2W57A

Crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
publication title Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Metal transport
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w57A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2w57A02
4FX0A 1S3JA 5AONA 5F1RA 2IP2A 2JT1A 1ZRCA 2DPDA 4HLXA 3IC7A 2EFNA 4I0AA 4KN4X 2VBWA 1ZYRF 5DEQA 3LQRA 2VONA 2M45A 2BBYA 1TLHB 3WTSC 2EFQA 3WU0A 3WGGA 3E6DA 3JTGA 1JHHA 1WQ2A 3QAHA 1LEBA 2E1NA 1HW2A 4JK1X 4EMSA 2YX7A 3K2ZA 1TNTA 2O03A 1Z9CA 2BV6A 3DFGA 1KA8A 2BEOA 5ICFA 4EGYA 4GYIA 1DPRA 1BIAA 2XV4S 2FNAA 4O6JA 2HDCA 3WG9A 1K79A 1ZAOA 2LNBA 2MH2A 1GXQA 3K1PA 4RB2C 2GZWA 1PP7U 3CLOA 2Z3YA 2VXZA 3E3VA 3B02A 2XAHA 2OAZA 2XASA 4KMUX 4XSXF 2K4BA 3Q9SA 1DDNA 2IA0A 2B0LA 1XCBA 2OU2A 5E1XA 2O8XA 1D3YA 3HUGA 3U1DA 1G4DA 1KU7A 2D45A 2QUFA 5KVRA 1W4MA 3K1NA 2D1VA 1J7KA 1QZZA 2HFHA 1R22A 4R1HA 5ILVA 3FM5A 1R23A 4M71A 1LVAA 2FOKA 4I09A 1W5TA 1IXCA 3V4GA 4OIOF 2BYVE 3ZMDA 4LD5A 1T38A 2TDXA 4EQQA 4EJTA 4HYEA 1FBSA 4EV0A 1U5TA 2VE8A 3GLXA 1R7JA 1JHFA 2LKPA 3J81K 3M8FA 2EWNA 3N97A 3MFKA 3NEUA 3CTAA 4RGUA 4HX7A 4N9IA 5HDKA 5IT9K 3KP2A 5CJ9A 3BZ6A 1E17A 2DT5A 1XGOA 2OQRA 3MEXA 5K5OA 1J0RA 3L00A 4BHCA 2EK5A 1ZGJA 3CJNA 1FNNA 1FBUA 5A2QZ 5FLXZ 2OZ6A 2P5VA 1I6XA 3QOPA 4HAMA 3BDDA 5LEJA 1VTNC 4UVBA 5H6QA 4HDUA 3TQNA 3S2WA 4IF4A 3KP4A 1B6AA 3LAJA 4KMFA 3O2PE 1U5TB 3MWMA 5J8CA 4UUVA 3DPLC 3TDUC 2OQGA 1W7PD 4I0BA 3C18A 4L0YB 3P9CA 3WGIA 1J5YA 1OYYA 4ETSA 2MD5A 3SZPA 2KJBA 3U2RA 4AIHA 2HZTA 3HRTA 3KZYA 5LRRA 2ESNA 5L3EA 1DP7P 1XDUA 3WTUC 2J5OA 5H6RA 3RKYA 3BWGA 3WTWC 4HBLA 1ZG3A 4YFKF 1R58A 5KK1A 1YW7A 3V8JA 1O7FA 4Q47A 2RDPA 4NB5A 3ZMUA 5TRDA 3FXQA 3HRMA 2K86A 2EV0A 4M6XA 4WXHA 2VOPA 4MNUA 1OYWA 2QQ9A 5E1WA 3F72A 3I64A 2ESHA 2UXNA 3WGHA 4CHUA 3I53A 2DTRA 4L5JA 4GCVA 2PN6A 1KQ8A 2LF8A 4IXAA 3FMSA 4LLGF 3IHUA 3F8MA 1XN7A 2NAZA 4CO8A 1ZH5A 2L4MA 3LA7A 5L3CA 3MQ0A 2RNJA 3ERED 5J6XA 3BJOA 1GVJA 3KCCA 4L9NA 5E20A 4KICA 3KZZA 3DPTA 5CVJA 4LGWA 2W84A 1F5TA 1B59A 3J80Z 4I98B 2IT0A 2ZMEA 2H6BA 2O0YA 3BOQA 3PFIA 5LRSA 4ZYHA 3V8KA 2XAGA 3VB2A 2A6EF 4AIKA 2HEOA 3F8BA 2VC0A 3DQVC 2QM3A 1JE8A 3E6MA 2DLLA 3EETA 1QQIA 5DCMA 5ILSA 2Q0OA 1L3LA 4LB5A 5DV5A 3OV8A 3R61A 1WKMA 2ZKZA 2Z5UA 5LHIA 4B8XA 3T5XA 2FF4A 4PCQA 3IRQA 5CLSA 4YFXF 1IXSB 2QQBA 4UV9A 3N4MA 2E1CA 2Y75A 4O5VA 4BAYA 1XMKA 1O57A 1P92A 1TQIA 2DQLA 4QLCU 3ULQB 1YYVA 3E6BA 1H9GA 4MTDA 1LB2A 5EEGA 1DUXC 2A61A 2QYOA 2IVMA 1B9MA 2STTA 5E1ZB 2V1XA 3T8RA 2EV6A 4M72A 3HHHA 4CDGA 2JRTA 1KYZA 4XBFA 2DQRA 2G9WA 3I58A 4UVAA 4L9TA 2ZMEB 1MKMA 4RB3C 1IUYA 3IKTA 1T2KA 2Q2EA 2QZ8A 5K5RA 1XDSA 2GIVA 2K27A 1R5GA 1LNWA 5DCMB 1U5TC 2L4AA 2HR3A 4YIFA 3BP8A 1QZYA 2P7VB 4PDKA 3F3XA 1S8NA 5CVIA 1O7LA 3E97A 4F7ZA 2V1DA 5D5XB 2CSOA 4CXFA 4YFNF 3GZ6A 1S29A 3K1MA 3CO6C 1QBJA 1K6OA 3TO7A 2PI0A 1Z1DA 4XSZF 5HS9A 2NRAC 4ESFA 3REOA 2IPQX 3GX4X 4NHJA 4P96A 1S7OA 1MJBA 1IN5A 4UVCA 1R5HA 3IKVA 1FSHA 3SHFA 5HLGA 1YG2A 3MCZA 1LDDA 1XMAA 3GZ5A 3SXYA 2XIGA 1X3UA 1XB4A 4H0EA 5LGNA 2MBFA 1ULYA 1FC3A 3HRSA 5DD4A 1HKTA 2ISYA 3G73A 5FD6A 3F21A 1ODDA 3IWFA 3C1DA 4R79A 4P5OA 4WCGA 4HX8A 1V3FA 1P4WA 2IRFG 3GW2A 1CGPA 2D2WA 4PGGA 2QBYA 3Q9VA 2P8TA 1FYMA 4I01A 3V7CA 2XVCA 4M74A 1UCRA 2D1HA 1KU2A 3DP7A 2RKHA 3BJAA 3VODA 3WODF 2V9VA 2VBZA 4GXOA 2DBBA 3EQLF 3D0SA 2W24A 1ON1A 3MAJA 1XSXA 2CGPA 3RPQA 1MJAA 4ZYDA 2PLYA 1YQAA 5LBQA 1K78A 4IHSA 2LF7A 4WX9A 4L9VA 3GXOA 1BN5A 4DQ2A 3P9IA 1C0WA 1HKQA 2PMUA 5L3DA 4BYYA 2VT2A 2ISZA 3I59A 2QBYB 1ZGAA 5D6EA 2H94A 3TO6A 3CUOA 2PQ8A 4OINF 3ZP5A 3K69A 1FT9A 4KDPA 4WK8F 2XGXA 3JTHA 1QO0D 2FQ3A 4BQAA 5BPDA 2PG4A 2RVCA 4ZZDA 4IRIA 2FXAA 5E17F 2VBYA 5ICGA 1IN4A 5AIPA 4OU0A 5F64A 2DW4A 1KGSA 4M73A 2XAQA 3TKYA 4XLNF 4RB1A 4QWQA 5DD8A 1K78B 5TJJA 4AIJA 3VOEA 4P9FA 1K7AA 3QPTA 1CF7A 3F22A 3RYRA 1FP2A 2RN7A 1BC7C 3I59B 5D5VB 1U78A 1XCVA 2AS5F 1FYLA 4CZZA 2Y0MA 1OPCA 2VODA 4GYGA 5LLQA 2COMA 4ESJA 3HRUA 4L9JA 4AD9A 4U7BA 4U0VA 1MJ9A 3FZVA 4EJUA 3R6SA 1P6RA 2NNYA 2IA1A 1RUOA 3BPXA 1JGSA 1KYWA 2MC3A 1ZG1A 1Q1HA 3ISPA 2JZYA 3F6OA 1RIOH 4XRFA 2EA2A 3V7SA 2OA4A 1MGTA 4I7HA 3LFKA 4U88A 3ABUA 2FNPA 1SD5A 2ETHA 5D4RA 3CUQC 4HOBA 3EYIA 1RUNA 5FB2A 4XLPF 1MZBA 1CF7B 2VOOA 3ECHA 4AVPA 1IRGA 4GO1A 4LJZF 2GA1A 5AIQA 2GAUA 4Y17A 2XRNA 1T0FA 4U0YA 1G3YA 2E7XA 4KNYA 1IW7F 1YFHA 2MLKA 2P7CB 2X4HA 5CVRA 1EH7A 2G7UA 1QNTA 4G6QA 2ELHA 3KETA 2J5PA 1TQMA 4RGRA 1SD7A 3I0TA 3AAFA 5CVVA 2R7FA 4ZH4F 1BI3A 1BM9A 4HV5A 4LG0A 4CGZA 4G7OF 3BPVA 4LLLA 3V7RA 5LHHA 5J8FA 1RI7A 2L3DA 1XSVA 2QVOA 4GGGA 3MZYA 3T8TA 3DKWA 4MGRA 1U3EM 3C3WA 4Q48A 5LGTA 1HW1A 3SQNA 3KLOA 2HTSA 2ACJA 3R0JA 1YW9A 5CVUA 5DUKA 1Z6TA 2ZXJA 1FLIA 2DAOA 4D0PA 4AWXB 1SFEA 3FXRA 4FT8A 1T6SA 3LAPA 4KIFA 3R4KA 4WWCA 2K7LA 4LG0B 1ZLJA 1YTYA 3E6CC 4K2EA 2UXXA 2RQPA 2Z33A 3F8FA 2KKOA 1B9NA 2M5WA 5K5QA 2QQAA 1YS7A 2H09A 2GQQA 4MEXF 1HSJA 5ED4A 4ENNA 4LB6B 5DYMA 3F6VA 2PJPA 2DK8A 4N9HA 3ZN1A 3LSTA 4ZYEA 1LQ1A 4LFUA 3ABTA 1SMYF 1SMTA 2HQNA 1O3SA 3DF8A 3RDIA 3IRRA 1SD6A 3FM3A 2F5DA 3RJPA 1BJAA 5ILUA 4IRHA 4PGHA 1F4KA 