2W57A

Crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
b'DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
publication title Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Metal transport
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w57A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2w57A02
2FXAA 1B59A 3RPQA 4WCGA 2RKHA 5DD4A 1J7KA 1T98A 3F72A 5E1ZB 2PN6A 1HBXG 1KU7A 3IKVA 3ABUA 1FP2A 3V7CA 3NRVA 2P5LC 1G3TA 1LB2A 3B73A 4HF1A 3D0SA 2G9WA 4XLNF 2Z9OA 3EYIA 3C7JA 3RJPA 5K5QA 3CDHA 1EH8A 3F8FA 3BOQA 4LG0A 4WXCA 1XB4A 2QQBA 4EJTA 4LMYA 2QZ8A 4IVNA 2O61A 4JBAA 4A12A 1I5ZA 1DPUA 4B8XA 1ZRCA 5HLIA 1ZG5A 1PP8F 2O0YA 5LHHA 2NRAC 4CDGA 4ZZDA 2QVOA 3BJOA 1QZZA 4L9NA 3E97A 2P7VB 3RIRA 2FA5A 2ZFWA 5CVJA 3RKXA 2A3SA 1ON1A 3QPTA 3K1NA 5D8KB 3IHUA 2Y0MA 3ABTA 1TW3A 5IT9K 3R6SA 1G4DA 1XDSA 2UXXA 4Q5SF 2XKOA 4G6QA 2KJBA 2ESNA 4DQ2A 2VBYA 2UZKA 1ZG3A 3LSTA 2JPCA 4KN7X 3M8FA 1FZPB 2Y75A 2ZMEA 2VC0A 1ZGJA 4P9FA 3EQLF 2L02A 2O6GE 4I09A 4CGZA 1CF7A 1MJ9A 5LRSA 1YLFA 3CUQB 1LNWA 1FPQA 2FF4A 1RUOA 4L18B 4NHJA 3MZYA 4L0ZB 4HYEA 2YX7A 1B6AA 5LHGA 5DCMA 4E70A 5F1RA 3U1DA 1YW9A 1U5TA 1IAWA 1DP7P 4ENMA 1YS7A 1OYWA 1K6OA 1WRJA 3O2PE 2A5YB 1H9TA 3KP4A 3IWFA 2DK5A 5FB2A 1QPMA 1R00A 2MH2A 3HHHA 4BHPA 3E6BA 2XROA 2ELHA 4YFKF 1YYVA 2UWMA 5D4SA 4MEYF 4HV5A 3JTGA 2VN2A 4I98B 3CJNA 2FQ3A 1WSUA 3I71A 3O3KA 3KZYA 3RYPA 4NQWA 5J8CA 2K02A 4MGRA 5D5XB 3BPXA 1YQAA 1OKRA 1KU9A 4GXOA 2DO7A 1S8NA 3R60A 2VC1A 4EGYA 5LGNA 5HS8A 2QENA 5K5OA 1Z9CA 1E2XA 3ZN1A 4AVPA 1F4KA 4B09A 4OIQF 5AONA 3MFKA 5DCFA 2G7HA 1Q1HA 4U0VA 2PQ8A 4RAZA 4DNCA 5ICFA 4HW0A 4ASNA 4UUVA 2F5FA 4EJVA 4YG2F 1EH7A 2A68F 1QO0D 3SQNA 4BH9A 3V8KA 3ZMZA 2YPRA 1FY7A 3I59B 2MA3A 3HHGA 3PQKA 2Y48A 3EYYA 4K2EA 1P6RA 1QBJA 3GLXA 4N9HA 1W5SA 1H0MA 2FNAA 2OQGA 4LB5A 1X3UA 2A69F 1BJAA 2HGCA 4YFXF 4HLYA 3S2WA 5E8GA 2PEXA 2OZ6A 1C0WA 5BOXA 1BI2A 1XMAA 1YW8A 2M30A 4FHTA 4KUMA 4HQEA 4HF0A 2HZTA 1LEAA 4A5NA 2HR3A 4IHSA 4L0YB 4UVAA 1R5GA 1TNTA 3RPUA 2DQLA 3V8LA 1BIAA 3FMQA 1J75A 1UHWA 1TNSA 2HKOA 4OINF 2PI0A 3W6JB 2L4AA 4UNOA 1FBUA 3I54A 2YX4A 4ESFA 4AIHA 1S7OA 1TBXA 4RB0A 1MJAA 1ZN2A 2EV5A 1G3WA 2BGCA 4M9ZA 1SMYF 2RVCA 4EV0A 2V9VA 1QGPA 2W57A 4RGUA 1VTNC 4TV7A 2OBPA 4WXDA 3WTZA 1LDKB 2OAZA 1F1ZA 2V1UA 2GWRA 3J81Z 3WODF 4P5OA 3KLOA 3R0JA 1K78B 4U0YA 5E1XA 4A0ZA 4BYYA 4HF2A 4NB5A 4UVBA 4CO8A 4GYGA 4RB3C 3QP6A 5ICEA 4A0XA 1IF1A 2KRFA 4P96A 2MLKA 4PCQA 1O7FA 4M9XA 2GA1A 1OPCA 2HYGD 2IVMA 4LLGF 1O57A 4XRFA 3FXRA 4IPAA 1UFMA 1FSHA 3KLNA 1T0FA 2FE3A 4P55A 2K4JA 3SFZA 4HBLA 1AWCA 1HSTA 4ZYGA 5A2QK 2WC2A 3E6MA 4XBFA 2H6BA 1J5YA 3F6VA 2FNPA 3DF8A 4ENJA 2DTRA 1R36A 1MJBA 4LG0B 3DFGA 2YSRA 1LJ9A 2G7UA 2RNJA 3U2RA 3TOBA 4KIGA 2XAGA 3WE2A 5JHUA 2VONA 3V7SA 2ETHA 3MQ0A 4YIIA 5DV5A 5CVRA 5CYVA 3N4MA 2EV0A 2M1BA 5DDGA 4O5VA 2EK5A 2NYXA 5D8LB 1GXPA 3BJAA 3L9FA 2DLLA 2IRFG 2FOKA 2LF7A 2ISZA 1ZGAA 5HLHA 3P7NA 4EVIA 2EFQA 3FM5A 3IC7A 3REOA 5K5RA 3HOTA 2E1NA 1ONVA 2ZMEB 1GXQA 1P2FA 1RZ4A 1BIBA 1FT9A 2D1VA 1BN5A 3P9KA 4M72A 2OQRA 2A6HF 2W24A 3EDPA 4AIJA 3DPTA 4HLXA 1Z6TA 4HX7A 1ZLJA 3VEPA 2IA0A 3COAC 3DPLC 5HS9A 1FP1D 2XAFA 2Q2EA 2DI3A 5DCMB 3ZMTA 4I01A 1U5TB 4BNCA 2ZJ2A 1SFEA 2DT5A 4L9TA 5IT9Z 2FBIA 2M5WA 1RNLA 4PGGA 3FXQA 2R7DA 1SD4A 4I7HA 4LFUA 4U7DA 3VB2A 4IXAA 3TO6A 3HSEA 1FLIA 3HOSA 2F5EA 1IRFA 2RV8A 4ZYHA 2EV6A 2P7CB 2FEZA 4Q48A 2J5OA 1IUYA 2MD5A 1BOAA 4G7ZF 3QU3A 4GO1A 4QLCU 5DD8A 2Z99A 2PFBA 4RGXA 3IRRA 4HOBA 1W5TA 2ACJA 2VT3A 4Z2YA 4U7BA 3E6DA 2RQPA 1G3YA 1XN7A 4R8HA 3K0LA 2CW0F 1NHAA 3V4GA 2IT0A 3HTUA 3FMRA 2A07F 2KIFA 4KNYA 4MQVA 1Z6RA 5ED4A 3LA7A 4OMZA 4A2UA 3TQNA 1XGNA 5IT3A 5LLQA 3BZ6A 1J2XA 3WU1B 1IN7A 1MZBA 2GZWA 3P9CA 3WGHA 5JR3A 4KMFA 3R4KA 5FGMA 4M71A 1BI3A 5KVRA 2JSCA 3OOPA 4AIKA 3B02A 5ILUA 5HDNA 2PJPA 2F5CA 4FX4A 3JW4A 1R7JA 1LDJA 3WGIA 1XGOA 2CFXA 3WTSC 3BROA 4IRIA 2EJRA 2GA2A 3WTTC 4D0PA 2E7XA 3I0TA 1DPRA 1QNTA 4G7OF 3M1EA 2ISYA 1S7AA 3K2ZA 4EMSA 1P4XA 1FYLA 3Q5FA 2HFHA 3I64A 2EA2A 3GEZA 3WTUC 3GFLA 1EH6A 4FX0A 2E7WA 4MQ9F 2AXLA 2EFNA 2JTVA 2L54A 1E17A 2XAJA 5DUKA 1TQIA 3WTWC 3F8BA 3RKWA 1YO5C 1ZRFA 4YIFA 4A0YA 3FZVA 1I1SA 3DXJF 2K27A 2EFOA 1FNNA 1I6XA 3F6OA 3LQQA 1MDMA 3HSFA 5BMZA 3KP6A 5H6QA 2QQ9A 4IHTA 2ZCWA 4EM0B 1IRGA 3KEQA 4CICA 5CJ9A 1KQ9A 1ZRDA 4EJWA 3C18A 1Y0UA 4WWCA 1KU3A 2P5VA 3M8EA 2COMA 1BC7C 3CO6C 3RTRA 3TO7A 2BE5F 1FOKA 4G6DA 4HDUA 4KFCA 2D45A 4OIOF 1YW7A 1R1UA 2M45A 1W4MA 2OA4A 3RKYA 3I5UA 1G3SA 5CVVA 4G7HF 1YIOA 2VBWA 3Q9SA 3FXUA 3IRQA 3RYRA 2IW5A 2K4BA 1ZLKA 2DPUA 3GXOA 1HSJA 1D8JA 1HW2A 5D5UB 3F8MA 3ZP5A 1IN5A 3ZMUA 1ZG1A 2QQAA 4ZZLA 1ULYA 3FF5A 3LA3A 3GZ5A 5D4RA 3TOAA 3P9IA 5ERIA 1REPC 2CGPA 4HA8A 4ON0A 1O3SA 1P92A 3BPVA 3MCZA 2EB7A 2KIMA 4HZFA 4GYIA 1XCBA 2XAQA 4KT5C 2JPBA 3I53A 3WTYC 3QP5A 1SD5A 1R23A 4Y17A 4KDPA 3HIFA 5TJJA 3TDZC 1HKSA 2LSOA 2JT1A 3ML6A 3F8CA 2QLZA 4L5IA 5LBQA 3AAFA 1B9NA 4HDVA 4OMYA 4ENKA 1V4RA 4OIPF 2BV6A 1W7PD 3MEXA 4BQAA 2H27A 4KYWA 3GFIA 2PG4A 4XSXF 2STWA 3FWEA 3ZMVA 6PAXA 4HQMA 1W7PA 3NEUA 4MTEA 3F23A 1F9NA 2VE9A 3CUQC 1XSXA 