2W57A

Crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Metal transport
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w57A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2w57A02
2DTRA 1U5TC 1J75A 4RGSA 3WTXC 1ODDA 1R1TA 4KN7X 2DQRA 5HS7A 2CSOA 2VC1A 3QP6A 4JQFA 5HLIA 1IZ1A 4L9TA 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3PQKA 1FBSA 4WF2A 1YIOA 2X4HA 3MZYA 2JZYA 4ENKA 2A07F 3W6KB 4ZZDA 1K79A 3L9FA 1MJBA 5DD8A 3D5LA 3L09A 1USTA 1EH8A 2XHKA 1CGPA 2QWWA 2STTA 3SXYA 4JK1X 2NNYA 1XGNA 3LWFA 3HRMA 3TOBA 3J81Z 3TKYA 2FMLA 5J8FA 1ZLKA 2VT2A 1RZ4A 1GXQA 2D45A 3MCZA 1QQIA 1SD7A 1W5TA 1IN4A 1TNTA 3ZMTA 3DQVC 1PP8F 4YFXF 2BBYA 3HOTA 5E1WA 4PGHA 4G6QA 1O7FA 3DFGA 3ZMUA 5D6FA 2BEOA 2FE3A 5LLQA 3S2WA 1I1GA 2GQQA 5KVRA 5TJJA 3F22A 2HQNA 1T2KA 1MJ9A 2Q2EA 3V4GA 4WXHA 5DCFA 3FX3A 3ZQ7A 4GYIA 1P6RA 4IRIA 3Q9VA 2XUBA 2M8EA 2DW4A 4F7ZA 4M73A 2BGCA 2QYOA 1QO0D 2ACJA 4A0ZA 1UCRA 3QPHA 3EQLF 1LJ9A 2F5DA 4MNUA 3KZYA 4JBAA 1F9NA 3M8EA 5EEGA 3ECHA 1G3TA 4LD5A 4ZYDA 4RGRA 1YO5C 3BJAA 2G7UA 5BS6A 3U2RA 5CVJA 3LA7A 1TNSA 1VTNC 2QENA 3JTHA 1Y0UA 4IRHA 3T0YA 4IRGA 4EGYA 4LK1F 2OAZA 4YIIA 1I5ZA 3V7SA 1HKTA 5IT3A 3M7GA 3WE3A 2EB7A 2OD5A 4WX9A 2UXXA 1O57A 5JFRA 5L3FA 1IUYA 1DPRA 3WE2A 1IXRC 4CGZA 4BHPA 2H94A 1O3TA 2UXNA 3J80Z 3KEOA 2KJCA 2RVCA 1R7JA 3COAC 2Y75A 2K02A 3KP3A 2GWRA 1GHCA 4OMYA 3D0SA 4CICA 2LSOA 4EM0B 3I59B 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1FSEA 4PGGA 2VN2A 2EFWA 3C3WA 4BNCA 3E5UA 1IF1A 1ZG5A 2VOPA 5HS9A 3E6MA 3CUQA 5LBQA 3LAJA 3K69A 1QGPA 4PDKA 4RB0A 2D1HA 3TDUC 1W7PB 4HQMA 1ZYRF 4WXCA 1ZREA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3HRSA 4CDGA 2KRFA 3I59A 4A6DA 5FB2A 1IN7A 4IJAA 3CLOA 3F8NA 4EM2A 5LGUA 4CYDA 3H3ZA 2HS5A 3E5QA 3ML6A 4N9IA 3TO7A 4I2OA 4FT8A 2EV0A 1ZGAA 5DUKA 1T6SA 3TDZC 2A5YB 1B1BA 2A3SA 3F8BA 2PQ8A 5HDKA 2QQAA 1W7PA 2ZFWA 1STZA 2UWMA 1XSDA 4MHGA 1EH6A 2P5VA 5E1XA 4RS8A 3OOPA 2DFIA 2FNPA 2HTSA 1UFMA 1O3RA 5F64A 2EFQA 2JPCA 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 1DPUA 3BDDA 4XBFA 4AD9A 5KK1A 1F1ZA 2K4JA 3L00A 1YFHA 3QOPA 4IXAA 4OINF 2HGCA 4EVIA 3GZ5A 1G3SA 2F5FA 4MQVA 1YLFA 1FNNA 1IRFA 3ELKA 2GAUA 4XLNF 4HZFA 2VOOA 5BOXA 3DPLC 1WQ2A 2QM3A 5E1ZB 2CW0F 1O3QA 1IRGA 2BYVE 1U5TB 4YG2F 4L9VA 4ESBA 5D5WB 4M74A 2DQLA 3RKXA 1I1SA 4UVAA 2H6CA 1H0MA 4U7DA 5J8CA 3JTGA 3WTWC 1TQMA 2V6CA 2OA4A 2BV6A 2WTEA 5LRSA 4ON0A 4KA4A 4UV9A 2Z33A 2JPBA 1KA8A 2XAGA 2LNBA 2VBYA 4OMZA 2F5CA 4Y13A 1W4MA 1Z9CA 5ED4A 5DEQA 2M45A 3KP5A 1OR7A 1K7AA 1ZG1A 1BIAA 2ETHA 2MLGA 3KP7A 2ESNA 4PCQA 5DUIA 1WI9A 3BY6A 2GA1A 5DYMA 4HF1A 2J5PA 1C0WA 2ZNZA 1MZBA 3IC7A 2RQPA 1IN5A 5IT9K 4A6EA 4G7ZF 4KNYA 3L7WA 1FZPB 3EUHA 3IWZA 5DCMA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 4HYEA 4CXFA 4XLPF 3LQQA 3GW2A 2L02A 4GO1A 3TO6A 1OYIA 2L54A 4B09A 2ESHA 1FLIA 2Z9OA 2ISZA 2YR2A 4UNOA 3HTSB 4NB5A 1LQ1A 3E5XA 3WTUC 1QBJA 1XGSA 3V8LA 1YW7A 4HX7A 1G4DA 1RI7A 4LLLA 3T5XA 4KIGA 5FD5A 2GXGA 3VOEA 3KP6A 2IRFG 2V1DA 3HSEA 2FU4A 2MC3A 5FLXZ 3MZHA 4U0YA 2HZTA 2JSCA 5ICFA 4CHUA 1FYLA 1YQAA 2DLLA 4YFNF 2TDXA 5E8GA 3ZP5A 3CUOA 5D6EA 4RAZA 4R1HA 2RC4A 4HX4A 5A2QZ 3GFIA 1LEBA 1P4XA 1FP1D 1OKRA 2VBXA 3WTSC 3ZPLA 5FFXA 3IL2A 3CO7C 4KYWA 3HSRA 3NQOA 4Y17A 4M72A 2E1CA 1LEAA 4MTDA 4Q48A 3U1DA 1KYZA 1BI3A 1KGSA 2A6HF 2HQRA 3E6DA 3P7NA 3I4PA 5FO5A 2KIMA 4HW0A 3DKWA 1UB9A 5L3BA 1HSJA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 2EFOA 3QRFF 4H0EA 3EDPA 1G6NA 5CJ9A 5K5QA 4GYGA 1W5SA 2RV8A 2XVCA 3HRTA 5ILUA 2EK5A 2VBZA 2HYFA 4G94A 2MH2A 2J5OA 2VE9A 6PAXA 5D8KB 2EA4A 3IRRA 3FXUA 4L5JA 4IHSA 1S7AA 3R4KA 2XKOA 5HDGA 2VONA 2P5KA 2RNJA 3BOQA 2WWYA 1WRJA 2K4BA 3I71A 3HHGA 4GCVA 1B6AA 1YS6A 4RB1A 3E6BA 2NNNA 3GWZA 1SD6A 5E20A 2AXLA 5D5UB 5L3DA 3RYRA 4Z2YA 3SZPA 4D0PA 2W25A 3F8MA 1R22A 4ENMA 4ASNA 4KIBA 1EV7A 1PDNC 2HTJA 4UVBA 3VB2A 2VBWA 1IW7F 3WGGA 1XCVA 3GO5A 1QPMA 3GZ6A 1E17A 2PLYA 2LDUA 5ICGA 4EM1A 5CVUA 2ZMEA 2Z99A 3GUDA 3T8RA 3REOA 1BI1A 2YU3A 5A2QK 2ZO4A 3E3VA 3H92A 1TQPA 1QZZA 5K1YA 3ISPA 2O6GE 2VODA 2XAFA 2IJLA 1FWZA 1OYWA 2P8TA 1MDMB 4PZJA 3T8TA 3HIFA 2Q0OA 1I27A 1ZRDA 2HEOA 3HHHA 3LQRA 2XASA 2PN6A 2XIGA 3RYPA 3FMQA 3FMRA 1J2XA 2KJBA 4A5NA 4UXNA 4KUMA 2O61A 1D8KA 4BYYA 5LEJA 2BE5F 2IPQX 4G6DA 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 3KCCA 3BJ6A 3ERED 4R79A 1FC3A 4ZZLA 3GEZA 4I98B 2D1VA 3WTYC 1WSUA 5BPIA 4Y15A 1YW9A 2PG4A 3DF8A 2EV6A 4EJWA 2QQ9A 2PBIA 4WXDA 1F4KA 1D3YA 3DXJF 5CVRA 5HLHA 1S3JA 4AIKA 3K1PA 3Q9SA 3EETA 3GVAA 1R58A 3TO9A 4ZYGA 2NAZA 2OQGA 1A04A 4DQ2A 3ULQB 5HVQC 2QQBA 4LFUA 3G3ZA 3RKWA 2O03A 5LEKA 3N97A 4KDPA 4K2EA 4I7HA 3GF2A 4N0BA 3J81K 3F3XA 1H9GA 1R00A 2XGXA 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 1HXDA 4TV7A 1B4AA 3WTVC 3HRUA 1Z6RA 1B9NA 3DEUA 4HV5A 3M9AA 3WGIA 4A5MA 2LF8A 1KU3A 2F5EA 1SFXA 1B9MA 1TTYA 2FRHA 4LB5A 1MDMA 5E17F 4L9JA 1V3FA 4FX0A 1IXCA 3F72A 3O3KA 2A69F 1UHWA 1BI0A 2YX4A 2R3SA 4L9NA 1TLHB 3RDIA 2FF4A 3AAFA 4MEYF 4Q47A 3MWMA 3JAMZ 4ZYHA 2R7DA 1JXSA 2FMYA 4XSXF 1TW2A 2GA2A 3SFZA 4HAMA 1R1VA 1ULYA 