2W58A

Crystal structure of the dnai
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
188
Chain Sequence
KRQESLIQSMFMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAAIANELAKRNVSSLIVYVPELFRELKHSQTMNEKLDYIKKVPVLMLDDLGAESWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQKVKAARIMERIRYLAYPIEITGPNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOME COMPONENT (HELICASE LOADER)
publication title Molecular Interplay between the Replicative Helicase Dnac and its Loader Protein Dnai from Geobacillus Kaustophilus.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Hydrolase
total genus 54
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01695 IstB_IS21 IstB-like ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w58A01
3DVLA 4NCNA 4C0HA 1U81A 1EFCA 1E2MA 3GLGA 4M1WA 1YKSA 3NDPA 4U02A 3QF4A 4C9BA 1XD8A 3HYRA 2A30A 2XNDD 2HJGA 1OHHA 2Q3MA 1EWQA 1GRQA 4V0OA 2AFHE 1GKYA 1N2CE 4A8JA 5KNCA 3TH5A 1P75A 4R7ZA 1J70A 2EFHB 2Y8EA 3LX8A 4HAWA 4U5XA 4X8HA 5DHAA 3SBEA 1YZGA 1EFRD 2VEDA 5J4VA 2ZI9A 2ZE5A 1NMYA 1UEJA 1GWNA 3IBYA 1EG7A 4Q4AA 4FN5A 4RCYA 1D8TA 4BE7B 1SXJC 5IK2D 1ZM2A 3U6BA 4D4MA 1II0A 1XCPA 1VCNA 1XFAA 4TQUS 3K9HA 4W9MC 2REXB 2VP0A 1YZLA 2NG1A 4Z51A 4RKEA 3BH0A 1Y63A 1CIPA 3K0FB 5H8WA 4HB2A 2BMJA 1NP6A 1NG9A 1P4SA 5FOUA 3T35A 4IVQA 4TMVA 4URZR 2BJVA 2UKDA 2ZRIA 5FI0B 1MO4A 2V8OA 4FD2A 1KGDA 4D4LA 1E99A 3GJ0A 2ZI5A 4MYHA 3KKNA 2WPDA 2F1IA 4KBFA 4FCWA 3I1FA 4KU4A 4B34A 1U94A 2AXPA 2E1RA 1Z06A 2RGNA 4Q4JA 2ATXA 1P6XA 3GJ3A 4DKXA 3PR1A 2J41A 3OFND 4EFLA 4XWKA 4AIIA 1A1VA 2QAGC 1G9XA 1GL9B 3EZ7A 5DI3A 5FL7D 4BLOA 3IILA 1NKTA 2V9PA 2VHCA 2BVNA 4FW9A 3ICQB 4JLPA 1XMSA 4EQ6B 3GLFE 4DCVA 1GNQA 1ZM9A 2EWWA 5KUTA 1E69A 2UZIR 1I4LD 4GZLA 1OXSC 1S96A 1Z0DA 1VECA 2GZAA 5FUVA 4CEIB 2FPLA 4RZ3A 2VSXA 3U3OA 2X8AA 1E9SA 1E4VA 3DO6A 2ZJZA 5HKKA 1G291 4G3XA 3E5HA 4QGFA 4TYWA 1C9KA 1N25A 2PH1A 3CRVA 3AQ4A 3GLHA 4O25A 5EP2A 3TSZA 1W36B 3EIQA 5P21A 2IK8A 1Q22A 2QMEA 3NTUA 3GLIE 2ZRLA 4V03A 4ESVA 2V4ZA 4GMDA 4EPWA 4NYJR 2UZ3A 1E0AA 1KSFX 1ESNA 4PANA 1E2DA 3L8ZA 4M9XA 5J4KA 3ZYCA 1W5SA 3BS4A 2PZEA 1E9FA 4Q00A 2YHSA 5K8IA 1S9DA 3IQXA 1QG4A 1UKYA 4A92A 1FL9A 3BRWD 1UDWA 3JVVA 4NCIA 4GPTA 3Q72A 4KSCA 5TY0A 1IXRC 1OV4A 1G64A 1E9RA 4M9SA 1QHIA 2OFXA 1DE0A 3SYNA 3N2IA 4B3CA 1XPOA 1P73A 2ZJ2A 1AZSC 1KAOA 1KKLA 3PUZA 2YOHA 4H9GA 2QQ0A 3FMPB 1ZUHA 3LXRA 3QXXA 3C15C 3NBYC 3DL0A 3TMKA 4MRSA 1UEIA 1Q3TA 3K9GA 6Q21A 4OHXA 1Z0IA 5KHOC 4B44A 2OXCA 3OE7D 3CB4A 1VYTA 1KZGB 2QTVB 3DKVA 3HPQA 4I4LA 1U0LA 4MRVA 5FOWA 2O8BA 1GVNB 2JLVA 3W5IA 3FDIA 1NN5A 1IOZA 1HTWA 4QM6A 3VHXA 3N5CA 2H92A 4V0KA 3Q5DA 2GZDA 4GMXA 2RHDA 2XSZA 2GEDA 3E1SA 3MMPA 1UKVY 2VH5R 2WSMA 1E79A 4TTPA 2VL7A 2H7VA 2YJTD 3KXIA 5EZ6B 5FTMA 2J7KA 1IN5A 4LV6A 3WNCA 3WMFA 2JCSA 4UJ5A 3WHKA 3EA5A 3QF7A 1NN0A 4W7SA 2BEKA 1OKKD 1KK1A 3KJGA 4XH9B 2PZFA 2B8TA 2QA5A 3QG1A 1ZCAA 1M1YE 1AS2A 1XU4A 1HQCA 1XD9A 1G16A 4ASUA 1FPMA 2EYUA 5FI1B 3W6PA 4A2PA 2F3RA 3BD9A 2HLDD 3NBZC 2QTFA 1JPNA 2GK6A 1G20E 1EFHA 1IY2A 3IEVA 3QSYA 3FHOA 4LHZA 4HSEA 2GILA 4BFZA 5JFGA 3IQWA 4ZI3A 2QAJA 2QQEA 3EA0A 5LD2B 3H0KA 1NMZA 1TPZA 4XD7A 1KOFA 3GLGE 2DWOA 2RCNA 3IO3A 3T34A 1DAMA 3THXB 1N6RA 1Z28A 3NVAA 4EPXA 4U00A 3I8SA 4MA4A 3L8YA 1KO1A 5FPYA 4JS0A 1C4OA 4PTLA 3KL4A 5ANRB 1CU1A 2IHBA 3UG7A 1CLUA 3NWJA 1GFIA 3IKJA 5AJWA 3QEJA 3A1WA 1EX7A 1G3UA 5LDDC 1U2RA 4DRZA 4JLBA 3A4MA 3L0PA 4Q1DA 2WAYA 5GJWC 3VKWA 4D26A 3LY5A 3K09C 1RE0A 1NVUQ 2GEUA 4MITA 2BEJA 2OILA 4LJYA 1R2QA 4CEHB 3ZH9B 5HZHA 5CITA 3LVRE 4OQNA 2ODEA 2F1RA 4C0KA 2VIIA 5TARA 3VR5A 1OH5A 4ON9A 5FTLA 1QZXA 2NIPA 3LD9A 4PSVA 3O8CA 4TLEA 4DZZA 1J8MF 4GT1A 4P33A 4BQSA 3TUZC 2ZS7A 1E0KA 3QKSA 1SGWA 3P32A 1ZRHA 4QJ3A 4YDSA 4MKIA 1VG9B 2H5EA 2XX3A 1FP7A 2PMKA 1CR4A 3FFBA 1R8QA 1TU4A 4W5HA 4G1UC 1P5ZB 1TADA 3FPAA 4B3XA 4XWAA 1A2BA 5CIQA 8OHMA 2HT1A 3LLUA 3FKSA 1Q3HA 3X1YA 1DS6A 2ZVPX 4DB2A 3L2OB 1OXXK 3RANA 4CDGA 1UBGA 1XWIA 2ODWA 1VHTA 5JSZB 3Q9LA 1AGPA 4HUQA 4I1SA 5SZJA 1JQJC 2NOAA 5KO2A 5HE9A 1QHHA 4BFXA 3JZMA 4PHTA 2FN4A 3ADCA 4HZUA 4M1TA 2IYUA 2I1VB 2QTHA 1F2TA 3FHCB 4R2HA 4JLKA 3G5UA 1NSTA 4G5RA 4TYQA 1QHXA 2XXAB 4YXWA 2BKUA 2JIZA 1GKUB 4WBSA 3V00A 5LD2C 5J47A 3T61A 3KKQA 5DN6D 2IS4A 3Q7QA 5BYKA 2ZJAA 4X8LA 1BS1A 1FMJA 3BFXA 1E9AA 3M0EA 5E95A 2AFIE 4HAXA 1X1SA 1NVWQ 4H1UA 3FYHA 4RFSB 5G40A 1T5LA 2C9YA 3BB4A 2O8CB 3MG9A 1JEEA 1P72A 3BB1A 2G6BA 3CRW1 2QM7A 4JVMA 2VP5A 1LB1B 1E94E 2J7PD 1QVRA 3Q8XB 5FPHA 4PQFA 2KBFA 1K6MA 1TF2A 1NBMA 4QXAA 1TF5A 2RGGA 4LJ8A 1RPZA 2KE5A 2FDCA 4D0NA 3NDBB 2WKRA 3B82A 4HLDA 4DDTA 1E4YA 1G3QA 1KK2A 1HA3A 1KTVA 5LB4A 3AVYA 3NH6A 2O8FA 2EW1A 4KV9A 3H84A 4PQYA 3REFA 2YINC 3AF4A 2H57A 1JNYA 4KLNA 4PHGA 1US8B 1RRGA 1CJUC 1E9EA 2DR3A 2ZAMA 3EARA 4YMWA 3V9PA 1NVVR 3WNDA 2W83A 3SYLA 3ZQJA 4OI4A 3SN6A 4DXAA 4ZI2A 3OAAD 3NBXX 2W6ID 4OKSA 1E2GA 4FXPA 5DO9A 3GLGB 1JALA 3QY0A 1O3YA 1Z6XA 2MSDB 1TQ4A 2Q9BA 5AR1A 2H1LA 2ZTSA 3B8HA 3QF4B 4OHZA 3U7GA 5BQ5A 1W1WA 2QY9A 3EAQA 2IYYA 1V5WA 1X3SA 4A8JB 1II8A 3K8YA 4Q9KA 2C9CA 5CDFE 5M04A 1XMIA 1CTQA 1N6HA 1ZP6A 3PUYA 5HCIA 2XB2A 3WYFA 1RC8A 