFVA 2KHCA 4J9SA 3BEGB 4I2PB 2M0GB 4DX8H 5I3UB 1LOUA 4L3NA 4NCAA 1QAIA 2ZH2A 3E2EA 2HLUA 5IT9Y 1A9NB 3MEEB 1S6QA 5KG0A 3IN5A 2HNYA 1A7GE 1B0PA 4NOHA 4Y2IA 3MM7A 4KIAA 1HPZB 2D9OA 4K4WA 2J0XA 1HBMA 1MMLA 1U8SA 5EUHA 1YHQS 4A8XA 2XO7A 1P1TA 2G0CA 4YMEA 4LIRA 4ZOSA 3Q8QB 1C0UB 5DQGA 5KFYA 5KOWA 3HHLC 3KK3B 5HLFA 2G4BA 3LAKA 4A8YA 4F4KA 2YKOA 2XBPA 5DS7A 4WFNQ 3AB4B 4Q2MA 5CYMA 4NYZA 3CIMA 4QWBA 3GR1A 1DLOB 2XMVA 2JHEA 4HL9A 4X2BA 4RUHA 2YKNA 2D7SA 2RJZA 2UUCF 2HPUA 4DV1F 3D5MA 4ES1A 1LFPA 3EGWB 1FKAF 3H2VE 5DDOC 2DNKA 2IYIA 2JVOA 4K2XA 4RNOA 2R7UA 3WX4A 2FLPA 2DBBA 5B0EA 2JSXA 3QO9A 4F25A 2UV8A 4UY8T 1S99A 2GIRA 4RBTA 5E0OA 4C98A 2IA6A 3DRSA 1S72S 1OPZA 3SXLA 2DPIA 4RWXA 5EDWA 2N3OA 3NMRA 5L9XA 5GAHI 2OKQA 3PW7A 5KG5A 1U24A 4H4MA 1NJIT 3DLKA 4I64A 4DQQA 1M5PC 1JLQB 3RB0A 2BQ3A 1VFJA 3JTOA 4QIGA 1X0PA 3MOJB 1VOMA 2JEGA 3C6TA 4ICLA 3I4PA 4ZVFA 4KFBB 1KVIA 3THVA 4I6WA 5GAGU 1HMVA 2ADCA 1HHTP 2NR0A 1S1UA 4O4GA 3OHAA 5L1LA 2MB0B 3HLUA 2DHAA 2CQ3A 1SL0A 2Q1LA 3D1QA 2B4PA 3D28A 2X51A 3NCQA 5L1IA 3QJPA 1SJ1A 5LXRA 1KC8T 4OI4A 3BGLA 5HI7A 4YQWA 2I8EA 3SDEA 1VLYA 3OTBA 4Y65A 2MZQA 2GMJA 1RTIA 3GFZA 3OTCA 1ZYQA 3MM7B 3RW6A 2C3PA 3FZBA 1BD6A 4WK1A 1HI1A 2RRNA 1FK9A 1FD8A 1HWKA 2CPIA 1IQTA 5IWAF 2N7CA 1KHWA 5DQHA 4TQSA 2DNGA 2ZOGA 1UP1A 3OR2A 5F9LA 1RDRA 2DIVA 1GX5A 4LF6F 5KFXA 4PWDA 1TL4A 2WSFC 1ZBTA 2CG4A 2FHJA 1FKOB 4WCEQ 2YNFB 1FRLA 2XY6A 1HD1A 1IKYB 1IBMF 2DGVA 3BZQA 1VBZA 3CT9A 3H40A 4CNZA 1KS2A 4P7VA 2XGQA 4RZRA 2ZJRQ 2CJQA 5B09A 1IXKA 4ETZA 2XWYA 4XAKA 2V0NA 2Z2LA 2ZVSA 3DDNA 2JL9A 1S9GB 2OD6A 4RUAA 2LKZA 2M70A 4ELTA 5L9NA 3LP1B 4EBCA 2XLKA 2Q43A 1JIHA 2DNHA 4KE5A 4MIWA 1Q53A 5E33A 2F1FA 4H4MB 1S6PB 4HHJA 2IBOA 2J8AA 2O67A 1ZH5A 1YIJS 2RUGA 1KQKA 2O66A 2FHJD 4M5DB 1NJZA 2E1CA 1UJ5A 1R6YA 1WHVA 2WBMA 3ZZOA 3THPA 1FNXH 1FJGF 4DFMA 2VA3A 1RT6A 2N4CA 2ZC3A 1M90T 1VRTA 