2H94A 2O8XA 5A2QZ 4MEXF 5BPIA 2A61A 2Q8KA 1OYIA 3H3UA 4LB6B 3JSPA 3GVAA 4M9SA 5FO5A 3HRSA 4RS8A 3N97A 1QZYA 2FMLA 1HKTA 4PZJA 5LHIA 4WX9A 3E5QA 2MBFA 2GIVA 2DU9A 4ZYEA 2V79A 5HVQC 1R22A 2NS0A 2W84A 5ICCA 1ZARA 1K7AA 3BP8A 2XKPA 4RGSA 2C6YA 3QRFF 4KN4X 3WTVC 3KP5A 1P4WA 3J7AO 4LJZF 4LGWA 1T39A 4S05A 4M73A 2P8TA 3E6CC 3EETA 4UV9A 3GYHX 1EV7A 2QUFA 1PP7U 4G8XA 1AOYA 1IXSB 4KA4A 2PMUA 3ERED 1U8RA 2A6EF 2IPQX 3GUDA 2NAZA 3RI4A 1LQ1A 4I0AA 4YFNF 1D3YA 1OYYA 5HDGA 5LEJA 1SD6A 3IL2A 2ZBKA 1MD0A 3HSRA 5D6FA 4A5MA 3ECHA 2HTSA 5HLGA 5DYMA 3NQOA 1XGSA 3KP7A 3GW2A 5L3BA 3R61A 2GQQA 3G73A 3OV8A 1IXRC 4L5JA 3KP2A 1RI7A 2IA2A 2R7FA 3JTHA 3RDIA 1IXCA 2ZNYA 2VOPA 1O7LA 4P9UA 2J5PA 4BHCA 2WWYA 1CGPA 3BY6A 4AWXB 2FBHA 5FD5A 2LDUA 3T8TA 2CQKA 3WGGA 3WU0A 5FLXZ 2OD5A 3JSOA 5E18F 2W85A 4HAMA 4WK8F 3W6KB 2DAOA 1B1BA 4I02A 5BPDA 2O03A 1SD7A 1BBYA 3K69A 3M9AA 2HQNA 3IWZA 5JFRA 2HS5A 3HRUA 2X0LA 3PFIA 5H6RA 1R58A 4N9IA 2X4HA 4O3MA 3CUOA 1J9IA 1R5HA 3VFZA 3T8RA 3F8NA 2DBBA 2EWNA 2EFWA 1PDNC 2D2WA 2QWWA 2HQRA 1T6SA 1XCVA 3E5UA 5D5VB 1JHHA 1MDMB 4GGGA 2ESHA 4IRHA 2MC3A 2P4WA 4CZZA 3LWFA 1XGMA 1D5VA 2IP2A 2ZXJA 1USTA 4KMUX 2KKOA 2FMYA 4Y13A 3J80K 1S29A 4G94A 5BQTA 2FRHA 2XRNA 2EFPA 5H20A 2HDCA 5HS7A 3DEUA 4CYDA 4KICA 2XGXA 1HW1A 3FHZA 2VXZA 2XUBA 4LK1F 1U6GA 3PQJA 3T1BA 1WQ2A 5ICGA 3ROUA 1FX7A 2MH9A 4CXFA 2CSOA 4IRGA 5FLXK 1R1TA 2JRTA 2ZNZA 3KCCA 2B0LA 2CG4A 2V6CA 2QBYA 4BXUA 2DPDA 3EUHA 3C3WA 5E1WA 3D5LA 4OU0A 2Z3YA 5L3FA 4S04A 4ZH4F 3QPHA 1IN6A 4M6YA 3HRMA 1IN8A 4EM2A 2H09A 3KZZA 3DKWA 1TQMA 3GF2A 2BEOA 4KIFA 4ZYDA 2K86A 4M74A 1RUNA 5KK1A 3Q9VA 3HTSB 4IF4A 4A6DA 1L3LA 1YG2A 4LK0F 4OOIA 3DQVC 3GO5A 3I4PA 5CVUA 1U3EM 2RGVA 1R1VA 2NNYA 1BM9A 2DW4A 4O6JA 3TKYA 1XSDA 2FU4A 2PBIA 3HYIA 1S6LA 3CLOA 3MWMA 5HOOA 3SZPA 4Q47A 1YTYA 4UXNA 2P6TA 2Q0OA 1W7PB 4BAYA 3LA2A 3WG9A 2RDPA 1YFHA 1HQCA 4BHBA 3T0YA 5CLSA 3KP3A 2TDXA 4Q4ZF 3ISPA 3JAMK 1KYZA 1LVAA 4ENNA 5L3GA 1U5TC 3QU6A 1OMIA 4EQQA 4ESBA 3VOEA 3GWZA 4XSZF 3MZHA 3T5XA 1TLHB 4R1HA 2XVCA 1KA8A 3KE2A 1OR7A 3M7GA 2ZO4A 2XHKA 1HW5A 2M8EA 4U0WA 2P5KA 1TQPA 1J0RA 5LRRA 1JHFA 2HYFA 1BI0A 1GHCA 5L3EA 4UHTA 2HKXA 3MAJA 4ETSA 1ZREA 3ZQ7A 2L3DA 4MTDA 1XD7A 4PGHA 3U9GA 1T38A 1L0OC 5ILVA 2KIUA 3G3ZA 1KYWA 4RGRA 4LD5A 5DUIA 5F6FA 5EEHA 3F3XA 4LLNA 1O3RA 2YR2A 2VE8A 5D6EA 2M87A 2XIGA 1XDUA 1F5TA 3FX3A 5AIQA 5D5WB 2F2EA 2HEOA 2XASA 4Y15A 1B4AA 1JGSA 5AIPA 2XAHA 3CO7C 1ZAOA 3BJ6A 2MLGA 4GCVA 2L4MA 1T2KA 3ELKA 1SFUA 4PDKA 4FT8A 1YS6A 4CHUA 4HV6A 3O6BB 1KU2A 4EJUA 1KQ8A 4L9VA 2V1DA 1I1GA 2VBXA 4H0EA 2DQRA 1D8KA 2IJLA 2CWEA 1O3TA 2DFIA 2RC4A 5LEKA 3I58A 1PUEE 2O3FA 1TW2A 2D1HA 2V1XA 3WTXC 1ZH5A 4HX8A 1IN4A 5J8FA 3L09A 2FBKA 1FYMA 2LNBA 3LQRA 1Z1DA 2STTA 1HXDA 2H6CA 2BYVE 3V8JA 4F7ZA 5CVIA 1TTYA 1ZHFA 2DK8A 1BC8C 5K1YA 2HOEA 1FYKA 1SAXA 3BWGA 1MKMA 3TO9A 1U2WA 4WF2A 3ULQB 5F64A 3SHFA 2IA1A 2PMHA 2GXGA 3WE3A 1SFXA 4MNUA 3CUQA 1UB9A 3ZN0A 4U88A 5E8IA 5FFXA 5BS6A 1KQ0A 5TRDA 4EJOA 2WV0A 3GFJA 2UXNA 1G6NA 3LAPA 3ECOA 3GX4X 1XMKA 2R3SA 3K1MA 4N0BA 1FSEA 1Z05A 1DDNA 2E1CA 3V7RA 5EEGA 1ON2A 4XLPF 3SZTA 4MHGA 4RB2C 4WXHA 2AS5F 2WTEA 1S3JA 3FMSA 4I2OA 2FSWA 3L2CA 1I27A 5DEQA 1WKMA 3QAHA 4KIBA 1SMTA 3ZMSA 2EA4A 2OU2A 3KEOA 2P6SA 4R79A 1LDDA 3F22A 3HRTA 3TGNA 4JK1X 2QBYB 2VBZA 2GAUA 3VODA 2Z33A 2KJCA 5JI6A 2PLYA 4RB1A 1UCRA 1Z91A 2QYOA 2LF8A 3QOPA 4M6XA 3SXYA 3R0AA 2HTJA 5HDKA 3F21A 2W25A 1FC3A 1USSA 3J80Z 2OZUA 1JXSA 1RIOH 4IJAA 4OIRF 1LEBA 4JQFA 1U78A 5L3DA 2ZKZA 3GZ6A 3LFKA 2LKPA 1UHMA 1FWZA 3L7WA 5L3CA 2JZYA 4ESJA 5LGUA 1KGSA 4QWQA 3ZPLA 2QM3A 2K7LA 4LLLA 3LAJA 4UV8A 3BDDA 1Z7UA 3HUGA 4EM1A 1DUXC 4RAYA 3KFWX 4EGZA 3I59A 2L01A 1V3FA 5ILSA 1HKQA 3ZMDA 2VODA 5E17F 1QQIA 2XV4S 2VT2A 1H9GA 1GVJA 4A6EA 5FFZA 3DP7A 4G9YA 5FD6A 3TDUC 5E20A 3C1DA 2RN7A 4I0BA 1J59A 1IZ1A 3CTAA 3H92A 3GFMA 1A04A 3E3VA 3K9TA 5J6XA 5LGTA 2CO5A 2BBYA 3J81K 2CYYA 4L9JA 1BI1A 1WI9A 1FBSA 1XSVA 1MGTA 1IW7F 1K79A 3DV8A 1CF7B 3E5XA 4AD9A 3IKTA 5JVTA 1ZYRF 2HWVA 4UVCA 3FM3A 3H3ZA 3L00A 1B9MA 2YU3A 1FBQA 2Z5UA 1STZA 2GXBA 4HX4A 1ODDA 2VOOA 3K1PA 1O3QA 1P4AA 3KETA 2F5DA 1JE8A 1WWXA 3JAMZ 1K78A 2ADUA 2NNNA
chains in the Genus database with same CATH superfamily
3FXKA 2FXAA 1B59A 3RPQA 2DTZA 4WCGA 2DJIA 4XIDA 2RKHA 1PX2A 5DD4A 1J7KA 1VQ7I 1T98A 2E2IJ 3CJRB 5KFAA 3F72A 2NS7A 2KRHA 4RDUA 3TP3A 4B3SH 1FVIA 4NNJA 4XM3A 1D1CA 5E1ZB 4DR2H 3OR1C 1P8LA 2PN6A 1HBXG 1KU7A 2R5ZB 4MV8A 4M7EA 2Y2ZA 1IJWC 3ABLH 2C28A 2X6YA 1MNEA 1FKAH 3JRIA 3OYDA 3RBEA 3IKVA 1GLNA 3ABUA 1RJQA 4BQNA 4ED2A 2E5NA 1ZTRA 1NH3A 1IRZA 1R49A 2ZXIA 1FP2A 4F52A 3V7CA 1O4XA 3GTGJ 3NRVA 3MWDA 5KFKA 2SCUB 2WAQN 3RAQA 2HPMA 2W6OA 2P5LC 3JRHA 1G3TA 3WHBA 4JV0A 2XB5A 1BR1A 1LB2A 3DTKA 4FETA 3B73A 4J9NA 4M3GA 2KLOA 3D0SA 4HF1A 2HZDA 2XGQA 2XDVA 1XG1A 2G9WA 5B66C 2FKLA 2HXIA 4FS2A 4XLNF 3KTMA 2R93G 2FUG2 2B63A 2Z9OA 3EYIA 5FRMA 3MKZA 3HM5A 2CV0A 2BY2A 3M9OB 3C7JA 3RJPA 5K5QA 3CDHA 3DLAA 5C44G 3G1LA 2C35B 5GAGJ 1EH8A 3PW7A 3W2AA 4KJZA 3JSNA 2JMWA 1YJ9I 3JRFA 3F8FA 3BOQA 2GOXB 4LG0A 4WXCA 1XB4A 3A03A 4A3GG 