3RJPA 4RB2C 5FLXK 4M9SA 4O6JA 1CF7B 5JI6A 1BI2A 1U3EM 1EH7A 1K78A 2CO5A 1YYVA 5F1RA 2Y48A 3N4MA 4GXOA 3FHZA 1RIOH 3ZMZA 1SFUA 2ELHA 1R5HA 1JGSA 2WV0A 4OIOF 1XSXA 1ON1A 3HYIA 1XDSA 4HV6A 3F8FA 1R5GA 5L3GA 2A61A 4HOBA 4OIPF 2ZBKA 3TGNA 4LMYA 2FOKA 2HFHA 3SHFA 2QBYB 2KIUA 2ZKZA 2P6SA 1SD4A 3L2CA 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4L18B 4P9FA 2L01A 4XRFA 3R0AA 4LLGF 4HA8A 4HLYA 2D2WA 3K1MA 5ILVA 2FBKA 2GXBA 2UZKA 4EV0A 4HF0A 3IKTA 4M6XA 3WTTC 5FD6A 3RKYA 3HUGA 3C18A 1R1UA 1BN5A 2DO7A 2KIFA 3GX4X 2RN7A 3PFIA 4G8XA 2KKOA 1ZN2A 2M5WA 2P5LC 1T38A 3K2ZA 3I5UA 4A2UA 3R60A 1AWCA 2IA1A 3LSTA 3ABTA 2DBBA 1WWXA 2QVOA 3ZMVA 3KEQA 1FYMA 1O3SA 1TQIA 2VXZA 3CTAA 1MD0A 2CYYA 3W6JB 3RPUA 3I53A 1L3LA 4S05A 3DPTA 3F21A 2PEXA 2OU2A 5HLGA 2PI0A 4EJTA 2H27A 2FBHA 2NRAC 5E18F 1HQCA 1LVAA 3M8FA 2E7WA 2ZJ2A 5TRDA 2E1NA 2PMUA 2CGPA 3GFMA 5L3CA 1SAXA 3VFZA 3CUQC 5AIQA 4KFCA 1OMIA 2W84A 3TOAA 3CDHA 2FBIA 2DAOA 1J9IA 2H6BA 2F2EA 5E8IA 2STWA 1LDKB 1B59A 1XDUA 2NS0A 4EJVA 1J5YA 5LHGA 4CO8A 3KLNA 2O0YA 2VT3A 4MTEA 4U88A 1SMTA 1BBYA 2AS5F 2CQKA 4KIFA 4KT5C 4NQWA 4WCGA 3V7CA 3V8JA 3I54A 4P55A 2XAJA 2XRNA 4A12A 1BM9A 2K7LA 2MA3A 4MQ9F 2MD5A 2DK5A 5CLSA 2L3DA 1XGOA 1H9TA 2IA2A 1J0RA 3FF5A 2VE8A 4EMSA 4I0AA 1TBXA 2W85A 1DDNA 1XB4A 4UHTA 1RUOA 5D4RA 3KETA 1USSA 3P9KA 2FNAA 5IT9Z 3OV8A 2P4WA 1KQ9A 3KZZA 3MFKA 5HDNA 2QUFA 3BPVA 2A68F 1ZRFA 3ABUA 3IRQA 3EYYA 1DUXC 3O6BB 3QAHA 2V1UA 2RDPA 4P5OA 2K27A 1S8NA 1Z91A 3CUQB 4AIJA 1XD7A 4O3MA 3HSFA 3KP2A 4ETSA 4OOIA 3KP4A 4AWXB 1LNWA 2OZUA 3F23A 2IA0A 2ZXJA 4U7BA 3SZTA 4DNCA 4M9ZA 3BWGA 5LRRA 1T0FA 2MBFA 1G3WA 2R7FA 3C7JA 3R61A 5DD4A 3G73A 1XGMA 2EA2A 1AOYA 2IW5A 1XSVA 2IP2A 5K5RA 1ZG3A 4A0XA 4HDVA 3FM5A 1LB2A 1TW3A 4S04A 4KMUX 1ONVA 1MGTA 4M71A 4HQEA 4KN4X 1HKQA 4R8HA 5HS8A 2L4AA 5D5XB 3U9GA 1Z05A 4LG0B 1IAWA 3ZMSA 1I6XA 1LDJA 4KMFA 1W7PD 1QNTA 3RPQA 3DV8A 2CWEA 2FEZA 3KFWX 5DDGA 1LDDA 1U2WA 3E6CC 4ZH4F 4G7OF 1ZHFA 4RGXA 4M9XA 5DV5A 5BPDA 3FM3A 1XMAA 3F8CA 5FFZA 1G3YA 4LG0A 2PFBA 2JT1A 4U0WA 3PQJA 1JHHA 5K5OA 1WKMA 2PMHA 4OIQF 5LHIA 3FXRA 3ZN1A 2MLKA 5LHHA 5ICCA 3IKVA 2XAQA 5FGMA 3MAJA 1DP7P 2XROA 4LK0F 2M30A 3E97A 4BAYA 2P7VB 2V9VA 3HOSA 2EFPA 1X3UA 5F6FA 1FYKA 4L0YB 4RB3C 5L3EA 2P7CB 1IXSB 1SD5A 4BXUA 2VC0A 5D8LB 4IPAA 4M6YA 5LGTA 5LGNA 2B0LA 3T1BA 4ESJA 1PP7U 2PJPA 1HW5A 2ZNYA 2L4MA 3FWEA 5CVIA 3EYIA 3KE2A 2G9WA 2XKPA 4OIRF 1YW8A 4ESFA 2DPUA 3SQNA 1QZYA 1Z6TA 3O2PE 4O5VA 4LJZF 1O7LA 3FZVA 5D4SA 1MJAA 1Z1DA 5EEHA 2Z3YA 2C6YA 1SFEA 4GGGA 1FBUA 1R36A 2V1XA 2YSRA 2ISYA 1ZARA 4I0BA 1Q1HA 2EV5A 2HYGD 4I01A 5J6XA 1BJAA 2JRTA 3TQNA 2DI3A 2OQRA 3BJOA 1SMYF 4ENJA 1RUNA 2O3FA 1FP2A 3WU1B 4UVCA 1K6OA 2LKPA 3BPXA 3WODF 1FT9A 2RKHA 1FOKA 4LB6B 5AIPA 1KU9A 5JVTA 1U8RA 2Y0MA 3B02A 2ZMEB 1ON2A 4MGRA 2IVMA 5H20A 2OZ6A 3ECOA 1FBQA 5H6RA 4UUVA 1KQ8A 2XAHA 1Z7UA 1OYYA 2A6EF 1YG2A 5AONA 4EJOA 2DK8A 1J59A 3V7RA 3MQ0A 3QPTA 5H6QA 3GXOA 3Q5FA 3IHUA 1YS7A 4EQQA 3CJNA 2W24A 3RI4A 4FHTA 3WU0A 1ZGJA 2DU9A 2Z5UA 4Q4ZF 2EWNA 3LFKA 3GFLA 1BIBA 1T98A 3VODA 4YIFA 1BOAA 5BMZA 2WC2A 1J7KA 4NHJA 1ZH5A 3JAMK 1UHMA 3R0JA 3RIRA 3V8KA 3HTUA 4RGUA 1K78B 4ENNA 1XN7A 2FA5A 3RTRA 1HSTA 3BP8A 4EJUA 2X0LA 1XCBA 1KU7A 3M1EA 4CZZA 2HWVA 3DP7A 3CO6C 3KLOA 2RGVA 3JSPA 3J7AO 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4QLCU 4YFKF 4B8XA 2EJRA 1HKSA 2LF7A 4P96A 1D8JA 3WGHA 1L0OC 2HOEA 2QZ8A 1P2FA 4I09A 2ADUA 1GXPA 3ZN0A 5HOOA 1U6GA 1BC7C 2O8XA 2V79A 3C1DA 1IN6A 1OPCA 2MH9A 1YTYA 4E70A 4Q5SF 1V4RA 4IVNA 2H09A 3H3UA 1U5TA 3K1NA 3B73A 1KYWA 2HR3A 4BQAA 2XV4S 4LLNA 2GIVA 2W57A 3QU6A 4HF2A 3LAPA 2ZCWA 4L0ZB 1FPQA 1HBXG 1F5TA 4OU0A 1NHAA 2JTVA 5BQTA 1CF7A 3GFJA 2COMA 3BROA 3FXQA 4BHCA 4A0YA 4U0VA 3P9IA 4XSZF 4LGWA 4UV8A 1HW2A 3K0LA 1HW1A 2G7HA 4L5IA 1S7OA 1ZRCA 4P9UA 5JHUA 4AIHA 3ZMDA 3WG9A 1XMKA 1ZAOA 3GYHX 4N9HA 3MEXA 3I0TA 2QLZA 2EFNA 1GVJA 1S29A 4HBLA 5CVVA 2HKOA 1D5VA 1P4AA 3NEUA 2M1BA 4WWCA 4HLXA 1FY7A 4KICA 3ROUA 4ZYEA 4IHTA 1MKMA 3K9TA 1REPC 2IT0A 4BH9A 5DCMB 1ZLJA 1PUEE 2YX7A 4QWQA 2FXAA 5D5VB 3R6SA 2GZWA 1JE8A 1S6LA 4RAYA 1RNLA 4IF4A 2HKXA 2QBYA 1KQ0A 5ILSA 1IN8A 3F6VA 3FMSA 3F6OA 3LA3A 4I02A 5JR3A 2M87A 3QP5A
chains in the Genus database with same CATH superfamily
3M9NB 4EFEA 2DTRA 2MFZA 3RIZA 1U5TC 5HLTA 3D1NI 4RGSA 1J75A 4AM3A 1BW5A 4J9RA 3WTXC 5BMVF 1ODDA 1R1TA 1RRJA 3GTKA 4KN7X 3PO2J 2EZIA 2DQRA 1GSHA 5HS7A 5KFJA 5L1LA 2CSOA 1S03G 1V54H 2VC1A 3QP6A 4JQFA 5HLIA 4BDZA 1IZ1A 2E1MB 2X6XA 4LOCA 4L9TA 1HNWH 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3NWTA 3CCEI 3PQKA 1FBSA 3Q0WA 1YIOA 2X4HA 4WF2A 3N43B 3MZYA 4CA0A 2JZYA 5IP9G 2V4JC 1B72A 4ENKA 4APMA 2A07F 3QQAA 3W6KB 3JAMW 1HR0H 1V5EA 5GPCA 1ULZA 4BBSG 4CYCB 5KFSA 4ZZDA 4MV8A 3LSGA 1RR7A 1K79A 3L9FA 1MJBA 2PJRB 5DD8A 1JI8A 5H80A 4A2BA 3D5LA 3GIJA 2WB1N 1R71A 3L09A 5DM7F 5KX5F 2IAIA 3AG2H 1USTA 5IP9J 1IDZA 1EH8A 2XHKA 1CGPA 3S2HJ 2QWWA 2FJZA 3TIGA 5C1OA 2FP4B 2STTA 2C2RA 3SXYA 2EPFA 4B47A 4JK1X 1CQTA 2R5YA 2NNYA 3EUKL 1XGNA 2CW7A 3LWFA 3HRMA 1BXRA 1FKAH 3TOBA 1E0EA 3J81Z 5EZYF 3TKYA 2EZLA 2FMLA 1K6YA 2R93J 5J8FA 