1HH4A 3AEZA 4O2RA 1CJVC 5SZHB 4C0BA 2OV2A 4EFMA 2O5VA 4Q4AB 5CLQA 4Q02A 3U2QA 2FWRA 2GVZC 1AK2A 1OE0A 1ZCBA 4QFMA 5DH9A 3P27A 3D31A 4AKHA 2IT1A 2Q3HA 5E7MA 2Z43A 4F91B 1PLKA 3RVBA 1MV5A 2X2FA 2DWPA 3ZLJA 5JJLA 3TVDA 5FOXA 2IX3A 1KSHA 4TZ0A 1R0XA 3KQLA 1CULC 3AP3A 4OI2A 2BMEA 1OJLA 1S2MA 3QIAA 5JI3E 1LW7A 4BUJA 4C7OA 4ZV4A 4XTRA 3QPVA 2WJGA 3ZGXA 1COWD 1X6VA 2GK7A 4EUNA 1D6JA 3THYA 1G6OA 2YV5A 4PAQA 4G5QA 2VYFA 4Q4JB 5CB8A 4QJ4A 1WBDA 5GJBA 5IF9A 1E0SA 5KDOA 1HUQA 3TK1A 1TNDA 5DI3B 4PQRA 3SZRA 3O8RA 4HB0A 2C9OA 4TLBA 4OI0A 2NO6A 3TNFA 4HLUC 5FTNA 1TTTA 1R0WA 3W90A 3X1ZA 5JS8A 3AGPA 1BMFD 2JJ2A 2ORVA 3VMFA 2OESA 2P65A 2ZSBA 4KAXA 3UATA 2ZRAA 4YMTA 3ZD7A 1D9ZA 1KJYA 5KSZA 4L15A 4Q7MB 4RJLA 5BW8A 1H8EA 2QU8A 2P5SA 4WIAA 2XOKA 1BOFA 3ADBA 3QI2A 3GLHB 4V0MA 4DLWA 2ASEA 1P9RA 2VP6A 3IHLA 4TZ6A 2FFHA 1YZNA 4B74A 4A36A 2VTKA 1Q1QA 1ZU4A 3RRMA 3UXMA 4LI0A 5JJKA 2FJUA 1LVGA 1FNNA 4S2EA 1D5CA 3ZIAD 1IY1A 1YQTA 1AS3A 2F1HA 1XD2A 5TV2A 1KY2A 1VKJA 2GJ9A 3SJAA 4N0DA 4L8GA 4CVNA 2AK2A 4JZKA 3MFYA 2GRJA 5E3HA 1JBKA 3QNUA 2R6DA 4JLOA 5CM8B 4MGYR 2DBYA 4GP6A 3REGA 3ZS9A 4N3NA 4A8JC 3CUEF 3AKCA 2DYKA 1VG8A 2OZEA 1XEWY 2GCNA 1IM2A 1U9IA 3FB4A 5DI9A 3UMFA 2FPKA 4Z8YA 3IIJA 4FINA 4FMDF 4I81A 5DSZA 4B2PA 1MOZA 1EK0A 3SJBA 2XAUA 2RHMA 4LY6A 2V7QD 2AK3A 1CR2A 1UADA 3SR0A 2Z6VA 4Q4HA 4YMVA 1Z63A 5FUXA 2P2LA 4DC9A 3A1UA 4KVGA 1VYVA 4C2UA 2WAXA 1GRRA 3T5DA 1HE8B 3CW2A 3AVTA 2NTYC 2O8BB 4TLDA 3PJRA 1CJKC 1YR6A 1Q44A 3R9WA 1AM4D 1ZBDA 1DAHA 3GCGA 2ZUCA 1JR3A 4DDVA 2DFLA 3AKYA 2C04A 2QENA 1UBCA 4Q1AA 2YYZA 1ODFA 4MKFA 4M1OA 2G83A 3CZQA 2R62A 2XTMA 1YR7A 4LJ5A 1W49A 2GTPA 2VHQA 4Q9IA 3VR2A 2R6AA 3LWNA 2CK3D 3BXZA 1L7VC 1NBME 3I32A 4KYIB 4CF7A 2HYIC 2BKEA 4PR0A 3ZZ0A 3GJ6A 3WYAA 1EFUA 4M21A 5CM9C 3GLFA 2Z5FA 4IEIA 2G1JA 4OJKA 1ZD8A 3QBVA 1RIFA 4BRWA 2ORWA 1E6CA 3KUCA 5HPYB 5KYKA 3KUDA 2FZ4A 3DOFA 4O2LA 2XZOA 3IIMA 3KB1A 3EPJA 3GEIA 4FCVA 3U7HB 1KI9A 4NMMA 2PL3A 1UDXA 2ZJYA 4C30A 521PA 4F7WA 1KI2A 1ZC3A 2F55A 1IHUA 4UQOA 2GDJA 2BM0A 1SVOA 1ZD9A 5CYPA 4ZKEA 1NIPA 4LC1A 2WJYA 3TUIC 4B2IA 1YZUA 5IDVA 4M9QA 3GLIA 2W2TA 1G8HA 2OT3B 2I4IA 1RYFA 4V0LA 1P2SA 2JLRA 4AURA 3MD0A 1XBTA 5G3ZA 2ZRNA 2OAP1 3C5CA 3T15A 1E1RD 2FG5A 3UWOA 4C4PA 1IXSB 3CBQA 1Q1BA 4LJ7A 4LOAA 2QT1A 3HDTA 2AXNA 1H8HA 3JZAA 3MUFA 4RSGA 2QPTA 1SHKA 1HQYE 2I3BA 1HY3A 1HEIA 2ZSFA 2VLIA 4AG6A 2IWRA 1TQ2A 3VR4A 2YZ2A 3U7EB 3GJ5A 1SHZA 1Z0JA 3QXSA 1JI0A 4QGHA 3RNLA 4LZZA 2VBCA 4MKGA 4LYFA 4QHSA 4TT3A 3LW7A 1L8QA 3TW4A 3PEVA 4I1OA 5HE8A 1SKYB 1IN7A 2NGRA 2HCJB 2CHGA 2IHYA 2XTZA 1PJRA 1N6NA 1TQDA 3L0SA 3QKSB 4B3GA 2Q9AA 5AUQA 3AVOA 1KIMA 1QHGA 4I1VA 4WA7A 3RRZA 1FUUA 3B1XA 5FBWB 4YMSA 3KFXA 1DADA 1Z08A 1FFHA 2FSHA 2WJIA 4N0EA 2BBOA 4IHQA 2ODBA 1EX6A 4OHWA 4L4UA 3EC1A 2IUSA 3MLEA 3ADDA 1EFTA 1F48A 3ICEA 1ZNYA 5JBQA 121PA 2CLSA 1ZVQA 4ZIRA 2X1VA 4QGGA 1I2MA 4EPVA 4HUQB 3WP0A 1G8PA 3PEWA 5CIWA 5FR2A 4P3YA 1FW6A 3HP1A 1GL7A 1OXUA 1Z5ZA 2GJKA 2VHUA 2F9MA 4BPBA 1QHHB 2IF0A 3W9YA 1E1QD 4HZUB 4TL7A 1KI1A 4BWYA 1F2TB 1WF3A 4XVRA 1MH1A 2VP9A 3ZVNA 3A1SA 4LJ4A 3C7KA 2GBLA 4Q4LA 1K5GA 4PPFA 3B5JA 1GITA 3V4RA 4NP6A 5BN5A 3EIEA 2PEZA 4FMCF 2HT6A 2WBLC 1Z47A 1P2VA 2D3WA 4HATA 4AYWA 2ZYTX 4NYIQ 3W8NA 5EXXA 1G7CA 1W4CA 3FWYA 1P60A 5KDLA 3KXKA 1G3MA 3F5FA 3MSXA 1BO6A 1TEVA 1T8TA 3BAFA 1KDTA 4RD3A 1XCGB 3KXLA 4JSYA 1ZU5A 2IEZA 3D8BA 1E0JA 1W4BA 3BGWA 4I99A 4Z1MA 1KNXA 1Z6AA 4TL8A 2WKPA 1FQJA 2O8FB 1UPTA 2YWHA 4GBMA 1E2QA 1KK0A 3EZFA 3O47A 3VTKA 4DBLC 2ZQ5A 5FTJA 1G19A 4LYJA 2PLRA 1JR3E 2O0KA 4QGAA 1U8AA 3A8TA 2AR7A 3A4LA 3U60B 4HLCA 3EASA 3CO5A 4X8OA 1Z3IX 1LS1A 4F93B 2OXRA 3CH5A 2GESA 4QG7A 5EP4A 3CX6A 3QBTA 2JLXA 4TLAA 4BECA 4R2IA 3SHWA 2ZREA 1BYIA 2QROA 5AUPB 3OESA 2WJJA 4POAA 1N5KA 3RS4A 3U4QA 2JJ1D 1WRBA 3SQXA 4ZDIA 4KYUA 3GJXC 4GI7A 2XNDA 1A2KC 2REOA 3AVWA 2F3TA 1II8B 1JJVA 1B23P 1E2LA 1Z29A 4JIMA 2IWHA 4PC7A 2C78A 4B71A 3SE0A 1Z0KA 5CK4A 3WXMA 4LX0A 4CRWB 1CXZA 2ZJBA 2QGZA 1EFRA 2QP3A 2ZU0C 1U90A 4XVUA 1HV8A 5IK2A 1KI3A 5BWMA 5FOTA 3R8CA 4EIWA 3J81k 5GADl 2YC2C 1P7CA 2GETA 4TTQA 4EJSC 2RH5A 4TL6A 1NLYA 1ZNXA 4NONA 2RGBA 3EPLA 3BOSA 2J5XA 2YVUA 1SVSA 4HB3A 2FA9A 2FEOA 4PZYA 3FHTA 4C7OB 5TB5A 2LKCA 1BKDR 2B6HA 4H1VA 2GHIA 3THYB 3NHBA 2JEOA 4JL8A 1JR6A 2D2EA 4DLXA 2B7BA 5L3VA 2FOLA 2TMKA 2J87A 3OFNA 5FPTA 1KKMA 2EYQA 4DUGD 4IDPA 3ASYA 5H68A 3K0AA 3B1ZA 4GP7A 5FL7A 2IYLD 1YU9A 2R6FA 3EZ2A 4AKGA 1W4RA 5KNDA 4MGIR 1WP9A 1KO5A 4ILEA 1QF9A 2ZU6A 1VMAA 4UXIA 2DCUA 4M1MA 4PPNA 5A4JA 3NKVA 4NBSA 1T5IA 3H1TA 2WIAA 2BC9A 1P2UA 1OLOA 1UF9A 2ONKA 5J5CA 3B1WA 2OCBA 4BFTA 4CT5A 1Q0UA 3PG5A 3CX8A 4DJTA 2ERXA 4Y0AA 1R4AA 1UBFA 2CLCX 3KX2A 1NY6A 4AKIA 2VHJA 3EWSA 2BBSA 2P5TB 4Q7LA 4LPSA 1DO0A 3DHWC 2QPAA 2D4HA 4G5SA 5HZKA 2WJHA 4LDJA 1KHTA 1F2UA 5B58C 1XD2B 3E70C 4UNNA 2IYRA 5DE3A 1MO3A 3D7MA 1UBEA 2UVQA 1Q1EA 1XRJA 1CBUA 2EFCB 3AV0B 3WBJA 1G7RA 3WP1B 4NZYA 4K8OA 1VCIA 4RD0A 2DB3A 2AWOA 1CEEA 2CNWD 3CPHA 4QBFA 4GDFA 1PVOA 5CDFA 2ODNA 2WWYA 3LO5A 1AS0A 2J0UA 1SXJD 2WWHA 3QXJA 1T4GA 4BEJA 1NI3A 2ZRKA 2CLDX 4XWOA 1KSGA 1Y3AA 4AYTA 3IIKA 3NC1C 1JAHA 3P4XA 2A3RA 4RFVA 