2W4CA

Human common-type acylphosphatase variant, a99
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
NTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE-1
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2w4cA00
1KQKA 3HHLC 1U7LA 2G9OA 2KT2A 2LQBA 2QIFA 1X8DA 3T9NA 2RU9A 1FEEA 1RJJA 1SI9A 1Y3JA 2GA7A 3BM7A 3I9ZA 2HFOA 3QMQA 1SQEA 1MWZA 1TUVA 1VQSA 2ACYA 2OFGX 3MZIA 3HF5A 1FE0A 2XMUA 1IUJA 2GV1A 1YJTA 5B08A 2XMWA 2K1RB 2ROEA 4OJHA 2QYCA 4NL5A 2ASYA 3FGVA 3GZ7A 3KKFA 1SB6A 5KAKA 1GXUA 4DL0C 3IWXA 3TNVA 2K7KA 5B0FA 2BJEA 2ZDOA 3IWLA 2HQIA 4ZOSA 2KKHA 4Y2IA 2XMTA 3HDSA 2KYZA 1YRXA 3E8OA 3HFKA 2N7YA 4HL9A 2PGCA 2LXFA 2RMLA 3VTIA 3BDEA 3DXSX 2AJ0A 1N5QA 4YDXA 1W2IA 1YG0A 2FIUA 1GXTA 1AFJA 2Q3PA 1OSDA 3HX9A 4OIXA 2GGPB 2HLTA 4A47A 5IXUA 2W4CA 1Q8LA 2HIQA 4U9RA 2XMJA 1FD8A 1TL5A 1S6OA 3CJKA 1N5TA 3HHLB 2BYCA 1XBWA 3WDOA 2VV5A 3BR8A 1Y3KA 2QLXA 1S6UA 1CC7A 2BJDA 3QGPA 2OFHX 1P8GA 1URRA 1Y0HA 2FTRA 2HLUA 4HI2A 5B0EA 3TOQA 1X0PA 2IYIA 1N5VA 3LGMA 5B09A 1Q4RA 1TZ0A 1LQ9A 5T7LA 1KVJA 1YJVA 5T7LB 5B0DA 1APSA 2ROPA 4OJGA 1WD6A 2GFFA 2RILA 3K7RA 5K9FA 4Y2MA 3FRYA 2OD6A 1AW0A 4A46A 1ULRA 2K1RA 3KNGA 1CPZA 1CC8A 3BB5A 4OJ1A 2K7JA 2N4CA 1N5SA 1R6YA 1X7VA 2BBEA 5B0CA 3FMBA 1FVQA 2N4DA 3BF4A 1Q53A 3F44A 2W4PA 2AP6A 3BGUA 3LGNA 4DN9A 2K2PA 5B0GA 1Y9OA 4Q2LA 3HHLD 4ZA1A 2XMMA 1OQ3A 2IFXA 4EFAC 2VH7A 3KG0A 1TL4A 1AFIA 1P6TA 1JWWA 1YJRA 4DPOA 2OP5A 4NPOA 2JDJA 4OJ3A 5B0AA 2OD4A 1OPZA 2BUNA 3KG1A 2FB0A 4QOTA 1FE4A 2ROGA 4F67A 1Q8BA 2EW9A 2HFNA 5A6WA 2W4DA 1MWYA 4A48A 2L3MA 2OAUA 2GO8A 2KT3A 2ZDPA 1TR0A 5F0UA 4Y2KA 4YEAA 2AW0A 4Q2MA 1YJUA 4A4JA 1K0VA 1JK9B 2FHMA 2LDIA 3BN7A 3DCAA 1QUPA 3MCSA 2CRLA 2LQ9A 2GCFA 3LO3A 2RSQA 2GGPA 1V3ZA 5B0BA 1FESA 3TRGA 2QLWA 4FNHA 2XMVA 3UDCA 4HH0A 5A6PA 2AJ1A 5F0WA 3CJKB 3HHLA 2OKQA 1OQ6A 2XMKA 2OMOA 4FNIA 2PD1A 1VQYA 2IYGA 4HH1A 1FVSA 1KVIA 4HI1A
chains in the Genus database with same CATH superfamily
4B02A 1JLAA 2CADA 1RT4A 3CDBA 3GIRA 4KBIA 3CCRS 1FERA 1Y3JA 3VVUA 3I9ZA 2RS2A 2MQLA 3SV4A 1Q5VA 1JWWA 3VF0B 4ZJQA 5KFFA 4OL8A 3BGRA 2XMUA 2QMXA 3WBZA 4F02A 2JFDA 4IH7A 1IQZA 3GMGA 2J6SA 4RNHA 1XMQJ 2DGVA 1TKTB 2XI3A 1URNA 1WDTA 1ZM9A 3KKFA 2K3KA 1WHVA 2WVEA 2YKMB 4M5GA 4B9NA 1M5VC 3IO1A 2MQ8A 1F9EB 3C6TB 4ZLPA 5F8JA 1KN6A 1FWLA 2R9LA 1BD6A 4Y65A 2OSRA 4A8YA 1DLOB 4Y2IA 3PW0A 3V6KA 1RCOB 2M5YA 3K8VA 4DSIA 1RT2B 2V67A 5G0RA 1YTYA 4R8UB 2UUTA 3E3XA 3E8OA 3TR5A 8RUCA 2XC9A 2GNKA 1F9HA 2CAJA 4DPXA 3UVJA 1FNXH 3CB4A 2FC9A 3DC2A 5KFKA 2AEFA 4JP8A 1N0VC 1WJ9A 2JSXA 5KFGA 1W2IA 2QO3A 5KFNA 1M5KC 1S49A 3DLJA 4I2PB 3V6JA 4DF8A 5KFJA 2FLPA 3H5XA 3GIJA 3PXGa 2RKIA 5AJ3J 2CNNB 2ZBCA 3NOCA 4FPIA 4YOEA 2HVHA 3LP1A 2RU3A 4Y6IA 3JSYA 1S9GA 4UTGA 3O6QA 2G0CA 3KJFB 4C11A 3BQ0A 3WDOA 3PR5B 3C6UB 4M5LA 3KK2A 1N36J 1YITS 2ZH6A 2QA4G 3IAS9 1WG5A 1P8GA 1X4HA 2C42A 3MEGA 3RBDA 3PO4A 1SJFA 3DLEB 3JYTA 4CH7A 1JJ2R 3H5YA 2V4RA 1LQ9A 3MFIA 3L9ZA 3T41A 3Q22A 1IBKJ 2GIQA 3CE8A 4PAAA 2GO9A 3GSIA 1VQ7S 2GFFA 2OEKA 2Q6BA 2YY3A 3FCVA 3PHEA 4WCEQ 4DR7J 4Q44A 4FYWB 3ILJA 1U49A 3NNHA 3CJRA 2RKIB 2DCLA 4ZPVR 3FEZA 2MKJA 2DXEA 2Q79A 2ZH2A 4YMEA 2HHUA 2QMWA 2HHQA 1UEKA 3CC7S 3VVTA 2YPZA 4FS2A 4JI1J 4FKXA 4B08A 3W62A 3RAMA 2JLGA 8ATCB 4YR0A 4B9SA 1HYSB 1ZH5A 3BH6B 4EYIB 1YDLA 4F36A 1T7PA 1JLEB 1K44A 2DGWA 1C0TA 1KOOA 2DNPA 3GPAA 1LOUA 2O67A 4LRFA 3LGNA 3UQSA 2K2PA 5BYRA 4AD6A 3UI3A 5EHHA 4KY3A 1WF2A 4LFAF 3NMRA 2HVIA 1OS5A 1NU4A 1BC6A 3PYFA 3C14B 3OHAA 4C4WA 2VC0A 1K47A 4LBHA 1YJRA 4L3KA 5KG5A 4X65F 2R7UA 1BXNA 1UP1A 1HNVA 1MROA 2DGQA 2DY1A 5DG7A 4PUOA 2XYHB 3C15B 2AX0A 3KG1A 5L8RC 1WOPA 2GS8A 1RCXB 3WHIA 3SMZA 2OO4A 3CDAA 3BDPA 4NZ0A 4ELVA 3MM6A 1DTTB 3R2DJ 3GFYA 3TI0A 4H4KC 3IRWP 4JI6J 1OPIA 3AA9A 1C0TB 1H2UX 2RF2B 4Y2AA 5CZXA 1N33J 3FDSA 5C25A 1BUXA 5E7OB 3TEGA 2I5JB 2DGUA 2Y0SD 1HWUA 1X4GA 2WAQD 2QYGA 3OTBA 1QAXA 1HBUB 1OQ6A 2ZVSA 4KKOA 1REGX 2LMIA 5DDQC 4C98A 4DS5A 2HHHF 4B3MF 1FF2A 1NK8A 3TQ1A 1AXQA 2PEBA 3GR1A 3KUGA 3PYGA 1DAXA 3GG0A 4X4QA 1SXLA 3OTEA 5LJ3Y 1LWXA 4F4ZA 2VPWB 1CG2A 2OEJA 5EX0A 2MYFA 2E1RA 3CD0A 2EC2A 3FCHA 4P74A 4OI1A 3SSQA 4CWBA 3FSIA 2IDEA 1JKHA 2ZZNA 4P72A 4IRKA 2NXUA 4DFKA 3KK1B 2FDNA 4DU7A 3HZEA 1RZMA 1S6QB 1TMJA 4JI0F 2YKOA 3D2WA 1CSJA 1RBAA 4UOCA 1DARA 2D3O1 2DR8A 4F0KA 1I94J 5KFEA 2CPEA 1QAYA 2YX4A 4NWBA 2VQFF 5A8RA 3EZUA 3BQ1A 2O01C 1LWEA 4QWDA 4RNMA 2RRNA 4TU9A 5JXSA 5KFIA 2GZOA 4J90A 4ZCIA 4BCAA 3D4JA 1WEYA 1T9WA 4DUZJ 2RMLA 2J5AA 2JFKA 2N3OA 2XI2A 4LRDA 3PKYA 3QAEA 4OV6A 3OTOF 2MZQA 4IG3A 1BQMB 3SFGA 1WNEA 5KT3A 1U6FA 4GKKJ 2C2NA 3I32A 4O4GA 2HNDA 1LEOA 1ZM4A 2F9DA 3CJ8A 3CJSA 1BQNA 1LKZA 4U67Q 1FRHA 1KTQA 3M2VA 1RT3A 5A0YB 3MR6A 1HQ2A 1KD1T 4AUKA 2AMCB 5L1LA 5C2CA 4DL2A 4OI0A 2DHGA 3I0RB 4PQUB 3G9CA 5IV4A 2P9EA 3VZIA 3G87A 4EI2A 4CH1A 4DR6J 3GB0A 1HI8A 4F4KA 3NCRA 4LVOP 1D9AA 1Y0HA 2XSJB 2M8HA 3W2WA 3TOQA 3WX8A 3HMJG 2ACMA 4OX7A 4WTYA 5KFMA 3QRPA 3LGMA 2VL1A 2WVFA 4OLOA 3HK2A 1KVJA 4QR1A 3OVBA 3TUIC 1EP4B 2XHWA 1NH7A 1TVRB 2CJXB 3OFHA 1X4AA 3MM6B 4LT6A 5F3TA 4FVCA 4OX9F 3W9JA 3IN5A 