2W57A

Crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Metal transport
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w57A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2w57A02
1MDMA 1FP1D 3HYIA 4RGSA 2CSOA 4LLLA 2F5FA 4O5VA 1B1BA 4E70A 2VBWA 3GYHX 1P2FA 3HOSA 2JRTA 4WXDA 2WWYA 4GYIA 3JAMZ 1FPQA 1UHMA 3H92A 1I1GA 1S6LA 4RB3C 4U0WA 4G7OF 1S29A 2G7HA 1WI9A 2EWNA 4RGUA 1R7JA 5HVQC 2A07F 2JPBA 3BY6A 1LDJA 3VOEA 4ZYGA 3F8BA 1REPC 1F5TA 4KN7X 1F1ZA 3MWMA 1XGOA 4M9SA 5FB2A 1FYMA 2MLKA 2HGCA 3C3WA 4Z2YA 3V8JA 2DPDA 3WTSC 2IPQX 5LHIA 1SMTA 2W57A 1BI2A 2JTVA 3PFIA 1XD7A 3RKXA 1B6AA 4HLXA 4BNCA 3WGIA 3FHZA 4GXOA 2EB7A 1FNNA 3IL2A 3U2RA 3DP7A 4BHBA 2EK5A 1KYWA 3O2PE 4HX8A 5FD5A 2W25A 2ZKZA 2Q0OA 3LSTA 1HSTA 2O3FA 3WE3A 5CVVA 1YYVA 2H6CA 4CZZA 3B02A 4KT5C 5ED4A 4A0XA 3PQJA 1RI7A 1ON1A 1EV7A 2VE8A 3BJOA 3E6CC 1MZBA 2OD5A 4HW0A 4OIRF 3PQKA 1Y0UA 3LA7A 4HQMA 3GO5A 2ZNZA 4EM2A 3DF8A 2DFIA 3HUGA 4LMYA 1R00A 2W24A 3WODF 4LLGF 3WTYC 1H0MA 1I5ZA 2LDUA 1O7LA 2QYOA 2CW0F 2VONA 3BDDA 1USSA 1G6NA 1O57A 3CJNA 3KP3A 3IWZA 4F7ZA 1JXSA 1FOKA 3I0TA 1P4WA 4G7HF 3HSRA 2FEZA 3KP6A 1SD4A 1P4XA 5HS9A 5LHHA 5L3FA 5F64A 3QU6A 4L0YB 1U5TC 3V7RA 5J6XA 1A04A 5ICCA 3F22A 1W7PB 4LB6B 4DQ2A 4IF4A 1XGNA 1ZAOA 2PBIA 3I53A 3T8RA 1E17A 3GF2A 2GXGA 2VBXA 2Z3YA 1BI3A 3RYRA 4ZYHA 1WKMA 2V1XA 1MKMA 2ZMEA 2ISZA 1KU2A 5FLXK 4Y13A 5BMZA 5LEKA 3I5UA 4B09A 4HV6A 3ZPLA 1FBUA 4EV0A 1T6SA 2Y48A 3M1EA 3F8NA 2QZ8A 1FLIA 1KU7A 5HDGA 1XMAA 2GWRA 2DQRA 2KIMA 1OYYA 3VODA 2WV0A 1FSEA 1PP7U 3E6MA 3ZMTA 1XCBA 3ML6A 1TTYA 4BHCA 1TNTA 2D45A 1G3WA 5ICEA 2YR2A 4P96A 3TDUC 1IZ1A 3M8FA 3BPVA 3JTGA 2D2WA 3BROA 3HRUA 3KEOA 2O03A 2KRFA 4U88A 3V7SA 4AIKA 5ICGA 2MH9A 1YS7A 1EH7A 3J81Z 2IW5A 2CFXA 2D1VA 3HTSB 4MQ9F 4TV7A 2H09A 2EFQA 5AIPA 3SFZA 4HQEA 4LFUA 3KE2A 4I02A 1SD7A 1RNLA 3BJ6A 1K78B 1TQPA 2C6YA 4KMFA 4ZH4F 4P9FA 4XBFA 3HIFA 2VT3A 1U5TA 5DV5A 2HYGD 5DD4A 3ECOA 3F6OA 2QBYA 1XDSA 2XKPA 3GW2A 4PGHA 4HF2A 5E8GA 4HZFA 1HKSA 1CF7B 2DO7A 1BC8C 2E7XA 3TO6A 3NRVA 2FXAA 2VC0A 1ULYA 2FMLA 4P9UA 3R0JA 1AWCA 3TOBA 4N9HA 4NHJA 5D8KB 4MTDA 1GVJA 2XAHA 2NYXA 5HOOA 1HW2A 3GLXA 3MZYA 2BYVE 2CWEA 4FX4A 2BEOA 2A68F 3E6BA 2P8TA 5L3EA 4EJOA 2IA1A 2A5YB 3LAPA 3K69A 1P6RA 5ILVA 5E17F 5CVRA 1IN7A 5E1ZB 5DCFA 3ZMUA 4M9ZA 1Z1DA 5FLXZ 4XSXF 5DDGA 4I7HA 3EUHA 4A2UA 2IVMA 5K5RA 4QWQA 4L9NA 4BXUA 4WK8F 1QZZA 3F3XA 1LDDA 3I4PA 1T39A 1ZLJA 2UXXA 3JSOA 3KZZA 3LA3A 1WSUA 1U6GA 5HDKA 2OAZA 3WTXC 4U7DA 3HRMA 2M30A 4MHGA 1DDNA 4EM1A 2P7CB 3KCCA 3KLOA 3QP5A 2M5WA 4U7BA 4KUMA 5H20A 2EV0A 1D8KA 1BI0A 1O3QA 5LRRA 3F21A 1XB4A 1O3RA 3RKWA 5FO5A 4YFNF 2EFWA 1KQ8A 2NNYA 4BH9A 2M45A 1YIOA 3CDHA 2FBIA 4ENJA 3DKWA 2VN2A 1RUOA 2FF4A 4YFKF 1L0OC 3J81K 2G9WA 3R4KA 4EMSA 3JAMK 1HKQA 3ERED 2GQQA 1E2XA 2LSOA 3D5LA 4OOIA 3FXRA 3BPXA 1XCVA 2EFOA 3VEPA 5HLIA 2QLZA 2D1HA 2KIFA 3K1MA 2HQRA 4EM0B 3MCZA 4EJVA 3MFKA 1UB9A 4M6XA 4KMUX 2QENA 1YQAA 4M71A 1FZPB 1D5VA 3SHFA 3TO9A 1RIOH 5CVIA 3QPTA 5FD6A 3GUDA 1PUEE 2H6BA 3QPHA 3E5QA 4EJUA 3T0YA 2P5VA 2YPRA 3GZ5A 1VTNC 1PP8F 3TKYA 2KJCA 5F1RA 5AONA 4MTEA 4OU0A 3RI4A 1SFEA 5LEJA 3FX3A 3I59B 3E97A 4OIQF 4EJTA 3ZN0A 3HTUA 3R0AA 1ON2A 3J80Z 2H27A 3ZMZA 4LJZF 2HEOA 4UV8A 1XGMA 4ZZLA 2DI3A 2M8EA 3ZP5A 2BBYA 2K7LA 4UVCA 1RZ4A 1IXRC 4MEYF 1IN4A 3GVAA 4PDKA 5EEHA 1FX7A 4G9YA 1U3EM 1R1UA 2AS5F 1JHHA 1W5SA 2V79A 5KK1A 3GXOA 1S3JA 4Y15A 3GFIA 4L5IA 4GO1A 2PMUA 3BOQA 2WC2A 2P6SA 1BIBA 2XROA 4RAZA 1J59A 4ESBA 2ESNA 2L4MA 3F8MA 3EQLF 1XDUA 3FM5A 3WTWC 2DK5A 2EA4A 5LLQA 3W6KB 3CUQA 4G8XA 4ZYDA 2OQGA 1FY7A 1KYZA 1ZG1A 4UNOA 3ABTA 3KEQA 2ZO4A 4AIJA 1QZYA 1HW1A 2OA4A 2IA0A 4PGGA 2MBFA 3L9FA 2MC3A 2NAZA 2B0LA 2STWA 2DU9A 3COAC 1GXPA 2NRAC 2ISYA 3QP6A 4A6EA 3TQNA 1FP2A 4WWCA 2NS0A 4G6QA 3JTHA 3G73A 2ETHA 2K86A 1MJAA 2V1DA 4WCGA 2TDXA 1K7AA 1O7FA 4P5OA 1IF1A 3CUQC 5HLHA 2OBPA 2PEXA 2IP2A 2XASA 2HKOA 2WTEA 3L2CA 3HHGA 3O6BB 4KIGA 2HQNA 3DPTA 3H3ZA 2MD5A 2VC1A 1X3UA 3TO7A 4CDGA 1YS6A 3WG9A 2MH2A 5J8CA 2Z99A 5BOXA 5JI6A 2JT1A 3CTAA 1JHFA 1H9TA 4AWXB 1O3SA 5L3GA 5EEGA 2E1NA 4Q5SF 2HZTA 5BQTA 2GZWA 3FXQA 2HOEA 4A6DA 3CO6C 4Q47A 1T0FA 1WRJA 5DUKA 5LRSA 3SXYA 4HF1A 3EYIA 2FNAA 4RS8A 1Z05A 3ROUA 3FXUA 4KFCA 4HV5A 2VBZA 1Z91A 4NB5A 4A12A 4WXCA 1HW5A 3I58A 1HQCA 1UFMA 1TBXA 1STZA 3E5UA 2MLGA 5D4SA 4OINF 2CYYA 3FM3A 3QOPA 2QM3A 5DCMB 1OKRA 1MDMB 4CICA 4Q4ZF 2ZNYA 4MGRA 1V4RA 4I01A 1J0RA 4KYWA 1W7PD 3M7GA 1DUXC 1EH6A 3F8CA 1ZGAA 2HR3A 1QGPA 3TOAA 2DT5A 2FU4A 3K9TA 2GA2A 5TRDA 1DPRA 1ZYRF 4R79A 1I27A 3QU3A 2YX4A 3P9KA 2ELHA 4ENNA 3ABUA 3MAJA 5DD8A 5ILSA 4UVAA 4UUVA 3HSFA 2VODA 3N4MA 5D6FA 1QO0D 3R6SA 5HDNA 2Z9OA 1TQMA 3GFLA 3IC7A 3OOPA 4LK1F 4L9VA 4NQWA 4MEXF 4KDPA 2KIUA 1KA8A 4HDVA 1J5YA 2VXZA 5LBQA 2EFPA 2X0LA 2CG4A 4UXNA 4EGZA 2FNPA 5DYMA 3F6VA 1YFHA 1DP7P 4A5MA 1XSXA 5JR3A 4LG0A 4A5NA 5LGNA 1ZN2A 4IXAA 2Y0MA 4LD5A 4GCVA 2PQ8A 3AAFA 1I1SA 4JK1X 3HOTA 3DXJF 1L3LA 3JSPA 4ESFA 3BP8A 4BHPA 2BV6A 3OV8A 2E1CA 5D4RA 1Z9CA 2R7FA 2HTSA 1B9MA 1FYLA 1G3TA 1FSHA 1R23A 1FWZA 3EDPA 1IN6A 3CLOA 2ADUA 4L9TA 