4Q4HB 4X8MA 2XGJA 1W36C 3PFIA 1YR9A 4M1SA 5EE3A 2GF9A 1OH6A 2PJRA 3GEHA 2ZM5A 1VTKA 2J0VA 2V1XA 2CL0X 2P6UA 3OE7A 3SBDA 1TAGA 1WBBA 2A5GA 2C8VA 3VNVA 1WE2A 3EIHA 4LYHA 3GEEA 2WHXA 4PO9A 4QHTA 4RD4A 1O87A 4EPRA 5FOVA 1HYQA 4E09A 1TU3A 4MYUA 4DSUA 5CJ2A 1TL7C 3BJIC 3OIVA 4JLMA 4FMDB 1II9A 2N42A 5KSYA 3I4LA 5HTKA 1ZC4A 1IAQA 2W00A 1NSFA 1YHNA 1YJ5A 1E2KA 3QKRA 3ND9A 2ECKA 2GVDC 4HEJA 4LRWA 3AH8A 3QOFA 4EFNA 1T3HA 5A0FA 5K8LA 1DAIA 3K70B 1UM8A 3FKQA 4B3DA 1OKKA 1Z2CA 4Q9HA 2WZQA 2A5YB 4Q19A 4TSFD 1FTSA 1YR8A 3GLFB 4Q1BA 1YVDA 3IHWA 3WMEA 2W2VA 3OZXA 1MO5A 4V0NA 4A0GA 4B6EA 3CH4B 4M9ZA 4JYBA 2HLDA 2NO0A 5JRZA 3PXGA 3ZDQA 4C0LA 5F3WB 3VKHA 1HT2E 2ZI3A 3RAPR 1GSIA 4B3FX 1IJFA 3QXCA 1OXTA 3V4FA 1N0VC 1OFUX 1Z0FA 3RABA 2ZYUX 1R5BA 5TMPA 3B60A 4P4TA 3UK6A 1IONA 4BGDA 3GLIB 2GEVA 1XZQA 1QHNA 3LA6A 4Q7JB 4YMUA 3EXAA 3TR5A 3C41J 1FP6A 3DDCA 4AWXA 4QL3A 2DFNA 2F7SA 2B92A 2NPIA 5BN4A 1HT1E 5JWOA 3MWJA 4OHVA 1NMXA 2JAQA 2NO1A 1VG1A 4WAUA 5JS7A 1PLLA 2NQ2C 4QOSA 5JWRA 1DTSA 2IYQA 1RKBA 5JRJA 2EU8A 2G3YA 2BCGY 2F6RA 4JVSB 4D25A 4ARZA 2QORA 1U9IC 2XB4A 2CJWA 2ZROA 3BWDD 3SNHA 4D4KA 2VSOA 5FPSA 1KDRA 3O8BA 3B7GA 4CEJA 5EUMA 1E32A 3ZVMA 4DCNA 1MKYA 4TQ9A 4HI0E 1VIAA 5CK5A 2BJWA 1X8KA 1GZSA 2KWIA 3H86A 1W5TA 5TXGA 1S0UA 5AJVB 4IOLA 4GL2A 3CZPA 1RZ3A 2WIBA 5EZ5A 1LV7A 3HU3A 3PUWA 1MRSA 4W5JA 2W2XA 1F3OA 5BN3A 3QXHA 4NCKA 1IBRA 1Z83A 4KXFB 4TMXA 3RDPA 3OEHD 3IUYA 4NHOA 3PIRA 2LKDA 4UNQA 3QKUA 4WZAE 2V6JA 4DSTA 1OYWA 1XMJA 1MT0A 1XJ0A 3N2EA 3TRFA 1KDPA 1XEFA 1KNQA 2ZE7A 3QE0A 4ZIRB 1FUKA 3A58B 3H4MA 5HCNA 3AUYA 3KJIA 1OIXA 2ZR9A 2OCPA 5FL3A 1X1RA 1JXOA 4JVNA 2NO9A 3ETLA 2WOJA 1E2JA 2FU5C 4C0SA 4P0TA 1P9WA 5JMTA 2CDNA 3RWOA 2Z83A 1VYUA 4GOJA 3HR7A 5A5GA 4WVFA 4OQXA 4LBVA 3WMGA 2YC4C 4A1FA 2PJZA 5EE1A 2ZSAA 2IYVA 3VHLB 1W36D 3I72A 4E5UA 4ESHA 2Q9CA 4IW3B 1P3JA 2OE2A 3BC1A 3T12A 1JAIA 4DB4A 1SZPA 2XTNA 3SC3A 3CRRA 4DCTA 2ZXUA 4TYNA 2EFEB 2WWIA 2ZI7A 1YZKA 4LHYA 5DN6A 3RRYA 1NLZA 2N46A 4AI6A 4WW0A 2IF2A 4UXHA 2MMGA 4MKHA 2W6JD 2CL6X 2Z4RA 2ZRPA 5L8VA 2JA1A 1XZPA 2JATA 3QUSA 5AUOB 3HU1A 4KBGA 4IEEA 4O0MA 4JBXA 1PUJA 2BIFA 3GMTA 1ZD1A 2ZITA 4Q1FA 5D3MB 1AGRA 5KSOA 3I8XA 2OM2A 2PT7A 3CIOA 2J7PA 1F5NA 4FMCB 2PLFA 1QRAA 2CVHA 2RKOA 5FFMA 3VU9A 5EE9A 4D2IA 4JKIA 1XPRA 5F9FA 4JT2A 2FV8A 3NBFA 1SVWA 4URWR 1U0JA 4MDFA 4IVRA 3EZ6A 2ZS9A 4URVR 1OYYA 3N70A 4NYMQ 1NKSA 3KJHA 1H8ED 2HF8A 2WWGA 2ZRBA 3B1VA 5KU1A 2YOFA 2VA8A 2CVFA 5JLJA 1E2PA 4HAUA 5EXSA 2G88A 3OAAA 3LLMA 1HURA 2DY1A 2QL6A 2D74A 1JJ7A 2W6IA 1JXMA 3KQUA 4Q9LA 2ZUBA 5FOSA 1UKEA 3IDQA 2FZLA 2X77A 1G5PA 3U4QB 1JPJA 2ZEJA 1CF4A 3TBKA 1Z07A 2O0HA 4DLVA 5AWFC 3DZ8A 1T0JB 1XTQA 1Z6TA 2QNRA 4L5BA 5AJZA 5SZKB 1TMKA 5CLLA 1SXJE 4JT4A 2QE7D 3U5ZB 3CNLA 4MH0R 2HCBA 1DAGA 5F98A 721PA 4AYXA 2V55B 1NN3A 1G17A 1M8PA 4HDCA 3I5XA 3W3ZB 4AY2A 1CKEA 2H16A 4KFRA 2FH5B 1RJ9A 4RY2A 4BASA 1W2HA 2D2FA 2GBLC 2WV9A 3SI7A 3LFUA 4F38A 3OIUA 4DLSA 2KB0A 1KI7A 3AKDA 2L0XA 1OIVA 4KFSA 4CYMA 3AGQA 3RSLA 4TYPA 4ZKDA 5KTYA 4W5WA 1W0JA 3E2IA 3LBIA 3KB2A 5EE0A 2VPPA 4C2TA 2NO7A 1COWA 1G21E 3EPKA 3SFVA 4D4JA 5GJCA 2FSFA 2WMOB 4Q21A 1T8UA 2C77A 3C16C 4BLQA 4LV8B 2IA5A 3K0AB 2D06A 1VCMA 1YRBA 1G8GA 4LPKA 4BZXA 2YWFA 2EFDB 3WRYC 4BFYA 4RD1A 5L3SA 3P26A 2XZLA 1BMFA 3RS7A 1AKYA 2LWIA 4DVGA 2H18A 1ELOA 2GZHA 4ZPXA 2IS2A 1W0KD 2WM9B 1KAGA 2JDID 4KSBA 2REBA 3QVVA 1AA9A 2NMVA 1NN1A 2ZJ5A 1XTRA 2WSSA 5F9HA 4Q47A 2ZRCA 1XEXA 3BB3A 1N3BA 1C1YA 4PC6A 4M22A 3TIFA 4C0QC 1LNZA 3VFDA 3ECCA 2WJVA 1GG2A 4ABYA 1YRAA 2ZI6A 3LV8A 1XXHA 1N0WA 2HF9A 2BWJA 2RGNC 3TJZA 4B47A 4F4JA 4K46A 1F2UB 1SKQA 2WVJA 3FVQA 3OHMA 4JMPA 3ZIAA 3CWZA 2DFKB 1ZMXA 3ZZTA 2ZAOA 4TTRA 4DLZA 4KITB 2IEYA 1G8FA 3ZVRA 4YDHB 5GVRA 2OLJA 4PAMA 4CGZA 1ZNZA 1NVXQ 1Q1ZA 2V6IA 3U44A 5J40A 1MO6A 4M1KA 2ANBA 1H8HD 2BMDA 1XB2A 1NLFA 2B8WA 2Q3FA 4XSHA 2J0UB 3K9LA 4A6PA 2QP9X 1W4AA 1T9HA 4LV5B 1EESA 1DG3A 3U3RA 1OFTA 2Q21A 4IDOA 1WB9A 1N5IA 4JVLA 2CCKA 2RGEA 2V7QA 2MSCB 1P9NA 3OEED 1T3SA 3B1YA 2ZSEA 3Q3JB 5FBQB 3DMNA 4F92B 4Z54A 1XMVA 2VSFA 4BLRA 3CNNA 4IVPA 1MRNA 4NCHA 3K0EA 2RMKA 3SEAA 2ZIAA 4RZ2A 2QMOA 3C8UA 3IEUA 3WNBA 5L3QA 5FR1A 5KPDA 2C98A 2W58A 1ZUNB 3AVUA 2AKAB 4YC7A 4GOXA 4F4IA 4IDHA 1PV4A 4IDNA 5DIFA 4TMTA 5FBLB 1NJGA 3T06B 2IYZA 4OBEA 2IYWA 1QVAA 2IXFA 5G3YA 4OK3A 4XIGS 2EFGA 1KJZA 3W8RA 3QKRB 2CK3A 1XEWX 3M4YA 1KI4A 1ZYUA 3K0CA 1QDEA 2IC5A 2FGKA 2SHKA 2R8RA 3B78A 4HDOB 4UJ3A 4WXPA 1KO7A 3B2EA 3SJCA 3EG5A 4BLPA 4G5OA 4LCBA 2QP4A 1N5LA 4A6XA 1K5DA 4B76A 4BFWA 2JLQA 2ZSDA 1GIAA 2LCFA 4DT1A 1KI6A 1LF0A 421PA 1AN0A 1IN6A 4LWZA 5K8UA 4YLGA 4TMKA 2FSIA 3UMRA 4E07A 1DARA 1GILA 1ZUIA 4WXRA 3T1OA 3OIWA 4NYIR 2QGNA 3NIBA 2AN9A 5GJVC 5D3QA 4RD6A 1P2TA 4IOKA 5FUYA 1D2EA 4S35A 3W6NA 1DO2A 1S8FA 4TQAA 4E03A 1WQ1R 4PX9A 3K9NA 5TVKA 2BBWA 3W6OA 2ZR7A 3PEUA 5F2EA 4DLRA 1OHHD 1OF1A 3I61A 3VKGA 4C3ZA 4LJ9A 1CR1A 1GAJA 1SVMA 2WTUA 1R6BX 1N6OA 4Z8XA 4P4UA 2XJ9A 5JCZA 1FNMA 2ZPTX 4MYTA 5G53C 4A0FA 3A36A 2ZYWX 3U3MA 1G3IA 2FFAA 3GFTA 3H2YA 2P67A 5IHPA 5ELXA 4IFBA 4RCZA 2F9LA 4ARZB 4E22A 1GM5A 2CJWB 2F1JA 3M1IA 4DEXA 3T1TA 4TWZA 4B3BA 4IFEA 