4PR6A 2QE5A 2OTJS 4LSNA 5DGBA 1TAUA 3MI7X 3GWCA 2AWZA 1RT5B 3IM9A 2OPRA 2XBPA 3RUBL 4OJ1A 1ICEB 5JVHQ 2FJXA 3T5KA 1NKCA 1X9SA 1RWOB 2CNKB 1SH2A 1FRJA 2X3DA 1PO6A 4ZDNA 3T5JA 3ILIA 1WI6A 2HS4A 1S12A 5DRKA 4WFBQ 2XLIA 3BO3A 2DVIA 1RI7A 3F44A 4K2XA 1NJWA 4FN5A 1WHWA 1N6QA 1Y9OA 2B51A 2RHSB 3PFOA 3BKTA 5L39A 1M1KT 5EDWA 4JI4F 4YB7A 3QRQA 3OXGA 4KV8A 1P6TA 3ISZA 2CDQA 3NGSA 3ZNUA 1FI4A 5I3QA 2ATLA 2AGQA 3L7PA 2H9ZA 3OLAA 1DHMA 4DV0F 5KG1A 4JI5F 2OLWA 4IFVA 2EW9A 5A6WA 2J6UA 2DH7A 1U1PA 4OYIA 1Q0NA 2G0IA 2HZVA 4OHWA 2HZCA 4ENOA 3KK3B 1GX5A 3TZZA 5F9NA 1TK8A 4K0KJ 4B17A 1S1VB 3KDOA 4YY3F 4JI6F 3VV2B 4X66J 1T9YA 3QT6A 2X3GA 2XZDB 3ULHA 5JMNA 2LQ9A 4RW4B 3HXMA 1HHQA 1IBLJ 4U7CA 1EIYB 5B0BA 2R8JA 3OR1A 2QJ3A 3ZZPA 2YQ0A 2QMUB 4XTTA 2DD8S 4DR5J 1O0PA 3IRXA 2MZTA 4I0WA 4MKVA 4IG0A 5FDLB 2V2KA 2PMZD 5CYJA 5J2MA 3EGNA 1WELA 3R6LB 4DPYA 3ILLA 3N6LA 3OFEA 3DLKB 4Q8EA 4ES1A 2EVZA 2Z2YB 1HMVB 3QWPA 2G2ZA 2NYHA 2ADCA 3KJVA 1MWZA 3ELHA 1VISA 4A48A 2LLZA 1QVFR 1CQNA 2ZBQA 3H2UB 1S77D 2J0XA 2QC3A 1AZSB 1C1BB 2M52A 1PC5A 4MMOA 1ROFA 2V4JA 2Z2ZA 1RU1A 3SEOA 4V19X 1WKKA 3X1LB 4RU9A 2DNMA 4O3SA 3M2UA 3HM9A 2MLYA 4USTA 1HI1A 2PO4A 3IWXA 4XPCA 5HMXA 2NPIA 4JI0J 4N5SA 4JYAF 3JTNA 1KTVA 2KYXA 2YH0A 3EVWA 3ZXWA 4V19J 5KG2A 1HNVB 1MROB 1B0VA 5DZ6A 5KG7A 5A8KA 4ZKAA 5U47A 2ZH4A 1IKVB 4QPTA 3AB2B 4O44A 2OJ3A 3PW7A 5AXNA 1FCAA 2B5JA 2D3ZA 4DOZA 1B3TA 1VK3A 4IH5A 2WHOA 2GQCA 4LBIA 1KHVA 2WCXA 1B70B 3VTIA 4LF1A 3PX4A 4JI3F 1WOSA 1XMBA 2MJNA 3VHQA 2HNYB 1APSA 4R8UA 3Q8PB 5CD4A 3DU5A 1G4CA 1JLCB 3EPIA 3NBPA 1BMQB 2LA4A 4C8MA 4YB1P 2HIYA 1ZM2A 4YB6A 2VPZB 1JQGA 3MEEA 2EI5A 3CJKA 1F3FA 1VRUA 4QIEA 2NSCA 3DRSA 4TQRA 1VQ5S 2JX2A 1RSCA 2NPFA 2PMWA 2OFHX 1URRA 2DNGA 1S0NA 2JEGA 4NRUA 3U1LA 3Q8UA 2IYIA 3BSNA 4DL4A 3QJLA 3H8YA 4LF5F 1M5SA 4G1PA 1WKJA 2CXEA 1RLCL 5J2MB 3RZAA 4OJGA 4CYUA 4PRFA 4AXJA 1J5OA 3MEGB 4JI2J 3EPGA 3BBCA 3R5CA 1ULRA 1NKEA 2K1RA 1K0TA 2YX1A 1RT6A 2DHAA 4M5JA 5HMZA 2DR9A 4RBUA 2JOQA 3HHKA 4RW4A 1T3NA 2CPXA 3QZ7A 4ECYA 2KB2A 4CNYA 4ZVSB 2BQUA 1RUSA 1FNOA 2DGXA 1HBNA 1R6YA 5KFRA 3HVAA 1XN9A 2N4DA 4F25A 2FD2A 2J7UA 5DQHA 1MMNA 1NDPA 2B3TB 3OHBA 3LOUA 3D6MB 1AT1B 4OX6A 5IZHA 2FZGB 4JI1F 2E44A 3CUNA 4WZMA 5E5NA 2HQGA 3T1YF 2IFXA 1IJFB 2BV3A 1KP6A 1GNKA 1Y5IB 2V5HG 3KG0A 4F3MA 5HO4A 3T3FA 2QSWA 3W5ZA 3B4MA 3RB0A 5MAOA 4DV1J 1VGYA 2AHOB 3BREA 1BWVA 3DRRB 4HT5A 3TAQA 2AGPA 4TQSA 3LAMA 1G3OA 2CZ4A 4DV2F 1VQLS 2JEIA 4K4UA 4X4TA 3MM7B 2X1AA 2WRMA 3I96A 4K5SA 3OUYB 2BDPA 1FJGJ 2RQCA 2GAHC 2GW8A 1YJ9S 1HNZJ 1WTBA 2J9EA 1KR4A 1R8AA 1CVJA 1LK7A 3UFCX 2CPDA 5HP1B 2G13A 4CM0A 2QLWA 4DI6A 1XMOJ 5L38A 4TKTA 3P8BB 4QPXA 2CQCA 4FS1A 2RF2A 2OUGA 3PM9A 1EQMA 1RBLA 3T6BA 2AYBA 4NCAA 4EYHB 4HH1A 1FVSA 4ZIVA 5LMUJ 3Q83A 4IOAQ 3QPIA 4EMDA 4PWDA 1RT4B 5ITHA 1YQHA 3Q8RB 2G4BA 4CLTA 5D4LA 3L3CA 4O4RA 4QR0A 2ZE2A 1A6LA 3GJRB 5LXRA 1VQSA 2WW4A 4UUXA 1YHQS 1UVIA 4NYZA 3J7YI 1IBMF 2RDDA 4NEYA 3NLCA 3UN5A 2K3IA 3T19A 2ZOFA 4EZ6A 3M4XA 2HHWA 1NK4A 4RW8B 3VGTA 3ZC4A 1WC4A 3CF5Q 1GK8A 2B9EA 3EXYA 1GXUA 4ZP6A 2JLFA 4FYXB 3FFIB 1M5OC 3ADAC 1H73A 3UDVA 1VQ8S 3M8QB 4ZOSA 4DX5A 3E01A 1P1TA 2FHKA 4ZPAA 2HMIB 4J91A 4NMLA 4JYAJ 2CUYA 5C24B 1TV6A 3D3CJ 3H59A 4NLSA 1WC0A 4WXOA 4J37A 3EZOA 2LXUA 5I4MA 1HWIA 2AKWB 3DDNA 2LXFA 3K5PA 2KJVA 3MMJA 4X62F 4GC7A 2MLZA 5A8RB 2JNJA 3MHYA 3OJSA 3QRRA 1EKRA 4J7CA 1B4SA 4I2QA 5K20B 2Q3PA 4ECTA 3W5YA 3EDRB 2CNLB 1F5BA 5KOXA 1IM4A 3LUYA 2WW8A 4ANCA 1U48A 3R3TA 1GXLA 1PJ6A 2YNFA 3BBBA 3JTPA 4YDDB 1UA1A 3KDNA 4IRCA 1SJRA 1KEKA 4AL7A 4ZLJA 3B54A 2H3EB 3IRXB 3EVMA 3HHLB 1VQ6S 4GKKF 2DGOA 3O1LA 2VV5A 2YWHA 3L7OA 4IH6A 4C3MA 2P9GA 3LTOA 2MGZB 4GC6A 3NNCA 3HT3A 5D4PA 1LWEB 3G4SS 4X4NA 3HP6A 2O66A 1X0PA 3KMQA 2AX1A 3UCUP 3AOBA 3H40A 4F4WA 4JOUA 5T7LA 1O5JA 3PEJA 3HLUA 1U1RA 4I64A 1QSSA 2UUBF 1DTQA 2V0NA 4P7VA 5B0DA 3N0VA 4KKOB 2RILA 3OBIA 5FJ4A 1XR5A 4XPEA 2ADBA 1U26A 2XS2A 3CD7A 2RQMA 1AW0A 3KLFA 3H2VE 3TUPA 4DR4J 3HHNB 3W7BA 2YNGA 3U1MA 1U6BA 1T9VA 4KHPF 1RKIA 3NRBA 4OYPA 2I0XA 3OT9A 4KPCA 1KNZA 3I0SB 1QE1B 1Q78A 3KLIB 7AT1B 1S0MA 2ZHAA 4IR1A 2A10A 4TU7A 1S1WA 3CCWA 4FZVA 3VAKA 3L95X 1XNQF 1WF0A 1R6VA 4WJBA 4ZN1A 5HN0A 1IN0A 4ED2A 1WKLA 4PKDB 2IVFB 1PC4A 4QCLA 1GMWA 3ET6B 1VBXA 1EJ7L 1CS4A 4C0OC 5EWEA 1QTMA 2ZZMA 3DYAB 3N01A 4QW8A 5HMWA 3V81A 3DU6A 1G2EA 3MCOA 2FY1A 1SKSA 1FRLA 2OPQA 5A8WA 1RTJA 4R0JA 3QQCD 4ALZA 1I51B 5H9FJ 4B9MA 1IWAA 4LF9J 1JLGB 1S6PB 4OYWA 2H1YA 3R6GB 2XB2D 3VAIA 4XAKA 4K4YA 4MTPA 4B9TA 1VS3A 2CQ1A 2YPYA 3HHEA 3RU0A 2NXJA 1PKUA 4CO1A 1XWLA 3BH7B 1M0SA 2VPYB 1S48A 3T9ZA 2DIUA 2A2DA 5C7PA 2D1CA 3GV5B 3M2UB 4ZP7A 4CRJA 1K8AT 1FESA 3M32A 2CVIA 4TY8B 1OMSA 1R3NA 2HWTA 5KG3A 1UFKA 2AJ1A 3TA2A 4TU8A 2IRYA 1YGYA 3I0RA 4UZBA 2IRUA 3NS7B 2Q1LA 2XMKA 2YKQA 3ONQA 4CO0A 1IBLF 4C8YA 3SSRA 1PJ7A 2EFQA 4FF3A 2NXNA 3MUVP 1WC1A 3CW2C 3DRPB 5KFWA 2BMBA 1FEHA 3DFEA 1KVIA 4ETZA 1IWGA 3V6HA 2LQBA 3ISNC 4PWDB 3BZQA 7FDRA 5KOWA 1U2FA 4RW6B 2N7CA 2UV8A 4ZCKA 3CXCR 1Q95G 4UOGA 1N48A 4QW9A 3NGDA 2QL9B 2XWYA 1WEXA 3MAHA 4F26A 5DS7A 2JL9A 2KM8B 3KHHA 