3KETA 1K6OA 4XRFA 3D0SA 1S7AA 1R1TA 3SZPA 3M8EA 3R61A 2VBYA 2IT0A 1FYKA 2RQPA 1U2WA 4ETSA 4M72A 5IT3A 2CQKA 2DAOA 1T2KA 2A3SA 2QQAA 4CO8A 5DUIA 1ZG5A 2XAQA 1U5TB 1U78A 3GZ6A 4YIIA 1SFUA 1LJ9A 1YW8A 1EH8A 1Z6TA 2PLYA 3ELKA 2EA2A 1R5HA 2QUFA 3LA2A 1HBXG 4M9XA 3IKTA 2G7UA 4WF2A 4CXFA 1ODDA 2XKOA 4AVPA 3ZQ7A 1AOYA 4PCQA 1OPCA 5FFXA 4XLPF 2L4AA 3ZN1A 2ZMEB 5HLGA 2LF8A 1BM9A 1ONVA 1IXCA 2GAUA 1NHAA 3DQVC 5E18F 1GHCA 5A2QZ 2RDPA 1BOAA 1HSJA 4OIPF 3FF5A 2L01A 5CYVA 1FT9A 2ZFWA 2DLLA 2OZ6A 1IXSB 4LGWA 1I6XA 1R1VA 1TNSA 3BZ6A 2DTRA 3LFKA 3WTVC 4KIBA 3WGGA 5D5WB 4HLYA 3K1NA 2XIGA 1R58A 1B4AA 5H6RA 5F6FA 4EVIA 1CGPA 3KFWX 4ON0A 2EV6A 1YO5C 2DK8A 3RJPA 4ENKA 2XAFA 5JFRA 2FOKA 2YU3A 4L9JA 2YSRA 5A2QK 1ZG3A 2BE5F 3K1PA 4P55A 3DFGA 1XN7A 3VFZA 3L7WA 2HFHA 4RGXA 2VE9A 2QQ9A 2COMA 2XHKA 2PMHA 4DNCA 1OR7A 3H3UA 2XAGA 3NEUA 4N0BA 4RB1A 2ZCWA 2VT2A 4XSZF 2Z33A 4I0AA 2Q2EA 3DEUA 2O6GE 1OYIA 5H6QA 2ZBKA 4HOBA 2QWWA 3FMSA 5E1XA 5E8IA 3C1DA 3RYPA 1KU3A 3KLNA 5K5OA 4BYYA 3WE2A 3I54A 3VB2A 4N9IA 5LGTA 5LHGA 1K78A 3L09A 4ENMA 1MD0A 3RKYA 3RPQA 3T1BA 1R36A 1SD6A 4BQAA 2HKXA 1S8NA 3LQQA 2R3SA 1C0WA 5AIQA 4U0YA 2QBYB 1G3SA 3HHHA 4XLNF 2P5KA 3GFMA 1CF7A 3LAJA 1ZLKA 3KZYA 2FA5A 1T38A 1G4DA 1IW7F 1ZREA 3LQRA 1P92A 2L54A 2OZUA 2EFNA 3WTZA 3ECHA 1R5GA 3HRSA 1V3FA 5FGMA 2RGVA 5IT9Z 3IWFA 3CO7C 1J75A 2W84A 2W85A 4S04A 1JE8A 2RN7A 3JW4A 3QAHA 2PJPA 1IN5A 4HX7A 1D8JA 4IHSA 3GFJA 1BBYA 4OIOF 2PI0A 1MJ9A 4ZZDA 3W6JB 1FC3A 3I59A 4L18B 5BS6A 4RGRA 5JVTA 4EGYA 2A69F 2FMYA 2KJBA 2DQLA 1ZGJA 3IHUA 3T8TA 4O6JA 2PFBA 5BPDA 2OQRA 2ESHA 3GX4X 1UHWA 2XVCA 2E7WA 3LWFA 4M6YA 2HWVA 2P6TA 2QQBA 3EYYA 3WTUC 1QPMA 2RVCA 2RKHA 2XAJA 3Q5FA 4A0YA 1W7PA 4R1HA 5TJJA 3V4GA 4ASNA 1U8RA 2A61A 1H9GA 4I0BA 3RDIA 1IN8A 3N97A 1UCRA 2XRNA 2L02A 3MQ0A 4MNUA 1HKTA 4IRGA 3FMQA 2IJLA 1YW7A 4KIFA 1XSVA 2FBHA 1IUYA 1LEAA 1ZH5A 3HSEA 3E5XA 5E20A 1YG2A 4CHUA 1BIAA 2PG4A 4IJAA 3ZMDA 1LQ1A 4Y17A 4AIHA 3WU0A 1OMIA 1KQ0A 2GA1A 4HA8A 4YIFA 4IVNA 3P9IA 2O8XA 2K27A 1Z6RA 4G7ZF 4KN4X 4UVBA 4L0ZB 1GXQA 3I64A 4FT8A 1QNTA 1W5TA 2BGCA 2V6CA 4IRHA 3L00A 1K79A 3IRQA 3G3ZA 4H0EA 2X4HA 3KP2A 1Z7UA 5ILUA 1IRGA 2O61A 4IHTA 4ZYEA 3RTRA 4LK0F 1J7KA 3DV8A 2M1BA 1XSDA 1ZRDA 4HYEA 3Q9SA 5D6EA 1XGSA 1S7OA 2DW4A 2FSWA 2RNJA 4B8XA 2M87A 3C18A 1RUNA 2LNBA 1OYWA 1QBJA 3P7NA 3F23A 2ACJA 1IRFA 1HXDA 3KP7A 2Q8KA 3F72A 1ZRCA 3DPLC 4G6DA 3REOA 1MJBA 2V9VA 4R8HA 4K2EA 2OU2A 4U0VA 2PN6A 4HDUA 4I09A 3WTTC 4UV9A 4WX9A 2RV8A 4WXHA 1J9IA 5D5XB 1W4MA 3RPUA 3V7CA 3T5XA 1USTA 2L3DA 3BJAA 5LGUA 5D5UB 3ZMVA 3SQNA 3I71A 4MQVA 2EJRA 3MEXA 2IA2A 3BWGA 5E1WA 1B9NA 4RAYA 3V8KA 3ZMSA 3P9CA 4M73A 2GIVA 4BAYA 5D8LB 2RC4A 1SAXA 2FBKA 5K1YA 1FBQA 1KU9A 2JZYA 3ULQB 1LNWA 2DBBA 2JSCA 4L5JA 2UZKA 1BN5A 1G3YA 4EJWA 4M74A 2HTJA 4I98B 1SMYF 2K02A 5L3BA 3CUOA 3TDZC 2HDCA 1MGTA 3U1DA 5HS8A 3E3VA 4YFXF 5D5VB 1XMKA 1LVAA 4HX4A 3MZHA 3FZVA 2Z5UA 5FFZA 5L3CA 1JGSA 2J5OA 3HRTA 4ESJA 2KKOA 5CVUA 2R7DA 2V1UA 2HS5A 2JPCA 3GWZA 3V8LA 3J7AO 5CJ9A 5HS7A 3KP5A 1ZHFA 2F5DA 4OMZA 3RIRA 1P4AA 4LLNA 3C7JA 4Q48A 4GYGA 4YG2F 4LB5A 1YTYA 1KGSA 4EQQA 4UHTA 1ZARA 4IPAA 4CGZA 4RB2C 4JQFA 1BI1A 3U9GA 5CVJA 1F4KA 1TW2A 3QRFF 1PDNC 3CUQB 3WU1B 3SZTA 5K5QA 4JBAA 1WWXA 5DEQA 2DPUA 3KP4A 1F9NA 2P5LC 2FRHA 2EV5A 1B59A 5IT9K 3O3KA 2FQ3A 2LKPA 2F5EA 2MA3A 3WGHA 2UWMA 3IKVA 1TLHB 2XUBA 4G94A 4GGGA 3B73A 3F8FA 3S2WA 3Q9VA 1TQIA 2VOPA 2P7VB 2ZXJA 2CGPA 5ICFA 2FE3A 4D0PA 5J8FA 3GEZA 3TGNA 2K4BA 4FHTA 1LDKB 1KQ9A 3FMRA 2K4JA 2H94A 4AD9A 1Q1HA 5BPIA 2A6HF 2AXLA 2O0YA 3M9AA 2Y75A 3EETA 4O3MA 2IRFG 3R60A 1WQ2A 2P4WA 4CYDA 4OMYA 1O3TA 2J5PA 1SD5A 4HF0A 4KICA 1BJAA 2STTA 2ZJ2A 1J2XA 1SFXA 2XV4S 6PAXA 1BC7C 1LEBA 3NQOA 1R22A 2HYFA 1YW9A 1DPUA 5CLSA 2YX7A 1D3YA 3E6DA 4HAMA 1IAWA 2XGXA 2CO5A 1FBSA 3IRRA 2VOOA 1QQIA 4QLCU 2UXNA 3ISPA 5JHUA 2A6EF 4I2OA 1TW3A 2F5CA 3J80K 5KVRA 1YLFA 2LF7A 4A0ZA 1ZRFA 4KNYA 2QVOA 3K0LA 2NNNA 4PZJA 4LG0B 1T98A 3FWEA 4HBLA 4FX0A 3K2ZA 2GXBA 4RB0A 4IRIA 4S05A 2F2EA 5ERIA 5L3DA 4KA4A 1LB2A 5DCMA
chains in the Genus database with same CATH superfamily
1A9XA 4RZQA 1MDMA 5C5JA 3OR1C 2DMQA 1FP1D 3A0HC 3HYIA 4MV9A 4O3SA 4A93J 3JSNA 4RGSA 5LA6F 4M3BA 3S32A 4B47A 2CSOA 2V4QA 3HOVG 4LLLA 3GIJA 1GLVA 3OYDA 2F5FA 2M9HA 3H5RA 4LSXA 3Q8SB 2E34A 4C2MJ 3C0FB 1RKTA 4HRIA 1GSOA 5JVGF 3AG4H 4XOTA 3MVPA 4O5VA 1B1BA 3K10A 4B43A 1IDYA 5KFZA 4E70A 1T33A 3GTMA 2VBWA 3GYHX 2YS6A 1P2FA 3LSPA 2R7XA 3HOSA 2JRTA 4DV6H 1R9TJ 4WXDA 2WWYA 2MG4A 4E4TA 4GYIA 3GTLA 3PJRA 4JYAH 4BBSG 3JAMZ 2BY3A 4DV2H 1FPQA 1UHMA 3H92A 1I1GA 1S6LA 2HOAA 4RB3C 4U0WA 2LKXA 3NWSA 1S29A 4G7OF 4E7IA 2G7HA 3HKZE 5T14A 1WI9A 2EWNA 4RGUA 1R7JA 5HVQC 1K1SA 1I94H 2A07F 2JPBA 3H0GA 4DR1H 4CZCA 3BY6A 3HZJA 3PW0A 1LDJA 3VOEA 1JJ8C 2FOWA 1NH3A 4ZYGA 3IH4A 3OL4A 3F8BA 1KONA 5I47A 2JRMA 2MSYA 5TISC 2V59A 1REPC 2CV1A 1F5TA 4E6KG 2UVVA 3H0GJ 4KN7X 1F1ZA 2DOEA 4JV5H 3MWMA 1XGOA 4M9SA 1VQNI 2IBDA 5FB2A 3GZNB 1FYMA 4XYMB 2MLKA 5CKTA 2HGCA 5FRMA 2XC9A 1RJQA 2V5AA 3C3WA 4Z2YA 3V8JA 4E7HA 1A31A 2DPDA 3WTSC 5KG5A 