4CEJB 2CHQA 5JJIA 2OSBA 3R9IA 5JZVA 1QHSA 3F3YA 2ZUDA 4OHYA 4OQFA 2C2HA 4B48A 1FQKA 2V54A 5J4LA 2ZRGA 2QSZA 2VP2A 3AKEA 1RVDA 2YKGA 3RS5A 3FTQA 3I3SR 2WPDD 4PHFA 3TE6A 2MSEB 4QRHA 1R5OA 3THWA 4HB4A 2A7QA 2Z0MA 3MGCA 3S1AA 2O8DA 4FI3C 1E9DA 4KFTA 2C99A 1N6IA 1XNJA 2NZJA 4M0LA 5JI2E 2G9NA 3CWQA 3HJNA 4JBYA 3PENA 1M74A 2KBEA 3L82B 5D3MA 2IW3A 3UWKA 4Q9JA 4KO8A 4B75A 3IGFA 4DHEA 1E96A 1M7BA 1XTKA 2GCOA 1MABA 1KMHA 3QEOA 1WDTA 2O8EA 3BFKA 1JECA 2PX3A 3KQHA 5E7JA 3KKMA 4XTCS 5G41A 1TUIA 2OBLA 1Q21A 4LUCA 5FH9A 2QRNA 2K5UA 4A15A 4JLDA 4QC2A 3PITA 3NH9A 1SVKA 5HKKD 1DELA 3F8TA 4OQLA 3UMSA 2BDTA 1E1QA 1J99A 2IXGA 1GDDA 3QKTA 1XXHE 4FWIB 4DIDA 4ZCIA 4OL0A 3C4JA 4DDUA 1OW3B 1RW4A 2WMNB 4JBWA 2R6GA 4EPYA 2V1UA 1ESMA 1TX4B 4I1UA 4LSGA 4B6FA 3HWSA 3FFAA 2QG6A 1D2NA 4PHHA 4OYHA 4R98A 3A1VA 5DGXA 1LTQA 4QBIA 1I2DA 5FUWA 4DDWA 2R9VA 3Q5EA 4LK2A 3MWLA 4A9AA 1U8YA 3CKLA 2CE2X 4IXMA 1T3LA 1KJWA 4DLTA 4URXR 2DHRA 1KK3A 3VQTA 4KJZA 2VQSA 3ZS8A 2WWFA 5JEEA 4D81A 1OB5A 1DAEA 3GQBA 1RFLA 1OB2A 3AVXA 1U99A 3SYKA 3RHFA 2G0TA 3LNCA 1KO8A 4LHXA 2GXSA 5GVSA 1TEXA 5IT5A 1QBKC 2OCAA 1JQLB 2QT0A 1M7GA 1L4UA 4QM7A 2EVWX 4UNPA 5UKDA 1T0HB 2ZYVX 3VU9B 4D82A 4M2LA 4NCJA 4P32A 1GOTA 4ZCLA 4CW7A 1FZQA 1ZIPA 4K81B 4BFUA 3TAUA 4L9SA 5FPKA 4KFUA 2CXXA 4A2QA 4PO8A 4Q66C 2F43A 3CPJB 3BIFA 3SOPA 5C1BA 1ZNWA 3X1WA 5EP3A 1R0YA 2OCYC 2H8KA 1D2MA 1S9HA 3VR1A 3I62A 2XSZD 2QUZA 4PPQA 3B85A 1X8JA 3CLVA 2BBTA 1TQ6A 4NDZA 1E79D 4LC0A 3ZQ6A 2KJQA 5L3RA 3WRXC 3NHAA 4QHYA 1GRNA 1FMLA 3KTAA 4HYYA 4NPHA 4PC2A 1XDBA 2J9RA 3R9XA 1OPXA 4LBZA 1PZNA 1SULA 2RB4A 1MR3F 3RWMB 3TR0A 2JJ1A 1N5JA 1A4RA 4PSAA 1GNPA 3B6EA 2ZRHA 2QMHA 2JGNA 1LY1A 1J2JA 4N1AA 3K1JA 4Q7KA 4QBGB 4ASUD 3VAAA 1DOAA 1GUAA 4NL4H 2X2EA 1KYIA 1QG2A 1NJFA 1K8RA 1G4UR 2QM8A 4M53A 3RS3A 4JYCA 2ZE8A 5K8TA 4DCSA 3AP1A 4R71A 1G6HA 1PUIA 1T6NA 3EPHA 2GJSA 4URYR 4HAYA 4XSGA 1RJ9B 4PSKA 4TL9A 4XD7D 3AF1A 3U61B 5CYOA 1TUEA 3A1TA 1DG1G 1PLJA 4MUBA 4IRUB 5E4FA 5DLQC 4FWTA 3KZ1E 1AQUA 3UIEA 4KODA 3BK7A 1UAAA 1ANKA 2R6CA 3BBPA 2IL1A 1G3RA 2XZPA 1Q12A 5DYIA 1XPUA 2E9SA 4NYJQ 1IXZA 3MAAC 1G8YA 5DISB 1CR0A 3TUJC 2IYXA 4HLQB 1OH8A 2QRZA 1DPFA 2ZS8A 4ACBA 5EE5B 4MQBA 2AHOA 2Z4SA 2NZ8A 4RD2A 4DUGA 3DM5A 1G5TA 2ZE6A 4KHZA 1UKZA 3G82C 3JVUA 3QPWA 2CMKA 5L3SB 2RAPA 3KDSE 3GD7A 3PUXA 3X2SA 2ZJOA 4GZMA 2CL7X 4PFSA 2P6NA 3I73A 2W0MA 4AKEA 2JLWA 3GPLA 2AL7A 3AB3A 3DM9B 3LVQE 4QBHA 3CF0A 4GFDA 1RRPA 1LFDB 4NH0A 4M8NE 4D80A 1BIFA 3TSWA 2EQBA 1OFIA 3GFPA 2ONJA 4XJXA 1XEXB 2OHFA 4NE2A 1Z2AA 4P4SA 2JLSA 2P3SA 3W34A 4B2LA 4EPTA 1OH7A 2J46A 1W2GA 3I92A 2RGAA 1Z6GA 1VIYA 1XXHB 1ZM7A 1FX0A 3CRQA 3SQWA 1VG0B 1DAFA 4G0NA 5DYGA 4UNRA 3R7WA 1RRFA 1NG1A 3FKSD 4BRUA 4IOJA 1EXMA 3F0TA 4ITRC 1E3MA 4ZDKA 3LXXA 3U44B 4OK6A 1QHYA 1A5TA 1R10A 3BH6A 1W48A 3CR7A 1GTVA 2OG2A 2CNWA 2C03A 3WBKA 3I5YA 4WZ6A 1G41A 3R20A 3TQCA 2CE7A 3U3KA 1G4AE 3ZJYA 1S4QA 3QVUA 1SXJA 5C18A 3CX7A 5HR5A 4OJQA 2GCPA 3ASZA 3CONA 3KQKA 4BZPA 1KO4A 3GP8A 4JL6A 3P4YA 5SZIA 3K0SA 3QQ5A 5KDDA 1H65A 2OFOA 4PC3A 2CBZA 4HZIA 3DOEA 3SJZA 3CPEA 2IS6A 2QN6A 3RC3A 4YXWD 2JIZD 2XITA 2GXQA 1KSJA 1NY5A 5L3QB 1G5RA 2A9KA 3PEYA 2OLKA 3D3QA 1DBSA 3C5HA 4RZUA 2D7DA 5TDHA 1GL6A 3DPUA 4A82A 2DPXA 1N6LA 1Z6YA 4OK5A 5KNBA 2QAGA 4ZCMA 1U98A 3DMDA 4ERNA 2WICA 4NU0A 1KMQA 1G7SA 1R7RA 1NL3A 2C95A 1CRQA 1IN4A 4MRPA 2GXAA 4AK9A 2J0SA 1NBMD 2QPOA 1WXQA 3B9PA 4II7A 4TSFA 3LQRA 1L2TA 4QNRA 4MRRA 1UJ2A 1CRPA 3QENA 4OQMA 4DT1B 1KI6B 1UFQA 2HXYA 1CP2A 2J59A 3GLHE 1AJEA 1GNRA 5B30A 4LBWA 2FX3A 3FMFA 4Q1CA 2WKQA 3MRSA 2QBYA 1Z8FA 1W44A 1CJTC 1GP2A 2JASA 1AQYA 2VP4A 1XTSA 3AF3A 4R9UC 3UANA 4EJSA 4F4CA 3ONWA 3O8DA 3U6KA 4A4DA 2Q6TA 3PV0A 2DFTA 4LGMA 4LJ6A 3THOA 1Z22A 2FSGA 3SDZA 4Q48A 1KI8A 3VR3A 1BYUA 4ACAA 3AVQA 4EKDA 1J90A 2ZRFA 5EJEA 3K70C 1GKIA 2PZGA 4PZZA 3L0IB 4TMZA 1X8LA 2A2ZA 3GJ4A 2ZRJA 4LBYA 5EXPA 1I4DD 3VX4A 1KY3A 4V02A 2XJ4A 2DWQA 3BE4A 1IY0A 1SVLA 2ZRMA 4ZO4A 2H17A 3LAWA 3EC2A 821PA 3WYGA 1ONBA 1XJQA 2VF8A 3MWKA 2RGCA 4NYMR 3K0FA 3QG5A 4OI1A 1W46A 2W0SA 3W3AA 2HDNB 4MYCA 1L4YA 4KI0A 1E2FA 4AG5A 3R8FA 2CHVA 1U0HC 2GJAA 2YOGA 4M4SA 2VRWA 1E9CA 1M7HA 3THWB 2AD5A 3S1AB 2O8DB 1CS4C 1XJCA 3AVVA 3X1XA 2ZRDA 3OEHA 4B43A 1P62B 2IUTA 2J3EA 1V43A 2IYTA 4RKFA 1N6PA 4B33A 3CR8A 4CT4B 5BXQC 2GF0A 3U7FB 4Q01A 4US0R 2YNMA 2NPFA 1NNEA 5AUNB 1VHLA 3Q85A 5JWHA 2OO7A 1RRCA 2PCLA 4FCTA 1J8YF 1XCMA 2GXUA 1NIJA 2GCOB 1MABB 1KMHB 4Q5IA 5FTKA 3K0CC 3W5JA 2O8EB 2PEYA 2JJ2D 4EQ6A 1W7AA 4LHVA 3T1QA 3TKLA 4JLVA 4CIDA 1EGAA 3IBGA 4PC1A 2RGXA 3AUXA 4MDEA 1S3GA 2R44A 3G0HA 4PXAA 2JLUA 1BH2A 1G18A 3EWAA 4CEIA 4CZ2A 2ZR0A 2C5LA 4TLCA 2XOKD 4JLNA 2B21A 2ZJ8A 3DEFA 1DEKA 2QMUA 1A7JA 1XX6A 3ND8A 3D6TB 4JL5A 1A82A 2OBNA 2FPMA 5B57C 3ZD6A 3PQCA 2ZVQX 2I1QA 5C2JB 3K53A 2KSQA 4O3MA 2GKSA 1NVVQ 3LH5A 3ZVLA 4DLYA 4ZDJA 4EDHA 1RYHA 1X86B 2GA8A 4GOKA 3T1VA 5H70A 1OXVA 1WA5A 3NEYA 4DSNA 2J1LA 1W0JD 3LQQA 1ZJ6A 2GAOA 2A5FA 1G7TA 2FFQA 2W6JA 3PVSA 1Q20A 1XP8A 4DWJA 2J45A 2FFBA 2FMXA 3NEJA 3RRNA 1OFHA 3K09A 2HV8A 1B0UA 1KDOA 5JECA 2IYSA 5JCPA 2JLYA 5C46F 2ATVA 2YWEA 3TGPA 2KI5A 4MGKR 4D0GA 1F6BA 2OBMA 