4DV0H 1MMGA 1KJIA 5E3NA 3E5NA 3CC7I 2LG4A 1ZLKA 2VT2A 1RZ4A 1GXQA 1SVOA 2D45A 3MCZA 1QQIA 2R7LA 1SD7A 3GTJA 3MWDA 3R23A 3OIPA 4BDYA 2WYOA 4D1QA 4XYLB 4EGJA 3DLAA 4XN3A 3LMMA 1W5TA 1IN4A 1TNTA 2DJIA 3ZMTA 3DQVC 1HOMA 3WU2C 1PP8F 1X58A 3FXJA 1MH4A 4YFXF 4M3FA 3SI8A 2BBYA 5KFPA 3HOTA 5E1WA 4FBTA 4Q45A 4PGHA 3GMEA 4G6QA 1O7FA 3DFGA 3ZMUA 3GILA 1LFPA 3QPSA 4RUCA 1WGXA 2LOOA 5DTDA 5D6FA 2BEOA 3S16J 5KT7A 2FE3A 2M4KA 5LLQA 5L1IA 3S2WA 3FBIB 4E4HA 1I1GA 1Y1WG 1PVEA 2GQQA 4CCNA 2YRWA 5KVRA 2E19A 3CMMA 1Z7LA 5TJJA 3F22A 2HQNA 4E6KG 1TT0A 5F04A 3B6CA 3LSKA 1WJBA 1T2KA 1MJ9A 3H9GA 4AC0A 2Q2EA 3V4GA 3VPRA 4BS9A 1AN7A 4XZ3B 2XGQA 4WXHA 2KSWA 1N77A 2RQQA 5DCFA 4ECUA 3FX3A 2L7MP 1S7EA 3ZQ7A 1JXLA 1LKXA 4GYIA 1P6RA 4IRIA 1R5ID 3H40A 3LMLA 3Q9VA 3JSLA 2R7ZG 2XUBA 3I4NG 2M8EA 4B44A 2DW4A 2ZJRF 4HSRA 3BJYA 4JV0A 2I8CA 4F7ZA 3OIOA 4GKJH 3MKLA 2MCTA 1IBLH 4M73A 2BGCA 2QYOA 3RZDJ 1QO0D 4A93G 3KALA 1TWFJ 2ACJA 3KZIC 4A0ZA 1UCRA 9ANTA 4PSWA 3QPHA 4A3DJ 2Z1DA 2DPJA 1PK8A 5IY5H 2LKXA 3JRWA 3EQLF 1LJ9A 2F5DA 4MNUA 5EF6A 3KZYA 1FMWA 4JBAA 1F9NA 4PDBA 3M8EA 5EEGA 2R4GA 4ED8A 2NS8A 3ECHA 2LK2A 1YITI 1FOYA 1EZ1A 4C2MA 4ITVA 1G3TA 5C1PA 4LD5A 4ZYDA 2BHYA 4RGRA 2K9QA 1YO5C 1CQIB 2WAQE 4DR6H 2KT0A 2PMZN 4DLKA 2HOTA 1YJ9I 1KC7A 4DR3H 3BJAA 2XGPA 1N32H 2G7UA 5BS6A 3MMYB 3U2RA 2JA5J 5FJ8J 3KXYT 5KFZA 2JVHA 3BTLA 4IRDA 3SYTA 5CVJA 3LA7A 1TNSA 3H5NA 5F1JA 3A4CA 2DA6A 4ZYAA 1VTNC 2QENA 3JTHA 1Z3XA 3ZQGA 1IV6A 5LL6b 2JA5A 1Y0UA 4IRHA 3T0YA 1Y1VJ 1B6RA 4ED2A 1IOVA 4PJMA 1VQMI 4IRGA 4D7NA 1T33A 4EGYA 1FIPA 2VI6A 4BBSJ 1UJ8A 2IMWP 1VQOI 3SEQA 3CVZA 4LK1F 3FBNB 2OAZA 4YIIA 1I5ZA 3V7SA 3OUUA 3H4DA 3HB9A 1GYFA 1HKTA 2DFFA 5KKNB 3R5XA 5IT3A 2W7PA 3GZNB 3M7GA 3WE3A 2WE6A 4PK4A 1A6QA 2EB7A 1GUUA 3PJRA 2OD5A 4WX9A 2UXXA 1GV2A 1ETWA 1O57A 3DKYA 4BGDA 3BT9A 5JFRA 5L3FA 1IUYA 1DPRA 4O3NA 2DMQA 3DU5A 1IXRC 2XRLA 2LBFB 3WE2A 1NK3P 4CGZA 1I7LA 1KJJA 4BHPA 2H94A 2M7BA 2Y30A 1O3TA 2JA7G 2UXNA 3J80Z 2V58A 2FK1A 3KEOA 2KJCA 4XORA 4QWCA 2RVCA 3BA9A 3ZQHA 2LRDA 2W6PA 1R7JA 2M9HA 1WCMG 3COAC 4A3BG 1BR1A 4A3FG 2Y75A 2HQ5A 4X0GA 2K02A 3MKYB 1FMVA 3PL8A 3KP3A 2GWRA 3N6XA 3MD2A 1GHCA 5FPRA 4OMYA 1EUCB 3D0SA 5FRMA 4CICA 2LSOA 1AUXA 4DL3A 4EM0B 3I59B 4UCSA 3PFYA 4G9YA 4ZI7F 2DT5A 2E7XA 4FS2A 4FBUA 3P9CA 1P92A 1GO3E 1V55H 1FSEA 4PGGA 4E7LA 2VN2A 3OYLA 3C3WA 2R7RA 2EFWA 4BNCA 3E5UA 1IF1A 2B9SA 4F4XA 2PVPA 2V9WA 3BG9A 1ZG5A 2VOPA 5HS9A 3K2AA 2XF6A 3RSNA 4BEHA 1I6HJ 4EFBA 3E6MA 3CUQA 3DTEA 1WJCA 5LBQA 3PW2A 1LPQA 3RFCA 5EOYA 3OSNA 2ZJTA 2QQ8A 2KZVA 3PO3J 4RAGA 2OC6A 3LAJA 4YAKB 3TBIA 5EDWA 4C5BA 3K4JA 1G59A 1DGSA 1SCUB 3K69A 1QGPA 1A35A 2R7SA 2FKLA 4PDKA 2YW2A 4RB0A 1BA5A 2D1HA 3TDUC 1FOWA 1W7PB 4HQMA 2W71A 1ZYRF 4WXCA 4XLEA 1ZREA 4EBEA 4DL6A 2VXDA 3I64A 5KG0A 1E2XA 5ERIA 4AVPA 4EGZA 1K1SA 3LFUA 2M3AA 3NWSA 4J9SA 4ECZA 3HRSA 4CDGA 2KRFA 3I59A 4PJLA 4A6DA 1DIKA 1EYZA 3MR6A 5KFGA 5FB2A 4ZDOA 1IN7A 4LF5H 2ME0A 4IJAA 3CLOA 4S0HB 2JUGA 4NC8A 3W2VA 3F8NA 4EM2A 2XF5A 5T14A 2Q2TA 5LGUA 2ID3A 4CYDA 4E7SA 1A5JA 4A3DG 3H3ZA 5JHFA 4XNFA 4C2TA 2RDJA 2VKHA 4LFBH 2ZDQA 4NQWB 2HS5A 3E5QA 3ML6A 4N9IA 1R9TJ 3TO7A 4I2OA 2E1OA 3GTGA 2Q1ZB 2EV0A 4FT8A 1ZGAA 3FXLA 5DUKA 1T6SA 3KYLA 1E4FT 1TA8A 3KX2A 1R9TA 3DBRB 3TDZC 3G6VA 2A5YB 3GTGJ 1Z2PX 3K4KA 2R7ZJ 4DZPA 1B1BA 3HKZA 2XSDC 1AHDP 1Y6IA 1H8AC 1HA8A 2A3SA 2K5CA 3F8BA 2IBDA 2PQ8A 3OYGA 1FJLA 3Q1KA 1S10A 5HDKA 3L1PA 2X9DA 1JLLB 2QQAA 1UHSA 1W7PA 1OCRH 2ZFWA 1W96A 1STZA 2UWMA 2JEGA 4ZTJA 1XSDA 4MHGA 1EH6A 2P5VA 2QYZA 1WI3A 5E1XA 4RS8A 3OOPA 2DFIA 3RV3A 2VLAA 2FNPA 2HTSA 1UFMA 1O3RA 1JUPA 4EEYA 5F64A 2E2HJ 4ECYA 1S97A 2EFQA 4GKKH 3H36A 2JPCA 2R0QC 4J19A 1R23A 3JW4A 1A0IA 3G8CA 5D8DA 3VEPA 2K86A 3WTZA 3J80K 4IO9F 1DPUA 3HOYJ 1EKEA 3BDDA 4B1RA 5KFOA 4XBFA 4AD9A 3RJ0A 5KK1A 1WR2A 1MIJA 1F1ZA 1SYXB 2K4JA 3L00A 1YFHA 4X6AJ 4F50A 4A3EG 3QOPA 2DOFA 2R82A 2DYSH 3IG0A 4MV9A 4IXAA 4OINF 1OCPA 2HGCA 3FISA 1RETA 5FKLA 5M5YJ 2VUGA 4BACA 1Z21A 5BPFA 1RJPA 1SAUA 4EVIA 1H88C 3GZ5A 3K5HA 5GONF 1G3SA 2F5FA 4F92B 1ZHQA 2RAEA 4MQVA 3Q0UA 1YLFA 3VSKA 1FNNA 1IRFA 5J3LA 2GXAA 2R93G 1E4EB 3ELKA 2GAUA 1JKPC 4FE7A 3KHHA 3BTJA 3PUFA 4XLNF 5EG0A 4HZFA 4J01A 2VOOA 5BOXA 2HPMA 1IG7A 4ZC3A 3DPLC 3BABA 1UZCA 1WQ2A 2QM3A 2ZXHA 5E1ZB 2XPWA 2CW0F 1O3QA 2DPIA 5KFBA 5GADJ 1IRGA 2BYVE 2MABA 1U5TB 5A2QW 2VL8A 3DEWA 4XLHA 4YG2F 4HYKA 1ZTRA 2IA6A 1IO2A 3HOZJ 5IYBJ 4BKXA 3PSIA 4ZOLF 3QODA 4L9VA 4ESBA 2DXIA 4AVZA 5D5WB 4M74A 2DQLA 2I87A 4JV1A 1OCZH 3KEYA 2VASA 3ASNH 2PMZE 5J2UF 3ZQFA 2QCOA 3RKXA 1I1SA 2KQRA 3K70C 4A3CG 4FU0A 5D1OB 3RCOA 2WADA 4UVAA 4N4NB 2H6CA 2LYCA 5FJ8G 3W2AA 1H0MA 4U7DA 2RF4A 5J8CA 1I94H 1X3WB 4CYCA 3JRFA 3JTGA 3WTWC 2UVUA 4RUAA 1TQMA 2V6CA 2OA4A 4KITB 3MN2A 1ZHSA 2UUAH 3PO2G 4DUYH 2BV6A 1XMXA 5LXTF 2WTEA 4OX9H 2QSFX 5LRSA 4ON0A 4KA4A 2F4MB 1WVRA 5D1PA 4UV9A 3G71I 4B3SH 2Z33A 3OYCA 4PWQA 4DL2A 4LF8H 3CF5F 1E3HA 2L5QA 4RBOA 4IL6C 2JPBA 3K6GA 5K7ZA 2PN1A 1KA8A 2R7VA 3N40P 2XAGA 2LNBA 5F9NA 4KHPH 1I7NA 2VBYA 4OMZA 2F5CA 3EUAA 4RZQA 5KG5A 4Y13A 1W4MA 2LREA 1EHIA 4G6TB 1Z9CA 5ED4A 5DEQA 1V9PA 1JKOC 2M45A 2ZDHA 3CCJI 3BQYA 2ZB9A 