2W58A

Crystal structure of the dnai
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
188
Chain Sequence
b'KRQESLIQSMFMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAAIANELAKRNVSSLIVYVPELFRELKHSQTMNEKLDYIKKVPVLMLDDLGAESWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQKVKAARIMERIRYLAYPIEITGPNRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOME COMPONENT (HELICASE LOADER)
publication title Molecular Interplay between the Replicative Helicase Dnac and its Loader Protein Dnai from Geobacillus Kaustophilus.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Hydrolase
total genus 54
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01695 IstB_IS21 IstB-like ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w58A01
2VRWA 1XZPA 1N0VC 4YXWD 4B3CA 2QGZA 2VP5A 2NO1A 3M0EA 3GQBA 1EFHA 1NVUQ 4R2IA 4RD2A 2IC5A 3W6NA 4CT5A 2IK8A 2SHKA 1D5CA 2BOVA 1KMHA 5CB8A 2KE5A 3B5JA 3T1QA 3CRRA 2J46A 3TLXA 5SZHB 4DB2A 4WXPA 1NVWQ 3OIYA 3SHFA 1Z47A 3THWB 3D6TB 4HLCA 1VCOA 3W90A 3W8RA 2FA9A 3ETLA 4HZUA 2NQ2C 4RZ2A 3GJ6A 1ZAKA 2J0VA 2FJUA 1G1MA 1AGRA 2YOHA 4KBGA 3RDPA 2O5VA 4NP6A 1NBMD 3ZYCA 4MRVA 5SZIA 1KDRA 1US8B 5HR5A 4LHXA 2R8RA 3F0TA 1GNQA 4RZ3A 1OPXA 4HB2A 2O8BB 4M1TA 4MA4A 1YVDA 4EFNA 1G3IA 3FHOA 4EPTA 1KO7A 3PQCA 1R6BX 4XVRA 3DMDA 2BKUA 4TTQA 4MQBA 5FUVA 3KKQA 3LA6A 1G64A 1U94A 4YMSA 4XJXA 3TSWA 1TADA 3CH5A 2ZS7A 1TUEA 1NN3A 2QP3A 4OJKA 1AM4D 1KY3A 1NP6A 2QRZA 4WZ6A 2BEJA 1OW3B 2A5GA 4HLUC 2G88A 3R9IA 1CJUC 3H86A 1MRNA 4DIEA 3QPWA 4WVFA 4LV8B 1GUAA 3GJ5A 2F7SA 3HPRA 5J4LA 3LRPA 2UVQA 3IO3A 4KFSA 2BVNA 4TMKA 5EE1A 4RCZA 1Z08A 1XJ0A 1KAGA 3J81k 3R9XA 3SYNA 4HDOB 1OJLA 1XD2A 4OQNA 4W5JA 1BS1A 2JLVA 5CDFE 1TUIA 5FOTA 2QORA 1G20E 3FMOB 4A6PA 4IOLA 1AS3A 1SXJB 3RS0A 5FBWB 3GLIE 2QM7A 2ZRKA 3B9QA 2XGJA 4TLDA 1QRAA 1NMXA 2BMDA 4QBHA 1TF5A 3NKVA 1U8AA 4C0BA 4A0RA 1GDDA 4L16A 1N3BA 721PA 5K8IA 2J0QA 1VYUA 3H4MA 5BWMA 3HDTA 1QG2A 5AJZA 1G4UR 5C4MA 4ZDIA 2JLXA 5TV2A 1Z0FA 4DSTA 2V55B 1M8PA 4L8GA 1A1VA 1OH5A 2WWGA 1G16A 2RH5A 3EWAA 4KFRA 3FFAA 2AWOA 2J0UB 1R0ZA 1NBME 4C2TA 1X8KA 2GXUA 3I4LA 1OYYA 2EFHB 1ZJ6A 2G3YA 3OHMA 5E4FA 4PPFA 4D0LB 1GILA 4E07A 4YQFA 3KQHA 2FNAA 2ZS9A 1OIWA 3PVSA 2GZAA 3CR8A 3EG5A 2IX3A 3BBPA 3GJ7A 1XFAA 4C0QC 1XXHE 3GLFB 1XWIA 1ZCAA 1P9RA 5CK4A 3NEYA 3CRW1 1COWA 2MMGA 2R6CA 3KKPA 1AZSC 3TE6A 3SYKA 1GM5A 1E69A 2JASA 1JJVA 2WV9A 5EZ5A 5TB5A 1U90A 4G1UC 1UFQA 4D4MA 4Q1DA 5HCIA 1N5JA 1VIYA 1XCMA 4M21A 2ERXA 2VSOA 1T6NA 2CCGA 2CVHA 1HQYE 2BMJA 3B9PA 1GL7A 2HXSA 2IUUA 4Q00A 4B75A 5J5CA 2FFHA 2GTPA 4DCNA 1OIVA 4BFWA 4JLDA 1J8MF 1KNQA 2CLCX 2IS6A 2YC2C 3AGPA 2FZLA 5DLQC 3A1SA 2E9SA 4AIIA 4WZBE 5FBLB 3TRFA 2ZJBA 4JLPA 5CIWA 3T5GA 1OXUA 1KNXA 3KQKA 3CWZA 5D3QA 3ICEA 2F1RA 1VDZA 2FEMA 1CRPA 3EPHA 3FFBA 4D82A 3U60B 3PEVA 3N70A 5FPTA 4CEIA 4JLNA 4OI4A 3RABA 3RHFA 4RD1A 5CIQA 1COWD 4G0NA 4JKYA 1W44A 4QOSA 2ZXUA 3JVUA 2GVZC 3V00A 1QHGA 1SQ5A 4PSKA 4IVPA 4YDHB 2P0EA 2WWXA 3OEEA 4Z8YA 1RRFA 4PANA 4JL8A 5LB4A 1KI8A 3AF2A 4IKEA 3BERA 1LS1A 2FMXA 4M1OA 4Q4AA 2ZITA 4II7A 3X1YA 4P4UA 4ESHA 2IUTA 3R8CA 2WICA 1RRCA 1VTKA 2HLDA 3QF4A 5E7JA 3DOEA 4XD7D 1XBTA 1C9KA 3CNOA 5JZVA 1N5IA 2G77B 2PLRA 3B1YA 1XMSA 3W6PA 4JJKA 3H1TA 3TR5A 2RGNA 2VHQA 4CW7A 2NZJA 2P65A 2ZSBA 4IDOA 3SS8A 5JLJA 3EZ7A 1J2JA 5CM9C 2QTFA 2ZM5A 5JS7A 4DC9A 2JEOA 3EZ6A 2RGXA 3BORA 2XTZA 4OI0A 2PZFA 4BEBA 1H8EA 1PUJA 1ZVQA 4LJ4A 5FTLA 1U9IA 4AG5A 1RIFA 1H8HA 1AIPA 5JWRA 4NYJR 1HT1E 1DTSA 3U3JA 2AR7A 3OEED 4G5RA 5AWFC 1YR8A 1JBKA 1N6PA 3DKPA 4PHFA 3KB1A 5H68A 5A0FA 2WPDA 4BLPA 2JLWA 3VKGA 4ZDKA 1MOZA 4JS0A 1M74A 1EX7A 2HYDA 2Q3FA 3PFIA 3U3KA 4IEIA 3U3RA 4P4SB 4B2PA 3IPXA 4TMXA 4L5BA 5F3WB 2GBLA 1R7RA 2OCAA 2VQSA 3BRWD 2HLDD 4BFZA 2A3RA 4I4LA 1JXOA 2ZJ2A 2PL3A 4Q9HA 1NVVQ 2OV2A 3CX7A 4GOJA 1GIAA 1P2SA 3VR5A 5FUWA 2KBFA 3P27A 2ZRAA 4J0QA 1G7CA 2ZSAA 2WBLC 2MSDB 4AY2A 2EWVA 2QEQA 1SXJE 2FH5B 4RD3A 4B33A 4YC7A 3NXSA 4IW3B 2QUZA 3K09C 3REFA 2OG2A 2EYUA 2ONKA 2V54A 5KTYA 1UDXA 2ZSDA 4UNNA 1H8ED 2IXGA 3WHLA 3UG7A 5KDDA 1E9EA 2Z6VA 4B2LA 1GKUB 2FV8A 1VCMA 3I32A 4MKFA 4KCGA 4MRSA 4TLBA 2Q3HA 3FHTA 3Q8XB 4ACAA 3ADCA 2WWIA 1JALA 2W6IA 4B3BA 2P67A 4TZ6A 1KSFX 2CXXA 4TQAA 5LDDC 2CL7X 2WPDD 3K9LA 2XJ4A 2ZQ5A 1XTSA 2A5DA 3PUVA 1CIPA 4EJSC 5HKKA 5KSPA 3MUFA 2VH5R 2FU5C 3W8NA 2PBRA 5DHFA 3GMTA 4LSGA 3ZIAA 2QROA 5BN5A 1FX0A 1ZNWA 3KKOA 2W2VA 2RGGA 3BFXA 2DHRA 1G7RA 1ZUHA 5CM8B 3SJZA 5AK0A 4F4JA 1HURA 2R44A 4JVSB 1KI6A 4LUCA 3LBHA 3GLFE 2NOAA 2F3RA 2BKEA 2OFXA 2WTUA 2BMFA 3HR8A 1YZKA 3GD7A 5JWHA 4H1UA 3ONWA 4OK3A 1OYWA 4FCTA 3REGA 4R71A 1KI7A 1T5LA 2RGCA 5AJWA 1W36C 2XTNA 5CK5A 4PZLA 3Q7QA 1B0UA 4LYJA 1JECA 4I1OA 5DHAA 3BB3A 2Z0MA 4G5GA 4NYMQ 1W49A 3WP0A 1JQJC 4V0NA 3QPVA 1E9FA 2CK3D 1FNNA 1OSNA 3B6EA 1W5TA 5ELXA 4V03A 1BYIA 3V4FA 1JPJA 1MO6A 2CJWB 3K70D 3R9WA 3K0AA 2GNOA 2Q9CA 2W6ID 1M2OB 2IUSA 2O0JA 3VU9A 1TQ6A 2PMDA 4CIDA 3GP8A 1UBGA 4DJTA 5HKKD 2RGDA 3Q85A 4EPVA 4F38A 1EGAA 3NH9A 1UJ2A 4A92A 3ZIAD 3RYTC 2BCJQ 3VR4A 5FTNA 4EQ6B 1DG1G 1L7VC 1QHIA 3P4XA 1MR3F 4C0HA 3SI7A 2WWYA 3RSOA 1ANKA 4XSGA 1ZC3A 2IA5A 1DPFA 4K46A 