3B13B 3HPRA 1WMSA 3IPYA 2YWGA 3C14C 3LBHA 5LPNA 2HUPA 3T5GA 4PO1A 1SKYE 1DVRA 4BFSA 3TW8B 2F43B 5KPJA 2IXEA 2WSSD 2BOVA 4TYYA 2PMDA 1JR3D 1HE1C 2OEPA 4C0AC 2WWWA 3QJYA 4IDQA 3LDAA 5AK0A 4L9WA 4D6PA 2D7CA 2BHRA 3KKOA 1EWRA 4MRNA 3MWYW 5KSPA 3RSOA 2QI9C 3KTAB 2BM1A 4TN1A 3FMOB 2VO1A 4PAOA 2FE4A 4BLTA 2D62A 1OIWA 2QSYA 3A37A 3CF6R 5H1YA 3K70D 1XF9A 2G0NA 3TLXA 1VDZA 1S1MA 3RS2A 3WY9A 5CB6A 1OSNA 1ZM3A 4AD8A 5EP1A 4IXNA 3A4NA 5JHHB 3LW8A 2WOOA 2CCJA 3BH7A 4QNMA 4B32A 621PA 2QE7A 1ETUA 2CEAA 5LB2A 4WZBE 2RGDA 2AWNA 3UPUA 1S1CA 4US1R 4RZXA 1U8ZA 1NRJB 5J4YA 3LX5A 1J7KA 2R2AA 4YONB 1CJMA 2G1KA 3P20A 1AKEA 4KCGA 4EAQA 4P31A 3KKPA 2VF7A 4BEBA 1YZQA 4BFVA 3THXA 3KJEA 4Q18A 3M6AA 3TQFA 4HAVA 4KVAA 2HYDA 3SS8A 4DCUA 2J0QA 2FEMA 2O52A 1M6NA 3HYTA 5C4MA 4LYAA 1E2EA 2G77B 3AF2A 1XTJA 3NXSA 4M1YA 3VR6A 4DEYA 1IJEA 1TF7A 1Q57A 1M34E 3BERA 4PPGA 4YQFA 2PCJA 1ZINA 4QKQA 2V3CC 3EZ9A 2OAQ1 3QPUA 1JEDA 2P6RA 3AM1A 4U7DA 3DKPA 1LF5A 1VPLA 2AD1A 3VNUA 221PA 2R65A 4JJZA 4L16A 5EQTA 3SU8A 3MCAA 4FMBB 2ANCA 3TSOA 4AC9A 4CEHA 4GSYA 1AIPA 3AVPA 2VHTA 1S3SA 1VCOA 3IO5A 3KFVA 4TT3D 4ZDWA 5E7IA 5JEDA 4FIDA 5AJYA 1W0KA 3RYTC 2XEXA 2JDIA 5LBIA 1R0ZA 1LS6A 1NF3A 2HXSA 2QZ4A 4IKEA 5AJXA 4P4SB 2GNOA 4DLUA 2Q0HA 3UKDA 3LBNA 2EWVA 1ZM4A 4HDQB 1N0UA 1YZTA 1SVIA 3FGNA 2BMFA 1R8SA 1AZTA 4UKDA 3PUVA 1FX0B 2N1BA 2WWXA 4G5GA 4XVQA 2OFWA 1W47A 2ORIA 1FTNA 4A0RA 2JLZA 3U3JA 3ZZUA 4LHWA 3R7WB 1D9XA 4B73A 4MGZR 4QJ5A 5C4GB 4JLAA 3WHLA 3L0OA 2IS1A 2GJ8A 3AF0A 3FE2A 4B35A 4JJKA 1M2OB 1E9BA 2QEQA 5JSZA 4GNKA 4UXJA 1E2NA 3BORA 3RS0A 4Q1EA 4JLJA 3VX3A 1OT3A 3GFOA 3OF5A 1IQPA 1SXJB 2GWHA 3CF2A 2IBMA 3SFZA 3FMIA 4A0HA 4LJAA 3KQNA 4TMWA 2HEIA 5EUQB 2IUUA 2PT5A 5EXTA 3IPXA 2B7CA 2AX4A 1I4TD 3OEEA 3OIYA 4Y0VA 1SQ5A 3RLFA 4BLSA 2PX0A 1F60A 2MMCA 4JSTA 5IRCD 3PCRB 2XXAA 3CNOA 1G1MA 3MJHA 5B64A 2O0JA 3ADKA 2JJ8A 1ZIOA 2A78A 2ZI4A 2CCGA 2FF7A 3NG1A 1YE8A 4NTZA 4XOIA 1FOEB 4C0JA 5FBVB 4RVCA 3EX7C 1E1RA 4G01B 4WOPA 4PZLA 3X1DA 2BCJQ 4J0QA 1T91A 4Q03A 4UNSA 3TVTA 3L43A 2BV3A 4MUAA 4IJMA 1E2HA 4RFSA 3B9QA 1ZAKA 2E87A 2QAGB 2ZETA 4HAZA 4NKRA 2OUKA 4HUTA 2ERYA 3AP2A 5DNYB 3A6PC 2O8CA 4A2WA 3DZDA 3P1JA 1DAKA 2AKYA 3TAHA 3SHFA 4HLUA 5FBRB 4US2R 1KZ7B 3BFVA 3HU2A 1N6KA 2HJVA 2X19A 4JKYA 2A5JA 3Q7PA 3UG6A 1E98A 3LRPA 5J4HA 2P0EA 3GJ7A 4Z1MD 4BZQA 4IOMA 2ZANA 3HR8A 4GRAA 2A5DA 5KOYA 1IN8A 5DHFA 3RC8A 3FOZA 5BYJA 3MJRA 2GAAA 1JB1A 2FNAA 5CJPA 2FGJA 4URUR 4V0ME 1R5NA 4D0LB 1US8A 2XNSA 3GJ8A 3NC0C 5B2ZA 1XTIA 5JHGB 2QBYB 2PBRA 4DSOA 4EJSB 1ZW6A 1WCV1 3CM0A 1P61B 4KLZA 1Z0AA 2C96A 4DIEA 1E2IA 3CRMA 3EW9A
chains in the Genus database with same CATH superfamily
4OHUA 1UJMA 3U13A 1E2MA 4ZI5A 3E3MA 3GT0A 1XVVA 3RFFA 1XALA 4XYGA 1M1ZA 4RK0A 1XD8A 4C9BA 3HYRA 3SSAA 4TOIA 4FNAA 2HJGA 1F8YA 3THRA 2AFHE 3NB0A 1N2CE 3QWAA 5FULA 4A8JA 5KNCA 3TH5A 4DMMA 1J70A 2OGWA 1EEHA 3I01M 2W2MA 4PX5A 4ZVQA 1EDBA 2VATA 2VJMA 3EXIA 5DHAA 3S2ZA 1P0QA 3SBEA 3KQOA 3UJDA 3OLWA 5JQGF 2Z1NA 1SCKA 1ZXXA 4KRGA 3VO2A 2ZI9A 1G4HA 2VR1A 1E9VA 1NMYA 1W52X 1YFLA 1EG7A 3RC9A 1XZBA 4B8ZA 1ZM2A 3IQHX 4TQUS 3GRFA 1UQUA 3K9HA 1AF7A 1VSQA 1JUDA 4HBGA 1IFXA 4PIMA 4Z51A 3OX1A 4BTEA 1RAAA 2JBAA 4G4JA 5F1OA 2BMJA 1NP6A 2X3UA 1VJ5A 3T4UA 1O8BA 1M33A 1NP7A 2Q2OA 5D7NA 3OM8A 3T5AA 4TMVA 4URZR 4QXMA 5CLGA 5F2OA 2ZRIA 3GYGA 2V8OA 1Z8NA 2C2KA 1FFSA 2OCKA 4REQA 4MVYA 2B1JA 1D1TA 5AVKA 3ROXA 4KBFA 4Q3KA 3PQ4A 1A9ZA 2H9AA 1NBHA 1TTQB 1RKUA 2KS6A 3I1FA 5FV7A 5DWDA 5F51A 2E1RA 1L7RA 4K8RB 3KIPA 1GUDA 1D2GA 3B3JA 4QYTA 1OI7A 3L06A 3RIHA 1LCIA 2AJDA 1R66A 2Q8NA 5TPZD 4ZXFA 3P97A 2QAGC 4IILA 1AB5A 1QZ3A 1NKTA 2V9PA 3VGPA 4FW9A 2BGIA 3EVNA 4JLPA 1UFVA 2D8AA 2FR1A 3Q41A 4CQMD 1C50A 4EQ6B 5JAUA 1XCOA 4CBVA 1QU3A 1ZM9A 4UVHA 1E7YA 1XVAA 2EWWA 5FRDA 5KUTA 4FN4A 4X44A 3VZPA 3VPBA 1Y3HA 1DIGA 1NI5A 1OXSC 1XDDA 1Z0DA 2C31A 3GH3A 3QBDA 4JB0A 3RIEA 3TPZA 5E8JA 1R4MB 5HKAA 1O03A 1QX3A 3LPMA 1YS4A 2X8AA 3ONNA 1E4VA 3PWZA 2G5PA 4HEA6 5A05A 3SSMA 5HKKA 5K20A 5LDHA 1XXLA 2VWGA 4G0VA 1GGKA 1VHJA 4NDNE 2O3TA 3RWBA 4ENTA 4RSRA 3BWMA 1C9KA 1N25A 3CRVA 1JMKC 4O25A 4WKGA 5CU7A 5TNXA 2FWMX 3TSZA 2B35A 3GT4A 3EIQA 3QV2A 3L84A 2Z09A 3ZNQA 2WB2A 1OROA 5AKGA 4AKSA 2ZRLA 4V03A 2PUHA 5G0SA 3WWOA 3WMXA 1UIMA 5C53B 1Z13A 2QN2A 3P9CA 2IDMA 3OZVA 2UZ3A 5SYAA 1KSFX 4NZPA 2J3KA 4MW5A 4BQPA 3QBJA 4M9XA 1LDYA 5IW8A 2PZEA 2X22A 1UFRA 4MUJA 4Q00A 1ECPA 2VJOA 4H16A 3ORSA 4DMUB 1FLAA 1M10A 1FL9A 1T6XA 2IPOA 1UOQA 2XGOA 4KSCA 4GPTA 5EMMA 5DLDA 3TTXA 4EX7A 2HCFA 5TY0A 1OV4A 2M2IA 4Z9AA 1E9RA 1Q1GA 3GLVA 3RGWS 2PUFA 4OJNA 4B3CA 2VDWA 4WK0B 2IQ5A 1XPOA 2ZJ2A 2FK7A 1K3TA 4HFRA 3EBLA 2X7HA 3PUZA 2BEVA 2QQ0A 3QXXA 1ZUHA 3LXRA 3F4LA 3UAOA 3S3TA 1V1MB 2II6A 3OMWA 2IU0A 1TGVA 2Y05A 1V7QA 3NBYC 3DL0A 4MVJE 4RH1A 3T9AA 1JA9A 2BISA 2YXPX 3TMKA 1Q3TA 2HZ7A 3K9GA 4ZQFA 4AROA 6Q21A 5KWEA 4QQNA 1SWWA 4N48A 2FZEA 5KHOC 1REQA 1CHNA 2XUIA 4BBJA 3FGPA 4MVJI 3V6LA 3HCFA 3HPQA 4I4LA 3SKVA 2LXNA 4QICA 4MRVA 5A4MS 5FOWA 4GKAA 4H27A 1CZRA 1L5GB 1KEZA 2JLVA 1VPVA 5JAOA 1PR1A 3DUFA 4QM6A 1PR5A 1ZFNA 3GW8A 3Q5DA 3N3AC 3UT0A 4DCGA 4ZEVA 1SUDA 1D4ZA 2Y1GA 