2W58A

Crystal structure of the dnai
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
188
Chain Sequence
KRQESLIQSMFMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAAIANELAKRNVSSLIVYVPELFRELKHSQTMNEKLDYIKKVPVLMLDDLGAESWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQKVKAARIMERIRYLAYPIEITGPNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Interplay between the Replicative Helicase Dnac and its Loader Protein Dnai from Geobacillus Kaustophilus.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Hydrolase
molecule keywords PRIMOSOME COMPONENT (HELICASE LOADER)
total genus 54
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01695 IstB_IS21 IstB-like ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w58A01
2NPFA 4EPVA 1CJMA 1EESA 1TF2A 1XTRA 3H1TA 4E07A 1Y3AA 1JEEA 5KDLA 2IW3A 2XOKA 1FQKA 3RHFA 5GADl 1DAHA 4LHXA 5JI2E 2OFXA 2ATVA 2QMOA 4HB4A 1Z6YA 1C4OA 3ICEA 3IIKA 1CBUA 5B58C 3TSOA 2IXEA 2GJSA 2HJVA 4AG6A 2ZRBA 1QZXA 1S96A 3R20A 4G5RA 2A3RA 4PSKA 2ECKA 4EPYA 4BLOA 2OBLA 2CDNA 3QPWA 4DCNA 3EPHA 1LB1B 4PC1A 4N0DA 4NYMR 4IJMA 5DISB 2ZTSA 3W8NA 1OLOA 2HYDA 4KBFA 4Q9JA 3SQXA 2VTKA 1LV7A 2BOVA 3FKQA 4YMUA 2YVUA 5EJEA 4C0QC 4AK9A 4A2QA 4M1OA 2R6AA 4M0LA 5HZKA 1NG1A 3KUDA 4NZYA 2ZJBA 1VHLA 2FSHA 2MSCB 4I1VA 5HZHA 5TY0A 3FDIA 1S8FA 3GJ3A 3P4YA 4BEJA 4DSUA 2J45A 2OBMA 2WVJA 2DFLA 2BMFA 3EZ2A 4G5OA 1G64A 1G6OA 2NGRA 1DADA 3I73A 2P2LA 4JBYA 2JLWA 1I4LD 4TT3A 1HEIA 1OSNA 2C04A 3A6PC 3L82B 4JVNA 4Q9KA 4Q1CA 2F6RA 4KFSA 1PZNA 1X6VA 1P75A 3NEYA 4QC2A 4DLXA 2Z4SA 2IS1A 1G8HA 1KDOA 5DN6D 3AUYA 4A0HA 1V5WA 3RNLA 4R2HA 3ZZUA 5DLQC 4PQYA 3RABA 2ZE6A 1IXSB 3MWYW 3A4MA 3T1TA 5FR2A 3X1DA 4C0JA 1ODFA 4OK5A 2NPIA 4A36A 3KXKA 1UDXA 2CE2X 3X2SA 3QKRB 4FMCF 2B8WA 1FX0B 2EFDB 4HDCA 2Q6TA 1G8GA 3UMRA 2ZJ5A 3AF4A 2ZROA 4Z51A 5KU1A 2ANCA 5CM9C 2WWFA 1ZM3A 1E1RD 1ZU5A 