3KP5A 1OR7A 1NH3A 2WB1A 1BR2A 2I80A 4Y7NJ 4XM3A 1ZG1A 1K7AA 3GTKJ 1BIAA 3HG9A 2ETHA 2MLGA 3KP7A 4XMYA 2ESNA 3ABMH 4PCQA 2X51A 2QGUA 5F27A 3KAKA 5DUIA 4Q44A 1WI9A 4JV5H 3BY6A 1VQNI 2GA1A 5DYMA 3CCSI 2C35B 4HF1A 5C5JA 5DQHA 2J5PA 2ZNZA 1C0WA 3CMEI 1MZBA 3MJFA 1Y1WJ 3CC2I 3IC7A 2RQPA 4DYCA 1IN5A 4TV8F 1IOWA 4IHVA 2DYRH 5IT9K 4ANJA 4A6EA 4G7ZF 1VBHA 4RNMA 2IGKA 4FE4A 2N8GA 2R7MA 3LL7A 4KNYA 4O3PA 3L7WA 2XD4A 4PFOA 1Y56A 1FZPB 4RNNA 2R86A 4XR6A 3EUHA 2EIMH 3ESWB 3IWZA 3MKZA 1QU3A 2E71A 1DV2A 5DCMA 2LH9A 3ZGKA 2CFXA 3I58A 2FQ3A 2YPRA 4YAJB 3IWFA 1T39A 4AIDA 4HYEA 4CXFA 5J1YA 1HCRA 4A2AA 4XLPF 2R7NA 3LQQA 3GW2A 2L02A 3VYUB 4GO1A 5LD2C 3TO6A 4GC6A 2K9MA 1OYIA 2L54A 1JJ6C 2LKSA 2OCCH 2ESHA 2ZXIA 4B09A 1FLIA 1ACIA 2Z9OA 2FB9A 1GLVA 4O3OA 2ISZA 3TIIA 3VPBA 2YR2A 1T08B 4LH7A 4UNOA 2LFBA 2WAQN 3OWTA 2ID6A 4CCJA 4A3EJ 4IOAF 2HXIA 2EZKA 1MBJA 4NB5A 3HTSB 1YRNA 1WJDA 3LNQA 3F0CA 1LQ1A 3E5XA 2COBA 4Z6YA 4JI3H 5KAIC 3WTUC 5E3OA 1M1EB 2ECCA 2IGMA 1QBJA 1XGSA 3V8LA 2ZJQF 1XC5A 1YW7A 3IN5A 5J47A 2LVSA 3GBGA 4HX7A 4C9YA 4ZDLA 1G4DA 3HOVG 1APLC 1RI7A 2CUJA 3M07A 2WTFA 4LLLA 3T5XA 2F6CA 5JLWA 4KIGA 5FD5A 4DV7H 5FKOA 2GXGA 3VOEA 3VPDA 3KP6A 5GAGJ 2FK2A 3WHCA 3UQ8A 2R92G 2IRFG 2BVMA 2V1DA 4UUTA 1DU6A 2WV1A 2DODA 3HSEA 2FU4A 2MC3A 5FLXZ 3FMAA 3MZHA 4U0YA 3RTXA 2HZTA 2JSCA 1MBHA 5ICFA 3CCQI 4CHUA 1W36C 1FYLA 1YQAA 4IQ4A 4YELA 4CC6A 4DUZH 2DLLA 1T0FC 4YFNF 2DZDA 2IGNA 2TDXA 4BBRG 5E8GA 3KTMA 2M8GX 3ZP5A 3CUOA 4XKVA 5D6EA 5DM6F 3ETHA 3HOWG 4IWXA 3OMYA 4RAZA 4R1HA 4MV7A 2RC4A 1S5LC 4HX4A 3W3CA 5A2QZ 5J2TF 4LF6H 1K83J 4UUSB 1VI0A 3GFIA 2DOAA 1FVIA 3H0GG 1LEBA 2K9SA 1XPXA 1P4XA 1FP1D 2CV2A 1KBLA 1OKRA 2VBXA 3I4MJ 3H5AA 3WTSC 3ZPLA 3O8HA 2F4IA 4QW9A 5L1KA 5FFXA 3G2BA 3IL2A 3CO7C 4KYWA 2E34A 3PO3G 3ZOBA 2B63J 3OL3A 3K5IA 3HSRA 3NQOA 4Y17A 2D5VA 4M72A 3FKJA 2W48A 2JVGA 2W8KA 4ZTFA 2E1CA 1LEAA 4MA0A 5KFFA 4MTDA 4Q48A 1JKQC 2KIQA 3U1DA 1KYZA 4Y52J 5LA6F 1BI3A 1KGSA 3SJMA 2A6HF 3BR0A 3SE7A 1JT6A 2HQRA 3E6DA 3P7NA 3I4PA 3HOXJ 1HNZH 2E2JJ 2JUCA 2KIMA 2WY7Q 5FO5A 1B6SA 3GTOA 4HW0A 2K85A 1P8LA 5CB4F 2A6TA 3DKWA 1UB9A 2M4GA 3HPGA 3K7AJ 5L3BA 1V4YA 2WB1E 1HSJA 3OYDA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 1ZK8A 3JRBA 2XCAA 2EFOA 3QRFF 4H0EA 2HGSA 1X1DA 1G6NA 3EDPA 2DN0A 5CJ9A 5DQIA 5K5QA 4GYGA 2VA2A 2JRMA 4IRKA 1W5SA 2RV8A 2W9BB 4II3A 2MC4A 2L9SA 4A3BJ 2XVCA 3HRTA 2NVQJ 1MNMC 2CJJA 5ILUA 2EK5A 4YR2A 2CQ7A 5B5EC 1D1AA 4NC6A 2BY3A 2VBZA 2AGPA 2HYFA 2HXOA 1OCCH 3LOCA 4Q0YA 4EYHB 4G94A 2MH2A 2J5OA 2VE9A 4CSWA 2DMPA 6PAXA 1VQPI 3SDBA 5D8KB 1EJ9A 2CV0A 2EA4A 3LSIA 1JDBB 3FXUA 3IRRA 4BY7G 4J9QA 4L5JA 4ECVA 1MNDA 4R8UA 4D5FA 4IHSA 2CFOA 1S7AA 3R4KA 2XKOA 1N78A 3UKGA 1O4XA 4AYBN 4CUGA 1ZQ3P 1MBGA 5HDGA 2VONA 4F4ZA 2P5KA 2Y2ZA 4GLXA 2RNJA 2KRHA 3BOQA 3DBLB 4YY3H 2VJJA 2WWYA 3KYCB 5BR8H 1LE8A 3F9KA 1WRJA 3K4MA 2K4BA 3I71A 3HHGA 1O75A 2BVLA 4W97A 2FLLA 4GCVA 4A3KG 1B6AA 1IRXA 1YS6A 2A05A 3LSPA 2JJ7A 3RGXA 3PR5B 4RB1A 1WH5A 2JA5G 3O8GA 3E6BA 2E5ZA 2NNNA 3GWZA 4E7KA 1N48A 1RKWA 1SD6A 2CMPA 2R87A 4LIVA 3OSGA 3GV5B 5E20A 5CPRB 2AXLA 1HNXH 5HNFA 5D5UB 5H2FC 1U8BA 5L3DA 1V5GA 1YX3A 2HPIA 3RYRA 2L9RA 4RNOA 4Z2YA 1Y8RB 2W1OA 3SZPA 3EPIA 2TRTA 1Y0NA 3S14J 4D0PA 2X85A 2W25A 2OJED 3N05A 3F8MA 1R22A 3OHBA 4NDLA 4R7RA 4ENMA 2LC2A 2Q2UA 2XC9A 4A93J 4ASNA 1VQ7I 4KIBA 1G8XA 1EV7A 1PDNC 1SEIA 3AG1H 3I12A 1X3ZB 3L2QA 2HTJA 4UVBA 3KPHA 3OYMA 4LFAH 3VB2A 1M0WA 5KT5A 5C4XG 2VBWA 1ZGWA 3CJQB 1IW7F 2E36A 2W6ZA 2XCPA 2OTLI 4BUPA 3WGGA 3I56I 3M3YJ 1XCVA 4PJ0C 2XSJC 1J5EH 3GO5A 1QPMA 3EPZA 3GZ6A 3MFHA 2R7ZA 3BQZA 1E17A 5GTHC 3EUHC 2PLYA 2LDUA 4DIQA 5ICGA 1I50A 4EM1A 3T1HH 5CVUA 2ZMEA 5K7HA 4I50F 4XONA 1TL8A 3RQ4A 2Z99A 4BXXG 3GUDA 1I50J 4EG0A 2HVQA 1SVLA 2BZTA 3T8RA 1POGA 2AGOA 2NVYA 2R8IA 2HU9A 2W6NA 3FDYA 2W9BA 3REOA 1Y1WA 1BI1A 2YU3A 5A2QK 4YP3A 2ZO4A 3E3VA 2VR1A 2E2HA 2CU7A 4J9NA 3H92A 3CMYA 2ALZA 1WHUA 4OAYA 1TQPA 3K3VA 3FXKA 3ORQA 2HHHH 2J6TA 2JA6G 1QZZA 5K1YA 2BQ3A 3ISPA 4JYKA 2O6GE 2X6WA 2VODA 2XAFA 4YHHH 2IJLA 3Q2OA 1FWZA 1OYWA 4DGWB 3GLLA 2MGQA 2W7NA 3OSFA 2MG4A 2P8TA 2ME6A 3VYSB 2OPTA 1MDMB 3FXOA 4PZJA 3T8TA 1JJ8C 2LY1A 3Q8QB 3HIFA 2Q0OA 2HOAA 1I27A 5CQGA 1Z67A 1ZRDA 2TCTA 1KZHA 4MV3A 4DL7A 2HEOA 3IP4B 3HHHA 2EBIA 1DGRM 3LQRA 3AG4H 4WD3A 1Z2NX 4HNUA 2LLKA 1D1CA 3GTJJ 2OF7A 2NVXJ 5JQWA 3T5HA 2P0WA 3WG7H 3RBDA 2UVRA 3S93A 2XASA 2PN6A 3WO0A 2XIGA 3GTMJ 4NXNH 2AHQA 2DT7B 3RYPA 1WJFA 4XOTA 4JX6A 3FMQA 3GTMA 3C0FB 3FMRA 1IRZA 3M9MB 3HBLA 1J2XA 2R5ZA 2KJBA 1YIJI 1IBKH 2F48A 4A5NA 3G6YA 4UXNA 4X1EA 4KUMA 2DDBA 4CCLA 2HI3A 2NU6B 3MR3A 2O61A 1XMQH 1D8KA 4BYYA 5LEJA 2BE5F 1UG2A 2LTPA 2IPQX 2EQRA 4G6DA 3A01A 2EINH 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 2CS3A 4IKFA 2V4QA 3KCCA 5B1BH 3BJ6A 3ERED 1WSCA 4DV4H 1WH7A 4R79A 1FC3A 4ZZLA 4A3GJ 3GEZA 2UUCH 4I98B 5LMUH 2D1VA 3WTYC 1WSUA 1VS0A 3DTKA 5BPIA 4Y15A 3RV4A 2J6SA 1VNDA 1YW9A 3K4CA 4DYQA 3FKIA 5FKKA 2PG4A 3DF8A 2WAFA 2EV6A 4EJWA 3CCUI 4F93B 3B6AA 2QQ9A 3FKIJ 2V5AA 3SDGA 2PBIA 2A5WA 4WXDA 1F4KA 1D3YA 3AFHA 4JX4A 4X66H 3DXJF 3PW4A 1MH3A 3QYFA 5CVRA 5HLHA 3UFXB 3GV8B 