2W57A

Crystal structure of the vibrio cholerae ferric uptake regulator (fur) reveals structural rearrangement of the dna-binding domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
DNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Vibrio Cholerae Ferric Uptake Regulator (Fur) Reveals Insights Into Metal Co-Ordination.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Metal transport
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w57A01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2w57A02
4HQMA 2IRFG 2XRNA 3O3KA 4B8XA 4PZJA 4UXNA 1YQAA 2A69F 3E6MA 4BXUA 1WKMA 1B9MA 2LKPA 3HSRA 2QQ9A 3CUOA 1Z05A 2K7LA 1U5TC 3ROUA 2GXBA 2OZ6A 4KICA 3J80K 1YFHA 2QQBA 4Y13A 2EWNA 1ZGJA 3MWMA 2M45A 1ZGAA 1F1ZA 4HV5A 1R5HA 1R7JA 2KJBA 2UXXA 3GFIA 4L5JA 2DQRA 1HQCA 3KP5A 2P5LC 1F5TA 5FO5A 2JRTA 3I71A 3S2WA 1MDMB 3R60A 4OINF 3RKXA 3EUHA 2CSOA 1OYYA 4M9XA 2A5YB 4KN7X 2XAGA 2QWWA 1UHWA 2ACJA 4P96A 5HLIA 3LA7A 2C6YA 1U5TB 3BZ6A 1ZRCA 2DK5A 4RB1A 2HEOA 2DW4A 2RQPA 2CQKA 3ZMDA 3JTGA 4YFKF 3TOAA 1OR7A 2BYVE 2DK8A 3F23A 5ICCA 1UFMA 1W4MA 2HOEA 2EFQA 3WTSC 3G3ZA 3P7NA 4ZH4F 4LGWA 1I1SA 1QPMA 2EFNA 1GXPA 2VBWA 3ULQB 4LLGF 4IPAA 1ZLKA 1MJBA 3SZTA 3F6OA 3TGNA 3FXQA 5LGUA 3LFKA 4DQ2A 2Q2EA 4EJVA 4UVAA 3GVAA 5CYVA 2HZTA 2RDPA 3K0LA 3M7GA 4I01A 1O3TA 2FBIA 3HSFA 3MEXA 3GWZA 3WGIA 2ZJ2A 2DU9A 1UCRA 2EA2A 1T6SA 1SAXA 3R0JA 1XCVA 3CUQC 1IW7F 1XD7A 3BWGA 3GUDA 4GYGA 1OMIA 4XLNF 2OQGA 4ZYGA 1FBUA 4HQEA 1U6GA 1XGSA 2ZCWA 4RAZA 1T98A 4M6XA 2Z9OA 3HIFA 2ADUA 5D4SA 2E7WA 4G8XA 2TDXA 1BC8C 4KIGA 4HF2A 5D4RA 4A5MA 2LF8A 3CUQA 4IF4A 3KCCA 4KUMA 4EJOA 2JPCA 1J59A 2CWEA 1KU7A 1H9TA 2Q0OA 1FLIA 1QBJA 3ABUA 2D1VA 4ENJA 1V3FA 5D6FA 3SFZA 4HA8A 3VEPA 2GAUA 4PDKA 3QPHA 4OIQF 3L09A 3V4GA 2JPBA 4G9YA 2BGCA 2STWA 4FHTA 4UHTA 4UV8A 1O3QA 4P55A 3OV8A 2J5OA 1U2WA 5IT9Z 4I2OA 3WG9A 2OZUA 1X3UA 1I27A 4CDGA 1W7PB 2A6EF 3ZN1A 3C3WA 3WE2A 3IC7A 4L9NA 1J5YA 4ESFA 1S29A 1HW5A 4MQVA 2FXAA 1SD5A 2HYGD 2FBHA 1SD6A 2EFPA 4OIOF 5DCMA 2PN6A 2RKHA 1O7FA 3K69A 2KIUA 2E1CA 4FT8A 4BHPA 4ZZDA 3V7SA 1P4WA 3KEOA 2A07F 2XAFA 4U0VA 5ED4A 2FBKA 2B0LA 3WTTC 1MD0A 2F2EA 1YTYA 2V9VA 5H20A 2ZO4A 1SD7A 1V4RA 1ZG3A 4M9ZA 4A12A 1Z9CA 3GLXA 3GF2A 1B1BA 4KT5C 2M1BA 1G6NA 4BNCA 5ICGA 5L3EA 5E17F 2XKPA 3KFWX 2Z5UA 3R4KA 1MGTA 3I59B 1JE8A 3K1MA 1Z7UA 3LAPA 2FEZA 5LLQA 1TQPA 3T0YA 1T38A 1P6RA 4PCQA 4HLXA 1BOAA 2OBPA 3QP6A 2A68F 1FX7A 3Q9SA 1D8JA 2VT3A 3RJPA 1LNWA 1IN8A 3I64A 4L5IA 1C0WA 3ZPLA 1FOKA 1U78A 1L0OC 3HSEA 3B02A 2HKXA 2X4HA 3F22A 3DPTA 1S7AA 4YIIA 3WTXC 4EJUA 1SD4A 3V8LA 3RPQA 1RNLA 4NHJA 3F8BA 1J2XA 2IA0A 5BQTA 1FSHA 1KU9A 1ON2A 3HRTA 3BP8A 4GGGA 1YW9A 2FRHA 2QBYB 3WTWC 2H27A 1PP7U 1AOYA 3J81Z 5KVRA 3Q9VA 5F6FA 4P9FA 2QENA 3GW2A 2FOKA 2QBYA 1BI0A 5BS6A 3F8NA 5DD4A 2HS5A 4U0WA 2HFHA 2HTSA 1XSVA 1MKMA 3R0AA 5JI6A 1LVAA 2BEOA 1DDNA 3V7RA 1BC7C 3NQOA 1DP7P 3E5XA 1LJ9A 1HW1A 2XKOA 3GFJA 5FD5A 3O2PE 4HX4A 1USSA 2CFXA 2L02A 3IRQA 3GX4X 2GXGA 3K1PA 1P4XA 1TLHB 2OA4A 4A0YA 1GHCA 4L0ZB 5JFRA 2R3SA 3ZMTA 1R58A 3ISPA 2X0LA 3DFGA 3HRSA 3C1DA 4GYIA 2R7DA 2Y0MA 4HZFA 1P4AA 2K86A 5L3CA 2FF4A 3KETA 4IRHA 4XSZF 4L9TA 1IRFA 1J0RA 3MQ0A 3QAHA 2PBIA 3GZ5A 4GO1A 1ZG5A 5BMZA 1A04A 1LDKB 4LLNA 1XCBA 3F72A 1FYMA 3TO9A 2Y75A 1K7AA 2P6SA 3D0SA 5AIPA 3FM3A 1IUYA 5LEKA 4E70A 2CG4A 2DO7A 3BJ6A 4YFXF 1JHHA 3M8EA 3LA2A 3FMRA 3H3ZA 2EK5A 3ZMZA 1HKSA 3F8CA 3BPXA 2EA4A 1T39A 2EJRA 4IRIA 1HW2A 4G6DA 3KEQA 3ZP5A 4I0BA 5HDGA 3KP6A 4ENKA 1R1TA 3LQQA 3J81K 3L00A 1EV7A 2BBYA 5HVQC 5D5WB 1WQ2A 1XDSA 3M1EA 1FBSA 3WODF 1FNNA 2ZMEA 3WGGA 1FSEA 4U7BA 5CVIA 1R23A 2IT0A 1XB4A 4RGUA 3ZMUA 5LRSA 2DLLA 3F21A 2RNJA 4O3MA 3GFMA 2IW5A 3COAC 3JSOA 1S7OA 4BHBA 4L18B 5LEJA 2E7XA 3K1NA 2DAOA 4K2EA 4GCVA 3E5QA 2IA1A 3GO5A 5JHUA 4I98B 1FY7A 2XAJA 5F64A 1OYIA 1J9IA 1USTA 4ESBA 3DPLC 2PEXA 4UUVA 5DD8A 2DTRA 3BOQA 3N97A 5D5VB 1BBYA 1WWXA 1B59A 2HR3A 1W5TA 4OIRF 1REPC 5FFXA 2XAHA 2O61A 5H6QA 5ILVA 1SFXA 2IJLA 4N9IA 4HX7A 2W57A 1Y0UA 2FU4A 2PFBA 2PJPA 4KMFA 4YFNF 3WTYC 3FX3A 5E8IA 1F9NA 4RGSA 2KIMA 4ENMA 4A0XA 4MGRA 1L3LA 3G73A 4G7OF 3QPTA 4UV9A 3CLOA 1OYWA 4LB6B 2FNPA 1HSJA 5IT3A 4R79A 3KZZA 4AD9A 5AONA 2H6BA 4OMZA 2PI0A 2LF7A 3C18A 2K27A 3I58A 2W24A 5D8LB 4AIKA 5CVRA 1W7PD 5LGTA 3QRFF 2UZKA 1YIOA 3OOPA 3KP2A 1P2FA 4KIBA 4M71A 4UVBA 5LBQA 2F5CA 2G7UA 4IHSA 3E6BA 1O3SA 1BIAA 4HDUA 5DCFA 4ZZLA 3LAJA 1TTYA 4AWXB 2DI3A 2ZBKA 2IP2A 3I53A 3FZVA 3WTZA 1FP1D 2WC2A 2VE8A 2PQ8A 3L7WA 2D45A 5F1RA 2XHKA 2H09A 5D8KB 2K4JA 1IXCA 3IWZA 3P9CA 2ZXJA 3MCZA 2P4WA 5A2QK 3FWEA 2L3DA 3F3XA 3LSTA 3RI4A 1G3WA 4KYWA 4ENNA 3NRVA 2F5FA 4EV0A 1G3TA 3DEUA 5DV5A 1B4AA 4RB0A 4CXFA 3REOA 5ILUA 3SXYA 4M6YA 2CGPA 5J8FA 1I5ZA 3RTRA 2BV6A 4HLYA 1T2KA 4XSXF 2WTEA 1TNTA 2O0YA 4Q4ZF 1YW8A 3BDDA 1XSXA 2NRAC 4JK1X 2NYXA 3E3VA 2STTA 4A0ZA 3E97A 1R36A 1WSUA 1S8NA 2YR2A 4G94A 2EFWA 4N0BA 2XGXA 1R1VA 4IHTA 3JSPA 4Y17A 3U1DA 1OKRA 1IZ1A 1R22A 1HXDA 1FYKA 3ECOA 3M9AA 2VODA 4R1HA 1IN6A 5FB2A 4S05A 3PQKA 4WK8F 1HKTA 3T5XA 4UNOA 1TW3A 3H3UA 2KRFA 3F8MA 1XN7A 4BYYA 3HRUA 5AIQA 3RKWA 2JT1A 3B73A 3U9GA 