3P27A 4MKFA 2VQSA 2ZYWX 3CF2A 3VX4A 2CLDX 4B3BA 4A4DA 4Z8XA 2GCPA 4KODA 3CUEF 4E22A 4MUBA 2AWOA 4FWTA 3QG1A 4D4JA 5CK5A 2QPTA 3NHBA 4LYFA 2BMJA 1TADA 2OM2A 1DEKA 1GG2A 3REFA 5L8VA 3FVQA 1N6PA 2C96A 3NHAA 4HEJA 3U6BA 2BBSA 1KY3A 1UAAA 2GRJA 3VR1A 1ZC4A 3X1WA 5IRCD 2N46A 3QEJA 3THWB 2IYLD 2FJUA 4Q48A 5K8UA 5HKKD 3WY9A 2EVWX 1EFCA 4M1MA 5K8IA 1HE8B 3QKTA 4MGYR 1TUEA 1NLZA 1VCNA 5J47A 1A2KC 1ZNXA 3CLVA 1NVVR 2HV8A 4GSYA 3UATA 2JLVA 1M34E 2VIIA 3PJRA 2W6IA 4BRWA 4A0GA 4DRZA 4DDVA 1OXTA 2RGNC 4JL6A 4RZ2A 3TBKA 2QP4A 1XPRA 3NH6A 2A5JA 1LF5A 2VEDA 1A5TA 5DYGA 2QRZA 3PFIA 3NBXX 3K0SA 1Q57A 1VCOA 5SZJA 2G1JA 4RY2A 1ETUA 2F1HA 4Q4AA 4IVPA 4UXIA 3KQHA 5TMPA 5FL3A 3AVPA 1Z08A 1DAIA 1N0WA 1K8RA 2CNWA 1EXMA 2H16A 3ZVMA 4BLTA 4HAXA 4NYMQ 3QNUA 1JXOA 4CEIB 1A82A 1IY0A 4LC1A 4BFUA 3U7GA 4P4UA 3MGCA 4WOPA 3L2OB 221PA 1X8KA 1XJ0A 4Q4HB 2OFWA 3QJYA 4CIDA 3C5HA 3GJ6A 5D3MB 4DUGA 5H1YA 3SEAA 1G20E 3V9PA 2WV9A 4R98A 3RS5A 3VR5A 4Q9IA 2CLSA 2FN4A 1CRQA 5JJKA 1G3UA 1IJEA 3CB4A 2KB0A 4HLUA 3WNCA 4CYMA 2QGNA 2QZ4A 3B2EA 4ZDKA 2JA1A 2MSEB 3IKJA 1QHHA 5LD2B 4EPRA 1TEVA 4OQMA 1DS6A 4BZXA 2CXXA 4B35A 4KVAA 2Q3MA 5FL7A 4OI0A 2CL7X 3TJZA 1LY1A 1FNMA 3B78A 5J5CA 2IL1A 2G0NA 3IILA 2B92A 2ZAOA 3LQQA 2Q3FA 5IHPA 4LJ8A 1MO5A 3U3RA 2G0TA 4TL9A 1GNQA 2ZRCA 3P26A 4C7OA 5FI0B 3Q72A 1YRBA 3VAAA 3SNHA 4MYHA 3ZLJA 2I4IA 4HLCA 2RAPA 5IF9A 4NCKA 2R6FA 1ZMXA 3C41J 4DJTA 1XZPA 2Q0HA 4YDSA 3T1OA 2PMKA 4HUQA 2OAQ1 3DL0A 2D7CA 4DLVA 4BLSA 1VIAA 2P67A 4LRWA 1KMQA 1P6XA 1UEIA 4W5WA 3VHXA 3UWOA 3CRQA 4KYIB 4Q18A 3R9XA 1YR8A 2RH5A 3TK1A 3KQKA 4ZCLA 4M9QA 1NN5A 1Q1BA 4NMMA 4YXWA 5KDOA 1OJLA 4FMCB 5HR5A 2I3BA 1QVRA 3KB2A 5GJBA 1OFUX 2CEAA 1ZCBA 3UPUA 3ND9A 3D31A 2J3EA 1T8TA 3O8CA 3SC3A 4DB4A 2VP6A 3RWOA 5SZIA 2C9OA 2QT0A 4YONB 5UKDA 3OAAA 4FMBB 4MYUA 4GMXA 5JSZB 4QHTA 2F9MA 2ODEA 2WWGA 5BWMA 2MMCA 1UDWA 2R62A 5EP4A 