2XRMA 1YUNA 5A5EA 4PLYA 2PX5A 2WSMA 1E79A 3KXIA 3L4BC 3DZKA 2QYHA 3LUBA 5G1NA 1E64A 5B3JA 5KREA 2YJ4A 5KSZA 2XD4A 3HQ4O 4UJ5A 1GQRA 1UCFA 3R7LA 2Q1XA 2HEGA 5AIAA 3V1MA 2EKQA 3OIGA 4X24A 1ZAYA 1VJCA 1YR3A 5KYVA 1YACA 3H9GA 4UMVA 4RSMA 1YJQA 2QQ5A 2WD7B 3PUHA 4TT8A 3ITDA 3GLSA 3HJHA 4MVJP 2XMBA 1XD9A 2XZDA 1G16A 3QU2A 3W78A 1Z45A 2OXFA 2AFRA 3DDWA 5ERYA 3V80A 2ZB7A 4Y2UA 1TZJA 3NBZC 1OZ0A 4I8XA 4E5VA 5HQTA 2H85A 1EP1B 1G20E 1RDFA 4HG2A 1ZJYA 1EQ2A 1Q6YA 2CNLA 4GP9A 2BD0A 2VTEA 3CG0A 1JAXA 1M6EX 5IS2A 2VS1A 2QQEA 1JFRA 5HRCA 1SR8A 3EA0A 3W7VA 3H0KA 2XT0A 2B9EA 5IK2D 1KOFA 2D3TA 5LD2B 4YAIA 1FVOA 2WP0A 4RFLA 1N6RA 1PRYA 1X3LA 1Z28A 3NOOA 4L22A 4YO7A 4U00A 1U7HA 2R97A 1QXSA 1JB9A 3KEOA 4FDUA 4M49A 5AVTA 3CX3A 2DP4E 1KO1A 3OMLA 2PVCA 4JDPA 4JP3A 7MDHA 1SD5A 3IV7A 3RF7A 1T2EA 5AXBA 1GFIA 1Y80A 4L85A 4NZZA 1CB7A 1VBMA 5KTRA 1QOQB 3C98A 3L6DA 3PI6A 4ZCTA 2ZUFA 2PZAA 3WJAA 5LDDC 2WPNA 3DL2A 3GRVA 3A4MA 3ICOA 4NCXA 4TVKA 1TE2A 1E92A 1MAVA 4D26A 3K09C 3KQTA 3KCNA 3DB2A 3TNDA 2B2CA 4MUEA 3WZLA 2O2YA 4TZ6A 1L4MA 4MEBA 4DMRA 5JVDF 4LJYA 2OHHA 3ANSA 2CJPA 3ZH9B 5HZHA 2VZ8A 3ORYA 1JQDA 1MIOB 2FOIA 4ZOLF 5IZ4A 4Q0MA 3TFQA 1OTYA 3MTAA 4WY2A 2C1XA 1IVNA 4C0KA 2VIIA 2HL6A 1K6EA 3ZHBA 3LDHA 3HGQA 2XA9A 3H1GA 2VOEA 4MI3A 3Q3CA 2OBFA 3RAGA 3O8CA 5AKXA 3T52A 4D9MA 1S2OA 3NLLA 3B9BA 2AG1A 2BDEA 3TUZC 1MPXA 3WVNA 1YCDA 3TBFA 5A6VA 1J0DA 2B8EA 3P32A 4LQ4A 1E66A 1ZRHA 1LK0A 3R5XA 4QJ3A 2EXXA 1W25A 3S4YA 1VG9B 2B9VA 3AWDA 5JVDA 2XX3A 1FP7A 2PMKA 4O4HB 5DWVA 3FFBA 5KWJA 1KIAA 4UBOA 4A10A 5JYEA 5F35A 4IH9A 3E6AA 4ERXA 4FFBA 3DL7A 1X9IA 3ZV4A 1PR2A 3MEQA 3TZ6A 3LLUA 2HT1A 3PLAE 1PNVA 1BNCA 1Q3HA 1EUDB 2CMGA 5DJ5A 3E7WA 4CDGA 1UBGA 2ODWA 3DUWA 5IAEA 5JSZB 4FWBA 1KAMA 1AGPA 1NJ2A 4HUQA 3S6JA 1UODA 1SKBA 1WSDA 4JBIA 4K6GA 4UAVA 3PQFA 5E0OA 2BUBA 2FP4A 2H31A 3P2MA 1GGVA 4JOQA 1JG2A 1JQJC 2GDZA 4KUEA 4CMCA 2GPNA 3MMZA 2AOXA 3O73A 2SECE 5AK4A 5HE9A 2VC2B 3ZV5A 2I6QA 3AEXA 2DKOA 4WZBA 3TZHA 4CCAA 3VPSA 3N8HA 4R6XA 5AHWA 2YR0A 4RYDA 1UK8A 1IZ7A 4LXTA 1F2TA 1YR2A 4R2HA 4OVKA 1B4DA 2CUTA 4PICA 3M2PA 4QRIA 4GZ6A 1UBJS 4G5RA 1VLMA 2ILTA 2SKDA 5EQFA 3TMAA 2J3QA 1K88A 3SHOA 1H1DA 4L0QA 1YE5A 1XDUA 3T1NA 1ZX1A 5J47A 4N4AA 3KKQA 5ELMA 3ZBPA 3Q7QA 1P3Y1 1U2DA 3JZIA 5BYKA 4X8LA 1B3BA 5I8ZA 2F59A 2VK8A 1FMJA 1RKQA 4QYIB 4LW8A 1E9AA 5E95A 5AVWA 5EWLA 4B9EA 1NVWQ 5SYMA 3STUA 4ZMBA 3H9UA 2VDVE 3HBLA 3FOFC 1EFVA 2Q0QA 4IV0A 5JZOA 1P72A 1H2ZA 5TGZA 2FEXA 2BP7B 4CMBA 1C8KA 1JDNA 2OUIA 3JWJA 2FPUA 3BCHA 1SOAA 4JVMA 1K7FB 1XZAA 1E94E 4PLPA 1QVRA 4HX2A 5ALWA 5FPHA 4AP6A 2JGMA 2KBFA 2FDRA 1TF5A 1DXOA 4OQPA 2RGGA 2KE5A 3I0ZA 4UU7A 1IRIA 1GTJ1 1NM5C 1JE1A 1KTVA 1JDZA 1FP1D 2H63A 4LIPD 4N54A 3TPCA 1F2VA 1Y37A 3MT0A 4HWOA 4DR7B 4O08A 2E89A 4PZ9A 1YL6A 2PHZA 2VJYA 1XZCA 4FQ8A 5I9TA 4DE5A 3DCJA 2ZWVA 4EGQA 1UBNA 5FF9A 1QIDA 3QVTA 4YT2A 4JQOA 4YMWA 3ZC3A 3IDSA 3SYLA 3I1IA 2BFBB 1V4VA 5DVZA 2C3OA 1TD9A 3AG6A 4DXAA 2DE0X 1NUQA 3BSSA 4PXSA 5JG7A 3VYSB 3CO0S 4NDAA 4MAFA 3I9MA 4OKSA 1MQ8B 1LRKA 1JALA 3ESQA 1Z6XA 4IUDS 3GH1A 4OD0A 4C04A 2CYAA 4TZTA 3GROA 3U7GA 1W1WA 2QY9A 5HIIA 5ARCA 4GL4A 4IQ8A 2ATIA 2IYYA 5FLYA 5K5EA 1JHYA 4TN5A 1FXUA 1G66A 4W9NC 4A8JB 4JP8A 4AT1A 5JXJA 2JFHA 2XVXA 3PQ7A 1XPJA 3BX1A 4O8ZA 1SBNE 3SZOA 4UDNA 4F56A 1JKXA 3PUYA 4TYMA 4F6CA 2RBEA 3EXIB 3WYFA 3AEZA 3WLIA 4WN9A 5SZHB 1Y4UA 2H3HA 4KJXA 4UHKA 2TS1A 3UBMA 1WZCA 4EFMA 5JD6A 1NP3A 2R5WA 3E4DA 3EUEA 3O8NA 2O48X 1SEPA 1RYMA 1NXXA 3GPIA 1T5DX 5DBGA 5L7YA 2PWPA 3OTQA 3WOVA 1A9SA 3ZHRA 5HYVA 1TYBE 2A4KA 3GB9A 1X13A 4EKNB 2KM1A 4OHCA 5JTUA 1N9GA 4AMVA 1MV5A 5DBOA 3WTCA 5JJLA 2WJZB 4MKZA 4G8BA 4TZ0A 1R0XA 1PSDA 4BO5A 3KVNA 2CXNA 2NADA 4DMKA 4C4AA 2HSJA 4Y9UA 2GQ0A 3I9KA 4GC9A 4JI7B 4REQB 2PGXA 1XQ1A 2IITA 2XVMA 3ZHZA 4F21A 5SY4A 3QPVA 2EX4A 2WJGA 4ZV4A 1YO6A 1ZR2A 5SY9A 1LQ2A 2YV5A 1T9BA 4YB8A 4QJ4A 2ZB8A 3A25A 5IF9A 1PK8A 4N3BA 1QH8A 3TK1A 4ZMRA 4PXYA 3S5JA 1TNDA 3JR3A 1ZBQA 2WU0A 2C4MA 2NSLA 3DO5A 4PQRA 2JGIA 3CR3C 4TKMA 3GT3A 4E5KA 1QDLB 1GRCA 4MP6A 3BTSA 3TNFA 1ULTA 3DE6X 5GOTA 4OATA 3B53X 3W90A 2ISSD 2NYRA 1JDSA 3E5MA 3PRYA 4XX0A 4CF5A 4GS5A 5HS6A 3HCRA 3ZHQA 2W6ZA 2YY6A 2V97A 2ZSBA 3CZAA 3QIVA 1ZSYA 2X0FA 1WMDA 3ZD7A 3LWDA 1KJYA 2OXEA 2QQGA 1L5OA 2Q5EA 3IQEA 2YS7A 3D0KA 4P2BA 3WK6A 1X1EA 2P5SA 2QU8A 2IY8A 3KUKA 4JP2A 4ROSA 4F5DA 1J2EA 4WPGA 1TJ4A 3Q3GE 4DLWA 4YMGA 3BXGA 2CVQA 3O26A 4JWKA 4A36A 2VTKA 4RLFA 3N2KA 1Q1QA 2VRCA 2R48A 4U2KA 1FBTA 3K73O 3UXMA 5JJKA 3IMGA 2D2IA 1MDBA 4YCCA 3WICA 3ZIAD 4ZYYA 5BWBA 2GNAA 1AS3A 5TV2A 1PDOA 3A6JA 1KY2A 5DGIA 2C59A 1ZS9A 3IURA 5JALA 5AI9A 1RCUA 2E5WA 2EG5A 3EVAA 3QNUA 4JVOA 1KZ1A 2C1ZA 3REGA 5A4FS 5L7TA 3F73A 4Y0NA 3DDOA 3Q1KA 4RF5A 3N2LA 3OFVA 2EFJA 4RPKA 1VG8A 1WXIA 1DWOA 2DJ5A 2WY2D 4RPCA 3CT4A 2VDWB 3CINA 2GCNA 1TI7A 3FB4A 2VAWA 4C4TA 1X7YA 2BHSA 4BXOA 4I81A 2BEVB 4B2PA 1CQJA 5LQUA 1MOZA 1IEXA 1V6AA 2Q5IA 4QXQA 2BSQA 1W87A 5IVHA 4LY6A 5IUKC 4H15A 1J1ZA 2AK3A 2VBFA 1ZD2P 4HQFA 4UVGA 1TJYA 1DV1A 2FW9A 2LZ0A 1CV2A 3PKIA 1YK1A 1QO7A 2W6QA 4II3A 4DC9A 3A1UA 3OU6A 5B2FA 1REQB 1VYVA 1ORRA 3ZLBA 5H81A 2IRWA 1D0SA 4TLLB 3PNMA 