2XMWA 4ZVPB 3IC1A 4LFBJ 2WSCC 1U24A 3F56A 2E5IA 4LIRA 4OJHA 4TNOA 4RUHA 1K1SA 2CJAA 2L9WA 2QLBB 2YNGB 1PBAA 3CDEA 1U0HB 4H4OB 2BJ9A 1G7CB 3KJQB 1T05B 4E2FB 2KM8C 3FJ2A 2P9CA 2IPOB 1NMEB 1L3VA 2G1HA 5D77A 1SC1B 4MIBA 2C2ZB 1NPPA 2ZC3A 4WZQA 2M4MA 1YRXA 2AEJA 1HNXF 2CYYA 5CYMA 5D6GA 1TL3A 2CZVC 2R42A 2W2QP 5HATA 3IR6B 4DMZA 3C8YA 5AE1A 4JI5J 3OXLA 3TVKA 1U0SA 3VQTA 5IXUA 3RBXA 1T95A 3ICLA 4DUTA 3MUMP 1NXIA 3G6XA 4NASA 4I6YA 3KTQA 2ALYB 1R0BG 2CJKA 2V9WA 2PI5A 1S6OA 2IAJB 2QX0A 4LRCA 1DZ5A 2BKOA 2YTCA 1FRKA 4U96A 2LQ5A 1OYEA 2MJUA 2VZ9A 5D0GA 5KFUA 2JEJA 1A9NB 3NS6A 3C66A 4C8OA 1VQOS 4MKAA 2HNZB 3PRBA 4NCGA 2WBMA 2Y1LB 2IBOA 3AOCA 3G82B 3THTA 4DQRA 9RUBA 1RT6B 1TZ0A 2YWEA 2DGTA 4RBTA 4C8KA 5F8GA 3DLHA 1Y00A 4H4KA 4IOBA 3KFWX 3RRKA 2MZ1A 4P6QA 4WK1A 3DRPA 5K14A 2EG2A 5D0RA 5J1NA 3UR0A 3HKZD 2E7XA 4MFBA 1RKJA 2F4VF 1JXEA 3OTCA 4UUWA 2YWFA 1HBOB 4NZ7A 1AROP 1LW2B 2C2EA 2LYVA 2ZH5A 3GFHA 4KTQA 2HBRB 3IWNC 1C0UB 2DRDA 2XTJP 1VRUB 4Z7CA 1NSKL 5E3CA 1Q53A 3K5MA 1L5UA 4ICLA 2OTLS 4RBVA 1UVJA 1FJ7A 4Z7YA 2B9YA 4FPRA 3KLEA 2EFOA 3HI9A 4I56A 4O3PA 2ERRA 1SKRA 4OYMA 3MM5A 3QGIA 1KQSR 5HBMA 2BOPA 2VH7A 4RPFA 1UETA 3CMES 4K4XA 4F8RA 4OI3A 4GVBA 3ITHA 2HPUA 4LMZA 3CNQP 2R7SA 5EUHA 4OJ3A 5CYMB 3G6YA 4QJVA 2W9BB 5KG6A 1Q82T 1BQNB 4JI8F 4X64J 2OIHA 2HBZB 4LF9F 1JLFB 4N47A 3P45B 5GMDA 1X4EA 5IOLA 5CA5A 4Y34A 3Q24A 4ECUA 4OI4A 5J2NA 4LQ3A 2IC3B 4AXIA 4ILLA 1JK9B 4DUYF 1JLEA 2WB1D 2PC6A 4IDKA 2XYGB 5HAOA 2DHHA 4LIWA 3OL9A 2C3MA 3O3LA 4DV2J 3KNAA 5J2QB 2KU7A 1SC3B 5F8LA 4ANDA 3PYDA 3VAMA 2E29A 3SXLA 3MAAA 5K8PA 2NXEA 1RXOB 1HNZF 3DMJA 3B82A 1H98A 3FEYB 1L3KA 3J7ZT 4LF6J 2QIFA 5DQIA 4DV5F 2NLWA 2V8GA 2ZEJA 2J8AA 3H98A 4RUBA 2MKHA 3DRSB 3MZIA 3GIMA 3DOMA 3LQVA 2X7IA 3PVXA 4U6PA 2K1RB 2ROEA 4C0HA 1NAQA 1UMJA 3AXMA 5J2QA 2GHVC 5C25B 5IFMA 2F1FA 2WVCA 4ZN3A 3CGIA 2E9ZA 1GMVA 2YKAA 2ZUAA 4PPDA 1PYOB 3WC0A 2ZDOA 3PZPA 2D7SA 1CJVB 3HDSA 1D9DA 4IOCQ 2E1PA 4M63A 2E9TA 2W7OA 3HFKA 1JLGA 1S6PA 2UZAA 3MDFA 4P52A 4TYAA 3GJQB 3UNYA 1X5OA 2PGCA 2ZOMA 4CQ1A 4Q0BB 3JSMA 2IM3A 4QYRA 3ITHB 4CT8A 4B9VA 2V9KA 2ZITA 3BDEA 1T03A 3M7VA 3SCJE 4P2XA 4DV1F 1EKSA 1UJ6A 1OSDA 3MEDA 2JEFA 3IBWA 3LWMA 3ZTQA 2M8DB 4J9KA 1RA6A 3NCPA 3IBCB 4ZP9A 1Q8KA 2HK3A 1KQGB 2L9NA 3DHWC 3UR3C 2Y1JA 4D3GA 4RX6A 3JXOA 4JI4J 1FJGF 2V2VA 3D3BJ 3MFHA 4CLWA 4GKJJ 5KFPA 3JS9A 2NUUG 3WIVA 3JQKA 1IKXA 1JLBB 2DEIA 3K89A 2PMHA 4C0BA 1Y3KA 1S1TA 4DX7A 1U1LA 3G8SA 1Y5LB 3GFXA 3P4UB 4HI2A 3D0GE 4S0MA 1Y11A 3GIKA 3SBMA 4DV3J 2MTLA 1D1UA 3UD3P 3JAMU 5GMKa 3G2XA 2AIRB 2VQEF 2Y1RI 3ENAA 3QYYA 3V81B 2ZBPA 5ETNA 2F8MA 1EAYC 4EUVA 2DR7A 4YY3J 3FRYA 2RQKA 3OL8A 4A46A 1F3VA 1TL1A 3WIUA 3RJMB 4CO3A 1J5OB 1PAUB 2Y3YA 3QIPB 3F73A 5D78A 3KHLA 3RAXA 2B9XA 5HVHA 4CM2A 3I82A 3MMBA 4Q0BA 2QV6A 2R4FA 2BJ7A 1W26A 4CNZA 4Q45A 2R7WA 4DR5F 2CQ4A 2V50A 5KTQA 2RDJA 4AT1B 4ELUA 4X4OA 3CJ2A 3KJNB 2M0GB 3V2UC 2AGOA 1U2CA 1IR1A 5ETRA 4ETXA 4F04B 4ED3A 1L3UA 1Q7YT 1C1CB 5D15A 3CMQA 5RUBA 2C3PA 2G2YA 2VDHA 1SH0A 2VB6A 2ZWPA 1UPMB 4DLEA 3J7A1 2IJRA 2NXCA 3C6UA 3OR2B 4DPOA 1GEHA 3K2YA 4EGLA 3KK2B 2KTQA 1CJUB 5MLCV 4KFBB 4B3RJ 2VJUA 4ED8A 4RLEA 2HFNA 2XY7A 2VKRA 1Z4UA 1KHWA 2E5GA 4ID8A 4RW6A 1UZHA 2W4DA 2RHQB 1RHKB 4DXLA 3I6PA 3MD3A 1IKWA 2CQBA 2NR0A 3Q89A 1Z2ZA 4J9OA 1HWKA 4Q2MA 1YJUA 2GMLA 3FMWA 4LF2A 2IC3A 3R7SB 3MCSA 3SCLE 5DG9A 3PX0A 4OI6A 1ZYQA 2RSQA 3AQOA 4DUYJ 2FLLA 4X4UA 2W2PP 3CD6S 1KLMB 1M1HA 4UQGA 2MZSA 3G96A 3H25A 2ZD1A 2W8KA 4ID5B 4Y2CA 4HKQA 3P6YC 1RE1B 4TN2A 2PE8A 4DQIA 3OL6A 2ZH8A 4DSEA 1KFSA 1PYSB 2FUG9 1VCTA 1FX4A 4ZP8A 4DV6J 1FO1A 2VF3A 4DV4J 3TA0A 4EK2A 1F6TA 3IS9A 4FP9A 4PG5A 4PWWA 1SQEA 5F0WA 2QA1A 2AT1B 3HF5A 1DFDA 2XGPA 5DJBA 3A4TA 4C2MA 5B08A 1S72S 2W1BA 4J9QA 1VQ4S 2YNHB 3R5JB 1NH8A 2OEMA 2POKA 5EWGA 2CZ9A 4LR9A 1S9FA 3QO9A 1CEZA 1FDBA 2K7KA 4UZCA 2BJEA 5FIIA 3U27A 1JNRB 3IWLA 4MH8A 1NSQA 1YVFA 2J8SA 3ENQA 2GAGC 3GP9A 3C46A 4ZPWR 2I2YA 2R7TA 1YBAA 1IKYB 2MKIA 4YHHJ 3KMSA 2Z0GA 3CJ4A 3ZNJ1 1JJCB 4NMXA 3CCZA 4CI0B 2QA2A 2EFVA 2J7WA 5L1KA 2O5DA 4ZMMA 2HQCA 1RISA 1X31C 2Z8QA 3AAWB 2GGPB 3B4DA 3UNGC 4AE5A 4DR2F 5KFAA 1T94A 4BS2A 2RAQA 3M2VB 2DR5A 4DV7J 3BPDA 1RWVB 2KI2A 3T1AA 4OHXA 1N5TA 3PY8A 2DRAA 1HYSA 1F9FA 2GJIA 2FGCA 5BYQA 4RWWA 2FVRA 4KAIA 4L72B 2G2OA 4PZVA 4DCOB 4B3OA 3MR7A 4ZVUB 1TUWA 5LMNF 1H2VZ 1SC6A 2HYIB 3HD2A 5CYQB 4DV3F 2AYMA 1MLAA 2HS3A 4WK3A 1JX4A 4P71A 4ECSA 5E3AA 1WD6A 3DOLA 5GAGI 4CLKA 4CLPA 3TWZA 4C8ZA 3U02A 3GCXP 4KR0B 4ZHRB 2W9BA 3JSRA 1FT8A 3SZ2A 4DR6F 3J7Z5 5KG0A 1EX8A 3MM8B 2IJFA 3MM5B 3BF4A 3GV7B 5DM7Q 4RUCA 4W98A 1HQEB 3I31A 2YNFB 1CQMA 4NLWA 3TVZA 4J9SA 1X4BA 4W92B 1HR0J 4PUOB 1ZS6A 3GONA 1PCAA 3DKDA 5GAHU 3IR7B 1NB2A 2FJDB 2LA6A 3MEKA 3Q8QB 2PA3A 4YFUA 1RAGB 3TAMB 1R8HA 1F2HA 2E9RX 2XS7A 3QAUA 1VR6A 3HFZB 4DPUA 2XO7A 3CCVS 2ILYA 4HTJA 2YVSA 5A8WB 4HDHA 1KLNA 2JWNA 5HQLA 2B5JB 4ZCMA 3TANA 4AL5A 4OHZA 5T41A 5HBMB 4ZJLA 1P1LA 1X0FA 3M6UA 3BSOA 3JB9k 1U1MA 3SCKE 4WFAQ 3M8PB 5F0UA 3LPYA 1KQFB 3GILA 2CQ3A 1K0VA 5SUHA 3DCAA 2LDIA 1TL1B 1HBMB 1WI8A 1REVA 1XR6A 2CRLA 3O44A 