3C5HA 1UBFA 5EP4A 4F93B 1QVAA 2C5LA 4F91B 4AKHA 1IJEA 2CLSA 3QVUA 1D2EA 1G8PA 4ZPXA 1E2EA 3QQ5A 1QBKC 2WJHA 2NGRA 2XB4A 4M1KA 1NN5A 1OXSC 2DCUA 3FVQA 4LHWA 2Z43A 1GRQA 3BD9A 2NZ8A 3CRMA 4ZKDA 3AUXA 4LBZA 5LBIA 3Q7PA 2UZ3A 5KOYA 1P61B 2FN4A 5C18A 3K0FA 4TMWA 5EJEA 1ZU4A 2R9VA 1XEXA 3QKRA 2IW3A 3CIOA 1IN6A 4DKXA 1TF7A 3RLFA 3EA0A 5C2JB 4WZAE 3ND8A 2ZI7A 3A36A 1P2TA 4US1R 1MO5A 4OK5A 4LC1A 4URWR 4IXMA 2HV8A 4U00A 1F2UB 2QMHA 4Q1BA 5J40A 3A8TA 2WJYA 1E98A 3IPYA 1ZP6A 1EXMA 4GP6A 4Z54A 3LX5A 2X77A 3WNDA 1CBUA 2FZ4A 4HB0A 1P2UA 2P6UA 2H18A 3NTUA 4RZUA 1Z0DA 4DDTA 2DWOA 1DARA 4BZPA 4PO8A 3SJCA 1X8LA 2IBMA 4QFMA 2IWRA 3S1AA 4MDEA 1KKMA 2J45A 1FTSA 3QE0A 1T9HA 4DDWA 4PQFA 1XTJA 4Q21A 4GDFA 5KPDA 1RYHA 2G0TA 2ZRPA 4G3XA 3SQWA 3WHKA 4OQMA 2GESA 2V6JA 2PJRA 4ZDWA 4DLYA 1F2TB 1NMYA 3TMKA 2QGNA 5JCPA 1N6RA 1R10A 2C98A 4AKIA 2QPAA 3AV0B 5FBQB 2GZHA 3ADBA 3MSXA 1Q1QA 3HPQA 4HAXA 1UM8A 3UWOA 3CONA 1ZIOA 3U6BA 4DLVA 2YC4C 4A15A 2IYZA 3T5DA 2BIFA 2UZIR 2F1HA 4DZZA 4TSFA 3ZZUA 1M7GA 3TK1A 1DAIA 4JMPA 3QXCA 2REBA 1EFRA 1GITA 3UMRA 2QZ4A 2BJWA 1LV7A 2QU8A 3TW8B 3NBZC 3OIWA 1J7KA 1Z2CA 2YOFA 4AC9A 1G6OA 1KOFA 2CHQA 2R2AA 5FUXA 5J4HA 2FSIA 1W46A 3H84A 3QXJA 3EZ2A 2FFAA 2PT7A 1NIPA 4URUR 1U98A 1G8HA 4GRAA 2YWEA 3LWNA 4CZ2A 3U4QA 4GL2A 4ASUA 2FDCA 1EFUA 4YMUA 2N42A 2C03A 1EX6A 3BIFA 4QL3A 5A5GA 3DZ8A 3GJXC 1AKYA 4BLQA 2IYYA 2GK6A 4URXR 1WDTA 1ZUIA 3LX8A 1XEFA 3AB3A 2ZJAA 1R0WA 2DB3A 1XEWX 1KIMA 4Q47A 4NU0A 2RAPA 3RNLA 3UATA 1PLKA 2PCLA 1DAEA 4TL7A 2GXQA 4TSFD 3UANA 4Q9IA 3WXMA 1EFRD 1NKSA 2A5JA 2AXNA 5JRJA 1F60A 5G3ZA 5EUQB 1H65A 1GZSA 3VKWA 4IDHA 4C0SA 5HE9A 4IOKA 5FL7A 4WBSA 2ZJZA 4MRNA 3IQXA 5GJVC 5FH9A 3EIHA 2WKRA 2NPIA 2QMEA 4QM7A 1M34E 4DDUA 3L0PA 4EPWA 5C46F 1XD8A 4UJ5A 4HUQA 1UEJA 4KLNA 5IDVA 1SGWA 4PAOA 5AUQA 2ZRCA 2CDNA 2BBWA 4ASUD 1B23P 4FMDB 1JEDA 2QTHA 1KSJA 4JLOA 2EFDB 4OQFA 3T35A 1T3SA 1W0KA 4HDCA 3UK6A 2HJGA 5AUNB 2Z4SA 4U7DA 1P75A 1YZLA 4RY2A 3I8SA 2QT0A 5EP1A 3BOSA 3AP2A 4C0JA 1OXVA 3UXMA 3SBDA 4LOAA 1W48A 4B3GA 1S1MA 1N2CE 3VR6A 2RCNA 3L43A 1N25A 2J59A 1BYUA 1RE0A 4PR0A 2AHOA 4Y0AA 4JBWA 1A82A 1XDBA 1HEIA 2GZDA 1U9IC 4URZR 3VNVA 5DNYB 4A8JB 4BQSA 2FFBA 3GJ0A 1DS6A 5D3MB 1KK1A 2C77A 3THYB 2IYTA 3E1SA 2ZI6A 3K09A 5B2ZA 3U7EB 5DSZA 3ZGXA 3CBQA 1PLJA 5DI3B 3IUYA 3T1OA 1XMIA 1UEIA 5FL7D 1M7BA 3U7FB 2GBLC 5SZJA 2BBOA 5JRZA 3QXXA 1GOTA 2OSBA 2C9YA 4NPHA 3GEEA 4M1SA 5EZ6B 2ZAMA 4M1YA 4PFSA 5GJWC 3RS3A 1W0KD 2F43B 4EJSA 5J4YA 4Q7KA 2O8CA 1R4AA 4TYYA 2W83A 4FMDF 4MGIR 4HLDA 1NBMA 4GI7A 2J3EA 2OESA 1Q1BA 2OLKA 2JJ1D 3A4LA 5FPKA 1S2MA 4MRPA 2D62A 3NEJA 2YWGA 1VG1A 3BH7A 1Z28A 3EWSA 1XXHA 4Q9KA 4LJ7A 1PZNA 3KTAB 2O8EA 2W0MA 4Q19A 3H2YA 4Q7LA 3K70C 1AZTA 3CUEF 5JHGB 1S0UA 3AVPA 3PITA 3DVLA 3NC1C 5JBQA 2DFNA 2I4IA 4HSEA 1P5ZB 3DEFA 3TBKA 4O25A 3D31A 4LZZA 4N1AA 4D80A 2IYVA 4B32A 4EKDA 4OL0A 2GEUA 2QG6A 4Y0VA 2VP0A 4KSBA 1E9BA 1Q3TA 2VHTA 5JSZA 1UF9A 3B8HA 1EG7A 1A2BA 4Q02A 3ZS8A 3KX2A 2ZVPX 3AVUA 1ZMXA 1D9XA 2GJSA 1TTTA 4NCIA 5F9FA 3P20A 5AR1A 1R5BA 4CEHA 2CBZA 2NO0A 2VP2A 2Z83A 3H0KA 1EESA 3HU3A 1Z6AA 3DM5A 3C5CA 5LD2C 2XZOA 4DB4A 1OE0A 2R6AA 1LTQA 4JL5A 4LRWA 2ZJ8A 3LV8A 2PX0A 4PAMA 5FPYA 3V9PA 3QXSA 5FBVB 1TU4A 3BE4A 1FOEB 2NO7A 2FSFA 2DWPA 3EIQA 4PX9A 3C4JA 2GF9A 2H8KA 4K81B 5KHOC 3THXB 4NZYA 2ZYWX 3EC2A 2ZREA 2VLIA 2GILA 2ZYVX 1W36D 4JLBA 3EIEA 3O8CA 1DAFA 2B21A 2CCJA 1SKQA 2ZI3A 4X8HA 3WMFA 4I99A 1Z83A 3FGNA 2J1LA 4LI0A 1Q1ZA 1WA5A 2QBYB 1GL9B 5LB2A 4FXPA 1K6MA 2XZPA 3JZMA 3MAAC 4MH0R 2QRNA 1SZPA 4A6XA 2GXSA 1X86B 3IO5A 1G5RA 2QE7A 3THWA 3AVWA 3ZH9B 2Z4RA 3KXIA 3W3ZB 2IYSA 4X8LA 4NBSA 3WRYC 2PT5A 3IIKA 4KXFB 4C7OB 1G8GA 1G3UA 4KI0A 3KKMA 1E0SA 3L8YA 2ZSEA 2IYXA 2YINC 1NG9A 3I72A 4IDPA 5H70A 4Q01A 2AL7A 2FG5A 3LVQE 4WAUA 5AUPB 1QDEA 3K1JA 1M6NA 5FTJA 1US8A 1IXRC 2ZUDA 4M53A 4OHZA 1YRBA 5UKDA 2F1IA 1WQ1R 3BB4A 1Q0UA 4Q1FA 5CJPA 4A2QA 4V02A 2V6IA 1YRAA 2OUKA 2DPXA 4JYCA 3KL4A 3LVRE 4B47A 2NIPA 1Z29A 4QJ5A 1NLYA 2JLQA 2P6RA 2AK2A 4TMZA 4LYFA 2V4ZA 3B1XA 2GCOB 3QXHA 2OCYC 3GLHE 1KSHA 1YR6A 4LJ6A 3BWDD 4MYHA 5TDHA 2B8TA 1Z6GA 4UQOA 1N6OA 1GG2A 2IYUA 2CHGA 4HI0E 3QBTA 5JI2E 3A6PC 4X8MA 4F7WA 3EXAA 1NJGA 2GDJA 3W6OA 1YU9A 2QE7D 4IEEA 5L3QB 3E70C 2QSYA 5ANRB 5DYGA 5E95A 1KJYA 1DAMA 3LQRA 2J7KA 1XP8A 2WMOB 1E9DA 3IIJA 3U44A 1X1RA 3I61A 2XB2A 2DWQA 1IXSB 3NBXX 3WY9A 4NHOA 3LFUA 4QRHA 3EARA 1XPOA 1OF1A 1SXJA 4JVLA 3UWKA 4FINA 4QJ3A 8OHMA 2UKDA 2R6DA 1GL6A 4GOKA 1JAHA 1E99A 5JJIA 5HZHA 3FWYA 3W5IA 4D4KA 2KWIA 1YR9A 5EE0A 3U7GA 4JLKA 2EFEB 5F2EA 3UPUA 1IN4A 1CR0A 1FUUA 3U6KA 5P21A 3P4YA 2QI9C 3U2QA 3ZQ6A 4BEJA 2DY1A 1P62B 4EFLA 4ZCIA 4G5SA 3ZLJA 1ZINA 1LFDB 2Q9BA 3I62A 2FPKA 5CYOA 4QM6A 4N0DA 3IBGA 1R0YA 3FMPB 4G01B 2XXAB 5KNDA 5GADl 1Z8FA 2ZE7A 5DYIA 1P60A 2ZR7A 3AKYA 1GAJA 3GFTA 4XD7A 4M9SA 1CJMA 4F92B 1C4OA 2AD5A 1Z6TA 5JECA 2HYIC 3EPKA 2J0UA 4RD4A 1KMQA 1Q3HA 5CB6A 4N3NA 3KB2A 5JMTA 3X1WA 1AS0A 2VHUA 1CF4A 3D3QA 4ZCLA 3TGPA 1PJRA 5KU1A 2RB4A 2LKDA 2ZPTX 3WP1B 4TWZA 4TZ0A 2HT1A 4ITRC 1U2RA 2GEVA 3GLFA 4DLRA 3ZD6A 3MJRA 3UIEA 4LJ5A 5JJKA 1OFHA 5GVSA 4U5XA 5EP3A 1NL3A 1F3OA 1SXJD 