5J6XA 4WCGA 1LQ1A 3N4MA 4GXOA 3FXRA 2WWYA 4LD5A 1MZBA 2GA2A 3QP5A 4HV6A 4HX8A 5CVUA 4I0AA 2NAZA 3W6JB 3TO6A 1SMYF 5TJJA 3BY6A 4OU0A 2HWVA 1KU3A 1FC3A 1UHMA 4ZYHA 3WU1B 5DEQA 3TO7A 2QLZA 5A2QZ 5FLXK 2M5WA 2LDUA 5D5UB 1O57A 3WTUC 2VE9A 4PGGA 1XGMA 2VN2A 2M30A 2YSRA 2RV8A 1ON1A 4EQQA 1YYVA 1IN5A 2MBFA 3RYRA 1F4KA 5L3BA 1T0FA 1H9GA 4KA4A 2O03A 4IJAA 2OQRA 2A61A 2AXLA 1QZZA 1TQIA 5ILSA 3E5UA 1EH8A 1E17A 1J7KA 2GQQA 1RUOA 2NS0A 5FGMA 1XMAA 3DXJF 4LFUA 1FT9A 3EETA 2ETHA 5E1XA 4S04A 2UXNA 1LEBA 4A5NA 1OPCA 5L3DA 2KKOA 2RN7A 3GFLA 4G7ZF 2D2WA 3U2RA 4O6JA 3ERED 3KLNA 1D8KA 2PLYA 1KQ9A 2ESHA 1YS6A 2G9WA 2FMYA 5HDNA 2L54A 2QM3A 4ZYEA 2CYYA 4DNCA 4MHGA 1TQMA 1BI3A 3R6SA 1TNSA 3MZHA 4YG2F 3HOSA 1PP8F 3DV8A 2P7CB 3ZQ7A 2YX7A 2IPQX 4HF0A 3IHUA 1JXSA 2W85A 4G7HF 2Z99A 2ISYA 1BI1A 3DQVC 3WTVC 1KQ0A 2J5PA 2L4MA 3QOPA 1DUXC 2PG4A 5K5OA 2FSWA 2DPDA 4KMUX 3BPVA 2ZKZA 2W25A 2A3SA 3MZYA 2VC1A 4CGZA 1IXSB 3T1BA 2FNAA 3P9KA 4I09A 2AS5F 3EYIA 2RGVA 1B6AA 5TRDA 1ZAOA 3MAJA 1FP2A 4JBAA 3P9IA 4I7HA 2KIFA 2MC3A 1RI7A 2V6CA 1I1GA 3TQNA 1HBXG 1EH7A 2BE5F 1ODDA 2IA2A 1YO5C 3SHFA 5ERIA 1ZRDA 6PAXA 1LDJA 2YX4A 1ZN2A 2HTJA 3FXUA 3KE2A 3HOTA 5K5RA 2GIVA 4WWCA 2VBXA 4HAMA 3Q5FA 3KLOA 4BAYA 2NNYA 1LB2A 2P5VA 2VT2A 2YU3A 4U88A 3WE3A 1ULYA 2JTVA 3GZ6A 4PGHA 2MH2A 2PMHA 2RVCA 4YIFA 2ESNA 5D6EA 3GEZA 1G4DA 5CVJA 2NNNA 3J80Z 1PDNC 2MLKA 3I59A 4KNYA 1K6OA 2WV0A 5CLSA 1R5GA 3WGHA 4CICA 3QU6A 1CF7A 2O8XA 4LJZF 3HHGA 1XDUA 2O3FA 2VC0A 3V8KA 4MTEA 5HOOA 3SZPA 3K2ZA 4UVCA 4M9SA 3H92A 3CO6C 4RB3C 1IN7A 4MTDA 2MLGA 2XROA 4HDVA 5DDGA 3FHZA 3ZMSA 1MJAA 1O3RA 1XGNA 3R61A 1QQIA 5J8CA 4Z2YA 2ZNZA 2MD5A 5E1WA 4QLCU 3RIRA 5KK1A 4F7ZA 2OU2A 3CJNA 1R00A 2DT5A 5CVVA 2DBBA 1QO0D 2H94A 1S3JA 2A6HF 4LLLA 3KP3A 4LK1F 3TDZC 4NB5A 3ECHA 3KZYA 4EJWA 4EVIA 4EM0B 1KYZA 2HKOA 3KP4A 1Q1HA 3M8FA 2MH9A 1U8RA 2ZMEB 2L4AA 4Q47A 2VXZA 2HQRA 1XMKA 1KGSA 1LDDA 1KU2A 3FM5A 4ZYDA 4KN4X 4Y15A 2QVOA 4KFCA 4RS8A 1YLFA 3HTUA 4R8HA 1EH6A 1G3YA 3QU3A 3T8TA 2M87A 2DQLA 1QZYA 4AVPA 4LMYA 5EEHA 1BJAA 2QZ8A 3ELKA 1D3YA 3I5UA 1K78B 1VTNC 2HGCA 5FD6A 3EYYA 5HS8A 1FZPB 2ZNYA 5HS9A 4Q5SF 4ETSA 1KQ8A 4XBFA 1ZARA 1FYLA 2FMLA 3L9FA 4WX9A 2XAQA 2CO5A 1K78A 4HW0A 4A2UA 4LG0B 5LHHA 3EDPA 4ON0A 1MJ9A 2DFIA 3I0TA 1CGPA 2ELHA 3CDHA 3I54A 5FFZA 3DF8A 4L0YB 3I4PA 5E18F 1RUNA 4LG0A 3KP7A 1IXRC 2MA3A 5HDKA 1D5VA 2HQNA 1Z1DA 2P7VB 2VOOA 5HS7A 1IRGA 2Z33A 3L2CA 4M73A 2EB7A 1YW7A 1AWCA 4EJTA 1XGOA 3VOEA 2IVMA 3LA3A 1ZRFA 3JAMK 1RIOH 1ZH5A 4QWQA 1IAWA 3NEUA 4XRFA 4U0YA 1BI2A 1GXQA 4LK0F 1O7LA 2COMA 5CJ9A 2JZYA 5IT9K 3ABTA 1TW2A 5E1ZB 1FWZA 1HSTA 4RGXA 4B09A 4HOBA 3CTAA 1G3SA 4OOIA 1ZREA 3HHHA 1W5SA 4OMYA 2XASA 4KDPA 5JR3A 5DUIA 1ZHFA 3V7CA 2HYFA 3GXOA 1JGSA 1R1UA 2L01A 3LQRA 3DKWA 5HLGA 1XSDA 5K1YA 4M72A 2Z3YA 4WXCA 5LGNA 1KYWA 4TV7A 4P9UA 1I6XA 4A6DA 1ZYRF 2XVCA 3V8JA 4EGYA 2Y48A 2CW0F 3VFZA 1W7PA 5H6RA 1Z91A 5HLHA 3JW4A 5BOXA 3IL2A 4O5VA 3TKYA 3D5LA 4BH9A 2HDCA 5LHIA 5LHGA 2M8EA 3VB2A 4MEXF 3HYIA 3FMQA 5E8GA 1IN4A 3F6VA 3TDUC 1Z6TA 5L3FA 1YG2A 4M74A 5K5QA 1JHFA 3LWFA 4Q48A 3RKYA 3PFIA 1YS7A 2LNBA 2GZWA 1E2XA 2UWMA 3CO7C 3JAMZ 2ZFWA 3IKTA 2EFOA 4RB2C 2VBYA 4A6EA 2G7HA 1Z6RA 2F5EA 5DUKA 5L3GA 2O6GE 1WI9A 3O6BB 1BN5A 2DPUA 1CF7B 1IF1A 1B9NA 4CHUA 2XIGA 3IRRA 4MQ9F 5ICFA 3HRMA 1SFEA 1BM9A 4IRGA 4EGZA 5FLXZ 2XV4S 2QQAA 4ESJA 1NHAA 3RDIA 2GA1A 3DP7A 4KIFA 4CZZA 4WXHA 3BROA 4MEYF 5JVTA 4HBLA 4CYDA 2JSCA 4AIHA 2KJCA 4N9HA 3E6CC 2QUFA 1FPQA 1DPUA 1BIBA 3SQNA 4MNUA 4IVNA 2V1DA 2XUBA 4D0PA 2K4BA 1SMTA 4BHCA 4FX0A 2FQ3A 4H0EA 4EM1A 2OD5A 5LRRA 5BPDA 2OAZA 2EV5A 1HKQA 2D1HA 4I02A 2V1XA 2VONA 5DYMA 4FX4A 3RPUA 2EV0A 2V1UA 1QGPA 1MDMA 1H0MA 1S6LA 3AAFA 1TBXA 2FA5A 2E1NA 3CUQB 3HUGA 4HF1A 1WRJA 2P8TA 4BQAA 4LB5A 1ZG1A 1P92A 2EV6A 4WXDA 5EEGA 3FF5A 1STZA 2F5DA 2K02A 2Q8KA 2RC4A 3RYPA 1SFUA 4JQFA 2P5KA 4L9VA 3PQJA 2FE3A 1FBQA 2VOPA 4RAYA 2GWRA 3VODA 3IWFA 4WF2A 2P6TA 1J75A 4HYEA 3T8RA 3C7JA 3BJAA 1PUEE 3IKVA 3JTHA 2QYOA 5ICEA 4EMSA 4P5OA 3ZMVA 4OIPF 3W6KB 3F8FA 4RGRA 4CO8A 3BJOA 1U5TA 2YPRA 1ONVA 1RZ4A 3TOBA 5D5XB 2V79A 3FMSA 4ASNA 1DPRA 1U3EM 2VBZA 3EQLF 2LSOA 3J7AO 4U7DA 1UB9A 2R7FA 4IXAA 1QNTA 3WU0A 4XLPF 3GYHX 2H6CA 2W84A 5DCMB 1K79A 3K9TA 3MFKA 5E20A 3ML6A 1ZLJA 2ISZA 4NQWA 3E6DA 4EM2A 4G6QA 2PMUA 1GVJA 5BPIA 1LEAA 4L9JA 3HTSB 1KA8A 3ZN0A 4AIJA
chains in the Genus database with same CATH superfamily