2M4GA 2QQBA 2QEXI 3EPGA 4EJTA 1XPXA 2EZLA 4BXFA 2NOGA 3AL0B 4LMYA 4EEQA 4J9PA 2QZ8A 1A6IA 4IVNA 3BR0A 4JBAA 2O61A 4ZJZA 4A12A 1I5ZA 5DTDA 1DU0A 1DPUA 3LSRA 1UC8A 1DIKA 3KZIC 3RSNA 4J9MA 4O3RA 4B8XA 1ZRCA 2R7ZA 4LH7A 1KJIA 5FKNA 5HLIA 1ZG5A 1PP8F 2O0YA 5LHHA 2NRAC 4BS9A 4CDGA 4ZZDA 4ZTFA 2QVOA 2R8HA 3BJOA 1QZZA 4L9NA 3KAJA 4A3JG 3E97A 1N25A 2P7VB 3MR2A 4NXMH 2OF7A 1I3QA 4C3IJ 3RIRA 3CCMI 5HBRB 2FB9A 1N75A 2AQFA 3H1CA 2FA5A 5IT9W 4J9SA 2RAEA 4DR4H 2ZFWA 4O3OA 5CVJA 3RKXA 2X6XA 4CYCB 3FKIA 1BJZA 2A3SA 1XNQH 1ON1A 3RFCA 2OV7A 4EEFG 3QPTA 3K1NA 5D8KB 4IOCF 1WHUA 5K7FA 4ZI7F 3IHUA 2Y0MA 2Z2SB 3ABTA 1TW3A 5IT9K 3R6SA 1G4DA 3S16J 2VOBA 1XDSA 4F4YA 2UXXA 5FLVA 4Q5SF 4DUYH 2XKOA 4G6QA 3PL8A 4XMYA 2KJBA 2ESNA 2E60A 1QU3A 4DQ2A 1RJRA 2VBYA 2UZKA 2FPPB 3LMLA 4YR2A 1ZG3A 3WO1A 1YRNB 1Z7LA 1KJQA 4NXNH 2X48A 2NOJB 2VQLA 4ECTA 5E3NA 3LSTA 4BBRG 3FKIJ 2JPCA 4KN7X 4ZYAA 3M8FA 4TUYF 3MR6A 1FZPB 2Y75A 2ZMEA 4C2MA 4RMNA 5T14A 2VC0A 3U9SA 1S7EA 3CD6I 4A3LG 1ZGJA 4P9FA 3EQLF 4J9KA 2L9VA 2RQQA 2K9NA 2XPVA 2VJIA 4FE4A 3IV5A 3H5RA 4YEJA 3OYJA 2L02A 3LMMA 2O6GE 4DZJA 3HOYJ 3PO2J 4I09A 4CGZA 4KITB 1CF7A 1MJ9A 1YE9A 5LRSA 1YLFA 3X2QH 2H1LA 2W71A 3CUQB 3A2KA 1LNWA 4PJ0C 1FPQA 1IDZA 3FK7A 5GADJ 1WVRA 3LP8A 2FF4A 3AYHB 1ULZA 2PN1A 3CMMA 1RUOA 3S1QJ 3GCMA 4L18B 4NHJA 2DZDA 3MZYA 4L0ZB 4HYEA 4C2MJ 3HXLA 2YX7A 4RM2A 1B6AA 2GLTA 2CZGA 2XD4A 4XRSG 1D0XA 3W3CA 5LHGA 4UCSA 2WDTA 5DCMA 4E70A 4M3DA 2GM4A 5F1RA 3U1DA 1YW9A 2E19A 1U5TA 2XC7A 1IAWA 3L2WA 1W5CC 1DP7P 2R93A 2VL8A 1GV5A 2NVXJ 1TWGA 2DPIA 1RYSA 3P5JA 3I4MG 4ENMA 1YS7A 2R7MA 4DIQA 1OYWA 1K6OA 1WRJA 3O2PE 1FJLA 5CB4F 1H8AC 3OUZA 3CJQB 1FOYA 2A5YB 3M07A 1H9TA 4O4IF 3KP4A 3AFHA 3QFFA 3IWFA 2FPIB 2DK5A 1WI3A 5FB2A 4AYBA 2R7XA 3H20A 1QPMA 3Q2OA 3N05A 1R00A 4CCJA 2MH2A 3HHHA 3BTIA 4BHPA 3E6BA 1ETKA 2XROA 2ELHA 1HNZH 2L7ZA 4YFKF 1R4MB 1YYVA 4XK4A 1S72I 1B8IA 2VJ5A 3PFYA 2UWMA 5D4SA 4MEYF 2WADA 1FIAA 1Y56A 4HV5A 1TWGJ 4ECXA 3MFHA 2W6ZA 3OS1A 4LH6A 3JTGA 4IHVA 2DPJA 2VN2A 4QPOA 2W70A 4I98B 3CJNA 1N78A 4O3QA 4I99C 1I50A 1TWCA 2FQ3A 1DGRM 4IRKA 2R7KA 1U9NA 1WSUA 3TQ1A 3I71A 2ZSIB 3O3KA 3HOXJ 3KZYA 3RYPA 3M3YJ 4NQWA 2DCEA 5JVGF 3E0JB 2YS7A 5J8CA 2JA8G 1SANA 2K02A 4ECWA 1VZ0A 4MGRA 5D5XB 2JEIA 2R8JA 4JV1A 2W8KA 1VQOI 5FLMG 1A6QA 2JSPA 2HHHH 1KZHA 3ZQHA 3BPXA 4APMA 1YQAA 5KFQA 1OKRA 2ASJA 1JXLA 1KU9A 4GXOA 2DO7A 1S8NA 1U8BA 2M2EA 3R60A 3GIDA 2FJ1A 5J2UF 2GBYA 1UELB 5F9NA 1A5JA 4JI8H 4YB8B 1ETXA 5KFNA 2VC1A 5GAHJ 4EGYA 3I3LA 4ECZA 4S0HB 4U6PA 1POGA 3HKZE 3RAXA 3H9JA 1Z77A 4F55A 1OCOH 5LGNA 2HU9A 5HS8A 2IGOA 2QENA 5M5YJ 5K5OA 3JRGA 1Z9CA 1JT0A 4HQ6A 2OLSA 1E2XA 3ZN1A 2FK3A 3LL7A 1LPQA 2DFFA 2KMUA 4AVPA 1F4KA 2E1MC 3MZ8A 4B09A 4RNOA 1VQ4I 2W9BB 3HL2A 5EYRA 2KPMA 4NUBA 3TBIA 2BR0A 1LE8A 2I8DA 4OIQF 1K1QA 5AONA 3MFKA 2ZDHA 3HJEA 1P7JA 1Q1HA 2G7HA 5DCFA 1EYZA 3C2BA 4U0VA 2PQ8A 4RAZA 5IYBJ 1CQIB 2VJJA 4UY8I 3HUGB 4DNCA 5ICFA 4HW0A 4ASNA 4B3RH 4UUVA 4PJLA 2KQRA 2F5FA 4O3NA 4EJVA 1Y6IA 3KX2A 4YG2F 1EH7A 2A68F 1QO0D 3SQNA 5E3LA 4BH9A 3V8KA 3ZMZA 2YPRA 1FY7A 3I59B 1FMWA 3PSFA 4XRSA 1SC7A 2MA3A 2LG4A 4IRCA 1HOMA 3HHGA 1WH7A 3BT9A 3PQKA 1TL8A 3QWLA 2Y48A 5EWEA 3EYYA 4K2EA 1P6RA 1QBJA 2TCTA 3GLXA 4N9HA 1W5SA 4RM3A 1H0MA 3QZ7A 4QWDA 2X6WA 2JWTA 2DDBA 2FNAA 3CMYA 4C3JJ 2ZDQA 1OCPA 2OQGA 4LB5A 1WH5A 1X3UA 2A69F 2KIQA 3S3MA 2W6PA 5D1OA 2JEGA 1BJAA 2HGCA 4YFXF 4HLYA 1C3OA 4DJAA 1VAJA 4D5CA 3S2WA 5E8GA 2F4OB 2PEXA 4PK4A 1X1AA 3EPZA 1BW6A 3U1KA 2OZ6A 1JKPC 1C0WA 3GTMJ 5BOXA 3H0GG 3ZQCA 5H2FC 3TQTA 4CCMA 1VKZA 3T1YH 1X4PA 1BI2A 1XMAA 2O5RA 2NVUB 4ZTJA 1ZETA 3GTQA 3GTOA 3HOWJ 5DQIA 2C2DA 3OYIA 4IO9F 1YW8A 2VUMJ 3DU5A 3OYAA 4IHJF 2M30A 4FHTA 3MD2A 1BR2A 4XYLB 4KUMA 4TQSA 2VIXA 2EIMH 4HQEA 4JX4A 1HCRA 1CQTA 3KIOA 5LFAA 5EEAA 1ITYA 1WJBA 4HF0A 2HZTA 2IGKA 4RNMA 3ABMH 5EDWA 1LEAA 4A5NA 2HR3A 4DL2A 2DOAA 5JLXA 4IHSA 4Q0YA 5JQWA 4L0YB 4UVAA 1R5GA 5C1PA 3OYMA 2HVSA 1TNTA 3RPUA 1JT6A 1E3HA 2J6TA 2DQLA 3V8LA 4J00A 1BIAA 1VBHA 4Q8FA 4GFBA 4M3BA 2BVMA 2KZGA 4U7CA 1V55H 3FMQA 4LIUA 5KFCA 2UUZA 2R5YB 1J75A 4IWYA 1UHWA 1GO3E 1TNSA 3GTQJ 4QWBA 1ZKGA 2HKOA 4OINF 2PI0A 3W6JB 2L4AA 3V4SA 4UNOA 1FBUA 4BY7G 3I54A 3RZOJ 2KP6A 2YX4A 3BA9A 4BKXA 4ESFA 4AIHA 1S7OA 1TBXA 2EPFA 2L7KA 4RB0A 3RV4A 1MJAA 1S0OA 3M9NB 5KG2A 1ZN2A 2LYCA 4MV6A 2EV5A 2JN6A 3LSKA 4A3IJ 1G3WA 2BGCA 4M9ZA 4YP3A 1Y1WA 5KKNB 3SDBA 1SMYF 2F48A 3BQ0A 2RVCA 1IG7A 4EV0A 2R7ZG 2V9VA 3VSLA 1QGPA 2M3AA 2W57A 4RGUA 4IX7A 3RV3A 5KG7A 1VTNC 1H89C 2W7PA 4TV7A 2OBPA 4WXDA 4UUSB 4LFCH 2DT6A 3L2PA 1B6SA 3WTZA 1V5GA 3K70D 2UXCH 5EG0B 1PUFA 1LDKB 3ZCOA 5K7ZA 2VKVA 2OAZA 3H4BA 1F1ZA 5CQGA 2K9SA 4X65H 2V1UA 2GWRA 3T5KA 3J81Z 3GZNB 3O8HA 4MIMA 1V51A 3WODF 3S14J 2CV1A 4P5OA 3KLOA 3OSGA 3R0JA 1K78B 4U0YA 5E1XA 4A0ZA 2R8IA 4BYYA 1Y1VJ 1Y1WJ 3G6EI 2B9SA 4HF2A 3MR5A 3Q3SA 1TP4A 3D5SC 4V2FA 3CCEI 4NB5A 4B3XA 1YIJI 1GSOA 2W7OA 4UVBA 4CO8A 1XX5A 3MN2A 2VR1A 2ICWG 4GYGA 1GYFA 2AQEA 2VASA 1S9FA 2JA7A 4RB3C 3QP6A 2Y31A 2DFHA 5ICEA 1YJNI 3PNVA 3A1YA 4A0XA 1OCRH 4MFEA 4ANJA 1IF1A 3BG9A 2DODA 2WY8Q 4FISA 4E6KG 