3AVOA 4KFUA 4GP7A 3ZVRA 5HZKA 4K8OA 4BFXA 2XITA 4D0GA 4AG6A 1DE0A 3NC0C 4OBEA 2IYQA 4QGAA 4GMDA 2AWNA 3CF2A 1VIAA 1DO2A 5IF9A 2WHXA 3ZQJA 3CLVA 3CZQA 2YHSA 2CEAA 4NYJQ 3WMGA 2EWWA 5L8VA 1JJ7A 1TEXA 4KSCA 1K5DA 1PVOA 1DOAA 4Q1CA 5DISB 2P6NA 3K9GA 2ORIA 3OFNA 5KO2A 4JBXA 1D6JA 3OZXA 2VF8A 1XTKA 3I3SR 1XCPA 1ZNXA 2IYWA 3LLMA 2VEDA 4S35A 4RFVA 3MWKA 3THOA 1W2HA 2AKAB 4DCTA 4LV5B 3VR1A 1FW6A 4US0R 2HEIA 2X1VA 4LBYA 2J0SA 3AKEA 1CJVC 4QNMA 1FL9A 3QI2A 1GKYA 4TLAA 3RRZA 1NSTA 2IF0A 2QN6A 4C3ZA 2FSHA 1CJTC 2VP6A 1XB2A 2YVUA 1WBBA 3RRNA 1CJKC 1A5TA 3N5CA 4ON9A 3UG6A 1IONA 1YZQA 2EQBA 2ZRMA 1SULA 3O8DA 4IHQA 3TQCA 4IXNA 1SKYB 4NKRA 3SYLA 4R2HA 2WWWA 3P1JA 4JT2A 1K8RA 1IOZA 2FOLA 3M6AA 3EZFA 1NNEA 2JIZA 1YZNA 3ZS9A 1OH6A 1W4CA 4OHWA 4LYAA 1HH4A 3SU8A 3CW2A 4BFTA 3IILA 1KI3A 3GJ3A 1JI0A 3IQWA 4BZXA 1GFIA 2ATVA 3OFND 4MYTA 5GJCA 3RRMA 1AQYA 1NIJA 2DYKA 4OKSA 3O8BA 4LPKA 2ZIAA 2QAGB 3RSLA 1DBSA 5CLQA 1DAKA 3K9NA 5G40A 4D6PA 4W9MC 2A2ZA 3VX4A 3FOZA 2N46A 4P31A 3R7WB 1T3HA 5KNBA 4LHZA 2VHJA 3EW9A 3AF4A 3PUZA 4ILEA 2OEPA 2BV3A 3NHBA 2Q3MA 3VHXA 5JEEA 1T8UA 4DCUA 1E9SA 1RKBA 2P5SA 4TYPA 4DLTA 2CK3A 2J7PA 3TAUA 4BLOA 5KUTA 1E9AA 1LNZA 221PA 4RJLA 2HJVA 3B1VA 1D2MA 2FPLA 5J47A 121PA 4FWTA 1XMVA 1SHZA 4AD8A 2OFOA 5EUMA 1VHTA 5TXGA 1II8B 1GRNA 3T12A 3BH0A 2VO1A 4LJ9A 3NIBA 4JJZA 1NRJB 2XNDA 3RC3A 1P2VA 3L0OA 3SZRA 3GLGB 2ZEJA 4YDSA 1ZC4A 3O47A 2ZRJA 2A7QA 2JIZD 4P4SA 4P4TA 1AQUA 1P6XA 1SVOA 4BFUA 3D8BA 3VFDA 4CYMA 5HTKA 1KDOA 4DUGA 1BKDR 4CF7A 1NF3A 4FN5A 2W2TA 1YZGA 4EPRA 4ZIRB 4CEJB 1X8JA 4WOPA 1KJZA 3CNNA 2FX3A 5AJVB 1S8FA 3QKTA 3TUIC 4IOMA 4A0GA 3DHWC 3WYGA 2B7CA 3LW8A 1HE8B 2QQEA 1OH8A 2X8AA 3JZAA 4A8JC 1Z6XA 3MWYW 5K8UA 5E7MA 4B48A 5L3SB 3Q5EA 2J7PD 4ZO4A 3U3MA 2IXFA 1OFIA 1ZM4A 5FI0B 4Q48A 2ZRIA 3QKSB 5BYJA 3DPUA 5G53C 2H5EA 1NSFA 1JNYA 4LGMA 2FF7A 2DFLA 4IFEA 1F6BA 3P32A 3EPJA 2OE2A 4RCYA 4ZV4A 1HTWA 2AXPA 2XNDD 3G82C 4MKHA 5FOXA 1G21E 4EUNA 5EXSA 1ZU5A 3B85A 4ARZB 1X6VA 3GJ4A 4DUGD 2C9CA 1ZYUA 3LH5A 4UNQA 3ZVNA 3I92A 3TKLA 1OB2A 2XNSA 2VF7A 3VX3A 3Q9LA 1Z0IA 3KJHA 4B3FX 4OHYA 1E94E 4LBWA 4UJ3A 4FD2A 2ZR9A 1II9A 1VG9B 3AQ4A 4M9ZA 5E3HA 4P0TA 1CLUA 3L82B 1A2KC 3IHLA 4HB3A 1UKVY 1RPZA 4D4LA 1MT0A 2D7CA 3CPEA 1YR7A 4PHHA 821PA 1FPMA 4A1FA 1YZTA 4JSYA 2ZJYA 3V4RA 1Q57A 1XX6A 1CRQA 4R7ZA 4HYYA 4A4DA 4B71A 3PEWA 1NLFA 3RWOA 5FOVA 2VL7A 4BRUA 2GVDC 2CJWA 3QJYA 1U99A 4DLUA 4KHZA 4C9BA 3FDIA 4RFSB 1P9WA 4DVGA 1N6NA 1JR3A 3SBEA 3QPUA 2D2FA 4BGDA 1J70A 1J99A 4HAVA 2CCKA 1HT2E 2Q9AA 4TN1A 2D2EA 4OQXA 4P3YA 1Z63A 1CS4C 5DGXA 1ESMA 2AKYA 1XCGB 1JEEA 1UKZA 2IEZA 1TX4B 2ZJOA 4A2WA 4YMVA 3ADKA 4LHYA 4EQ6A 5AUOB 1E9RA 1BOFA 3A1VA 3NVAA 1G19A 3VTKA 3IEUA 4TLCA 4PC1A 1OHHA 3VQTA 4QHTA 3GJ8A 4Z8XA 4FIDA 2QQ0A 2GAAA 2YOGA 4A9AA 1PUIA 1PLLA 3TNFA 1Z0KA 4V0OA 3VR3A 4EFMA 2BWJA 2J41A 4GNKA 3PUYA 1L4YA 4Q4JB 1W1WA 3AVYA 1XEWY 2KB0A 4GOXA 4M9QA 2NTYC 3OIVA 1SKYE 5EXPA 1QHHB 1YHNA 2JLSA 2GWHA 2WJVA 4FI3C 3B2EA 4TYNA 2OZEA 5CYPA 3OEHA 3AF1A 5KSYA 4IVQA 2CMKA 3ADDA 5BW8A 1UKYA 3SEAA 4NONA 1QHSA 1JR3D 4R9UC 1FMLA 2JGNA 4KVAA 1ZNZA 3T06B 5B30A 1F2UA 1I2MA 2ZTSA 4NMMA 5B64A 2W00A 3QF7A 1J8YF 2REXB 4RD0A 1KDPA 2WKQA 2BM1A 3DOFA 1LS6A 2BC9A 4XIGS 1DADA 3TVDA 1P3JA 1FMJA 3SR0A 1JXMA 2G6BA 3RS4A 1SXJC 3TUZC 4M2LA 4Q7MB 1YKSA 4HAUA 3CRQA 1OHHD 2HT6A 1QF9A 1ETUA 2QA5A 4RVCA 4EPYA 3PV0A 1R5NA 3Q5DA 2EYQA 4Q9JA 4DCSA 2VSXA 1Z6YA 3A4NA 1RJ9B 1QHYA 2O8FB 1KJWA 2RKOA 5L3RA 2ECKA 3F8TA 4I1SA 1MO4A 4IDQA 4E03A 3L0IB 1FP6A 3L0SA 4BASA 1XZQA 3FMIA 3OEHD 2BHRA 1A7JA 2WIBA 3CKLA 3VAAA 2LKCA 1ONBA 2GF0A 2ZSFA 3U5ZB 1F2TA 3ZVMA 2IS4A 1S3GA 3KQUA 2D4HA 3FHCB 1Z0AA 1GKIA 4PSVA 4MKIA 1IJFA 3DKVA 4HATA 1XTIA 1OLOA 2OT3B 2HCBA 2Q0HA 4POAA 2JLRA 1HY3A 4RKEA 4BLTA 4CGZA 2WAYA 3PXGA 1CR2A 3HU1A 1QG4A 2KBEA 4KYIB 4X8OA 5EQTA 1OXTA 2PJZA 4H1VA 3B1WA 2V1UA 1KKLA 4OI2A 1BMFA 1IY0A 1S9DA 2Q21A 1IQPA 5KNCA 4V0LA 2KI5A 4M0LA 1TQ2A 3IHWA 3PJRA 3ASZA 3OE7A 4Q5IA 1N5LA 4NCHA 1T8TA 2O8DA 2QAJA 3FB4A 1G17A 1MABB 2WJJA 2AK3A 1HA3A 1YQTA 2V7QA 5B58C 3ICQB 2QY9A 4CDGA 5JI3E 4AYTA 5GJBA 2ZYTX 1JR3E 4BLSA 5DH9A 4U02A 4CVNA 4OI1A 2R62A 1IN5A 3SQXA 4ACBA 5TMPA 4AKGA 3BAFA 5JWOA 3QOFA 2F1JA 4YLGA 2ZUBA 5BXQC 3CH4B 3GLIB 1VYVA 3IKJA 5CJ2A 1KI9A 1WRBA 4L9WA 4M1WA 1NN1A 3K0CA 5C1BA 3BJIC 3KFXA 1QHNA 2G83A 4QGHA 4Q4HB 2JJ1A 3PUXA 2WIAA 4PHTA 2ZS8A 1G8YA 5EP2A 2OAQ1 1JAIA 1BMFD 1AA9A 1IXZA 4DIDA 1EWRA 3ZZ0A 4ZKEA 1KI4A 1DG3A 1ZD1A 4D26A 2B6HA 3HYRA 3IIMA 4MUAA 1KK0A 3SDZA 3VR2A 3FYHA 1RRPA 2CNWA 2WJGA 3OE7D 4M22A 3MWJA 2W6JA 2G9NA 2A78A 4DT1B 3ZD7A 2ANBA 3MRSA 4OHXA 2JAQA 1FFHA 2V7QD 1W5SA 4UNRA 5FR1A 5J4KA 4NCJA 4B35A 4AK9A 1W0JA 5K8LA 5DIFA 3GLHA 4I1UA 4XWOA 4Z1MA 2H92A 2X19A 3TSOA 2OHFA 1G7SA 1Z0JA 3K8YA 4QHSA 1E2DA 4B2IA 2OAP1 2F6RA 4URYR 1WCV1 2RGBA 4QGFA 1KO5A 2REOA 1VECA 1E32A 1KMHB 1KGDA 3Q72A 1HYQA 1QHXA 3BGWA 3QG5A 2A5FA 2VA8A 2F55A 1OV4A 3L8ZA 4GFDA 2QM8A 1Z5ZA 5SZKB 2J5XA 4P33A 4WXRA 1I4DD 2OM2A 4W5WA 1P4SA 2V1XA 3AKCA 3F5FA 4HZUB 3A1WA 4M8NE 2NMVA 2ZE6A 3EAQA 1WB9A 2IWHA 2MSCB 1ESNA 1Q21A 4TMVA 4A8JA 4LJYA 1TPZA 1OT3A 5KPJA 5D3MA 4BWYA 