3GCMA 3OYIA 4HQMA 2IRFG 1BW5A 3RB4A 2XRNA 3HGYA 3O3KA 4ECRA 2RQQA 4B8XA 4J9NA 1SANA 4PZJA 2GM4A 4DUZH 4UXNA 3QYBA 1YQAA 3M4IA 2A69F 3QPLA 4DR5H 3LSPA 3HOYJ 3E6MA 4BXUA 1WKMA 4CC5A 2W82A 1B9MA 2LKPA 2WADA 2WAFA 3HSRA 3M07A 3PN1A 3CCMI 4PWQA 2QQ9A 4CA0A 3CUOA 2IXSA 3GV5B 1HA8A 1Z05A 2K7LA 1SFKA 3OSGA 2L2OA 2JEGA 1U5TC 3ROUA 4F50A 2GXBA 3CF5F 2OZ6A 4KICA 2DA7A 3BR5A 1GSAA 3J80K 2W6NA 4RUCA 3BA8A 2FP4B 2GIZA 1YFHA 5GAGJ 1ERDA 1TWGA 2QQBA 2FJZA 4Y13A 4HR7A 4A3DJ 2EWNA 1ZGJA 3MWMA 3TW6A 5KFXA 2M45A 1ZGAA 1A36A 1F1ZA 3S17J 4C3JJ 4HV5A 3LWBA 3RBDA 1S72I 1R5HA 1R7JA 2VJJA 2KJBA 3H5NA 4RBOA 2H1LA 2KZGA 2UXXA 3GFIA 4L5JA 1XS9A 2VQEH 2DQRA 2DT6A 2Q2TA 4NBQA 2KMUA 2HOTA 5DQGA 3BTCA 1HQCA 3KP5A 2P5LC 1BW6A 3RPUD 3JSLA 2IEKA 1F5TA 2FLPA 1TWCA 1A6QA 5FO5A 2ASJA 2DMQA 2JRTA 3BAAA 1D5YA 2R7ZA 4EEFG 4B4CA 1VQOI 2LOOA 1WH7A 3I71A 3S2WA 2DA1A 3R60A 1MDMB 1M1EB 4TV9F 4OINF 5L1KA 3OIQA 5B1BH 4DL6A 3RKXA 3EUHA 2CSOA 1OYYA 3RZDJ 2LY9A 2ZDHA 3S8PA 4M9XA 2A5YB 2G0EA 4KN7X 1VQ8I 2XAGA 5IY5H 2QWWA 1T94A 1UHWA 1TWAA 2ACJA 3OSPA 3GZNB 4P96A 4XRMA 5HLIA 3LA7A 2YZMA 1MBHA 5F08A 1VQ5I 2C6YA 3OMYA 1U5TB 3BZ6A 1NTCA 1ZRCA 2QEXI 4UUSA 2DK5A 4RB1A 2HEOA 2DW4A 2R7VA 2RQPA 3CCEI 2CQKA 2XC7A 2FK1A 2I87A 3ZMDA 3JTGA 2F6CA 4ECTA 4YFKF 4FCYA 3TOAA 1OR7A 2BYVE 2DK8A 3F23A 5ICCA 1UFMA 1W4MA 2HOEA 2EFQA 2WDTA 2JWTA 3WTSC 3CCSI 1TWFA 2R8KA 3G3ZA 1T36A 3P7NA 3T5LA 1TWHJ 2ASDA 4ZH4F 2F4VH 4LGWA 1I1SA 4GC7A 2R82A 5M3FJ 4LIVA 4DV6H 1QPMA 2EFNA 1GXPA 1X3ZB 2VBWA 1B8IA 5JLWA 2DODA 4UUSB 5C1PA 3ULQB 4QIWN 4LLGF 2V1NA 4IPAA 2VKDA 2E2IA 1ZLKA 1MJBA 3SZTA 3BABA 5HNFA 4BDYA 1JLLB 3F6OA 2X6XA 3TGNA 3FXQA 2C2RA 1N33H 2CV1A 2DA6A 5LGUA 4RDUA 1ORKA 3LFKA 4DQ2A 2LREA 4UCTA 5FROA 1I7LA 2JUGA 2Q2EA 4Y4RA 3G8CA 2UVWA 1B8IB 1K1QA 1IV8A 3HOUG 1X2NA 3L2PA 5J2TF 4IL6C 4EJVA 5IYBG 1RYSA 4UVAA 3GVAA 5CYVA 2HZTA 2RDPA 3K0LA 4JI7H 3M7GA 4I01A 2HQAA 1E0EA 3NWSA 1RC9A 4V2FA 3GTKJ 1O3TA 4II3A 2FBIA 3MWEA 1IBKH 3HSFA 3MEXA 4UY8I 4XORA 4DYRA 5H80A 5KFWA 5BPHA 3H0GG 5C44G 1WCMA 3GWZA 5KFZA 5K7FA 3WGIA 5KFQA 2ZJ2A 4O4IF 2DDAA 2DU9A 1UCRA 3CCUI 2JUCA 1T6SA 2EA2A 2PMZE 1SAXA 2J6TA 3I4MJ 1MMSA 5F0CA 3R0JA 3OYCA 1VAJA 1XCVA 3BG9A 3UFXB 4ED8A 1T56A 3JRWA 3CUQC 4J9KA 1IW7F 1XD7A 4B43A 4J9MA 5FPRA 3BWGA 2EZIA 2VIXA 3GUDA 4GYGA 3K70C 3ETHA 3J7AY 4Z6YA 1IOVA 1OMIA 3JRXA 2PJRB 3BA9A 4DV5H 2XF7A 3H5AA 5KT2A 3KZIC 2OQGA 4XLNF 4ZJZA 4ZYGA 3CP2A 2HDWA 4NQWB 1Z2PX 1FBUA 4HSRA 1UC9A 5KAFC 2WY8Q 3A01A 1X58A 4BE2A 1ZR4A 4UUTA 4HQEA 2SCUB 1GT0C 2KISA 2X6WA 5KFVA 1U6GA 1XGSA 2ZCWA 2IGNA 4RAZA 5C5JA 2ZJTA 1T98A 4M6XA 2Z9OA 4UCUA 2CQ7A 1VBGA 3HIFA 2ADUA 5D4SA 1X4OA 2E7WA 2LK2A 2R7OA 4EATA 1BA5A 1KEEA 4G8XA 3OTOH 3V6HA 2TDXA 4KIGA 1BC8C 4YB8B 2JA6G 4HF2A 5D4RA 4A5MA 4F91B 1EF4A 1JUMA 2VKHA 2LF8A 3DLAA 3RAQA 3CUQA 3HUGB 4IF4A 4U7CA 3KCCA 1UELB 1LPQA 3F0CA 5HBRB 4KUMA 3CQZJ 3P5JA 1RR8C 4EJOA 2B9SA 4D5FA 3FKIJ 3A2KA 3DLLF 2JPCA 3D5SC 1J59A 2CWEA 3HJEA 4IWXA 3RB3A 4NC7A 1TAEA 2VJIA 1VQPI 2K9SA 1KU7A 4JI2H 1H9TA 1QHGA 2Q0OA 3FBNB 4J19A 1FLIA 3HXLA 1QBJA 3ABUA 3K3PA 1QRYA 1M6VA 1XG1A 2QQ8A 2D1VA 1Y1WJ 4ENJA 2R92J 4Q8FA 1V3FA 5D6FA 3SFZA 4HA8A 3ZQIA 1QU3A 2CQQA 3VEPA 3EUAA 4O3NA 2GAUA 3A02A 4PDKA 1ZETA 1AUVA 4IRDA 4XNFA 3HOYG 3QPHA 4OIQF 3L09A 3V4GA 4MV8A 2JPBA 3S2HJ 4G9YA 2BGCA 2STWA 2B63A 3L4KA 2MW8A 4FHTA 4RLFA 2JA6A 2A5WA 4UHTA 4UV8A 3KXYT 1CQIB 3Q8RB 1O3QA 4P55A 3OV8A 4LF5H 2KQRA 2KT0A 4EBDA 3OYBA 2J5OA 4YJ2F 1U2WA 2NVXA 5IT9Z 1F43A 4I2OA 3WG9A 2WE6A 2OZUA 1X3UA 1RRJA 1I27A 2I10A 4CDGA 1K4SA 2W6OA 1W7PB 4I55F 2DMTA 1KC7A 2A6EF 2BY1A 5M5XJ 3ZN1A 3BTIA 2MSYA 3C3WA 2L7FP 4UCSA 3WE2A 3IC7A 2CKZB 4CCJA 2XDVA 4L9NA 3CCRI 1J5YA 1Y14B 2AU0A 4ESFA 2CU7A 1S29A 1HW5A 4MQVA 3VPRA 2V26A 2FXAA 1XNRH 1SD5A 4I99C 3QYFA 2HYGD 4RAGA 1SD6A 2TRTA 4BBRG 4C5CA 2AQFA 1BR4A 2EFPA 5DQHA 4OIOF 2VL8A 4H4KC 5F04A 2AGOA 5DCMA 4DR7H 3MR6A 5LOVF 2PN6A 2RKHA 2X1EA 2R8HA 3I55I 1JKJB 1O7FA 3M4OJ 1TA8A 3K69A 1GV5A 1J5EH 3SEQA 2PBZA 2KIUA 5HODA 2E1CA 1K83A 2IA6A 4FT8A 3ERMA 4BHPA 1WVRA 3V7SA 4ZZDA 1P4WA 3KEOA 1YJNI 2A07F 2XAFA 4JI6H 3JR9A 1IOWA 3CMMA 2MFZA 4FE4A 4U0VA 2IBKA 2ECCA 5ED4A 4GC6A 2FBKA 3JAMW 2AO9A 2B0LA 2P0WA 1JKRC 1V9PA 3K4BA 3NWTA 1YJWI 2NVQJ 3GTMJ 1UNNC 4RNMA 1HDPA 3WTTC 4PJ0C 1BXRA 5FPOA 2LRDA 4QPQA 1MD0A 5LMNH 4ZQIA 1IGNA 1I50A 3BG7A 2F2EA 4E7IA 1YTYA 5EWEA 2V9VA 5H20A 3TP3A 4LFAH 3KIOA 1BJZA 3BCAA 2ZO4A 1GDTA 4ED1A 3B6CA 4A3GG 3WHBA 3OIPA 3FKJA 4DV0H 4ECUA 1SD7A 2E1OA 3RGZA 4LG3A 5GONF 3WG7H 1V4RA 2LY1A 3PO2G 1ZG3A 3GILA 4M9ZA 2VQGA 3MKZA 2YS6A 4A12A 2DA4A 2HOAA 2IS2A 2V58A 2DDBA 2FB9A 4Q43A 1B33N 1Z9CA 2CW8A 4CUGA 3GLXA 3GF2A 1S10A 5TGTA 3ZQFA 3MKLA 3KYLA 1GLNA 3CJRB 3MR2A 1N32H 5KFYA 1B1BA 1WJEA 1KJJA 4KT5C 4ZTFA 5L1JA 2M1BA 5LYJF 4Q8EA 1G6NA 1T95A 3BCBA 4BGDA 3CCVI 4BNCA 5ICGA 5L3EA 1VKZA 2NU6B 5E17F 2XKPA 3SI8A 4E7JA 5M3MJ 3NGDA 3KFWX 2FKLA 4DZPA 2Z5UA 4C9YA 3R4KA 1MGTA 3Q2OA 3I59B 1JE8A 2HPMA 3K1MA 1Z7UA 5EGOA 3PVXA 3SJMA 3GIPA 3LAPA 2FEZA 5LLQA 2UVUA 2W6ZA 1TQPA 3T0YA 1T38A 1P6RA 4PCQA 4HLXA 3JCUC 4XKCA 3GLKA 2UXDH 2P0AA 3I4NJ 1BOAA 3O8HA 2OBPA 2VPQA 3QP6A 2A68F 1ZQ7A 3DEWA 4IR9A 1FX7A 3Q9SA 2CH0A 1RYRA 1D8JA 3IG0A 3JRHA 2VT3A 4J9QA 1W36D 1R5ID 3RJPA 2BVMA 1LNWA 5EF6A 2OTLI 1IN8A 2BQUA 4BS9A 1BJTA 3I64A 4L5IA 4J9RA 2YRXA 1C0WA 3ZPLA 1FOKA 2OH2A 3DTKA 2V6EA 3OWTA 1U78A 1L0OC 1T0FC 3HSEA 3B02A 4GLXA 1S9FA 2HKXA 4GFBA 2X4HA 4BY7J 4C3IJ 4JV5H 5KG0A 3S3NA 3F22A 3DPTA 1S7AA 5KG1A 4J0MA 5IYCJ 1OFCX 4YIIA 2BXYA 2PMZA 3PIOF 3WTXC 4M3FA 2EQRA 2N8GA 4EJUA 1ZHSA 4FU0A 1T3NA 1SD4A 2K5CA 3KALA 3V8LA 4XLCA 3RPQA 2IAIA 3Q3SA 2JA5A 1PJRA 1RNLA 1AHDP 3LMMA 3V42A 2UXCH 4NHJA 2DA5A 1YHQI 3WNZA 3F8BA 1XTAA 2V9KA 4B48A 1J2XA 2IA0A 4D9JA 2MCTA 3OR2C 1MNEA 2DWCA 4PDBA 5KT5A 2M0CA 1JJ6C 5BQTA 1OCOH 1FSHA 4NUBA 4BBSG 4JYAH 