1IN6A 3GFIA 3ML6A 2V6CA 1R00A 2A3SA 1J59A 4G7HF 1DPUA 4RGSA 4ZZLA 1SFUA 2AXLA 3G3ZA 1P4XA 1BI1A 2M1BA 3M8EA 2HGCA 5DDGA 5ICEA 2CWEA 4KUMA 3H3ZA 4Z2YA 3KE2A 2R3SA 4UHTA 4EVIA 3E5UA 1UHWA 1KQ9A 3DV8A 1IRFA 2HYFA 1XGMA 1HBXG 4RAYA 2QWWA 2RGVA 4MHGA 1EH8A 5IT3A 3SFZA 2DU9A 2YR2A 4OIPF 3RKXA 1XSDA 1KQ0A 3LA2A 2KJCA 4EJOA 2Z99A 1E2XA 3FX3A 1R1VA 3GFJA 2HWVA 4HF2A 5F6FA 4HA8A 1O3RA 2OD5A 4M9SA 1ZHFA 5FO5A 1BBYA 3RIRA 1G3SA 5L3GA 2MLGA 4M6YA 5HS7A 4Y15A 2L54A 1JXSA 3F23A 1ZRFA 1RZ4A 2YX4A 5E18F 2LDUA 1XGNA 3JSOA 3KEOA 4P9UA 3QU3A 2HKXA 5FD5A 4OOIA 2JTVA 2DK5A 4EJWA 2HOEA 2ZFWA 1P2FA 3I5UA 3CUQA 2RC4A 4M9ZA 4HZFA 3TOAA 2PEXA 3O6BB 4KA4A 1IXRC 1IZ1A 3C7JA 1WWXA 3GUDA 4Q4ZF 3ZPLA 2E7WA 4ZYGA 1HSTA 2CG4A 2VT3A 4IRGA 3J81Z 4U7DA 1GXPA 3LQQA 5FGMA 3KP5A 3M7GA 1Z6RA 3HHGA 5A2QK 2GXGA 2YU3A 5FLXK 1S6LA 4UNOA 1TNSA 3ELKA 1WI9A 5HDNA 1FX7A 3VEPA 5HVQC 2EFWA 3HSEA 3RPUA 2FE3A 1AOYA 4BNCA 4UXNA 3T0YA 2K02A 4BHPA 5E8GA 3ZMSA 5CYVA 1WRJA 2XHKA 4IVNA 3NRVA 5D4SA 3Q5FA 2OZUA 3CUQB 3ZMTA 2KIFA 1T39A 2PMHA 5LEKA 4KFCA 3M1EA 3HTSB 1H9TA 3FMRA 3J7AO 3HTUA 2JPCA 1KU9A 5L3FA 1J75A 2FU4A 1J2XA 1IF1A 3TO9A 2CFXA 2F5CA 3H3UA 3GYHX 1F9NA 2IJLA 4OMYA 4RAZA 2W57A 3HOTA 4ESBA 2YPRA 1KU3A 1L0OC 1QPMA 3L9FA 1OKRA 1ZREA 3WTZA 4A5NA 3WTXC 2XKOA 2DFIA 3KP7A 3FXUA 5D6FA 4IHTA 4S05A 3R60A 1UHMA 2JPBA 4KIBA 5E8IA 1W5SA 1T98A 4IJAA 5FFZA 3FHZA 2RV8A 3GFLA 2EV5A 4A6DA 2UWMA 4CICA 3J80K 2NS0A 1FZPB 2EB7A 4DNCA 2VC1A 3F8NA 3P7NA 3FWEA 4HF1A 4M9XA 3ZMZA 1D8KA 2HQRA 3GWZA 4KYWA 2BGCA 3CO7C 2GA2A 4G8XA 5HLIA 2FA5A 1NHAA 2CW0F 1EV7A 2A6HF 4MQVA 2VBXA 2ADUA 1P4AA 3RI4A 3WTVC 2MH9A 4HW0A 4HX4A 2FRHA 2JSCA 4OIRF 2P5LC 3V8LA 5BMZA 2EJRA 1YW8A 4L5IA 3HYIA 3GO5A 4LK0F 1AWCA 4LLNA 2QENA 4A6EA 3IL2A 1B4AA 5BQTA 1MDMA 3I4PA 3ROUA 4OIQF 4YG2F 1ZG5A 3WTYC 3K0LA 3DXJF 2V79A 2PBIA 3HOSA 3W6JB 1OR7A 2F5EA 3KLNA 1PDNC 2A5YB 4WXCA 2X0LA 4N0BA 2DI3A 1J9IA 4EM2A 5JI6A 2Y48A 3BJ6A 4G94A 3GEZA 3L2CA 2CYYA 1BC8C 3L09A 1A04A 4I2OA 2GXBA 1G3WA 2A07F 1FSEA 3OOPA 4RB0A 1FY7A 1ON2A 2ZO4A 4WF2A 5K1YA 5HDGA 2HKOA 4OMZA 1BIBA 3BROA 2NYXA 1SFXA 2XAJA 3B73A 1REPC 2HS5A 4YIIA 1OMIA 1FP1D 1USTA 4G6DA 3BY6A 1MDMB 3E5QA 1S7AA 3WE3A 3WTTC 3TDZC 5BPIA 4ENJA 1QGPA 4G7ZF 1HW5A 1HKSA 3H92A 4HQMA 2FBIA 5JHUA 2A69F 1ZN2A 1Z05A 5JVTA 2ZNZA 4U0WA 2FEZA 1TQPA 2O6GE 4A2UA 2FSWA 2VN2A 2WV0A 3ZMVA 2H27A 1BI0A 2LSOA 4IPAA 2P4WA 2XUBA 1UB9A 4L0ZB 1ONVA 3GVAA 2IW5A 2W25A 1I5ZA 2W85A 4CYDA 1ZRDA 4PZJA 3RKWA 4NQWA 1TBXA 3FF5A 2FMLA 1RNLA 2FMYA 1O3QA 4EM1A 2OBPA 1U8RA 2EFPA 1IN8A 2WC2A 4MEYF 4MTEA 3EYYA 2Z9OA 3W6KB 3ECOA 5D5WB 1Y0UA 4KT5C 3ZQ7A 3JAMZ 2WTEA 2XROA 2L01A 1D5VA 2P6TA 2KIUA 3GFMA 2HTJA 4TV7A 3I54A 2KRFA 3QRFF 1FWZA 3O3KA 1BOAA 2DO7A 4ASNA 1W7PA 3TGNA 4HQEA 4BHBA 2R7DA 5DUIA 4P55A 2FBHA 4BXUA 3M9AA 1I27A 2O3FA 4I02A 4A5MA 1HXDA 2IA2A 5FFXA 5H20A 4MQ9F 2NNNA 4JBAA 3E5XA 1LJ9A 3K9TA 4B09A 4EGZA 2ZBKA 2ZCWA 2F2EA 2ZJ2A 4JQFA 4FHTA 1FPQA 4G9YA 1TW3A 4Q5SF 1G3TA 3JSPA 1Z7UA 5BS6A 2F5FA 3QP6A 1TTYA 5DCFA 1FOKA 4L18B 3T1BA 5BOXA 1W7PB 2M8EA 4WXDA 2PFBA 1GHCA 4EJVA 2GWRA 2Q8KA 1F1ZA 3DEUA 1LDJA 4EM0B 3HIFA 5HOOA 2ZNYA 2P5KA 1H0MA 3PQJA 5LHGA 3LA3A 5EEHA 3TOBA 3I71A 2C6YA 1SD4A 1U6GA 6PAXA 3D5LA 1LEAA 1UFMA 4KN7X 4ENMA 3CDHA 1PP8F 2BE5F 3RYPA 3LWFA 3PQKA 2WWYA 4A0YA 1V4RA 4HDVA 3GF2A 1O3TA 2M87A 2G7HA 5LGUA 5L3BA 1WSUA 3RTRA 4A0ZA 1OYIA 3KEQA 5D8LB 4ON0A 2L02A 3IWZA 2O61A 4LK1F 1Z91A 1U2WA 1USSA 5JR3A 1XGSA 1ZARA 4O3MA 5D8KB 1STZA 4A12A 1SAXA 3WE2A 2V1UA 1R1TA 1XD7A 2CQKA 4A0XA 1HQCA 4HLYA 1LDKB 3ZN0A 2MA3A 2STWA 5JFRA 2YSRA 1I1SA 3F8CA 3QPHA 1EH6A 5IT9Z 3VFZA 2M30A 2H6CA 4BH9A 1ZLKA 1D8JA 3WU1B 1IAWA 4HV6A 5D5UB 1B1BA 1MD0A 2DPUA 2HYGD 2VE9A 5ERIA 3FMQA 4HF0A 2QLZA 5ICCA 3MZHA 5HS8A 1YS6A 1YO5C 2FBKA 4R8HA 2P6SA 3L7WA 2XAFA 4Y13A 3JW4A 3QU6A 3COAC 1YIOA 2KIMA 3EDPA 1IN7A 3HSRA 2EA4A 3QP5A 3KP6A 4S04A 2EFOA 1TW2A 1R1UA 2K4JA 1G6NA 4RS8A 4ENKA 3JAMK 2CO5A 1R36A 2A68F 3EUHA 5HLHA 4UV8A 2UZKA 1YLFA 1FBQA 1PUEE 3KFWX 3P9KA 3KP3A 2XKPA 3U9GA 3R0AA 1BI2A 3NQOA 4LMYA 4KIGA 1I1GA 4E70A 3SZTA 4RGXA 3HSFA 4FX4A 1FYKA
chains in the Genus database with same CATH superfamily
4FX0A 2VPRA 5EF6A 2ZMEC 1S3JA 5AONA 3KYCB 2DT7B 2HXIA 2M3AA 1QPIA 2R87A 3K4LA 1HDPA 4XORA 5F1RA 4XRMA 4FCYA 4UB8C 3PW0A 4BBRJ 2IP2A 1W36C 3SDBA 3CCJI 4ED7A 5KFZA 3LOCA 2JT1A 2FLLA 2VUMG 3CESA 1ZRCA 2DPDA 2GM4A 4HLXA 3IC7A 1JLLB 2EFNA 1VQMI 2VLAA 4I0AA 4KN4X 2XCLA 2LH9A 2VBWA 5DM7F 5FPRA 4FQGA 4XL9A 4B3XA 1ZYRF 3DWLE 5DEQA 3LQRA 2VONA 4AQYH 2QYZA 3LSMA 2M45A 2BBYA 1CQJB 3I12A 4MV6A 1TLHB 3LSGA 3WTSC 2F48A 2EFQA 4XRSG 3WU0A 3W6VA 3WGGA 3T5KA 1PK8A 2Q2UA 3E6DA 3JTGA 3IAS2 1JHHA 1WQ2A 2XB0X 3QAHA 1LEBA 1B72A 2E1NA 3FIWA 2DIKA 5LXTF 4B1RA 4YRVA 1HW2A 1X9NA 2FQ4A 2MSYA 4JK1X 4EMSA 1X3WB 2LKSA 2YX7A 3K2ZA 1YJ9I 2AGOA 1TNTA 2O03A 2BW3A 3VPRA 4XLHA 5GAGJ 1JT0A 3TQTA 1Z9CA 2BV6A 2OF7A 3DFGA 4PK4A 3H40A 5GP9A 1KA8A 4NNJA 1N77A 2BEOA 5ICFA 3I4MJ 4W1UA 4EGYA 1ITYA 4GYIA 1DPRA 4JI2H 4HSRA 1BIAA 1KJ8A 3C0FB 2ZDHA 2XV4S 2FNAA 4O6JA 5IP6A 2HDCA 4RZRA 3WG9A 3ZQQA 