2OH2A 2JK3A 1Y8RB 4IHYA 1R9TA 2W7OA 1VQMI 1W36D 2CFOA 9ANTA 4BU2A 1U9NA 1X1CA 2RAEA 2IPQX 5LHIA 1SMTA 5J47A 2W57A 4ZTJA 1BI2A 2DA7A 3MKZA 1BXRA 2JTVA 2E1MB 3PFIA 4R8UA 1XD7A 3K4JA 1VQ6I 3RKXA 2LG4A 1B6AA 2Z1DA 4BDZA 1K6YA 3H36A 4HLXA 2VKHA 3E1SA 1QA6A 3GIDA 5EZYF 4BNCA 2LVSA 3PO2J 4ECTA 4LF6H 3FDYA 3WGIA 3PIOF 3FHZA 3IG0A 2FUG2 4GXOA 5FKOA 2R87A 2PMZA 3CMYA 3PO3J 5HV6A 2YL2A 2EB7A 4HNTA 3ETJA 1FNNA 3IL2A 2LBFB 3AG2H 3U2RA 4J01A 1MSEC 3DP7A 3RAXA 4BHBA 3HOXJ 4XLAA 2EK5A 4DBQA 2CW8A 1KYWA 3O2PE 2PMZN 4A3EG 4HX8A 2V4JC 4E7SA 2XGQA 5FD5A 2W25A 2ZKZA 4X6AJ 2NVUB 2Q0OA 3LSTA 1HSTA 3NWTA 5DQHA 1T56A 3TEDA 2GXAA 2O3FA 2NVXA 1KJ9A 3WE3A 1GUUA 5CVVA 1TWCA 1V5EA 1YYVA 4DV3H 2DA3A 3G1LA 2H6CA 4X66H 2P0AA 4CZZA 3B02A 3CMEI 1MBKA 2KRHA 2O9LA 4KT5C 1YRNA 1E4EA 4IHWA 3FXKA 1J5EH 2BVMA 1HF0A 2LFBA 2Y31A 5ED4A 2X0SA 3GMEA 2ZJQF 4A0XA 2LKSA 3PQJA 1RI7A 1XX5A 3DCFA 1TWAJ 1ON1A 4QTRA 3HJEA 4D5CA 2RF4A 1EV7A 2VE8A 3BJOA 3NAUA 3E6CC 4LF9H 3I4NG 1AKHB 4J9MA 4QWBA 2EZHA 1MZBA 2DMPA 4B3TH 2OD5A 4HW0A 1BJTA 4JI8H 2A5WA 4OIRF 3PQKA 2W6NA 4F4WA 2LOOA 3BR6A 2CUZA 2B63G 4B3MH 1Y0UA 3RB0A 3LA7A 4HQMA 3GO5A 3DEEA 3KHGA 2ZNZA 5KFNA 4EM2A 1I7LA 1WCMA 5HBRB 2MYSA 4DR4H 2JUGA 3L4JA 1S0MA 2VB6A 3FXLA 2B7EA 3DF8A 3W3CA 2YZMA 2DFIA 3HUGA 2JSPA 2KPMA 4LMYA 1R00A 2RNGA 2W24A 5CB4F 2F4VH 1TWFA 3WODF 4LLGF 4M3GA 3WTYC 1H0MA 4J9SA 2QQ8A 1J09A 1HLVA 1I5ZA 1Y1WG 3V6HA 2LDUA 1O7LA 2W00A 5C3EG 1Z3XA 2QYOA 2WAQA 4I76A 5DM6F 4EEQA 2CW0F 2DLNA 2VONA 5KFHA 3BDDA 2R5YB 4EFEA 1USSA 1G6NA 1O57A 3CJNA 2R7KA 3KP3A 3N43B 2AXTC 3IWZA 4F7ZA 1JXSA 1FOKA 3I0TA 4R7RA 5D1OB 1P4WA 3DU5A 1LPQA 4G7HF 1KEEA 3GIMA 3GIKA 3HSRA 2CW7A 3T5KA 2FEZA 1HC8A 3KP6A 5BNGA 1SD4A 1XNQH 1P4XA 5HS9A 4UFZA 3DEWA 5LHHA 3H9QA 3N05A 3OYCA 3VDXA 2R7QA 1AA7A 4Y33A 5F64A 5L3FA 1YJWI 4DOZA 5KFUA 3HOYG 3V4ZA 4ITVA 3QU6A 4QIWN 2OJED 4LFAH 4L0YB 1U5TC 3PFYA 3V7RA 5J6XA 5D8DA 4J9QA 2OTLI 1A04A 2I10A 5ICCA 1W7PB 4LB6B 3F22A 5EZHA 1FTTA 4MV3A 4ZTFA 1N56A 4DQ2A 4IF4A 2OCCH 1XGNA 2VUMA 3ZQFA 2EZLA 1ZAOA 2PBIA 3I53A 3T8RA 1E17A 3GF2A 2GXGA 2VBXA 2Z3YA 1N32H 5J4VA 3FIWA 4NQWB 3B6AA 5IYCJ 1BI3A 3LSGA 3RYRA 4ZYHA 1WKMA 5J40A 1CQIB 2V1XA 4JI5H 1MKMA 1A5JA 2ZMEA 2ISZA 3K2AA 1KU2A 2DPJA 4F92B 3OS0A 3BQZA 4MO7A 1JTYA 2L7KA 4A69C 2DJIA 4Y13A 5BMZA 5FLXK 4BAYA 3HDDA 5LEKA 3I5UA 1U9OA 4B09A 4RDUA 4HV6A 2X6YA 1YI2I 1W36C 3ZPLA 2BR0A 2JA2A 4DV5H 1FBUA 2FLNA 4EV0A 3OYIA 1T6SA 1K83J 1WJBA 2Y48A 1TA8A 1A36A 4UUSB 3M1EA 3F8NA 2FLLA 2QZ8A 1FLIA 5EDWA 1BR2A 3AFHA 1KU7A 5HDGA 5HLTA 1XMAA 3QODA 2KIQA 3Q8RB 2AQEA 5BR8H 3CD6I 2WTFA 1XMOH 2GWRA 2DQRA 2KIMA 1OYYA 3BLYA 4N4NB 3VODA 2IXSA 3PO3G 5DG8A 3IAM2 4QJFA 2KISA 2WV0A 5KG6A 1FSEA 3CCMI 1PP7U 1WJAA 3E6MA 2MFZA 3ZMTA 2R85A 3S8PA 1XCBA 2ECBA 1TTYA 3ML6A 4ANJA 4BHCA 1TNTA 2QEXI 5EOYA 4JI3H 1PJRA 4PSWA 2D45A 1ZHQA 2NU7B 5FKMA 2VPQA 1G3WA 1QU3A 4IRKA 5ICEA 2XF6A 2YR2A 5JUMA 4P96A 1LFPA 1Y1VJ 4RAGA 2WAQN 3TDUC 5LOVF 5GTIC 2EINH 2D5VA 2H8RA 1IZ1A 1AHDP 4O2BF 5EGOB 3CCQI 3M8FA 4JI6H 2R92J 4M6VA 2X1CA 3GV8B 5DGAA 3CCYA 4GDFA 4MFEA 2PJRA 3N42B 3BPVA 3JTGA 2D2WA 3D5SC 4RMNA 4XN3A 3BROA 1SAUA 2Q1ZB 2R8KA 3HRUA 4RLFA 3DBLB 2JA6J 3TP3A 1MH3A 4KHPH 5J1YA 3KEOA 2O03A 2KRFA 1SCUB 2K9SA 4U88A 4BKXA 3IN5A 3L2QA 3V7SA 2AGPA 4AIKA 5ICGA 3PZPA 2ZSHB 2P81A 2VQFH 1S5LC 2MH9A 4MA0A 3GTPA 4S0HB 2CKZB 1YS7A 1EH7A 3J81Z 1I50J 4J19A 3G2BA 2G0EA 4IEJA 4HSTA 2IW5A 1MBHA 1Z3YA 1N25A 1HA8A 2YUSA 2CFXA 2D1VA 3HTSB 3QZ8A 4XK4A 2Z2SB 2DYRH 1NG6A 5F0HA 4MQ9F 4AYBN 4TV7A 2NU8B 2H09A 1I3QA 5KNLA 2EFQA 3HB9A 3P5JA 2LLKA 5IYDG 5EG0B 2KFDA 3RZOJ 2QSHX 4UCRA 4Z6YA 1WCMJ 5AIPA 3SFZA 4HQEA 3HBLA 4LFUA 3KE2A 4BJ5C 2DODA 3JREA 3BA8A 1JXLA 5C1PA 4I02A 1SD7A 1RNLA 4EGQA 2RDIA 3BJ6A 5KG1A 2ZXWH 5KKNB 1K78B 1TQPA 1Y1VA 3VPRA 2C6YA 4KMFA 2A6TA 1BOBA 2ZSIB 4DW6A 4ZH4F 5KAFC 5H2FC 4P9FA 4J9KA 4XBFA 4CYCA 3HIFA 4UUTA 5E3LA 3BG3A 2VT3A 1U5TA 5DV5A 1ZK8A 1ZQ7A 2DPIA 2VQDA 2HYGD 5DD4A 3SEQA 3ECOA 2R82A 4A3JG 1QRYA 2LY2A 3F6OA 3S3OA 1D0ZA 4F52A 2QBYA 5KFLA 1XDSA 2XKPA 3GW2A 4PGHA 5E8GA 4HZFA 4HF2A 1HKSA 1RJRA 1CF7B 2V6EA 2DO7A 5KFBA 2R7ZG 3RGZA 3QPLA 1BC8C 3ZQQA 4E7LA 2E7XA 3TO6A 3CQZA 3NRVA 3V42A 3V6KA 1M1EB 2FXAA 3K4NA 3S1QJ 2VC0A 1ULYA 2FMLA 2QYZA 4P9UA 5EJCA 5GP9A 4XNFA 1ETVA 2XB0X 3R0JA 1AWCA 4W1UA 5FRNA 1MMDA 2R7ZJ 3TOBA 2F6CA 4N9HA 4NHJA 3T1YH 1TAEA 3HOWG 5IY5H 1TWAA 2VL8A 3WO1A 1ACIA 1UAAA 1ULZA 1FOXA 5D8KB 4A3BJ 4MTDA 3SFIA 1O75A 2SCUB 1GVJA 2XAHA 1YIJI 4N4OB 2DCEA 1CQTA 2NYXA 2OTJI 5HOOA 3G8CA 1HW2A 2W70A 2XGEA 3HOZJ 2F48A 3ZCOA 1FIPA 3GLXA 3OYLA 3MZYA 1K1QA 4RAFA 2BYVE 3GV7B 2CWEA 2LK2A 3H3VK 1JUSA 3PVXA 4FX4A 2BEOA 2A68F 3E6BA 2JEFA 2P8TA 2EILH 2VKEA 5L3EA 4EJOA 5LD2C 3M9OB 2IA1A 3LMLA 3KZIC 3LOCA 1N77A 4G6TB 1B72A 3HEFA 3RV3A 4CCMA 2A5YB 2UXBH 2DXIA 3LAPA 3K69A 2ZM6H 3PR4A 1LE8A 4J9RA 1P6RA 1PYVA 5ILVA 3RF2A 5E17F 2HDDA 5CVRA 1KZHA 2MD0A 3FXOA 1IN7A 4BQQA 5IPAA 4O3QA 2VPRA 5E1ZB 3EUHC 5DCFA 2JA5J 1FVIA 3ZMUA 4M9ZA 1Z1DA 5FLXZ 3N8DA 4XSXF 1TP4A 5DDGA 2R86A 4I7HA 4E7JA 4PJNA 3EUHA 3OTOH 4A2UA 1ETYA 1AUXA 2IVMA 