2GAAA 3EA5A 1AN0A 2WJJA 1Z0AA 1OXVA 4QBGB 5JBQA 3I1FA 2ODBA 1OFHA 4B3CA 1FW6A 2H92A 3RLFA 2ZR7A 3QQ5A 4HI0E 5AUNB 1ZM4A 1S3GA 3HPQA 2EWWA 1D2MA 2ZUDA 1GUAA 4V0LA 2ZETA 2RHMA 2PX0A 4XWAA 3A1SA 4QHSA 3RRMA 3MMPA 1OH8A 1NSTA 2VSOA 4D81A 2NO6A 2IYVA 2J9RA 5BQ5A 3X1YA 1G7CA 1X1RA 2C98A 5FTLA 2JLUA 1VDZA 1XPOA 2JJ2A 5P21A 1HQYE 2O8BB 4LV6A 1M7HA 1IN6A 1M1YE 2W00A 3RS7A 4UQOA 4ABYA 3QENA 3EC2A 1NBME 4UJ3A 5KNCA 4PSAA 3TNFA 5FUVA 2PLRA 4IXNA 4FMDF 5IK2A 1Z3IX 2FFHA 3QVUA 5TARA 1X3SA 4DCUA 1Z5ZA 4PX9A 5J4YA 1G7TA 2JJ2D 5BYKA 4F92B 3K0AA 2CCJA 4L16A 3B7GA 4OI2A 3C7KA 3RS3A 5FBLB 4PC2A 2PJZA 1F48A 4AD8A 1UBEA 3W34A 2J5XA 1Z29A 4TSFA 2O8BA 2O8EB 2ODWA 4V0MA 3K70C 2P3SA 2NOAA 2OG2A 3OEHD 4O25A 1D9XA 1U0LA 4HUQB 3LY5A 4C0SA 3FB4A 2FPKA 1N6RA 2D3WA 1MO3A 5LD2C 1XEXB 4QRHA 1N0VC 5GVSA 1IONA 5AJVB 1SVSA 1G16A 1X8LA 2XNSA 3T5DA 2GK7A 3EWSA 2HCBA 2B8TA 4Q5IA 1DAEA 5KNBA 4EUNA 1WBBA 4NKRA 2IYWA 4TLAA 3VTKA 2QNRA 4URZR 1CR2A 1OYWA 3U7FB 1DBSA 3DZ8A 3KQLA 4C9BA 2IYXA 1XD8A 1ZUIA 4R2IA 4HUTA 3B85A 1RRCA 3K70D 4XSHA 4L9SA 3EW9A 4IDNA 3A1TA 3ZGXA 2GVDC 2VSFA 4X8MA 3R9WA 5JI3E 1G4AE 1YE8A 2GVZC 1U8YA 3CKLA 3U3OA 3IGFA 4UNRA 3K09A 4MRSA 3D3QA 5E4FA 4DZZA 1AKYA 3PEUA 4C2UA 5DE3A 4LPKA 2CBZA 2G83A 1QHYA 2X1VA 2V9PA 1HT2E 3QXCA 3V4FA 1GTVA 3CNLA 4LJ5A 4QGGA 4DCSA 2WWYA 2XZLA 1RC8A 1EK0A 3PVSA 3BFVA 3K8YA 1KI9A 2WJHA 1NVXQ 1E2IA 4TLEA 1L4UA 2O0KA 1E9DA 1U94A 2Z43A 4URUR 1K5GA 5F2EA 3MRSA 4AYWA 1CR0A 3FE2A 4CW7A 2KI5A 4LI0A 1D9ZA 4IOLA 1G8PA 3QF4A 4LHVA 4BFXA 2BIFA 3AUXA 4DSTA 1PUIA 2IYYA 1JPNA 4TMZA 4M2LA 1ZINA 3DDCA 4CZ2A 3LQRA 2Q9CA 3VHLB 1IY1A 1JBKA 3NDPA 1JB1A 4ON9A 4EPXA 721PA 4PO9A 3CO5A 4B33A 4QBFA 3UKDA 4P4SA 4A8JB 2ZE8A 2NZ8A 3SOPA 2FU5C 4K8OA 4Q4JA 3AP2A 3VR2A 4ESVA 2FFBA 2QL6A 3CX6A 2CCGA 3MLEA 1C9KA 4KO8A 2GJKA 3KX2A 3LX5A 2O8EA 3TQCA 1FZQA 3GJXC 2GNOA 1T3SA 4P31A 1FP7A 2P6NA 4PHFA 