1G3RA 4WA7A 1SVWA 2CE2X 3THYA 2CNWD 3LLUA 2VHCA 2W6JD 2ZANA 1FP7A 5DI3A 4YMWA 3W34A 1P7CA 4TTPA 1A4RA 2AX4A 4MYCA 3LW7A 3F3YA 5FOWA 1NY5A 1GNRA 1W0JD 2F9LA 5EE9A 1E2QA 2K5UA 4XH9B 4QC2A 2EW1A 5AJYA 4Z1MD 2FSGA 2H1LA 5JCZA 1TMKA 4TL8A 3RAPR 3PG5A 3KQNA 2QAGC 2YKGA 2B92A 2F43A 4KO8A 3NDPA 4TTRA 1MV5A 4BFSA 1ZM3A 2BEKA 5JHHB 1NG1A 3RVBA 1OFTA 2RHDA 4A0FA 4XSHA 2ORVA 1U0LA 1E2MA 1CU1A 1DEKA 4BUJA 1GNPA 1XTRA 4LPSA 4EIWA 4NTZA 2YNMA 3KQLA 3KTAA 4QJ4A 4TQ9A 3ECCA 4L4UA 1Z06A 4EAQA 4W7SA 1E0AA 1XD2B 4IRUB 3X1DA 2Y8EA 2CHVA 4IJMA 1AKEA 2OFWA 3U3OA 4Q4LA 2YJTD 4C0LA 4YONB 4LJ8A 4AWXA 4M4SA 1XMJA 5EXTA 3B7GA 3EC1A 3I5XA 1R8SA 1KI1A 3CPHA 3AEZA 2VIIA 1ZNYA 1OKKA 1E4YA 1XTQA 1C1YA 1E79D 1DVRA 2PMKA 4DRZA 1ZUNB 1LW7A 4UNPA 3WRXC 3IBYA 1F48A 2ERYA 5TARA 2JJ8A 1SVKA 4UXJA 1SVIA 1TEVA 4KV9A 1J90A 1Z2AA 5IHPA 3AVVA 1E9CA 1E2LA 4JL6A 5IRCD 3M1IA 4Q1AA 3VNUA 1SVMA 2J9RA 2ZRNA 1EWQA 4IOJA 4DLWA 1P73A 4D4JA 4S2EA 1XJCA 4AYXA 3PENA 4BPBA 1JQLB 1SHKA 1NLZA 1FQKA 3AGQA 3DO6A 2O8BA 1BH2A 1X1SA 3THXA 3NBYC 3QKUA 1OB5A 1N6KA 1E96A 1HQCA 2QTVB 2LCFA 4B43A 3TVTA 2GK7A 1E4VA 1ZD9A 3DMNA 4NE2A 3KKNA 1WXQA 4HAZA 3ZZTA 3BK7A 2GKSA 3ZVLA 4ESVA 4YMTA 1IN8A 2BCGY 3U44B 4NYIQ 2PX3A 1UKEA 2DR3A 4LC0A 3EPLA 4R98A 1Q44A 2QBYA 1CP2A 5B57C 3A4MA 1OKKD 1XD9A 4MUBA 1IAQA 1XF9A 1U0JA 1N0WA 4F4IA 3MD0A 1TL7C 4JLAA 2ZU6A 4UNSA 5FPSA 4C7OA 4IVRA 5KDLA 1UBEA 2IS1A 2AFIE 3OF5A 1T91A 2DFKB 3AH8A 4A0HA 3HWSA 2GHIA 3MGCA 4AYWA 2G0NA 3NHAA 4NDZA 1YZUA 1XNJA 1S1CA 1VG8A 2D7DA 2C04A 3QUSA 3BFVA 4ZI3A 4NYIR 1KTVA 4OJQA 2HF8A 2ZRLA 4QGGA 1AGPA 3AF3A 3FMFA 2LWIA 3FKQA 2H7VA 3GPLA 4UXIA 3T15A 2ZAOA 2GCOA 4PO9A 3HP1A 3TQFA 5C4GB 4PC7A 1ZM2A 4TL6A 2I1VB 2A5YB 3M4YA 4CEIB 4GT1A 2C78A 2VYFA 4XVQA 1W47A 1E2FA 4ZCMA 1P72A 4JLVA 3Q3JB 5EE5B 1UBCA 2R6FA 2NPFA 5LPNA 2XX3A 3LO5A 2JA1A 4QBFA 1Q12A 5L3QA 3B13B 1Q1EA 4DLZA 3ZJYA 4D0NA 2GRJA 4LHVA 1WE2A 5IK2A 3E2IA 1ZD8A 3MFYA 3PCRB 1GSIA 2MMCA 4H9GA 2TMKA 5E7IA 4Q4AB 4BFVA 1N6IA 1NY6A 1ZBDA 4HAYA 4Q66C 5BN3A 1KO1A 4PAQA 3QF4B 3B78A 4TMTA 2IF2A 4QXAA 2D74A 3EA5A 4EDHA 1TAGA 3UKDA 2E1RA 2XTMA 1VPLA 1GWNA 2HDNB 4HLQB 1I2DA 2JATA 1UDWA 2IEYA 4Q18A 4BFYA 4E09A 3QEJA 1T5IA 2O0KA 1E2NA 3TUJC 3QSYA 3AM1A 1OXXK 1W4BA 3NH6A 3CO5A 4LY6A 1E3MA 3L2OB 5JFGA 2O0HA 4BZQA 2ZRFA 1D2NA 3R8FA 1E2KA 5TY0A 1NKTA 4DSNA 4Z51A 1EFTA 5TVKA 3SJAA 2XXAA 3TJZA 2G1JA 2ZR0A 3W3AA 1N6LA 1X3SA 4JYBA 4NCKA 4MYUA 4B3DA 3GEIA 2NO9A 5M04A 1HV8A 2C8VA 2OILA 2H16A 4WW0A 4ABYA 4QKQA 2IT1A 2WVJA 2V8OA 2IL1A 1RFLA 2JJ2A 3PR1A 2JCSA 1XU4A 5IK2D 3WBJA 1T0HB 1IM2A 4Q7JB 4TQUS 1JR6A 3CF6R 1G3MA 3WNBA 2IS2A 3W9YA 3KJIA 3TAHA 2PZGA 3DL0A 1LF0A 1N6HA 1JB1A 5H8WA 1FZQA 3T34A 3NG1A 1LY1A 1FQJA 5HPYB 3C8UA 1G9XA 1I4LD 1WMSA 1AJEA 3AUYA 3WMEA 1IY2A 3FTQA 2WAXA 1CTQA 3BB1A 4OHVA 3DZDA 2RHMA 3EZ9A 1E1QA 2L0XA 4KU4A 1G41A 2GJAA 5FFMA 4GMXA 2EVWX 4C2UA 4GZLA 4B3XA 4Q03A 4M9XA 1N0UA 4CRWB 4IFBA 4LJAA 4DHEA 2P5TB 3K0CC 2A30A 1AK2A 3DDCA 2YZ2A 4B34A 2GJKA 4DWJA 3OIUA 3K70B 3RRYA 4MDFA 1HUQA 2DFTA 3X1ZA 3VHLB 4EPXA 2I3BA 4B6FA 2JLYA 2JJ2D 4DDVA 2WWFA 3UMSA 1W4RA 2HXYA 2QSZA 5F9HA 3SC3A 4XVUA 2H17A 3HR7A 4MGZR 1N5KA 2D3WA 3C41J 3GCGA 4AURA 1OH7A 4OK6A 1TQDA 4JVMA 3GFOA 4QHYA 2CL0X 2GCNA 2P3SA 4XWKA 4PC3A 2ZRDA 2ZYUX 1Z07A 2ZUCA 3N2EA 2ZRHA 3O8RA 4MGKR 2EFGA 1E0JA 1E2PA 1FX0B 2WM9B 3K0EA 3P26A 3LY5A 3EX7C 1IY1A 5KYKA 5L3VA 1AS2A 4V0KA 4M1MA 5DE3A 4C0AC 1KI6B 3BC1A 3I1FA 2OBLA 2QPTA 4NCNA 1CR1A 2ZROA 4RZXA 3W5JA 1E1QD 4BRWA 1W4AA 5LD2B 4HEJA 1QZXA 2XOKA 5FOUA 2PEZA 2GJ9A 3RWMB 6Q21A 1T3LA 3MCAA 1VG0B 3WYAA 4LX0A 4W5HA 5EE3A 2J87A 1E2HA 2OBMA 4HDQB 3AP1A 4JZKA 3K0SA 1Q22A 2IYRA 3FE2A 1TU3A 4DLSA 3D7MA 1OIXA 2IXEA 1H8HD 1NI3A 1MKYA 3LXXA 2BBTA 2ZRBA 2QAGA 3K0AB 1UAAA 1RZ3A 1P9NA 4TLEA 3WNCA 3VU9B 2CL6X 4PQRA 3R7WA 4B76A 2ORWA 1MRSA 1NVVR 2QMOA 3QBVA 2ZRGA 3VMFA 1DELA 2QP9X 3BH6A 3FPAA 3RANA 4ZDJA 1BO6A 1NJFA 2MSEB 4FWIB 1YE8A 5BQ5A 3ZDQA 1R8QA 2FFQA 3OAAA 4PZYA 2OCBA 4D2IA 2E87A 3PIRA 3TSZA 5IT5A 1JPNA 3CWQA 3IEVA 2XZLA 2HCJB 2BMEA 1LF5A 1E2GA 3KJEA 4O2RA 4C30A 2QNRA 3CM0A 1FUKA 5K8TA 3LBNA 2WSSA 3EASA 1II8A 4US2R 3CRVA 2XOKD 2WOJA 1BIFA 5JEDA 2XAUA 4D81A 4HUTA 4A36A 2QT1A 3MJHA 4JSTA 3GLGA 1Z22A 1GRRA 2H57A 5DN6A 2YYZA 2X2EA 3SFVA 4RKFA 1ODFA 1LB1B 1QVRA 2ZI5A 4ZIRA 4CEJA 3QEOA 5DO9A 4BE7B 3K0FB 1W7AA 2RGEA 1G3QA 4F4CA 4QNRA 1XEXB 3QKRB 1XRJA 2B8WA 3C7KA 4B44A 4A2PA 2CLDX 3CPJB 2QENA 1WF3A 1Z3IX 4PPGA 5KDOA 3A58B 5G41A 4TL9A 3TW4A 2F9MA 2X2FA 1NN0A 4HLUA 2GXAA 2QL6A 5L3SA 3OAAD 3ASYA 4GBMA 2JLUA 1KAOA 2BJVA 1WBDA 3MMPA 1L4UA 4A82A 1RYFA 2WOOA 4C4PA 1E0KA 3QKSA 1RRGA 2YWHA 3IDQA 4NYMR 2JLZA 3QVVA 4LYHA 2W0SA 3RC8A 3CR7A 2WSSD 1G4AE 2PLFA 2R65A 2VTKA 5HE8A 3WBKA 2VBCA 2AN9A 3NBFA 4KFTA 4L9SA 1UADA 3S1AB 3CX8A 4TYWA 1E6CA 3E5HA 4MITA 5FL3A 4ARZA 1IHUA 5DN6D 2NO6A 3QG1A 2FGKA 5FBRB 1LVGA 1XPUA 5KSZA 2V9PA 1R0XA 1KYIA 1SVSA 4CT4B 4DBLC 1EFCA 4ZI2A 1M7HA 3NWJA 1U8YA 1S3SA 5GVRA 3B1ZA 5EXXA 2RGAA 3A37A 1KI2A 2XEXA 1ZW6A 4DSOA 3QENA 1ZCBA 4UXHA 2GEDA 3U61B 1G8FA 4KODA 2JDIA 2C99A 1CXZA 2ODBA 4JKIA 4BLRA 4DSUA 1GVNB 4P32A 3RS2A 1ZRHA 1VYTA 1L8QA 