5K5RA 4TV9F 1E3PA 4IHJF 4KJZA 4QWQA 2KZGA 4BBRG 4BE1A 5IYBJ 4L9NA 2FK2A 4BXUA 1TT0A 4XKWA 4V2GA 2VI6A 4WK8F 1QZZA 2IGMA 2CMPA 3F3XA 4QPQA 4W97A 3QQAA 2GIZA 1JKPC 4HNVA 1LDDA 2K9LA 3I4PA 1WJDA 1T39A 1VBGA 1SEUA 1ZLJA 1JKJB 3OYGA 4B3AA 2OCEA 2UXXA 3JSOA 3G6EI 4IQJA 3WO0A 4YIRX 2FJ1A 4RZRA 2YW2A 3KZZA 3CCJI 4ED7A 1YE9A 3MZ8A 5IOZA 3CCEI 3LA3A 1JGGA 1I6UA 5DTDA 1WSUA 1FOWA 1U6GA 4YEJA 3S1RJ 4C2UA 3J7AY 5HDKA 2OAZA 3WTXC 2HQAA 4C3JJ 4M7EA 3V6JA 3OS2A 4BS9A 4CCOA 3OIQA 4U7DA 3FMAA 2UUAH 2Y9YA 1N36H 3QPSA 1WJ5A 4RU9A 3HRMA 2M30A 4XLFA 4MHGA 1DDNA 1VKZA 4EM1A 2P7CB 3ORQA 2W9CA 2GOXB 2Q2EB 2CUEA 3KCCA 2GLTA 3K7AJ 4EBCA 3KLOA 3QP5A 2R4GA 1RPWA 2W9BA 2M5WA 2K85A 5C4JJ 1EUCB 4U7BA 4KUMA 3VSKA 1E4GT 4DL2A 2DFFA 5H20A 1MBJA 2HOSA 2EV0A 1D8KA 2X6XA 4MA5A 1BI0A 4L5EA 1VQ8I 3HXLA 3BCBA 5LRRA 3F21A 1XB4A 1O3QA 1O3RA 2NVXJ 1BA5A 2M05A 4DGWB 3RKWA 5FO5A 4Y3OA 4FQGA 2EIKH 4YFNF 2EFWA 3OSNA 3PN1A 1KQ8A 3CLQA 5KT5A 2NNYA 4BH9A 2M45A 1BJZA 1YIOA 2X6OA 3CDHA 2LMDA 2MGQA 3HC7A 1E0EA 5DGBA 2C00A 3K70D 2FBIA 4ENJA 1DV2A 3DKWA 4V19K 3JAMW 5KT4A 3G1OA 2VN2A 1RUOA 3KPHA 2FF4A 4YFKF 4F3QA 1L0OC 2QA4I 3J81K 2G9WA 3R4KA 4LIUA 4EMSA 4FE4A 1S10A 3OIPA 2K9MA 3JAMK 1HKQA 2YU9A 1LKXA 4QPOA 1IJWC 3L2WA 3ERED 3BA9A 1JUMA 3L2RA 1F36A 4A3BG 2GQQA 1E2XA 1SVMA 2LSOA 3D5LA 4FETA 4J9OA 2FMAA 3RB3A 4RM3A 4OOIA 5KHDA 3FXRA 3BPXA 3RQ4A 1XCVA 2EFOA 3VEPA 1ZETA 4D1QA 2BXYA 5HLIA 2QLZA 1B33N 5DQIA 2D1HA 2KIFA 2W8LA 3H3VH 2HDWA 2VXDA 3K1MA 5EWFA 1S03G 5K7FA 1MNEA 2JA7J 2KDZA 3T5JA 4IL6C 1AU7A 2CUFA 2HQRA 4EM0B 3MCZA 4EJVA 2J9GA 3MR5A 3MFKA 3VSLA 1UB9A 4D7MA 3MWEA 1I6HJ 4EEFG 2E5ZA 4M6XA 4KMUX 2QENA 5J3LA 2R6FA 1YQAA 4M71A 5DG9A 2GBYA 1Z7LA 3Q0WA 1QZEA 4Y4RA 1FZPB 2QF7A 5KFDA 1D5VA 4IX7A 4QIWA 3SHFA 3TO9A 1RIOH 5CVIA 3ASOH 2LD5A 3QPTA 2R7RA 3OUUA 1KJQA 5FD6A 3GUDA 4XICA 5CA0F 2L7MP 2M8GX 1PUEE 2VASA 1YOVB 2H6BA 3K4BA 3QPHA 3E5QA 3KAKA 2DA6A 2EH3A 4EJUA 5IYZF 3T0YA 2P5VA 4O3PA 2ALZA 2YPRA 3RQIA 5GAGJ 3R23A 5EWGA 1T08B 2HHHH 3GZ5A 4MLOA 1VTNC 1PP8F 3TKYA 2KJCA 2YS7A 5F1RA 3CESA 1FTZA 5AONA 4UCUA 4MTEA 4OU0A 3RI4A 1X9NA 1SFEA 4JI0H 5LEJA 2YS9A 2IS1A 3FX3A 3I59B 4OWRB 3E97A 3H9JA 1V51A 4OIQF 3OHBA 3H20A 4EJTA 1N33H 3M4IA 3KXYT 5EWEA 1JKOC 1IBMH 3TP0A 4BEHA 3ZN0A 2R5ZA 4UCTA 3HTUA 3R0AA 4MFDA 1ON2A 3J80Z 4J00A 4BY7G 2H27A 3ZMZA 4LJZF 2HEOA 2IGKA 4UV8A 1XGMA 1ZELA 2H1LA 4ZZLA 2DI3A 2M8EA 2OF7A 2CH0A 3FXJA 3CCUI 3F0CA 4ZDPA 4RBOA 2DT7B 3ZP5A 1M6VA 2W6ZA 4FU0A 4BXFA 5JLXA 1ZQ3P 3PR5B 2WB1E 2IBKA 2N8GA 4FTHA 2BBYA 2K7LA 4UVCA 1EHIA 1RZ4A 1IXRC 4RUCA 2I8DA 4MEYF 1IN4A 1JKRC 2ELKA 1S0NA 2K3FA 3ERMA 2HZDA 2BHYA 2R7UA 1DP3A 4BGDA 3GVAA 3UKGA 2DA1A 4NXNH 1NG7A 2JWTA 4PDKA 5C4XJ 5EEHA 1SYXB 1FX7A 4G9YA 4PJMA 5KFEA 5E3MA 5F1JA 3C2BA 5KT6A 1U3EM 5FROA 2JEGA 3RB6A 1R1UA 2Y0SN 3JCUC 2AS5F 1MSFC 1JHHA 2QGUA 1W5SA 4FE7A 4C30A 2P0WA 2V79A 5KK1A 2CUJA 1PUFB 5IYCG 4KITB 3CC7I 1M0WA 4I4TF 3GXOA 2Y9ZA 1C30A 3QYBA 4ZC3A 1S3JA 3RCOA 4BQNA 4Y15A 4FM9A 5C44G 4XKVA 3MKLA 5K7ZA 3GFIA 4L5IA 4GO1A 5E79C 3K3PA 1KBLA 3H40A 2ZFUA 3OYNA 5L9XA 5E3NA 2R93A 2PMUA 3BOQA 4DL3A 1WCMG 4NC7A 2WC2A 2JN6A 2P6SA 3CP2A 3H5AA 2ID3A 2W71A 4F4YA 4A3DG 3OMYA 1BIBA 2XROA 5DLFA 4RAZA 1J59A 4D5FA 4P1WA 3CCSI 3VYTB 4ESBA 2ESNA 2L4MA 3F8MA 1C3OA 3JZIA 3EQLF 4O3OA 1XDUA 4UCOA 4X64H 2IMWP 3FM5A 3WTWC 3EUKL 3A03A 1D1AA 2DK5A 4XLCA 4BXXJ 4C5BA 2JA8J 1N34H 2ECCA 2EA4A 3G4SI 4G3IA 5LLQA 3W6KB 3CUQA 4G8XA 4ZYDA 4A3JJ 2WAQE 4DR2H 1RR8C 2OQGA 1FY7A 1FJLA 2V4RA 4EGJA 3GTGA 4UCSA 3CZ6A 4XLEA 2NS8A 1KYZA 2FPIB 3GQCA 2L9VA 1ERDA 1ZG1A 4XKBA 4UNOA 1UC8A 3ABTA 3OUZA 1K61A 3KEQA 1S68A 2Y30A 2Y69H 2ZO4A 4A3FJ 4AIJA 1F43A 1G8XA 1T95A 2EZKA 1QZYA 3KYDB 2YRWA 5L1KA 3LL7A 4QWAA 4II3A 1HW1A 4AM3A 1YX3A 4I50F 5B66C 5EF6A 2OA4A 2IA0A 4PGGA 1VQLI 3GILA 4EBDA 2MBFA 3AYHB 3N40P 4YR2A 3L9FA 1WI3A 5LMUH 5M3MJ 2E2IJ 3BG9A 5IYBG 3KHHA 2MC3A 5KFFA 2UUBH 3PSIA 4B3RH 1IC8A 2NAZA 5DLGA 2B0LA 2ZMEC 2STWA 3H5NA 2DU9A 3COAC 2HVQA 4G12A 1GXPA 2M0CA 1CQJB 2ZJPF 2NRAC 2ISYA 4DLKA 3QP6A 4A6EA 3RUPA 5KT3A 1YJ9I 3RZDJ 5F04A 3RFCA 3TQNA 3FHNA 1GO3E 3HOUJ 2HXOA 1RYSA 1FP2A 2F4IA 4O4IF 4WWCA 3J7YJ 2NS0A 4G6QA 4IRDA 3JTHA 2VKVA 4A3CG 3FK6A 3G73A 2ETHA 4MAMA 2K86A 1MJAA 4E7KA 2V1DA 2L7FP 2R7VA 4WCGA 2L7ZA 2VA2A 2TDXA 1K7AA 2J6TA 2V7FA 4GLXA 4DBRA 3H0DA 1O7FA 5BPFA 4IAJA 1UJ8A 2ICWG 5JLWA 5FKNA 1X3WB 4P5OA 4YRVA 2XPUA 4LOCA 1X4OA 1IF1A 4I6ZA 2FK3A 3CUQC 4JI1H 5HLHA 4LFBH 1OCCH 1BR4A 2K9NA 2OBPA 3VYSB 4ZI7F 2PEXA 3HM5A 1BW5A 4X65H 5KCMA 3RBEA 2IP2A 2XASA 2JA6A 3TW7A 2DMNA 2HKOA 2WTEA 1OLTA 3HPGA 2KDOA 3L2CA 1T3NA 3HHGA 2BW3B 2QKMB 2XD4A 2LH9A 3O6BB 4KIGA 3MWDA 4Q45A 4JV1A 2HQNA 3A2KA 3DPTA 3H3ZA 2DMUA 2MD5A 2VC1A 1X3UA 5KG4A 3TO7A 4CDGA 1YS6A 3WG9A 2MH2A 3A01B 5J8CA 2Z99A 4E4HA 1UMQA 4E7ZA 2I80A 2VKDA 1B6SA 5BOXA 1JTXA 2GPWA 5JI6A 2JT1A 5L1LA 3CTAA 1JHFA 1H9TA 4AWXB 1O3SA 4XYLB 1D5YA 5L3GA 3KYLA 5EEGA 2ME6A 1R71A 2E1NA 5KFXA 5DQGA 4Q5SF 2E2JJ 2HZTA 5BQTA 2GZWA 3HL2A 1SANA 1VQOI 3FXQA 3MJFA 1TWHA 4CUGA 4B44A 4PDBA 2HOEA 2MC4A 3CVZA 2XRLA 4A6DA 3KTMA 