5H3HA 1I2AA 1TYZA 3BWBA 4G6ZA 10MHA 3AVTA 2NTJA 4UTPA 3PJRA 3UAGA 4M89A 1NVDA 2W2LA 1KJ8A 3DUFB 2BKVA 3GCGA 3URMA 1JR3A 2DFLA 3OOWA 4L7QA 3U48A 4YUWA 2ZPUA 5LA6A 4K9RA 2ZSJA 1YRYE 2AE1A 1T3TA 3K7EA 3WGGA 4MUYA 2G83A 3CZQA 3U09A 1MG0A 2R62A 2WJPA 1TC2A 1XL1A 3GG9A 1KYXA 1W49A 3LA8A 3OO1A 4LKOA 2JGEA 2Q1SA 2QLNA 3EDOA 3VR2A 5I7VA 3LWNA 4KYVA 3D2BA 5K6TA 2R86A 1JDTA 1NBME 3S2EA 1OBCA 4S1NA 1N2ZA 4CF7A 1EKXA 4JUCA 1QFJA 2D1SA 3L0BA 2V6BA 3IP5A 1K7SN 4BO1A 1UC5B 4CM6A 1GTRA 4M21A 4CETA 1J8QA 2OP1A 4IEIA 1NJ1A 1QZZA 1XK7A 1ZD8A 4MYRA 4BNVA 1W85A 1IZ9A 1JH8A 2FZKA 1RIFA 4V38A 3SZ3A 1PR9A 5CVJA 5FA6A 3KUCA 2PQMA 3KUDA 3TZLA 4BMCA 5LWHA 4NJMA 1M5TA 2XZOA 3UICA 1FSGA 3Q4GA 4FCVA 3IXMA 3G9ZA 1HDGO 2FY8A 3G8AA 1JT9A 2ZJYA 4C30A 4EF5A 5GM1A 3X2EA 1IHUA 3UMMA 2GDJA 4F12A 1NBOA 4DDHA 4KVZA 5DGTA 4M86A 3L5OA 5TRTA 1BFKA 3CYFA 4RTNA 1N0HA 4YJKA 4V24A 5EEGA 1G8HA 4K2AA 3GFQA 4IDBA 2LIPA 1KAEA 2I4IA 2OT3B 1RYFA 2RCYA 1SCBA 2H2FA 3GLKA 3LL4A 4NBRA 3A14A 3KL2A 2AXQA 3MD0A 1XBTA 5F1PA 5K1ZA 3AONB 3BSWA 3ZWYA 3C6ZA 3C5CA 1HMPA 4MVJF 5ABPA 3FPGA 5YASA 3UWOA 4C4PA 3C6XA 2CMHA 2XCLA 5FQNA 1GA4A 3IBTA 3KAKA 2AXNA 3DXFA 1EJ2A 5KWSA 5TT0A 3K2EA 4H18A 3FB1A 1PWEA 4EVRA 3FTNA 1DTEA 1V8OA 1WW3A 3LC1O 1J00A 1SHKA 2PMBA 1HY3A 2QRGA 3JR7A 2RI0A 2XWSA 3ENQA 4F8YA 1Y9JA 4Z7QB 2IWRA 4E31A 2RHCA 3QVJA 1A8IA 5CB4F 3A3KA 1L3BA 2QX9A 2PSHA 2YZ2A 1SHZA 1RQNA 5HILA 3U7EB 1DJLA 3DF7A 4FHZA 4GR9A 4WBXC 4ZQGA 4LZZA 4EMUA 1RWBA 1PT6A 2ZP1A 3FZNA 4D9EA 3CISA 1AKMA 4PGHA 1ORHA 4TT3A 4K9LA 1DIRA 2H1IA 1O96A 2ZIFA 5JXWA 2FLWA 2PD6A 1CS0A 2XODA 4ITUA 1QYCA 1IN7A 3EXG2 3DV0A 1U6IA 3GY0A 4UASA 5F9MA 5C52B 2CB0A 3NVKI 2VK4A 3L0SA 1JEAA 1NNLA 6LDHA 3ZDAA 5JVDB 1QHGA 3EXHC 3HXTA 4ZHQF 5JMOA 1V25A 3NEAA 3GAAA 4NRDA 5JJBA 2QG9A 4MVJG 1FUUA 3WNQA 1YL5A 1SC4A 1LBEA 4KK4A 4UHDA 1OTHA 1P19A 3L6UA 3KFXA 3MW8A 3O2QB 5F2KA 1PL6A 5FBWB 5M29A 3OPVA 4FFBB 1AMOA 4DCJA 3JY6A 4UTXA 1EX6A 4OHWA 2OY0A 1EWVA 1BVRA 3LXMA 3OZEA 2R96A 4L0CA 3UM9A 4ALNA 3ADDA 3ICEA 5JSUA 1C14A 3PGXA 3TF5A 4RE5A 4Y3UA 3TQQA 2R00C 5DSTA 5CFPA 2XCIA 1I2MA 2K87A 4EPVA 1JDBB 4HUQB 3FGOA 1WOMA 2PIDA 3KV1A 1ABFA 2FG6C 5IDYA 4P3YA 2FP4B 4PSCA 4MS4A 2GJKA 1KQPA 2VHUA 5KJCA 5LIPA 5K2OA 1EWKA 2MTBA 2GM9A 4BPBA 1O94A 4H6XA 1R37A 4I1IA 3EE6A 1V6CA 1E1QD 3HU5A 2FPGA 4WZBB 3KAJA 3ENKA 3V2UA 5BUQA 3NHJA 1XMQB 1G20A 5AXAA 1F2TB 1WF3A 2J31A 2P40A 3ZDZB 2VP9A 2VXOA 3O4FA 3ZDFA 3VNQA 3C7KA 2GBLA 2CW5A 3SQNA 1NC1A 1Z2NX 1GITA 3DGEC 3BK2A 5I7AA 3V4RA 4L02A 4FMCF 4W5NA 5ADUS 3D1JA 2D3WA 1GRVA 2ZYTX 1F0KA 1KEEA 1QYDA 3PFCA 4YJ3A 2DLCX 3FUWA 1GUZA 1E1CB 1W4CA 2QUJA 3ELDA 4WKPA 9ABPA 1JHOA 5EWLB 5IH7A 3OC0A 4E3ZA 2AJCA 3DLTA 3WR5A 3L5KA 5HJ7A 3LOPA 1EFVB 4L5JA 1B00A 4PBTA 2G7MC 2JCVA 1KDTA 4ARIA 4GICA 2XNKA 1T0IA 1LA2A 3GT7A 3KXLA 4JSYA 4KN8A 3W04A 4CI0B 4PS1A 5LLTA 3K9CA 1G38A 4EEZA 2CHUA 1E0JA 1PVVA 2DSNA 2Q28A 4AY4A 3CJRA 1OAOC 2PQ0A 1KNXA 2Z4TA 3NGXA 1RQPA 5DYYA 4Z1MA 1Z6AA 3OQJA 3UHAA 4CFYA 4EX6A 5CEEA 5IWCA 1LSJA 4ZT4A 3O91A 3QMVA 3OA2A 4RDCA 1Q19A 1E2QA 4RZQA 3RPEA 3VTKA 5ALOA 2ALJA 1G19A 3O0TA 2O0KA 1EA7A 1U8AA 4FFMA 3DE4X 1XKXA 4GZ5A 2AR7A 3A4LA 3QNMA 2P91A 4QJBA 5BPHA 1GCUA 4KMSA 9GPBA 2WUWE 3PX3A 3ZY5A 3PA6A 4R9RA 4X8OA 5KYYB 1JSCA 1KFJB 5MN5A 2GESA 3NASA 3GFGA 5IJWA 3IHTA 3BRQA 3QFFA 4PN3A 4AL4A 2ZATA 2O3SA 1J39A 4QLAA 2QROA 3I9JA 1FFXA 3OESA 1FDVA 5KPJA 3CFYA 2X2OA 4ZDIA 4RPIA 5BT9A 3AVWA 2WHRA 1Z73A 3STTA 1LLQA 5AVOA 2P69A 2JG3A 1B23P 2IWHA 1PYGA 4P38A 1YF3A 2YXEA 1ECJA 1Z75A 1PP4A 3NAMA 4WN9B 4YP9A 3WXMA 2DECA 2CXOA 1ML3A 2J8ZA 4URHA 4CRWB 3H5RA 1EFRA 4UTVA 1X2BA 1R6XA 1SVNA 1V0JA 1JTVA 2QP3A 3HCAA 3NDIA 2BR4A 4UZEA 1HV8A 3AHDA 4K9MA 3TG2A 3KYIB 1O0CA 1ZN2A 5BWMA 1J8FA 1W5FA 3A6GA 3R8CA 4KX3A 5DX8A 2PPVA 1PSZA 5KHAA 2YC2C 3CLRD 2C82A 1N9GB 4TTQA 3GRUA 4EJSC 5CYFA 2QLLA 4R6WA 1NLYA 5EVJA 3V32A 3F6RA 2HA6A 3EPLA 1TLFA 2J5XA 3BOSA 3G9UA 1FC0A 1ULUA 2CKMA 4QNNA 4RK7A 3TQSA 4A16A 4ZQHA 2QNBA 5GGXA 2LKCA 1GFSA 2RAVA 5LJLA 5EJ5A 3I0NA 5DYWA 4KDCA 4NY1A 2ZSIA 1YUBA 1I1OA 2IBTA 2O8NA 1L1QA 3VNSA 5BYAA 2JEOA 3G88A 4DLXA 2VTVA 3ABRB 2B7BA 3D3EA 4JGIA 5JV5A 4DR5B 1F6WA 1QH8B 2K6GA 5C81A 2O20A 4X41A 3OFNA 3BE5A 5E3IA 4YCDA 4LDAA 4OP3A 4DUGD 3N28A 3FPSA 3K0AA 4ED9A 1HOXA 1Z0ZA 2Y1FA 2IPLA 3PRHA 4S1VA 4O02B 4Z7NB 4AKGA 2H1FA 5KNDA 1C0IA 4MGIR 1NXTA 1VMAA 2M32A 3DZFA 4XX0B 1KQNA 3WL4A 3DXYA 3M5WA 1T5IA 3NKVA 2H4FA 3H1TA 1QQ7A 4N5DA 1OLOA 1UF9A 4MWZA 3RVDA 1R6AA 3TR6A 1AKTA 3AJRA 5FUBA 1YDEA 3PHHA 3F8WA 1VBNA 1Q0UA 3PG5A 1D2CA 4Y6SA 1H6CA 3EIUA 4C78A 1XZHA 2PUCA 3TTYA 1PTJA 4QLBA 4W5TA 1W94A 1UBFA 1N2OA 3KT6A 3VU8A 1HRKA 3I34X 4WEQA 1RYNA 4QEKA 2WB4A 1X1QA 4Q7LA 4LPSA 1B7GO 1DO0A 3DHWC 2QPAA 3M4NA 3N2KB 3QLTA 5DP2A 1IXKA 3SK0A 2D4AA 5D1HA 1SXHA 4ZVRA 1F2UA 3LBFA 3N7TA 3SVTA 4J1QA 1W35A 2F4VB 5H16A 1L7DA 4EF6A 1NV8A 1MO3A 1OZHA 3BCUA 3KSUA 2UVQA 3G2MA 3AINA 1Q1EA 2QW0X 3A6FA 1CBUA 2EFCB 3AV0B 3P0JA 3WBJA 4K8OA 1VCIA 1YC5A 1Z5PA 1ZMOA 4NBTA 1MW9X 4L76A 2GM5A 1K4YA 1U1DA 2AWOA 2J09A 3H2JA 4U2FA 4BO7A 3CPHA 1ID1A 2Z5GA 5EIWA 1WNFA 3JD2A 5TVGA 4YV7A 3LUKA 1VDMA 2P5YA 3B7WA 2ZUSA 