3HJEA 3AKZA 5T14A 1K79A 1ZAOA 4UCSA 2LNBA 5IY5H 1TC3C 3OUZA 1IBLH 2V4RA 2MH2A 3H9QA 3MKZA 2YS7A 1GXQA 4CC5A 3K1PA 3G6YA 4RB2C 2GZWA 4YY3H 2XC7A 1R71A 4LIUA 2OTJI 2UXDH 1Y6IA 1NG6A 3M3YJ 2DOAA 3BR3A 1PP7U 2KSWA 3CLOA 5FKOA 5KFMA 2DMTA 4QSHA 2Z3YA 2VXZA 3MR5A 2LMDA 2R5ZA 3GTGJ 1Y14B 3E3VA 2XGEA 1SEUA 3B02A 1WH7A 2KIQA 2XAHA 5CAEB 2EH3A 2OAZA 3OYFA 2VA2A 2XASA 4BY7J 2RQQA 2R93J 3BJYA 3BAAA 2QGUA 4KMUX 4XSXF 1VQ9I 3CP8A 2K4BA 3H5RA 4J19A 3GV5B 2DA7A 3Q9SA 2LBFA 4J9QA 2HJWA 1DDNA 4F91B 2IA0A 2B0LA 1XCBA 1M0TA 2OU2A 1B72B 5FLVA 3QYFA 1Z21A 4EATA 3G6XA 3TBIA 1B6SA 1POGA 2ME0A 3WO1A 2VKDA 2UVRA 5EEAA 5E1XA 4I76A 2KLOA 2VKVA 2O8XA 3GIIA 2BW3B 1D3YA 3HUGA 2AQFA 3U1DA 1G4DA 2DA5A 3DLLF 2K3FA 1KU7A 3ORQA 2XF6A 2D45A 3S1QJ 4E6KG 1OJLA 2QUFA 4XLCA 2VUMJ 2GIZA 1M6VA 2JA7A 1Y8QB 2LR8A 5KVRA 1FOXA 2X51A 3GLLA 4D9JA 1W4MA 3K1NA 2D1VA 2OPTA 3GTOJ 1J7KA 4OWRB 2W48A 3RZDJ 1QZZA 4RZQA 2HFHA 1RJPA 3FDYA 1R22A 3SZGA 3HB9A 4R1HA 1O4XA 2IP4A 1JDEA 3GV8B 4EYHB 5ILVA 2K9MA 3RSNA 1MBFA 5B3SH 3ZRGA 5EWEA 4B4CA 4N4OB 3FM5A 1R23A 4M71A 2HQAA 1A35A 2H8RA 1LVAA 2FOKA 3AG4H 4I09A 2X9DA 5F0HA 1W5TA 3BR0A 2TRTA 5B66C 1IXCA 1S68A 3V4GA 4LF8H 2R5ZB 4XOPA 4OIOF 1OCPA 1HC8A 2BYVE 3ZMDA 3GTMA 4LD5A 5FKLA 1T38A 2TDXA 4CCNA 4EQQA 1I94H 1GSAA 2R7TA 1MMNA 1MSFC 3OYEA 4EJTA 4ECYA 1VBHA 1FMVA 1X3ZB 4HYEA 3FBNB 1FBSA 4EV0A 3BTCA 1U5TA 2VE8A 1D1CA 3E0JB 3GLXA 4BJ5C 1R7JA 1JHFA 2LKPA 3BQZA 3J81K 3M8FA 5IYCJ 2BHYA 5LFAA 2EWNA 2LBFB 3N97A 3MFKA 3NEUA 4HNVA 2JA5G 3CTAA 4NXNH 4GFBA 2L7KA 4C30A 4RGUA 2KL4A 5B5EC 4F4YA 2BY2A 4O2BF 2RDJA 4HX7A 4LF4H 1IUFA 4N9IA 5HDKA 5IT9K 2JUCA 3M8JA 3KP2A 2R8KA 5CJ9A 1AA7A 3BZ6A 1SC7A 3TL4X 2KP6A 3S93A 3GTQJ 1N78A 4JV2A 1E17A 4EGJA 4C3JJ 3DCFA 2DT5A 3HUGB 2B63A 5J1UA 5H80A 4CUGA 1XGOA 2OQRA 4BGDA 3MEXA 2R7KA 5K5OA 1J0RA 5I47A 3L00A 4BHCA 2HYJA 2EK5A 2YZGA 3KAJA 1ZGJA 5HODA 1VAJA 1I6UA 3CJNA 2I80A 1PX2A 1FNNA 3MZ8A 2R6FA 3J81W 1UMQA 2XB5A 3CVZA 1FBUA 5K2MA 3H3VH 1YOVB 1RKTA 3HPGA 3HOWG 1OCRH 2Z16A 5A2QZ 3N8DA 2X6YA 4OAZA 1S0MA 5FLXZ 2UV1A 2OZ6A 2P5VA 1V51A 2M2EA 4RAFA 3C2GA 2ZSHB 1EYZA 4A3JG 1I6XA 2Y0SN 3QOPA 5IT9W 4HAMA 1OCZH 5FKKA 1TP4A 1ENHA 3BDDA 2LG4A 3IV5A 5KKNB 5LEJA 2IS6A 3EUHC 2IGKA 1VTNC 4UVBA 3H4DA 5H6QA 1K1QA 4HDUA 3N43B 3GTLJ 1S9FA 3TQNA 3S2WA 3SDGA 1GV5A 1GSOA 1A31A 1EKEA 4IF4A 4BDYA 3KP4A 4GC6A 1B6AA 4RA2A 3LAJA 4NC8A 4V19K 4KMFA 3O2PE 4B44A 2E5LH 1U5TB 3MWMA 3SE7A 2W8KA 3HOZG 5J8CA 3L2RA 4UUVA 3ZXSA 3DPLC 2CUZA 3TDUC 4YP3A 4BKXA 1N56A 4GKJH 2OQGA 4XLEA 5F1JA 1XDNA 1W7PD 4I0BA 3C18A 4L0YB 3R23A 3P9CA 2K5CA 3WGIA 1JKPC 4A3CG 1J5YA 2PBZA 2PMZE 2VQLA 3HOVG 1OYYA 2AO9A 3SEZA 4ETSA 3DBHB 2MD5A 3SZPA 5KFYA 2KJBA 5KFBA 2ECCA 3U2RA 4YELA 2MCTA 5L1KA 3DU5A 4AIHA 2HZTA 3HRTA 3KZYA 3OYBA 5LRRA 2ESNA 5L3EA 5KFJA 4TV9F 3LSIA 4BDZA 1DP7P 1XDUA 3WTUC 2J5OA 2Q2TA 5H6RA 5KAFC 3RKYA 3BWGA 2EZLA 3WTWC 2M4KA 4HBLA 1ZG3A 4YFKF 1R58A 2Y30A 3RKQA 5F9NA 5KK1A 1YW7A 3V8JA 1O7FA 4Q47A 2RDPA 4NB5A 3ZMUA 3KHRA 1WJEA 1IGNA 5TRDA 3FXQA 3HRMA 2QSGX 2F4MB 2K86A 2LTPA 3K4KA 3Q3SA 5FRMA 4I55F 4EBCA 1SVLA 2EV0A 2R7ZA 4M6XA 3ZOBA 4WXHA 4IOCF 2VOPA 4MNUA 1BA5A 2YZNA 4MV3A 1OYWA 2UUAH 2QQ9A 5E1WA 3SEQA 4EGQA 3F72A 1QU3A 3I64A 2ESHA 2UXNA 3WGHA 3HOUG 3DTKA 2VKEA 3ETJA 4CHUA 1XMXA 5KAIC 3I53A 3FBIB 2JJ7A 4FISA 4IO9F 3RQIA 3V6HA 1NK3P 1BR1A 4X64H 2DTRA 3CJQB 4L5JA 4GCVA 2R7XA 3BT9A 2PN6A 4FE4A 1KQ8A 2LF8A 4IXAA 3Q1KA 3FMSA 4LLGF 3CQZA 1BJZA 2X1EA 3IHUA 2E36A 4BS9A 3ZQCA 3F8MA 4MV7A 4YR2A 1XN7A 4KITB 2Y31A 2NAZA 1M0WA 2X0SA 4CO8A 1LPQA 2OH2A 2L7MP 3JRDA 2XSDC 1ZH5A 3LSHA 3RB0A 2L4MA 3LA7A 2VI6A 2ZJRF 1DU0A 1JT6A 2R7VA 5L3CA 2Q1ZB 3MQ0A 1W36D 4DV4H 4F52A 2RNJA 3ERED 2UVUA 4XYMB 1JJ8C 5J6XA 4LH7A 3BJOA 2WE6A 1GVJA 3ABMH 3KCCA 2E5NA 4L9NA 4DW6A 5E20A 5BR8H 3HL2A 4EFBA 2NU6B 2YRXA 4KICA 3KZZA 3DPTA 5C5JA 3CMAI 5B1AH 5CVJA 5C4XJ 4LGWA 2W84A 1F5TA 1B59A 3J80Z 2HZDA 4I98B 2VUGA 2W8LA 4ZQIA 4C3HJ 2IT0A 4AIDA 2ZMEA 2H6BA 2HPIA 2ZM6H 2AU0A 3B6CA 4A3JJ 1VQ4I 5KFIA 2V26A 4WBNF 2FK1A 2O0YA 2JA7G 3BOQA 1E3PA 3PFIA 4PFPA 4JOMA 3CCLI 2W6MA 4MV1A 2VQCA 5LRSA 4IHWA 4ZYHA 4QWAA 1V5FA 3V8KA 2XAGA 3VB2A 2A6EF 4AIKA 2HEOA 2W6ZA 1K6YA 3F8BA 2VC0A 2I10A 2QM3A 3DQVC 3E6MA 3ZR8X 1JE8A 2DLLA 3EETA 1QQIA 5DCMA 5GAEJ 5ILSA 4Q0YA 2Q0OA 1L3LA 2WAFA 3OR1C 3Q8SB 5HBRB 2JN6A 4LB5A 4ECWA 5DV5A 3OV8A 2DJIA 3R61A 4LF7H 3HOZJ 1WKMA 3OS2A 2ZKZA 4LSAA 4PJMA 4ZI7F 1M7JA 3Q0WA 4D7MA 1MNEA 2Z5UA 2BXYA 5LHIA 4B8XA 5E3NA 3T5XA 2FF4A 1BR2A 4A3CJ 4XZ3B 1DGSA 4PCQA 1FVIA 3IRQA 1TWGA 5CLSA 4YFXF 1IXSB 5M3FJ 1Z2NX 3G1OA 3HOVJ 2D5VA 1IO2A 5JUMA 2QQBA 4UV9A 2HU9A 3GTPA 3VYTB 2K9NA 2ZJPF 3N4MA 3SJMA 1UC8A 3BR2A 3L1PA 2B9SA 2E1CA 2Y75A 4O5VA 4BAYA 5IOYA 1XMKA 3KPHA 5KT4A 1O57A 1P92A 3LWBA 3LMMA 2ASDA 1TQIA 2DQLA 4QLCU 3ULQB 4MA5A 4LF5H 1E4EA 1YYVA 2W7NA 3E6BA 2OLSA 1H9GA 2V9KA 4MTDA 1LB2A 5EEGA 1UG2A 3QYEA 1DUXC 1TT0A 2A61A 2UXCH 3GIPA 2QYOA 2IVMA 1B9MA 2STTA 5FJ8G 4DV6H 3H36A 2XF5A 2QA4I 4G6TB 5E1ZB 4K0KH 2V1XA 3T8RA 2EV6A 3RBEA 4M72A 5CQGA 3HHHA 3AYHB 2WAQN 4CDGA 3CD6I 4BJTA 2COBA 2JRTA 2V4JC 