3CO6C 3FBNB 4Q47A 1T0FA 2VQGA 1WRJA 2KQRA 4C3IJ 5DUKA 5LRSA 1Z2PX 1OCPA 2Q2UA 3SXYA 3QOEA 3I4MG 3MKYB 4HF1A 3EYIA 3FXMA 5KFVA 5FLXW 2FNAA 2DTZA 4NC8A 2QSFX 1FEXA 4DJAA 1POGA 4RS8A 1Z05A 5TGTA 1O4XA 1MBEA 2F5VA 3ROUA 4DL4A 1VS0A 2Z16A 3FXUA 2L9NA 3FKIJ 1MNMC 4KFCA 4MV4A 3CMAI 4HV5A 2VBZA 3FKJA 3DU6A 4FBUA 2K5CA 1Z91A 3HPHA 2XGPA 3CCRI 4NB5A 4A12A 1HOMA 2O5RA 4JI7H 3HGYA 3K4LA 4WXCA 4AIDA 3JRXA 1HW5A 2F4MB 3I58A 3VPCA 2ASLA 1HQCA 1IUFA 1UFMA 2TCTA 1TBXA 2FPPB 4ECQA 3HKZA 3ABKH 1STZA 3E5UA 1MMNA 1RK5A 4XR6A 4A3LJ 4AYBE 1DU6A 2MLGA 3LWBA 3CQZJ 4L1KA 2JA6G 3JRAA 3Q2OA 3L2VA 1CE8A 4QWCA 4BY1G 1JJ6C 1UZCA 1ZGWA 2AQFA 2BY0A 5D4SA 4OINF 1MH4A 2AO9A 2CYYA 3FM3A 3HKZN 3QOPA 4BQOA 5B5EC 3J81W 2KLOA 4IHXA 1SVOA 2QM3A 5DCMB 4TUYF 1OKRA 1MDMB 1JT6A 2K9QA 4CICA 4Q4ZF 2ZNYA 4MGRA 1HDDC 1VQ9I 1M7JA 1Y1WJ 2ZDHA 1KC7A 1V4RA 2EIJH 4I01A 1J0RA 1W7PD 3M7GA 5IP6A 4KYWA 1WSCA 1DUXC 3VPDA 1EH6A 4Q0YA 3F8CA 2AHQA 1ZGAA 2HR3A 2FD5A 1QGPA 3TOAA 1S72I 2DT5A 2FU4A 3N44B 3K9TA 2GA2A 5TRDA 1DPRA 1ZYRF 2DOFA 4R79A 1I27A 4IR1A 3K4CA 2NOJB 1S0OA 4GC6A 2V58A 5JVLA 2VUGA 4GKJH 1I3QJ 3QU3A 4QW8A 5KFTA 2YX4A 3P9KA 2ELHA 4ENNA 3ABUA 4XRSG 3MAJA 5DD8A 5ILSA 4UVAA 2OUMA 4UUVA 5JH7F 3HSFA 2UUCH 3GTPJ 2VODA 2W6PA 4DV0H 2HI3A 4J9PA 4IR9A 3S93A 4QWDA 1XNRH 4KISA 3N4MA 2E19A 5D6FA 4RA2A 2KP6A 2R8JA 1QVUA 2CRGA 2IGNA 1QO0D 2M7AA 3PIPF 4ME6A 3R6SA 5HDNA 3I3LA 4HPQA 2Z9OA 1TQMA 3GFLA 3IC7A 3ZQLA 2ZB9A 3OOPA 1DGSA 4LK1F 3PL8A 1Y0NA 2HOTA 2W7NA 1UG2A 4L9VA 4CCLA 3BR0A 4IQ4A 4NQWA 1BL0A 3BQ1A 1XTAA 2LC2A 2RGRA 4MEXF 2WV1A 4KDPA 4B48A 2KIUA 2OPTA 4H4KC 4XOPA 1QHHD 1EUDB 1KA8A 2XPWA 4HDVA 4I55F 1J5YA 2VXZA 4ECWA 5LBQA 2EFPA 2VA3A 3O8GA 1L2ZA 2R7NA 3S2HJ 2X0LA 3BR1A 2BVLA 2CG4A 3JRGA 3BQ0A 4A3FG 4XZ3B 4XRSA 4NNJA 4GRIA 4UXNA 2PN1A 5FJ8G 3CP8A 4EGZA 4C5CA 2FNPA 5DYMA 2OV7A 3N6XA 4BY1J 1V5FA 3F6VA 5H80A 3UR3C 1YFHA 5EDNA 4UUSA 3U1KA 1DP7P 1TZLA 4A5MA 1XSXA 5JR3A 1IDZA 3M07A 4BWSC 3DF7A 2EIMH 4FS1A 4BBSJ 5BMVF 4LG0A 2PVPA 5GPCA 4A5NA 3DBRB 5LGNA 3T1HH 1OCRH 1ZN2A 2C2RA 3OIOA 3EUAA 2Q2TA 2V9KA 4LFCH 4IXAA 4Y52J 1Z67A 2CJJA 2Y0MA 4IO9F 4LD5A 4GCVA 2PQ8A 3AAFA 4JUZA 2AGQA 4PWQA 3ESWB 1HNWH 2V1NA 1I1SA 2ME0A 4K0KH 4JK1X 1IOWA 3FISA 2L9SA 1K4SA 3HOTA 3KIOA 1GDTA 2HPMA 1MW7A 3DXJF 2C22A 4FBTA 1L3LA 3JSPA 2FB9A 1VQ5I 5KFWA 2M4KA 2X48A 1Y1VG 1DU0A 5J2UF 2DN0A 2PX9A 2EZIA 4YBZB 2DMTA 2XF7A 4A3GG 4ESFA 1X1BA 3BP8A 4BHPA 2BV6A 3OV8A 3LSMA 2E1CA 2MABA 5D4RA 1N78A 1Z9CA 2R7FA 3NGDA 3BG5A 4DYQA 3R5HA 2HTSA 1B9MA 2VJ5A 2DYSH 1FYLA 3R5XA 1G3TA 1RC9A 2E35A 2Y0SA 1FSHA 2YRXA 3VMMA 5F9LA 1R23A 1FWZA 3EDPA 1IN6A 4J9NA 3CLOA 3OL3A 2ADUA 5CAEB 4L9TA 3KETA 2R93G 4UB8C 5KAIC 1K6OA 4ECVA 3BTLA 3CMMA 3TL4X 3GTJA 4AQYH 2DA5A 1QHGA 4XRFA 4A3MJ 2CQ7A 5B1BH 3D0SA 5HNFA 5KT2A 2R8HA 4YY3H 3RBDA 1S7AA 3IUOA 2HNHA 1H8AC 1R1TA 4CA0A 1GLNA 2W7PA 3SZPA 3M8EA 1WVRA 3R61A 3U9SA 2VBYA 2IT0A 1FYKA 2RQPA 4BJ6C 3HUGB 1U2WA 4ETSA 4GFBA 5GAEJ 1LFBA 4DL6A 4M72A 5IT3A 2CQKA 2DAOA 2NVYJ 2XAUA 4ED1A 1T2KA 2A3SA 2QQAA 4CO8A 2EPFA 3L2PA 1XPXA 5DUIA 3OYKA 2HVRA 2R92G 4CYCB 2WBMA 3BTJA 1ZG5A 2XAQA 1U5TB 2ELJA 1U78A 3IAS2 1P8LA 2FQ4A 1A6QA 3GZ6A 3TIGA 3RIZA 2W1OA 2V9PA 4YIIA 4BE2A 4R8UB 4C3HJ 3E5NA 1R6RA 1SFUA 3HG9A 1OFCX 5J4YA 1LJ9A 3JSLA 1YW8A 1EH8A 1LUJB 2GOMA 1Z6TA 2KHMA 2PLYA 4CC5A 2E1MC 3ELKA 4DV1H 2AU0A 2EA2A 3SEZA 4ABZA 4LF8H 1R5HA 2QUFA 3LA2A 4BXXG 1HBXG 1I3AA 4M9XA 3H4DA 3IKTA 2TRTA 2G7UA 4WF2A 2LRDA 4XKCA 5CQEA 5IP9J 5B1AH 1ODDA 4CXFA 2XKOA 3S2DJ 4A3DJ 4AVPA 1D1CA 3ZQ7A 1AOYA 4O4LF 1CS0A 4PCQA 2LBFA 1DV1A 3BC8A 1OPCA 5FFXA 4YAJB 4NXMH 3ABLH 2BQRA 2QCOA 4XLPF 4XL9A 5HODA 2R7LA 2HXIA 3PUFA 2AGOA 3FK7A 5HNHA 2R7MA 5GONF 1ZR2A 3GTKA 2L4AA 4YR0A 1WJEA 2KT0A 4B3XA 1PX2A 3ZN1A 2ZMEB 2RQQA 5HLGA 2E5NA 2LF8A 1BM9A 3ASNH 1ONVA 5C1OA 1IXCA 2GAUA 2WYOA 5FJ8J 4J0MA 3HGGA 1NHAA 3DQVC 5E18F 3OYMA 1ETWA 1E4EB 3CC4I 1V9PA 1GHCA 5A2QZ 3AG1H 4DYCA 2RDPA 1BOAA 1HSJA 1W0TA 4OIPF 3FF5A 2L01A 3S15J 1AN7A 3U9TA 3BTCA 3BQYA 1XS9A 4HEA2 5L1IA 3LSJA 3PNVA 3SYTA 5FKKA 2L2OA 4PJJA 4J9LA 1SFOA 1BNCA 5CYVA 1FT9A 2ZFWA 1MNDA 2DLLA 2OZ6A 1AKHA 4UCVA 1GSHA 1PK8A 2XB5A 4NDLA 4A3MG 3FBIB 2WY8Q 5A2QW 5E3OA 1IXSB 3CDIA 4LGWA 2YZNA 4ED2A 3BR5A 1I6XA 3E0JB 1R1VA 1TNSA 2PMZE 3BZ6A 2DTRA 3I4NJ 3LFKA 4DUZH 3WTVC 1T94A 4KIBA 3G6VA 4JYKA 3BJYA 2JEJA 4YELA 3WGGA 5D5WB 4YR3A 4HLYA 3K1NA 4NLGA 3M9MB 3OYJA 2XIGA 3DTIA 1R58A 4O4HF 4DYRA 5FLMG 5IP7J 1B4AA 5H6RA 5F6FA 3WHCA 4EVIA 2LP0A 1CGPA 2E2HJ 3KFWX 2YZGA 3K6GA 4ON0A 2EV6A 3BT9A 5LXTF 1YO5C 3RPUD 2NVQJ 2DK8A 3RJPA 4ENKA 2O8KA 2UUZA 2XAFA 1UELB 5FKLA 2VUMJ 2FOKA 5JFRA 4ECSA 5CA1F 2YU3A 4RNMA 4L9JA 1OJLA 1SVLA 3MMYB 2R5YA 2YSRA 3ZXSA 1ZG3A 5A2QK 2BE5F 3K1PA 1VFCA 3ETHA 4DR3H 4P55A 2M7BA 2K3PA 1IG7A 3LSRA 3DFGA 2W6MA 1XN7A 1A6IA 3VFZA 5K2MA 4Q8FA 4LH7A 3BR3A 3L7WA 2HFHA 5KX5F 4RGXA 2VE9A 4F50A 2QQ9A 2COMA 2XHKA 4LH6A 2PMHA 4DNCA 1LVKA 4RLQA 1OR7A 3H3UA 2XAGA 3NEUA 3CCVI 2DA2A 4U6PA 2FP4B 4N0BA 3BZCA 2XSJC 2R7WA 1MIJA 5CPRB 1WJFA 3X2QH 3IH3A 4RB1A 2ZCWA 2VT2A 5DG7A 3A02A 4XSZF 3UNGC 2OWOA 