2ZU0C 1KK2A 3HJNA 3SN6A 5KSOA 2W2XA 4NL4H 3LQQA 421PA 1PV4A 3BXZA 5FPHA 2PZEA 4NH0A 1MO3A 4E5UA 4JLMA 1UPTA 4RFSA 1VMAA 4BECA 2ODNA 5J4VA 3CB4A 4V0MA 2NG1A 3PEYA 1ZM9A 2A9KA 4G5QA 3MWLA 3TIFA 4QBGB 4QG7A 5F98A 4FMBB 4DEXA 5FTMA 1M1YE 2IHYA 2OBNA 1VHLA 1ZM7A 2VSFA 4PPNA 1CEEA 3AVQA 1DAHA 3A1UA 2ATXA 1Y3AA 3K9HA 2ANCA 2ZE5A 3U4QB 3X2SA 2CE7A 2KSQA 1RW4A 3SJBA 1OFUX 4WIAA 2FE4A 1KSGA 3N2IA 2ZI4A 2WSMA 4PTLA 1T4GA 3GEHA 3C15C 2R6GA 4O3MA 4N0EA 1Y63A 1FTNA 2WMNB 4Q4JA 2JDID 4GZMA 2BM0A 3QIAA 3SFZA 1G6HA 1K5GA 2GAOA 2ZJ5A 3KXKA 2ZETA 2EU8A 5FTKA 3UMFA 2OO7A 5FI1B 1QHHA 2OXCA 5H1YA 1S4QA 2ASEA 3GLGE 1G7TA 3SOPA 2QP4A 1AN0A 3QY0A 1NMZA 3KXLA 4JT4A 3C14C 2P2LA 3CF0A 4D25A 1O87A 3FKSA 3KUDA 2ZVQX 3KUCA 3T61A 1VCNA 3B82A 3KDSE 1II0A 2WJIA 3HYTA 3ND9A 3G5UA 2O8DB 1KO8A 4RD6A 3I8XA 1TF2A 3JVVA 3AF0A 2O52A 1E2JA 2C95A 4LV6A 4MGYR 1CULC 4LBVA 4LK2A 4XTRA 4KITB 4KBFA 4KYUA 1D8TA 1S96A 4HUQB 1T0JB 1U81A 3MLEA 1G5PA 5JS8A 1XJQA 4DCVA 3KJGA 4UKDA 2V3CC 1V43A 1V5WA 2OXRA 1KK3A 4Q9LA 4PZZA 4FMCB 4XTCS 2OLJA 1U0HC 3RS5A 5HCNA 3B60A 3PEUA 3SNHA 4FCWA 1YJ5A 2HF9A 3C16C 2CVFA 1RJ9A 4KAXA 2F3TA 2QMUA 2O8FA 3T1VA 1DAGA 4TT3A 2FGJA 3LDAA 2WZQA 2GJ8A 2KJQA 2W58A 3HU2A 5FR2A 1E2IA 1KO4A 1ZIPA 1NVXQ 3QNUA 4PC6A 4ERNA 2WKPA 4LDJA 4KLZA 4HAWA 3R20A 2XJ9A 4AI6A 1GTVA 1RVDA 2PCJA 2PH1A 2BBSA 4XOIA 4QBIA 2YV5A 5JJLA 4LCBA 5FOSA 1FNMA 3FKSD 2GA8A 3DM9B 4I1VA 4L15A 4TYQA 5A4JA 3AKDA 5CLLA 3IGFA 4O2LA 1IBRA 1Q20A 3WYFA 2XSZA 2ONJA 2YWFA 2FEOA 3KZ1E 2Z5FA 3AP3A 4B74A 4DXAA 521PA 1G18A 2DBYA 3BFKA 1S9HA 2Q6TA 1L2TA 3GLHB 4PPQA 2I1QA 5DI9A 5BYKA 3KFVA 1KDTA 1KY2A 4FCVA 1D9ZA 4LWZA 3LXRA 4Q1EA 4B6EA 2RGNC 4B73A 4EJSB 1G291 4HB4A 2O8CB 4URVR 1E1RA 2ODEA 1KHTA 4FW9A 2VP9A 2C96A 1MABA 4DEYA 1U8ZA 1RC8A 4FMCF 4TT3D 3MG9A 1HE1C 4V0ME 1CR4A 4JBYA 2FWRA 2GETA 3SE0A 2RMKA 5G3YA 1TQ4A 1XXHB 4XWAA 3A1TA 1TNDA 4GSYA 5FUYA 1KZGB 5CDFA 2O8EB 3LD9A 1VKJA 2ZI9A 3PUWA 1W36B 2HUPA 3I5YA 1WP9A 4YXWA 4AKEA 3RS7A 2EFCB 3GLIA 1GP2A 2PEYA 4OQLA 3T1TA 3AVTA 2QPOA 3AVXA 2ZE8A 1W2GA 1MH1A 2G1KA 3NDBB 5AJXA 3VKHA 4PO1A 5CITA 4E22A 3OESA 4IDNA 4KJZA 1XPRA 4GPTA 2BDTA 2XSZD 2AD1A 4Q4HA 2D06A 4JVNA 1DO0A 3X1XA 2IYLD 2IHBA 1F5NA 3LNCA 5JSZB 2B7BA 2VP4A 3BS4A 3I73A 621PA 2GCPA 4KVGA 1EK0A 1R2QA 4I81A 1SVLA 4CEHB 3K53A 1IN7A 1ELOA 4PXAA 1KZ7B 1O3YA 3TH5A 2N1BA 1I4TD 3LBIA 1E1RD 2WWHA 4G5OA 4C0KA 4OYHA 3CZPA 3GFPA 3CX6A 1CKEA 4JIMA 4RSGA 4DT1A 4PC2A 2AFHE 3CNLA 5BN4A 4PQYA 4MKGA 4MRRA 4PHGA 1VCIA 2VPPA 3G0HA 3U7HB 2C9OA 4JLJA 2OCPA 4O0MA 2ODWA 1E79A 1G5TA 1R5OA 4DLXA 2C2HA 4HZIA 3SHWA 4PSAA 3TR0A 3LAWA 2FPMA
chains in the Genus database with same CATH superfamily
1W5EA 5CLGA 1S6YA 2QN9A 1C2TA 4B3CA 2VZEA 5E2AA 5FLKA 2PSFA 4UC0A 5FYQA 3RR2A 4CT5A 2WNHA 4CIBA 3T54A 3BFJA 2SHKA 2BOVA 4I5IA 3TL3A 1KMHA 3PXBA 3O4VA 3KOUA 4EG1A 1GZDA 3M9XA 2J46A 3SIWA 3U3DA 3BAZA 4PGFA 3LUGA 4KREA 1W6UA 4GBGA 3UAXA 1VCOA 3W90A 3B6JA 4X9XA 5IAEA 2LCQA 4DXDA 3PICA 2HMUA 2UYYA 2SKEA 2WA1A 1ZAKA 5FUMA 1QX3A 1QZZA 3ZWOA 1PJZA 4DR7B 2PD3A 4J1QA 3ZDBA 2CLIB 2HRQA 3OPNA 3AJDA 4YQYA 1AGRA 3IHTA 1I6LA 3KELA 3AI2A 1V8DA 2SCUA 5D1HA 5HSGA 4NP6A 1ILWA 4P08A 1N57A 4WN9A 4GX2A 2I65A 1CRWG 2R8RA 5C8XA 1A9QA 4RZ3A 4F5YA 1H2YA 1UPXA 3AT1A 2D54A 4HDSB 3WKDA 2VUHB 2YJ3A 4M1TA 1LSUA 4EFNA 3H4VA 3MAJA 2APJA 1Y98A 3OSUA 4KDEA 1T29A 2QDXA 1F0NA 3PQCA 4PFJA 4R8SA 4EPTA 5LJIA 1Q95A 1V7PC 1W76A 3EVGA 2AQ8A 4NV0A 4DRXA 3UYLA 3WQBA 5SYAA 4YNBA 4YRAA 1J0AA 1YDEA 3LA6A 5FBHA 4CR8A 1W29A 2H08A 2NSDA 5SYNA 3M5WA 1Q0PA 2AMFA 5DWVA 1NNI1 1H6DA 4LE2A 1EPUA 3ER6A 2CMGA 3WX0A 1KRWA 5JMWA 3R9IA 2CFOA 1SHUX 4OHUA 3HPRA 3GJ5A 4JB8A 4BX2A 3CCCA 5HUHA 1JU3A 3IO3A 4K1LA 2FEKA 2BVNA 3UTCA 1XJ0A 3K2QA 3SYNA 2PLWA 5FEMA 3TX2A 2I2FA 2Q2WA 4A6DA 3F7OA 5JD4A 1UQTA 3NHPA 3E3AA 4FFLA 4XB2A 1IQRA 2R47A 2PUEA 4JOQA 1UOPA 3R0VA 4MIYA 4KYTA 2CKDA 3HNPA 1VPWA 4IOLA 3RS9A 4M1EA 2C7GA 2HIHA 4CI0B 3OCYA 5FNVB 1ZDMA 1HFWA 4N8EA 5BQ3A 2XMGA 3UFBA 1JA9A 1FDUA 2ZRKA 3ENKA 4JUCA 3M6FA 4TLDA 5EC8A 1NMXA 1I5EA 1GLNA 1WV0A 2BMDA 3M6UA 3MS7A 4HUJA 5H02A 2OFFA 1TF5A 2CHFA 3NKVA 3R5FA 4A16A 1GDDA 2C29D 3QVKA 4ENTA 4YRNA 2VBGA 2XYRA 3DZFA 1N3BA 4YRKA 1HOXA 4BNIA 4JOSA 1KBQA 2J0QA 4ZAYA 4M36A 3HDTA 2WTXA 5C31A 1KAHA 1FSZA 5K0CA 5AJZA 3NIWA 5FB3A 1TT5A 3D0KA 3ROEA 3U80A 2JLXA 2WQ6A 4EMBA 1Z0FA 1VL6A 5EOVA 1Z6PA 3ABOB 2QTWB 2ZB7A 2ZYDA 3C1AA 2YN4A 4N18A 2DEUA 2ERCA 3FFAA 4RHCA 2AWOA 5GM1A 1JJBA 2Q07A 2XGOA 3H16A 3FYUA 2GXUA 2V7UA 3BRSA 4HDMA 1OYYA 2EFHB 2C2BA 2TMDA 3P0HA 2VHZA 1V16A 3G2NA 3U1BA 1GY8A 3I83A 5B2EA 1DDGA 3W5DA 3KQHA 2V03A 2IX3A 3EG5A 3FR8A 1JI3A 3BBPA 4KWEA 4B83A 2OPBA 3HRKA 1JKJB 2HWYA 3AEKA 3ELWA 1XWIA 1E7MA 4CKBA 5CK4A 1HYEA 3RYCA 1WWKA 3L9XA 2YCBA 3NEYA 2XUPA 2I71A 3DDUA 1JMYA 1ZGGA 2WF9A 3NRBA 3MT9A 1JEYB 1AZSC 1GM5A 2VDMB 2I2WA 4ZEMA 3PSHA 1MOPA 4OOEA 4G1UC 4DQLA 3ZV6A 3QKWA 4CGYA 4KN8A 1QGOA 3ZU5A 1VKNA 4D4MA 2XRZA 4Q1DA 3WYBA 1NVTA 2VK8A 2IDJA 3EOAI 1VIYA 3DZKA 3G8AA 3GGOA 1OYVA 2VSOA 3B9PA 1WIWA 2WJWA 2BMJA 1GL7A 3V8MA 4HDNA 3A2LA 2IUUA 4B75A 5CFPA 1XU7A 2B34A 1MDBA 2X0IA 4DCNA 4EHFA 2WLTA 1WTAA 2YMMA 