1S3JA 3PW7A 1GVDA 1YRNB 4MV6A 1PJRA 2DCEA 4BU2A 4AIKA 3K1PA 2LP0A 2IP4A 2W70A 3Q9SA 3BR3A 2GBYA 2KPMA 2WAQA 3EETA 2ATLA 3GVAA 4GFBA 1R58A 3UR3C 4IZOA 3TO9A 1J09A 4ZYGA 4IR9A 2NAZA 4X64H 2OQGA 2DA4A 2CQXA 1A36A 1A04A 1UG0A 4DOZA 3U9SA 3OYNA 4KT6A 4DQ2A 1TAEA 2E5NA 3ULQB 5HVQC 4UCVA 5K7FA 2QQBA 2L9VA 2QKLB 3CZ6A 3D5RC 4LFUA 3G3ZA 3RKWA 4IHWA 2EIKH 3QYBA 2W9CB 5IP7G 2O03A 5LEKA 3N97A 4Y8VB 4KDPA 2HDWA 4K2EA 4I7HA 2DFEA 2V26A 3GF2A 4N0BA 2GM4A 3BCAA 4U6PA 2K9NA 4IRCA 3JRDA 4UCRA 3J81K 3F3XA 5DG9A 2RGRA 2VPRA 3C2BA 5EEAA 1H9GA 1R00A 3S8PA 3JRIA 4O3RA 2BY2A 3CP2A 2IBKA 2XGXA 2HQAA 2JA8J 3GTOJ 1YX5A 2VUMG 2ZM6H 1W1WE 1DGWY 3QU3A 1KU2A 4BHBA 4HDUA 4QWAA 3H4BA 4HX8A 3BG3A 1HXDA 3RUPA 4TV7A 2DMTA 4F55A 2OCEA 1X4OA 1DU0A 1VQLI 4B3MH 1B4AA 3TQTA 3WTVC 3HRUA 3ETJA 1Z6RA 1JGGA 3RZOJ 4UCOA 1B9NA 4V19K 4DR2H 3IH4A 4M3GA 3S1RJ 3N41B 1HDDC 1EUDB 4DJAA 3DEUA 2K3PA 4HV5A 5KFWA 3M9AA 3WGIA 3E7LA 4A5MA 1SFKA 1H89C 4ME6A 2LF8A 4GC7A 3OYAA 2CQNA 2HDDA 4MA5A 1KU3A 5C4XJ 2F5EA 2P81A 4Y33A 1SFXA 1B9MA 3PSFA 4E7IA 4A3IG 1TTYA 1IC8A 2FRHA 4EEQA 4IR1A 4JI1H 3DKXA 4LB5A 1MDMA 1VQKI 5EZHA 5E17F 4L9JA 4LF9H 1IUFA 2FX0A 5IYZF 3BR6A 4QWBA 5IYDG 1GT0C 1V3FA 2Y9ZA 4FX0A 4BY1G 4E7ZA 1IXCA 4RZRA 4JX5A 3TP3A 3F72A 3O3KA 4Q8EA 5CA1F 1XTAA 4NBQA 2A69F 1UHWA 1V51A 2FPPB 4BQNA 1BI0A 2QF7A 2YX4A 3OS2A 2R3SA 4RM2A 1QA6A 5EGOB 2CQYA 3EPGA 1MNEA 1QPIA 3HXLA 4L9NA 1TLHB 1R4MB 3RDIA 4RLQA 3CDLA 2FF4A 5KFUA 1ZELA 3AAFA 1S9FA 3BR1A 4XQFA 2OWOA 4F4WA 4MEYF 4Q47A 3MWMA 1JKJB 4MV4A 4NXMH 5FROA 3JAMZ 4F91B 4IOCF 3ERMA 2R7QA 3HZJA 5KG7A 4ZYHA 3CMAI 4U7CA 3U21A 2R7DA 4B43A 1B04A 1JXSA 2V4RA 2H8RA 2FMYA 3AL0B 2IS2A 3GLKA 4BL0B 4XSXF 4CH7A 1TW2A 2GA2A 1M6VA 2J9GA 4CCOA 3V42A 3SFZA 4HAMA 4RM3A 2JEFA 1R1VA 3JSNA 1ULYA 3BTIA 4XKBA 2VQHA 2VQLA 3RJPA 3CCVI 1N56A 4RB2C 5FLXK 4M9SA 2R84A 3A0HC 2JK3A 1R4NB 4O6JA 4XYMB 1CF7B 1RPWA 1UMQA 3ZQCA 5JI6A 1BI2A 3TP0A 2VB6A 5B3SH 4XX0B 1U3EM 1JX4A 1EH7A 1K78A 3RB3A 2CO5A 3D5SC 3TW6A 2JSPA 4OWRB 3QZ8A 4RU9A 1YYVA 5F1RA 1PYVA 2Y48A 5KFLA 5C3EG 3N4MA 2R7KA 4GXOA 3FHZA 3JAMK 3ZMZA 1RIOH 1K4SA 4NUBA 1SFUA 4Q8FA 2ELHA 1JUSA 1R5HA 3SEZA 1JGSA 4O2AF 1Z3YA 1C3OA 2WV0A 3WNZA 4OIOF 2UXCH 2ELJA 4HRIA 1XSXA 1ON1A 3A02A 1XDSA 3HYIA 4HV6A 4XLAA 4EEFG 3HUGB 1OWTA 3BCBA 4M6VA 4LSXA 3F8FA 5KT6A 1R5GA 1RR8C 2MW8A 5L3GA 2A61A 4HOBA 1MBKA 4OIPF 2VJ4A 2ZBKA 3TGNA 5J1RA 1KJ9A 2AQEA 2KLOA 4LMYA 2F4VH 3MWEA 3X2QH 4JP0A 2FOKA 3QZ7A 2NVYJ 2XC7A 3OR1C 2HFHA 3SHFA 5E3MA 2HVSA 1UC9A 1BGWA 2QBYB 2QEXI 1KONA 2KIUA 2ZSIB 4UFZA 2ZKZA 1MMAA 4M3DA 5J40A 5EDNA 2P6SA 2XB5A 1SD4A 1L2ZA 3OYKA 5FLVA 3ZQQA 1QVUA 1NTCA 3S1MJ 1ZETA 5IYDJ 1CE8A 3L2CA 4IX7A 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4P9FA 1JUMA 4L18B 3P5JA 5HV6A 3MKWB 1I3QJ 2L01A 4XRFA 2VPLA 3R0AA 5EJCA 5KFAA 5KFDA 4I76A 4LLGF 3OOUA 4XIDA 2R8JA 5KFYA 3HOUJ 4HA8A 3MZ8A 4HLYA 3C2HA 2D2WA 2Y0SE 3K1MA 2UU9H 1BJZA 3CCLI 5ILVA 2FBKA 2GXBA 2UZKA 3NAUA 1BL0A 4EV0A 4HF0A 4CZCA 2W8LA 3GIDA 5KT2A 2E5LH 4A3LG 2Y0SA 5J4YA 3IKTA 4XRSA 4M6XA 3WTTC 2KHMA 2R85A 3BAAA 1RYSA 5FD6A 4ECWA 3RKYA 3N8DA 1N33H 2CZGA 3HUGA 2YYAA 3C18A 3JCUC 4G3IA 4Y4RA 4DV5H 1R1UA 1XS9A 1D0ZA 2CQQA 4RAFA 3JRCA 5EWFA 3NARA 3ZXSA 1UC8A 1BN5A 4UB6C 2X1CA 2DO7A 4ED0A 2KIFA 3GX4X 4D5CA 2RN7A 4X65H 2H8WA 1WH2A 1M7JA 3TINA 3PFIA 3UNGC 2W00A 2KKOA 4G8XA 3GIQA 5KG2A 3ZQLA 2VQGA 2AQFA 4YJ3F 2C28A 1ZN2A 2W9CA 3BTCA 3GIKA 2M5WA 2P5LC 4WBNF 1DQUA 1X2MA 5C44G 2OTJI 1VFCA 5J4VA 4BE2A 1T38A 1PUFA 4EBDA 3S3NA 3K2ZA 1IDYA 4FCYA 1K61A 1K1QA 3I5UA 4A2UA 2KP6A 3R60A 4C3IJ 5HODA 5TISC 3GIIA 3HPHA 1AWCA 4QPQA 3H9QA 1FJGH 2IA1A 3LSTA 4LFCH 3ABTA 2DBBA 1Y8QB 1MW7A 1WWXA 1YOVB 2QVOA 3ZMVA 2R7XA 3OL4A 3KEQA 3VMMA 1FYMA 4I6ZA 2R6FA 3OHAA 4DV6H 1O3SA 4DL4A 5HBRB 3WO1A 3OS0A 2UXDH 4MLOA 5FLMJ 3L4KA 1TQIA 3AL0C 4P1WA 2VXZA 2YZNA 3CTAA 1MD0A 4A3IJ 2OH2A 2CYYA 4PJNA 3W6JB 3RPUA 4DBRA 1I39A 2G0EA 3DCFA 3I53A 1L3LA 4S05A 4JV2A 1IV8A 3DPTA 5TGTA 3F21A 5E79C 2PEXA 3JREA 2OU2A 4TQRA 4H4KC 1WZ2A 1BJTA 5HLGA 5CKTA 1F36A 3CJRB 1VZ0A 2FUG2 2PI0A 4EJTA 2XPUA 2H27A 3FKIG 2FBHA 2NRAC 2CRGA 2HJWA 3N42B 3HL2A 5E18F 3BG6A 1HQCA 2HYJA 2DWCA 1LVAA 3M8FA 5EG0B 5KFCA 2E7WA 5IPAA 5KG1A 2ZJ2A 5TRDA 2L7KA 2ZFUA 4XLCA 2E1NA 2UV1A 3HGGA 1ITYA 3AYHB 3RBEA 2PMUA 3A01B 1JDEA 2VPSA 3LSJA 2CGPA 3BC8A 4YR3A 1MBEA 2V59A 3GFMA 5L3CA 1G2HA 3OYHA 4AUXA 2MYSA 3PVXA 1UAAA 1VQ9I 1SAXA 2DA1A 3VFZA 3K4LA 3CUQC 5AIQA 3JR9A 4KFCA 1OMIA 4M7EA 2W84A 4ECSA 4QJFA 2UXBH 3TOAA 1VQ6I 3DTIA 3CDHA 4ZDPA 4ECTA 2FBIA 3GV7B 2DAOA 1J9IA 2H6BA 1IJWC 4JI5H 2LR8A 2C00A 2AO9A 2XGCA 1ENHA 3BR5A 4D7MA 1MSEC 5KHDA 1UNNC 2F2EA 2DA5A 5E8IA 2DFHA 1I6UA 2STWA 4XKCA 1LDKB 4HNTA 1B59A 1VAJA 1XDUA 4J9MA 2XGEA 4KJZA 5JVGF 2O8KA 2NS0A 4EJVA 1J5YA 1OCOH 5LHGA 2GOMA 4CO8A 4DZJA 4UCTA 2DMUA 1W5CC 2P0AA 3J7YJ 3OYEA 1KEEA 4MO7A 2W9AA 3KLNA 4XN0A 1ETOA 2NVXA 4Y3OA 3I55I 3LSMA 3G4SI 3PUBA 2O0YA 4GRIA 1HC8A 2VT3A 4E4TA 4MTEA 1VQ8I 2GPSA 3LP8A 5KFIA 2YS6A 3T5KA 4U88A 1SMTA 1BBYA 1ETYA 1T3NA 4FQGA 2BHZA 1GLNA 4XLFA 2BXYA 2CQKA 1S72I 2AS5F 4KIFA 2CV1A 2FK3A 2NU7B 2UVVA 4DV3H 4OAZA 4KT5C 4NQWA 2VQDA 