2GCFA 4BHQA 2HBQB 3NAHA 5J2PA 3M2RB 2LDYA 4MJKA 4X64F 4OYBA 1LWFA 4DDFA 1N5YB 4YR3A 3M8ZA 4Y3CA 4D3HA 1VBYA 2RUSA 3JTOA 1ZTTA 1KOHA 1HNIA 1TQLA 4ER8A 5ADZA 4DCJB 4N8OA 1VLYA 4X65J 3HPOA 2VOPA 1H6KX 3HJFA 1ZAVA 2B8QA 4NEZA 1JLAB 3DLEA 4TY9A 4OZ3A 4YN3B 5B7WA 1H74A 2KT2A 3JYTB 2C3UA 2MPUA 4L74A 3TX0A 4NCBA 1FEEA 1RJJA 1XC9A 5E33A 5HROA 2DH9A 5ETTA 1T03B 4A8MP 1H72C 4OYOA 4UOHA 3W64A 5EGYA 3N6NA 1XEZA 2EBGA 3AB4B 5AXMA 4PG8A 3J80Y 1R8BA 1HD0A 3I0SA 4HDGA 1U8SA 4F0MA 3MXHP 3CD5A 5F8NA 1RP5A 2EXUA 2H5JB 4MT1A 6FD1A 5KFDA 2IA6A 5I42B 2D9PA 4PQUA 4DR4F 2F8HA 4DR1F 3DOMB 4ES2A 3KUHA 3S01A 2E7VA 3TZWA 5DDOC 3V4MA 3CCLS 2Z58B 3VALA 3C2PA 4RNOA 4NXNJ 3FBCA 4XK8C 1GH8A 4ZVRB 4FF1A 2FHOB 1WEZA 3MCMA 3ZO7A 2HWHA 3VR1A 1RTIB 3W3SA 3QSYB 2CG8A 2FLOA 4HYKA 1MSWD 4RL1A 2P5VA 4M5DA 4DPWA 2UXBF 4YDXA 2WSEC 1PAEX 1RWUA 4O0IA 1FA0A 4KSEB 3HJVA 3QATA 2O1PA 5C5JA 2MQOA 2MKCA 3KLGB 1NLKL 1U47A 2H65B 1MNEA 2HRTA 2W4CA 3BSCA 2W9CA 2KVIA 4NE9C 4LF7F 1N88A 2BZ2A 5F3ZA 2VUGA 4G6VB 1V9OA 2HFZA 2MKYA 2XMJA 3P5TL 1O6XA 3OJUA 2ZM6F 1SPBP 3GQCA 4J9MA 2WBRA 2QSFA 5F41A 2ZJPQ 4GVBB 3VAFA 1Z1ZA 2HSEB 3MPVA 4MK9A 5ETMA 1BY9A 3DI6B 4WFNQ 1H7WA 2NZCA 1S99A 4G1QA 4TYBA 4WE1B 3QGHA 3U7JA 4WP8A 2CVEA 5JUMA 1SQGA 1QY7A 2HGLA 4NZ6A 3OW2R 2ROPA 3TJ8A 2A3JA 2XZTB 4PYAA 4V1Ak 3W2WB 3MEDB 3VAGA 1CJTB 1NJIT 2CA9A 2DO0A 3QNWB 1I1GA 3AY0A 2KVQE 3D1OA 3ZFVA 5LXYA 2IVYA 1EETA 4ZVTB 5M2UA 2W7AA 2Y9HA 3PJWA 1RT3B 5A0YA 1C0UA 2MZJA 4F2RA 1N34F 3FNNA 3GFZA 2R7RA 3H20A 1EZZB 2DNOA 5ETPA 2D3OR 1YIJS 2RD5C 3PJ9A 2Z2LA 4WFZA 4N76A 1FK9A 2W4PA 3C16A 1V5VA 2YBVA 5IQQA 4UW2A 2B7BB 2H51B 4DZ6A 2NZ4A 4Q2LA 1Y4ZB 1UZDA 3BN4A 4FKYA 4NLVA 2MKSA 2ZD1B 3A12A 3PW4A 1V3RA 3HZGA 4WWSA 1S7IA 1QAIA 3TAMA 3G71S 5ETQA 3J81j 2B6AB 2KRRA 3CCJS 3DGPA 2ILZA 4IFYA 1S4EA 4OV1A 3ZZTA 3M8RA 4ZK7M 1ZTWA 1IJEB 1U02A 3KXDA 4PXEA 3SIPB 4ZLNA 4NYOA 4DX6A 3IS9B 3R8YA 3UE2A 5KFHA 2DIVA 3MR5A 2YWGA 4G1IA 1MWYA 3DGVA 1V3SA 4U8YA 2GO8A 4MIWA 4DG1B 1HNXJ 2B9WA 2KT5A 1KS2A 4IG3B 3VQSA 2FHMA 1S1WB 1SIZA 1XK8A 5H1SV 2WONB 4DV4F 3NAIA 4R5PB 1FKOA 1NHVA 4E8UA 2RQ4A 5HP1A 3BQ2A 1SUQA 3NWGA 4EBDA 1S0VA 1S7HA 2NREA 4PXDA 3R9LA 3OUYA 3PYEA 4QIVA 1LFPA 1TMMA 3DI6A 2BKNA 3FK4A 2DNLA 3P96A 4FNIA 1SC4B 4LRAA 4OZ0A 4HHJA 2P2CB 1LFWA 1KLMA 2KDOA 2QZ8A 1NDCA 2NCKL 4K59A 2OPSB 4P10A 1U45A 2E7WA 2LCWA 4PYDA 2M70A 3A8JA 3D0HE 4WIQA 3T9NA 3TA1A 2VG7B 5IM0B 1C4AA 3QMQA 4DF4A 3GIIA 2RH3A 2ZC4A 3NWRA 4BDPA 4ZPDA 3AA8A 2ZUGA 1EHWA 1VRTA 2GIFA 2GJFA 4GRSA 4KGZB 3K5LA 2MGZA 1FRIA 2DNKA 2QYCA 2ZNYA 4PCQA 3LP2B 4R5PA 1SB6A 2V94A 4IYQA 5F8HA 3MPUB 2CQHA 1Q81T 4Y28C 3TNVA 1X5SA 2WZ1A 1RB0A 4QIFA 2F5GA 2V63A 2A1BA 3UO0A 4ED5A 2NS1B 3CVKA 3W8GA 5CCLA 1IBMJ 1J5EF 1LWFB 1U1QA 3RBZA 3MR3A 2UP1A 1HBUA 2LEPA 2MQPA 3NNAA 1HNIB 5AE3A 2B4VA 4O23A 3EX7B 3QGGA 2RUGA 1S1UB 4C8NA 4B3RF 1IKVA 2UVWA 5K14B 7FD1A 2FC8A 2VFVA 1SL0A 5J2PB 4IO9Q 2AJ2A 4CO5A 4TLQA 2AJFE 2XMAA 3IXQA 5KFQA 1RWKB 3C6TA 2W9AA 3DDKA 3QJJA 3EWGA 2E66A 3T1HJ 3FQLA 3LA0A 1JLCA 4LFAJ 4F4YA 1S79A 3DYAA 2P6SA 4DEZA 2DTJA 1J2VA 2DNRA 3HSZA 5B0EA 2KFZA 1M90T 2MY8A 4LVNP 3MEEB 2VG5A 4KH0B 4DV7F 4KGVB 1RYRA 1MWQA 2E5JA 4QIGA 4URGA 4CLZA 6FDRA 4JI3J 3TZXA 2OPPB 5GADI 4YP3A 4PG7A 3T5HA 1HL6A 1LXJA 3O8WA 4USIA 3N5FA 1S9EB 5FLXU 5F8IA 4XIUA 1BLUA 2HNYA 2R8HA 2LFVA 1KRPA 5F9LA 2ZJQQ 1G1XA 2UUCF 2MY7A 3TZYA 3VWSA 5KT4A 2DHSA 2OGUA 4GVLA 1WOOA 4NLRA 3SI8A 2RJZA 3CC2S 2FVSA 2CQIA 1VRTB 2V69A 3CWJA 2RVJA 1WC5A 4I7FA 1AZSA 1RAEB 2DITA 3AT1B 3G8QA 3I9V9 1UAWA 2FHJD 4YS2A 3EE3A 4U95A 1TL7A 1RAOA 2ZWOA 3HKWA 2AP6A 5GADU 4DN9A 1TU0B 4CP5A 1T05A 1NNDA 2HQDA 5CXTA 2EEYA 2HHHJ 2PFDA 4NLQA 4ZJOA 4F3QA 4I6WA 4LFCF 3A1YG 2JZ5A 5C42B 2DEJA 3GV8B 2OP5A 5G0RB 1C1BA 3IG1B 4ED0A 2JLEA 2M9KA 3DLGB 1EQ0A 2BUNA 2A2CA 2FB0A 2ROGA 4ZHRA 3V4IB 2DNHA 1NZ8A 1ACMB 4L76A 1KC8T 2L3MA 2OAUA 3UW1A 2ZDPA 3D1QA 3FSYA 4I2PA 1T9TA 2C2KB 3K17A 3LW5C 4A4JA 3W60A 2KH9A 4ECRA 1DRZA 2AZ1A 1WHXA 2IHR1 2JJ4D 3CJ5A 2ZNZA 1SJ3P 2GGPA 4B3TJ 1F5CA 5FD1A 1I94F 2HS0A 4UT4A 3EMTA 4PG6A 3TRGA 1FKOB 2OHDA 2KJWA 4TY8A 5CHCB 4NXMJ 3LH2S 3GYNA 3HVTA 3I5BA 2HMIA 3UVJB 2PFFB 2OMOA 3I55S 4KC5A 1LW0B 3KYLA 2BE2A 4DSJA 1VQYA 3QT7A 3W1YC 2FVPA 3H5SA 2VG5B 4OQJA 5IT9U 1PG5B 3N5BA 3OTOJ 5SZTA 3PTWA 2E5HA 2G9OA 2XCPA 3GTYX 2GA7A 2OPPA 1RHJB 3M30A 2KHDA 4G65A 3MECB 4L73A 1V6HA 3MURP 2I8EA 4FF2A 4KJIA 2VD3A 1FE0A 3FFIA 4KGXB 3BGRB 2HQFA 3DGPB 3EUNA 4A8WA 1JXVA 3HO1A 5ETSA 3H42A 5ETLA 4I68A 4NL5A 5C24A 3FKBA 1B7FA 2Z57B 2F63A 3H90A 3ET6A 3L09A 2ABYA 5KFLA 2RB7A 3GR0A 3RRGA 2UUAF 1PILA 1OIAA 4DPTA 4ED6A 1IKYA 3J7YU 2UVVA 1HPZB 1M5HA 2CG4A 3RTVA 2M88A 2HURA 4DR1J 3M6VA 3PIPQ 5A76A 4IKAA 3LPEA 1LW2A 5E3QA 2KHCA 3QT8A 4ES3A 5IT0A 4ECXA 2ZE2B 4F50A 4JV5J 2GHPA 3DM2B 3ZTPA 2EK6A 1RHMB 4CCHA 4USUA 4A8OA 1S1XB 2BVZA 3A8KA 4A47A 4R25A 4GO7X 4DWIA 2V4QA 2VJVA 2X51A 2HIQA 3CO9A 4RUAA 2MSTA 4WE1A 3M9OB 1TL5A 3PDNA 3QFWA 4IRDA 3B8HA 5DG8A 5LJ5Y 4PQAA 1ZA1B 4UOFA 4WP9A 2QFJA 3NGUA 4LSLA 1CC7A 4QZVB 3BKUA 5M2PA 4C97A 3PRVA 4I1TA 3G6VA 5IQ6A 3AQPA 4ERDA 2OPSA 