4BFWA 4JLDA 1KNQA 2PRSA 3ZI4A 2HO5A 1CZLA 2CLCX 2Q8PA 2YC2C 4RKQA 4JVOA 4EYKA 3QYJA 3SS9X 2ZIGA 3EEFA 1FP2A 1GDTA 3F96A 4ZKDA 3TRFA 1V3UA 1KEVA 2OCXA 2ZJBA 1GPYA 3B9BA 4JLPA 2XWJI 5CIWA 3SSOA 1NW3A 3U7JA 4EZEA 1B43A 5KHLB 1OXUA 1TA9A 2Z30A 5LSAA 2W8BB 3KQKA 5JE8A 1T2DA 2QUIA 3IS3A 3SK0A 2RSLA 5D3QA 3OCJA 1I7LA 3HDGA 4QYXA 1IK4A 4CMGA 2RC5A 3RSSA 4RH1A 1SCAA 4HFMA 3IT1A 2MIIA 1E4OA 3VSDA 4DW8A 3N70A 2EERA 4MW7A 4ZN6A 5CCEA 1PJLA 5K2MA 1CSEE 3S8YA 4CEIA 3I2GA 2JK1A 4X95A 2CT8A 2IODA 5CIQA 3CNHA 3MTAA 3LDHA 1M8GA 1Z0ZA 2GVZC 1XELA 2HXGA 3AU9A 1N4AA 3RV4A 4ER6A 5KIAA 3IL2A 1OGYA 1JT2A 1QHGA 2YQZA 4PSKA 3CW9A 4IVPA 1E64A 2O0LA 2ZWAA 3U3XA 2GKOA 4GWLA 3TFQA 2O59A 4PANA 2PUFA 1RLMA 2YVKA 4JL8A 3E15A 4OHFA 2LW7A 1LA2A 2WG1A 5I4KA 5C52B 3UJ6A 3MMSA 6CHYA 2FMXA 4FX5A 3DUWA 4M1OA 4Q4AA 9GPBA 4MUKA 4AUKA 1OA1A 3D64A 2WICA 3G2QA 1VTKA 2HLDA 4YRRA 5LQJA 4BMZA 2DLCX 1W88B 1YRYE 3DOEA 4WZAB 1UPCA 2CFCA 4R1SA 5KOIA 3WGNA 4V0RA 3B1YA 3SCZA 2PLRA 4HQLA 1Y9AA 2G67A 4GLBA 2QRVB 4JJKA 3H1TA 1WO8A 3TR5A 4TXHA 5HVNA 5IJ0A 3W5CA 2P65A 2PUVA 3INGA 3SS8A 4PBTA 1U9ZA 5CNJA 4XIFA 4KX5A 4OQYA 4PG8A 4DC9A 4NZ9A 2AFVA 2JEOA 3VPHA 3N2KA 1CFZA 3EZ6A 3L3BA 2PE5A 3OJWA 3T3MB 3WSWA 3ASUA 1E5TA 1G5HA 1XKQA 1EU1A 3BORA 2XTZA 3H9UA 3QFFA 5A03A 4ZT5A 3FLMA 5C7OO 2PGLA 5BWNA 3WL7A 2Z1MA 4EI7A 1ZVQA 1SC4A 1QLJA 4KL8S 5FTLA 5DGIA 3HZHA 4UMFA 4AG5A 5DM70 2OPHA 1AIPA 4RKRA 3RAGA 4N48A 1HT1E 2YJ6A 3LUKA 3TQOA 2AR7A 2QQFA 4PHFA 5A0FA 4YPFA 3PEEA 4GXQA 4D8YA 4NENA 5I3ZA 4OFZA 2HADA 2MR6A 4IEIA 4II2A 4P4SB 3U3RA 3VDQA 1O9HA 3FFWA 1Q5PA 5DOZA 5LA6A 2P1RA 4KIWA 2XOEA 4TWJA 5FORA 3Q7RA 2PL3A 4KPUB 1NRXA 2O3RA 1NVVQ 2WHEA 2NZ2A 3M33A 2RONA 1YONA 1S3IA 4QT0A 2KBFA 4L8YA 5FHQA 4Y2UA 4Y9DA 4E33A 3B7WA 5DIZA 2A14A 3EXG2 3QYAA 2O3UA 4GKBA 2WBLC 1UEXC 4ENWA 2MSDB 2B98A 3GHHA 1N2JA 2B1RA 2C42A 4HN4B 2V8BA 3RFCA 1NONA 2XH8A 1JQDA 2OYSA 3NFRA 5LU8A 4P3KA 1UXJA 4YC7A 3EQ8A 4MYRA 3QRWA 2B36A 4CKWB 1OBHA 2C7BA 2IDMA 2HR1A 3M1AA 2P9YA 3BWMA 3NTRA 2GPBA 3REFA 2C61A 1RKUA 2EYUA 2ONKA 3HJCA 1RZUA 1F14A 1H8ED 3CZ5A 2JAPA 2BFDA 2RH9B 5ERGB 3WHLA 3UG7A 5CLHA 5KDDA 4OUKX 3R3XA 2Z6VA 3RVPA 1V9CA 1UMCB 4Y18A 4KQ1A 3I32A 4TLBA 3FHTA 4H7IA 2HK8A 3Q8XB 3KIPA 3LGAA 4IYRA 4WTOA 4ACAA 1JALA 2B35A 3PIIA 5BYAA 2CMFA 1PL7A 4TQAA 1JVBA 2CL7X 4AJHA 1U0BB 4P2BA 3O31A 4O59O 3IEKA 2E4AA 2A5DA 3PNPA 3BMOB 4MJ3A 1PFYA 1P5FA 1RYEA 4I3FA 3DNFA 4DA7A 3E7PA 5KSPA 3ZBTA 1VA5A 3OG9A 1QO9A 4TN5A 4Z49A 2VH5R 2FU5C 1GU1A 2V6FA 1HE4A 1FNSA 3V4SA 4IHAA 4RJ2A 3I58A 1C9JA 1ULAA 4E2YA 3KKOA 2W2VA 1RT9A 1ZUHA 4IGIA 5CM8B 3SJZA 3PPIA 1HURA 3VR5D 4JVSB 1KI6A 2PQ6A 5D1NA 3L04A 1P0PA 4CQMB 5A2QA 3QEBZ 1VBFA 5L7TA 3BMCB 3EZXA 5CFOA 3HR8A 3H11A 1OYWA 1T5LA 1L4MA 2C97A 3IP8A 3P9PA 4KR9A 3FSGA 2G9UA 1E8NA 4RTOA 3D2AA 3DDOA 4ANFA 5JNWA 1V5IA 2B7LA 1JQJC 4V0NA 4ITUA 1U7ZA 3QPVA 2CK3D 2HSGA 4LY3A 1FNNA 2NU9B 2A9QA 3ZLTA 3RHZA 5D86A 3VTAA 2SECE 4RESA 4DLPA 2UVPA 1SQFA 1F6WA 1Y82A 3GK3A 2IIQA 3L0ZA 2ZW9A 4DMKA 3K0AA 3HZRA 4L28A 2CLEB 4L72A 1A8PA 4ZEXA 1MGPA 3D6VA 1TQ6A 2QZ9A 2BUBA 2WW8A 4JLSA 3JQAA 2HMWA 5LWHA 1UBGA 2JBAA 4YMLA 2C2MA 1CUAA 1J1IA 4EPVA 1RXEA 1VI5A 2ALJA 2NTEA 3ZIAD 3RYTC 4TTJA 2E85A 2DE0X 3Q9NA 4KUEA 3VPGA 3NMUF 4C0HA 1N2XA 3IMEA 4ZVNA 4UDOA 4HTFB 2WDZA 2PZLA 4XSGA 3JQRA 3BQMB 2Q3BA 3C5HA 4QUKA 4F91B 4KNYA 3HLYA 1Y5RA 4TGLA 2GLXA 1IJEA 3D3KA 4ID9A 1A5BB 3AHHA 3NV7A 1H0HA 2ZSKA 1D2EA 5ALZA 3CVYA 1CQWA 1Y1SA 1GG8A 1QBKC 2D5BA 2WJHA 2XB4A 5E6SB 2XQIA 1EFAA 2HA7A 2DCUA 4LHWA 4WINA 4RM2A 1GRQA 4IYJA 1PHPA 2NZ8A 5JMOA 2CUTA 2HH9A 2I33A 4BO8A 5KOYA 3O0TA 3RVOA 1GU7A 1O1YA 2BFAA 5K3FB 4TMWA 4NPCA 5C18A 3V9AA 4ESVA 1GAQA 1K66A 3K92A 3WQRA 1LCIA 4G23A 2D4AA 4HNUA 2BSQA 1U1IA 3AZQA 3CXUA 4D4HA 1KP3A 1TF7A 1Y37A 3LCMA 4I1IA 3DVSX 4WZAE 3RLFA 4FW8A 4CHGA 1M34A 1Z36A 1MO5A 4K9MA 4XPZA 3U62A 1L9KA 1TB4A 2B4QA 3JZFA 2H4ZA 5DCUA 5LXTF 2QXYA 4AO8A 4GMHA 1YC5A 1PFVA 4X60A 5A6SA 1JIUA 3EH2A 1WU7A 4MYSA 2GO1A 4EHLA 5JNTA 4RNDB 3RTCA 3VR4D 1CBUA 2FZ4A 4NCBA 4YCCA 1DCKA 3N07A 4RXMA 2ZPUA 1SOVA 4P3NA 1SHJA 3UT6A 5B6IA 2X22A 3NTUA 5B5SA 3WKCA 4R68A 4D8TA 5I01A 4PO8A 2YZGA 1ZSNA 3DLCA 2P9BA 3B6IA 4QFMA 1M5TA 3CBGA 3DPSA 3ZIDA 4DDWA 1T9HA 4PQFA 5LBTA 1BAPA 4QQNA 4BN0A 5C35A 3HCCA 5IASA 4EM6A 2D5CA 3B20A 4OA8A 1MG5A 1PEAA 4E21A 1WD5A 1D4FA 1LBQA 3HCRA 4WUTA 3UMJA 1RZVA 1TD1A 4JI4B 3GA7A 2AFRA 5IWCA 1NMYA 3TMKA 4PICA 5JCPA 2WUEA 1N6RA 3HCOA 4GRDA 4K6FA 4R3UC 3T7DA 4KJXA 5DBIA 5E4YA 3UJ9A 5CT4A 2WSLA 5BUQA 4OXIA 2GZHA 1EKXA 1OWMA 3AG5A 1Q1QA 3K96A 2R1ZA 2OGTA 1GXSB 1I1OA 2BGKA 3GZ4A 3V33A 3CONA 2REQA 2VRBA 2D8AA 4X3OA 1R15A 3ELDA 3V7YA 1OFGA 2YC4C 4HRXA 4XPIA 3T5DA 3V8BA 1B93A 5HFNA 2K2QB 5B1DA 1PR6A 5BQOA 1M7GA 2AZMA 3FW1A 3M5CA 1UPUA 1OZAA 3GRYA 4NBRA 1FDSA 1HDRA 4ESOA 5ALIA 4J0FA 5JEEA 5KQMA 2UXDB 3A3NA 4GR5A 2PRJA 1ULHA 4CNQA 1KZ4A 3CG0A 4K1XA 1LDMA 2GAJA 3DE7X 3NBZC 2QLJA 1M1NA 1Z2CA 3Q11A 4GI3A 3MAGA 2GQ0A 2P9EA 2PA3A 2YOFA 3OHSX 4W7HA 5L95A 5F7JA 1VI2A 3AR5A 2R2AA 3P5SA 1L5NA 1XR3A 4ALMA 2FSIA 5FLEX 1OQAA 4MIOA 2QTBA 5AKIA 1W59A 3UAZA 3EZ2A 4XE5A 1NIPA 1KJ8A 2BR4A 3O2SB 5DEIA 