4GP7A 3AKYA 5M04A 1NVUQ 3TUIC 1P3JA 5BW8A 1S1CA 5FPHA 1YR7A 5FPTA 4BFWA 1J8MF 4NYIQ 3K9HA 4HDQB 2RB4A 4ARZB 1CS4C 1H8EA 4PO8A 2CHVA 4AURA 1FUKA 1T6NA 1WP9A 2BC9A 2BWJA 2PEYA 3AVXA 1O87A 4URYR 1G5RA 3OAAD 3TMKA 4LV5B 4RCZA 1NSFA 3UK6A 2CLCX 1SVLA 3GCGA 4GRAA 4FMDB 2VBCA 1L4YA 1MRSA 4Q00A 4V0ME 3RYTC 3LBIA 4C0KA 4M8NE 1SXJA 3EZFA 1QRAA 4J0QA 2GETA 3WRYC 4KV9A 2XGJA 3KXLA 4AI6A 5K8TA 2AHOA 3KTAB 4JLVA 5LB4A 3AB3A 2WIAA 3DMNA 3O8BA 3QBTA 4TQ9A 4JVSB 1AQUA 2O5VA 5FPSA 5DSZA 1UEJA 4A0RA 1E1QD 2PCLA 4LGMA 2R9VA 4L8GA 2RCNA 5JS7A 4PSVA 1G18A 4M9SA 3WBKA 3BOSA 4A6PA 3NBZC 4FINA 1GL9B 5TV2A 2G88A 2QPAA 2ZJZA 2OXRA 3BC1A 4FW9A 2NG1A 5EZ6B 5CIWA 5L3QA 4S35A 1W5SA 1E1QA 3ETLA 4E09A 3SFVA 2OILA 4PC6A 3CR8A 3TR5A 4OJQA 1R6BX 4F93B 4JLPA 3M6AA 2R2AA 4E5UA 2CL6X 2H8KA 3NVAA 4HZIA 3CZPA 3T1VA 1IXZA 2BKEA 1LF0A 2AK2A 3BERA 2GCOB 1PUJA 3NIBA 2XJ4A 2XOKD 3QEOA 1AS3A 4MRVA 4V0OA 4C0AC 1AS2A 1ONBA 5L3QB 4I4LA 2AWNA 3M4YA 3OZXA 1Z0KA 2XXAA 1ZIPA 1S3SA 1W0KA 2QT1A 1E2KA 1E9SA 1IN4A 4ILEA 5AUQA 3SU8A 3VKWA 2LWIA 1I4TD 1ZC3A 3HYTA 1RE0A 1N0UA 5JRZA 1BYUA 2B7CA 5AUOB 4V03A 5EXXA 4QG7A 1NMZA 3ZZTA 3RRYA 1WDTA 5CM8B 2ORWA 4C0HA 1U0JA 4DEYA 4PC3A 1G291 2GCOA 5C46F 4QNRA 4TYYA 4US0R 4XH9B 4D80A 1CJUC 3EIQA 1XXHB 4XWOA 2HF9A 4JZKA 5FBWB 4L5BA 4KJZA 3FHTA 3U7EB 3H86A 4F91B 3BORA 4JL5A 1ZNYA 4YDHB 4OKSA 2V55B 4DKXA 2GKSA 5L3SB 2QMEA 1XEWX 4FXPA 3AVYA 2V4ZA 3K0CC 4NYJQ 4PQFA 2QMUA 4TMKA 2F3RA 5BXQC 4DT1A 2WMOB 1TF7A 2VYFA 2KWIA 1SVIA 2ZQ5A 1NLFA 1RJ9B 4LV8B 4A82A 4WZBE 4Q4LA 1KSGA 2QAGA 4M1KA 4ZI3A 1AJEA 1JAHA 3LX8A 4TSFD 4WZ6A 1CF4A 3B9PA 5JEEA 4V0KA 4A8JC 2OFOA 3G5UA 2VP5A 4KSBA 3U44A 2XAUA 4PAMA 2RGNA 2XZOA 1Y63A 1OYYA 4JLAA 5EXPA 5A5GA 3AKCA 3GJ0A 3MWLA 2I1VB 4DLUA 2FZ4A 3THXB 2W2TA 1U2RA 4MKHA 4CEHA 3I62A 3VNVA 2QEQA 421PA 4U5XA 3FMOB 1NMXA 3DHWC 4MKGA 1SVOA 5D3MA 1VCIA 3TUJC 5BN3A 4Q1BA 