3N42B 1KYZA 2DQRA 2G9WA 3I58A 4UVAA 4XBFA 1EF4A 4L9TA 2WB1E 3RQ4A 2HHHH 2B63G 5LOVF 2ZMEB 2P0WA 5DG9A 2HVRA 1MKMA 4RB3C 3ZGKA 3HOUJ 1IUYA 2IGOA 3NWSA 3IKTA 1A5JA 1T2KA 2CUJA 2Q2EA 3S1NJ 4DYQA 2QZ8A 4C2MA 3RJ0A 2OWOA 5IYBG 1MSEC 5K5RA 1XDSA 4U87A 3BABA 2GIVA 2K27A 3TW7A 1R5GA 1LNWA 5DCMB 1OCCH 4XLAA 1U5TC 2YRWA 2L4AA 1ZGWA 2HR3A 4YIFA 3BP8A 3CDLA 1DP3A 4NBQA 1QZYA 1LE8A 2P7VB 4PDKA 3F3XA 3J7ZI 1S8NA 3DTEA 5CVIA 3L2UA 2VPQA 2LOOA 1O7LA 1GSHA 3E97A 5KT2A 4F7ZA 1A6QA 2V1DA 5D5XB 3KHGA 2CSOA 1ULZA 4CXFA 1T56A 4AYBN 4YFNF 3GZ6A 4LSXA 3JRGA 1OLTA 1S29A 2ZFUA 3K1MA 3OYMA 3CO6C 5IYDG 1MH3A 3CCYA 1JTXA 2OCEA 3MKYB 2L9SA 1TWCA 2NVYA 1QBJA 3N40P 1K6OA 3TO7A 2PI0A 1Z1DA 4O3RA 3CCEI 4XSZF 4C5AA 5HS9A 2X85A 3OYGA 2NRAC 1A0IA 2KZGA 5EZGA 4ESFA 2JA7J 4HG2A 3AL0C 1DU6A 3REOA 1E4EB 2IPQX 3GX4X 3VYRB 2DDBA 4LIVA 4NHJA 1V54H 4P96A 4AM3A 5L1LA 4QJFA 4XICA 3KHLA 3PUFA 3BLYA 1S7OA 3O8GA 1ETVA 1MJBA 3GZNB 1WPKA 1IN5A 3CC7I 4UVCA 1MBJA 4QIWA 1R5HA 2V59A 3M9OB 1MW7A 3IKVA 1FSHA 3SHFA 4UFZA 3DBRB 4YJ3F 4JI8H 1LVKA 4B43A 5HLGA 1RJRA 4IQ4A 4YJ2F 1YG2A 3MCZA 1YI2I 1LDDA 2LRDA 1XMAA 3GZ5A 3SXYA 3C2HA 1VFCA 2WDTA 2W9BA 3RAXA 2LY1A 2XIGA 1X3UA 1Y39A 1XB4A 5KFAA 1CS0A 2WTFA 2E2HA 4DL4A 2Q2EB 4IZZA 4H0EA 5LGNA 2MBFA 2IA6A 1ULYA 4BWSC 1FC3A 1S03G 5KFVA 1E4GT 2R85A 4PJLA 3HRSA 2R7ZG 5KFWA 4Q8EA 5DD4A 3KIOA 1HKTA 3HEFA 1VQOI 2BXZA 5DQIA 5KCMA 3OIQA 1BXRA 2CRGA 5DTDA 2ISYA 1LE8B 5C1PA 3G73A 5KFCA 5FD6A 4TV8F 2XCAA 3F21A 1ODDA 3IWFA 1R5ID 1GUUA 3C1DA 5J2UF 4YR3A 2E71A 5IP9G 4JP0A 2V1NA 2ZJTA 4R79A 4P5OA 4WCGA 4HX8A 2M7BA 1Y1WA 4DGWB 5GPCA 2RGRA 1V3FA 3RV3A 1P4WA 2IRFG 2GOXB 2B63J 2R7MA 3GW2A 1CGPA 2D2WA 4PGGA 2QBYA 3Q9VA 2EZHA 2P8TA 3IP4B 1FYMA 4I01A 4I4TF 3U9TA 2DXIA 1JI8A 3V7CA 5D1OB 5C8YF 1V9PA 1A9XA 2PVPA 2XVCA 4M74A 2GXAA 1UCRA 2D1HA 1AU7A 4UCUA 4MV8A 1KU2A 2IGNA 5L1IA 2E1MB 2WB1A 1WJ5A 3DP7A 2V9PA 2ZB9A 2RKHA 4JI3H 3BJAA 3VODA 3WODF 2L2OA 4JI7H 2V9VA 5JH7F 5KT3A 4BE2A 2VBZA 4GXOA 4E7HA 2DBBA 3BG3A 3EQLF 4NUBA 4QPQA 2ZDQA 1QRYA 2UVWA 3D0SA 2W9BB 2W24A 1ON1A 3JSLA 1NH3A 1S97A 3MAJA 2MW8A 1XSXA 3VYSB 1YJWI 2CGPA 4BBSG 3RPQA 1MJAA 1WH2A 5LP6F 4ZYDA 1DGWY 2PLYA 4DR6H 5CA1F 2ZJQF 5EG0A 2EIJH 4F55A 3MJFA 1YQAA 2QSFX 5CPRB 5LBQA 4PJNA 4DR1H 1ZR2A 1K78A 3C2BA 1ZR4A 4D7NA 1TZLA 3BG7A 1EUCB 4IHSA 2LF7A 3I3LA 4XONA 2NOGA 1GO3E 3JAMW 2JEGA 2VQDA 4WX9A 4L9VA 1V5GA 3GXOA 1FTZA 1BN5A 2HOAA 1TWFA 5KFXA 1JX4A 4DQ2A 3P9IA 1C0WA 2IS4A 4X6AJ 2NVXA 1XC5A 5CB4F 1HKQA 2BR0A 1MBGA 2PMUA 3S15J 4ED1A 1ZKGA 1X2NA 2CUFA 5L3DA 4IAJA 4E7KA 4NC7A 4QPOA 1E0EA 1J5EH 4BYYA 2E2IA 2VT2A 2ISZA 3I59A 4MA0A 1JKRC 1N32H 2J6TA 2NOJB 3GIJA 2R92A 2FK3A 4BQNA 3EUKL 2QBYB 1ZGAA 3KTMA 1NG7A 5D6EA 1JUSA 4ZTJA 2H94A 2MGQA 4IOAF 3TO6A 3K5IA 2VASA 1Z0XA 3G71I 4FU0A 4A3LJ 4YQWA 3CUOA 2R8GA 2PQ8A 2DZDA 4OINF 3ZP5A 1R49A 4ITVA 5CQEA 4RBOA 3K69A 1FT9A 4KDPA 4WK8F 2XGXA 4O3NA 3JTHA 2J6SA 1WCMA 1QO0D 1QHHD 2FQ3A 4I50F 4BQAA 3OSFA 2MFZA 2R7ZJ 5BPDA 4M3FA 3S32A 3VPBA 1P7JA 2PG4A 3Q8PB 3ZQIA 2F4OB 2RVCA 4EEFG 4ZZDA 3M9MB 1XMOH 1ETYA 3Q0UA 4IRIA 2FXAA 5E17F 5KFEA 2LK2A 2VBYA 5ICGA 3SI8A 2AQ4A 4KT6A 4BQOA 4X62H 1IN4A 5AIPA 3K10A 4OU0A 3TP3A 5IP9J 3CQZJ 1ZELA 5EZHA 5HNHA 2CUEA 5F64A 2VL8A 2DW4A 2LFBA 1KGSA 3KZIC 5JLXA 2DPIA 4M73A 2XAQA 1UC9A 3TKYA 4XLNF 3DF7A 1GV2A 3HBLA 5EG0B 4RB1A 4DR2H 4QWQA 5DD8A 3RUPA 2KFDA 2Z2SB 2R7SA 5IYCG 4M3EA 1K78B 1X1CA 3K4CA 4ECXA 4IHJF 4M3DA 5TJJA 4LOCA 1ERDA 2E35A 3CMYA 3K5HA 1S0OA 4AIJA 2LC2A 3VOEA 4HNTA 3HDDA 4P9FA 1K7AA 1Z67A 3QPTA 3OSNA 2GPWA 1CF7A 3F22A 2FJ1A 2KDOA 3BA9A 2E19A 4HQ6A 3IUOA 3MWEA 3HOXG 1XNRH 2KZVA 4BY1G 4Q44A 3RYRA 4LITA 1FP2A 2RN7A 4DL5A 1BC7C 3BQ0A 2K9QA 3I59B 1A6IA 5D5VB 2E60A 1U78A 4DLKA 2XAUA 1XCVA 3PM1A 2AS5F 3FXKA 1VF9A 1IJWC 1FYLA 2FLNA 4ECRA 2BZTA 4CZZA 4ZTFA 3OHBA 3GLKA 2Y0MA 1OPCA 2WY7Q 2VODA 3JRWA 1IDZA 4GYGA 5LLQA 4BBSJ 2COMA 2O9LA 4ESJA 2JQ7A 1Z3YA 5EJCA 5KNLA 3HRUA 5E3MA 2W70A 1E3HA 4L9JA 4AD9A 1H88C 4U7BA 2AHQA 4PFOA 4EFEA 4U0VA 1MJ9A 1PVEA 3FZVA 1I3QA 2AGQA 2XDVA 4ZDOA 4EJUA 3K4JA 2HGSA 2JVGA 3PNTA 2DCEA 1SCUB 3R6SA 5KFPA 3GILA 1P6RA 2XPWA 3IN5A 1AKHA 2NNYA 1G2HA 2IA1A 2CV0A 4UUTA 1RUOA 4GKKH 3H1CA 1OCTC 3PSIA 1TWGJ 4XN0A 3OUUA 3BPXA 1JGSA 2IS2A 1F43A 1KYWA 2CW8A 2MC3A 5GAHJ 1ZG1A 1Q1HA 3ISPA 1RR8C 3GTPJ 2JZYA 3F6OA 1RIOH 2M05A 2C35B 4XRFA 3QYBA 2TCTA 2EA2A 3V7SA 1SFKA 3LMLA 3D5RC 3OYHA 3GIKA 1MMAA 2OA4A 5CA0F 1MGTA 4I7HA 3RGXA 3LFKA 4L5EA 4U88A 3ABUA 2CKZB 2FNPA 3FMAA 4C5BA 1B04A 3S2DJ 2UUZA 1SD5A 3HC7A 3VPDA 2ETHA 3T5JA 4XIDA 3MVPA 2C2EA 5D4RA 3CUQC 4QWCA 4HOBA 2E1MC 3EYIA 1RUNA 5FB2A 4XLPF 4DV3H 3GTJA 4EBDA 1MZBA 1N48A 1ORKA 4BE0A 1CF7B 2VOOA 1I7LA 3ECHA 1Y1WG 4AVPA 1VS0A 3CF5F 3K2AA 2YUSA 5F04A 1IRGA 4IRKA 4GO1A 2ZXHA 1BGWA 2G0EA 4LJZF 2GA1A 1D1BA 5AIQA 4MFEA 1K1SA 3W2VA 2GAUA 4Y17A 3A01A 1ETXA 1BW6A 3VWBA 2XRNA 3A02A 1W93A 2R86A 2SCUB 5M5WJ 2CZGA 4B3MH 1T0FA 4U0YA 3S3NA 4C2MJ 1G3YA 2E7XA 3BZKA 4KNYA 2YU9A 1TWAA 1FJGH 1X1PA 2GOMA 1IW7F 4DR5H 1YFHA 2MLKA 1H89C 4IR1A 2P7CB 1WSCA 2X4HA 5CVRA 5DGAA 3LSPA 1EH7A 2EZIA 2G7UA 1QNTA 