2VJ4A 4DIQA 1KU9A 2E35A 5CPRB 1ON2A 2W7PA 3OUUA 3HRTA 1JXLA 1VQLI 3V4ZA 2XCPA 3BP8A 4GGGA 2QCOA 2RF4A 4A3JJ 1YW9A 3OOUA 1AKHA 3TIIA 2FRHA 5DGBA 2W9AA 2ME6A 2QBYB 3M9OB 4ED3A 3VPDA 3WTWC 2H27A 3ONQA 5DLFA 1PP7U 1AOYA 2R93A 3PJRA 3J81Z 5E3OA 5KVRA 3Q9VA 4ZYAA 3RAXA 2ZXWH 5F6FA 3HOVJ 4KISA 2V59A 3WO1A 4P9FA 2QENA 4A3EJ 2R8IA 1T08B 4QW9A 3C0FB 4YAKB 1O75A 3GW2A 4QIWE 2FOKA 1OQYA 2QBYA 1BI0A 2WYOA 1MH4A 5BS6A 3AG3H 1WJAA 2BW3B 3F8NA 1I6HJ 5DD4A 4CCNA 2HS5A 3DBLB 4U0WA 4A3FJ 2OTJI 5IT9W 1SCUB 2HFHA 5IYZF 2HTSA 1G2HA 1XSVA 1MKMA 3MZ8A 3R0AA 1OR7C 5JI6A 4YR2A 1LVAA 3Q0WA 2BEOA 1DDNA 1WR2A 3V7RA 3PO3J 3TMOA 1BC7C 3OR1C 2VPRA 1NK3P 1HLVA 5FRMA 2HJWA 3NQOA 4QPOA 3LP8A 1VNDA 1DP7P 4YAJB 4JV2A 3E5XA 3K4KA 4BY7G 1LJ9A 5C4XJ 1HW1A 1V55H 3OHBA 3VYRB 4FASD 2XKOA 3GFJA 2X0SA 4BJ6C 3M9MB 3WHCA 5FD5A 4X1EA 3O2PE 4HX4A 3FKIA 2ZXHA 1R9TJ 2YRWA 2NXNB 4OWRB 5EYRA 4E4HA 5KFMA 2M4GA 3GTLJ 4RZQA 1USSA 4CYCA 2CFXA 3BR1A 2R5YA 2L02A 3IRQA 3GX4X 3BT9A 2GXGA 2HQ5A 3K1PA 4O3SA 2VQFH 1P4XA 1V54H 1TLHB 4NXNH 2OA4A 4A0YA 1GHCA 3GTMA 5IWAH 2IGKA 5JLXA 4L0ZB 3BTJA 3TQ1A 1Y1WG 5FKOA 1MBGA 3PNTA 5C4JJ 5JFRA 2R3SA 3GTJJ 3ZMTA 4IRKA 1MBEA 3OYEA 3D1NI 1JUPA 3PNYA 2C28A 4FBUA 3ASOH 1R58A 3ISPA 1NK2P 3SZGA 2ZJQF 2X0LA 3G2BA 3OHAA 3IAS2 3DFGA 1MNMC 3HRSA 5CAEB 3G71I 2W6QA 3C1DA 4P1WA 2GPWA 4GYIA 3BG3A 4LF6H 2R7DA 1FVIA 2Y0MA 4HZFA 2L9NA 3OYLA 3SDGA 1P4AA 2K86A 3RSNA 1ETVA 5L3CA 2D5VA 2FF4A 1ETQA 3NARA 1UG2A 3KETA 4IRHA 4XSZF 2Y9ZA 5C4XG 4L9TA 2HU9A 1IRFA 2PJRA 4O3QA 1J0RA 3L2UA 4X6AJ 1AN7A 5KG4A 3EPGA 1P7JA 3MQ0A 3GIMA 3LSIA 3QAHA 1LFBA 2PBIA 4ZTJA 3FHNA 3GZ5A 4GO1A 4AYBN 5IP7G 2J6UA 2DFHA 3CDIA 1ZG5A 5BMZA 2F48A 1A04A 1HF0A 4BACA 1GLVA 2E5ZA 1LDKB 1U0JA 2EIJH 4LLNA 1XCBA 3F72A 2KDZA 1VQMI 1FYMA 5M5YJ 2R8JA 3PM1A 1IUFA 4YEJA 3OYMA 3CESA 2HHHH 3DTIA 4BXXG 3TO9A 2Y75A 5EG0B 1K7AA 2GOMA 2DMUA 2P6SA 4QIWA 3D0SA 2KP6A 3PL8A 5AIPA 2M05A 3N41B 3FM3A 1IUYA 4YBZB 2Z2SB 5LEKA 1LE8B 1W5CC 4E70A 2CG4A 3BJYA 5KFPA 4KHPH 5GP9A 2YL2A 4ECZA 4Y7NJ 2DO7A 1BR2A 3BJ6A 4YFXF 2JA6J 1JHHA 2K40A 1MBKA 5JVDF 3M8EA 4ED7A 2WY7Q 1DU6A 1VF9A 3E1SA 3LA2A 3K4MA 4X0GA 2E60A 3M1CA 3FMRA 2K3PA 3H3ZA 2EK5A 3ZMZA 5FJ8J 3QODA 1YIJI 4GDFA 3RBEA 4F55A 3H40A 1HKSA 4ZHQF 3Q0UA 1D0XA 2UU9H 3F8CA 3BR0A 3BPXA 2EA4A 4LOCA 3L2RA 4M3BA 2OF7A 1T39A 2EJRA 4IRIA 1HW2A 2R87A 4X65H 1Y8QB 2DMNA 4G6DA 1XDNA 2R7WA 3KEQA 3ZP5A 2Z16A 1GVDA 1JKPC 4LIUA 4BUPA 3OYNA 4I0BA 5HDGA 2C00A 1TWGJ 3KP6A 4KJZA 1R1TA 4ENKA 1JT6A 3LQQA 1DV1A 3ETJA 3J81K 3RV4A 1WCMG 4IRCA 4JI8H 3HKZE 2BZTA 2JSPA 1EV7A 2BBYA 3L00A 5HVQC 1Z21A 5D5WB 1WQ2A 4ECYA 2DPIA 1XDSA 3BR3A 3M1EA 2YCHA 1FBSA 3WODF 4R7RA 5M5WJ 1FNNA 3LSMA 2ZMEA 1M0WA 4XKWA 3WGGA 3QYEA 1FSEA 3FK7A 3H0GJ 4U7BA 5CVIA 3K4NA 1R23A 1GSOA 2IT0A 3K10A 1XB4A 1H8AC 4EBEA 1DGWY 4RGUA 3W2WA 4X64H 3M8JA 5GPAA 3ZMUA 2IMWP 5LRSA 4AU7A 1X2MA 2DLLA 1OCRH 4FTHA 2JQ7A 4Y3OA 3F21A 2NU8B 4YHHH 1DGSA 2RNJA 4J9LA 4O3MA 3GBGA 3GFMA 2VUMA 2IW5A 2ZSIB 3COAC 3MKWB 3JSOA 2ZDQA 4DV4H 1S7OA 4NDLA 3L4JA 4BHBA 5CA0F 3JSNA 4L18B 1PUFB 3OYKA 3AL0C 3RB6A 5LEJA 1M7JA 3MVPA 2E7XA 4ABZA 3K1NA 3AYHB 3OSFA 2QK4A 5DM6F 2IGOA 5KFKA 3T5HA 2DAOA 1Z7LA 2XGEA 1OCCH 3E7LA 2KDOA 1ZGWA 2BW3A 5GTHC 1Z3XA 1KONA 4K2EA 1ZELA 4GCVA 3K5IA 1G8XA 3K4CA 3E5QA 2IA1A 3GO5A 5JHUA 2CUFA 1T8IA 3DWLE 3QOEA 4I98B 4HSTA 4I4TF 2UUAH 3C2GA 3FDYA 4TUYF 5LP6F 5LD2C 1VI0A 1FY7A 1B72B 2Q2EB 2XAJA 5F64A 3TBIA 1WH2A 1OYIA 1EZ1A 1J9IA 4IAJA 1USTA 4WBNF 4ESBA 4G12A 3DPLC 3ABLH 4I76A 1BOBA 4L1KA 1S0NA 3TINA 4MA0A 2PEXA 3GTQJ 3OS2A 3FDSA 5BR8H 3K4LA 2X51A 3LSJA 4QJFA 2I8DA 4O2BF 2LBFA 3OS0A 4UUVA 5DD8A 3H4DA 2R0QC 3H0DA 2CRGA 2DTRA 4A3LJ 3BOQA 3IV5A 2BOLA 4UB8C 2HXIA 9ANTA 1N25A 4C5AA 3N97A 2R7UA 5D5VB 4BY1J 3HDDA 1BBYA 2NS8A 3CD6I 1WWXA 2RAEA 1B59A 1I3AA 2HR3A 2E2IJ 4IQJA 3G4SI 4HQ6A 3QZ8A 5D8DA 1R9TA 2I5UA 4PSXA 3HKZN 1W5TA 3CCYA 2YS7A 1EHIA 5KFCA 3RQ4A 4OIRF 2ZJRF 1REPC 3H36A 1NH3A 3AG4H 4XLEA 5FFXA 5EG0A 2LBFB 1WJCA 1XC5A 2DCEA 2XAHA 4S0HB 3BC8A 2O61A 1H88C 2R86A 3JRAA 3H4BA 5H6QA 1LE8A 3H20A 4DL4A 1TWHA 5ILVA 1SFXA 2IJLA 2MC4A 4N9IA 4HX7A 2L7ZA 3L1PA 3V4SA 3PW5A 2K9MA 2W57A 4OAZA 1Y0UA 2FU4A 2PFBA 3H9JA 2PJPA 4KMFA 4YFNF 4DBQA 3RKQA 2E19A 4DV3H 3WTYC 5C44J 2LR8A 3CJQB 2Y0SN 5EDWA 5IOYA 1IC8A 3FX3A 5E8IA 1WFXA 5E79C 1OCTC 1F9NA 1R49A 1UC8A 2QKMB 5GAHJ 1VQ7I 3UQ8A 4RGSA 4U87A 5BNGA 1YITI 2KIMA 3A03A 4F92B 4E7HA 1MH3A 5F9NA 4ENMA 2R7TA 1X19A 2ZC2A 3QPSA 4A0XA 1MMDA 4IQ4A 3MMYB 4MGRA 1SC7A 1L3LA 1CQJB 2JEIA 3G73A 3GIKA 4J9OA 4G7OF 3CMEI 2GPSA 3QPTA 4UV9A 2PN1A 2R93G 3OL3A 3CLOA 1OYWA 4LB6B 5GTIC 2FNPA 5J1RA 4BE0A 1LFPA 2R7KA 3LNQA 3H0GA 1HSJA 2DJNA 5IT3A 1Y8RB 4R79A 3LL7A 5KFAA 3KZZA 5FKKA 4AD9A 4M3EA 2J9GA 2FK2A 3HB9A 5AONA 3W6VA 2JN6A 1XPXA 3K4JA 2H6BA 4OMZA 2PI0A 2AXTC 4BJTA 3RV3A 3GTLA 2O9LA 2LF7A 3C18A 3U9SA 3M9NB 5KAIC 2K27A 1QVTA 1FMWA 2KFDA 3I58A 2W24A 5D8LB 2UUBH 1XNQH 4AIKA 2WB1A 4YP3A 3OYAA 3T5JA 2UV1A 5CVRA 1W7PD 5LGTA 1M0TA 2NOJB 2VB6A 3QRFF 2UVVA 4YELA 2UZKA 1RJPA 2CV2A 4IHVA 1S97A 2VJ5A 4M9UA 1YIOA 3GTPJ 3OOPA 1V5FA 3KP2A 3S16J 1P2FA 1JUSA 4JX5A 1TZLA 