3LO5A 4FI3F 1IIRA 1X7YB 4BXOB 1T4GA 4PBRA 3AQIA 4F3NA 1CQJB 1NI3A 2ZRKA 1ID8A 3FCYA 4IJVA 3ZK8A 4XM0A 1QWSA 1V2HE 4AYTA 3IIKA 3NC1C 3P4XA 2R8BA 2A3RA 3FPJA 5C7OO 4EW6A 5B1EA 1W36C 5A1TA 4Q3NA 4DNQA 1OH6A 1ZJZA 1VTKA 2J0VA 3LY7A 3CN7A 1JG3A 2H1WA 2V1XA 1T0UA 1ECGA 1POXA 3IDFA 3SBDA 4HVCA 3NS7A 3QEKA 3ELBA 1S2NA 3IKVA 4M0FA 1L7QA 3Q3IA 4MB0A 2P2GA 4QHTA 1A98A 2NLOA 3JARA 4YP0A 1O87A 3OZBA 5F4BA 5I7SA 3G5TA 5B7QA 1ZUNA 5LA6B 5JPCA 1S2LA 1THZA 2ABWA 2ODQA 4HH1A 4MICA 2VJPA 1SKMA 1QIEA 2O2GA 2VDMB 2UVPA 3FFWA 4TRRA 5KSYA 3DD5A 3I4LA 1UDAA 3DV9A 2XADA 1P9LA 2ZWMA 3BIOA 4PRYA 4TMFA 3KEGA 1M6HA 4XB6B 1NGSA 1E5TA 5E1BA 3QKRA 3ND9A 2ECKA 2NZWA 4JJ8A 2HWKA 4L0MA 1R1DA 2CVOA 3M1YA 3D5EA 4KE7A 3EBOA 3UTCA 5K8LA 3C6MA 1DAIA 3NFYA 3ST7A 5FAXA 3HVIA 1UM8A 1Z0UA 2Z8YA 3N8NA 4B3DA 4CG0A 1KY5A 2WZQA 4ZODA 3BJZA 1MVOA 1FTSA 3FNRA 5CNMA 3O4GA 3WBBA 5FLXA 1I7DA 3WMEA 2W2VA 3OZXA 4B84A 1W85B 3GJTA 4B6EA 2XWBF 1U0TA 4A0GA 1HNWB 3VJKA 4C01A 1L5MA 1O6ZA 4KR2A 4NJMB 1I5OA 3OE1A 3PU6A 1RJGA 1EFKA 5TR9A 1O9HA 3FYUC 4NX2A 5DHPA 5K3EA 1IJFA 1VI5A 3FCUB 3HC7A 3PICA 3EWIA 2OHIA 5L4LA 4RMGA 1GR0A 2NSHA 3NHLA 3RABA 1U8EA 2ZYUX 4P4TA 2NP7A 4PX2A 1IONA 3D4IA 2WHYA 5TSDA 4A0QA 3T9CA 1T10A 1XQ6A 4ID3A 5BSRA 2GD2A 4UCWA 2QB5A 4A8PA 4BQQA 1DUVG 2I4NA 2NN3C 1NXQA 2FWPA 3DDCA 3HA5A 4XPZA 3ZCVA 3G8YA 2DFNA 3HLYA 3A7DA 1YJ8A 4GBJA 4B9AA 4I9UA 3PNSA 1MJ5A 4FM9A 3RH0A 5K0TA 3KPJA 3SVZA 1VG1A 1XP5A 3QWFA 5LZ5A 1A72A 3LT0A 2Q29A 4KR9A 3GARA 2A0WA 1DTSA 1RKBA 4FX2A 4JZYA 2EU8A 3SC6A 2G3YA 4IEFB 1RXIA 4JVSB 5AYVA 5B3LA 2ZTHA 4D25A 3JTEA 4ZV9A 2GT1A 2ZROA 2CJWA 3SNHA 3TXXA 4CR7A 1N3LA 1JS1X 4KAAA 3IYLW 1J42A 5JDIC 2HK9A 1OLUA 3K1YA 3FWNA 5EUMA 4J7CA 5JJ5A 2CLOB 1D2HA 3FROA 1T1GA 4HI0E 1W30A 5CK5A 1GZSA 3H86A 1O96B 2JI8A 3AERA 5IAOA 5F7ZA 1W34A 1CS0B 1S0UA 5AJVB 1P0CA 1V47A 3DV0B 4HEHA 4ZT7A 2Z5VA 1QPGA 3CZPA 2X9GA 5I9LA 1RZ3A 1T4CA 3FZQA 3P0EA 4N18A 1LV7A 2ZPAA 3HU3A 3PUWA 1P0MA 2OOKA 4PRKA 4W5JA 2IEAA 1XRQA 3D6UA 2ZIZA 4NCKA 4NNOA 4KXFB 5TX7A 1V3TA 4TMXA 4UE2A 3WRXA 3IUYA 1THMA 4I0WB 4PWYA 3EBPA 4DR2B 2C8JA 5K9ZA 3Q2IA 3PIRA 5ALUA 2JFPA 2Z9DA 3WLAA 4QODA 2PL1A 3AIIA 1I7PA 1YQQA 3CTPA 1IBKB 1BEUB 2Z3VA 1IUOA 1ZWLA 3BHJA 2EDCA 3FF4A 3P45A 2DH6A 2HH9A 2LCQA 2KW5A 3FSGD 2XYVA 1KNQA 1M2HA 4TKUA 2GBFA 1DHTA 2BFPA 3GNLA 1S8NA 3H4MA 4MLCA 3EVFA 4HN9A 2IDKA 1OIXA 2O3QA 2OCPA 3NUZA 3PXAA 1X1RA 1NXSA 3BQMB 4LE1A 5K0BA 5AKZA 2WOJA 4C0SA 5FPPA 4MS4B 5EIOA 4BVBA 1JSRA 1D2RA 5H4GA 1NLMA 3A9VA 3BCRA 1MJGM 4GOJA 2C2OA 3MOIA 4CM9A 1IOVA 4B5KA 2FPGB 4LBVA 1M6VA 1G20B 4A1FA 2PJZA 4HXYA 4PX3A 4BO2A 2NZXA 2ZSAA 1GSOA 3A2MA 1YZVA 1T13A 2GLUA 1QYRA 2GZ1A 1XI2A 2WF9A 4MUIA 4ESHA 2OE2A 1DRUA 3EGCA 1N2BA 2V74B 4HJRA 5KYNA 1X14A 2VJDA 2XTNA 2ZXUA 4ZGGA 3D0RA 1L5RA 2WWIA 4IWYA 4FT4A 5JRDS 2PRJA 1KE2A 1NF8A 2O6LA 1H4TA 1KEEB 1GSAA 1LLUA 2OFPA 4CL0A 4YJ3B 1NR1A 3TIXB 3I30X 5KOJA 2MMGA 1R88A 3CIFA 3U4MA 1B73A 3VHQA 2A9QA 7GPBA 2ZRPA 1ZN7A 4WCFA 3O21A 1XZPA 2ZLBA 3QUSA 2P4QA 5B55A 1V9CA 3DTNA 4KBGA 2R1VA 1CFZA 2BRUA 1LRLA 1Y7PA 4IEEA 3CUUA 3PL1A 3RUCA 5JY1A 3EGOA 3D0QA 1ZD1A 4JLWA 1WABA 4QFBA 4ROTA 3T3PB 3JQDA 1E5VA 3D6HA 3GVIA 2PT7A 1Q92A 1SVUA 3CIOA 1FRVA 4FMCB 4LYEA 4L51A 2A9JA 3PQDA 1QRAA 5IN4A 2RKOA 1SZDA 1HL3A 3AY0A 3O03A 1W2WB 1YC2A 3S8YA 4EBBA 3BQNB 4FQ5A 3GFRA 4ZT3A 1XPRA 4XB1A 2X0RA 1ZUWA 1IEQA 3P0FA 4M99A 4HAIA 4URWR 3A4YA 2PSDA 2ZS9A 5DF1A 3UGJA 1WF6A 3KSRA 2D5IA 5DM2A 3IA7A 2WWGA 2EZ4A 1Z7GA 2ZRBA 2P2NA 5EEHA 3VC3A 4J8PA 2V5UA 5KU1A 1NWCA 2O2XA 1DT3A 4PCAA 1HDOA 4M87A 2G88A 3P2JA 1HURA 2I34A 2DY1A 5L45A 2D74A 1IHDA 2W6IA 1VP3A 3WGJA 4Q9LA 5FOSA 1UKEA 3DA8A 1FFXB 2I3GA 2NO4A 2FZLA 2X77A 3VZSA 4Z4FA 3LQ2A 2MYTA 4HEA1 2J9FA 4CIXA 2FW1A 1CF4A 2NO5A 3TBKA 1Z07A 2O0HA 1IWBB 1CWUA 4DLVA 5AWFC 1UP6A 3WIUA 4GXQA 2VDNB 1XROA 3HKCA 4ZAVA 4QASA 3GP5A 4BJ1A 1Z6TA 4L5BA 1PO7A 4QO8A 1IE3A 1LUAA 4NF2A 3EEIA 5CLLA 3RTGA 1NF9A 2UUPA 3EXG1 3GG2A 1ECLA 1B8OA 2JHCA 4WCVA 2W70A 3S68A 3CNLA 1PSWA 5HF8A 2W4QA 4FX5A 1I24A 5F98A 1JAYA 1K5PA 1UPXA 3BZWA 4ISCA 4Q34A 4AYXA 3TRHA 1PAUA 2RHWA 3AJ8A 1M8PA 5TQ2A 5CD9A 3W3ZB 3K71B 1N2XA 3PUJA 3DBOB 2HB6A 2XLCA 5F7XA 1IK6A 4LKRA 1P7WA 4UPEA 1NRIA 4W1RA 3JYLA 4NOKA 4JXXA 1A8UA 2BMAA 2WV9A 3A2KA 2IODA 3H9JA 3QEBZ 2KB0A 1ZITA 2WJWA 3WLMA 1D8AA 3JVEA 4CYMA 1RJWA 1GU1A 3JPWA 2LUOA 5EKSA 1KDYA 3E2IA 5COBA 2BONA 1KJ9A 3LBIA 5EE0A 2VPPA 1I7QB 1QP7A 1G21E 1MX5A 4KXWA 4LOKA 4AM8A 4HR7A 3LT2A 4D9BA 4MK4A 3KD2A 4GOOD 4MQ4A 3M4JA 4PYLA 4ZO6A 1J1UA 3BREA 3K0AB 3IR5A 2D06A 1VCMA 2DH5A 4IJKA 2A92A 1BEZA 1FX1A 3WRYC 1W5BA 2FB9A 1M0EA 4CMAA 2VEOA 5CYPA 1U7TA 1XAHA 3A26A 4CUKA 1JIIA 4LZOA 5T67A 1U8FO 1TIBA 2NV2B 1E4OA 2Z6AA 4COOA 3BSFA 2JZOA 1RQ7A 5DYTA 3W3AH 1YNSA 3GX1A 1YB6A 1RYZA 2ZJ5A 2WSSA 2NMVA 1KBOA 3H87A 3U0BA 5JAPA 2FJ0A 1XEXA 3BB3A 1N3BA 1G63A 1NOIA 3R23A 3QNWA 1ZLXA 3VFDA 3O7WA 2FYTA 2WU3A 1GG9A 2ZVJA 1IG0A 2HLNA 1T26A 2ZRQA 2WJVA 4DUPA 4NOJA 1L7NA 2ZI6A 1UAYA 2VWQA 3K4QA 1SZJG 2XA1A 4ND1A 1F38A 3X1MA 3WQQA 4GQBA 1J56A 1M2JA 1F2UB 1SKQA 3FVQA 2XKJE 5CG2A 2ID9A 2P0YA 2DFKB 1GCGA 1ZMXA 3H1AA 4RORA 4TTRA 3N9IA 3VR0A