4G6QA 2ELHA 3KETA 3K3PA 4QW9A 4E4HA 1V4YA 2J5PA 1TQMA 4RGRA 1SD7A 3I0TA 3AAFA 5CVVA 2R7FA 2CQYA 4ZH4F 1BI3A 3L4JA 2GLOA 1BM9A 5FPOA 1AKHB 1PYVA 2VQFH 4HV5A 4ED8A 1YJNI 3BCAA 4DL2A 4LG0A 3OYAA 4CGZA 3V4ZA 4G7OF 3RBDA 2X48A 3BPVA 4LLLA 3HOXJ 1TWCJ 2NVYJ 2O7OA 4HRIA 1F36A 4O4HF 4Q43A 1JGGA 4BY1J 3K4BA 3V7RA 1FOYA 3FHNA 4IWXA 4A2AA 1LKXA 5LHHA 5BPFA 5J8FA 4YAJB 1RI7A 5GONF 2L3DA 4RNOA 1XSVA 2EPFA 4ZC3A 2QQ8A 2QVOA 2W00A 4JX6A 5E79C 4GGGA 1IRZA 3MZYA 5IYZF 2FLPA 2WAEA 1QVTA 1VNDA 1E4FT 4FBTA 3OYLA 4Y4RA 1DGRM 3BR5A 1XNQH 2WYOA 5KG7A 3BG6A 3T8TA 5C4XG 1MIJA 2BHZA 3DKWA 4J9KA 1YIJI 4MLOA 3DKXA 4MGRA 9ANTA 3DEEA 1U3EM 3C3WA 4JYAH 1TL8A 4Y8VB 2FMAA 2W7PA 2I87A 5KFOA 1LFUP 4Q48A 5LGTA 4ECVA 1HW1A 3A01B 2E2HJ 3SQNA 5BNGA 2FUG2 2HTSA 3HXLA 3KLOA 2FB9A 2ACJA 3R0JA 1YW9A 5CVUA 5K7ZA 1QZEA 1V5EA 2JRMA 5DUKA 2XD4A 2RAEA 1Z6TA 1WJAA 3KYDB 5F27A 5JHFA 1WCMG 3UQ8A 2ZXJA 3H5AA 4B3AA 4F4ZA 1FLIA 5EYRA 3OWTA 1DIKA 2WADA 2DAOA 4JV1A 4D0PA 4AWXB 1SFEA 1IBMH 2H1LA 1RC9A 2WY8Q 3FXRA 2EBIA 4FT8A 1T6SA 4NC6A 1T3NA 5L9XA 3OOUA 5JLWA 3LAPA 3HKZE 4QW8A 1XTAA 5EWGA 2LREA 2R7OA 4KHPH 4KIFA 3R4KA 4WWCA 1I50J 4AUXA 4E7SA 1X4PA 2K7LA 3FXMA 4LG0B 1ZLJA 4XYLB 1YTYA 3E6CC 3RTXA 1Y1WJ 4K2EA 2UXXA 1GYFA 2N8GA 2RQPA 4M9UA 1C3OA 3KALA 2Z33A 3PR5B 4RMNA 3W3CA 4XKVA 3F8FA 5GTIC 4XR6A 4V2GA 3VDXA 1KJQA 2KKOA 1B9NA 2M5WA 5GTHC 5J4VA 5K5QA 4A3IG 2QQAA 4FE7A 1HNWH 2RNGA 3AL0B 2NVUB 3RIZA 1K83A 1YS7A 4S0HB 2H09A 4C2TA 3A1YA 4YR0A 3MFIA 3RCOA 2GQQA 3OS1A 4MEXF 3S1RJ 4OX9H 1HSJA 3N41B 5ED4A 4ENNA 4LB6B 5DYMA 3F6VA 3AFHA 3SFIA 4XQFA 2PJPA 4F4WA 2NU7B 3OL3A 4FTHA 4EG0A 1I39A 2DK8A 3BR6A 1RYRA 2WAQE 4N9HA 2O8KA 5KFUA 3ZN1A 4YHHH 3ABLH 3LSTA 4ZYEA 5GADJ 2DYRH 3NARA 1LQ1A 5KG0A 4LFUA 2EQRA 1I7NA 3MN2A 3FKIA 3ABTA 3OIOA 1SMYF 4CCKA 5KHDA 1SMTA 3H0DA 2HQNA 4MFDA 1O3SA 3DF8A 4JUZA 3OR2C 4RAGA 1KBLA 1UJ8A 4OAYA 3RDIA 3IRRA 3OYDA 1SD6A 3FM3A 4BL0B 1WZ2A 5TGTA 4O2AF 1S0NA 2F5DA 2RREA 4IX7A 4BACA 4CZCA 1TWFJ 2ZSIB 1BJAA 3RJPA 5ILUA 4Y52J 4O3QA 4IRHA 4PGHA 2NVXJ 4RNNA 2L7ZA 1APLC 1F4KA 1IN6A 2HDDA 1TWHA 3GFIA 2LVSA 3QPSA 2E2IJ 4ED6A 1LFPA 2EIMH 3ML6A 4HPQA 4AYBE 4U7CA 2V6CA 1R00A 1T95A 4V2FA 2A3SA 1R4MB 3FKJA 1J59A 2QK4A 2R92J 3F9KA 4CCMA 4G7HF 3U21A 1I6HJ 1DPUA 4RGSA 2XGDA 4ZZLA 5F0FA 1SFUA 2AXLA 1ZHQA 2NXNB 3G3ZA 1VBGA 1P4XA 2DMUA 1BI1A 2M1BA 2E5ZA 3M8EA 1WHUA 2HGCA 5DDGA 2W6NA 5ICEA 2CWEA 2J9GA 1IV6A 1WCMJ 3S14J 4KUMA 4J9PA 1U9OA 1X1AA 3H3ZA 5E3LA 4CCOA 2PJRB 2MC4A 4PJ0C 5KFKA 2ZXWH 2M0MA 1ZQ7A 4XKWA 3KHHA 4FS2A 2H1KA 4Z2YA 3KE2A 3N05A 2OUMA 2L9VA 2R3SA 3H35A 4UHTA 4IR9A 1AUVA 2OTLI 3P5JA 3TP0A 4EVIA 4DR4H 4YB8B 1XMQH 3GV7B 3MFHA 1Z7LA 3E5UA 1UHWA 1U0JA 3RFCA 5L1JA 4J9RA 2I8DA 1KQ9A 1OFCX 3DV8A 1IRFA 1RETA 4AC0A 4RUCA 2XC9A 2HYFA 5F0CA 2LYCA 3VSLA 1XGMA 1HBXG 1N36H 4RAYA 2QWWA 2RGVA 4MHGA 1EH8A 5IT3A 3FK7A 2VJ5A 4BXFA 3SFZA 1N33H 2DU9A 1HCRA 1GDTA 3MR3A 1M1EB 2YR2A 3WG7H 3HKZA 3RKXA 1XSDA 4I99C 4C2UA 4IKFA 4OIPF 3M9NB 2AQEA 2GBYA 4XK4A 4A3IJ 2W6PA 5KT5A 2PMZA 1KQ0A 2F4IA 4HNUA 1D0YA 3LA2A 4CYCA 1TT5B 2M9HA 1S10A 4ZOLF 1S5LC 2KJCA 4EJOA 3R5FA 4ED2A 2VIXA 3S3MA 1EA3A 1E2XA 2Z99A 3FX3A 1R1VA 2YZMA 3GFJA 4DV7H 1MH4A 2HWVA 1HLVA 1IC8A 4HF2A 1B6RA 5C44G 2AGPA 5F6FA 1T0FC 4HA8A 1O3RA 2OD5A 4M9SA 2V58A 4UCOA 4A2BA 4J9SA 2P81A 3KEYA 3Q8RB 1ZHFA 4PUSA 5FO5A 1BBYA 3RIRA 3HOYG 1G3SA 3L4KA 3BQ1A 4IHXA 5L3GA 2CV1A 5IOZA 3WHCA 3PN1A 5C1OA 4LF6H 2MLGA 2KPMA 4M6YA 5FKMA 5HS7A 1YITI 1I3QJ 1HDDC 3KX2A 1CQIB 2FX0A 1MBHA 1WJBA 4Y15A 2WAQA 3PW2A 1P8LA 2VA3A 2L54A 5F9LA 3GMEA 2Y69H 1JXSA 3D5SC 3F23A 4XX0B 1ZRFA 2KQRA 1RZ4A 2YX4A 1C30A 5E18F 2M7AA 2VB6A 1S72I 3T5LA 2LDUA 3R5XA 2OJED 1HNXH 1XGNA 2ZDGA 3JSOA 2V6EA 3KEOA 4P9UA 4TUYF 3QU3A 1K4TA 1D0ZA 4UY8I 2BQ3A 1T8IA 3PW7A 2RDIA 2ID6A 2DLNA 2HKXA 5FD5A 5FKNA 4DUZH 2KRHA 4O3PA 3KXYT 4OOIA 2W71A 3QPLA 2NU9B 3G6EI 2JTVA 2DK5A 4QIWN 2R0QC 5J2TF 4EJWA 1W96A 5D1OA 4BUPA 2HOEA 3OHAA 3TW6A 3EPIA 2C28A 3PO3J 2ZFWA 2MG4A 1P2FA 3I5UA 4LFBH 3CUQA 2RC4A 4M9ZA 4CYCB 3M1CA 4UB6C 4HZFA 3GTJJ 4JI0H 3HG9A 2EINH 3TOAA 2PEXA 2VJ4A 2VJJA 3V6KA 3WU2C 5HV6A 5KT7A 3IH4A 3O6BB 4Q45A 2NS7A 2LY9A 2DA2A 3LNQA 3E5NA 3BZCA 4KA4A 1RK6A 1WJFA 1IXRC 1IZ1A 3HGGA 3C7JA 1L2ZA 1WWXA 3GUDA 1Q1VA 4GLXA 4A3LG 4Q4ZF 3ZPLA 3VPCA 4QWDA 2E7WA 2W6QA 3PZPA 4ZYGA 3GTMJ 1HSTA 1E3OC 2BVLA 1QA6A 3PNVA 3TQ1A 4M3BA 1KONA 2CG4A 1TWAJ 2R7WA 2ID3A 2VT3A 4IRGA 3J81Z 3MKWB 2YU9J 4O3SA 1JUMA 4U7DA 1RJQA 3MD2A 1T33A 2CQNA 1GXPA 3LQQA 5FGMA 2DFFA 3KP5A 2LY2A 5JVGF 2VQEH 3G1LA 3CC2I 5DG8A 2V4QA 3BTLA 1FIAA 2R8IA 4DR3H 2BQRA 4DL7A 3QZ7A 2ELKA 3MKLA 1BL0A 1Y1VA 4YIRX 4GC7A 2UVVA 4JI6H 3M7GA 3ZQFA 2FKLA 1Z6RA 3HHGA 4M6VA 2VQHA 5A2QK 4RU9A 2GXGA 2YU3A 5FLXK 2WV1A 1VQ5I 1S6LA 4IEJA 3HGYA 4UNOA 3L2QA 1UNNC 3KYLA 5M3MJ 4KJZA 1TNSA 1VQNI 1SYXB 3ELKA 1WGXA 1OQYA 1WI9A 3EUAA 5HDNA 1FX7A 3VEPA 5HVQC 2EFWA 3HSEA 3GBGA 3RPUA 1R9TA 5B1BH 2FE3A 1EJ9A 1AOYA 4BNCA 5C44J 1T36A 4UXNA 3T0YA 1GLNA 2K02A 4BHPA 4UCRA 5C4JJ 5E8GA 2M8GX 3ZMSA 3I4NJ 5CYVA 1ZTRA 2JA6A 5EOYA 1WRJA 3J7YJ 2XHKA 4IVNA 2CU7A 3NRVA 2DA6A 3DPUA 