1LXJA 2Q3PA 4QW9A 3IFEA 5KFCA 1SH2A 2CPDA 1P9QC 2CPZA 2VFUA 3H2LA 4O4GB 2HHUA 4NWBA 4JYAF 4AYBD 4RU2A 3PW2A 3VQTA 3J7YI 2IHR1 2JEJA 5L1JA 2A1BA 3VAHA 3KNAA 2B7BB 1YI2S 4YFUA 4ECUA 1RTIB 3MR6A 2FJXA 1G3OA 3R27A 3TUIC 3N9UC 5GVQA 3QAUA 3M4XA 1FKPB 2Y1JA 3ZC4A 5FD1A 2E1MC 3G6ES 4Z2XA 5LSRA 3D54A 4P7TA 2IMWP 3KG4A 2ZJQQ 3T3FA 3RBDA 1RJJA 4I6YA 4WXOA 4OI1A 5K14B 4ZCIA 2W9AA 4QIFA 4CT9A 1U1RA 1TL5A 1H3DA 1KR4A 3TW0A 5KOXA 1J5EF 4RBVA 1UL3A 3CCQS 2MZRA 2PSZA 4YOEA 3V81B 2OPSB 4MKAA 7FDRA 3GG1A 4QWDA 3BSAA 1RWUA 2R7QA 4DFKA 4DL3A 4JV1A 2NUHA 4P6QA 3WDOA 1MWYA 1UMJA 1XERA 5KT6A 1UVKA 1N88A 5C42B 2ZH5A 4DN0A 4M95A 2W4CA 2MYFA 1H2UX 1PILA 3DOMA 3VAGA 1VQLS 5L8RC 5T7LB 5BJRA 2YKPA 1QUPA 4Q5VA 4DSFA 4V19X 5FLXY 4I7FB 4KBIA 4EGLA 1X4CA 3SEOA 3IWLA 2W24A 3OR1A 4C11B 2VG7B 1Q8IA 1KEKA 2MKIA 1Y3KA 1VBYA 2HGNA 2R7RA 4A8FA 4EU0A 2EKYA 2HFOA 1ZM3A 1C1BA 2MXYA 1ZTTA 3LP2A 2UP1A 4FF2A 4LMZA 4ECVA 1LQ9A 4DS4A 5GAEU 1NHUA 2WCXA 4AUKA 4YB1P 2IA0A 5DDRC 1MROB 4UQTA 4C8NA 5DG9A 2XS7A 2IYGA 1HBNB 3OJSA 2BVZA 2J7UA 4PCQA 3KK1B 4J9RA 3BQ2A 1V3SA 4LVOP 1E6VA 1BC6A 2DGSA 2L9NA 1EP4A 3K5LA 2D41A 1YTYA 1LKZA 2KVIA 1W2IA 1WI6A 3A8EA 4FXWA 1SH0A 4QWAA 4GO5X 2ZZNA 2GFFA 4NA2A 3QIDA 3ZZPA 5LJ3Y 1LW2A 2Y1RI 1FTRA 4B3MF 4JI5F 4K50A 4AQYF 3IAS9 2DGTA 2W25A 2KFNA 4EBDA 4DS5A 1SKRA 5D3GA 2PIIA 4HT5A 3PFEA 3KLIA 4QR2A 1RAJA 2MMYA 3GSDA 1QY7A 4NCGA 3T19A 3TQ1A 1UETA 4KSEB 1Y00A 2G13A 5KFRA 2V5HG 3H98A 1FJCA 1X5PA 5KFQA 4LQ9A 4DDFA 3PEHA 3QGGA 1IR0A 2J0WA 4JUZA 4U6PA 4CO0A 3G86A 4F2SA 4IOCQ 5KG1A 1N6QA 2IMOA 3UD3P 5A6WA 1WHYA 2L3MA 3PW0A 2GCFA 2ZBIA 1X9SA 4KAIA 4F3QA 1DHMA 3SSSA 5B0BA 4PWUA 4J9QA 4GC6A 3MM5B 2CQ4A 1JMTA 2HLTA 3PJXA 1WG4A 3KG0A 3PV8A 5J2PA 4QJVA 3EPGA 1ROFA 1C0TB 3SV3A 4M63A 4ED8A 3UQSA 3MUMP 3PY8A 3P6YC 4Q8EA 1VQ6S 1AFIA 1C1BB 1UJ4A 3F41A 2F8HA 2I2YA 2OSQA 4F02A 2RU9A 1H6KX 1X5OA 2BAN