3VWBA 5BPFA 5IP7G 2KRFA 3VPCA 4ECVA 5BPHA 1EF4A 4P96A 2MLKA 4PCQA 1O7FA 4M9XA 2GA1A 1MSFC 3HOZJ 5F0CA 1OPCA 2HYGD 2IVMA 4LLGF 1O57A 4XRFA 4DL6A 4B3MH 2E5ZA 1WR2A 3FXRA 2E2JJ 5A2QW 1SFOA 4RLFA 1IOVA 4IPAA 1UFMA 3K4NA 1AUXA 3H0GA 1ZQ3P 1FSHA 3NGDA 2R7QA 4HG2A 3KLNA 1T0FA 3HC7A 2FE3A 4P55A 2K4JA 3SFZA 4HBLA 2W6MA 1W36D 1AWCA 1N77A 1HSTA 1LUJB 1V54H 4P1WA 4ZYGA 2JA7J 3S1NJ 1DGSA 5LMUH 5A2QK 4D5FA 2WAQA 2MGQA 2QSHX 2WC2A 3B6CA 3E6MA 4XBFA 3N40P 1AUVA 4DV2H 2IA6A 2H6BA 2X0SA 2W9BA 4J9LA 1J5YA 3F6VA 2M0CA 2FNPA 3DF8A 2HOAA 3MKLA 4ENJA 3ERMA 4A3KJ 1BXRA 4XZ3B 3LSMA 2DTRA 4PFOA 5IYZF 1R36A 1MJBA 3H3VK 2CKZB 2RF4A 4LG0B 4EYIB 5B3SH 3ETHA 3DFGA 2XPUA 3A0HC 4EATA 2YSRA 4FASD 2JA6A 3HPHA 1WJEA 3NAUA 3DLLF 3U21A 1K6YA 1IO2A 5F04A 1UC9A 2IS6A 4BJ6C 1LJ9A 2G7UA 2RNJA 3SJMA 3AG3H 3TOBA 3U2RA 4KIGA 4LSXA 3I56I 1MNMC 2XAGA 3WE2A 5JHUA 2XF5A 2VONA 3V7SA 2ETHA 3MQ0A 4YIIA 5JHFA 5J40A 5DV5A 5E79C 1JKJB 4DL5A 5IP9J 5EZGA 2W6QA 5CVRA 5CYVA 4A93J 3LSGA 3N4MA 1WJFA 4D7NA 2EV0A 2M1BA 5DDGA 2JA6J 1OQYA 4O5VA 3ONQA 2EK5A 2NYXA 1D1AA 1Y8QB 3BG3A 4O2AF 5F0FA 5D8LB 4JUZA 1GXPA 3VPDA 4D1QA 1SEUA 1MMSA 3S2DJ 1IDYA 3BJAA 3L9FA 4NDLA 2KDOA 3V4ZA 2VKDA 4K0KH 2DLLA 1ETYA 4XRMA 1X1CA 2HVRA 1UG0A 2FOKA 4XORA 2IRFG 5BMVF 5DLFA 4JI0H 2LF7A 1IV6A 2ISZA 3BQ1A 1JI8A 3DBHB 1E4EA 4DV7H 3TMOA 1H88C 5KFZA 1ZGAA 2M34A 4XLAA 5HLHA 1YI2I 3EUAA 4JI5H 4R7RA 2HJWA 3P7NA 4EVIA 1OISA 2EFQA 3FXOA 3EPIA 4HNVA 4G3IA 3KYLA 3FM5A 4B47A 2DA6A 2YUSA 3IC7A 4DYCA 1RC9A 1RESA 4XONA 3OYCA 3REOA 4W97A 4Y33A 5K5RA 3JRXA 3HOTA 2E1NA 1ONVA 4ED1A 2ZMEB 3R5XA 5HODA 3OYLA 2LLKA 1GXQA 1P2FA 1RK6A 4BUPA 5LD2C 2O8KA 2IGMA 1RZ4A 4V2GA 4NBQA 1VQ9I 3VYSB 1NG6A 3QPSA 4M9UA 3JCUC 1BIBA 1FT9A 2A6TA 2D1VA 4C30A 1BN5A 4CCKA 1FIPA 3OYEA 3P9KA 4M72A 1A0IA 2OQRA 1TT0A 4ED0A 2A6HF 2W24A 3EDPA 4AIJA 2X9DA 3DPTA 4EGQA 1PYVA 4HLXA 4UCOA 1Z6TA 3PW2A 4HX7A 2UVUA 1B72A 1R6RA 4LF6H 4CSWA 4ZDPA 1BNCA 1ZLJA 4ECYA 3VEPA 2IA0A 3COAC 3GLKA 3DPLC 1D0YA 5HS9A 2L7FP 1FP1D 2CU7A 4A3FJ 2X1DA 2XAFA 3U9TA 1BL0A 2Q2EA 3LNQA 1X9NA 3J7AK 2DI3A 5DCMB 1QVUA 5KFLA 3BR5A 3ZMTA 4I01A 3FDYA 3IUOA 1VFCA 1U5TB 4YBZB 4BNCA 2E2IA 2KL4A 4DL7A 5EDNA 2ZJ2A 1SFEA 4DZPA 4Q8EA 2DT5A 2K5CA 4L9TA 2OJED 3EUHC 1Z2PX 5IT9Z 2FBIA 3N42B 5GPAA 2M5WA 2ECCA 4JYKA 1RNLA 2LVSA 4O2BF 4PGGA 4DV1H 3FXQA 2R7DA 2K3PA 1SD4A 4JV2A 4I7HA 4LFUA 1IBMH 4X6AJ 1S68A 1JUMA 2MD0A 4U7DA 3VB2A 3HOYG 4IXAA 3TO6A 2MFZA 3PO2G 3HSEA 3RCOA 3RQ4A 3HOSA 2DMPA 1FLIA 2IS1A 2F5EA 1GSAA 1IRFA 3DU6A 5EJCA 4KISA 3Q8PB 2DYSH 3VSKA 2RV8A 1TC3C 2MG4A 4WD3A 4ZYHA 1F36A 3F0CA 1OCZH 5EZHA 2EV6A 3ORRA 3Q8RB 2ASLA 4EGJA 5FLXW 1I7NA 2P7CB 2FEZA 1WJAA 1WCMA 4Q48A 2WB1E 2J5OA 1B8IB 1MBJA 1BOAA 2MD5A 4G7ZF 1IUYA 4EEYA 2FLLA 4C9YA 3GTGA 2K3FA 2J6SA 2XPWA 3QU3A 3QOEA 5DG8A 4GO1A 4J01A 4QLCU 5DD8A 5J4VA 5F1JA 2VQCA 4HNUA 1ZELA 3HPGA 2Z99A 2R8KA 2PFBA 2BQRA 5JVLA 2MABA 1MBHA 4RGXA 5GPCA 3AG4H 3IRRA 4HOBA 1W5TA 2ACJA 2WE6A 4XLEA 2VT3A 4A3BJ 4Z2YA 4UCVA 4NQWB 2HYJA 3A02A 4U7BA 3A4CA 3E6DA 2ID3A 1G59A 2RQPA 1G3YA 1QHGA 1XN7A 3RKQA 3G2BA 3PSIA 4R8HA 3K0LA 2CW0F 1BOBA 1NHAA 5C3EJ 4I55F 3DPUA 3V4GA 3OS0A 1WCMJ 2IT0A 2DA4A 3HTUA 2C22A 3PNYA 3FMRA 2A07F 2ME0A 2KIFA 4KNYA 5FPRA 4MQVA 2AHQA 1Z6RA 5ED4A 3LA7A 4OMZA 3ZOBA 2ELJA 4A2UA 2Z16A 3TQNA 2JA5J 5K7HA 3J7YJ 1XGNA 4AU7A 3H5NA 5IT3A 5LLQA 5KFSA 3BZ6A 1J2XA 3WU1B 1IN7A 1MZBA 4DV3H 4ED3A 1VQMI 2GZWA 3P9CA 2R7LA 1ZQ7A 3K4CA 3WGHA 3W2WA 5JR3A 4KMFA 1SCUB 3R4KA 2UVRA 3TW6A 1ZGWA 5EOYA 2V4RA 1DU6A 5FGMA 4M71A 1BI3A 5IPAA 5KVRA 3V42A 2JSCA 3HOXG 3IAS2 3OOPA 2OCEA 2PVPA 1LE8B 2QF7A 4AIKA 9ANTA 3B02A 4RNNA 5ILUA 1I7LA 5KT7A 5HDNA 2PJPA 4UB6C 4BEHA 3BZCA 2F5CA 2JA2A 3R5FA 2NU7B 4FX4A 3JW4A 1A35A 3JSLA 5KG3A 1R7JA 3TEDA 1EJ9A 2NXNB 1LDJA 3WGIA 1XGOA 3KYCB 2CFXA 3S8PA 3BROA 3WTSC 2RDJA 3PO3J 4IRIA 2EJRA 2GA2A 3WTTC 1M0WA 4D0PA 2WB1N 2E5LH 3RB4A 2E7XA 3I0TA 5KFJA 3OHAA 4EBCA 1X3WB 1DPRA 1QNTA 2V9PA 2IS2A 3IH3A 4BDZA 4DR6H 4G7OF 3M1EA 3Q0UA 3I55I 2ISYA 2L9RA 1S7AA 3K2ZA 4EMSA 3J7ZI 3ZQGA 2PBZA 4R8UA 4ECRA 3ZQIA 2E2HJ 1P4XA 2FQ4A 3KYDB 1FYLA 4I50F 5E3OA 2VJ4A 3Q5FA 2HFHA 5FKOA 4UFZA 5D1OB 4EFEA 2AXTC 3I64A 2R84A 5JUMA 2EA2A 3CDIA 1BA5A 3GEZA 1X4OA 2XCAA 3H4DA 2O9LA 3KXYT 3OY9A 3WTUC 3GFLA 3M4OJ 3IP4B 1EH6A 4FX0A 3H3VH 2E7WA 4MQ9F 5IYBG 2AXLA 2EFNA 3MVPA 4PJNA 4E7KA 2HDDA 2JTVA 3ZXSA 2L54A 1E17A 2XAJA 1KONA 5DUKA 4X66H 2YRWA 4AUXA 4YAKB 1TQIA 3WTWC 3D1NI 5GONF 4AM3A 3F8BA 3RKWA 1YO5C 1OR7C 1Z3XA 1N56A 5M3FJ 2M0MA 3OYGA 1ZRFA 4YIFA 4A0YA 4C5BA 1WH2A 3FZVA 3BG7A 1I1SA 4XN0A 3DXJF 3GMEA 2K27A 3JRDA 4X0GA 1MBFA 3UR3C 2EFOA 1FNNA 2WY7Q 1I6XA 3F6OA 2NVXA 1OCCH 3HKZA 3LQQA 1MDMA 5FJ8J 2OPTA 2YS6A 1S0MA 3HSFA 3HGYA 1C30A 5BMZA 2FLPA 5C4XJ 3KP6A 3GTJA 4PSXA 5H6QA 5CKTA 5J47A 2BXZA 2R6FA 2QQ9A 1X3ZB 4Q44A 4QPQA 4IHTA 4GDFA 2ZCWA 4EM0B 1IRGA 3CCYA 3SDGA 1JX4A 3KEQA 4HR7A 1MH4A 3I4NJ 4DV4H 1K83J 4CICA 2UUBH 5CJ9A 2CUJA 4IQ4A 1JKRC 2NVTJ 4IOAF 1T94A 2RGRA 1KQ9A 1YX3A 4EJWA 3S1RJ 1ZRDA 2XB0X 3C18A 4XLFA 4A3CJ 3VMMA 2UU9H 1KC7A 4JYAH 3BC8A 1Y0UA 4WWCA 5FROA 4BY1J 1KU3A 3HOWG 