3QOEA 3HOYJ 2W6OA 4R7RA 5A2QW 2XCPA 5D4SA 3DTIA 2OZUA 3CUQB 3Q5FA 5FLXW 2GLTA 3PNYA 4FM9A 3ZMTA 2NU8B 2DTZA 2KIFA 5GPAA 1T39A 4G12A 2PMHA 3A0HC 4DYCA 5LEKA 1OCOH 4KFCA 5LMNH 4EBEA 3M1EA 2R8JA 3HTSB 2K85A 5KFRA 4A3MG 1FKAH 3N6XA 2HOTA 1H9TA 4RLQA 3S8PA 4EEYA 2YCHA 3FMRA 4BEHA 3J7AO 3HTUA 3UKGA 4B3TH 2DA4A 2JPCA 3DLAA 1KU9A 1WFXA 5L3FA 2JK3A 4QWBA 1J75A 2FD5A 3K70C 4JV5H 2FU4A 2H8WA 1J2XA 4ZYAA 3BTJA 1IF1A 3BCBA 3TO9A 3NGDA 1YRNA 3PVXA 2CFXA 2F5CA 2CQXA 3H3UA 3JRHA 3GYHX 2F6CA 1F9NA 2IJLA 2JMWA 4RAZA 3ESWB 2A05A 4OMYA 2W57A 2JA5A 4DR7H 3H9JA 4XKBA 3HOTA 4ESBA 4BU2A 5DM6F 2YPRA 1KU3A 1L0OC 1QPMA 3X2QH 3L9FA 3VSKA 2XRLA 4W97A 5CKTA 1D0XA 5KFGA 1FOWA 1YX5A 5D1PA 4LFCH 4APMA 3H0GA 3ERMA 5DLFA 3AG1H 2MD0A 1QVUA 4DYRA 5KG5A 1OKRA 1ZREA 3WTZA 1MMSA 3NWTA 1DQUA 3OIPA 1KJJA 2DN0A 4A5NA 1ZK8A 3WTXC 2XKOA 3HM5A 2DFIA 4ZDPA 3KP7A 3JRBA 2NS8A 3FXUA 3BG5A 3ZQHA 5BPHA 5D6FA 4MIMA 5KFLA 4DOZA 4IHTA 4S05A 4D1QA 3R60A 4B47A 1UHMA 4CC6A 2JPBA 4KIBA 1U8BA 5EDWA 2JA2A 5E8IA 5LYJF 1W5SA 1K83J 4YAKB 2XF7A 1T08B 5LMUH 1T98A 4IJAA 2R7QA 2NVQJ 5FFZA 2HI3A 3H4BA 3FHZA 5H2FC 2ATLA 2RV8A 3GFLA 1U9NA 2EV5A 4RDUA 1HF0A 4A6DA 2UWMA 4CICA 2DOFA 2NS0A 2JUGA 2WBMA 3J80K 1FZPB 2EB7A 3GQCA 1XS9A 2W9CA 1SFOA 1SAUA 4DNCA 5J47A 2VC1A 1CE8A 2DPJA 4BEHB 2M34A 4QWEA 3F8NA 3P7NA 1V55H 3FWEA 4F93B 2DFEA 4HF1A 1JKJB 4KISA 4A3EG 4A3KG 3FKIJ 2DMNA 1YRNB 2HOSA 2LP0A 4M9XA 3ZMZA 1D8KA 3CCQI 3CP2A 1KJIA 2HQRA 1EUDB 3GWZA 3TEDA 4KYWA 2DOEA 2BGCA 3CO7C 1ZHSA 4FS1A 4XM3A 2LLKA 3OS0A 2GA2A 4XNFA 4G8XA 4MAMA 5HLIA 4FBUA 2FA5A 1NHAA 3IH2A 4A93G 1BR4A 4BJ6C 1Y0NA 4JI1H 4PDBA 4P1WA 2CW0F 3CDIA 3G4SI 1EV7A 2K9SA 2X6WA 4LG3A 1K61A 2BY0A 2RF4A 2A6HF 2VPSA 2P0AA 4MQVA 3FDSA 3J80W 2VBXA 4X0GA 2BVMA 2ADUA 1P4AA 1TWHJ 4Y33A 3RI4A 1R6RA 3WTVC 2I8CA 4ED0A 3WHBA 2MH9A 2QF7A 3N44B 5M5XJ 1SANA 3IAM2 4HW0A 4HX4A 4JX4A 1VQKI 2FRHA 2JSCA 2M4GA 4OIRF 2P5LC 4A3MJ 3FXOA 3K3VA 2HQ5A 5C3EJ 3TINA 3V8LA 5BMZA 3QZ8A 2EJRA 2GPSA 1YW8A 2ASLA 4E7IA 4L5IA 3HYIA 3ABKH 3GO5A 2R7UA 3EPGA 4LK0F 2B7EA 2K9LA 2HPMA 1AWCA 4LLNA 2QENA 1MMDA 4A6EA 1D1AA 2KMUA 4ANJA 3IL2A 1B4AA 1SVOA 2K40A 5BQTA 2HVSA 3A2KA 1GGOA 1VQ8I 4O3OA 1J09A 2O5RA 2JEJA 2QKLB 1MDMA 3I4PA 1OWTA 2WA0A 2XPUA 2Y2ZA 3ROUA 4OIQF 2W9CB 2JEFA 4B3RH 4UCVA 4YG2F 4PSWA 4JYKA 1ZG5A 1MNMC 3WTYC 3K0LA 2KT0A 4XN3A 2Y0SE 4I6ZA 1BOBA 2F4VH 3G1MA 1CQTA 3DXJF 3MR6A 2V79A 2PBIA 3TMOA 3HOSA 4BXXG 2BY1A 3W6JB 1OR7A 3OSPA 5KG6A 2F5EA 3FK6A 3KLNA 3OY9A 5EGOA 1PDNC 4GDFA 2C2RA 2A5YB 1Y1VG 4WXCA 2X0LA 2HVQA 4N0BA 3DKYA 2DI3A 1J9IA 5KFHA 4EM2A 1PUFA 2W82A 5JI6A 3JRIA 1N75A 1G59A 4WD3A 1JTYA 2JSPA 2Y48A 3BJ6A 1EHIA 4DBRA 5DQHA 4RUAA 4G94A 1AN7A 1X1DA 2XPVA 2X1DA 3GEZA 3L2CA 2CYYA 2QEXI 4JI5H 2JEIA 2JA8G 1BC8C 3WO0A 1IOVA 3L09A 1A04A 4I2OA 2DODA 2GXBA 2NUAB 1G3WA 1LUJB 2A07F 2DMPA 5J1YA 1UHSA 1FSEA 3OOPA 1HNZH 4LFAH 4RB0A 3OYJA 4NXMH 1FY7A 1NK2P 1ON2A 2ZO4A 4WF2A 4IL6C 3S17J 4ZDLA 4RM2A 1EZ1A 4LF9H 5K1YA 2JA6G 4BE1A 4L1KA 4EEQA 2CQQA 4NDLA 3JRAA 5HDGA 1JJ6C 2HKOA 4A3BG 4E7LA 4OMZA 1BIBA 1Z2PX 3BROA 2YS9A 1VZ0A 2NYXA 1GLVA 1SFXA 2XAJA 4UUSA 3B73A 4A3EJ 3OYIA 4A3KJ 4II2A 1REPC 1ZETA 4XOTA 2HS5A 4YIIA 4FASD 4ME6A 4DJAA 2ALZA 2V9WA 1OMIA 2EZKA 1VQ7I 1TAEA 1WJCA 3T1HH 1KJ9A 1AHDP 1Z2OX 2CFOA 1FP1D 3F0CA 4A93J 1USTA 2DFHA 3PR4A 3J7AK 4G6DA 3BY6A 1MDMB 5KG4A 4J9LA 3E5QA 1S7AA 3CJRB 3WE3A 3WTTC 3TDZC 4QTRA 4R8UA 1W5CC 4ECTA 5BPIA 3GTKA 2C00A 1S9HA 1XG1A 4ENJA 2L9NA 1QGPA 2QCOA 5KFTA 1B8IA 3CMMA 4G7ZF 1HW5A 1HKSA 1YE9A 3H92A 5EGOB 4HQMA 5J3LA 2FBIA 5JHUA 1FEXA 2A69F 3WNZA 3CCMI 1PUFB 1ZN2A 2XSJC 3RB3A 1Z05A 5JVTA 2ZNZA 4U0WA 2XGCA 4HYKA 2FEZA 1MMGA 1TQPA 4CSWA 2O6GE 4A2UA 1ETWA 3H0GG 3AG3H 2FSWA 3PFYA 3K4MA 4AVZA 2R8HA 3PW5A 1UZCA 2VN2A 3OYCA 2OV7A 2WV0A 3OMYA 4CCJA 3RF2A 3LSJA 4DIQA 2EIKH 3ZMVA 2H27A 3GIQA 5J1RA 4YEJA 1BI0A 2R92G 2LSOA 4IPAA 2P4WA 5EWFA 3OTOH 4B48A 1ZQ3P 1TA8A 4UCTA 1MNDA 2JVHA 3CJTB 5FLMG 2XGPA 4IRDA 2XUBA 4ECSA 1BNCA 3QQAA 4H4KC 4C3IJ 1UB9A 5DQGA 4L0ZB 3HZJA 3LSRA 1ONVA 3CMEI 3H9GA 4M7EA 3GVAA 2XGQA 1Z3XA 2IW5A 2W25A 1KEEA 3V6JA 4CH7A 5HNFA 1I5ZA 2W85A 2VR1A 5DS9A 2R7LA 4PWQA 4CYDA 3UFXB 1ZRDA 4DBQA 5KG1A 4PZJA 3RKWA 4FETA 1VQ6I 4UUSB 3A4CA 4BXXJ 5BMVF 2KISA 3LL7A 4IWYA 1ETOA 3VMMA 1Y1VJ 2IXSA 4NQWA 1TBXA 2Z1DA 3FF5A 3PL8A 5LA6F 2FMLA 1RNLA 2FMYA 1O3QA 4HEA2 2Y0SA 2KDZA 3BR1A 4EM1A 1JXLA 4DV2H 2OBPA 2KHMA 3M4OJ 5M5YJ 3JR9A 1U8RA 2R82A 2EFPA 4U6PA 3I55I 1IN8A 2WC2A 4J9MA 4R8UB 5KFFA 4MEYF 1H8AC 4MTEA 3EYYA 1JKQC 3W6KB 2Z9OA 3ECOA 2JA8J 4C5CA 5D5WB 3JREA 1R4NB 1R9TJ 1Y0UA 1B8IB 2OCCH 4KT5C 2CV2A 3ZQ7A 3UR3C 1XPXA 1D5YA 3G8CA 5KFNA 3Q8QB 1HOMA 3CZ6A 4TQSA 1FIPA 1GT0C 2JA6J 2V7FA 3NAUA 3JAMZ 5EZYF 4A3DG 3K70D 4D5CA 5J4YA 2UUBH 3ASNH 1T94A 2R5YA 2IAIA 4DL3A 4A3BJ 3PIOF 1FTTA 2PJRA 2WTEA 3OL4A 2XROA 2L01A 2R4GA 2W1OA 3ZCOA 2DA1A 1D5VA 3JZIA 5D8DA 4DV0H 2P6TA 3CF2A 4DL6A 2KIUA 3PJRA 3GFMA 2HTJA 1KZHA 4TV7A 3I54A 2KRFA 4Z6YA 2J6UA 3L2PA 3ORRA 2LKXA 1BJTA 2MYSA 3I56I 3QRFF 4EYIB 1FWZA 1BW5A 4RNMA 3O3KA 1BOAA 3A0BC 2C2DA 2DYSH 4ED3A 4DUYH 2DO7A 