3B60A 2ZAMA 3AVQA 1Z07A 4P4SB 1G17A 4QOSA 1CIPA 3MAAC 4AIIA 3CW2A 4HAYA 5FBVB 4RD0A 4UNSA 3GLFA 1MR3F 3NC1C 3A36A 4G1UC 1KGDA 2JCSA 5G40A 2BJVA 1R5OA 3KFXA 3QXHA 2C78A 1E0KA 1YZGA 3IDQA 4Q4AB 4IRUB 5EP1A 2BJWA 5EE9A 5DI3B 2WAYA 2QSZA 3KKQA 4FI3C 2WOJA 3KFVA 1JEDA 5FOTA 4Y0VA 1SGWA 1IXRC 5L3SA 2WKPA 3P4XA 2IF0A 5HPYB 1EG7A 3LAWA 4JVLA 4YLGA 3R9IA 2ATXA 4WAUA 4DB2A 1UM8A 2V6IA 2C77A 4LHWA 2CL0X 4C0BA 2P5SA 1OV4A 3CONA 1G19A 4Q1EA 5HCNA 4KSCA 1GM5A 3A37A 1W48A 2ORIA 3L8ZA 3T12A 3ZVNA 3FYHA 2OV2A 3PEVA 2J0UA 1LVGA 4QJ3A 3O8RA 4TQUS 2IBMA 3TUZC 4B44A 3I61A 3AKEA 1N3BA 5L3VA 1XJQA 5KPJA 4Q01A 3U60B 3CWZA 4ITRC 2H17A 3RS2A 121PA 3MJRA 1NG9A 5CLQA 1US8A 4L4UA 1GFIA 2IEYA 2TMKA 5F3WB 5G3ZA 4YC7A 2QSYA 4IDHA 5EZ5A 3HU2A 1QHXA 2WKQA 3MCAA 1Q20A 4KLNA 4RFSB 4CF7A 2EFHB 2I1QA 3Q8XB 3EX7C 1G1MA 3NKVA 1N2CE 1NIJA 3B82A 1CR1A 1FP6A 1SVKA 2KBFA 1EWQA 1Q3HA 5JCZA 2ZU0C 3C16C 4RZXA 4QBIA 4IFBA 1XD2B 4US2R 1TUIA 2ZRAA 1KK2A 1E2PA 3A4LA 5FTKA 4Q7MB 1RYHA 1JXMA 3D8BA 1U0HC 1G7RA 1M74A 3OESA 2FEOA 2FE4A 4NP6A 1TQ4A 2ZSAA 1Z0IA 3WHKA 4Q9HA 2IWRA 2ODNA 4C30A 2NO7A 1G8YA 4QGHA 2QA5A 3GLHA 1KO1A 1YZUA 4Z1MA 4F4IA 3NC0C 3KJIA 2WSSA 2AR7A 3QSYA 2HLDD 1FMJA 3AF2A 3W3ZB 2VSXA 1E9CA 1BKDR 2GXSA 2QY9A 5FTJA 1COWA 2FGJA 3DKPA 1NL3A 4UXHA 1ZBDA 2J0UB 3HDTA 4GPTA 3TIFA 2XSZA 3AF1A 1XMSA 1KK1A 2A5DA 1NRJB 3U61B 5E7JA 1JJ7A 5CDFA 2ZRJA 4B74A 4Z1MD 1DARA 3KQUA 4DIEA 4YXWD 1BMFA 1WE2A 4IKEA 1PLKA 1KDTA 1RVDA 3NEJA 4I1OA 2V1XA 3DOEA 4WXPA 1VG8A 1OIWA 1XBTA 1BIFA 2QP3A 3OIVA 3EA0A 2IX3A 2H1LA 2QRNA 2BMEA 4B32A 1FPMA 4RKFA 2ZRIA 4AKHA 2J7KA 1UKYA 2QI9C 3JVUA 2ZSEA 1L7VC 5LBIA 5C4MA 1OT3A 4BGDA 4FWIB 1XD9A 3QPUA 1ZP6A 1E2QA 1KMHB 2YYZA 3KTAA 4NTZA 5D3QA 5FOUA 5AR1A 3RAPR 4EFMA 2B7BA 1J70A 1QVAA 4G3XA 4GFDA 3A1UA 3ZYCA 1GP2A 4AG5A 3L0OA 4MDEA 5LDDC 1IN7A 2JLQA 3NH9A 1GITA 4DCVA 3IQWA 4A15A 4JLNA 2ZSFA 2V7QA 