3OXFA 5BXIA 5LSOA 1UEVA 3Q8SB 3W2VA 1S5ZA 1ZBTA 1F0XA 2V8HA 4WFYA 2KFYA 3R1LA 1Q86T 5AXKA 2N3LA 3LP0A 5JJBA 1PSDA 4RU2A 1HMVA 1MN9A 3H4DA 1S10A 1UCNA 3MM7A 3Q86A 1FTRA 9ATCB 1S97A 3K7RA 5HLFA 4Q43A 3BO2A 4F2SA 3H5UA 4U8VA 4UF4A 3D7SB 3AHPA 4DL6A 1QVGR 3DRYA 4O3QA 1UW4A 2J9CA 3I4PA 4IR9A 4LF4J 5DQGA 2XSFA 3BYRA 1U0HA 4H4OA 1TKXB 2A6MA 3IBFB 3FCWA 3K8WA 4LQ9A 5G4DA 4CT9A 4DV6F 1R0AA 4ZVHA 2I5JA 5B0CA 2WOMB 4NX9A 1FVQA 2HRYA 1B7YB 3SQGB 3RW6A 4CZCA 3K59A 1NHUA 2WONA 3MTJA 1OWXA 3BGLA 1AUSL 2ZH3A 3V6DA 1TL7B 5K5MA 1Q7LB 1IXKA 3D9BA 1RQ0A 3TJAA 4QWCA 5HJYA 3OSPA 2DK2A 4OMFG 3Q2SC 2UUBJ 4FYVB 4X4SA 2CJYB 2XG8A 1DQ9A 2JH3A 2C28A 2J9DA 3IG1A 3UN2A 3CCSS 2PI4A 1OPZA 4DQPA 3ZZOA 3AJDA 2EFGA 2CDRB 3QZ8A 1ZPVA 3QFHA 1UJ5A 3HSGA 2EBEA 4YB5A 2AYGA 3EDQB 2GIRA 4M5HA 2JVOA 4KO0A 3EYZA 3RR7A 4UY8T 2BE7D 1RAIB 2DXFA 2HVZA 2IRXA 3R27A 4ZLLA 2R2TA 3LO3A 1ZZNA 1IR0A 1N0UA 2VDIA 1UWBB 3A3NB 1NKBA 2C22A 3W5XA 5HQMA 4AQYF 4F3OA 3PJXA 3NXZA 3E51A 3IA0A 4F7VA 4DX8H 1MN7A 1RGVA 5DDRC 5A2QU 1D3WA 2R8IA 3JSBA 4HACA 1NK9A 3FZ2A 2ZJRQ 2BANA 2BE2B 4FYYB 4YQWA 1E6YB 4LF8F 1GTHA 3MUTP 3A13A 4DFPA 1HW8A 1Q8IA 2HHTA 2F9JA 3FRZA 3NMAA 4XO0A 1X8DA 4G3IA 2QLJB 4ZCLA 2ZKTA 5AT1B 3RB4A 2DBBA 2HFOA 1Q5YA 1SV5A 2K06A 4KO0B 3TVYA 3W66A 3M9NB 3M8YA 1XERA 3MM8A 1B99A 1TFYA 2Z2MA 1FRXA 1WF1A 4ZIWA 3AD8C 3D5MA 3KHRA 1JLQA 1FXLA 1ZAXA 2YQ1A 3L4BC 4DL0C 1N34J 2LU1A 2J0QD 1TKDA 5B0FA 3GU0A 2CQPA 2CPHA 1TK5A 1AUDA 2DR6A 3M6WA 2ZZTA 4O3OA 4DV5J 3MR2A 1HD1A 2NSBA 4PABA 1X60A 2W2OP 3VCDA 2XGQA 1C4CA 1S1UA 3DLKA 1RTIA 4AYBD 3OVSA 4ECZA 3EJMA 2KFNA 3LGHA 5HL7Q 3IP0A 1Q16B 5L9NA 2DPIA 1TKZB 2ZOGA 2YQ3A 3CJ3A 4CLSA 3CC4S 4X2BA 2A6OA 3CCES 2V68A 1N5QA 3QLHA 4HEA9 5CH7B 5E2QA 1TUGB 3HX9A 2V4JB 3BBFA 3GJSB 2W01A 2LQ8A 4OIXA 3RGIA 2UXDJ 1PJ5A 2DYAA 3MGJA 1P9QC 5IS2A 3IGNA 4BWMA 2HG4A 3V6DB 3AH6A 1UA0A 1RBOB 3ILOA 4KIAA 2LEBA 1YI2S 3SSSA 4K2JA 3UWTA 3SV3A 5D4NA 2GVZA 3TEHB 2Y8YA 2IJNA 1UW9A 2ASJA 4K4SA 2RS8A 1RT1B 2UXCJ 2QLXA 4C7QA 2Q66A 1RT2A 2KXFA 1CLFA 2N82B 1Q4RA 5DETA 4IUFA 4NLDA 3MCNA 3CCMS 4MKYA 3FBBA 4USKA 3NGRA 1IVZA 5ETKA 5K8OA 4M5KA 5K9FA 4I6AA 1GFWB 3QIDA 4O0NA 2L48A 4DR2J 2BKPA 5D0EA 1S1VA 3ENVA 2CPJA 2EKYA 2ZFHA 1RT5A 4LF4F 2LKZA 1R8CA 4Z37A 4I2QB 2W8LA 4NLTA 1YJWS 4IO1A 4QU7A 1X7VA 3FMBA 4ZS6A 1CJVA 3MF5A 3E01B 4DHVA 1X4DA 1RAFB 3ISND 2VIHA 4NA2A 2Z56B 4DQSA 3BGUA 2R3VA 2YNIA 1OY6A 1HHSA 3I87A 4JB8B 4JUZA 5GAEU 1IM6A 2OELA 3HHLD 4ZA1A 2YKMA 5GAEI 4CIOA 4J9NA 3QT5A 4QIWD 4CLFA 4RW7B 5EX3A 4C6AA 2ALZA 1EB0A 2X1BA 4NLYA 4OX8A 2IBKA 3MM9B 1SBRA 4NPOA 1M1GA 5B0AA 3OPKA 5E3RA 3ZZRA 4MFBB 3THPA 4F67A 3M30B 1O8BA 1NSPA 1RWMB 4KQZA 1N6QB 4QBUA 2XEXA 4UQTA 5L9XA 2FY8A 1NHKL 2CQDA 2KRBA 2FJBB 4JV2A 3DXBA 1TR0A 4H4MB 3K0JA 2AW0A 4OLPA 1CJTA 2JC0A 4RO0A 2KZZA 5IT9Y 4A8QA 2F4FA 2COLA 3DMJB 1ZAWA 1ZOTA 3K57A 4J9RA 4FYDA 2EC0A 1S4FA 2BR0A 1SUQB 1HWJA 2J7KA 1XNRJ 2AU0A 4HH0A 2XWXA 2GVZB 1NPKA 5F8MA 2B4OA 4LF7J 1NK6A 4C11B 3KHGA 3OTDA 1Q1KA 2PD1A 5BJRA 1FXDA 1Y5NB 4NLOA 3ZTOA 1RTZA 1YZ6A 2CWKA 5I3UB 1OY8A 3CMAS 3HHLC 3TW0A 4W90B 3M8WA 4JI8J 4DUZF 1DQ8A 1RWWB 1OY9A 3P3DA 4JV1A 1Q79A 3NG8A 1LW0A 1TUVA 2ZM6J 3K5NA 4M5DB 2WTFA 2W7PA 1NBEB 3LALA 2HNDB 2XY6A 1FJCA 4FXVA 1UKUA 1CULB 3HD1A 3J7AN 2RDIA 4CLLA 2DXDA 1D8ZA 3S8SA 1NRKA 2BQRA 4OZ1A 5HK4A 1FKPB 5GVQA 4RKUC 4XDDA 2L9DA 1LWCB 1XR7A 5AJ3F 2XNQA 4J9LA 2HEKA 2V8DA 5E0OA 5I3UA 4A8FA 4DSKA 3FUYA 1BHNA 1UJ4A 2J0SD 1GTEA 2DO4A 3H0PA 2AZ3A 4KHRA 1FDAA 1YBTA 1ZZFA 5HANA 4O3NA 3FBEA 1TKZA 4DFJA 2QEXS 2UUAJ 4UY85 2XZWA 2K8GA 2QRRA 3DXSX 5KFZA 2FIUA 3MPYA 4P7TA 3BGOP 4QYZK 1U25A 3CCUS 4ICLB 2FHJA 1GMUA 2J9DE 3D6HB 4KHPJ 4USMA 2IMOA 4ILMA 2QFIA 3QBCA 3T5LA 3M05A 1WHYA 2EKNA 2YNIB 2UXDF 4OHVA 4JV5F 1FD8A 2PEHA 4IQXA 2XCAA 2CPYA 2HGNA 2A18A 1FTCA 3ENWA 4OZLA 2BM1A 4DR3J 1C2PA 1P27B 1TKTA 3NKYA 2XM3A 1N56A 1QSLA 2BANB 1S76D 2MHEA 2LVWA 2HLUA 4J5OA 4KPYA 3C15A 4Q8FA 2PDAA 4CTAA 4OZJA 1UVLA 4Q5VA 2HHPA 1L3SA 5BYSA 1VC6A 1UFLA 1GX6A 1JLBA 2VASA 3ZZUA 1DTTA 1CS4B 2XLKA 5GMEA 2PT0A 2BOAA 2B0GA 1E6VA 2EFPA 2PN6A 3FVYA 1RK8A 4Y2MA 2XLJA 4RW9B 2E5LJ 3R7NB 1BQMA 1QTNB 3MMAA 1RTJB 3US5A 2RE1A 2Q6CA 2E1CA 3BV8A 1YKWA 3R5DA 1GAOA 4LSZB 1A0OB 1MMDA 1RAAB 1XTZA 1YX2A 2H4WB 2K7JA 1U09A 2MLXA 2UUWA 2AEMA 5LMNJ 2BBEA 1SVDA 1KFDA 3QSIA 4Q7AA 4U7UK 4BWJA 4C3LA 3K58A 1NJZA 2DH8A 1MU2A 4HVZA 1N8RT 1RTHA 3N6MA 3B6BA 2YWKA 4KHMA 1X5PA 1AYEA 3I5AA 3QJPA 2EK1A 4O44B 5B0GA 4QQBA 2FZCB 4ED4A 3DRXA 4KFBA 4WKRA 4ANEA 3JQMA 2FZKB 4QU6A 2WOMA 3SQGA 3VGSA 4EFAC 1LWCA 1H38A 1SQFA 1AFIA 3NP5A 3SFUA 3OD2A 2AV5A 3D54A 3LAKA 4W4MA 1D09B 1RHRB 3CCQS 2E1AA 4MK7A 2F40A 5CZVA 5KT7A 2MQQA 1NZAA 5DO2A 2R2UA 3BS9A 3N79A 1VDHA 4QWEA 3OVAA 1HARA 1TKXA 1J5EJ 1OO0B 5KT5A 2OMLA 4LFBF 5D8HB 1HHTP 1R8PA 2VFSA 3LP1B 1HR0F 1YSJA 1FKPA 3MTKA 5DM6Q 3EXCX 1N4LA 1UPPA 4KYZA 4QWBA 1RU2A 3BEGB 3H7HB 4M5IA 1V3ZA 3ZTSA 1FWPA 1WWHA 5M2RA 2NQPA 4FNHA 3W9HA 3RRHA 2FYXA 1DURA 3SYZA 4PXCA 3THVA 1FJEB 4CYUB 4A8KA 1XNRF 2OKQA 3RYLA 1DLOA 4AFFA 3SDEB 1N32F 2HHSA 1SV5B 3ETMA 2I9SA 2ASLA 2NUHA 3CDUA 