4ASNA 5K7FA 1W7PA 3TGNA 2F5VA 4IHVA 2PN1A 4HQEA 1ETQA 5DLGA 4BHBA 2R7DA 4D5FA 5LL6b 5DUIA 5EDNA 4XLFA 1SVMA 2FBHA 4P55A 4BXUA 3M9AA 1I27A 1OISA 4MO7A 2O3FA 3JRFA 3RZOJ 4J9OA 4J9NA 4I02A 4A5MA 1VKZA 1HXDA 3O8HA 2CQ7A 3RV4A 2IA2A 2ME6A 5FFXA 3PIPF 5H20A 2JA5J 2JWTA 4NQWB 5KG3A 4MQ9F 2YYAA 2NNNA 1NTCA 4YBZB 1KC7A 2X6OA 2L0KA 4A3GG 4E7JA 1PJRA 3S3OA 4JBAA 3M07A 1DV2A 3E5XA 1LJ9A 4MV4A 2IGMA 3QFFA 3K9TA 5JVDF 1N34H 3H0GJ 3QODA 4B09A 3L2WA 2E34A 1WI3A 5J40A 4PSXA 4EGZA 2PX9A 2ZBKA 2ZCWA 3UNGC 2FPPB 2IS1A 2F2EA 1RKWA 2ZJ2A 4JQFA 2FJZA 4FHTA 3FXLA 3OSGA 2ASJA 1FPQA 4IZOA 4G9YA 1S7EA 1TW3A 2I5UA 3HPHA 5FLMJ 3OYKA 4Q5SF 1IBKH 1G3TA 3PO3G 5FROA 2ICWG 3W2WA 3JSPA 1Z7UA 2R5YB 3L2VA 3K6GA 4XKCA 3BA8A 3HOWJ 4QIWE 5BS6A 4IHYA 2F5FA 2ELJA 4JX5A 5KFQA 1LFBA 3QP6A 1QHGA 1TTYA 4JV0A 2L5QA 4RM3A 4ECUA 3I9V2 1P7IA 4ABZA 3GTGA 1RK5A 3RAQA 1ACIA 1SFOJ 5KG2A 3ZQGA 5DCFA 1FOKA 4L18B 1FMWA 1HA8A 3T1BA 3AG2H 5BOXA 2VQGA 4ZJZA 3JRCA 1W7PB 4X65H 2R93A 2M8EA 4WXDA 2PFBA 3HKZN 1GHCA 3VYUB 1OR7C 4EJVA 2VOBA 2GWRA 2PMZN 2Q8KA 3BC8A 1F1ZA 1RESA 3DEUA 1ETKA 1LDJA 4EM0B 2R84A 3HIFA 5HOOA 3FXJA 3MWDA 2DJNA 2HXOA 2ZNYA 2P5KA 2VJIA 4F4XA 3B6AA 3K7AJ 1H0MA 3PQJA 5LHGA 3RB4A 4A3DJ 3LA3A 3BQYA 3QWLA 4RLFA 5EEHA 3V4SA 2VXDA 3TOBA 3I71A 2C6YA 2NVTJ 1DV1A 4O4LF 1SD4A 1U6GA 2CW7A 2DA3A 5HLTA 1K4SA 6PAXA 2IMWP 1YHQI 2VKHA 5TISC 3D5LA 4GRIA 5IP7G 2VUMA 2L9RA 4DZJA 1LEAA 1UFMA 4KN7X 1IG7A 4ENMA 3CDHA 3I4NG 2VPLA 1PP8F 3GTOA 5DGBA 4JI4H 2BE5F 2Y9ZA 2ZC2A 1RRJA 2C22A 2BQUA 1W1WE 1Z77A 4M3GA 3RYPA 4LH6A 3LWFA 3CCVI 1IDYA 3JCUC 5KFDA 3RB6A 3PQKA 3PO2G 5KFSA 4N4NB 2WWYA 3RGZA 4A0YA 1V4RA 4CCLA 4G3IA 4HDVA 3CLQA 4X66H 4XRSA 4X1EA 2BOLA 5DG7A 3GF2A 4O4IF 3CC4I 1X19A 1O3TA 2UXBH 1IOWA 2M87A 2G7HA 4A3GJ 1G8XA 2E1OA 5LGUA 1JKOC 3S1MJ 1Y56A 3SYTA 5L3BA 1WSUA 3RTRA 1IV8A 1OYIA 3KEQA 4A0ZA 4TQRA 2W9AA 1JDBB 1WH5A 5D8LB 2FK2A 3ETHA 5JVLA 4ON0A 2L02A 3LSKA 3IWZA 3K4NA 4XMYA 2O61A 3BTIA 4IQJA 4LK1F 3U1KA 1Z91A 1I3AA 2K3PA 4J0MA 1U2WA 1USSA 5JR3A 1UELB 4B3SH 1XGSA 1ZARA 1A36A 3Q2OA 3DU6A 4O3MA 5D8KB 2R7RA 1HR0H 1WR2A 3V42A 3CCRI 4A3FG 4AYBA 5LD2C 5KT6A 1STZA 3GTQA 4CA0A 4A12A 2IEKA 3TIIA 2LD5A 3Q0VA 1SAXA 3WE2A 4E4TA 1N25A 3GIMA 2UU9H 1SEIA 2V1UA 2CMPA 1R1TA 4ZHQF 1XD7A 2CQKA 3PW4A 4A0XA 4Q8FA 1HQCA 2Y9YA 1WVRA 2EILH 3JRXA 4Y7NJ 1LDKB 4HLYA 3T1YH 1X58A 3ZN0A 2MA3A 4F3QA 4J01A 3RPUD 2STWA 2W7OA 2YS6A 4C9YA 5JFRA 2M0CA 1X2MA 2YSRA 1I1SA 3F8CA 3QPHA 4BBRG 3E1SA 1X4OA 3BQ2A 1EH6A 5IT9Z 3TIGA 2KRCA 2ZXIA 5E3OA 3H20A 2HDWA 3VFZA 2CH0A 4ECZA 2BY3A 3GTLA 2M30A 1UG0A 4F92B 2H6CA 4BH9A 3PUBA 1RR7A 1ZLKA 1D8JA 3MR2A 1B33N 3WU1B 1IAWA 3S16J 2YL2A 4HV6A 5D5UB 3GTKJ 4F50A 3ASOH 2UUCH 1MBEA 3FKIG 1B1BA 1MD0A 2ECBA 2DPUA 2HYGD 2YW2A 2IBKA 4PJJA 1UAAA 5IP7J 2VE9A 1VI0A 3KAKA 3CCSI 3JSNA 5ERIA 2WB1N 3EPZA 2A5WA 3ZQLA 3FMQA 5IPAA 5FJ8J 4BQQA 4DV5H 4NLGA 1YX3A 1JIHA 1I50A 2MABA 4HF0A 2QLZA 5ICCA 3MZHA 4E7ZA 5HS8A 3J7AY 1YS6A 1YO5C 3PO2J 1X1BA 2FBKA 4R8HA 3CCUI 3IH3A 4DV1H 2P6SA 3L7WA 2DDAA 2XAFA 3I4MG 3MMYB 4Y13A 2OC6A 3JW4A 3QU6A 3COAC 1YIOA 1Y8RB 3FISA 2KIMA 3EDPA 5K7HA 4HR7A 3GIDA 3G2BA 4Y3OA 3S2HJ 1IN7A 4MV9A 5C3EG 2L7FP 3G6VA 5F08A 2IBDA 3HSRA 2QKMB 2EA4A 5FRNA 5IYBJ 3QP5A 1VQPI 3W2AA 3T5HA 3KP6A 4S04A 2EFOA 4ECQA 2AXTC 3ONQA 1XX5A 5IWAH 1TW2A 1P9QC 2DWCA 1O75A 1JUPA 1R1UA 2K4JA 1G6NA 2X6XA 2CS3A 4RS8A 4AU7A 3JAMK 4ENKA 2CO5A 2FOWA 3A03A 2DT6A 4HSTA 3R5HA 1R36A 3IG0A 1W0UA 2QSHX 2R7NA 2A68F 3EUHA 5HLHA 2HNHA 4UV8A 5KX5F 2UZKA 1YLFA 1FBQA 3DEWA 1PUEE 3GCMA 3OYNA 3KFWX 3P9KA 3PSFA 1MBKA 2FPGB 5IYDJ 2FPIB 4IRCA 4BY7G 3KP3A 2R93G 1IRXA 3H5NA 2XKPA 4A3FJ 3U9SA 3U9GA 3R0AA 2CJJA 1BI2A 3NQOA 4II3A 4LMYA 4KIGA 3LP8A 1GVDA 5JQWA 3D1NI 1I1GA 2W4SA 1RYSA 3M4IA 3BG9A 4E70A 1VQLI 3SZTA 1W0TA 2FP4B 4DZPA 4A69C 2A6TA 2X1CA 3DBLB 4RGXA 4J00A 1WJDA 3HSFA 1FJLA 4FX4A 3H3VK 2E2JJ 1RPWA 2V5AA 3E7LA 1AUXA 1FYKA 2DMQA 3LFUA
chains in the Genus database with same CATH topology
4FX0A 1S3JA 5AONA 5F1RA 2IP2A 2JT1A 1ZRCA 2DPDA 4HLXA 3IC7A 2EFNA 4I0AA 4KN4X 2VBWA 5FPRA 1ZYRF 5DEQA 3LQRA 2VONA 4AQYH 2M45A 2BBYA 1TLHB 3WTSC 2EFQA 3WU0A 3WGGA 2Q2UA 3E6DA 3JTGA 1JHHA 1WQ2A 3QAHA 1LEBA 2E1NA 1HW2A 1X9NA 4JK1X 4EMSA 2YX7A 3K2ZA 1TNTA 2O03A 1Z9CA 2BV6A 3DFGA 1KA8A 2BEOA 5ICFA 4EGYA 4JI2H 4GYIA 1DPRA 1BIAA 3C0FB 2XV4S 2FNAA 4O6JA 2HDCA 3WG9A 1K79A 1ZAOA 4UCSA 2LNBA 1IBLH 2MH2A 1GXQA 4CC5A 3K1PA 4RB2C 2GZWA 4YY3H 2UXDH 2KSWA 1PP7U 3CLOA 2Z3YA 2VXZA 3E3VA 3B02A 2XAHA 2OAZA 2XASA 3BAAA 4KMUX 4XSXF 2K4BA 3Q9SA 1DDNA 2IA0A 2B0LA 1XCBA 1M0TA 2OU2A 5E1XA 2O8XA 1D3YA 3HUGA 3U1DA 1G4DA 1KU7A 2D45A 2QUFA 5KVRA 1W4MA 3K1NA 2D1VA 1J7KA 1QZZA 4RZQA 2HFHA 1R22A 4R1HA 5ILVA 3FM5A 1R23A 4M71A 1LVAA 2FOKA 4I09A 1W5TA 1S68A 1IXCA 3V4GA 4LF8H 4OIOF 2BYVE 3ZMDA 4LD5A 1T38A 2TDXA 4EQQA 1I94H 4EJTA 4HYEA 1FBSA 4EV0A 1U5TA 2VE8A 3GLXA 1R7JA 1JHFA 2LKPA 3J81K 3M8FA 2EWNA 3N97A 3MFKA 3NEUA 3CTAA 4NXNH 4RGUA 4HX7A 4LF4H 4N9IA 5HDKA 5IT9K 3KP2A 5CJ9A 3BZ6A 1E17A 2DT5A 1XGOA 2OQRA 3MEXA 5K5OA 1J0RA 3L00A 4BHCA 2EK5A 3KAJA 1ZGJA 1I6UA 3CJNA 