3JRAA 2P5VA 2MC4A 2COMA 2QKMB 3M8EA 1BC7C 2VUMG 3CO6C 2WTFA 2OTJI 3RTRA 3TO7A 2BE5F 4CCLA 1FOKA 3S93A 1T3NA 4G6DA 3GTJJ 1KJ9A 5GAEJ 4HDUA 3PNTA 2ZC2A 3K4BA 2LC2A 4KFCA 5TGTA 1AKHA 2D45A 4BE2A 3GIPA 3RIZA 2B7EA 4OIOF 1YW7A 5DGBA 2IXSA 1R1UA 3DKYA 4CCOA 3KAKA 3BR1A 2QGUA 2M45A 1W4MA 2OA4A 1PUFB 2LY9A 3JRWA 2VQHA 2DMTA 3RKYA 2VB6A 2EQRA 5L1LA 3I5UA 1HC8A 1G3SA 1MW7A 2ZSHB 4NC7A 2BVLA 1X1PA 5CVVA 2V9KA 2Y9ZA 1JLLB 4G7HF 2A05A 1V9PA 1YIOA 4E4TA 2VBWA 2O7OA 3ABKH 3Q9SA 4XX0B 3FXUA 3IRQA 3RYRA 1E4FT 2X85A 3Q8QB 2W48A 2IW5A 2WAEA 2K4BA 1Z67A 1ZLKA 4MV4A 1MMNA 2DPUA 3GXOA 5J2TF 2GXAA 1HSJA 2LKXA 1PJRA 1D8JA 1M7JA 4YY3H 1F43A 4RUCA 1HW2A 5D5UB 4A3IG 2R7UA 4DBQA 1K1SA 4MAMA 3F8MA 3CP8A 1IN5A 3ZMUA 4B43A 3ZP5A 1ZG1A 4RA2A 4A3EJ 4A3DJ 3TL4X 2CUZA 2QQAA 4E4HA 2UUAH 4ZZLA 2DOFA 1ULYA 2LY2A 3FBIB 3FF5A 3M8JA 1ETVA 3LA3A 4PUSA 4F4WA 3GZ5A 2PMZE 5D4RA 4ZHQF 3TOAA 4FS1A 3P9IA 5ERIA 4F3QA 1REPC 1LVKA 4HA8A 2CGPA 1E4GT 3BAAA 3BJYA 2DIKA 1DP3A 3G1MA 5KFPA 4ON0A 4C3HJ 3AL0C 1O3SA 3OTOH 1P92A 3BPVA 2DWCA 3MCZA 1RR8C 2ZM6H 2EB7A 2KIMA 3K3PA 4HZFA 3CC2I 1G8XA 2Y9YA 4GYIA 2DDAA 4PJJA 1MSEC 3W6VA 3SEQA 1XCBA 4YAJB 2XAQA 4EFBA 1XMQH 1Y1VG 4KT5C 3FMAA 1Y1WG 2QA4I 3K5HA 2DA5A 2JPBA 3I53A 2YYAA 3PW0A 3WTYC 4HRIA 5JH7F 3QP5A 2UVWA 4F4ZA 1VS0A 3GV5B 1Y39A 1MBKA 1XDNA 2R82A 1SD5A 1R23A 4Y17A 1GT0C 3S17J 5KFRA 2QK4A 4KDPA 2Z1DA 2FMAA 1N36H 5KFGA 3HIFA 4A3MJ 4DL4A 2DA1A 5TJJA 1N33H 3TDZC 1HKSA 4ED6A 2ECBA 1UNNC 3H5AA 2LREA 1E3OC 2LSOA 2JT1A 2BZTA 3ML6A 2JQ7A 3HOZG 1GVDA 1M6VA 1VF9A 4QW9A 3F8CA 4MO7A 2QLZA 3WNZA 4L5IA 5LBQA 3GIJA 4FBUA 3PW4A 3GTMA 3AAFA 1B9NA 1ETWA 4HDVA 1BR4A 4OMYA 4ENKA 1V4RA 4OIPF 1I94H 1TZLA 3PVXA 2BV6A 2JA7G 1I3AA 1W7PD 3MEXA 5DQGA 1A36A 3G6VA 2EINH 4BQAA 2H27A 4PDBA 2VUMA 4KYWA 3GFIA 2PG4A 3OYHA 2AU0A 4XSXF 4XOTA 4JI3H 1IC8A 2STWA 4BBSJ 2BQUA 5DGAA 3FWEA 3ZMVA 3C0FB 6PAXA 4A3KG 3BG5A 4HQMA 2DMNA 2KHMA 1W7PA 2HNHA 3NEUA 3QODA 4MTEA 1WPKA 4DYQA 4NC8A 2FJZA 1E4EB 3F23A 1F9NA 2VE9A 5KFMA 1QHHD 3CUQC 4PSWA 1XSXA 2V7FA 3GQCA 1W96A 5KFUA 4RZRA 2H94A 2O8XA 3RPUD 2JEJA 5A2QZ 3TW7A 4MEXF 1Q1VA 1EUDB 2CW8A 5KFVA 4BGDA 5KT3A 4J9QA 5BPIA 2A61A 2Q8KA 1OYIA 3H3UA 3HKZN 2CV2A 2R7VA 4MLOA 5LL6b 3GTPJ 1VI0A 4LB6B 3JSPA 1RPWA 3GVAA 4M9SA 5FO5A 3HRSA 4RS8A 1JJ8C 1JDEA 1XC5A 2K9LA 4BL0B 3N97A 1QZYA 2FMLA 1HKTA 5IP9G 1VQ8I 4PZJA 5LHIA 2LOOA 4A93G 2VA3A 4WX9A 2FP4B 3E5QA 3L4KA 2JA6G 2MBFA 3RTXA 2GIVA 4MV9A 2DU9A 2NU8B 4ZYEA 3UNGC 4YIRX 5KT2A 2V79A 4N4NB 3N6XA 3QPLA 2X1EA 1R22A 2NS0A 5HVQC 4QWCA 2Y0SE 1NG7A 2W84A 5ICCA 1B72B 1NK3P 1FTZA 2C2EA 1MBGA 1ZARA 1K7AA 3BP8A 2XKPA 3CCSI 4RGSA 2C6YA 3QRFF 1ETQA 4KN4X 4L5EA 2DT7B 2V1NA 5KT6A 2BHZA 3DTEA 3WTVC 1FJGH 3KP5A 2LD5A 1XMXA 2I5UA 2Q2EB 1P4WA 3VYUB 3J7AO 3MMYB 1Y1VA 2VPSA 1QZEA 2FD5A 4CC6A 3BTCA 4LJZF 4LGWA 1T39A 4S05A 4M73A 5EWFA 3N44B 2P8TA 3OSPA 2M7AA 2NVQJ 1ZK8A 2RDIA 4DV0H 5EWGA 4FTHA 4LOCA 3QQAA 3E6CC 4A2AA 2E35A 3EETA 5KG5A 1JUSA 3OOUA 3L2VA 2W82A 4II2A 4FU0A 5KFXA 3T5JA 2W7NA 2XGEA 4XLCA 4UV9A 3GYHX 5KT5A 3K3VA 1EV7A 1FEXA 2QUFA 3A0BC 3I9V2 3JREA 4PJMA 1AN7A 2IBKA 1TA8A 1PP7U 4LF4H 4G8XA 2VQGA 1AOYA 2QSGX 3OYKA 2PJRB 1IXSB 5GP9A 4KA4A 2PMUA 3ERED 1EA3A 2HI3A 1U8RA 4DOZA 2A6EF 2IPQX 1AA7A 3NWSA 2YZGA 4CC5A 2ASDA 3GUDA 1L2ZA 1MMGA 2NAZA 3C2GA 3BABA 3V6JA 3N8DA 2X6OA 4A3FG 2YL2A 4HYKA 3RI4A 1R9TA 2VA2A 3K4JA 1LQ1A 4I0AA 1MIJA 4YFNF 4MV3A 1D3YA 1OYYA 5HDGA 4O4HF 2XCPA 4I76A 1A9XA 1X2MA 1SD6A 5LEJA 3IL2A 2ZBKA 2OH2A 4Z6YA 5KFBA 3KPHA 3ZQFA 1MD0A 3HSRA 1HLVA 2VPQA 4HNTA 4YQWA 4F93B 3MKYB 4IHXA 4E7IA 5D6FA 4A5MA 1W36C 5KFWA 4BDYA 5DQHA 2RNGA 3ECHA 2HTSA 1U9OA 1R9TJ 3KHGA 3OUUA 5HLGA 5IWAH 1QRYA 3DF7A 1ZR4A 5DYMA 3NQOA 1FMVA 1XGSA 3KP7A 3GW2A 1D1BA 5L3BA 4DBRA 1WJ5A 3R61A 2GQQA 4E7ZA 3G73A 1HA8A 2KISA 3VYRB 3OV8A 4BXXJ 1IXRC 3OL4A 3C2HA 3BQYA 4L5JA 4QIWE 5LXTF 1JUPA 2M9HA 1RI7A 2IA2A 2R7FA 3KP2A 3JTHA 1CS0A 1GGOA 3RDIA 1IXCA 3CF2A 3V6HA 4A3BG 2ZNYA 3BQZA 3JRBA 2VOPA 1O7LA 4P9UA 1DQUA 3OSFA 2J5PA 2VI6A 2BQ3A 2QYZA 4BHCA 1RRJA 5C3EG 5J1UA 4BEHB 2WWYA 5KFIA 3QZ8A 1WCMG 3R5HA 1CGPA 3BY6A 4AWXB 2FBHA 3ZGKA 2H8RA 4IWXA 3PJRA 5FD5A 2R7RA 1S5LC 5KNLA 4QJFA 5J3LA 1V4YA 4WBNF 2LDUA 5KG0A 3T8TA 4IZOA 2KZVA 4HEA2 2CQKA 1KJ8A 1S10A 3WGGA 4IR9A 3WU0A 5FLXZ 3LSPA 5LYJF 2OD5A 2JA5G 3JSOA 5E18F 2YW2A 4JV5H 2W85A 1SEIA 1ZHSA 4HAMA 3H36A 4WK8F 3W6KB 1IGNA 2WB1A 3CMAI 2DAOA 1B1BA 4I02A 2I87A 3KALA 5BPDA 2O03A 1SD7A 2P0AA 3CCJI 2EILH 4R8UB 2WYOA 1BBYA 3K69A 3M9AA 2HQNA 3IWZA 1R4NB 1HNWH 2F4VH 5JFRA 2HS5A 3HRUA 4OWRB 4LFBH 4JOMA 3AG1H 3BZKA 2X0LA 3PFIA 1JJ6C 4CUGA 2W9CA 5H6RA 1MH3A 5FKMA 1D5YA 5KFOA 2AQ4A 1R58A 4N9IA 2X4HA 5LP6F 4LG3A 5IYDJ 3PR4A 1XMOH 3PUBA 4O3MA 5M3MJ 2COBA 1LFUP 5IYCJ 4F92B 1OJLA 3G1OA 3CUOA 2GPWA 1J9IA 1R5HA 2CRGA 5KAIC 3SFIA 5JVDF 2BW3A 2R0QC 3J81W 3VFZA 2NUAB 4BJ5C 3CQZA 2AGQA 5E3MA 3PO3G 3T8RA 3F8NA 2DBBA 1WJDA 2V4JC 2EWNA 2EFWA 1KBLA 1PDNC 2D2WA 1SVMA 2QWWA 2HXOA 2EBIA 2HQRA 1ZHQA 1T6SA 3I12A 1XCVA 2DJNA 3E5UA 4QIWN 5D5VB 1JHHA 1LFBA 2W1OA 1MDMB 4RAFA 4GGGA 2CS3A 2ESHA 2WA0A 3PUFA 5HNHA 4IRHA 