2Z33A 4I0AA 2ID6A 2Q2EA 3W6VA 3DEUA 5KG7A 2O6GE 4ECXA 2C2EA 4TQSA 1VQ4I 2BY1A 2HU9A 1OYIA 1A35A 4DV7H 2HPIA 5H6QA 1WH2A 2LTPA 1TWGA 2ZBKA 4A3GJ 4HOBA 2QWWA 3FMSA 3GIQA 3RJ0A 5E1XA 5E8IA 3Q8QB 3C1DA 3RYPA 1KU3A 3KLNA 2JA7A 5K5OA 3OY9A 2AQ4A 4DL7A 3HOZG 4RUAA 4BYYA 3WE2A 1GV2A 3V4SA 3GV5B 1X1PA 4B3SH 3I54A 3VB2A 4ED0A 4OAZA 1OQYA 4N9IA 5LGTA 5LHGA 3HOVJ 1GSAA 1K78A 3H9GA 4XN0A 3L09A 3OYEA 5M5YJ 4ENMA 2LY9A 2BZTA 1MD0A 3RKYA 3RPQA 1WH7A 3T1BA 1R36A 3TQ1A 4X1EA 1HNZH 1SD6A 2ZJRF 4BQAA 2HKXA 4PFOA 3EPZA 4IKFA 1S8NA 3LQQA 2NU9B 5KFQA 2R3SA 1C0WA 5AIQA 4U0YA 4F93B 4XIDA 3TINA 3M3YJ 4JX6A 2QBYB 4HYKA 1G3SA 3HHHA 1P7IA 5F9NA 3I9V2 4XLNF 2B63A 2ZDQA 3VYRB 4YHHH 2P5KA 3GFMA 1CF7A 4AYBA 1EZ1A 3LAJA 2B63J 4Q43A 1ZLKA 3KZYA 4F91B 3JRDA 5LYJF 3O8HA 2FA5A 2LY1A 1T38A 1G4DA 1IW7F 2FX0A 2QSGX 1ZREA 4ECUA 2UV1A 3LQRA 1P92A 2L54A 1Z21A 2NS7A 2OZUA 2EFNA 2UVWA 1DGRM 2XCLA 2WA0A 3PUBA 3WTZA 3ECHA 1R5GA 3HRSA 1V3FA 5FPRA 4MIMA 4DUYH 5FGMA 3KX2A 2RGVA 5IT9Z 3JRBA 3M9NB 2FPGB 1FOYA 1WGXA 3IWFA 3CO7C 1ENHA 1J75A 2PJRB 3TBIA 2W9AA 5EYRA 3RB4A 2W84A 2W85A 4S04A 1JE8A 2RN7A 5C44J 4MV7A 3JW4A 3OYBA 2VJIA 3QAHA 2DWCA 1IO2A 2PJPA 1IN5A 4NC6A 4HX7A 5EZGA 1YRNB 1D8JA 2ZDGA 3LSKA 3KALA 5CQGA 4YB8B 4A3KG 4A3EJ 4IHSA 1X19A 3LMMA 4IZOA 3GFJA 2W4SA 1BBYA 4OIOF 2JA8G 2IA6A 1DGWY 3G71I 2PI0A 1MJ9A 2LREA 3DKXA 4F4XA 3HOUG 1Q1VA 4ZZDA 5IOYA 1W93A 3W6JB 1FC3A 4XQFA 1FMWA 3I59A 1VQKI 4L18B 2I5UA 2ZXHA 4M3DA 5BS6A 3MR6A 4A3LG 4RGRA 5JVTA 3LSIA 4X0GA 4ZDLA 1LE8B 4EGYA 3BZKA 3ZR8X 2A69F 4BEHB 2FMYA 2R5ZB 4HR7A 3OHAA 4CCNA 3C2HA 3M1CA 1FKAH 2DFHA 1HCRA 4F4ZA 5FPOA 3AG3H 2KJBA 2DQLA 1N48A 1ZGJA 1OCTC 2QK4A 1TWGJ 4XMYA 1ZKGA 2O7OA 3F9KA 3IHUA 3T8TA 1G2HA 4IWXA 4O6JA 2X1DA 2CV2A 1TT5B 5LMNH 2DOAA 2M4GA 1IBLH 4Q8EA 5KFPA 2PFBA 1ETQA 5J1RA 1X1DA 3DLLF 5BPDA 5GADJ 1B8IA 2OQRA 1BGWA 2ESHA 5M3FJ 2DIKA 4C9YA 3GX4X 2COBA 4CH7A 3DLAA 3CJRB 3BG7A 3CDLA 3H35A 3WG7H 4ZJZA 3KAJA 1UHWA 2XVCA 2CU7A 3GTQA 2E7WA 2L9RA 3S3MA 3LWFA 3HOWJ 4M6YA 2HWVA 2P6TA 1X1AA 4XONA 1QPIA 1SFKA 2IGOA 1AUVA 2H1KA 5D1OA 2DA4A 1U8BA 3M8JA 2QQBA 2X1EA 3EYYA 3WTUC 1QPMA 2RVCA 2RKHA 2XAJA 2GM4A 3J7AK 3Q5FA 2JJ7A 2B9SA 1MBGA 1SFOJ 3KHLA 3RAQA 1JX4A 3BABA 4BACA 3WNZA 5IP7G 2R8GA 1W96A 2E2HA 4M9UA 2BQ3A 4BUPA 2HVSA 3FDSA 5KFGA 4A0YA 3S14J 1D0XA 1W7PA 3QYEA 4R1HA 2IS4A 3K70C 2J6UA 3TIIA 2X51A 2CQQA 2LR8A 2NOGA 5F27A 2JMWA 5TJJA 3GTJJ 3V4GA 4ASNA 3OYFA 1U8RA 2A61A 1H9GA 4FCYA 4I0BA 3RDIA 1IN8A 1VQ7I 1RK6A 4DZJA 1T36A 3A0BC 3N97A 1UCRA 2XRNA 5J2TF 2CQXA 2L02A 3MQ0A 4MNUA 2KSWA 1OWTA 1WZ2A 4A2BA 3GCMA 1HKTA 4ZOLF 4IRGA 3FMQA 1JDBB 2IJLA 2VR1A 5F08A 2M0MA 1YW7A 1WJCA 1X2NA 4KIFA 1XSVA 3OSFA 2FBHA 1T0FC 2BOLA 3D5RC 3GTOJ 1LEAA 1IUYA 3T5HA 1Y14B 1ZH5A 1DIKA 1S97A 2R7OA 2JVHA 3HSEA 4DZPA 4C2TA 3E5XA 3RV4A 1ETKA 1XMQH 2VUMG 3JRFA 4EBEA 5E20A 2DFEA 2LYCA 2VIXA 4DL5A 1YG2A 4CHUA 2J6SA 4A3KJ 1YITI 1BIAA 2DZDA 2UXCH 3CJTB 2PG4A 4IJAA 3ZMDA 1LQ1A 2OLSA 4O3RA 4DR6H 5C4XG 2XSDC 4Y17A 3OOUA 5KT7A 4AIHA 4XRMA 3SJMA 3WU0A 4LITA 4AUXA 5KFCA 3HOXG 2WE6A 1OMIA 4EG0A 1KQ0A 2V9WA 2GA1A 4B4CA 3BAAA 1LFUP 4HA8A 2YU9J 1H88C 1PVEA 5KFIA 1XC5A 4YIFA 4BE0A 4IVNA 3P9IA 1Y39A 2O8XA 2HYJA 1WHUA 2K27A 3GTKJ 1Y8QB 1Z6RA 3JRCA 2RREA 3W2AA 4G7ZF 4KN4X 4UVBA 1M0TA 3ZRGA 4L0ZB 2KRCA 2K40A 1GXQA 3PM1A 3BQ2A 1IOVA 4WBNF 3I64A 2ATLA 2WY7Q 1JI8A 4FT8A 4JX5A 1MMSA 1QNTA 1FJGH 2BXZA 1W5TA 3OYHA 1RKWA 2BGCA 1NK2P 2CV0A 4O3NA 2V6CA 4IRHA 2E36A 4C5AA 3L00A 2NXNB 1K79A 3IRQA 3G3ZA 5EGOA 4H0EA 3PNTA 1G59A 4A2AA 2HJWA 1ZR4A 1H89C 3CF5F 2W6OA 3G1MA 2WDTA 1OISA 2DDAA 2CQNA 4CCKA 2X4HA 3J80W 3KP2A 1Z7UA 5ILUA 3VWBA 1IRGA 5KFYA 2O61A 2H8WA 1X4PA 4HSRA 4IHTA 1OR7C 4BJTA 2NUAB 4JV2A 3BTIA 4CC6A 5LL6b 3TQTA 4HG2A 4ZYEA 5GTHC 3MN2A 3RTRA 4LK0F 2X9DA 3LNQA 3K3VA 3LP8A 1J7KA 1KJJA 2X6WA 3H1CA 5KFMA 3DV8A 1E3HA 4LG3A 5B3SH 4FASD 2M1BA 1XSDA 1ZRDA 5KG3A 4HYEA 3Q9SA 3GLKA 5D6EA 2C28A 1XGSA 1S7OA 1S7EA 2C2DA 2Y0SE 2DW4A 2NVYA 1ZHSA 2JA5A 2FSWA 2BW3A 1WPKA 2L5QA 4U87A 3I12A 2RNJA 4B8XA 2M87A 3C18A 1RUNA 3WU2C 2LNBA 1OYWA 1QBJA 3P7NA 3F23A 4X62H 4XORA 4LIVA 2W9BB 2JA7G 3OSGA 2FJZA 2ACJA 3MKWB 5KFRA 4ZYAA 2EBIA 1VI0A 1VF9A 4KT6A 2WAFA 4AC0A 3J7ZI 4GC7A 1Z0XA 1WH5A 1IRFA 1HXDA 1R4MB 3KP7A 2Q8KA 1EA3A 3F72A 1ZRCA 4RNNA 3DPLC 4G6DA 4EYHB 3T5LA 4A3IJ 4YJ3F 2E5LH 2JA5G 3REOA 3CCLI 5EG0A 4LSAA 1MJBA 2V9VA 1JLLB 4R8HA 1VNDA 4K2EA 2OU2A 3U21A 4U0VA 4O2AF 1HR0H 1JKQC 2PN6A 3EPGA 3PW2A 4HDUA 4I09A 1WR2A 1X2MA 4II2A 1B8IB 1IGNA 3WTTC 4UY8I 4UV9A 4ED3A 5IT9W 3H4BA 4WX9A 2JQ7A 2RV8A 4WXHA 3K4MA 3RTXA 4IHVA 1J9IA 3L4KA 3R5FA 5D5XB 3JRHA 1Y56A 4UB6C 1W4MA 1EKEA 4ECRA 2NVTJ 3RPUA 3PW5A 3V7CA 3T5XA 1YX5A 1PUFA 1D1BA 2XF5A 2R7ZA 3W2VA 3W2WA 2CQYA 1V4YA 1USTA 3QWLA 4AVZA 1KJ8A 1UG0A 5D1PA 3SI8A 2L3DA 3BJAA 3E7LA 5LGUA 3OS1A 5D5UB 1MMAA 3ZMVA 2E1OA 2WB1N 3SQNA 3I71A 3GTOA 1X3ZB 4MQVA 2EJRA 4RM2A 3MEXA 5KFAA 4BY7J 2FLPA 2A05A 1GGOA 1E4FT 3GIPA 2IA2A 4HNUA 1MMGA 1YJNI 4YP3A 1IRXA 3MR3A 1A0IA 4LF5H 2VPLA 3BWGA 2WB1A 4APMA 4MV6A 3DTEA 5E1WA 3PO2G 2M3AA 3ABMH 2E71A 3B6CA 