1CQJB 4DW6A 1GV5A 2L0KA 3IH3A 4WCGA 4XOPA 3V7CA 3V8JA 2BW3B 2W6MA 2KDZA 4A3GG 4J0MA 3H1CA 3I54A 4P55A 3S3OA 2XAJA 2XRNA 1MSFC 1BR4A 2LY9A 4J9PA 4A12A 1BM9A 1HDPA 2DJNA 1I3AA 2K7LA 4BE1A 1YJNI 2MA3A 1EF4A 5GP9A 1YJWI 4J9KA 1BOBA 2GIZA 2MD5A 2WAEA 2DK5A 4MQ9F 2L3DA 5CLSA 5GPAA 1B8IA 5DLFA 4A3KJ 2XAUA 1GSAA 1XGOA 1H9TA 4A3CJ 1X4PA 1TWCJ 2O5RA 3CD6I 2IA2A 2H1LA 1IGNA 1J0RA 1LVKA 3FF5A 1HLVA 3CCMI 2VE8A 4EMSA 1NG6A 5CAEB 4I0AA 1TBXA 2E2IJ 2W85A 2WA0A 1OR7C 2VIXA 4KISA 5LOVF 1DDNA 4JI0H 1XB4A 5KFTA 2AU0A 4B3XA 3ASOH 2E2IA 4DV2H 5K2MA 4UHTA 4BJ5C 1RUOA 1GDTA 1ZKGA 5D4RA 3KETA 1FTTA 1USSA 3P9KA 2FNAA 5IT9Z 5J1UA 3OV8A 4A69C 2P4WA 5KFRA 1TWFA 1N75A 4HR7A 1K83A 4BXFA 5C4JJ 1VKZA 1RKTA 1KQ9A 3KZZA 4NNJA 5FLMG 1N25A 2DDAA 2NS7A 3MFKA 4DBQA 5HDNA 2QUFA 3H3VK 3BPVA 2Y9YA 4O4LF 2VA3A 2AQ4A 1V5FA 2DTZA 3DBHB 1T56A 2A68F 2WBMA 3K10A 1FOXA 1ZRFA 3ABUA 1PUFB 3IRQA 1MMSA 4PFPA 3EYYA 3HDDA 4HSTA 5KG4A 1DUXC 4M9UA 1N34H 2C2DA 4IAJA 3O6BB 3L4JA 2YZGA 3QAHA 2V1UA 4EBCA 2RDPA 2GOXB 2R7OA 3HGYA 4P5OA 2K27A 1S8NA 5GTIC 1K4TA 4AU7A 4YJ2F 1Z91A 3CUQB 4AIJA 2L2OA 1XD7A 5FPOA 4O3MA 2E60A 4XKWA 3Q8SB 3DPUA 3HSFA 5M5WJ 1XG1A 5KFMA 4U87A 4DV1H 1Z2OX 3H9JA 4LH6A 4BXXJ 3H35A 3KP2A 4ETSA 4BJTA 5IYCG 2PBZA 2QK4A 3PW0A 4A3MJ 4OOIA 2BQUA 2I8DA 5KFXA 2F5VA 2OV7A 3KP4A 2HZDA 4AWXB 3IV5A 1OFCX 4ZHQF 4RA2A 4UB8C 5KG6A 1LNWA 2OZUA 3F23A 1UELB 2IA0A 2ZXJA 4U7BA 3SZTA 4DNCA 2IS4A 3KAJA 4BEHB 1AA7A 3BWGA 4M9ZA 4A3LJ 5LRRA 3RF2A 1T0FA 4AYBA 5EWGA 2MBFA 5C3EJ 3GTLJ 1G3WA 1VBGA 2R7FA 3QWLA 2NVUB 3JZIA 3C7JA 3R61A 4JI2H 5DD4A 1B33N 5I47A 3G73A 3VPCA 1XGMA 2EA2A 2Z2SB 1AOYA 5KG3A 3ONQA 4ED1A 1XX5A 3A1YA 3H0GJ 2IW5A 2HOSA 5DLGA 1XSVA 2IP2A 2W4SA 3E1SA 5KT3A 5K5RA 3DWLE 5EYRA 1SANA 3QOEA 4QTRA 1T36A 1ZG3A 4A0XA 2E1MC 5LMNH 3PZPA 4HDVA 3FM5A 3BQ0A 1LB2A 1TW3A 4A3MG 2X6OA 1AKHB 4S04A 4KMUX 5IYCJ 1ONVA 3G1OA 1T94A 1VF9A 1MGTA 3FIWA 4M71A 5DGBA 4HQEA 2O7OA 3V4SA 4ED3A 3QPLA 3RAQA 4C3HJ 1QVTA 3RKQA 4KN4X 5F0HA 2VUMJ 1HKQA 1MMNA 4R8HA 4IHXA 2R8KA 5HS8A 2JA8G 2L4AA 4C2UA 5D5XB 1A31A 3U9GA 2LD5A 2X1DA 4B3AA 1N36H 2FLNA 1WJAA 4AYBE 2XF7A 2ASDA 1BW6A 1Z05A 2LMDA 3HOXG 3RB6A 4LG0B 2YS9A 1JKRC 2FMAA 1IAWA 5KT4A 4QIWN 2LBFA 2VOBA 3ZMSA 1I6XA 2R7UA 3JRAA 1XMOH 1LDJA 2IS6A 3A0BC 1X19A 1NK2P 3DEEA 2SCUB 5C8YF 4KMFA 4AQYH 1W7PD 1QNTA 2EILH 3RPQA 3DV8A 2CWEA 2X0SA 3PNYA 2FEZA 4M3BA 4FASD 3KFWX 2R5YB 2JQ7A 5M5XJ 5DDGA 5JVLA 2JEJA 4YIRX 2JEIA 1AKHA 3FK7A 1X1CA 1LDDA 4DR1H 3SZGA 2XPVA 3L2UA 4JI7H 3G6EI 4RMNA 4D9JA 3H3VH 1U2WA 4ZH4F 1A6IA 3E6CC 2KISA 4G7OF 1RK5A 1ZHFA 4M3EA 2R7WA 4RGXA 2QKMB 4MAMA 2JA2A 4M9XA 4NC7A 5DV5A 2UUZA 2NXNB 5BPDA 5KAFC 2AGQA 1QHHD 1U9OA 3HOWJ 1ETXA 3BZCA 3FM3A 2DA7A 2MSYA 1GGOA 1WCMA 2W6QA 2V1NA 1XMAA 2XB0X 1Q1VA 3F8CA 5FFZA 3CC4I 1G3YA 4LG0A 2PFBA 2BXZA 4A3FJ 1OJLA 2BY1A 2JT1A 1TWAA 3L2WA 4U0WA 4MFDA 4ED6A 3PQJA 1JHHA 5K5OA 3DLLF 3RPUD 1WKMA 2PMHA 2QSHX 4B3TH 4ZJZA 1MBFA 4OIQF 5LHIA 2VKVA 3FXRA 3ZN1A 2MLKA 5DQGA 2R92A 5LHHA 4DR5H 3M4IA 5ICCA 2V9PA 3IKVA 3R5HA 2XAQA 2R92J 5KFEA 4E7JA 5FGMA 3J7AK 2GLOA 3FHNA 3MAJA 4J00A 3QFFA 4C5CA 1JTYA 3ABKH 1X1AA 2Z16A 1BNCA 2M05A 2YRXA 3R5FA 4CC5A 3NGDA 1DP7P 3I3LA 2KMUA 2XROA 4IWYA 2OUMA 4LK0F 2KZGA 2UVWA 2M30A 3E97A 2W6OA 4BAYA 3CP8A 5L1JA 2P7VB 4ED7A 4QWDA 2V9VA 4QIWE 5KFNA 3T1YH 5IWAH 3HOSA 2EFPA 1AU7A 1X3UA 3GTQJ 5F6FA 3BZKA 1FYKA 4L0YB 2FLPA 3GTPJ 4QPOA 2W82A 4RB3C 4YBZB 5DG8A 1TC3C 5L3EA 2P7CB 1IXSB 1SD5A 4BXUA 1QZEA 2VC0A 3GTQA 2GPWA 1I3QA 1QRYA 2EIJH 1TWHJ 4PSXA 3RQIA 5D8LB 4UUSA 3E0JB 5M3FJ 4IPAA 5JH7F 3MR5A 2O9LA 5FKNA 4QW8A 1W0TA 4YQWA 4M6YA 2XCLA 1U0JA 5LGTA 5JUMA 4FETA 1DP3A 5LGNA 2B0LA 3T1BA 2KFDA 4ABZA 4ESJA 4I4TF 1KJ8A 1D1BA 1PP7U 3OIQA 2PJPA 4TUYF 2W7OA 1HW5A 2ZNYA 2L4MA 4C5AA 4J9LA 2VJIA 3FWEA 5CVIA 3KE2A 3EYIA 2PMZA 2G9WA 5E3LA 1YI2I 3ABLH 3OS1A 3OR2C 2YCHA 2XKPA 4HPQA 4OIRF 4F3QA 1OCTC 3T5JA 2WY8Q 4UCUA 1YW8A 1JIHA 2VJ5A 2ASJA 4ESFA 2DPUA 3ZCOA 3SQNA 2KL4A 1QZYA 1S9HA 1Z6TA 3DU6A 3O2PE 4O5VA 2CW8A 4LJZF 1O7LA 3FZVA 5DGAA 2L7ZA 5D4SA 2V6EA 3ZR8X 1MJAA 3KHRA 1Z1DA 2VQCA 5EEHA 4G12A 4QSHA 4II2A 2Z3YA 2C6YA 3OYFA 3TL4X 3PN1A 1SFEA 4GGGA 2ZSHB 1FBUA 1R36A 2E35A 2V1XA 2YSRA 1FIAA 4C30A 3S1NJ 2ISYA 4V2GA 1ZARA 2FPIB 4F4YA 3A03A 5CQEA 4I0BA 1Q1HA 2CUFA 3L2RA 2EV5A 2HYGD 3BG7A 4I01A 5J6XA 4ZQIA 1XNQH 5KCMA 1BJAA 2JRTA 3TQNA 2DI3A 2YUSA 2OQRA 3HOVJ 3BJOA 3Q8PB 3CESA 1SMYF 4ECRA 4L5EA 4ENJA 1RUNA 3ZQIA 2O3FA 1FP2A 3S3MA 3WU1B 3HC7A 1YE9A 3RAXA 1P7JA 4UVCA 1K6OA 2ICWG 2LKPA 1ETQA 3BPXA 3ORRA 4YB8B 3WODF 1FT9A 2V9KA 5IP6A 3HJEA 1F43A 2RKHA 1FOKA 3J7ZI 4CCKA 3Q8RB 3KHGA 3CQZJ 4LB6B 2PX9A 5AIPA 5BPHA 1D5YA 1OQYA 1KU9A 2RDIA 3BA8A 5JVTA 1U8RA 1WPKA 5DG7A 2Y0MA 3CQZA 4EYIB 2F4OB 3B02A 2ZMEB 1ON2A 4TQSA 1RJQA 3N44B 5M3MJ 3OY9A 4MGRA 1DV1A 3TEDA 2IVMA 4HG2A 2ASLA 5H20A 2L7FP 1WFXA 2OZ6A 3ECOA 4MV1A 4FS1A 1FBQA 5H6RA 4C3JJ 1Y14B 4O3QA 1Z0XA 4E7HA 4UUVA 1KQ8A 1X2NA 2XAHA 1Z7UA 1OYYA 4FISA 2A6EF 1VQ5I 1YG2A 5AONA 4IQJA 3CCYA 3HKZE 4B4CA 2JWTA 4LG3A 2K3FA 2RREA 1ETVA 3BQ2A 4FM9A 2KRCA 4EJOA 2DK8A 2KDOA 1QHGA 5EGOA 3OYIA 1J59A 3U9TA 4PUSA 3V7RA 3K3PA 3CDIA 5C44J 3V4ZA 1C30A 