5FOWA 2AG5A 4MRMB 2JPDA 4Y8VA 1TZKA 4GRAA 3R5SA 1VHWA 3LWNA 2XT9A 3SX4A 1GVHA 3NYRA 2HHJA 4C87A 3PFHA 5DRTA 4WH0A 3I2HA 2FDCA 1EFUA 1SY7A 3N87A 2N42A 4QL3A 4TKMA 4GOMD 3DDSA 2HLNA 3GJXC 5A06A 3HNOA 4EARA 4BLQA 5LVAA 5JCOA 3M1YA 2OECA 4URXR 1WDTA 2VAMA 2BN4A 4LCJA 3KQTA 1XEFA 3SC2B 1EM8B 2JS7A 2R7NA 5L53A 1R0WA 2H0RA 1OAOA 2DQKA 5AFSA 1P45A 1XZNA 3LP5A 4GF5A 4TWRA 1R12A 5CDUA 5ALYA 2I55A 1DBWA 3KOZA 2X7JA 4LMBA 1DDOA 4MP8A 3BGIA 1YVEI 3IIEA 3L7OA 3LDFA 1M76A 3KT0A 3HN6A 4KLRA 1C1DB 1MQAA 4AZ3B 2PUTA 2YFYA 4JC5A 4WFKA 4EI8A 2ROQA 3COPA 4KO2S 1H69A 5G3ZA 3KYIB 2WF6A 1RD4A 1AQ6A 4IG4A 1HDXA 2W6MA 3C6ZA 4P7GA 3G88A 5HE9A 2VQ6A 2PSEA 2IPLA 5GZ3A 1UBSB 4WBSA 2F67A 3IQXA 3O4HA 4YMGA 2NPIA 2QMEA 1XAIA 3CY6A 3KPJA 2FF5A 3CLUC 4L73A 3L0PA 1QGED 1X77A 4X84A 5TT1A 2WVAA 2YQ5A 2XGSA 4KK4A 2RK6A 5HJEA 2IZ6A 5AUQA 3UBTA 4AKGA 3HM9A 1FUIA 4ASUD 1B23P 2W2NA 2QTHA 4FMDB 1KSJA 3C3AA 3SXPA 3UK6A 2AE2A 1P75A 4I1PA 1UBKS 4RY2A 4BP8A 4E1AA 3I8SA 4TV8A 3PJEA 1USUA 3BOSA 4RC9A 1DBVO 4C0JA 1OXVA 4NAVA 3UXMA 5JRDS 3H1FA 3LUFA 2EJBA 4AF8A 4ENRA 4TV8F 1C80A 2JIOA 4I2VA 3KYJB 2OC4A 2AFIB 3FCAA 1XRQA 4HEQA 4YP9A 2QOEA 2H1HA 2RCNA 3NDJA 3W6NA 5DULA 2YWXA 4Y0AA 3A4TA 2AHOA 4J0DA 4MW6A 4HN9A 2HF7A 4JBWA 1A82A 5TQ0B 1XDBA 3PPWA 2GZDA 2H5IA 1A50B 5AYVA 5TGDA 3TOCA 3WK6A 3VNVA 5DNYB 1A8HA 3TYXA 1AHHA 1A7UA 5D3MB 4CMCA 2Y1XA 3THYB 1VBKA 3ESAA 3F9CA 3U7EB 5E9JA 1GKKA 4NBLA 1C3XA 1SCIA 4RTRA 2VTBB 1KOJA 2FE1A 1LI5A 2FR8C 2ODQA 2Q8NA 4L51A 4DYDA 3V32A 3LHDA 1XVVA 3D3JA 1X1DA 3MW8A 5JD5A 2BFNA 1S8NA 3GPBA 1M0WA 2DUJA 3B70A 1PZMA 2OSBA 5TF4A 2X0JA 4M54A 3GEEA 3PHIA 2ZAMA 2JNWA 1UZNA 4GBED 4M1YA 1KQNA 3TEMA 1W19A 1WW3A 4FN4A 3RS3A 3PDUA 1I1HA 5J4YA 4Q7KA 2E37A 4FGSA 2FZWA 1JHVA 3G23A 4XRGA 4MVXA 1JJFA 3DLBA 4RGVA 4HLDA 2QW1A 2X23A 3JQ9C 3LTEA 1AKVA 1ZXXA 1Q1BA 1M54A 4MGHA 2Y05A 2JJ1D 3A4LA 1ODKA 1EP3B 2B99A 2BKXA 4INJA 4H35A 5ALNA 6REQB 1YHZA 4KTVE 1E92A 3F2VA 3NEJA 1VG1A 3EWSA 4Q9KA 2B25A 1PZNA 1QV6A 2FPUA 2O8EA 4Q19A 5CGZA 4N6OA 4NVRA 4WBXC 2PUCA 3OWHA 3AVPA 2XF8A 4K0RA 3DVLA 1AV6A 4X1IB 1A3CA 2JFNA 4HGNA 1SBYA 2E5WA 4HNVA 4OQQA 1W34A 2QE6A 2I4IA 4P7BA 4K3UA 3TBKA 1FDWA 2IHJA 2PVCA 3M6IA 1KYXA 1W1UA 1QTNA 4OL0A 3USCS 3LL7A 3ODPA 1O96B 1EK6A 5DF1A 1TFRA 1O6CA 3GFFA 1QCCA 3QFRA 4DQXA 2V0GA 4F06A 3EDRA 2AYXA 4Q02A 1CUEA 1RCFA 3DLIA 1V11B 4JP3A 1ZMXA 1D9XA 2QYSA 3BGDA 4HNQA 5H0IA 1YF3A 3MYYA 4HDKA 2BEVB 4OLHA 3TLMA 1WMDA 2NO0A 1BROA 5AW1A 4LRUA 3IH5A 3ZDXB 5FFNA 5B7GA 2BGGA 3HN2A 3M3PA 4DJ5X 2AOXA 2PX0A 2ZQYA 3B2QA 3HFRA 4MIEA 4RVNA 4UAJA 4V39A 1WF6A 4X1OA 1U5AA 3WAKA 1C0LA 4ND1A 2WG0A 4OO3A 1LTHR 1TU4A 1S2LA 4OBWA 3RU9A 2FSFA 2DWPA 5I6DA 1VB3A 2HBYA 3L0BA 3O21A 5JXJA 4K6OA 2ZYWX 4ICIA 4K6KA 4NZYA 3EC2A 4I6EA 2HI0A 3SZLA 2ZREA 1Z4JA 1K8QA 2I0FA 1YVPA 2GILA 3FZGA 1D0VA 3RJMA 2ZUSA 3UPDA 1OLXB 3EIEA 1JTVA 2VJLA 4JA0A 5AVUA 1KEEB 3L0YA 3JQBA 1PSDA 3PLAE 4X1KB 1YDGA 2JD2A 2ZI3A 1E1NA 3SM9A 3WMFA 1KHHA 1I0IA 1Z83A 4AJ1A 1MW9X 2J5RA 1KDYA 1B0PA 3KSRA 3H9CA 2FI1A 5DNDA 3M81A 2VTEA 1WU8A 4EMSA 3STXA 1K6MA 2XZPA 3G7NA 4BE4A 3WIBA 2VWHA 1HKHA 1UZLA 5A5FA 1I3OA 3E27A 1X86B 2P4EA 5DYWA 4Y1GA 4ZU6X 5THXA 1YFJA 1MD9A 4KAAA 3KXIA 2VF2A 2IYSA 3VR5H 2PSSA 5DU2A 2QTRA 3WRYC 1B7GO 3AY7A 5KTRA 2JCVA 4C7OB 4QE3A 5U9CA 2GRAA 3EUAA 3WLAA 1RQPA 4B4OA 1IULA 4HNTA 1PEKE 4D3DA 1U3TA 1NG9A 3BEDA 2AL7A 3F3KA 2GH1A 2VUSA 1VJ0A 3DMTC 3GAAA 1KU0A 1M6NA 5FTJA 5BNZA 1ADFA 1IXRC 3F2IA 4M53A 1YRBA 4UQPA 4HDSA 1WQ1R 3BB4A 5CJPA 4JAVC 5HMLA 3RTGA 3IQIX 1JTFA 1WMAA 3T3EA 2X41A 5I7RA 2AMVA 2YNMD 4G85A 4LFBB 3D8SA 5DNAA 2FUKA 3OCUA 4OXKA 2AK2A 3L6OO 4GH5A 2AOTB 1RKQA 5K0GA 1SXIA 2XDWA 5EGNA 5AHXA 4C6HA 5CT6A 1QVZA 1JHAA 3BWDD 3D6FA 1MO2A 2F3UA 1Z6GA 1VLVA 4R41A 5TDHA 4GOND 1LK0A 1P5RA 1MX1A 2IYUA 4V24A 1EZZA 3DCYA 4ME6A 1ZA2A 3GBSA 1RXVA 3GJRA 3EXAA 2JGDB 3GY0A 3A2MA 4FHEA 2GDJA 4G4IA 2DJ5A 2QE7D 2YXNA 3TI9A 4PY2A 3W6OA 4OXNA 2QRPA 3AEXA 2BD0A 5DYGA 3LPDA 3ZWXA 3UWMA 5AW6A 4Z4GA 1QIJA 3JWEA 5JY1A 2J7KA 1NVFA 1XP8A 3PT5A 1JW9B 2FRDC 2E5LB 1X1RA 2VTDA 3BRCA 2R1VB 4BNZA 1GZ5A 4K6MA 5TJHA 4UZEA 1EVKA 3ZWPA 3RS8A 3V2UA 4D0RA 1OF1A 3UWKA 2NUPB 5FNVA 8OHMA 4LK3A 3VU8A 1YASA 1H6CA 2Y0PA 3FWYA 4D4KA 3KU1A 4KDFA 3EXG1 3FOFC 1MTZA 1C8LA 2EFEB 5F2EA 5KJCA 3UPUA 1T8PA 3PC4A 1ZG3A 2YXDA 3ZQ6A 4BEJA 2V4MA 3ZLJA 3HM2A 4X41A 1QDLB 1WD7A 2P9TA 4IJ5A 1E6EA 2WINI 1FA9A 3FYSA 4Y3UA 1VJDA 3AUKA 4QT4A 5GTDA 2AEJA 2E6UX 4TKLA 3WGUA 1NT4A 1MEEA 4G01B 1T3GA 5GADl 1P60A 5M3BA 1ECJA 3AIMA 3IE2A 3S6JA 1B4DA 1AB5A 1D5WA 1YAJA 2NUTB 4QLOA 5B3KA 3N8HA 4C05A 2LRHA 3RSFA 4JLWA 2AD5A 2C4VA 1OZGA 4LE1A 2EL7A 4KDCA 4P4LA 2XUFA 4RD4A 4U7PB 1EFDN 2M6SA 4P3OA 1KMQA 2XAAA 2YHUA 3NQ41 4N54A 3KB2A 5JMTA 3X1WA 5D00A 5EMJA 1JZQA 1ZMTA 3ILXA 4OBBA 4I5DA 2O4CA 3NGMA 4UDXX 2V7GA 5JVDB 3DL7A 4ZYZA 2PZMA 5LOVF 3NVKI 2C07A 1XK7A 2WILA 4GKAA 3ZXXA 4G89A 1HT3A 1VP9A 1JKJA 2GEVA 4DLRA 1H9AA 4ETWA 1QE0A 1J24A 4KQKA 3VSEA 2ZULA 1Z5WA 5A62A 5GVSA 3C7DB 4CMHA 3GJQA 4CLRB 4OXYA 1F3OA 5ESDA 1SXJD 4IQ8A 3K3PA 4GUAA 1JEYA 1FBTA 2XUQA 2IZ7A 4DQDA 2OCGA 2JD1A 1CUJA 1IH8A 1DE0A 4FOSA 4M60A 4A26A 1GR0A 2GTHA 