1B9NA 5F0FA 4RAYA 3V8KA 3ZMSA 2GLOA 3P9CA 4Y7NJ 4M73A 4EEYA 4EYIB 2GIVA 2XGDA 2BY2A 2CS3A 2RC4A 3KEYA 5D8LB 2FBKA 4BBRJ 1FBQA 5K1YA 1SAXA 1KU9A 4JI2H 1XMXA 2JZYA 3ULQB 1LNWA 3A4CA 4NBQA 3ZGKA 2VOBA 2M2EA 4QIWE 2DBBA 2JSCA 1RESA 4QW9A 4IZZA 2RDJA 4L5JA 2UZKA 5C3EJ 1BN5A 1G3YA 2CZGA 4EJWA 3AL0C 4M74A 4MV8A 1TL8A 2HTJA 2I87A 5KG2A 3QZ7A 1W1WE 2MW8A 4BDYA 4I98B 1SMYF 2K02A 5L3BA 1K83A 3CUOA 3TDZC 4IOAF 3VPBA 2HDCA 1B72B 3OWTA 1XG1A 2DDBA 1MGTA 3U1DA 3MR2A 5DM7F 3OR2C 3C2GA 5JVDF 3N41B 3BR2A 5KFOA 3LFUA 5GPAA 1Z2OX 3GTQJ 5HS8A 1R5ID 3E3VA 4YFXF 1IBKH 3A1YA 1VQPI 2XCAA 2VJJA 5D5VB 1RYRA 4CCJA 2BHZA 3ZQCA 1XMKA 3S17J 1VZ0A 1P7JA 3OYAA 1LVAA 4Q44A 4HX4A 4ZDOA 3MZHA 1I7NA 3ZQHA 4ZHQF 3BG6A 2IEKA 1APLC 4TQRA 3FZVA 2Z5UA 3Q0UA 5FFZA 2VPSA 4V2FA 5L3CA 1JGSA 2J5OA 3LSHA 1V55H 3HRTA 3TMOA 4IRCA 2JVGA 4CSWA 1B6RA 1GT0C 3EPIA 4ESJA 2KKOA 2E60A 5CVUA 2JUCA 3GLLA 4JV0A 2R7DA 2V1UA 2FK1A 2HS5A 2JPCA 3GWZA 3V8LA 3J7AO 5CJ9A 5M5WJ 2V26A 5HS7A 3GBGA 1I50A 4ECZA 4OX9H 2R92A 1SEIA 4YJ2F 2VQEH 3KP5A 5LP6F 1ZHFA 2F5DA 3DTKA 2UVUA 1I39A 4OMZA 1VAJA 2XPVA 3RIRA 1DQUA 2GPSA 1P4AA 1UNNC 2XDVA 3H0GG 5IYDJ 4LLNA 3C7JA 4FS2A 4Q48A 4GYGA 1NK3P 4YAKB 4YG2F 3MFHA 4XM3A 2ASDA 4M3FA 4LB5A 1YTYA 1KGSA 5DS9A 3S1NJ 4EQQA 2R0QC 1BR1A 3FKIA 4UHTA 4D9JA 2W9CB 2R8IA 1Y6IA 3KYCB 3K4KA 1ZARA 4IPAA 2YYAA 4QWEA 3ZQIA 4A3IG 5JQWA 4CGZA 4RB2C 3CF2A 4JQFA 1BI1A 3MFIA 1FMVA 3U9GA 1ETXA 5CVJA 1F4KA 1EYZA 1ITYA 3A01A 1TW2A 3QRFF 2IAIA 4XLHA 1JDEA 5KFSA 1Y1WA 3ZOBA 2PBZA 3MD2A 1PDNC 2ASJA 1JIHA 3CUQB 3WU1B 4HQ6A 1R4NB 3RKQA 3SZTA 5K5QA 4JI4H 4LF4H 3IH2A 2F4OB 4PFPA 2QKLB 3TW6A 4ED6A 3L2UA 4JBAA 1MBFA 1WWXA 5DEQA 1IV6A 2DPUA 1KJIA 4YQWA 3KP4A 4PJ0C 2HQ5A 1F9NA 1Z2NX 2P5LC 2FRHA 2EV5A 2WAEA 3GIIA 1B59A 5IT9K 3O3KA 2ZJTA 1EF4A 4DR5H 4BL0B 4PJLA 2FQ3A 2LKPA 2IS6A 2F5EA 2JEIA 3WHBA 1GV5A 1RETA 1V54H 4TV8F 5J1UA 2ZXIA 2MA3A 2Y2ZA 1S9HA 4NUBA 3WGHA 5JHFA 2UWMA 2VQHA 3SZGA 2YCHA 3PW7A 3SDBA 3IKVA 1TLHB 2XUBA 4G94A 4GGGA 2W82A 3Q3SA 1TC3C 4F55A 1TWCJ 1GVDA 3B73A 2W8KA 3F8FA 2WADA 3NARA 3S2WA 4D7NA 1GYFA 1TWHJ 3Q9VA 1TQIA 2IS2A 4EFBA 2KL4A 2I8CA 3AL0B 2VOPA 2P7VB 1V5GA 2ZXJA 1W0UA 3CJQB 2CGPA 2VQCA 5ICFA 4GKKH 3S16J 4ED8A 2VQLA 2DT6A 4ZQIA 2FE3A 1P9QC 1JUPA 4D0PA 4I99C 1S9FA 3DKYA 2VLAA 5J8FA 3S3NA 1ETOA 3GEZA 3TGNA 2KMUA 2K4BA 3PSFA 2DJNA 3SE7A 4FHTA 3RGXA 1JT0A 3Q1KA 1LDKB 2W48A 1KQ9A 3DBHB 3FMRA 2K4JA 1IV8A 2H94A 3GTLJ 3KHRA 4AD9A 1RR7A 1Q1HA 2M34A 4QSHA 3K5HA 2A6HF 5BPIA 2AXLA 2O0YA 3M9AA 3ONQA 2W6QA 2Y75A 1TWFJ 3EETA 4PUSA 3G6XA 4O3MA 2UXDH 2IRFG 4PSXA 2R84A 4A93G 3R60A 3Q8PB 1WQ2A 2P4WA 1Z77A 1E3OC 3I4MJ 3K5IA 3D1NI 4Y8VB 4CYDA 2OC6A 4OMYA 1O3TA 3VYUB 4IOCF 4FISA 3SDGA 5IP9G 1W5CC 2J5PA 5KFKA 3OSPA 2HGSA 1SD5A 4JP0A 4HF0A 4JX4A 2KZVA 5IWAH 1RJPA 4KICA 1BJAA 3ZQGA 2STTA 1UHSA 1SC7A 2C35B 2FKLA 2ZJ2A 2XCPA 1RRJA 1J2XA 1SFXA 4DV4H 2XV4S 3QYFA 6PAXA 3DWLE 1BC7C 1LEBA 3RSNA 1ZTRA 4C2MA 3NQOA 2EQRA 2VJ4A 1R22A 2ZC2A 4AU7A 3PW4A 3CC2I 3PNYA 3DPUA 2HYFA 5BPHA 2R7SA 3AKZA 1YW9A 2MCTA 2XC7A 1DPUA 5CLSA 2UU9H 2YX7A 1BW6A 3G6YA 2X85A 4JOMA 1D3YA 1IRZA 5L1JA 3E6DA 4B1RA 1X58A 4HAMA 5GAHJ 1IAWA 2XGXA 2CO5A 3L1PA 2R7TA 1UC9A 1FBSA 2E2IA 3IRRA 2VOOA 1VBHA 3BCAA 4RNOA 1QQIA 4QLCU 4U7CA 4A3CJ 2UVRA 3UFXB 2UXNA 4IWYA 3ISPA 1QVTA 3JRIA 3JRWA 3GTMJ 5JHUA 1XDNA 2A6EF 1TW3A 2F5CA 3J80K 1K4TA 4I2OA 5KG0A 5KVRA 1OCOH 1YLFA 2LF7A 1ORKA 2L0KA 4MV1A 4DIQA 3JR9A 3QFFA 5F0CA 3ORRA 5LFAA 3I55I 4A0ZA 1B04A 1HNXH 1WFXA 5M5XJ 1NTCA 1OCZH 3IV5A 1ZRFA 4KNYA 2R93J 2QVOA 2BQUA 3K0LA 4WD3A 5EEAA 4XX0B 3UQ8A 4ECYA 1N75A 1YHQI 2NNNA 2XGCA 4PZJA 5FLMJ 1R49A 4LG0B 3IP4B 3FKIG 5KFJA 2NU6B 1D0YA 1EJ9A 1T98A 3FWEA 3M4OJ 4HBLA 4FX0A 5C8YF 3K2ZA 2GXBA 3Q0VA 4RB0A 1HDPA 2IP4A 1T8IA 4LF7H 4IRIA 1FIAA 4M3EA 3I56I 1U0JA 4OAYA 4DR7H 4EATA 4PK4A 4S05A 2F2EA 5ERIA 5L3DA 5K7HA 5FLVA 3S1MJ 4KA4A 3HOYJ 3GTGJ 1LB2A 5DCMA
chains in the Genus database with same CATH topology
4RZQA 1MDMA 1FP1D 3HYIA 4MV9A 3JSNA 4RGSA 2CSOA 4LLLA 2F5FA 4LSXA 3C0FB 4O5VA 1B1BA 4E70A 2VBWA 3GYHX 1P2FA 3HOSA 2JRTA 4DV6H 4WXDA 2WWYA 4GYIA 4JYAH 3JAMZ 4DV2H 1FPQA 1UHMA 3H92A 1I1GA 1S6LA 4RB3C 4U0WA 4G7OF 1S29A 2G7HA 1WI9A 2EWNA 4RGUA 1R7JA 5HVQC 1I94H 2A07F 2JPBA 4DR1H 3BY6A 1LDJA 3VOEA 4ZYGA 3F8BA 1REPC 1F5TA 4KN7X 1F1ZA 4JV5H 3MWMA 1XGOA 4M9SA 5FB2A 1FYMA 2MLKA 2HGCA 3C3WA 4Z2YA 3V8JA 2DPDA 3WTSC 2IPQX 5LHIA 1SMTA 2W57A 1BI2A 2JTVA 3PFIA 1XD7A 3RKXA 1B6AA 4HLXA 4BNCA 4LF6H 3WGIA 3FHZA 3IG0A 4GXOA 2EB7A 1FNNA 3IL2A 3U2RA 3DP7A 4BHBA 2EK5A 2CW8A 1KYWA 3O2PE 4HX8A 5FD5A 2W25A 2ZKZA 2Q0OA 3LSTA 1HSTA 2O3FA 3WE3A 5CVVA 1YYVA 4DV3H 2H6CA 4X66H 4CZZA 3B02A 4KT5C 1J5EH 5ED4A 4A0XA 3PQJA 1RI7A 1ON1A 1EV7A 2VE8A 3BJOA 3E6CC 4LF9H 1MZBA 4B3TH 2OD5A 4HW0A 1BJTA 4JI8H 4OIRF 3PQKA 4B3MH 1Y0UA 3LA7A 4HQMA 3GO5A 2ZNZA 4EM2A 4DR4H 3L4JA 3DF8A 2DFIA 3HUGA 4LMYA 1R00A 2W24A 2F4VH 3WODF 4LLGF 3WTYC 1H0MA 1I5ZA 2LDUA 1O7LA 2QYOA 4EEQA 2CW0F 2VONA 3BDDA 4EFEA 1USSA 1G6NA 1O57A 3CJNA 3KP3A 3N43B 3IWZA 4F7ZA 1JXSA 1FOKA 3I0TA 4R7RA 5D1OB 1P4WA 4G7HF 3HSRA 