3S32A 4CCMA 4KIBA 1PUFA 4M71A 1ETOA 4UVBA 1NG7A 5LBQA 2R5ZA 5LMUH 1XMXA 2DA2A 3GIJA 2F5CA 3HOWJ 2G7UA 4FQGA 4IHSA 2M7BA 4DYCA 5KHDA 3E6BA 3W3CA 4XLHA 1O3SA 4JI5H 4UCRA 4QTRA 1BIAA 2ZMEC 2CMPA 4HDUA 2Q2UA 2B63J 3RGXA 4BDZA 5DCFA 4ZZLA 2X1CA 3FXOA 4Y33A 3LAJA 1TTYA 4XN3A 5E3NA 2YYAA 2HDDA 4AWXB 4CYCB 3A0HC 3FMAA 2DI3A 1B72A 2ZBKA 2V4QA 3N40P 4IKFA 2DIKA 2IP2A 3HOXG 2R7RA 3I53A 3FZVA 5KFTA 3WTZA 2ZXIA 1KJIA 1FP1D 3IH2A 5EZYF 2WC2A 2JK3A 2VE8A 3VYUB 3HOXJ 3ZR8X 2QSGX 5KFJA 2PQ8A 4A3JG 4JI1H 4IEJA 2FPPB 4HEA2 1ZKGA 3L7WA 4UB6C 2D45A 1HNZH 2EZLA 2XHKA 5F1RA 2H09A 4JV0A 2GLOA 5D8KB 4HNVA 2K4JA 1IXCA 5KT6A 3IWZA 3PW7A 5FKLA 5J40A 3N8DA 3P9CA 2HI3A 4AM3A 2ZXJA 3MCZA 2OV7A 2P4WA 5A2QK 2B63G 3TL4X 4LF7H 1MIJA 3FWEA 2W48A 2L3DA 3F3XA 3OYJA 2XCLA 4FETA 2F4MB 3LSTA 3RI4A 1G3WA 4M3GA 4RAFA 4KYWA 2CQYA 4ZI7F 4DR1H 4ENNA 3NRVA 2H8WA 1Y0NA 2LD5A 1WJDA 2F5FA 4EV0A 2X6OA 4HPQA 1G3TA 2KHMA 4RM2A 1FTZA 1HCRA 3DEUA 1YE9A 3B6AA 5DV5A 3EPIA 2DLNA 4RZRA 1B4AA 1OCZH 1JIHA 5JHFA 2CUEA 4EG0A 5KFBA 4RB0A 2V4JC 4CXFA 3U1KA 1DP3A 1ETWA 2CQXA 3REOA 3OIOA 5ILUA 3SXYA 4M6YA 2NOGA 2QSFX 1FTTA 2CGPA 5J8FA 5DLGA 4D5CA 4QWCA 5HNHA 2QSHX 1I5ZA 3AKZA 3RTRA 2BV6A 4HLYA 4ED0A 1TT0A 2NVYJ 4AUXA 1T2KA 4JV1A 1U8BA 1I6UA 4XSXF 2WTEA 1W1WE 1TNTA 4O3PA 3S3MA 4Q44A 2O0YA 2K9LA 3IUOA 5FKNA 3ZOBA 1E4EB 4Q4ZF 4TV8F 5T14A 3K6GA 1V5EA 1YW8A 3BDDA 1XSXA 1S5LC 2NRAC 1FEXA 1B6SA 5KFSA 3GTKA 5C1OA 4JK1X 2NVYA 2LLKA 4W97A 4XL9A 2NYXA 3E3VA 2DTZA 3C2HA 2XRLA 5JVGF 2STTA 4EBCA 3PW0A 1X9NA 1I39A 3E97A 4A0ZA 4I6ZA 2AGPA 1VBHA 4BJ5C 5KG5A 4RA2A 2XGQA 4RMNA 1R36A 1N77A 3V6KA 1WSUA 1S8NA 2CUJA 3R23A 2YR2A 4G94A 3ZGKA 3RQIA 2JA2A 2EFWA 4J9PA 3BQ0A 4N0BA 1N78A 3G6EI 2RREA 3FXKA 2XGXA 1R1VA 4IHTA 3JSPA 4Y17A 3U1DA 1OKRA 1IZ1A 1R22A 3VPBA 3G6YA 3DEEA 2EIMH 4A3BG 4PJLA 1HXDA 4IHWA 3LSKA 1E3PA 3N05A 2GLTA 1E4GT 2R7XA 1FYKA 4IZOA 3HG9A 3ECOA 2WV1A 2IP4A 3M9AA 2Y9YA 2VODA 4R1HA 1IN6A 1L2ZA 5FB2A 2R93J 2VUMJ 3VMMA 5BPFA 4S05A 3KX2A 2OJED 1IJWC 3PQKA 1JKOC 4WK8F 1HKTA 4DL3A 4TQRA 5FLMJ 5KFOA 4XRSG 1P7IA 1W0UA 3T5XA 3G1MA 3BQYA 4UNOA 1TW3A 3BG5A 1IV6A 3H3UA 4PFOA 3SE7A 4DOZA 2IS4A 1K61A 2KRFA 4XOTA 3RJ0A 3F8MA 1WSCA 4APMA 1XN7A 4BYYA 3HRUA 5AIQA 4MFEA 4XYMB 3FXJA 3RKWA 5JQWA 2JT1A 2A6TA 3B73A 5C8YF 3U9GA 5DQIA 1K83J 4ECQA 4AIDA 3PIPF 3H3VH 4A93G 2YZNA 2W9BA 3HOZJ 2JMWA 5H2FC 4GKKH 5J6XA 4WCGA 3ASNH 1LQ1A 4A2BA 3N4MA 1NG6A 4GXOA 2FD5A 3FXRA 2WWYA 4LD5A 1PX2A 1MZBA 2GA2A 3QP5A 3QZ7A 4HV6A 3HEFA 4HX8A 4I0AA 5CVUA 2FJ1A 2NAZA 3W6JB 3TO6A 1B6RA 1OWTA 1RESA 3M3YJ 2HZDA 1SMYF 4ZDLA 3S2DJ 1SEIA 4B3AA 4R8UB 3J7AK 5TJJA 3BY6A 4OU0A 2Q1ZB 2HWVA 5KNLA 4RNNA 2BXZA 1KU3A 1FC3A 2W00A 4JYKA 1VZ0A 1FKAH 5KFHA 4A3LG 4DV1H 1UHMA 4ZYHA 1GV2A 3QQAA 1ZR2A 2W6MA 1POGA 1Y6IA 3WU1B 2E1MC 2FOWA 1CQTA 5DTDA 2W6PA 5DEQA 2R85A 3TO7A 2QLZA 2LVSA 2R84A 1QHHD 1X1BA 5A2QZ 3X2QH 2Y0SA 5FLXK 3MR3A 2IS6A 2M5WA 2LDUA 1EJ9A 3KHHA 2DFFA 1F36A 3O8GA 5D5UB 1RK6A 1TWCJ 2J6SA 1WGXA 3KHLA 3Q8PB 1O57A 1R4NB 4XLAA 3WTUC 2VE9A 3CQZA 2M3AA 4F4XA 4ECXA 1G59A 4PGGA 1E4FT 1XGMA 3BR2A 2VN2A 2M30A 2YSRA 4II2A 3VDXA 2VOBA 3CJTB 3GIIA 5KFIA 3CMAI 1LKXA 5KG7A 2RV8A 3ZQLA 1ON1A 3FXMA 2L9SA 4EGJA 1SFOJ 1A9XA 2XSJC 1YYVA 4D7NA 4EQQA 5EWGA 2VI6A 1IN5A 2MBFA 2R5YB 4QWAA 2RDJA 1Y1WA 3RYRA 1JT0A 1F4KA 4DR2H 5L3BA 1T0FA 4BU2A 2E5LH 1H9GA 2KIQA 4KA4A 3LSGA 2O03A 4DGWB 3HPHA 4BQQA 4IJAA 1JTYA 4BXFA 5J4YA 1X1AA 4MO7A 3KTMA 3S3OA 2PVPA 3S15J 2OQRA 3S1NJ 2JEFA 2A61A 2AXLA 1ITYA 4ME6A 1WPKA 3OYGA 2VPSA 1QZZA 1TQIA 3OYHA 3N43B 1V4YA 5ILSA 3E5UA 1EH8A 1E17A 1J7KA 3QFFA 2GQQA 1RUOA 5CB4F 1O4XA 2E5NA 2NS0A 1A31A 1TWFJ 5FGMA 3BQ1A 3GTJA 4O4HF 4C30A 1ETYA 1XMAA 2RNGA 2W4SA 3DXJF 4LFUA 4DYQA 1FT9A 5TISC 4IX7A 1RJRA 2XCAA 3EETA 3CVZA 2ETHA 5E1XA 4S04A 1YX3A 2UXNA 2WAQE 4XIDA 1LEBA 4A5NA 2MYSA 3DPUA 4A3IJ 1N36H 1OPCA 4W1UA 2KKOA 5L3DA 3JRFA 2VLAA 4RUAA 3PO2J 4IR1A 1DQUA 2Y30A 1U9OA 2RN7A 1WCMJ 1RK5A 3GFLA 5A2QW 5CQEA 1AA7A 4G7ZF 1DV2A 2XD4A 4A3FG 4KT6A 2D2WA 1E3OC 2XC9A 2O5RA 4A3GJ 3U2RA 1UHSA 4O6JA 1ULZA 5LL6b 3ERED 5JUMA 2NS7A 3KLNA 2AGQA 1D8KA 2QGUA 2F4IA 3VWBA 2PLYA 3T1HH 1ZTRA 4BQNA 2ZJPF 1KQ9A 2ESHA 4C3HJ 1YS6A 2G9WA 2PMZN 2C2EA 1TL8A 3ZRGA 1W93A 3DKYA 1N48A 2FMYA 4MIMA 3HOVG 5HDNA 1XMOH 2L54A 5L1LA 2QM3A 4ZYEA 5DG7A 2XPVA 1QA6A 3HOZG 1QZEA 2CYYA 2X1DA 2M8GX 3UNGC 2OCEA 3ZCOA 1IBMH 2E1MB 2QA4I 4DNCA 4MHGA 2C35B 1TQMA 1BI3A 3R6SA 1MSEC 1TNSA 3MZHA 2E2JJ 2K3FA 4YG2F 2W9BB 5JVLA 3HOSA 4JX6A 4LH7A 2WTFA 1PP8F 3DV8A 3ZQ7A 2P7CB 3GTOA 2YX7A 2IPQX 2BHYA 2E34A 3IHUA 1D0ZA 1UMQA 4HF0A 1JTXA 4NC6A 4XONA 2JA8J 1JXSA 1VS0A 4A3DG 2W85A 4G7HF 5KG3A 1VQKI 4A3KJ 4EGQA 2YU9A 5GPCA 2Z99A 2ISYA 3H9GA 2EZKA 1BI1A 3DQVC 3WTVC 1KQ0A 2J5PA 2L4MA 2FUG2 1N34H 2WAQA 3QOPA 2X9DA 2JA5G 2VASA 1DUXC 1N56A 2PG4A 2LH9A 5K5OA 2FSWA 3LOCA 2DPDA 2NU7B 4A3CG 4CCOA 4KMUX 1DU0A 4BEHA 2HVSA 3BPVA 2ZKZA 4OAYA 2W25A 2A3SA 3MZYA 2VC1A 3PNVA 1APLC 4CGZA 3U9TA 4YJ3F 2V7FA 4CZCA 3EPZA 2GOXB 3GIQA 1IXSB 5HV6A 1S0OA 3Q8QB 2I80A 2P81A 3T1BA 1S0MA 2FNAA 3P9KA 2FPGB 2H1KA 2L5QA 4I09A 4F52A 4G3IA 2ELJA 2AS5F 3GV8B 2MG4A 3JRIA 