1E3MA 2YOHA 2WOOA 3GJ5A 2ZJAA 4ERNA 3M1IA 2XTMA 1OFTA 3OFND 2MMGA 2ZITA 5G53C 2W58A 2ZUBA 4JJZA 4II7A 5AK0A 1PVOA 1KAGA 2JJ8A 4ZV4A 1E9RA 1CP2A 5DHAA 1YKSA 2EWVA 3WRXC 2V3CC 2D2EA 2ZR9A 2HXSA 5EE5B 5AJWA 1T3HA 1R5BA 4AC9A 3L0SA 2GILA 3CNNA 1W0JD 1P7CA 2FGKA 3QKSB 1M7BA 1N5KA 1VECA 4CEHB 1N6LA 2ZR0A 2YZ2A 1N5JA 3DO6A 4LWZA 3CH5A 2A2ZA 5CYOA 5EQTA 1E79A 4RKEA 5J4KA 4CEIA 3AM1A 3E5HA 4ACBA 2GEUA 2KJQA 4AWXA 1N6OA 1YVDA 3HR8A 4B2IA 2QAJA 1IAQA 4DSOA 4PPFA 3SS8A 1KZ7B 4O3MA 3T5GA 4MUAA 2GXAA 3BAFA 5E7MA 1W1WA 1EFHA 2IF2A 2W2XA 4DWJA 521PA 4HB2A 2AFHE 1OE0A 3B1YA 3CH4B 4GOXA 2OESA 4YMWA 1XXHA 2CK3D 3L8YA 4R9UC 3DPUA 4JMPA 3EG5A 1NJFA 2HT6A 2B21A 2GBLC 2ASEA 1JAIA 2EFEB 4X8OA 2CCKA 2VH5R 4B2PA 4HAZA 4RZ3A 2WJGA 3FPAA 4B3XA 4DLYA 2PLFA 1II8A 2VP0A 4NONA 2IYRA 4HSEA 4OHXA 3WMEA 3F8TA 1RZ3A 2IA5A 3E2IA 4Q9LA 1GKYA 1W5TA 2ZSBA 3P1JA 5JWOA 1ESNA 3AV0B 2OZEA 4GOJA 3SJBA 1L8QA 4EQ6A 3GLHB 4KLZA 1II9A 1ZU4A 3KXIA 5TXGA 4LCBA 1P2UA 2XNDA 3QXSA 1OIVA 2XSZD 4WZAE 1KSFX 5FBQB 1E2MA 4P0TA 1QDEA 4YMSA 5C2JB 3CRMA 2IWHA 1G5TA 2IXFA 2JIZA 1RPZA 1XZQA 5EE3A 1AGPA 1P2VA 2O8FA 4KITB 1E1RA 2CHGA 2G6BA 3F0TA 2OBNA 3FFBA 2GJAA 1T3LA 3DM5A 4BLRA 1Q0UA 1R7RA 2R6DA 3LW8A 1E2EA 4CRWB 2F7SA 1FUUA 1YZKA 2ZSDA 3OFNA 3D6TB 2NZJA 4TLDA 4XVUA 4TYNA 4B6EA 1T0JB 1OFIA 3IBGA 2UZIR 1DOAA 2YINC 3Q7PA 1GDDA 3ZIAA 1EFUA 1JR3A 2PZFA 2DY1A 2JAQA 5E7IA 3SQWA 2GESA 4GOKA 1CU1A 4EJSA 3DKVA 4EDHA 3HR7A 3FKSD 4G01B 1F60A 4G0NA 4LSGA 3BXZA 2YOFA 3T06B 1MABB 3VR3A 1J2JA 1P61B 4KVGA 4UXJA 3RSOA 1KK3A 3IHLA 2A30A 1DAGA 3NG1A 3H0KA 2JEOA 1H8HD 4G5SA 2GZDA 4HLUC 5FUXA 3ND8A 2G77B 4B6FA 1FX0A 4C7OB 2N1BA 4MDFA 2EFCB 3V00A 1TF5A 2V8OA 1GAJA 5C18A 2O8DA 2G9NA 3VMFA 1ZRHA 2LCFA 4TWZA 3FKSA 4DLRA 4HATA 2YNMA 3K9NA 4B34A 1KJYA 4K46A 1Q12A 1R0WA 1KHTA 2O8CA 2IK8A 3B9QA 4HB0A 4N0EA 3SHWA 3F3YA 2H18A 2V54A 3H4MA 2ZU6A 5F9HA 