2MC3A 3J80W 5K2MA 2XGDA 2P4WA 4CZZA 4GLXA 2Q2TA 1LKXA 3LWFA 3WU2C 1XGMA 3CQZJ 1D5VA 2IP2A 3GV7B 4XN3A 2ZXJA 1USTA 4KMUX 1FOWA 2KKOA 2FMYA 3DKXA 3GIQA 2IAIA 2BOLA 2VPRA 3ASOH 4Y13A 2UXBH 3RZDJ 3J80K 1S29A 4G94A 3FXJA 4Y4RA 1Z2OX 5BQTA 1JDBB 2FRHA 2XRNA 4GRIA 2EFPA 5H20A 2XSDC 2HDCA 5DM7F 5HS7A 4BE0A 2E34A 3DEUA 4YR0A 4N4OB 2WBMA 3K2AA 4KICA 5BNGA 4CYDA 4CZCA 1EUCB 4X64H 4L1KA 2XGXA 1AKHB 3HEFA 2XGPA 1HW1A 2GIZA 5FJ8G 1S03G 2F4MB 3SYTA 3FHZA 2F6CA 2XSJC 2VXZA 2L0KA 3K6GA 4UB8C 1K61A 2HOSA 2PJRA 3IG0A 5C4XG 1X58A 2DYRH 4RZQA 2XUBA 4LK1F 3OIOA 3Q1KA 3LFUA 1U6GA 3PQJA 3T1BA 2K40A 1WQ2A 5ICGA 3ROUA 1FX7A 3T1HH 2CQXA 3I4NG 2KFDA 2MH9A 4CXFA 2HPIA 2CSOA 2R92J 4IRGA 3GIMA 2XF7A 2E1OA 5FLXK 1R1TA 2JRTA 4NC6A 1FOXA 1DV2A 4A3CG 5FKKA 2JA5A 5HLTA 2ZNZA 3KCCA 4QWAA 2LR8A 4BY1G 2B0LA 1YOVB 1EKEA 4BQQA 3CC7I 4MA5A 2QCOA 4B4CA 1R71A 2CG4A 4HPQA 3RB0A 2V6CA 3RBDA 2QBYA 4BXUA 5IOZA 2DPDA 3KHLA 3EUHA 4AQYH 1P9QC 4GKKH 3C3WA 5E1WA 1QPIA 3D5LA 4CCNA 5TISC 1N34H 1BJTA 4IEJA 3PIOF 4OU0A 4BACA 2F4IA 3CC4I 4IRDA 3BCAA 2BY0A 3KEYA 4JP0A 2DOEA 4ABZA 2YU9J 2Z3YA 4ED8A 5L3FA 1M0TA 5B1BH 3HOUJ 4S04A 3HDDA 4ZH4F 3QPHA 1IN6A 3S32A 5CA1F 2I8CA 4M6YA 1GDTA 2NVYJ 1IN8A 3HRMA 1Z3YA 2DLNA 4EM2A 2H09A 3KZZA 3HOVJ 1O75A 3DKWA 3OMYA 1TQMA 3GF2A 4B3AA 5GTIC 1IUFA 2CQYA 2BEOA 4KIFA 4DGWB 5M5XJ 1T56A 2YZNA 3FXLA 3K5IA 4ZYDA 3HZJA 3OS2A 2UUCH 2DMUA 2K86A 3GLLA 1R5ID 4M74A 2VKHA 1RUNA 2OWOA 1UMQA 3H0DA 5KHDA 5KK1A 3CCLI 3Q9VA 2R7TA 5F08A 1S0NA 3HTSB 1JTXA 4IF4A 2VKEA 4A6DA 3OHBA 3CP2A 5C5JA 1WFXA 2E2HA 4A3EG 3RF2A 4LF8H 1L3LA 2ZJTA 4XKWA 4A3DG 4ECSA 1YG2A 3DBRB 3DBLB 4LK0F 2E71A 4OOIA 3L1PA 4LF7H 1JKOC 1MMAA 3DQVC 3GO5A 3CZ6A 3I4PA 3G6YA 2KSWA 3OIQA 5CVUA 3A01A 3CLQA 1U3EM 2RGVA 1RETA 1R1VA 4UCUA 2NNYA 2XAUA 4XOPA 1P7IA 4IR1A 2I10A 3S3OA 1BM9A 2YRXA 4E7SA 1GSHA 4LIVA 4XL9A 1NTCA 2DFEA 3JZIA 1PVEA 2DW4A 3RGXA 5IP6A 2QKLB 2B63J 4O6JA 3TKYA 1XSDA 5CQEA 2E1MB 3GILA 5KX5F 2ZMEC 2FU4A 3OL3A 4E7HA 5IOYA 5J1YA 2PBIA 2XF6A 3HYIA 1S6LA 3CLOA 1SAUA 3MWMA 3SZPA 5HOOA 1X1DA 1YX5A 4Q47A 2HOTA 1YTYA 3PIPF 5KG4A 2CMPA 3PR5B 4UXNA 2LRDA 2P6TA 3E7LA 2Q0OA 1W7PB 4XYMB 4BAYA 2C00A 5LOVF 3KHRA 4A3MG 4LFAH 2QSFX 3LA2A 3WG9A 3TIGA 5DS9A 4J0MA 4YR3A 2RDPA 1B04A 1YFHA 1HQCA 2L9NA 4BHBA 3R23A 2XC9A 3H40A 3T0YA 1HNXH 4O3SA 2DMQA 2OUMA 3JAMW 1AU7A 4D9JA 2EIKH 4IZZA 5CLSA 1Y0NA 3KP3A 4EBDA 4MV1A 1K83A 2PMZA 2H8WA 1ORKA 2TDXA 4YELA 3SE7A 4PWQA 4Q4ZF 4QTRA 1I3QJ 3ISPA 1J09A 1JKQC 3JAMK 2JVHA 5J4YA 1KYZA 3JR9A 4XR6A 1LVAA 4ENNA 5L3GA 4IKFA 1U5TC 1Z21A 3QU6A 1OMIA 4EQQA 1VQKI 4Y52J 2ME6A 4ESBA 3VOEA 4BBSG 2JRMA 4DR5H 2NS8A 3ASNH 3GWZA 4ZDLA 4XICA 4GC7A 4ZC3A 3HG9A 2L9SA 1U0JA 3F9KA 3OIPA 2JK3A 4DR1H 4XSZF 2DA2A 4OAYA 3G8CA 3MZHA 1V5EA 4FQGA 2FLNA 3T5XA 1TLHB 4R1HA 2XVCA 3VYTB 5L1IA 1KA8A 4A69C 3SEZA 1VQNI 5C8YF 1GV2A 3KE2A 1OR7A 2NU6B 3M7GA 4DR7H 2JJ7A 3B6AA 2R7SA 1IBKH 2ZO4A 5EGOA 3AKZA 2XHKA 2LP0A 5B1AH 4UCRA 1ETOA 2LY1A 3K4LA 1HW5A 2M8EA 4LF9H 2AGOA 4U0WA 5KFHA 3N43B 5FPOA 2P5KA 1TQPA 4H4KC 4X62H 1J0RA 3BTLA 2F5VA 3W2VA 4JI1H 2MSYA 2ATLA 4JI2H 3LSHA 2LFBA 5LRRA 1JHFA 4EYHB 2Q2UA 2IMWP 2DXIA 4B1RA 2P0WA 2HYFA 2EZIA 1BI0A 1GHCA 5L3EA 4UHTA 2HKXA 2DA3A 2LK2A 3MAJA 3SZGA 4ETSA 3OYNA 1ZREA 1I6UA 1HDPA 3ZQ7A 4IQJA 2L3DA 2W00A 3RGZA 4MTDA 1XD7A 4FCYA 3L2QA 3WG7H 5L1JA 4PGHA 2LBFB 2G0EA 3U9GA 3ZQQA 1T38A 4YRVA 3S15J 1RJPA 2FPGB 2JUGA 2HQ5A 1L0OC 3VPRA 5ILVA 1VQPI 4XKVA 2KIUA 3G3ZA 1KYWA 4RGRA 4ED7A 3HGGA 4LD5A 5DUIA 4IHYA 3BTJA 5F6FA 2M05A 1TWFA 1DGWY 2ZDGA 5EEHA 3F3XA 2R93J 3E5NA 4LLNA 4IAJA 4ZQIA 1O3RA 1B33N 2V6EA 2YR2A 4CA0A 4DV6H 2V9WA 2VE8A 5D6EA 2M87A 2XIGA 4AVZA 2HGSA 5HV6A 5I47A 3BR3A 1XDUA 5C44J 4DL3A 2X51A 2R5ZA 1F5TA 2FX0A 1GUUA 4DV5H 3VDXA 3FX3A 2FK1A 4A3GJ 3CJTB 4RBOA 2QQ8A 5AIQA 5D5WB 4B3TH 4V19K 4TV8F 2F2EA 2YS9A 2HEOA 2XASA 4Q45A 1X1BA 3CESA 4D7MA 4Y15A 2R86A 1B4AA 2CUEA 1JGSA 2VPLA 1K4TA 4M3FA 1TWFJ 5AIPA 2XAHA 3CO7C 3DTIA 4A3JJ 2Y0SA 2ZXWH 3T5LA 1ZAOA 3BJ6A 2MLGA 3H35A 4UUTA 2E36A 1I50J 1TWCJ 4GCVA 2J9GA 2L4MA 1W1WE 2Q1ZB 2W6NA 4TQRA 4O4LF 4FE7A 1T2KA 3ELKA 1SFUA 3L4JA 3SI8A 4UCTA 4PDKA 4FT8A 4RUAA 1YJWI 4FBTA 5CPRB 3K4KA 3JRCA 2R8GA 1YS6A 1JGGA 4CHUA 4HV6A 3L2RA 3O6BB 3FK6A 4DUZH 2JVGA 3IH4A 1KU2A 4OAZA 4W1UA 1RKTA 3G71I 3BLYA 3UQ8A 4EJUA 2GLOA 2V5AA 5KFDA 5EF6A 1CE8A 1KQ8A 4L9VA 1SFKA 2AO9A 2UVVA 1E3PA 1HDDC 2MCTA 1SVOA 1YHQI 2J6UA 3OR2C 4ZDOA 3CF5F 1Z2NX 3VPBA 4GC6A 1AHDP 2V1DA 1I1GA 1M1EB 4XQFA 1JIHA 2VBXA 3CVZA 4H0EA 4IHWA 1SYXB 2DQRA 1D8KA 2IJLA 4BBRJ 4O3PA 2CWEA 3GTPA 3RB6A 1O3TA 2DFIA 3HB9A 2RC4A 1RR7A 4C2TA 5LEKA 4Y8VB 4XNFA 2XGCA 3PM1A 4A3LJ 4BXXG 3I58A 1PUEE 5KG1A 2O3FA 1TW2A 5F27A 1E0EA 4AYBE 2D1HA 2V1XA 3WTXC 2X1CA 3H9QA 4CYCA 4ECUA 1ZH5A 4HX8A 2VXDA 1IN4A 5J8FA 3PW5A 2PMZN 3L09A 3LSIA 2FBKA 3L2UA 3MWEA 2W9CB 3V6KA 3FXMA 1FYMA 1FTTA 4E7JA 5KG6A 5M5WJ 4J19A 2LNBA 3LQRA 1Y14B 1UHSA 1Z1DA 2STTA 2OCCH 3BCBA 4Q43A 3EUKL 3NARA 1HXDA 2H6CA 1XTAA 2EZHA 2BYVE 3V8JA 2BW3B 4F7ZA 2BHYA 4ECQA 5CVIA 2DA7A 1TTYA 1ZHFA 4C2UA 2DK8A 1XS9A 1BC8C 5K1YA 1YRNA 1T36A 4BJTA 3D5RC 