2CW7A 2FEZA 3KP6A 1SD4A 1XNQH 1P4XA 5HS9A 4UFZA 5LHHA 5L3FA 5F64A 3QU6A 4LFAH 4L0YB 1U5TC 3V7RA 5J6XA 1A04A 5ICCA 3F22A 1W7PB 4LB6B 4DQ2A 4IF4A 1XGNA 1ZAOA 2PBIA 3I53A 3T8RA 1E17A 3GF2A 2GXGA 2VBXA 2Z3YA 1N32H 1BI3A 3RYRA 4ZYHA 1WKMA 2V1XA 4JI5H 1MKMA 2ZMEA 2ISZA 1KU2A 5FLXK 4Y13A 5BMZA 5LEKA 3I5UA 4B09A 4HV6A 3ZPLA 4DV5H 1FBUA 4EV0A 1T6SA 2Y48A 1TA8A 3M1EA 3F8NA 2QZ8A 1FLIA 1KU7A 5HDGA 2VQFH 1XMAA 5BR8H 1XMOH 2GWRA 2DQRA 2KIMA 1OYYA 3VODA 2WV0A 1FSEA 1PP7U 3E6MA 3ZMTA 1XCBA 3ML6A 1TTYA 4BHCA 1TNTA 5EOYA 4JI3H 2D45A 1ZHQA 1G3WA 5ICEA 2YR2A 4P96A 3TDUC 1IZ1A 3M8FA 4JI6H 3N42B 3BPVA 3JTGA 2D2WA 3BROA 3HRUA 4KHPH 3KEOA 2O03A 2KRFA 4U88A 3V7SA 4AIKA 5ICGA 2MH9A 1YS7A 1EH7A 3J81Z 2IW5A 2CFXA 2D1VA 3HTSB 4MQ9F 4TV7A 2H09A 2EFQA 4UCRA 5AIPA 3SFZA 4HQEA 3BA8A 4LFUA 3KE2A 4I02A 1SD7A 1RNLA 3BJ6A 1K78B 1TQPA 2C6YA 4KMFA 4ZH4F 4P9FA 4XBFA 3HIFA 2VT3A 1U5TA 5DV5A 2HYGD 5DD4A 3ECOA 3F6OA 2QBYA 1XDSA 2XKPA 3GW2A 4PGHA 4HF2A 5E8GA 4HZFA 1HKSA 1CF7B 2DO7A 3RGZA 1BC8C 2E7XA 3TO6A 3NRVA 2FXAA 2VC0A 1ULYA 2FMLA 4P9UA 3R0JA 1AWCA 3TOBA 4N9HA 4NHJA 3T1YH 1TAEA 5D8KB 4MTDA 1O75A 1GVJA 2XAHA 2NYXA 5HOOA 1HW2A 3GLXA 3MZYA 2BYVE 2CWEA 4FX4A 2BEOA 2A68F 3E6BA 2P8TA 5L3EA 4EJOA 2IA1A 3LMLA 2A5YB 2UXBH 3LAPA 3K69A 2ZM6H 1P6RA 5ILVA 3RF2A 5E17F 5CVRA 1IN7A 5E1ZB 5DCFA 1FVIA 3ZMUA 4M9ZA 1Z1DA 5FLXZ 4XSXF 5DDGA 4I7HA 3OTOH 3EUHA 4A2UA 2IVMA 5K5RA 4QWQA 4L9NA 4BXUA 4WK8F 1QZZA 3F3XA 1LDDA 3I4PA 1T39A 1ZLJA 2UXXA 3JSOA 3KZZA 3LA3A 1I6UA 1WSUA 1U6GA 5HDKA 2OAZA 3WTXC 4M7EA 3FMAA 4U7DA 2UUAH 1N36H 3HRMA 2M30A 4MHGA 1DDNA 4EM1A 2P7CB 3KCCA 3KLOA 3QP5A 2M5WA 4U7BA 4KUMA 1E4GT 5H20A 2EV0A 1D8KA 1BI0A 3HXLA 1O3QA 5LRRA 3F21A 1XB4A 1O3RA 3RKWA 5FO5A 4YFNF 2EFWA 3PN1A 1KQ8A 2NNYA 4BH9A 2M45A 1YIOA 3CDHA 2FBIA 4ENJA 3DKWA 3JAMW 2VN2A 1RUOA 2FF4A 4YFKF 1L0OC 3J81K 2G9WA 3R4KA 4EMSA 3JAMK 1HKQA 3BA9A 3ERED 2GQQA 1E2XA 2LSOA 3D5LA 4OOIA 3FXRA 3BPXA 1XCVA 2EFOA 3VEPA 5HLIA 2QLZA 2D1HA 2KIFA 3K1MA 1S03G 2HQRA 4EM0B 3MCZA 4EJVA 3MFKA 1UB9A 4M6XA 4KMUX 2QENA 1YQAA 4M71A 1FZPB 1D5VA 3SHFA 3TO9A 1RIOH 5CVIA 3QPTA 5FD6A 3GUDA 1PUEE 2H6BA 3QPHA 3E5QA 3KAKA 4EJUA 3T0YA 2P5VA 2YPRA 2HHHH 3GZ5A 1VTNC 1PP8F 3TKYA 2KJCA 5F1RA 5AONA 4UCUA 4MTEA 4OU0A 3RI4A 1X9NA 1SFEA 4JI0H 5LEJA 3FX3A 3I59B 3E97A 4OIQF 1N33H 3H20A 4EJTA 3M4IA 3KXYT 1IBMH 4UCTA 3ZN0A 3HTUA 3R0AA 1ON2A 3J80Z 2H27A 3ZMZA 4LJZF 2HEOA 4UV8A 1XGMA 4ZZLA 2DI3A 2M8EA 3ZP5A 2BBYA 2K7LA 4UVCA 1RZ4A 1IXRC 4MEYF 1IN4A 3GVAA 4NXNH 4PDKA 5EEHA 1SYXB 1FX7A 4G9YA 1U3EM 1R1UA 2AS5F 1JHHA 1W5SA 2V79A 5KK1A 1M0WA 3GXOA 4FM9A 1S3JA 4Y15A 3GFIA 4L5IA 4GO1A 2PMUA 3BOQA 2WC2A 2P6SA 1BIBA 2XROA 4RAZA 1J59A 4ESBA 2ESNA 2L4MA 3F8MA 3EQLF 1XDUA 4UCOA 4X64H 3FM5A 3WTWC 2DK5A 1N34H 2EA4A 5LLQA 3W6KB 3CUQA 4G8XA 4ZYDA 4DR2H 2OQGA 1FY7A 4UCSA 1KYZA 1ZG1A 4UNOA 3ABTA 3KEQA 1S68A 2ZO4A 4AIJA 1QZYA 1HW1A 2OA4A 2IA0A 4PGGA 2MBFA 3N40P 3L9FA 5LMUH 2MC3A 2UUBH 4B3RH 2NAZA 2B0LA 2STWA 2DU9A 3COAC 2HVQA 1GXPA 2NRAC 2ISYA 3QP6A 4A6EA 3TQNA 1FP2A 4WWCA 2NS0A 4G6QA 3JTHA 3G73A 2ETHA 2K86A 1MJAA 2V1DA 4WCGA 2TDXA 1K7AA 4GLXA 1O7FA 4IAJA 4P5OA 1IF1A 3CUQC 4JI1H 5HLHA 4LFBH 2OBPA 2PEXA 4X65H 2IP2A 2XASA 2HKOA 2WTEA 3L2CA 3HHGA 3O6BB 4KIGA 2HQNA 3DPTA 3H3ZA 2MD5A 2VC1A 1X3UA 3TO7A 4CDGA 1YS6A 3WG9A 2MH2A 5J8CA 2Z99A 5BOXA 5JI6A 2JT1A 3CTAA 1JHFA 1H9TA 4AWXB 1O3SA 5L3GA 5EEGA 2E1NA 4Q5SF 2HZTA 5BQTA 2GZWA 3FXQA 4PDBA 2HOEA 3CVZA 4A6DA 3CO6C 4Q47A 1T0FA 1WRJA 5DUKA 5LRSA 1Z2PX 2Q2UA 3SXYA 4HF1A 3EYIA 5FLXW 2FNAA 4RS8A 1Z05A 3ROUA 1VS0A 3FXUA 4KFCA 4HV5A 2VBZA 1Z91A 4NB5A 4A12A 4JI7H 4WXCA 1HW5A 3I58A 1HQCA 1UFMA 1TBXA 1STZA 3E5UA 2MLGA 5D4SA 4OINF 2CYYA 3FM3A 3QOPA 3J81W 2QM3A 5DCMB 1OKRA 1MDMB 4CICA 4Q4ZF 2ZNYA 4MGRA 1V4RA 4I01A 1J0RA 4KYWA 1W7PD 3M7GA 1DUXC 1EH6A 4Q0YA 3F8CA 1ZGAA 2HR3A 1QGPA 3TOAA 2DT5A 2FU4A 3N44B 3K9TA 2GA2A 5TRDA 1DPRA 1ZYRF 4R79A 1I27A 2VUGA 4GKJH 3QU3A 2YX4A 3P9KA 2ELHA 4ENNA 3ABUA 3MAJA 5DD8A 5ILSA 4UVAA 4UUVA 3HSFA 2UUCH 2VODA 4DV0H 1XNRH 3N4MA 5D6FA 1QO0D 3R6SA 5HDNA 2Z9OA 1TQMA 3GFLA 3IC7A 3OOPA 1DGSA 4LK1F 4L9VA 4NQWA 2RGRA 4MEXF 4KDPA 2KIUA 1KA8A 4HDVA 1J5YA 2VXZA 5LBQA 2EFPA 1L2ZA 2X0LA 2CG4A 4UXNA 4EGZA 2FNPA 5DYMA 3N6XA 3F6VA 1YFHA 1DP7P 4A5MA 1XSXA 5JR3A 4BWSC 3DF7A 4LG0A 4A5NA 5LGNA 3T1HH 1ZN2A 2Q2TA 4LFCH 4IXAA 2Y0MA 4LD5A 4GCVA 2PQ8A 3AAFA 1HNWH 1I1SA 4K0KH 4JK1X 3HOTA 3DXJF 1L3LA 3JSPA 4ESFA 3BP8A 4BHPA 2BV6A 3OV8A 2E1CA 5D4RA 1Z9CA 2R7FA 2HTSA 1B9MA 1FYLA 1G3TA 1FSHA 1R23A 1FWZA 3EDPA 1IN6A 3CLOA 2ADUA 4L9TA 3KETA 1K6OA 4AQYH 4XRFA 3D0SA 4YY3H 1S7AA 1R1TA 3SZPA 3M8EA 3R61A 2VBYA 2IT0A 1FYKA 2RQPA 1U2WA 4ETSA 4M72A 5IT3A 2CQKA 2DAOA 1T2KA 2A3SA 2QQAA 4CO8A 3L2PA 5DUIA 2HVRA 1ZG5A 2XAQA 1U5TB 1U78A 1P8LA 3GZ6A 3RIZA 4YIIA 1SFUA 1LJ9A 3JSLA 1YW8A 1EH8A 1Z6TA 2PLYA 4CC5A 3ELKA 4DV1H 2EA2A 4LF8H 1R5HA 2QUFA 3LA2A 1HBXG 4M9XA 3IKTA 2G7UA 4WF2A 4CXFA 1ODDA 2XKOA 4AVPA 3ZQ7A 1AOYA 4PCQA 1OPCA 5FFXA 4NXMH 4XLPF 2L4AA 3ZN1A 2ZMEB 5HLGA 2LF8A 1BM9A 1ONVA 1IXCA 2GAUA 2WYOA 4J0MA 1NHAA 3DQVC 5E18F