3EYIA 4MA5A 3PUBA 2HPIA 2O7OA 2RGVA 3AL0B 1B6AA 3FBIB 3SYTA 5TRDA 1ZAOA 3MAJA 2YZGA 4DLKA 1WI3A 4QWDA 4BQOA 1FP2A 4JBAA 2C22A 5EZGA 4CSWA 4TQSA 3P9IA 4I7HA 2R92G 4MLOA 2E2HA 2KIFA 2MC3A 1RI7A 2R7MA 1EKEA 2KPMA 4XKVA 2CW7A 2V6CA 2IBDA 2W8KA 3TQTA 3VYTB 1I1GA 2B7EA 4O3RA 1IDZA 1RKWA 3TQNA 1HBXG 1EH7A 1D1CA 2BE5F 2UXBH 1ODDA 2V4RA 4GKJH 4Q0YA 2IA2A 1WHUA 1YO5C 3AFHA 3IH4A 3SHFA 5ERIA 1ZRDA 6PAXA 1LDJA 1BNCA 3FXUA 1X4PA 1ZN2A 2HTJA 2YX4A 5IOZA 4YRVA 3KE2A 1ETXA 3HOTA 3Q0VA 5JH7F 5K5RA 2GIVA 2W7OA 4WWCA 1JX4A 3TW7A 2VBXA 1K6YA 4HAMA 3C2BA 4N4NB 5DGAA 2TCTA 5IP6A 3Q5FA 3KLOA 4BAYA 1EUDB 3ZQQA 2NNYA 2KL4A 1LB2A 2P5VA 2VT2A 2YU3A 4U88A 1IG7A 1A0IA 4UCOA 1JKQC 3WE3A 4IOAF 1ULYA 2JTVA 2YS9A 3GZ6A 4PGHA 4JOMA 3CCLI 2MH2A 1T33A 3ABKH 4QSHA 2DFEA 4XX0B 4LF4H 1OCPA 3GLLA 3MWDA 2PMHA 3ZXSA 4F4ZA 3JREA 4JUZA 1Y39A 2QYZA 1MNDA 2RVCA 5DM7F 3I56I 2V5AA 5C3EG 4YIFA 3CZ6A 1GO3E 2QF7A 2ESNA 5D6EA 2R7LA 1SYXB 3GEZA 3DU5A 1G4DA 1XMQH 5CVJA 3EUKL 3S14J 2NNNA 3J80Z 5K7HA 1PDNC 2MLKA 3I59A 4KNYA 2HGSA 2R8GA 5EGOB 1K6OA 2WV0A 3TEDA 2AHQA 5CLSA 1MSFC 2CZGA 1R5GA 5I47A 3BQZA 3WGHA 4CICA 3QU6A 1D0YA 1CF7A 1B04A 4JI0H 3OUZA 2KRHA 1XX5A 4IOCF 2O8XA 4LJZF 5F27A 3HHGA 1YRNB 2XSDC 1XDUA 2CS3A 2O3FA 2UUZA 4YY3H 2VC0A 2A05A 3V8KA 4MTEA 2DXIA 5HOOA 3SZPA 4ZDOA 5GAEJ 5KFEA 4DL7A 3K2ZA 3KYCB 2YW2A 4UVCA 4YQWA 1TC3C 3KHRA 3N42B 2XPUA 4M9SA 5FLVA 3H92A 1ENHA 3CO6C 1KBLA 3W2AA 4RB3C 3PR4A 2XPWA 1IN7A 1VQ9I 1Z67A 5B5EC 4MTDA 2MLGA 2PX9A 2XROA 4HDVA 5DDGA 4V19K 1Z2NX 4E7SA 3FHZA 3ZMSA 5EDNA 5KCMA 1S68A 3PZPA 3HOWG 2EPFA 3K2AA 1MJAA 2Z1DA 1O3RA 1XGNA 2ZB9A 3R61A 4CCLA 1BL0A 3I4NG 1QQIA 1HDDC 4PFPA 5IP9G 4FM9A 5J8CA 3PW2A 1ETKA 3LFUA 4Z2YA 2ZNZA 5D1OA 5BMVF 3PR5B 1VQNI 2MD5A 3A0BC 5EEAA 5IYDJ 5E1WA 3TP0A 5F0HA 2OCCH 3DU6A 4QLCU 4XM3A 3RIRA 2BQRA 5KK1A 2V9WA 5B1AH 1E3HA 1X1DA 3HC7A 4F7ZA 3DBHB 2OU2A 3CJNA 3OS1A 3OYFA 5FRNA 3R5XA 5KFFA 1R00A 2DT5A 5CVVA 4YIRX 5KG2A 4F93B 1IDYA 2DBBA 4E4TA 1MMAA 1QO0D 2H94A 4X66H 5J3LA 1YX5A 1S3JA 2A6HF 3G1LA 1YOVB 4LLLA 3KP3A 1PYVA 1R6RA 3A4CA 4LK1F 4B3MH 1R4MB 2M34A 2E36A 3TDZC 3MD2A 4NB5A 1ZK8A 3SFIA 3ECHA 3KZYA 4EJWA 4EVIA 4EM0B 3J7YJ 4EFEA 4A3CJ 1KYZA 3Q1KA 1ZHQA 2HKOA 3KP4A 3MFIA 4JX4A 4M3DA 3BG6A 1Q1HA 3M8FA 2MH9A 1U8RA 2ZMEB 2L4AA 4Q47A 2VXZA 5KX5F 4B3TH 2HQRA 1XMKA 1KGSA 4FBTA 3KEYA 3OSNA 2R5ZB 4A3KG 1LDDA 3L2WA 2RGRA 3IAM2 1KU2A 3FM5A 2VXDA 3CF2A 4ZYDA 4DV7H 4XKBA 4KN4X 4Y15A 5F1JA 2W71A 4MV4A 5K2MA 4AYBE 4XYLB 2ZDGA 1BR1A 1D1AA 2QVOA 1LVKA 4KFCA 1AU7A 4RS8A 2DT7B 1JDEA 4U6PA 4A3EG 1YLFA 3BQ2A 4WD3A 4A69C 2LKSA 3HTUA 3ZQHA 2XB5A 3JRGA 3GTPA 4XICA 2L7KA 4Q45A 4R8HA 1EH6A 1G3YA 3QU3A 2LY2A 3T8TA 2M87A 2DQLA 5CQGA 1QZYA 5EJCA 4AVPA 2JVGA 2Y31A 2BVLA 3G6XA 3H3VK 3S1MJ 4O4LF 2DYSH 4L5EA 2VR1A 4LMYA 5HLTA 5EEHA 5CKTA 4ZDPA 3K3VA 1BJAA 3AG1H 4NC8A 2ASLA 2QZ8A 3ELKA 2ALZA 1D3YA 3UR3C 2LTPA 4CH7A 1YI2I 3I5UA 3MN2A 1K78B 4IWYA 1VTNC 3LMLA 4MFDA 2HGCA 5FD6A 4ZOLF 3EYYA 4UFZA 1LFUP 2HXOA 5HS8A 4CC6A 1FZPB 2ZNYA 5HS9A 4Q5SF 2VQHA 4ETSA 1KQ8A 4J00A 4XBFA 1P8LA 4HYKA 5D1PA 1RPWA 3IH3A 4GRIA 1ZARA 3OY9A 1FYLA 2FMLA 2VUMG 5F9LA 3I12A 1UAAA 2ID6A 3L9FA 4WX9A 5IP7J 2BY0A 2XAQA 5IPAA 5KFDA 1Y1VG 2R4GA 4IHYA 2CO5A 3HM5A 2VKVA 3CP8A 1K78A 4HW0A 2W9CB 3HKZA 4A2UA 1CS0A 2K85A 4B3SH 4LG0B 3SEZA 5LHHA 2HVRA 1RR7A 3EDPA 1YRNA 2FPIB 4ON0A 1MJ9A 2DFIA 3JZIA 4LF8H 4IZZA 2W7NA 3I0TA 4C2MJ 2JA7G 1CGPA 3N44B 1ACIA 1V5GA 2ELHA 3CDHA 3I9V2 3KPHA 4AC0A 3VPCA 1VQ6I 3I54A 5FFZA 3DF8A 4L0YB 3ABMH 1GUUA 3I4PA 2FLLA 2WAQN 2AQEA 1QVUA 1FMVA 1X1CA 2EIKH 4B47A 2DYRH 2ME0A 2FMAA 5E18F 1RUNA 5KFNA 3L2QA 3JRBA 4N4OB 4LG0A 1S03G 3KP7A 2O8KA 2FLNA 1IXRC 2MA3A 5HDKA 1D5VA 2HQNA 3BZKA 3PSFA 1Z1DA 1X3WB 4ITVA 2P7VB 4Y52J 4B3RH 3KAKA 2VQLA 3OL4A 2DMPA 2VOOA 2BR0A 5HS7A 2L9RA 1IRGA 4LF9H 2Z33A 3IN5A 3L2CA 3KAJA 3PW4A 4M73A 2NVTJ 2EB7A 2W70A 1YW7A 1AWCA 3H1CA 4EJTA 5GADJ 4QWEA 3GTQA 1XGOA 4LITA 3VOEA 2IS1A 2IVMA 1N75A 3LA3A 3CCJI 2E71A 1ZRFA 1KJ9A 3JAMK 1RIOH 1ZH5A 4QWQA 1IAWA 5J47A 2XF6A 4MV6A 3NEUA 1OISA 2LYCA 3J7ZI 2LMDA 4I50F 5KFUA 3R5FA 1TT5B 3F9KA 5FLXW 4XRFA 2LP0A 4U0YA 1BI2A 1I3QJ 1GXQA 4LK0F 1O7LA 1WJFA 2COMA 4BEHB 5CJ9A 2JZYA 1U9NA 2COBA 2DOAA 3ABTA 3HZJA 5IT9K 2NVXJ 4XOPA 3GMEA 3GIDA 1TW2A 4ECVA 1PVEA 1MBJA 3A01B 5E1ZB 1FWZA 5E3MA 1HC8A 1I50J 3CC2I 2AQ4A 2XGPA 4JI3H 1HSTA 1R71A 4RGXA 1ZQ3P 2JA8G 5KKNB 4K0KH 4JI4H 4C5BA 1FIPA 1D1BA 1FJLA 1MW7A 4B09A 3CMYA 1CE8A 4BY1G 4HOBA 4B44A 3CTAA 5KG6A 1G3SA 2WA0A 4OOIA 2HVQA 1W0TA 1ZREA 5DG8A 3HHHA 1W5SA 4OMYA 2GBYA 5FJ8G 1JJ8C 2XASA 4O3OA 2VQDA 2MGQA 4A2AA 4KDPA 1Y1VA 2WBMA 4UCVA 4MV3A 4J9SA 5JR3A 2C2DA 3BLYA 5DUIA 2R7QA 4DR4H 1PK8A 1ZHFA 4CCKA 3V7CA 2E2HJ 2R7ZG 3G6VA 2HYFA 4XLFA 4XMYA 1JGGA 3GXOA 2XGDA 1JGSA 3CC7I 3R5HA 1Y56A 2M2EA 4Y8VB 4AYBA 4BBSJ 2JA7A 4BBRJ 2XF5A 3CCQI 2IGMA 1UZCA 4NNJA 4ED6A 4F4YA 1R1UA 1JI8A 2L01A 5FLMG 3LQRA 3DKWA 5B3SH 5HLGA 5IYBJ 2LKXA 3VSLA 1XSDA 4IHXA 2VUGA 5K1YA 4PJMA 2OUMA 3MR5A 3KHGA 4DR3H 3AG2H 3EUHC 2K9QA 3GTOJ 4R8UA 5KT7A 4M72A 2Z3YA 3DCFA 3GQCA 1IRZA 4WXCA 4XN0A 5LGNA 1KYWA 3NAUA 4PJNA 2GXAA 4TV7A 2Y69H 