1S1XA 4NA1A 1X4CA 3N9UC 2DGSA 3D0IE 1RTDB 3RBEA 2LQJA 3EICA 3LP0B 2YWWA 3BM7A 4LBPA 4NI2A 2MXYA 3NGKA 1FKAF 1NUEA 4B3SJ 4N7TA 1IUJA 2GV1A 4LF8J 2M3DA 1X4FA 2BE9B 4LSLB 4K4TA 4LSNB 3MOJB 4LREA 2M7SA 3W8PA 2ASYA 1VI7A 2UV8G 3M32B 4EO8A 2WSFC 5HVGA 1D0EA 2HQ3A 1UWBA 2MZRA 4E98A 1WSVA 4N41A 5IC4B 2VFTA 1SH3A 1IR2A 2XMTA 3CJTA 2MSSA 1S57A 3M9MB 4DL7A 3PW2A 4C48A 4HTIA 4DBQA 1E6YA 3WZ0A 1UVMA 3NS5A 1KKHA 1T9UA 3P5BP 5CAAA 1WSRA 2CIMA 5CCMA 3D6FB 3AJ2A 4Y0FA 2Z30B 1W25A 3JSMB 1T8EA 2AJ0A 1KSPA 5H9EJ 1YG0A 1W2BR 1UTAA 2CPFA 3Q8YA 1HA1A 2YKNB 3HT0A 4URSA 4WFXA 5IWAJ 2ASDA 1QE1A 3KLIA 2HFUA 3GYGA 3LP2A 1JJHA 1RT7A 1VHIA 2HLTA 3PKMA 1N54B 4K8RA 1FK9B 3MECA 1FDDA 5LT5A 2DKOB 4DCPB 1FX2A 3QO9B 5KFOA 4N56A 3HCXA 1RAJA 2BYCA 4CLUA 4FF4A 4DZDA 3MAAB 1HFEL 2D74B 4X4PA 2DRBA 4ZPBA 2R7XA 1F1BB 4EO6A 1JXLA 5J1EB 1TL3B 4NRTA 4N8NA 5IT4A 5T7LB 1SJ4P 5DGAA 1VRQC 1YK9A 4WF9Q 1IKWB 5EWFA 3KK3A 5FDLA 1XMQF 2UXCF 1U1NA 1KVKA 3TQEA 2OD6A 3VZHA 1HBNB 4ITSA 3G86A 1CULA 1CJKB 3U1NA 5DZ7A 3KNGA 2NYIA 4F0HA 5CYQA 5LSRA 4B3TF 4KE5A 1HI0P 4WXWA 2VICA 1DY3A 1WUUA 3I4HX 4PEOA 4NXMF 2H54B 4DV0J 3KWMA 5AE2A 1RWNB 2FJAB 2FJVA 1VQKS 3TX8A 2HHVA 3CCTA 3OSNA 4IDKB 3V5RA 3CO0P 2Y0BB 3C16B 4KGMA 4WTOB 5J1EA 4K0KF 2CWXA 3HHDA 2B56A 3F41A 1DJ0A 3M1VA 1ZA2B 4KGKA 1OQ3A 2FQQB 3CSKA 3TUJC 1VYAA 4LJMA 4LF6F 5EN1A 3CDWA 2HZAA 2W2NP 1CJUA 2VKZG 1VJWA 3AD7C 1KWMA 3A8EA 3CTRA 4LRBA 3UCGA 5KFYA 1HBOA 2V8PA 2BW2A 3FBFA 2O3DA 1NDLA 3NL0A 3C19A 1NK5A 5KFCA 5D3GB 2H5IB 2F4VJ 1KONA 1FRMA 2CQ2A 2GQ2A 2YKNA 1FFWB 1EARA 2F3JA 2VFRA 1K9MT 4E0DA 1DBDA 4RW8A 3BR9A 4WIIA 3QWUA 3M6XA 2HFVA 2WVBA 2DNZA 2PA8D 1VMBA 2XSJA 1CBKA 1VC0A 2DCUB 2VBZA 5A6PA 1X5TA 3CJKB 4HACB 1NSAA 1HQUA 1SJ1A 1REVB 1UFWA 5D4OA 1UVKA 2XO6A 1QLNA 2X1FA 4HHHA 4GMKA 5E3PA 3MAQA 4EEYA 1N5YA 1BE4A 1HPZA 1RHQB 2GC8A 4ZVQB 4FDFA 1KQKA 1U7LA 5LM7E 3CIMA 3TO8A 2XS5A 1UEUA 4EZ9A 2RU9A 4X62J 1RAHB 4J9PA 3PX6A 1TK0A 1VC5A 2F65A 2EWHA 3T6JA 2IAJA 5DLFA 2R2RA 1D8YA 3DLBA 2CKWA 4B3SF 1IQTA 4J9VA 2MKKA 1T02A 4MIAA 1WC6A 2YKPA 3FEXB 3H4BA 2QG9B 4MK8A 2RIJA 1Y10A 5KAKA 4X4VA 2HVDA 2VG6A 4K7QA 1SKUB 4NOHA 1JMTA 3R1HA 1C1CA 4OFZA 3SCIE 3X3UA 2VOOA 2Y8WA 2VA2A 4R0EA 3PEHA 2KKHA 4M1KA 1H0HB 3Q23A 2VQEJ 5A8KB 3ZZ0A 4K4VA 1ZM3A 4G1QB 2KYZA 1WG4A 2EFNA 5I42A 1VFJA 5HJXA 1FXRA 2CJQA 2HAFA 2QL5B 3DOKA 4YR2A 1T9XA 2ZVIA 2XNRA 2GVDB 4MYUA 3OV7A 3A3PB 4IG0B 4P2SA 2GX8A 3VAJA 3UCZP 4JV0A 2LEAA 4FBTA 3AFGA 3MWBA 2VC1A 1JJ4A 1HIYA 1K73T 3N4WA 5THWA 3JAMY 5L1IA 4B3MJ 3JQJA 3R5BA 1N33F 4I7FB 4LR7A 3G6ES 3IR5B 5BR8F 4ECQA 3EGVA 2L41A 4OHYA 4A8SA 1Q8LA 5E41A 3KJVB 4F4XA 1DQAA 2UU9F 2VG7A 3EVOA 3MMBB 1U4BA 2HGMA 1LNQA 2HFSA 3IAM9 1R0CB 2JC1A 3IM8A 4WU3A 4ZVOB 2J76E 1HW9A 2G0JA 1FNMA 2M2BA 2VPXB 1SCJB 3BGFA 5CD4H 1DTQB 1PIEA 4DQQA 4GO5X 2BJDA 4I4BA 5HQ8A 1E6VB 1R27B 1FD2A 2ZKUA 3IGVA 3M2RA 2B4PA 1GT8A 2BJ1A 2BXJA 3HSJA 4FXDA 4MKBA 1L3TA 1PGZA 2WVDA 3MMAB 2BA9A 3H2LA 1R43A 4WYLA 5LL6d 4DU8A 5IM0A 1WC3A 2XULA 4WPAA 3D28A 2VBXA 5K8MA 3M8PA 1NJYA 2MEWA 1JLFA 3RG6A 1UL3A 1VHFA 4LUBA 3VGUA 4RWXA 5HI7A 4AQYJ 1QAJA 4QYZJ 4BLGA 2VODA 2ZBIA 2DNYA 2AD9A 3DNCA 4URQU 2MMYA 4OYAA 5GAHI 1RTHB 1NCLA 3D68A 2DY9A 4TXSA 3TARA 2AQ4A 2FLNA 2XQCA 1BGXT 1QJHA 1YRUA 1RABB 5KT6A 4ZVGA 5HROB 1YRTA 4FBUA 4JI7J 2OH2A 1IKXB 1SKWA 2FPHX 3NBPB 2QTWA 1D9FA 3I5CA 3PCOB 2XY5A 2YH1A 2AF6A 2B6AA 2KG1A 3B78A 4GKJF 1QD1A 2X1GA 2QGFB 5GAGU 4WKYA 4CTAB 4H54A 2XMMA 1B0PA 5H9EK 2FVCA 1TVRA 2CNOB 2V2QA 1TAQA 1TL4A 2I38A 4DN0A 1VBKA 1LK5A 4OI2A 2V8VA 2B4UA 3GLJA 5HSPA 4YUDA 1XMOF 1M5PC 4NLUA 2QL7B 3ZZYA 4QOTA 3VAHA 4Y00A 1NJXA 1Q8BA 3NY0A 2Y1IA 1X9MA 4NI2B 3S6EA 4OYXA 1JIHA 5D3GA 2W2MP 5LMUF 1T11A 2LECA 3M8QA 4O3RA 3R5AA 4Y2KA 1SIWB 4YEAA 2GHWA 2ZHBA 2HKEA 2R7QA 1N36F 5ETOA 3G82A 1VIOA 2B8PA 2MDAA 2ZBRA 3MD1A 4NLXA 1F5AA 2BM0A 3MMCA 2HHXA 2F8EX 2VFUA 3UDCA 4A8XA 3PRDA 1N52B 1YJ7A 4OX9J 4C9DA 2ATCB 1U1OA 2Z4PA 3CJQA 3FC9A 3HHLA 1LV5A 4L6V3 1IBKF 3HVTB 2VA3A 1H3DA 1IBCB 3AOAA 4NYPA 2IYGA 2KG0A 3PV8A 4L3NA 4M8LA 2GJ2A 1CJKA 1S59A 2APOA 3KLHA 3W2VB 8AT1B 3Q2TC 1VIXA 2CQGA 3D67A 1NO8A 3D6TB 4RZRA 2IM1A 3T1HF 1R7IA 3SDEA 2R2SA 2OFGX 2ACYA 2I1RA 1NK7A 5IV3A 4P9SA 4J9UE 2D69A 3UN3A 4DFMA 3UPFA 4HHUA 4ECVA 4DJBA 5DDPC 2RRAA 3TAPA 1RYSA 1LXNA 1KDNA 3DDIA 3GZ7A 4NA3A 3EGZA 1FHTA 1WDDA 4PPZA 2LXIA 2D3UA 2HQIA 5C42A 1YZ7A 3RW7A 5KG4A 5HMYA 2IDLA 1MU2B 5HLFB 1ZPWX 2DHXA 4CLYA 2BX6A 3S1TA 1MG7A 3SQOP 3DLLQ 1RWPB 3PIOQ 3OL7A 3V4IA 2N7YA 3DRRA 3EZ5A 1I5OB 5KT2A 3S7RA 1FFGB 2OPRB 2ZHOA 2RT3A 3BPSP 3OR2A 4BBYA 1VQNS 1HKAA 1AFJA 2C2OB 1FWKA 1GXTA 3BO4A 5KFXA 4H4MA 3UD4P 2CJ9A 5ETVA 4CH0S 2KXNB 2ZH9A 4K4WA 2QLFB 2YNHA 2KXHA 1KBRA 4HLBA 4PG4A 3PHTA 4TLRA 1WORA 3WQPA 2W24A 1XNQJ 1A7GE 4TVAB 4U9RA 4DL3A 3A8IA 2MQMA 2DT9A 1F60B 2UU9J 4EBCA 3K5OA 1YWXA 2QT7A 2I6WA 3IFEA 5J1PA 3PW5A 3IMQJ 3O2IA 3QGPA 3I56S 2ZH7A 4OZ5A 2BABA 4ILRA 4YHHF 2GMHA 4ED1A 2J6TA 4B9UA 1NDKA 1N5VA 2W25A 2R7OA 5B09A 5A2QY 3GCWP 1YJVA 4CO4A 2E1MC 4IQMA 2HBYB 2HVEA 4WP3A 2P8IA 4RW7A 2R8KA 1RADB 2BEFA 2D41A 3MPWA 1K1QA 2YX7A 