3MQ0A 2BOLA 3QPTA 5H6QA 3VSLA 5GAHJ 3GXOA 3JRHA 2V7FA 3HOYG 5IOYA 3M1CA 3Q5FA 3IHUA 5LYJF 1YS7A 2NOJB 3IH2A 4EQQA 3CJNA 3PNTA 2W24A 4HEA2 3RI4A 4FHTA 4XK4A 1ZGJA 3WU0A 4JUZA 1ZR2A 3C2GA 3KYDB 4PJJA 5F0FA 1SEUA 2DU9A 2K40A 2ZC2A 2Z5UA 3G1MA 4JI4H 4JYAH 1SVMA 3J80W 2NUAB 4Q4ZF 3G6XA 2EWNA 3LFKA 3GFLA 1KJQA 1BIBA 3I9V2 3K4BA 2VPQA 4QWEA 2DLNA 3K70D 1TWGJ 3L2VA 1CS0A 5D1OA 1T98A 1W93A 4X62H 3VODA 3TMOA 4YIFA 4BY7J 1BOAA 2CUZA 5BMZA 5JVDF 3KHLA 1ETKA 1TWGA 1X9NA 3VWBA 2WC2A 3MFIA 2CKZB 1J7KA 2R93A 1NG7A 3PIOF 4NHJA 4ECXA 1ZH5A 2HNHA 1D0YA 1ZQ7A 2I10A 4XRSG 1UHMA 2BW3A 3LSHA 3R0JA 3RIRA 3HTUA 4RGUA 1E3PA 3V8KA 1K78B 2JA6J 3HOUG 3GTLA 4ENNA 1XN7A 2FA5A 1EA3A 3RTRA 1LFUP 2JA6A 4RDUA 1FTZA 1HSTA 3BP8A 1XNRH 4DL5A 3JRGA 2B7EA 4EJUA 5L9XA 3RB4A 2VKEA 4B48A 3TQ1A 3GIPA 2X0LA 5KFKA 1XCBA 3JRXA 4B3RH 4ECQA 5B1AH 2RNGA 3FDSA 3WHBA 1KU7A 3M1EA 5B66C 4IEJA 1ZR4A 4CZZA 2EZHA 1HF0A 4O3SA 3OYBA 2HWVA 3DP7A 3RGZA 4J9OA 5FRNA 1R6RA 3V6KA 3TW7A 3S32A 3CO6C 3KLOA 2RGVA 2I5UA 2Y69H 3JSPA 3AKZA 3J7AO 3H5RA 4V2FA 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4IZZA 3J7AY 2CUEA 4QLCU 2BQRA 4YFKF 4B8XA 2M7AA 2EJRA 2JN6A 4I55F 4N4OB 2EH3A 1HKSA 4UY8I 2LF7A 4P96A 1D8JA 4YEJA 3WGHA 1TT5B 3GCMA 1L0OC 1TWCA 2HOEA 4DYRA 2IS1A 5DS9A 2QZ8A 4LF7H 3CLQA 2ZDGA 5IYBG 3HOZG 3S15J 1P2FA 3VDXA 4I09A 3W6VA 3PW5A 2FD5A 4MFEA 3HM5A 2YU9A 3OSPA 3FXMA 2ADUA 2ECBA 1GXPA 2J6UA 3ZN0A 5HOOA 3T5LA 3PIPF 2XGDA 1T95A 1U6GA 1RYRA 1BC7C 2YU9J 2O8XA 3V6HA 2DT6A 1GSOA 4BQOA 2IXSA 2V79A 1Z77A 5IOZA 2M0CA 2FJ1A 1IN6A 3C1DA 5EZGA 5KNLA 1OPCA 1TZLA 2FPGB 2MH9A 4A3JJ 3H20A 4LF4H 1YTYA 1SC7A 4E70A 4XRMA 1VQ4I 1RJRA 4Q5SF 1V4RA 2NU9B 4EGQA 3IAS2 4IVNA 3BR2A 3Q0VA 2H09A 5KFHA 1PX2A 4C2MJ 4MIMA 4JI8H 5JLXA 4O2BF 4BBRJ 3H3UA 4R8UB 3KIOA 4W1UA 3A2KA 4XL9A 2ZJPF 4IHYA 2XDVA 3BQ1A 4BJ6C 1U5TA 3K1NA 1LFBA 3B73A 1KYWA 3OUZA 4BE0A 2HR3A 4BQAA 5F9LA 5IT9W 2XV4S 1TWAJ 1B8IB 2L9NA 1AUVA 2B63A 1RC9A 3VYTB 3S2DJ 2Y31A 4Q43A 3OTOH 3RB0A 3BG5A 1LE8B 2ZMEC 5F08A 2GIVA 2W57A 4LLNA 3BLYA 4FTHA 1Y1VA 4LSAA 3M9OB 4RLFA 5LFAA 1ERDA 1E4EA 3PR4A 2R8HA 3MVPA 3QU6A 2NOGA 2WDTA 1ORKA 3PNVA 2R5ZB 2K9LA 2LY2A 1P7IA 4HF2A 1FEXA 2BR0A 2R8GA 3HKZN 3LAPA 4YR0A 4CCMA 1S0OA 1W36D 2ZCWA 4L0ZB 1FPQA 1MMDA 2JMWA 1HBXG 2GLTA 2YZMA 3V6JA 1F5TA 1U9NA 4BY1J 4OU0A 5EWEA 2X48A 1IBMH 1NHAA 2JTVA 5BQTA 3W2WA 1SFOJ 1CF7A 3J81W 3GFJA 2COMA 1Y1VG 3BROA 1P9QC 4DR7H 3FXQA 4BHCA 2ELKA 4A0YA 3FK6A 4U0VA 3M4OJ 4LIUA 5BNGA 2NU8B 3P9IA 1S0MA 1SFOA 2BY0A 2B63G 4I99C 3DF7A 4XSZF 2DIKA 3GIMA 4LGWA 4UV8A 1HW2A 3ZRGA 3K0LA 3GTPA 1E4GT 4IHJF 3LSRA 2QSGX 1A9XA 1HW1A 1OLTA 2DA3A 1D0XA 2G7HA 3I4MG 2IGOA 4K0KH 2FOWA 4L5IA 1S7OA 4LITA 1YHQI 1TWHA 2YL2A 1ZRCA 4TV9F 1RESA 3Q3SA 4P9UA 2AXTC 4BWSC 3GQCA 2DA2A 5JHUA 2PJRA 3H0GA 4AIHA 3CJTB 3WG9A 3ZMDA 3CCRI 1XMKA 1ZAOA 2JA7A 3GYHX 5FKMA 3M8JA 4N9HA 3MEXA 3U1KA 2JA7J 3I0TA 2VQFH 4A3JG 5GAEJ 3H0DA 1RK6A 4HNVA 2QLZA 3S17J 4BQQA 2EFNA 1GVJA 1S29A 2Q2EB 2VKDA 3S1QJ 5KFVA 1R49A 2Y0SN 4HBLA 2IEKA 2VQEH 5CVVA 2CH0A 2NVTJ 1WJ5A 3I4NJ 2R7TA 2HKOA 1D5VA 2VUMA 1P4AA 3NEUA 2M1BA 2FQ4A 4WWCA 2HVRA 5FLXW 2UUBH 1T8IA 2YS7A 5LP6F 4HLXA 1FY7A 3OYJA 2M0MA 2H1KA 5KFQA 4KICA 2QA4I 4NLGA 3ROUA 2X6YA 4ZYEA 5IP7J 1S68A 4IHTA 2DMNA 3PM1A 4GDFA 3LWBA 4L1KA 1TP4A 1MKMA 1JTXA 3K9TA 5F0CA 3SFIA 3K4NA 1REPC 2IT0A 1B72B 4BH9A 3CF2A 4XICA 4DR4H 3HEFA 4QIWA 1WJEA 5DCMB 3G1LA 1ZLJA 1M0TA 2M2EA 2X1EA 2YX7A 1PUEE 4O4HF 4F52A 1W0UA 4QWQA 4JI6H 1E3OC 2FXAA 5D5VB 3QYEA 1X1BA 1XDNA 3L2PA 2M34A 3R6SA 3MR2A 2GZWA 1JE8A 5HNHA 1S6LA 3IUOA 4RAYA 2C2EA 2DOEA 1RNLA 2MD0A 3AG3H 2HKXA 4IF4A 4YRVA 2QBYA 2ZXWH 1KQ0A 4JOMA 5ILSA 5CA0F 1IN8A 3IAM2 1OISA 1X1PA 1JT0A 4HQ6A 3F6VA 3FMSA 3F6OA 3LA3A 1Y39A 4O4IF 1LUJB 4EATA 2C22A 1S0NA 4I02A 5JR3A 2M87A 2OLSA 1WCMJ 3VYRB 3QP5A
chains in the Genus database with same CATH topology
4EFEA 2DTRA 3RIZA 1U5TC 1J75A 4RGSA 3WTXC 1ODDA 1R1TA 4KN7X 2DQRA 5HS7A 2CSOA 1S03G 2VC1A 3QP6A 4JQFA 5HLIA 1HNWH 1IZ1A 4L9TA 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3PQKA 1FBSA 4WF2A 1YIOA 2X4HA 3N43B 3MZYA 2JZYA 4ENKA 4APMA 2A07F 3JAMW 3W6KB 1HR0H 4ZZDA 1K79A 3L9FA 1MJBA 5DD8A 4A2BA 3D5LA 3L09A 1USTA 3J80W 1EH8A 2XHKA 1CGPA 2QWWA 2STTA 3SXYA 4JK1X 2NNYA 1XGNA 3LWFA 2CW7A 3HRMA 1FKAH 3TOBA 3J81Z 3TKYA 2FMLA 5J8FA 4DV0H 1ZLKA 2VT2A 1RZ4A 1GXQA 2D45A 3MCZA 1QQIA 1SD7A 2WYOA 1W5TA 1IN4A 1TNTA 3ZMTA 3DQVC 1PP8F 4YFXF 2BBYA 3HOTA 5E1WA 4PGHA 4G6QA 1O7FA 3DFGA 3ZMUA 5D6FA 2BEOA 2FE3A 5LLQA 3S2WA 1I1GA 2GQQA 5KVRA 5TJJA 3F22A 2HQNA 1T2KA 1MJ9A 2Q2EA 3V4GA 1AN7A 4WXHA 2KSWA 5DCFA 3FX3A 3ZQ7A 4GYIA 1P6RA 4IRIA 3LMLA 3Q9VA 3JSLA 2XUBA 2M8EA 2DW4A 4F7ZA 4GKJH 2MCTA 1IBLH 4M73A 2BGCA 2QYOA 1QO0D 3KALA 2ACJA 4A0ZA 1UCRA 3QPHA 3EQLF 1LJ9A 2F5DA 4MNUA 3KZYA 4JBAA 1F9NA 4PDBA 3M8EA 5EEGA 3ECHA 1G3TA 4LD5A 4ZYDA 4RGRA 1YO5C 4DR6H 4DR3H 3BJAA 1N32H 2G7UA 5BS6A 3U2RA 3KXYT 5CVJA 3LA7A 1TNSA 1VTNC 2QENA 3JTHA 5LL6b 1Y0UA 4IRHA 3T0YA 4IRGA 4EGYA 3CVZA 4LK1F 2OAZA 4YIIA 1I5ZA 3V7SA 1GYFA 1HKTA 5IT3A 3M7GA 3WE3A 2WE6A 2EB7A 2OD5A 4WX9A 2UXXA 1O57A 5JFRA 5L3FA 1IUYA 1DPRA 3WE2A 