4P9UA 1I6XA 4A6DA 1ZYRF 1H89C 2OLSA 1AUXA 2BY3A 2XVCA 2DOEA 2X48A 1P9QC 3PFYA 3V8JA 4EGYA 1EUCB 3K70D 4BL0B 3LSHA 1RKTA 2Y48A 2CW0F 1HOMA 1UJ8A 3VFZA 1W7PA 2I8CA 3ORRA 4DL5A 4MAMA 1AKHB 5H6RA 4IHJF 1Z91A 4EEYA 4EYHB 3S1QJ 1C3OA 3J80W 2DOFA 1SVOA 3HL2A 3TIGA 5HLHA 4F4WA 4A3MG 4EFBA 3JW4A 4JP0A 5BOXA 2R92A 1I3QA 2ATLA 2K9NA 2KSWA 3ESWB 1MMGA 3H5RA 1K4TA 3IL2A 1SEUA 5KT4A 4O5VA 4XZ3B 4FE7A 3RB0A 4V2GA 2JJ7A 2VQCA 2CQNA 4XK4A 3TKYA 3ZQGA 3D5LA 5KFLA 2MD0A 4BH9A 4DR6H 2HDCA 5LHIA 4PUSA 2ZM6H 4DZJA 3IP4B 5LHGA 2M4KA 2M8EA 3VB2A 4MEXF 3HYIA 3FMQA 5E8GA 2LFBA 2OPTA 5LA6F 1IN4A 1EA3A 1DGRM 1X1PA 2QKLB 4PK4A 5FKMA 3UKGA 4AQYH 3GTGA 2JA7J 3E5NA 4C2MA 3F6VA 2HYJA 3TDUC 1Z6TA 3RZOJ 5L3FA 3H9QA 2W9CA 2HOSA 1YG2A 4M74A 5K5QA 1JHFA 3BTLA 3LWFA 1FOYA 4Q48A 4F3QA 3RKYA 4ED2A 2DA3A 3PFIA 4J01A 1Y1VJ 1YS7A 5F0FA 2LNBA 2GZWA 3JRCA 1E2XA 1S9HA 3WO0A 2CV0A 3I3LA 4E7ZA 2UWMA 3CO7C 5KT3A 3JAMZ 1E4EA 4PSWA 2ID3A 2ZFWA 5D1OB 3IKTA 2EFOA 4RB2C 2VBYA 2DZDA 4A6EA 1OLTA 2G7HA 1A5JA 1Z6RA 2F5EA 1RETA 5DUKA 5L3GA 4E6KG 1WI9A 3O6BB 2O6GE 1DIKA 1BN5A 2DPUA 4FS1A 1I94H 1IO2A 1CF7B 1IF1A 3T5KA 2ECBA 1B9NA 1LUJB 1Z0XA 4CHUA 2FQ4A 2XIGA 1VQ4I 3IRRA 4MQ9F 5ICFA 3HRMA 1SFEA 2W1OA 1BM9A 4IRGA 4EGZA 1KZHA 5FLXZ 2XV4S 2QQAA 2X6YA 2KLOA 4HG2A 4ZC3A 3S93A 4ESJA 2DPJA 1NHAA 4EYIB 3RDIA 4MV7A 4IO9F 2GA1A 3MFHA 4D1QA 3I4MG 1I7NA 4A93J 3RTXA 1K1SA 4DL2A 1WJ5A 3DP7A 4KIFA 4LSXA 4ECSA 1MBFA 3MKYB 4CZZA 2Y2ZA 1WZ2A 1BGWA 3HPGA 4B3XA 2VPLA 2KRCA 4WXHA 4QW8A 3BROA 1J09A 2WB1N 4MEYF 4EEQA 5JVTA 4HBLA 1FJGH 1UG0A 2KZVA 3SDBA 1SFOA 4HNUA 4CYDA 2CFOA 3K5HA 2X85A 2JEJA 4PJJA 3RFCA 2JSCA 2V9PA 4AIHA 4AIJA 2KJCA 4M6VA 4N9HA 3E6CC 2QUFA 5EOYA 2OC6A 2OWOA 3G1OA 1FPQA 2R7NA 2VKEA 2JVHA 1DPUA 1BIBA 2L9VA 1FOXA 5EZHA 2FK3A 5J1YA 3SQNA 5B66C 4OX9H 4MNUA 4IVNA 4RM3A 2V1DA 1RJQA 2XUBA 1W96A 2R7SA 1Q1VA 2BY2A 2CUZA 4DBRA 1IBLH 2EZHA 2L7MP 2EILH 4D0PA 4M7EA 2K4BA 3DBRB 1SMTA 5J1UA 3K7AJ 4FX0A 2F4OB 2FQ3A 4BHCA 4A3BJ 3RF2A 4H0EA 5DS9A 2M9HA 4EM1A 2OD5A 2XAUA 4FS2A 5LRRA 5BPDA 4O2AF 2OAZA 2EV5A 2BQ3A 1HKQA 2D1HA 3VSKA 4C2TA 4I02A 2V1XA 1A35A 3KYDB 3H35A 1GYFA 1EYZA 2VONA 5DYMA 1Z2OX 2ELKA 4D7MA 2ZSHB 4FX4A 1A6IA 4XRSA 3RCOA 1HNWH 2DJIA 1SAUA 1WJBA 1OJLA 3RPUA 2EV0A 3RUPA 2V1UA 1KJ8A 1QGPA 1MDMA 3CC4I 1H0MA 4E7KA 1Z77A 3MJFA 3E0JB 1S6LA 5IP9J 3S1RJ 4XR6A 3PO3G 1C30A 3AAFA 5EWFA 2UVRA 1TBXA 4ANJA 3DKXA 3FIWA 1GGOA 1S7EA 2JA5J 4LH6A 2FA5A 2E1NA 4XQFA 2EBIA 3CUQB 3HUGA 4HF1A 3FXLA 1TWAJ 1WRJA 2P8TA 4BQAA 4LB5A 4DUYH 1ZG1A 1JDBB 4X62H 4MV1A 3FKIG 4BWSC 1P92A 4RU9A 4DV2H 3J81W 4QWBA 2EV6A 2JRMA 4WXDA 5EEGA 3GV7B 2UUCH 3FF5A 4AVZA 1GSHA 5KFGA 4LFBH 4C2UA 4MV9A 1TP4A 2WB1E 1STZA 2R6FA 3W2VA 2F5DA 2M7AA 4DW6A 2K02A 2Q8KA 3RIZA 2RC4A 3DTEA 2XGCA 2R7ZJ 3PSIA 3RYPA 1SFUA 4JQFA 3WU2C 2P5KA 4L9VA 4HRIA 3BR6A 3HBLA 1KJQA 4G6TB 4HNTA 1MMNA 1HR0H 3PQJA 1V51A 4B1RA 4DJAA 2FE3A 1FBQA 3FK6A 3QWLA 2EINH 2EH3A 2VOPA 4RAYA 2M0MA 2YU9J 3T1YH 5K7ZA 2GWRA 3VODA 3IWFA 4LFCH 4WF2A 2P6TA 1W36C 1J75A 4HYEA 2VA3A 3T8RA 3C7JA 3BJAA 5E3LA 1PUEE 3IKVA 3JTHA 2QYOA 5ICEA 2NU9B 5LFAA 5C3EJ 4YR3A 4EMSA 4P5OA 3ZMVA 4RNOA 4OIPF 3W6KB 2F5VA 2BHZA 4BXXJ 3F8FA 1SVLA 3N6XA 4RGRA 4CO8A 2RDIA 2LC2A 3A1YA 3DF7A 3BJOA 2NUAB 1U5TA 1VFCA 1HNXH 2DN0A 5J4VA 2YPRA 1IRXA 1ONVA 4NXMH 1RZ4A 3TOBA 5D5XB 1YJ9I 2V79A 3ZQCA 4A3IG 3FMSA 4ASNA 1DPRA 2XB0X 1U3EM 2LG4A 2HNHA 2VBZA 3EQLF 5IYCG 2LSOA 1QPIA 3J7AO 2ICWG 1SVMA 2WAEA 4U7DA 3V6JA 3D5RC 2FX0A 3L2VA 1UB9A 2R7FA 3U21A 4IXAA 1Z3YA 3JRDA 4E7LA 1QNTA 4RLQA 3WU0A 5J2UF 3CLQA 4XLPF 3GYHX 4NLGA 2H6CA 4ECWA 2W84A 5DCMB 1K79A 3Q8SB 1FIAA 3ORQA 3K9TA 2L0KA 3HOUJ 3MFKA 5CA1F 2ZFUA 2VA2A 4BKXA 3PUFA 2NVUB 3FISA 4BE1A 2W8LA 3BZCA 5E20A 5L1IA 5LXTF 3LSRA 3ML6A 5IYDG 5KFRA 2MABA 5DG9A 1ZLJA 4FISA 3OYDA 2ISZA 4YR0A 2CJJA 4NQWA 1WH5A 2YUSA 2Y0SE 5L9XA 3E6DA 4EM2A 4G6QA 4KITB 4A3MJ 2PMUA 1GVJA 5BPIA 1FOWA 3VYSB 1LEAA 4LSAA 4L9JA 3HTSB 1KA8A 3GTGJ 3HGGA 3ZN0A 2H8RA 2FBHA 3CDLA
chains in the Genus database with same CATH topology
4HQMA 2IRFG 2XRNA 3O3KA 4B8XA 4PZJA 4DUZH 4UXNA 1YQAA 3M4IA 2A69F 4DR5H 3E6MA 4BXUA 1WKMA 4CC5A 1B9MA 2LKPA 3HSRA 3PN1A 2QQ9A 3CUOA 1Z05A 2K7LA 1U5TC 3ROUA 2GXBA 2OZ6A 4KICA 3J80K 3BA8A 1YFHA 2QQBA 4Y13A 2EWNA 1ZGJA 3MWMA 2M45A 1ZGAA 1F1ZA 4HV5A 1R5HA 1R7JA 2KJBA 2UXXA 3GFIA 4L5JA 2VQEH 2DQRA 2Q2TA 1HQCA 3KP5A 2P5LC 3JSLA 1F5TA 5FO5A 2JRTA 3BAAA 3I71A 3S2WA 1MDMB 3R60A 4OINF 3RKXA 3EUHA 2CSOA 1OYYA 4M9XA 2A5YB 4KN7X 2XAGA 2QWWA 1UHWA 2ACJA 4P96A 5HLIA 3LA7A 2C6YA 1U5TB 3BZ6A 1ZRCA 2DK5A 4RB1A 2HEOA 2DW4A 2RQPA 2CQKA 3ZMDA 3JTGA 4YFKF 3TOAA 1OR7A 2BYVE 2DK8A 3F23A 5ICCA 1UFMA 1W4MA 2HOEA 2EFQA 2WDTA 3WTSC 3G3ZA 3P7NA 4ZH4F 2F4VH 4LGWA 1I1SA 4DV6H 1QPMA 2EFNA 1GXPA 2VBWA 3ULQB 4LLGF 4IPAA 1ZLKA 1MJBA 3SZTA 3BABA 3F6OA 3TGNA 3FXQA 1N33H 5LGUA 3LFKA 4DQ2A 4UCTA 2Q2EA 3L2PA 4EJVA 4UVAA 3GVAA 5CYVA 2HZTA 2RDPA 3K0LA 4JI7H 3M7GA 4I01A 1O3TA 2FBIA 1IBKH 3HSFA 3MEXA 3GWZA 3WGIA 2ZJ2A 2DU9A 1UCRA 2EA2A 1T6SA 1SAXA 3R0JA 1XCVA 3CUQC 1IW7F 1XD7A 5FPRA 3BWGA 3GUDA 4GYGA 1OMIA 4DV5H 3BA9A 4XLNF 2OQGA 4ZYGA 1Z2PX 