3ETOA 3PACA 3F0NA 4NCGB 3W63A 3CULA 1RACB 1VOMA 2DB1A 1PYTA 4PWUA 2JHEA 4EU0A 4DS4A 2U1AA 1CC8A 1EETB 1ELOA 3TJ9A 2R7VA 2C3YA 3R7BB 2V2ZA 2DJWA 5IC6B 2G1DA 2VHGA 1N5SA 1QM9A 3C14A 4RJVA 4HT7A 3OLBA 3KLGA 4F4AA 5JVGQ 3RB6A 1U1KA 3W65A 2VQFJ 5D0HA 1RHUB 3D1HA 1RDRA 4LR8A 1BQXA 2LP4A 1NPRA 1B0TA 4USVA 3TP2A 6AT1B 2IVMA 1MMLA 2PIIA 2HRUA 2YXLA 3DLGA 1OYDA 2IM2A 2QA4S 1S0OA 3HULA 1RTDA 3BSAA 3Q8VA 2Q43A 2HWIA 5AXLA 4ZITA 3PFEA 2LU2A 3J81Y 2JDJA 3POTA 2OPQB 4I67A 3ZTRA 1R31A 2FJEB 2OD4A 4KRWA 4JBCA 2B7CB 3LF0A 2IM0A 3GSDA 2UUCJ 2BACA 3OFFA 1JLQB 2OSQA 1HNWF 2BW7A 3AODA 4C8LA 3KLFB 2GMJA 2HAIA 1G6BA 1HQEA 3BN7A 1QUPA 4ECWA 1I6JA 1JNZB 3PG9A 4QWAA 1WG1A 2C2RA 3QIPA 4MYTA 4NXNF 4RR5A 4KH1B 2DISA 1TTHB 3GE9A 2XMVA 3OR1B 3J80U 1HLWA 3A3OB 2XHCA 4CO2A 1R0AB 1GMWD 5L1JA 1UVNA 4LFCJ 1S9GB 5LOQA 2EPIA 1H7XA 2F7VA 2JVRA 3POTB 3O5TB 4DL5A 1NEEA 3EGWB 4DR3F 3OFGA 5HVFA 1RWXB 3DOKB 3MOZA 4HR2A 2J0WA 2OI2A 4OYZA 4RW9A 1ZETA 2CPIA 1NB7A 3R2CJ 3G8TA 1SL1A 3DN9A 2UXBJ 3PO5A 2DNQA 4MAKA 1OSCA 1SI9A 2AYEA 1U8WA 4K50A 2BRLA 1ITPA 4P75A 2KL8A 2FJWA 3N28A 1SJQA 4P2MA 3MPDA 2MQNA 3CPWR 1YJTA 2H5EA 1HBMA 2D9OA 3AJ1A 3BYPA 2AJ4A 2HW3A 1H2TZ 1F2GA 2BJ3A 3FGVA 2GQQA 4IFVB 3T1YJ 3UDEA 3RAQA 2E5LF 2H4YB 2ZH1A 3CIZA 3KLVA 1B64A 2JRSA 2DPJA 4KB7A 1QSYA 1J27A 2GVDA 3TYTA 2C3OA 1XJWB 2BJ8A 4NLGA 2IIHA 2WK4A 1HQUB 1RA7A 2XYPB 5I3PA 2RNEA 4CDIA 2KO1A 1R89A 2U2FA 1FDNA 1Y7PA 1UWAA 2A0FB 3DM2A 3HSDA 3PNIA 3AD9C 4HL9A 1MW7A 1O51A 1GQEA 1VQMS 3NOGA 1HWLA 1BWEA 2WB4A 3L7UA 3BKFA 2IA0A 3KG4A 3MM9A 3NCQA 1YLXA 1TELA 4I69A 4KT0C 5LSLA 3OQ2A 2CPZA 4EBEA 3EM1A 2C2DA 2MB0B 4ZVEA 3UDLA 1YJNS 4B9LA 2H48B 3NGTA 2AJQA 3E2EA 5KFVA 4X66F 1XIQA 3KLEB 1SL2A 4USWA 1NM2A 3P49B 4USHA 3W61A 3FSXA 2B43A 3AXKA 3R97A 1QUVA 3R5GA 4ID5A 4BC7A 1AA1B 1T0TV 1XBWA 3CT9A 1YBUA 4O4GB 2BQ3A 1EP4A 1QDUB 3BR8A 3CJ0A 1FFSB 4FXWA 5BR8J 1S6UA 1RT1A 1VQPS 2FTRA 4M95A 1TP7A 4K4ZA 2VU5A 5KFSA 3CEDA 4ATNA 3RR8A 3NEKA 4P73A 1Z2LA 4PXBA 2DNNA 3FQKA 2UVRA 4BC9A 3RB3A 3DOLB 4DR7F 3J81U 4RNFA 4DSFA 3D66A 1I3OB 4ED7A 4WYWA 3HVWA 1CPZA 1AB8A 1RLDA 1VLOA 2W9CB 2FVQA 1VK8A 3C3LA 1N32J 2CQ0A 3BB5A 4U7UD 1U6ZA 1VQ9S 1T3OA 4FVMA 3GG1A 4EWTA 2N4CA 2CFXA 2RRBA 4OZ2A 5L46A 1PBUA 2C2MB 4ZPTR 1XQIA 4DG1A 5DLGA 3PR4A 2C1EB 5KFBA 5KFTA 5CABA 2V6AA 4Z2XA 5C2GA 4RNNA 4M5NA 3W9IA 3KUEA 3UD5A 3LWLA 4AL6A 4ELTA 2IY5B 3WX4A 4C3KA 4OZNA 1S6QA 3M1VB 3ZZZA 2VG6B 4JI7F 1WTFA 2BRKA 4L75A 1VBZA 2VONA 2HK2A 3QLHB 2L08A 2FGOA 1U2RA 4N77A 4P2FA 1TV6B 5FLXY 1JKHB 2R8GA 3WC2A 2QN6B 4ZVFA 1VJQA 5CQGA 3HFVA 4WBFA 5K8NA 1P9YA 4B3OB 1FE4A 3KK1A 3KOAA 1JB0C 1W7WA 3FZBA 4X84A 1RT7B 1WACA 2V34A 4KV8B 5H9FK 5J2NB 3Q0AA 2VBYA 4M5MA 2KT3A 4ZPCA 5T14A 1X9WA 4K5RA 3VGVA 2KZMA 4USJC 3HVRA 1HNWJ 2PSZA 3LANA 3BJYA 2MHNA 4QR2A 2UVUA 4XDCA 3M8SA 3DHXA 1V5IB 4DLGA 4X4RA 4M94A 1OJ4A 2HNZA 5IWAF 2SXLA 4DSLA 3KLHB 3GJTB 2CJBA 3GYXB 1NK0A 4NLPA 2KN4A 4LF5J 2VBWA 2IMWP 4IFYB 1TFWA 2EG1A 3TUZC 1S1TB 4WU2A 1S9EA 3MMCB 4HI1A 2P6TA 4JI2F
chains in the Genus database with same CATH topology
4B02A 1JLAA 1RT4A 3CDBA 4KBIA 3CCRS 1FERA 1Y3JA 3I9ZA 2RS2A 2MQLA 3SV4A 1JWWA 3VF0B 5KFFA 4OL8A 3BGRA 2XMUA 2QMXA 3WBZA 4F02A 2JFDA 4IH7A 1IQZA 3GMGA 2J6SA 4RNHA 2DGVA 1TKTB 2XI3A 1URNA 3KKFA 1ZM9A 2K3KA 1WHVA 2YKMB 4B9NA 1M5VC 3IO1A 3C6TB 4ZLPA 1KN6A 5F8JA 2R9LA 1BD6A 4Y65A 2OSRA 4A8YA 1DLOB 4Y2IA 3PW0A 3V6KA 2M5YA 4DSIA 3K8VA 1RT2B 5G0RA 1YTYA 4R8UB 2UUTA 3E3XA 3E8OA 3TR5A 2XC9A 2GNKA 3CB4A 2FC9A 3DC2A 5KFKA 5KFNA 1N0VC 2JSXA 5KFGA 1W2IA 2QO3A 1M5KC 1S49A 3DLJA 4I2PB 3V6JA 4DF8A 5KFJA 2FLPA 3H5XA 3GIJA 3PXGa 2RKIA 2ZBCA 4YOEA 2HVHA 3LP1A 2RU3A 4Y6IA 3JSYA 1S9GA 3O6QA 2G0CA 4C11A 3BQ0A 3WDOA 3PR5B 3C6UB 3KK2A 1YITS 2ZH6A 2QA4G 3IAS9 1WG5A 1P8GA 1X4HA 2C42A 3MEGA 3RBDA 3PO4A 1SJFA 3DLEB 3JYTA 4CH7A 1JJ2R 3H5YA 2V4RA 1LQ9A 3MFIA 3Q22A 2GIQA 3CE8A 2GO9A 1VQ7S 2GFFA 2Q6BA 2YY3A 3PHEA 4WCEQ 4Q44A 1U49A 3NNHA 4ZPVR 2RKIB 2DCLA 3FEZA 2MKJA 2ZH2A 2Q79A 2HHUA 4YMEA 2HHQA 2QMWA 3CC7S 4FS2A 4B08A 2JLGA 3RAMA 4B9SA 4YR0A 1HYSB 4EYIB 1T7PA 1JLEB 2DGWA 1C0TA 1KOOA 2DNPA 3UQSA 1LOUA 2O67A 1N6QB 3LGNA 2K2PA 5BYRA 4LFAF 3UI3A 5EHHA 3NMRA 1WF2A 2HVIA 1OS5A 1NU4A 1BC6A 3OHAA 4C4WA 2VC0A 4X65F 1YJRA 5KG5A 2R7UA 2DGQA 1UP1A 1HNVA 1MROA 5DG7A 4PUOA 2AX0A 3KG1A 5L8RC 3SMZA 2OO4A 3CDAA 3BDPA 4NZ0A 4ELVA 3MM6A 1DTTB 3GFYA 3TI0A 4H4KC 3IRWP 1OPIA 3AA9A 1C0TB 1H2UX 2RF2B 4Y2AA 5CZXA 3FDSA 5C25A 5E7OB 2I5JB 2DGUA 2Y0SD 1HWUA 1X4GA 2WAQD 3OTBA 4KKOA 1QAXA 1HBUB 1OQ6A 2ZVSA 3OLAA 2LMIA 5DDQC 4DS5A 4C98A 2HHHF 2XB2D 4B3MF 1FF2A 1NK8A 3TQ1A 1AXQA 3GR1A 1DAXA 3GG0A 4X4QA 1SXLA 3OTEA 5LJ3Y 4F4ZA 2VPWB 1CG2A 5EX0A 4OI1A 2MYFA 2E1RA 3CD0A 3SSQA 3FCHA 4ALZA 3FSIA 1JKHA 2ZZNA 4IRKA 2NXUA 4DFKA 3KK1B 2FDNA 3HZEA 1S6QB 4JI0F 2YKOA 3D2WA 1CSJA 4UOCA 1DARA 2DR8A 5KFEA 2CPEA 1QAYA 2YX4A 4NWBA 2VQFF 5A8RA 3EZUA 3BQ1A 2O01C 1LWEA 4QWDA 4RNMA 2RRNA 4TU9A 5JXSA 5KFIA 4ZCIA 4BCAA 1WEYA 2RMLA 2J5AA 2JFKA 2N3OA 2XI2A 3PKYA 3QAEA 3OTOF 2MZQA 4IG3A 1BQMB 3SFGA 1WNEA 5KT3A 1U6FA 3I32A 4O4GA 2HNDA 1ZM4A 2F9DA 