1IXRC 4CGZA 4BHPA 2H94A 1O3TA 2UXNA 3J80Z 3KEOA 2KJCA 2RVCA 3BA9A 1R7JA 3COAC 2Y75A 2K02A 3KP3A 2GWRA 3N6XA 1GHCA 5FPRA 4OMYA 3D0SA 4CICA 2LSOA 4EM0B 3I59B 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1FSEA 4PGGA 2VN2A 2EFWA 3C3WA 4BNCA 3E5UA 1IF1A 1ZG5A 2VOPA 5HS9A 4EFBA 3E6MA 3CUQA 5LBQA 5EOYA 2ZJTA 3LAJA 1DGSA 3K69A 1QGPA 4PDKA 4RB0A 2D1HA 3TDUC 1W7PB 4HQMA 1ZYRF 4WXCA 1ZREA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3HRSA 4CDGA 2KRFA 3I59A 4A6DA 5FB2A 4LF5H 1IN7A 4IJAA 3CLOA 3F8NA 4EM2A 2Q2TA 5LGUA 4CYDA 3H3ZA 4LFBH 2HS5A 3E5QA 3ML6A 4N9IA 3TO7A 4I2OA 4FT8A 2EV0A 1ZGAA 5DUKA 1E4FT 1T6SA 1TA8A 3TDZC 2A5YB 1Z2PX 1B1BA 2A3SA 3F8BA 2PQ8A 5HDKA 2QQAA 1W7PA 2ZFWA 1STZA 2UWMA 1XSDA 4MHGA 1EH6A 2P5VA 5E1XA 4RS8A 3OOPA 2DFIA 2FNPA 2HTSA 1UFMA 1O3RA 5F64A 4GKKH 2EFQA 2JPCA 1A0IA 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 1DPUA 3BDDA 4XBFA 4AD9A 3RJ0A 5KK1A 1F1ZA 1SYXB 2K4JA 3L00A 1YFHA 3QOPA 3IG0A 4MV9A 4IXAA 4OINF 2HGCA 2VUGA 4EVIA 3GZ5A 1G3SA 2F5FA 1ZHQA 4MQVA 1YLFA 1FNNA 1IRFA 3ELKA 2GAUA 4XLNF 4HZFA 2VOOA 5BOXA 3DPLC 3BABA 1WQ2A 2QM3A 5E1ZB 2CW0F 1O3QA 1IRGA 2BYVE 1U5TB 5A2QW 4YG2F 4L9VA 4ESBA 5D5WB 4M74A 2DQLA 3RKXA 1I1SA 5D1OB 4UVAA 2H6CA 1H0MA 4U7DA 5J8CA 1I94H 3JTGA 3WTWC 1TQMA 2V6CA 2OA4A 1ZHSA 2UUAH 4DUYH 2BV6A 4OX9H 2WTEA 5D1PA 5LRSA 4ON0A 4KA4A 4UV9A 4B3SH 2Z33A 4LF8H 2JPBA 1KA8A 3N40P 2XAGA 2LNBA 4KHPH 2VBYA 4OMZA 2F5CA 4RZQA 4Y13A 1W4MA 1Z9CA 5ED4A 5DEQA 1V9PA 2M45A 3KP5A 1OR7A 1K7AA 1ZG1A 1BIAA 2ETHA 2MLGA 3KP7A 2ESNA 4PCQA 3KAKA 5DUIA 1WI9A 4JV5H 3BY6A 2GA1A 5DYMA 4HF1A 2J5PA 1C0WA 2ZNZA 1MZBA 3IC7A 2RQPA 1IN5A 5IT9K 4A6EA 4G7ZF 4KNYA 3L7WA 1FZPB 3EUHA 3IWZA 5DCMA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 4HYEA 4CXFA 4A2AA 4XLPF 3LQQA 3GW2A 2L02A 4GO1A 3TO6A 1OYIA 2L54A 4B09A 2ESHA 1FLIA 2Z9OA 2ISZA 2YR2A 4LH7A 4UNOA 3HTSB 4NB5A 1LQ1A 3E5XA 4JI3H 3WTUC 1QBJA 1XGSA 3V8LA 1YW7A 4HX7A 1G4DA 1RI7A 4LLLA 3T5XA 4KIGA 5FD5A 4DV7H 2GXGA 3VOEA 3KP6A 3UQ8A 2IRFG 2V1DA 3HSEA 2FU4A 2MC3A 5FLXZ 3FMAA 3MZHA 4U0YA 3RTXA 2HZTA 2JSCA 5ICFA 4CHUA 1FYLA 1YQAA 4CC6A 4DUZH 2DLLA 4YFNF 2TDXA 5E8GA 3ZP5A 3CUOA 5D6EA 4RAZA 4R1HA 4MV7A 2RC4A 4HX4A 5A2QZ 4LF6H 3GFIA 1FVIA 1LEBA 1P4XA 1FP1D 1OKRA 2VBXA 3WTSC 3ZPLA 5FFXA 3IL2A 3CO7C 4KYWA 3HSRA 3NQOA 4Y17A 4M72A 2E1CA 1LEAA 4MTDA 4Q48A 3U1DA 1KYZA 1BI3A 1KGSA 2A6HF 2HQRA 3E6DA 3P7NA 3I4PA 1HNZH 5FO5A 2KIMA 4HW0A 1P8LA 3DKWA 1UB9A 5L3BA 1HSJA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 2EFOA 3QRFF 4H0EA 2HGSA 3EDPA 1G6NA 5CJ9A 5K5QA 4GYGA 1W5SA 2RV8A 2XVCA 3HRTA 5ILUA 2EK5A 2VBZA 2HYFA 4Q0YA 4G94A 2MH2A 2J5OA 2VE9A 6PAXA 5D8KB 2EA4A 3IRRA 3FXUA 4L5JA 4IHSA 1S7AA 3R4KA 2XKOA 5HDGA 2VONA 2P5KA 4GLXA 2RNJA 3BOQA 4YY3H 2WWYA 5BR8H 1WRJA 2K4BA 3I71A 3HHGA 1O75A 4GCVA 1B6AA 1YS6A 3RGXA 4RB1A 3E6BA 2NNNA 3GWZA 1SD6A 5E20A 2AXLA 1HNXH 5D5UB 5L3DA 3RYRA 4Z2YA 3SZPA 4D0PA 2W25A 3F8MA 1R22A 4R7RA 4ENMA 2Q2UA 4ASNA 4KIBA 1EV7A 1PDNC 1SEIA 2HTJA 4UVBA 4LFAH 3VB2A 1M0WA 2VBWA 1IW7F 3WGGA 1XCVA 1J5EH 3GO5A 1QPMA 3GZ6A 1E17A 2PLYA 2LDUA 5ICGA 4EM1A 3T1HH 5CVUA 2ZMEA 2Z99A 3GUDA 2HVQA 3T8RA 3REOA 1BI1A 2YU3A 5A2QK 2ZO4A 3E3VA 3H92A 1TQPA 3K3VA 2HHHH 1QZZA 5K1YA 3ISPA 2O6GE 2VODA 2XAFA 4YHHH 2IJLA 1FWZA 1OYWA 2P8TA 1MDMB 4PZJA 3T8TA 3HIFA 2Q0OA 1I27A 1ZRDA 2HEOA 3HHHA 3LQRA 1Z2NX 2XASA 2PN6A 2XIGA 4NXNH 3RYPA 3FMQA 3C0FB 3FMRA 1J2XA 2KJBA 1IBKH 4A5NA 4UXNA 4KUMA 2O61A 1XMQH 1D8KA 4BYYA 5LEJA 2BE5F 2IPQX 4G6DA 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 3KCCA 3BJ6A 3ERED 4DV4H 4R79A 1FC3A 4ZZLA 3GEZA 2UUCH 4I98B 5LMUH 2D1VA 3WTYC 1WSUA 1VS0A 5BPIA 4Y15A 1YW9A 2PG4A 3DF8A 2EV6A 4EJWA 2QQ9A 2PBIA 4WXDA 1F4KA 1D3YA 4X66H 3DXJF 5CVRA 5HLHA 1S3JA 4AIKA 3K1PA 3Q9SA 3EETA 3GVAA 1R58A 3TO9A 4ZYGA 2NAZA 4X64H 2OQGA 1A04A 4DQ2A 1TAEA 3ULQB 5HVQC 4UCVA 2QQBA 4LFUA 3G3ZA 3RKWA 2O03A 5LEKA 3N97A 4KDPA 4K2EA 4I7HA 3GF2A 4N0BA 2RGRA 4UCRA 3J81K 3F3XA 1H9GA 1R00A 2XGXA 2ZM6H 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 1HXDA 4TV7A 4B3MH 1B4AA 3WTVC 3HRUA 1Z6RA 4UCOA 1B9NA 4DR2H 3N41B 3DEUA 4HV5A 3M9AA 3WGIA 4A5MA 2LF8A 1KU3A 2F5EA 1SFXA 1B9MA 1TTYA 2FRHA 4EEQA 4JI1H 4LB5A 1MDMA 5E17F 4L9JA 4LF9H 1V3FA 4FX0A 1IXCA 3F72A 3O3KA 2A69F 1UHWA 1BI0A 2YX4A 2R3SA 3HXLA 4L9NA 1TLHB 3RDIA 2FF4A 3AAFA 2OWOA 4MEYF 4Q47A 3MWMA 4NXMH 3JAMZ 4ZYHA 2R7DA 1B04A 1JXSA 2FMYA 4XSXF 1TW2A 2GA2A 3SFZA 4HAMA 1R1VA 3JSNA 1ULYA 3RJPA 4RB2C 5FLXK 4M9SA 4O6JA 1CF7B 5JI6A 1BI2A 1U3EM 1EH7A 1K78A 2CO5A 1YYVA 5F1RA 2Y48A 3N4MA 4GXOA 3FHZA 1RIOH 3ZMZA 1SFUA 2ELHA 1R5HA 1JGSA 2WV0A 4OIOF 2UXCH 1XSXA 1ON1A 3HYIA 1XDSA 4HV6A 4LSXA 3F8FA 1R5GA 5L3GA 2A61A 4HOBA 4OIPF 2ZBKA 3TGNA 4LMYA 2F4VH 2FOKA 2HFHA 3SHFA 2HVSA 1BGWA 2QBYB 2KIUA 4UFZA 2ZKZA 2P6SA 1SD4A 1L2ZA 3L2CA 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4L18B 4P9FA 2L01A 4XRFA 3R0AA 4LLGF 4HA8A 2UU9H 4HLYA 2D2WA 3K1MA 5ILVA 2FBKA 2GXBA 2UZKA 4EV0A 4HF0A 2E5LH 3IKTA 4M6XA 3WTTC 3BAAA 5FD6A 3RKYA 1N33H 3HUGA 3C18A 4DV5H 1R1UA 1BN5A 2DO7A 2KIFA 3GX4X 2RN7A 4X65H