1FBUA 4HQEA 1U6GA 1XGSA 2ZCWA 4RAZA 2ZJTA 1T98A 4M6XA 2Z9OA 4UCUA 3HIFA 2ADUA 5D4SA 2E7WA 3OTOH 4G8XA 2TDXA 1BC8C 4KIGA 4HF2A 5D4RA 4A5MA 2LF8A 3CUQA 4IF4A 3KCCA 4KUMA 4EJOA 2JPCA 1J59A 2CWEA 1TAEA 1KU7A 4JI2H 1H9TA 2Q0OA 1FLIA 3HXLA 1QBJA 3ABUA 2D1VA 4ENJA 1V3FA 5D6FA 3SFZA 4HA8A 3VEPA 2GAUA 4PDKA 3QPHA 4OIQF 3L09A 3V4GA 2JPBA 4G9YA 2BGCA 2STWA 3L4KA 4FHTA 4UHTA 4UV8A 3KXYT 1O3QA 4P55A 3OV8A 4LF5H 2J5OA 1U2WA 5IT9Z 4I2OA 3WG9A 2WE6A 2OZUA 1X3UA 1I27A 4CDGA 1W7PB 2A6EF 3ZN1A 3C3WA 4UCSA 3WE2A 3IC7A 4L9NA 1J5YA 4ESFA 1S29A 1HW5A 4MQVA 2FXAA 1XNRH 1SD5A 2HYGD 2FBHA 1SD6A 2EFPA 4OIOF 5DCMA 4DR7H 2PN6A 2RKHA 1O7FA 1TA8A 3K69A 1J5EH 2KIUA 2E1CA 4FT8A 4BHPA 4ZZDA 3V7SA 1P4WA 3KEOA 2A07F 2XAFA 4JI6H 4U0VA 5ED4A 2FBKA 3JAMW 2B0LA 1V9PA 3WTTC 5FPOA 5LMNH 1MD0A 2F2EA 1YTYA 2V9VA 5H20A 4LFAH 2ZO4A 4DV0H 1SD7A 3RGZA 1V4RA 1ZG3A 4M9ZA 4A12A 1Z9CA 2CW8A 3GLXA 3GF2A 1N32H 1B1BA 4KT5C 2M1BA 1G6NA 4BNCA 5ICGA 5L3EA 5E17F 2XKPA 3KFWX 2Z5UA 3R4KA 1MGTA 3I59B 1JE8A 3K1MA 1Z7UA 3LAPA 2FEZA 5LLQA 1TQPA 3T0YA 1T38A 1P6RA 4PCQA 4HLXA 2UXDH 1BOAA 2OBPA 3QP6A 2A68F 1FX7A 3Q9SA 1D8JA 3IG0A 2VT3A 3RJPA 1LNWA 1IN8A 1BJTA 3I64A 4L5IA 1C0WA 3ZPLA 1FOKA 1U78A 1L0OC 3HSEA 3B02A 4GLXA 2HKXA 2X4HA 4JV5H 3F22A 3DPTA 1S7AA 4J0MA 4YIIA 1ZHSA 3WTXC 4EJUA 1SD4A 3KALA 3V8LA 3RPQA 1RNLA 2UXCH 4NHJA 3F8BA 1J2XA 2IA0A 2MCTA 4PDBA 5BQTA 1FSHA 4JYAH 1KU9A 1ON2A 3HRTA 3BP8A 4GGGA 1YW9A 2FRHA 2QBYB 3WTWC 2H27A 1PP7U 1AOYA 3J81Z 5KVRA 3Q9VA 5F6FA 4P9FA 2QENA 3C0FB 1O75A 3GW2A 2FOKA 2QBYA 1BI0A 2WYOA 5BS6A 3F8NA 5DD4A 2HS5A 4U0WA 5IT9W 2HFHA 2HTSA 1XSVA 1MKMA 3R0AA 5JI6A 1LVAA 2BEOA 1DDNA 3V7RA 1BC7C 3NQOA 1DP7P 3E5XA 1LJ9A 1HW1A 2XKOA 3GFJA 5FD5A 3O2PE 4HX4A 4RZQA 1USSA 2CFXA 2L02A 3IRQA 3GX4X 2GXGA 3K1PA 2VQFH 1P4XA 4NXNH 1TLHB 2OA4A 4A0YA 1GHCA 5IWAH 4L0ZB 5JFRA 2R3SA 3ZMTA 1R58A 3ISPA 2X0LA 3DFGA 3HRSA 3C1DA 4GYIA 4LF6H 2R7DA 1FVIA 2Y0MA 4HZFA 1P4AA 2K86A 5L3CA 2FF4A 3KETA 4IRHA 4XSZF 4L9TA 1IRFA 1J0RA 1AN7A 3MQ0A 3QAHA 2PBIA 3GZ5A 4GO1A 1ZG5A 5BMZA 1A04A 1LDKB 4LLNA 1XCBA 3F72A 1FYMA 2HHHH 3TO9A 2Y75A 1K7AA 2P6SA 3D0SA 5AIPA 3N41B 3FM3A 1IUYA 5LEKA 4E70A 2CG4A 4KHPH 2DO7A 3BJ6A 4YFXF 1JHHA 3M8EA 3LA2A 3FMRA 3H3ZA 2EK5A 3ZMZA 1HKSA 2UU9H 3F8CA 3BPXA 2EA4A 1T39A 2EJRA 4IRIA 1HW2A 4X65H 4G6DA 1XDNA 3KEQA 3ZP5A 4I0BA 5HDGA 3KP6A 4ENKA 1R1TA 3LQQA 3J81K 4JI8H 3L00A 1EV7A 2BBYA 5HVQC 5D5WB 1WQ2A 1XDSA 3M1EA 2YCHA 1FBSA 3WODF 4R7RA 1FNNA 1M0WA 2ZMEA 3WGGA 1FSEA 4U7BA 5CVIA 1R23A 2IT0A 1XB4A 4RGUA 4X64H 3ZMUA 5LRSA 2DLLA 3F21A 4YHHH 1DGSA 2RNJA 4O3MA 3GFMA 2IW5A 3COAC 3JSOA 4DV4H 1S7OA 3L4JA 4BHBA 3JSNA 4L18B 5LEJA 2E7XA 3K1NA 2DAOA 4K2EA 4GCVA 3E5QA 2IA1A 3GO5A 5JHUA 2UUAH 4I98B 1FY7A 2XAJA 5F64A 1WH2A 1OYIA 1J9IA 4IAJA 1USTA 4ESBA 3DPLC 2PEXA 5BR8H 4UUVA 5DD8A 2DTRA 3BOQA 3N97A 5D5VB 1BBYA 1WWXA 1B59A 2HR3A 1W5TA 4OIRF 1REPC 5FFXA 2XAHA 2O61A 5H6QA 3H20A 5ILVA 1SFXA 2IJLA 4N9IA 4HX7A 2W57A 1Y0UA 2FU4A 2PFBA 2PJPA 4KMFA 4YFNF 4DV3H 3WTYC 3FX3A 5E8IA 1F9NA 3UQ8A 4RGSA 2KIMA 4ENMA 4A0XA 4MGRA 1L3LA 3G73A 4G7OF 3QPTA 4UV9A 3CLOA 1OYWA 4LB6B 2FNPA 1HSJA 5IT3A 4R79A 3KZZA 4AD9A 5AONA 2H6BA 4OMZA 2PI0A 2LF7A 3C18A 2K27A 3I58A 2W24A 5D8LB 2UUBH 1XNQH 4AIKA 5CVRA 1W7PD 5LGTA 1M0TA 3QRFF 2UZKA 1YIOA 3OOPA 3KP2A 1P2FA 4KIBA 4M71A 5LMUH 4UVBA 5LBQA 2F5CA 2G7UA 4IHSA 3E6BA 1O3SA 4JI5H 4UCRA 1BIAA 4HDUA 2Q2UA 3RGXA 5DCFA 4ZZLA 3LAJA 1TTYA 4AWXB 3FMAA 2DI3A 2ZBKA 3N40P 2IP2A 3I53A 3FZVA 3WTZA 1FP1D 2WC2A 2VE8A 2PQ8A 4JI1H 3L7WA 2D45A 1HNZH 5F1RA 2XHKA 2H09A 5D8KB 2K4JA 1IXCA 3IWZA 3P9CA 2ZXJA 3MCZA 2P4WA 5A2QK 4LF7H 3FWEA 2L3DA 3F3XA 3LSTA 3RI4A 1G3WA 4KYWA 4DR1H 4ENNA 3NRVA 2F5FA 4EV0A 1G3TA 3DEUA 5DV5A 1B4AA 4RB0A 4CXFA 3REOA 5ILUA 3SXYA 4M6YA 2CGPA 5J8FA 1I5ZA 3RTRA 2BV6A 4HLYA 1T2KA 1I6UA 4XSXF 2WTEA 1TNTA 2O0YA 4Q4ZF 1YW8A 3BDDA 1XSXA 2NRAC 4JK1X 2NYXA 3E3VA 2STTA 1X9NA 4A0ZA 3E97A 1R36A 1WSUA 1S8NA 2YR2A 4G94A 2EFWA 4N0BA 2XGXA 1R1VA 4IHTA 3JSPA 4Y17A 3U1DA 1OKRA 1IZ1A 1R22A 1HXDA 1E4GT 1FYKA 3ECOA 1L2ZA 3M9AA 2VODA 4R1HA 1IN6A 5FB2A 4S05A 3PQKA 4WK8F 1HKTA 3T5XA 4UNOA 1TW3A 3H3UA 2KRFA 3RJ0A 3F8MA 4APMA 1XN7A 4BYYA 3HRUA 5AIQA 3RKWA 2JT1A 3B73A 3U9GA 4GKKH 5J6XA 4WCGA 1LQ1A 4A2BA 3N4MA 4GXOA 3FXRA 2WWYA 4LD5A 1MZBA 2GA2A 3QP5A 4HV6A 4HX8A 5CVUA 4I0AA 2NAZA 3W6JB 3TO6A 1SMYF 1SEIA 3J7AK 5TJJA 3BY6A 4OU0A 2HWVA 1KU3A 1FC3A 1FKAH 4DV1H 1UHMA 4ZYHA 3WU1B 5DEQA 3TO7A 2QLZA 5A2QZ 5FLXK 2M5WA 2LDUA 5D5UB 1O57A 3WTUC 2VE9A 4PGGA 1E4FT 1XGMA 2VN2A 2M30A 2YSRA 2VOBA 2RV8A 1ON1A 4EQQA 1YYVA 1IN5A 2MBFA 3RYRA 1F4KA 4DR2H 5L3BA 1T0FA 2E5LH 1H9GA 4KA4A 2O03A 4IJAA 2OQRA 2A61A 2AXLA 2VPSA 1QZZA 1TQIA 3N43B 5ILSA 3E5UA 1EH8A 1E17A 1J7KA 2GQQA 1RUOA 2NS0A 5FGMA 1XMAA 3DXJF 4LFUA 1FT9A 3EETA 3CVZA 2ETHA 5E1XA 4S04A 2UXNA 1LEBA 4A5NA 1N36H 1OPCA 5L3DA 2KKOA 2RN7A 3GFLA 5A2QW 4G7ZF 2D2WA 3U2RA 4O6JA 5LL6b 3ERED 3KLNA 1D8KA 2PLYA 3T1HH 1KQ9A 2ESHA 1YS6A 2G9WA 2FMYA 5HDNA 1XMOH 2L54A 2QM3A 4ZYEA 2CYYA 1IBMH 4DNCA 4MHGA 1TQMA 1BI3A 3R6SA 1TNSA 3MZHA 4YG2F 3HOSA 4LH7A 1PP8F 3DV8A 2P7CB 3ZQ7A 2YX7A 2IPQX 4HF0A