1WZ2A 2HOEA 2M7BA 5D1PA 1FYKA 1X19A 1W0UA 1ZR2A 1BW5A 5H80A 2OC6A 1SAXA 3BWGA 1G2HA 2IEKA 1MKMA 4JI7H 3TO9A 2BY3A 4DW6A 1U2WA 4WF2A 3DEEA 1APLC 3I4MJ 3ULQB 5F64A 3DWLE 5FRNA 2C2RA 2WAFA 3BA8A 3SHFA 2IA1A 4G12A 2PMHA 2RREA 2CFOA 3S2HJ 2GXGA 3FBNB 4QIWA 3WE3A 2ZFUA 1W0TA 4YJ2F 1HR0H 4DLKA 5F0HA 2VUGA 3J7AY 1UAAA 1SFXA 4MNUA 2EZKA 3GIKA 3ZR8X 2KDZA 3CUQA 5IYDG 1UB9A 2K9MA 4U88A 3ZN0A 5E8IA 4BU2A 5FFXA 4J9RA 2JUCA 4HSRA 5IYCG 5BS6A 4F91B 2VQFH 1KQ0A 5TRDA 4EJOA 2WV0A 4Y7NJ 1ERDA 3GFJA 4LITA 3GTOJ 1EZ1A 3GTLA 2UXNA 3TP0A 4AC0A 1G6NA 1VQ6I 4DYRA 3LAPA 3ECOA 2CQNA 1XMKA 2WV1A 3BR2A 3GX4X 3K70C 3N41B 2HVQA 2R3SA 4YHHH 3K1MA 4B48A 2V58A 4PFPA 3QYBA 2R7NA 4N0BA 5KFTA 3LSJA 1FSEA 1Z05A 4M6VA 1T08B 2R87A 2A5WA 1DDNA 2E1CA 2ALZA 2ZJPF 1ENHA 2ZJQF 1MMDA 5EEGA 3V7RA 1ON2A 4XLPF 3SZTA 2JA8J 4AYBN 1BGWA 1CQJB 4MHGA 3LWBA 3MJFA 2K9QA 4RB2C 4WXHA 1HF0A 3K10A 5CAEB 4TV9F 2AS5F 2WTEA 1S3JA 3FMSA 5FLMJ 4I2OA 4KHPH 2FSWA 3L2CA 3WO0A 1I27A 2LBFA 3ZQLA 3S3NA 2K85A 5DEQA 1WKMA 1IOWA 2EIJH 1OWTA 5GTHC 3GTLJ 2OTLI 3QAHA 4KIBA 1SMTA 3ZMSA 3QYEA 4J9OA 2CQ7A 2EA4A 2OU2A 3KEOA 1Y8RB 3FIWA 4LF5H 4M3EA 2P6SA 4BWSC 3LOCA 1T0FC 3T5HA 4BE1A 4G6TB 4E7LA 1Z0XA 2CH0A 1I6HJ 1KEEA 2ID6A 2V4QA 5C1OA 4GKJH 4R79A 1LDDA 3F22A 3HRTA 5KT4A 4JX6A 4MV7A 3TGNA 4JK1X 2QBYB 2IP4A 2VBZA 1IV8A 2GAUA 2HQAA 3VODA 2YCHA 3FHNA 2W9AA 1VNDA 4U87A 2KJCA 5JI6A 2Z33A 2PLYA 2Y30A 5LA6F 4NLGA 1X2NA 4RB1A 1UCRA 1Z91A 5CA0F 3CDLA 2VLAA 2QYOA 2LF8A 3QOPA 1WGXA 2N8GA 4M6XA 3SXYA 3R0AA 2GOMA 2HTJA 2CW7A 5KAFC 5DM6F 1J5EH 2MYSA 1T95A 5HDKA 2Y0SN 5J1RA 1WJCA 2W25A 3F21A 1FC3A 1OCTC 2BY1A 1KJJA 1USSA 3J80Z 2R7OA 4B44A 5DLGA 2OZUA 2R7WA 2D5VA 1JXSA 1RIOH 4EBEA 4JI6H 2V26A 4RU9A 4MA0A 3GV8B 4IJAA 4OIRF 1LEBA 4QW8A 4JQFA 1U78A 2R92G 5L3DA 2ZKZA 3H9GA 3Q0WA 3GZ6A 3LFKA 3OWTA 3ZRGA 3CMEI 2LKPA 3RUPA 4Y3OA 5KFFA 1UHMA 3AG2H 1TWAA 1FWZA 3L7WA 5L9XA 5L3CA 2JZYA 5JLWA 5F9LA 3NWTA 1QA6A 4ESJA 4A2BA 5LGUA 1KGSA 2TRTA 3GTKA 3O8GA 3TINA 4QWQA 3ZPLA 2QM3A 2IBDA 2FOWA 2K7LA 1DV1A 1RK5A 3IN5A 4LLLA 3UKGA 3LAJA 3OSNA 2YZMA 4JI4H 3K7AJ 4UV8A 4ME6A 1VQLI 2L7MP 1ACIA 3BDDA 4F50A 4MFDA 1SFOJ 2GPSA 3HOUG 3CCUI 1Z7UA 2ELKA 3RB3A 3ETJA 3A01B 1NK2P 3HUGA 3H0GJ 1B6RA 1K4SA 2UXDH 4EM1A 2VQDA 1DUXC 4C5AA 1TWAJ 2I80A 2H1KA 2ZJRF 3PN1A 4ITVA 4RAYA 3HOVG 1SVLA 3KFWX 2VQEH 2XRLA 3M4IA 1I39A 4EGZA 2KRCA 1PK8A 3I59A 2L01A 1V3FA 5ILSA 1HKQA 3GTKJ 3TIIA 3ZMDA 2VODA 3G6XA 5E17F 4QSHA 1QQIA 1RYRA 2R4GA 1QVTA 2Y69H 2XV4S 2VT2A 3HBLA 1GLVA 3UFXB 5DG9A 1H9GA 3MR3A 1GVJA 5LMNH 1IBLH 4A6EA 5B5EC 5FFZA 4F4XA 3DP7A 1UG2A 3G4SI 1XNRH 4G9YA 5FD6A 2MW8A 1T33A 2AGPA 3FISA 3TDUC 5E20A 3C1DA 1TWHA 2RN7A 2LTPA 2P81A 4I0BA 1J59A 1IZ1A 3CTAA 3H92A 5D8DA 3GFMA 3MFIA 2W8LA 4HSTA 2NU9B 5C4JJ 1MBEA 2ZB9A 4BY7J 1A04A 2L5QA 2HDWA 3E3VA 1S97A 1S9HA 3K9TA 5J6XA 2JEFA 2ZXHA 2CUFA 2CO5A 4XKCA 5LGTA 3QYFA 2BBYA 2LH9A 5KFYA 3OYBA 3J81K 2CYYA 4X1EA 4L9JA 1A31A 4KT6A 3ESWB 1BI1A 1YITI 1WI9A 1IRXA 2KT0A 4II3A 3OYFA 5KFEA 1W93A 5KCMA 4C5CA 4QWEA 3BR6A 3WHCA 4YJ3F 2W4SA 2B63G 4CH7A 2R7ZJ 2XCLA 2DN0A 1TWHJ 1FBSA 1MNDA 1XSVA 1TAEA 4LSAA 3DEWA 1MGTA 4DR3H 3S1MJ 2V59A 4OX9H 1IW7F 5BR8H 4FM9A 1K79A 2M4KA 5IY5H 1UZCA 1LFPA 3M1CA 1V5FA 1UJ8A 4I6ZA 2R85A 1RKWA 2LKSA 3BQ2A 2R5YA 5EZYF 3DV8A 3IH2A 1TT5B 3RJ0A 1CF7B 1OFCX 2PX9A 3E5XA 4AD9A 3IKTA 3Q0VA 4XKBA 3KHHA 5JVTA 2FK2A 2WAQE 1ZYRF 2EH3A 1D0ZA 2IGNA 2HWVA 4UVCA 1N32H 2UV1A 3FM3A 3H3ZA 3ORQA 3GIIA 3IAM2 2R92A 5EGOB 1T8IA 2L2OA 3L00A 3K4MA 1B9MA 3E1SA 4ZOLF 2YU3A 4JX5A 1FBQA 2CQQA 1VBGA 2M8GX 5L1KA 2Z5UA 1STZA 1JTYA 4RAGA 4AIDA 3DCFA 5HNFA 2GXBA 4HX4A 2BXYA 3MKWB 3FKIG 3CCVI 1ODDA 2VOOA 4BQOA 5IP7J 1VQ5I 3FKJA 3K1PA 1N48A 1O3QA 4IL6C 4XLHA 4UUSA 2LMDA 1P4AA 3BG6A 3KETA 2F5DA 4EG0A 3RQIA 3PZPA 2IS4A 5FKLA 4I4TF 5EG0A 1EHIA 3GBGA 2YU9A 2CJJA 1OLTA 1JE8A 3FDSA 1WWXA 3CCQI 5DG7A 2NVYA 3Q8SB 3CCRI 3JAMZ 1K78A 1WSCA 4RLQA 3M9MB 2ADUA 2NNNA
chains in the Genus database with same CATH topology
2FXAA 1B59A 3RPQA 4WCGA 2RKHA 5DD4A 1J7KA 1T98A 3F72A 4B3SH 1FVIA 5E1ZB 4DR2H 1P8LA 2PN6A 1HBXG 1KU7A 4M7EA 1FKAH 3IKVA 3ABUA 1FP2A 3V7CA 3NRVA 2P5LC 1G3TA 1LB2A 3B73A 4HF1A 3D0SA 2G9WA 4XLNF 2Z9OA 3EYIA 3C7JA 3RJPA 5K5QA 3CDHA 1EH8A 3JSNA 3F8FA 3BOQA 4LG0A 4WXCA 1XB4A 2QQBA 4EJTA 4EEQA 4LMYA 2QZ8A 4IVNA 2O61A 4JBAA 4A12A 1I5ZA 1DPUA 4B8XA 1ZRCA 4LH7A 5HLIA 1ZG5A 1PP8F 2O0YA 5LHHA 2NRAC 4CDGA 4ZZDA 2QVOA 3BJOA 1QZZA 4L9NA 3KAJA 3E97A 2P7VB 4NXMH 3RIRA 2FA5A 5IT9W 4DR4H 2ZFWA 5CVJA 3RKXA 2A3SA 1XNQH 1ON1A 3QPTA 3K1NA 5D8KB 3IHUA 2Y0MA 3ABTA 1TW3A 5IT9K 3R6SA 1G4DA 2VOBA 1XDSA 2UXXA 4Q5SF 4DUYH 2XKOA 4G6QA 2KJBA 2ESNA 4DQ2A 2VBYA 2UZKA 3LMLA 1ZG3A 4NXNH 3LSTA 2JPCA 4KN7X 3M8FA 1FZPB 2Y75A 2ZMEA 2VC0A 1ZGJA 4P9FA 3EQLF 2L02A 2O6GE 4I09A 4CGZA 1CF7A 1MJ9A 5LRSA 1YLFA 3CUQB 1LNWA 1FPQA 2FF4A 1RUOA 4L18B 4NHJA 3MZYA 4L0ZB 4HYEA 3HXLA 2YX7A 1B6AA 5LHGA 4UCSA 2WDTA 5DCMA 4E70A 5F1RA 3U1DA 1YW9A 1U5TA 1IAWA 1DP7P 4ENMA 1YS7A 1OYWA 1K6OA 1WRJA 3O2PE 2A5YB 1H9TA 3KP4A 3IWFA 2DK5A 5FB2A 3H20A 1QPMA 1R00A 2MH2A 3HHHA 4BHPA 3E6BA 2XROA 