1FNNA 3J81W 3CVZA 1FBUA 5A2QZ 5FLXZ 2OZ6A 2P5VA 1I6XA 3QOPA 5IT9W 4HAMA 3BDDA 5LEJA 1VTNC 4UVBA 5H6QA 4HDUA 3N43B 3TQNA 3S2WA 4IF4A 3KP4A 1B6AA 3LAJA 4KMFA 3O2PE 2E5LH 1U5TB 3MWMA 5J8CA 4UUVA 3DPLC 3TDUC 4GKJH 2OQGA 1XDNA 1W7PD 4I0BA 3C18A 4L0YB 3P9CA 3WGIA 1J5YA 1OYYA 4ETSA 2MD5A 3SZPA 2KJBA 3U2RA 2MCTA 4AIHA 2HZTA 3HRTA 3KZYA 5LRRA 2ESNA 5L3EA 1DP7P 1XDUA 3WTUC 2J5OA 2Q2TA 5H6RA 3RKYA 3BWGA 3WTWC 4HBLA 1ZG3A 4YFKF 1R58A 5KK1A 1YW7A 3V8JA 1O7FA 4Q47A 2RDPA 4NB5A 3ZMUA 5TRDA 3FXQA 3HRMA 2K86A 2EV0A 4M6XA 4WXHA 2VOPA 4MNUA 1OYWA 2UUAH 2QQ9A 5E1WA 3F72A 3I64A 2ESHA 2UXNA 3WGHA 4CHUA 3I53A 4X64H 2DTRA 4L5JA 4GCVA 2PN6A 1KQ8A 2LF8A 4IXAA 3FMSA 4LLGF 3IHUA 4MV7A 3F8MA 1XN7A 2NAZA 1M0WA 4CO8A 1ZH5A 2L4MA 3LA7A 5L3CA 3MQ0A 4DV4H 2RNJA 3ERED 5J6XA 4LH7A 3BJOA 2WE6A 1GVJA 3KCCA 4L9NA 5E20A 5BR8H 4EFBA 4KICA 3KZZA 3DPTA 5CVJA 4LGWA 2W84A 1F5TA 1B59A 3J80Z 4I98B 2VUGA 2IT0A 2ZMEA 2H6BA 2ZM6H 2O0YA 3BOQA 3PFIA 5LRSA 4ZYHA 3V8KA 2XAGA 3VB2A 2A6EF 4AIKA 2HEOA 3F8BA 2VC0A 3DQVC 2QM3A 1JE8A 3E6MA 2DLLA 3EETA 1QQIA 5DCMA 5ILSA 4Q0YA 2Q0OA 1L3LA 4LB5A 5DV5A 3OV8A 3R61A 4LF7H 1WKMA 2ZKZA 4LSAA 2Z5UA 5LHIA 4B8XA 3T5XA 2FF4A 1DGSA 4PCQA 1FVIA 3IRQA 1Z2NX 5CLSA 4YFXF 1IXSB 2QQBA 4UV9A 3N4MA 2E1CA 2Y75A 4O5VA 4BAYA 1XMKA 1O57A 1P92A 1TQIA 2DQLA 4QLCU 3ULQB 4LF5H 1YYVA 3E6BA 1H9GA 4MTDA 1LB2A 5EEGA 1DUXC 2A61A 2UXCH 2QYOA 2IVMA 1B9MA 2STTA 4DV6H 5E1ZB 4K0KH 2V1XA 3T8RA 2EV6A 4M72A 3HHHA 4CDGA 2JRTA 3N42B 1KYZA 4XBFA 2DQRA 2G9WA 3I58A 4UVAA 2HHHH 4L9TA 2ZMEB 2HVRA 1MKMA 4RB3C 1IUYA 3IKTA 1T2KA 2Q2EA 2QZ8A 3RJ0A 2OWOA 5K5RA 1XDSA 3BABA 2GIVA 2K27A 1R5GA 1LNWA 5DCMB 1U5TC 2L4AA 2HR3A 4YIFA 3BP8A 1QZYA 2P7VB 4PDKA 3F3XA 1S8NA 5CVIA 1O7LA 3E97A 4F7ZA 2V1DA 5D5XB 2CSOA 4CXFA 4LSXA 4YFNF 3GZ6A 1S29A 3K1MA 3CO6C 1QBJA 3N40P 1K6OA 3TO7A 2PI0A 1Z1DA 4XSZF 5HS9A 2NRAC 1A0IA 4ESFA 3REOA 2IPQX 3GX4X 4NHJA 4P96A 1S7OA 1MJBA 1IN5A 4UVCA 1R5HA 3IKVA 1FSHA 3SHFA 4UFZA 4JI8H 5HLGA 1YG2A 3MCZA 1LDDA 1XMAA 3GZ5A 3SXYA 2WDTA 2XIGA 1X3UA 1XB4A 4H0EA 5LGNA 2MBFA 1ULYA 4BWSC 1FC3A 1S03G 1E4GT 3HRSA 5DD4A 1HKTA 2ISYA 3G73A 5FD6A 3F21A 1ODDA 3IWFA 3C1DA 2ZJTA 4R79A 4P5OA 4WCGA 4HX8A 2RGRA 1V3FA 1P4WA 2IRFG 3GW2A 1CGPA 2D2WA 4PGGA 2QBYA 3Q9VA 2P8TA 1FYMA 4I01A 3V7CA 5D1OB 1V9PA 2XVCA 4M74A 1UCRA 2D1HA 4UCUA 1KU2A 3DP7A 4JI3H 2RKHA 3BJAA 3VODA 3WODF 4JI7H 2V9VA 2VBZA 4GXOA 2DBBA 3EQLF 3D0SA 2W24A 1ON1A 3JSLA 3MAJA 1XSXA 2CGPA 3RPQA 1MJAA 1WH2A 4ZYDA 2PLYA 4DR6H 1YQAA 5LBQA 4DR1H 1K78A 4IHSA 2LF7A 3JAMW 4WX9A 4L9VA 3GXOA 1BN5A 4DQ2A 3P9IA 1C0WA 1HKQA 2PMUA 4IAJA 5L3DA 1J5EH 4BYYA 2VT2A 2ISZA 3I59A 1N32H 2QBYB 1ZGAA 5D6EA 2H94A 3TO6A 3CUOA 2PQ8A 4OINF 3ZP5A 3K69A 1FT9A 4KDPA 4WK8F 2XGXA 3JTHA 1QO0D 2FQ3A 4BQAA 5BPDA 2PG4A 2RVCA 4ZZDA 1XMOH 4IRIA 2FXAA 5E17F 2VBYA 5ICGA 4X62H 1IN4A 5AIPA 4OU0A 5F64A 2DW4A 1KGSA 4M73A 2XAQA 3DF7A 3TKYA 4XLNF 4DR2H 4RB1A 4QWQA 5DD8A 1K78B 5TJJA 4AIJA 3VOEA 4P9FA 1K7AA 3QPTA 1CF7A 3F22A 3BA9A 1XNRH 3RYRA 1FP2A 2RN7A 1BC7C 3I59B 5D5VB 1U78A 1XCVA 2AS5F 1FYLA 4CZZA 2Y0MA 1OPCA 2VODA 4GYGA 5LLQA 2COMA 4ESJA 3HRUA 4L9JA 4AD9A 4U7BA 4EFEA 4U0VA 1MJ9A 3FZVA 4EJUA 2HGSA 3R6SA 1P6RA 2NNYA 2IA1A 1RUOA 4GKKH 3BPXA 1JGSA 1KYWA 2CW8A 2MC3A 1ZG1A 1Q1HA 3ISPA 2JZYA 3F6OA 1RIOH 4XRFA 2EA2A 3V7SA 3LMLA 2OA4A 1MGTA 4I7HA 3RGXA 3LFKA 4U88A 3ABUA 2FNPA 3FMAA 1B04A 1SD5A 2ETHA 5D4RA 3CUQC 4HOBA 3EYIA 1RUNA 5FB2A 4XLPF 4DV3H 1MZBA 1CF7B 2VOOA 3ECHA 4AVPA 1VS0A 1IRGA 4GO1A 1BGWA 4LJZF 2GA1A 5AIQA 2GAUA 4Y17A 2XRNA 4B3MH 1T0FA 4U0YA 1G3YA 2E7XA 4KNYA 1FJGH 1IW7F 4DR5H 1YFHA 2MLKA 2P7CB 2X4HA 5CVRA 1EH7A 2G7UA 1QNTA 4G6QA 2ELHA 3KETA 2J5PA 1TQMA 4RGRA 1SD7A 3I0TA 3AAFA 5CVVA 2R7FA 4ZH4F 1BI3A 3L4JA 1BM9A 5FPOA 2VQFH 4HV5A 4LG0A 4CGZA 4G7OF 3BPVA 4LLLA 3V7RA 4A2AA 5LHHA 5J8FA 1RI7A 2L3DA 1XSVA 2QVOA 4GGGA 3MZYA 1E4FT 1XNQH 2WYOA 3T8TA 3DKWA 4MGRA 1U3EM 3C3WA 4JYAH 4Q48A 5LGTA 1HW1A 3SQNA 3KLOA 2HTSA 3HXLA 2ACJA 3R0JA 1YW9A 5CVUA 5DUKA 1Z6TA 3UQ8A 2ZXJA 1FLIA 2DAOA 4D0PA 4AWXB 1SFEA 1IBMH 3FXRA 4FT8A 1T6SA 3LAPA 4KHPH 4KIFA 3R4KA 4WWCA 2K7LA 4LG0B 1ZLJA 1YTYA 3E6CC 3RTXA 1GYFA 4K2EA 2UXXA 2RQPA 3KALA 2Z33A 3F8FA 2KKOA 1B9NA 2M5WA 5K5QA 2QQAA 1HNWH 3RIZA 1YS7A 2H09A 2GQQA 4MEXF 4OX9H 1HSJA 3N41B 5ED4A 4ENNA 4LB6B 5DYMA 3F6VA 2PJPA 2DK8A 4N9HA 3ZN1A 4YHHH 3LSTA 4ZYEA 1LQ1A 4LFUA 3ABTA 1SMYF 1SMTA 2HQNA 1O3SA 3DF8A 3RDIA 3IRRA 1SD6A 3FM3A 2F5DA 3RJPA 1BJAA 5ILUA 4IRHA 4PGHA 1F4KA 1IN6A 3GFIA 3ML6A 2V6CA 1R00A 2A3SA 1J59A 4G7HF 1DPUA 4RGSA 4ZZLA 1SFUA 1ZHQA 2AXLA 3G3ZA 1P4XA 1BI1A 2M1BA 3M8EA 2HGCA 5DDGA 5ICEA 2CWEA 4KUMA 3H3ZA 4Z2YA 3KE2A 2R3SA 4UHTA 4EVIA 4DR4H 1XMQH 3E5UA 1UHWA 1KQ9A 3DV8A 1IRFA 2HYFA 1XGMA 1HBXG 1N36H 4RAYA 2QWWA 2RGVA 4MHGA 1EH8A 5IT3A 3SFZA 1N33H 2DU9A 2YR2A 4OIPF 3RKXA 1XSDA 1KQ0A 3LA2A 2KJCA 4EJOA 2Z99A 1E2XA 3FX3A 1R1VA 3GFJA 4DV7H 2HWVA 4HF2A 5F6FA 4HA8A 1O3RA 2OD5A 4M9SA 4UCOA 4A2BA 1ZHFA 5FO5A 1BBYA 3RIRA 1G3SA 3L4KA 5L3GA 3PN1A 4LF6H 2MLGA 4M6YA 5HS7A 4Y15A 1P8LA 2L54A 1JXSA 3F23A 1ZRFA 1RZ4A 2YX4A 5E18F 1HNXH 2LDUA 1XGNA