1BQNA 1LKZA 4U67Q 1FRHA 1KTQA 3M2VA 1RT3A 5A0YB 3MR6A 1KD1T 4AUKA 4OI0A 5L1LA 4DL2A 4PQUB 2DHGA 3I0RB 3G9CA 2P9EA 3VZIA 4CH1A 3GB0A 1HI8A 4F4KA 3NCRA 4LVOP 1D9AA 2XSJB 1Y0HA 2M8HA 3W2WA 3TOQA 3HMJG 5KFMA 4OX7A 4WTYA 3LGMA 2VL1A 4OLOA 3HK2A 1KVJA 4QR1A 3OVBA 3TUIC 1EP4B 2XHWA 1NH7A 1TVRB 1J5OB 3OFHA 1X4AA 3MM6B 4LT6A 5F3TA 4FVCA 4OX9F 3IN5A 4PR6A 2QE5A 2OTJS 4LSNA 5DGBA 3MI7X 3GWCA 2AWZA 1RT5B 2OPRA 2XBPA 2FJXA 4OJ1A 5JVHQ 3T5KA 1NKCA 1SH2A 1FRJA 1PO6A 4ZDNA 3T5JA 1WI6A 2HS4A 5DRKA 4WFBQ 2XLIA 3BO3A 2DVIA 1RI7A 3F44A 4K2XA 1NJWA 4FN5A 1WHWA 1N6QA 1Y9OA 2B51A 3PFOA 5L39A 1M1KT 5EDWA 4JI4F 4YB7A 3OXGA 4KV8A 1P6TA 3ISZA 2CDQA 5I3QA 2AGQA 2ATLA 3L7PA 2H9ZA 1DHMA 4DV0F 5KG1A 4JI5F 2OLWA 4IFVA 2EW9A 5A6WA 2J6UA 2DH7A 1U1PA 4OHWA 2HZCA 3KK3B 1TK8A 1GX5A 5F9NA 4B17A 1S1VB 4YY3F 3T5LA 4JI6F 3K0JA 2X3GA 3ULHA 3HXMA 2LQ9A 4RW4B 2R8JA 4U7CA 5B0BA 3OR1A 3ZZPA 2DD8S 1O0PA 3IRXA 2MZTA 4I0WA 5FDLB 4IG0A 2PMZD 2V2KA 5CYJA 5J2MA 3EGNA 1WELA 3N6LA 3OFEA 3DLKB 4Q8EA 4ES1A 2EVZA 1HMVB 3QWPA 2ADCA 3KJVA 1MWZA 4A48A 1QVFR 2LLZA 1CQNA 3H2UB 1S77D 2J0XA 1C1BB 2M52A 1PC5A 4MMOA 1ROFA 2V4JA 4V19X 3SEOA 3X1LB 4RU9A 2DNMA 4O3SA 3M2UA 3HM9A 1HI1A 2PO4A 3IWXA 5HMXA 2NPIA 4JYAF 3JTNA 1KTVA 2KYXA 2YH0A 4V19J 5KG2A 1HNVB 1MROB 1B0VA 5KG7A 5A8KA 4ZKAA 5U47A 2ZH4A 1IKVB 4QPTA 3AB2B 4O44A 2OJ3A 3PW7A 5AXNA 1FCAA 2B5JA 2D3ZA 4DOZA 1VK3A 4IH5A 2WHOA 2GQCA 3PX4A 1KHVA 2WCXA 4JI3F 3VTIA 1APSA 1XMBA 2MJNA 2HNYB 4R8UA 3Q8PB 3DU5A 1JLCB 3EPIA 3NBPA 2LA4A 4C8MA 4YB1P 1ZM2A 4YB6A 2VPZB 3MEEA 2EI5A 3CJKA 1VRUA 4QIEA 2NSCA 3DRSA 4TQRA 1VQ5S 2JX2A 2NPFA 2OFHX 1URRA 2DNGA 1S0NA 2JEGA 4NRUA 3U1LA 2IYIA 3BSNA 4DL4A 3QJLA 3H8YA 4LF5F 1M5SA 4G1PA 5J2MB 3RZAA 4OJGA 4PRFA 4AXJA 1J5OA 3MEGB 3EPGA 3R5CA 1NKEA 1ULRA 2K1RA 1K0TA 2YX1A 1RT6A 2DHAA 5HMZA 2DR9A 4RBUA 2JOQA 3HHKA 4RW4A 1T3NA 2CPXA 3QZ7A 4ECYA 2KB2A 4CNYA 2BQUA 1FNOA 2DGXA 1HBNA 1R6YA 5KFRA 3HVAA 1XN9A 2N4DA 4F25A 2FD2A 2J7UA 5DQHA 1MMNA 2B3TB 3OHBA 3LOUA 4OX6A 5IZHA 4JI1F 2E44A 3CUNA 4WZMA 5E5NA 3T1YF 2IFXA 1IJFB 2BV3A 2V5HG 1GNKA 1Y5IB 3KG0A 4F3MA 5HO4A 3T3FA 2QSWA 3RB0A 3B4MA 5MAOA 1VGYA 3BREA 3DRRB 4HT5A 3TAQA 2AGPA 4TQSA 3LAMA 1G3OA 2CZ4A 4DV2F 1VQLS 2JEIA 4K4UA 4X4TA 3MM7B 2X1AA 2WRMA 3I96A 4K5SA 2BDPA 2RQCA 2GW8A 1YJ9S 1WTBA 2J9EA 1KR4A 1R8AA 1CVJA 1LK7A 3UFCX 2CPDA 5HP1B 2G13A 2QLWA 5L38A 4TKTA 4QPXA 2CQCA 4FS1A 2RF2A 3PM9A 3T6BA 2AYBA 4EYHB 4HH1A 1FVSA 4IOAQ 3QPIA 4PWDA 1RT4B 5ITHA 1YQHA 3Q8RB 2G4BA 5D4LA 3L3CA 4O4RA 4QR0A 2ZE2A 1A6LA 5LXRA 1YHQS 1VQSA 4UUXA 1UVIA 4NYZA 3J7YI 1IBMF 3NLCA 2K3IA 3T19A 2ZOFA 2HHWA 3M4XA 1NK4A 4RW8B 3ZC4A 3CF5Q 3EXYA 1GXUA 4ZP6A 2JLFA 3FFIB 1M5OC 1VQ8S 3M8QB 4ZOSA 3E01A 1P1TA 2FHKA 4ZPAA 2HMIB 4NMLA 5C24B 1TV6A 3H59A 4NLSA 4WXOA 4J37A 2LXUA 5I4MA 1HWIA 3K5PA 3DDNA 2LXFA 3MMJA 2KJVA 4X62F 4GC7A 3OJSA 5A8RB 3MHYA 4ECTA 4I2QA 2Q3PA 1F5BA 5KOXA 1IM4A 3LUYA 2WW8A 1U48A 3R3TA 1GXLA 2YNFA 3JTPA 4YDDB 1UA1A 4IRCA 1SJRA 1KEKA 4AL7A 3IRXB 1VQ6S 3HHLB 4GKKF 2DGOA 3O1LA 2VV5A 2YWHA 3L7OA 4IH6A 4C3MA 2P9GA 2MGZB 4GC6A 3NNCA 3HT3A 5D4PA 1LWEB 3G4SS 4X4NA 3HP6A 2O66A 1X0PA 3KMQA 2AX1A 3UCUP 3H40A 4F4WA 4JOUA 5T7LA 1O5JA 3PEJA 3HLUA 1U1RA 4I64A 1QSSA 2UUBF 1DTQA 2V0NA 4P7VA 5B0DA 3N0VA 4KKOB 2RILA 3OBIA 5FJ4A 1XR5A 4XPEA 2ADBA 1U26A 2XS2A 3CD7A 2RQMA 1AW0A 3KLFA 3H2VE 3HHNB 3W7BA 2YNGA 3U1MA 1U6BA 4KHPF 1RKIA 3NRBA 2I0XA 1KNZA 3I0SB 1QE1B 1Q78A 3KLIB 1S0MA 4IR1A 2ZHAA 2A10A 4TU7A 1S1WA 3CCWA 4FZVA 3VAKA 3L95X 1WF0A 5HN0A 4WJBA 4ED2A 1ZETA 1IN0A 4QCLA 4PKDB 2IVFB 1PC4A 1VBXA 4C0OC 5EWEA 1QTMA 2ZZMA 3DYAB 3N01A 4QW8A 5HMWA 3V81A 3DU6A 1G2EA 2FY1A 1SKSA 1FRLA 2OPQA 5A8WA 1RTJA 4R0JA 5H9FJ 4B9MA 1JLGB 1S6PB 3VAIA 4XAKA 4K4YA 4MTPA 4B9TA 1VS3A 2CQ1A 3HHEA 4CO1A 1XWLA 1M0SA 2VPYB 1S48A 3T9ZA 2DIUA 2A2DA 2D1CA 3GV5B 3M2UB 4ZP7A 1K8AT 1FESA 3M32A 2CVIA 4TY8B 1R3NA 2HWTA 5KG3A 2AJ1A 3TA2A 4TU8A 2IRYA 1YGYA 3I0RA 2IRUA 2Q1LA 2XMKA 2YKQA 3ONQA 4CO0A 1IBLF 4C8YA 3SSRA 2EFQA 4FF3A 3MUVP 3DRPB 1KVIA 5KFWA 3DFEA 1FEHA 4ETZA 3V6HA 2LQBA 3ISNC 4PWDB 3BZQA 7FDRA 5KOWA 1U2FA 4RW6B 2N7CA 2UV8A 4ZCKA 3CXCR 1N48A 4QW9A 3NGDA 2XWYA 3MAHA 1WEXA 4F26A 2KM8B 5DS7A 2JL9A 3KHHA 2HHTA 2XMWA 3IC1A 2WSCC 1U24A 3F56A 2E5IA 4LIRA 4OJHA 4TNOA 4RUHA 1K1SA 2CJAA 2L9WA 2YNGB 4W92B 3CDEA 4H4OB 1G7CB 1T05B 2KM8C 3FJ2A 2P9CA 1L3VA 5D77A 4MIBA 2ZC3A 4WZQA 2M4MA 1YRXA 1HNXF 2CYYA 5CYMA 5D6GA 1TL3A 2CZVC 4DMZA 3IR6B 3C8YA 5AE1A 3OXLA 3TVKA 3VQTA 5IXUA 1T95A 3ICLA 3MUMP 3G6XA 4I6YA 2CJKA 2PI5A 2V9WA 1S6OA 2IAJB 1DZ5A 2YTCA 1ZH5A 1FRKA 1A9NB 2LQ5A 2MJUA 2VZ9A 5KFUA 2JEJA 3NS6A 3C66A 4C8OA 1VQOS 4MKAA 2HNZB 3PRBA 4NCGA 2WBMA 4DQRA 2IBOA 3THTA 1RT6B 1TZ0A 2YWEA 2DGTA 4RBTA 4C8KA 5F8GA 3DLHA 1Y00A 4H4KA 4IOBA 3KFWX 3RRKA 2MZ1A 4P6QA 4WK1A 3DRPA 5K14A 2EG2A 3UR0A 5J1NA 3HKZD 2E7XA 4MFBA 1RKJA 2F4VF 1JXEA 3OTCA 4UUWA 2YWFA 1HBOB 4NZ7A 1AROP 1LW2B 2C2EA 2LYVA 2ZH5A 3GFHA 4KTQA 3IWNC 1C0UB 1VRUB 3K5MA 5E3CA 1Q53A 1L5UA 4ICLA 2OTLS 4RBVA 1UVJA 1FJ7A 2B9YA 4FPRA 3KLEA 2EFOA 3HI9A 4I56A 4O3PA 2ERRA 1SKRA 3MM5A 3QGIA 1KQSR 5HBMA