4DV1B 2F64A 4QGAA 3VZDA 2VNIA 3BIJA 2AWNA 1H4VB 1VIAA 1PNRA 1AUPA 1DO2A 1I3LA 1CQJB 3HO6A 4L5CA 5DTMA 4B3IA 3HA5A 3JR3A 4YRIA 1ABBA 3VTFA 3UMMA 1NPDA 4NYJQ 1ZUWA 2C92A 4PNPA 3CUKA 3HKCB 1Y9JA 2DG2A 2FWIA 5B7PA 1TEXA 1AB6A 1IG0A 1NBEA 3OD1A 5DM4A 1DQYA 2P6NA 2ORIA 2VZLA 3K9GA 3LCCA 4RGBA 2I29A 3MS2A 5KO2A 1D6JA 1NXQA 1FVFA 4N0PA 3OZXA 2IBSA 3S0JA 2C5FA 4QELA 5JMPA 1L7NA 2DX7A 2V7PA 4YTEA 1N2ZA 2HCFA 2W8BA 3MWKA 1TPYA 4HGOA 4HH4A 2TECE 3BN3A 3KLPX 1XUOA 4PTZA 1W2HA 5MDHA 1GGJA 1PEDA 2AKAB 1XAHA 3KQSA 1XG5A 2ID7A 3PUIA 4LV5B 4IINA 1FW6A 2J0SA 3GCDA 1YDWA 2F1KA 3AKEA 2XE4A 4J0EA 5TSDA 3QE9Y 2QZZA 3H0CA 4KQCA 4EKYA 5FA6A 1U6JA 3FPLA 4HBZA 2BI4A 2IF0A 2PGIA 4C3ZA 5C8DA 1IQUA 2FSHA 3DBRB 4H08A 4JR2A 1XB2A 1ADCA 3BSSA 1A5TA 4ON9A 1L1FA 2ACKA 3GROA 3UG6A 2ZRMA 3O9VA 1C4WA 1N5MA 1GGFA 1EB9A 1UBOS 1BHJA 3TQCA 4IXNA 5U4XA 4UU7A 2AJTA 2D7JA 4JT2A 3P1JA 4U4AA 3PC6A 1RI4A 4MA0A 4R2XA 4F71A 3FTDA 4N3AA 5M7EA 3EZFA 3O9MA 1NUUA 2IPXA 2QD5A 4QXPA 3WGVA 1YZNA 2XT0A 1K4YA 2FPGB 1XL0A 3ULKA 1CZUA 2ZFUA 4FHZA 4LYAA 4OHWA 3IJ5A 4ZVMA 1HH4A 1W88A 2J33A 4BFTA 4WZAA 1X7ZB 4QXOA 3KDPA 4WLUA 5BV1A 4MYTA 1UQUA 2ATVA 9LDTA 4YUWA 4EQZA 1AQYA 5DNCA 2DYKA 1Y0BA 1C7EA 4OKSA 1QORA 5KEIA 3OZIA 2QRVA 2WUVA 4AROA 1DBSA 5BYBA 2J9XB 5IU6A 2PZ8A 4XFDA 4TLLB 1TK9A 3R7WB 4LHZA 4HEHA 4YHHB 2QX4A 3IAM1 3MNFA 4GX5A 4AICA 2YJ4A 4FYXA 2D6FA 1J21A 1NE7A 4RVHA 1JA0A 1MC4A 1Z39A 2X9VA 3ILSA 3OZCA 4BMOB 2BV3A 2Q3MA 2JARA 1T8UA 3ITDA 1CD5A 1E9SA 1WTCA 2P5SA 4DLTA 2CK3A 1WZEA 2C3UA 3KKKA 3R77A 4X1YB 1U3CA 2WP8J 3NGLA 2D3TA 5BUZA 5KUTA 3VDRA 3A9WA 4DANA 3MVEA 4YJFB 3T5AA 5L40A 4NBUA 121PA 4QGBA 3K0HA 3KSAC 3LNTA 4LXUA 3K71B 5A3RA 2RBKA 2HA0A 1VHTA 2PT6A 2VRCD 3M70A 1GRNA 1U7WA 1EE2A 3C6QA 3T12A 4F2PA 4MW9A 4XWGA 1YKFA 1NRJB 5HMMA 1G66A 1P2VA 4BBZA 4CM9D 2XB9A 1EM6A 4YDSA 2ZRJA 3B3GA 2JIZD 5AXCA 1DCFA 4P4SA 4XRRA 4ZYVA 1V3VA 3BSWA 1JDSA 1NQVA 1SQGA 2H65A 3D8BA 4L4YA 4CYMA 4ZJYA 4IQFA 4D3YA 3T7SA 1PX2A 2W2TA 4EPRA 4KPUA 2HEGA 4BNFA 1X8JA 1QG6A 4WOPA 1JG4A 4G56A 3QKTA 4ZQBA 4EY4A 3PFNA 1ZO8A 2A5LA 4YH1A 1FTYA 3KQMA 4RY8A 4A0GA 3K1ZA 1HLGA 2FJ0A 3NTLA 1RLUA 3WYGA 1JNXX 1Y5MA 5CR9A 5D3ZA 4MIKA 1U3WA 4J76A 4CMEA 5J63A 5J43A 2BKVA 2PSJA 1OH8A 4W1PA 2PKRA 4JYMA 1Z6XA 3KV3O 4UBKA 3O84A 2VP3A 3MWYW 4B0OA 4CKWA 5EPUA 4MEBA 4HPJB 4O0LA 4UM9D 3K8QA 5I7UA 2J7PD 1TGYA 3DV9A 3KQVA 4D4IA 1JIXA 6ABPA 1DUVG 5FUBA 1U1EA 2XCRB 5F1YA 1ZM4A 4M7PA 3TZQA 1Q1NA 3QKSB 1KBOA 3MWDB 3DQQA 4DXHA 3QLJA 4Q16A 1UMCA 3LPAA 3ZQKA 2Q3JA 4H3SA 1NSFA 1V9LA 2ETXA 4I9GA 2QJTA 1JFFB 1Q77A 2PRZA 1QO0A 4PF1A 4Q9NA 4YMIA 4DMHA 1Q74A 1QP0A 5D85A 3PX7A 2C31A 4HWKA 4EVSA 4MKHA 4RLFA 1RYZA 2IH5A 1ZU5A 3BMOA 4IS2A 1QC5B 1X6VA 3G1UA 3MPOA 4DUGD 5K01A 1FCJA 3QX8A 2F4NA 2Y93A 1VMDA 1W6RA 3BQ9A 3LH5A 1KORA 4GI5A 2WUWE 4TUYF 2P6OA 3DH0A 3TKLA 3C3BA 3CV3A 2XNSA 1L4NA 2LGJA 4LC9A 3VX3A 1Z0IA 3KJHA 4EY3A 4RJTA 1RC1A 2EZ9A 3ISTA 4CQMA 1E94E 4LBWA 1V4VA 2HM7A 4YV7A 2ET6A 4Q7EA 4R9NA 3RGWS 4AUNA 5I7SA 4P0TA 4HB3A 2O2CA 1MRZA 2C2XA 2D7CA 3L77A 2O2GA 2Z5GA 4D4LA 1RMQA 4G4SP 2RG1A 1QYIA 1PGJA 4JC8A 2ZJYA 3ZGYA 1JEQB 1Q57A 4Y6RA 4FDVA 2C2ZA 2Q5IA 1CRQA 5IAJA 1P91A 4NZOA 4R7ZA 5K2OA 2MYTA 1M2KA 3HI4A 2NU9A 1PYGA 3ZJVA 2F8MA 3ZX4A 2I6SA 1QWOA 4BRUA 3M4ZA 4KHZA 1LDNA 1U99A 2G70A 1RBZA 3P0FA 4X71A 3WJ1A 2R7MA 2UAGA 3IRUA 3NAQA 5LYYA 2PDAA 1LPOA 3A0RB 4M89A 4DVGA 1N6NA 4F6CA 1JR3A 2PUGA 5IKPA 2B0JA 1J70A 3OLZA 5THKA 4HAVA 3U0BA 2CCKA 3HVHA 1HT2E 4M55A 3ZVKA 3R23A 1C7IA 4K40A 1UMDB 3O6VA 4P3YA 5DGXA 4X44A 3E9NA 4MB0A 5I45A 4DS3A 1JEEA 2OGSA 3R0JA 2IEZA 1F4LA 2ZYSA 5JCJD 2ZJOA 3A6KA 3NZEA 1K92A 1EP9A 1M1XB 2B94A 3ADKA 2WDPA 4B4KA 1VZ2A 3PXDA 3NVAA 1X7DA 4HDAA 4HTFA 3SDSA 1S7GA 4TLCA 4F3CA 2VLBA 3WTBA 1KJ9A 1TIKA 1VC2A 1FLAA 1E5LA 4QHTA 2OYCA 4N41A 4Z8XA 1I14A 2VF5X 2H3HA 2BFFA 3KSDO 3NR2A 4GICA 1VBNA 2YOGA 2HU5A 1HNXB 1S5PA 4V0OA 2WZDA 2E49A 2OO5C 1J25A 2C7VA 2BWJA 5CPFA 4EFMA 3EMVA 5IXYA 4AQ7A 1DI0A 4GQIA 4Q4JB 2G8NA 4UHCA 5E6SA 1WDWB 1UIRA 3TLKA 3S1SA 4OP2A 2KB0A 4LKRA 2C7RA 1LNQA 2DQSA 5JANA 3OIVA 2XVAA 3I6IA 4F96A 3TDKA 5GIPE 1YQDA 3QNWA 4JI0B 2WJVA 3WDMA 5K3FA 2OZEA 3OEHA 1F20A 2H0QA 3PGKA 3W4JA 2QS9A 2Y76A 5JS6A 2LBPA 2P3OA 1P1BA 1DL5A 4FHCA 2HCRA 3O2QB 2NQ8A 4P92A 3GRAA 1ZHOA 3F5SA 1R00A 5EVCA 3WHIA 1YQXA 3WWEA 1K7SN 1PFUA 1EVQA 1PT5A 1TLTA 1YKGA 3FRHA 3LQ4A 1WG8A 5K4GA 2W00A 1J8YF 2IHVA 3PZRA 3QOWA 4PQEA 1M6WA 1QSGA 3EBOA 3PQ5A 1KR5A 1SQ6A 1TTHA 4X24A 1DADA 2Q5HA 4LDAA 2J09A 1ZR4A 5K0JA 2FQYA 1JXMA 3IYLW 1TCUA 1ZSVA 4M2LA 1NF8A 1YKSA 4XIYA 5J2UB 2Q41A 2QA5A 1JDBB 1E3IA 4EPYA 3Q5DA 2A9FA 3O26A 4DUZB 1BVHA 3KB6A 4IFTA 2DF8A 2Q1WA 3E61A 3OM9A 4UD2A 3QGMA 4RF5A 4S1PA 1Y9DA 4GMGA 3U4DA 3DNPA 4I1SA 2PH7A 2FWJA 3WIDA 1CUWA 3JYQA 4JB0A 4GQBA 4BN4A 4WT7A 2AN4A 3SZ3A 4E03A 4EJFA 3R5HA 1YK0A 5HK8A 5LC1A 3MJTA 3L0SA 3FDFA 4BASA 1BS2A 3OSZA 1DOHA 3FMIA 4AY3A 2FHPA 3T1NA 1ZGJA 1HWYA 2ZSFA 1DKMA 4K05A 4FBLA 3CYFA 4YECA 4PSDA 1EK5A 3GV0A 3KQUA 3KWFA 2FW7A 1MC8A 1UXIA 1Z0AA 1KQGA 4W9NA 4MKIA 2PUHA 1RAFA 1WHTB 2OT3B 4QYSA 4ROSA 1QQAA 2L18A 3B89A 3EMDA 3HMKA 3LOUA 4QOIA 5EJAA 5HIKA 1U4NA