2ELHA 1HNZH 4YFKF 1YYVA 2UWMA 5D4SA 4MEYF 4HV5A 4LH6A 3JTGA 2VN2A 4I98B 3CJNA 2FQ3A 1WSUA 3I71A 3O3KA 3KZYA 3RYPA 4NQWA 5J8CA 2K02A 4MGRA 5D5XB 2HHHH 3BPXA 4APMA 1YQAA 1OKRA 1KU9A 4GXOA 2DO7A 1S8NA 3R60A 4JI8H 2VC1A 4EGYA 5LGNA 5HS8A 2QENA 5K5OA 1Z9CA 1E2XA 3ZN1A 4AVPA 1F4KA 4B09A 4OIQF 5AONA 3MFKA 5DCFA 2G7HA 1Q1HA 4U0VA 2PQ8A 4RAZA 4DNCA 5ICFA 4HW0A 4ASNA 4B3RH 4UUVA 2F5FA 4EJVA 4YG2F 1EH7A 2A68F 1QO0D 3SQNA 4BH9A 3V8KA 3ZMZA 2YPRA 1FY7A 3I59B 2MA3A 3HHGA 3PQKA 2Y48A 3EYYA 4K2EA 1P6RA 1QBJA 3GLXA 4N9HA 1W5SA 1H0MA 2FNAA 2OQGA 4LB5A 1X3UA 2A69F 5D1OA 1BJAA 2HGCA 4YFXF 4HLYA 3S2WA 5E8GA 2PEXA 2OZ6A 1C0WA 5BOXA 3T1YH 1BI2A 1XMAA 1YW8A 2M30A 4FHTA 4KUMA 4HQEA 4HF0A 2HZTA 1LEAA 4A5NA 2HR3A 4IHSA 4Q0YA 4L0YB 4UVAA 1R5GA 2HVSA 1TNTA 3RPUA 2DQLA 3V8LA 1BIAA 3FMQA 1J75A 1UHWA 1TNSA 2HKOA 4OINF 2PI0A 3W6JB 2L4AA 4UNOA 1FBUA 3I54A 2YX4A 3BA9A 4ESFA 4AIHA 1S7OA 1TBXA 4RB0A 1MJAA 1ZN2A 2EV5A 1G3WA 2BGCA 4M9ZA 1SMYF 2RVCA 4EV0A 2V9VA 1QGPA 2W57A 4RGUA 1VTNC 4TV7A 2OBPA 4WXDA 4LFCH 3L2PA 3WTZA 2UXCH 1LDKB 2OAZA 1F1ZA 4X65H 2V1UA 2GWRA 3J81Z 3WODF 4P5OA 3KLOA 3R0JA 1K78B 4U0YA 5E1XA 4A0ZA 4BYYA 4HF2A 4NB5A 4UVBA 4CO8A 4GYGA 1GYFA 4RB3C 3QP6A 5ICEA 4A0XA 1IF1A 2KRFA 4P96A 2MLKA 4PCQA 1O7FA 4M9XA 2GA1A 1OPCA 2HYGD 2IVMA 4LLGF 1O57A 4XRFA 4B3MH 3FXRA 5A2QW 4IPAA 1UFMA 1FSHA 3KLNA 1T0FA 2FE3A 4P55A 2K4JA 3SFZA 4HBLA 1AWCA 1HSTA 4ZYGA 5LMUH 1DGSA 5A2QK 2WC2A 3E6MA 4XBFA 3N40P 4DV2H 2H6BA 1J5YA 3F6VA 2FNPA 3DF8A 4ENJA 2DTRA 1R36A 1MJBA 4LG0B 3DFGA 2YSRA 1LJ9A 2G7UA 2RNJA 3U2RA 3TOBA 4KIGA 4LSXA 2XAGA 3WE2A 5JHUA 2VONA 3V7SA 2ETHA 3MQ0A 4YIIA 5DV5A 5CVRA 5CYVA 3N4MA 2EV0A 2M1BA 5DDGA 4O5VA 2EK5A 2NYXA 5D8LB 1GXPA 3BJAA 3L9FA 4K0KH 2DLLA 2HVRA 2IRFG 2FOKA 4JI0H 2LF7A 2ISZA 4DV7H 1ZGAA 5HLHA 4JI5H 4R7RA 3P7NA 4EVIA 2EFQA 3FM5A 3IC7A 3REOA 5K5RA 3HOTA 2E1NA 1ONVA 2ZMEB 1GXQA 1P2FA 1RZ4A 1BIBA 1FT9A 2D1VA 1BN5A 3P9KA 4M72A 1A0IA 2OQRA 2A6HF 2W24A 3EDPA 4AIJA 3DPTA 4HLXA 4UCOA 1Z6TA 4HX7A 4LF6H 1ZLJA 3VEPA 2IA0A 3COAC 3DPLC 5HS9A 1FP1D 2XAFA 2Q2EA 1X9NA 3J7AK 2DI3A 5DCMB 3ZMTA 4I01A 1U5TB 4BNCA 2ZJ2A 1SFEA 2DT5A 1Z2PX 4L9TA 5IT9Z 2FBIA 3N42B 2M5WA 1RNLA 4PGGA 4DV1H 3FXQA 2R7DA 1SD4A 4I7HA 4LFUA 1IBMH 1S68A 4U7DA 3VB2A 4IXAA 3TO6A 3HSEA 1FLIA 3HOSA 2F5EA 1IRFA 2RV8A 4ZYHA 2EV6A 5FLXW 2P7CB 2FEZA 4Q48A 2J5OA 1IUYA 2MD5A 1BOAA 4G7ZF 3QU3A 4GO1A 4QLCU 5DD8A 2Z99A 2PFBA 4RGXA 3IRRA 4HOBA 1W5TA 2ACJA 2WE6A 2VT3A 4Z2YA 4UCVA 4U7BA 3E6DA 2RQPA 1G3YA 1XN7A 4R8HA 3K0LA 2CW0F 1NHAA 3V4GA 2IT0A 3HTUA 3FMRA 2A07F 2KIFA 4KNYA 5FPRA 4MQVA 1Z6RA 5ED4A 3LA7A 4OMZA 4A2UA 3TQNA 1XGNA 5IT3A 5LLQA 3BZ6A 1J2XA 3WU1B 1IN7A 1MZBA 4DV3H 2GZWA 3P9CA 3WGHA 5JR3A 4KMFA 3R4KA 5EOYA 5FGMA 4M71A 1BI3A 5KVRA 2JSCA 3OOPA 4AIKA 3B02A 5ILUA 5HDNA 2PJPA 2F5CA 4FX4A 3JW4A 3JSLA 1R7JA 1LDJA 3WGIA 1XGOA 2CFXA 3WTSC 3BROA 4IRIA 2EJRA 2GA2A 3WTTC 1M0WA 4D0PA 2E5LH 2E7XA 3I0TA 1DPRA 1QNTA 4DR6H 4G7OF 3M1EA 2ISYA 1S7AA 3K2ZA 4EMSA 1P4XA 1FYLA 3Q5FA 2HFHA 5D1OB 4UFZA 4EFEA 3I64A 2EA2A 3GEZA 3KXYT 3WTUC 3GFLA 1EH6A 4FX0A 2E7WA 4MQ9F 2AXLA 2EFNA 2JTVA 2L54A 1E17A 2XAJA 5DUKA 4X66H 1TQIA 3WTWC 3F8BA 3RKWA 1YO5C 1ZRFA 4YIFA 4A0YA 1WH2A 3FZVA 1I1SA 3DXJF 2K27A 2EFOA 1FNNA 1I6XA 3F6OA 3LQQA 1MDMA 3HSFA 5BMZA 3KP6A 5H6QA 2QQ9A 4IHTA 2ZCWA 4EM0B 1IRGA 3KEQA 4DV4H 4CICA 2UUBH 5CJ9A 2RGRA 1KQ9A 1ZRDA 4EJWA 3C18A 2UU9H 4JYAH 1Y0UA 4WWCA 1KU3A 2P5VA 3M8EA 2COMA 1BC7C 3CO6C 3RTRA 3TO7A 2BE5F 1FOKA 4G6DA 4HDUA 4KFCA 2D45A 3RIZA 4OIOF 1YW7A 1R1UA 3KAKA 2M45A 1W4MA 2OA4A 3RKYA 3I5UA 1G3SA 5CVVA 4G7HF 1V9PA 1YIOA 2VBWA 3Q9SA 3FXUA 3IRQA 3RYRA 1E4FT 2IW5A 2K4BA 1ZLKA 2DPUA 3GXOA 1HSJA 1D8JA 4YY3H 1HW2A 5D5UB 3F8MA 3ZP5A 1IN5A 3ZMUA 1ZG1A 2UUAH 2QQAA 4ZZLA 1ULYA 3FF5A 3LA3A 3GZ5A 5D4RA 3TOAA 3P9IA 5ERIA 1REPC 2CGPA 3BAAA 4HA8A 1E4GT 4ON0A 1O3SA 3OTOH 1P92A 3BPVA 3MCZA 2ZM6H 2EB7A 2KIMA 4HZFA 4GYIA 1XCBA 2XAQA 4EFBA 1XMQH 4KT5C 3FMAA 2JPBA 3I53A 3WTYC 3QP5A 1VS0A 1XDNA 1SD5A 1R23A 4Y17A 4KDPA 1N36H 3HIFA 5TJJA 1N33H 3TDZC 1HKSA 2LSOA 2JT1A 3ML6A 3F8CA 2QLZA 4L5IA 5LBQA 3AAFA 1B9NA 4HDVA 4OMYA 4ENKA 1V4RA 4OIPF 1I94H 2BV6A 1W7PD 3MEXA 4PDBA 4BQAA 2H27A 4KYWA 3GFIA 2PG4A 4XSXF 4JI3H 2STWA 3FWEA 3ZMVA 3C0FB 6PAXA 4HQMA 1W7PA 3NEUA 4MTEA 3F23A 1F9NA 2VE9A 3CUQC 1XSXA 2H94A 2O8XA 5A2QZ 4MEXF 2CW8A 5BPIA 2A61A 2Q8KA 1OYIA 3H3UA 5LL6b 4LB6B 3JSPA 3GVAA 4M9SA 5FO5A 3HRSA 4RS8A 3N97A 1QZYA 2FMLA 1HKTA 4PZJA 5LHIA 4WX9A 3E5QA 3L4KA 2MBFA 3RTXA 2GIVA 4MV9A 2DU9A 4ZYEA 2V79A 3N6XA 5HVQC 1R22A 2NS0A 2W84A 5ICCA 1ZARA 1K7AA 3BP8A 2XKPA 4RGSA 2C6YA 3QRFF 4KN4X 3WTVC 1FJGH 3KP5A 1P4WA 3J7AO 2VPSA 4CC6A 4LJZF 4LGWA 1T39A 4S05A 4M73A 3N44B 2P8TA 4DV0H 3E6CC 4A2AA 3EETA 4UV9A 3GYHX 3K3VA 1EV7A 2QUFA 1AN7A 1TA8A 1PP7U 4LF4H 4G8XA 1AOYA 1IXSB 4KA4A 2PMUA 3ERED 1U8RA 2A6EF 2IPQX 4CC5A 1L2ZA 3GUDA 2NAZA 3BABA 3RI4A 1LQ1A 4I0AA 4YFNF 1D3YA 1OYYA 5HDGA 5LEJA 1SD6A 3IL2A 2ZBKA 1MD0A 3HSRA 5D6FA 4A5MA 3ECHA 2HTSA 5HLGA 5IWAH 3DF7A 5DYMA 3NQOA 1XGSA 3KP7A 3GW2A 5L3BA 3R61A 2GQQA 3G73A 3OV8A 1IXRC 4L5JA 3KP2A 1RI7A 2IA2A