1ZIOA 4QM6A 3LVQE 3AQ4A 3RSLA 4GMDA 1W4AA 3ONWA 1M6NA 1SHZA 1TEXA 4I99A 5SZKB 3TW4A 1WBDA 3TVDA 2GF0A 4HYYA 2ZJ2A 1BO6A 1G21E 2PCJA 5FPYA 3DMDA 2AN9A 5JLJA 4IHQA 4RFSA 3DZDA 3N2IA 2NTYC 1QBKC 2J41A 3BRWD 3CX8A 4U02A 4R71A 1OW3B 1H8HA 2IYZA 4EFNA 1N6HA 5KOYA 1UKEA 2W6JA 3O47A 3B5JA 1LTQA 3GLFB 1IY2A 4MQBA 1R0ZA 1NNEA 5KSOA 1AZTA 2OLJA 2O8CB 3EIEA 1W4BA 2P65A 4JJKA 3SYKA 4AKEA 1XTJA 3IBYA 4TTQA 3AVWA 3QG5A 2OHFA 5EE0A 4ZDWA 2HCJB 1JJVA 2LKCA 3IPYA 2ZEJA 4LBVA 2RGCA 3VFDA 2AK3A 5CB6A 2YWEA 4EJSC 2ZI3A 4IEIA 2WZQA 2YC4C 2FFQA 2IS2A 4NPHA 1CR4A 1X8JA 5SZHB 1XMJA 2WM9B 2F1IA 3BIFA 1JR3D 1XMIA 4F4CA 2EU8A 3MUFA 3WP0A 4W5JA 2Z6VA 3FGNA 4LJAA 3C4JA 1NF3A 2IYSA 1Z6XA 2XNDD 2ZREA 4B71A 3PEYA 3MG9A 3R7WA 1N6KA 4OHYA 5FOWA 4IW3B 3LO5A 3U5ZB 1DTSA 1NIPA 4P3YA 2OSBA 4BLPA 1RYFA 1CXZA 1YZLA 1A1VA 1CLUA 3IEVA 4HAUA 1IQPA 2PX3A 3B13B 1UFQA 3ZS9A 3U6KA 4URXR 1GRQA 2HT1A 1AKEA 3CF6R 3BFXA 2IEZA 2VF8A 1K6MA 2ZRLA 2D74A 2ZE5A 3B1WA 3MD0A 2PMDA 3P20A 1Q1ZA 3KJEA 2QM7A 2OCAA 4Q66C 3TH5A 3IIJA 2OCPA 4PFSA 1L2TA 3AP1A 2WMNB 4ASUA 2FA9A 4D6PA 2RGBA 5AUPB 2E1RA 2WPDD 1E6CA 1F2UA 2BHRA 1DG3A 2GDJA 3WXMA 3K70B 4UJ5A 3DEFA 3UMFA 3FMFA 3TAUA 1CJVC 1ESMA 1E0AA 4P32A 3JZMA 2VHTA 4POAA 1N6IA 5B57C 2O8DB 4NCIA 1A4RA 4Q47A 4WA7A 4OHVA 3GLGB 2DHRA 5E3HA 4OI4A 4LPSA 1U9IA 1RKBA 4FD2A 4OQLA 4BFSA 3U7HB 1CEEA 4M9ZA 1OXUA 4ZKEA 2FDCA 1D6JA 4GT1A 1ZM7A 4JBXA 4NCJA 1XTIA 1ZUNB 3L0PA 5H68A 4ZPXA 1E2GA 4JS0A 2AD5A 4IDQA 1JECA 1Q1QA 1R2QA 2YC2C 3GFOA 4JBWA 1V43A 3J81k 1JNYA 4BPBA 3SN6A 1Z83A 5B64A 3LVRE 4LOAA 1E2HA 1E94E 3GD7A 3AVVA 1VG1A 1JI0A 3VKHA 1E9BA 3N2EA 2QPOA 3MWKA 4I1UA 1AQYA 5CDFE 5HE8A 2FPMA 3EASA 2F1RA 1S4QA 3R8CA 5J4LA 4C0LA 2DYKA 1CKEA 1DE0A 1HYQA 3T15A 4V0NA 3IHWA 3V4RA 1TU4A 4KAXA 1E2LA 3CIOA 3EZ6A 1CULC 5BN4A 1GVNB 5KNDA 2BEKA 3PG5A 3QUSA 3ZJYA 1K5DA 1KNXA 2REOA 4Q02A 4XTCS 1R8SA 2PL3A 5LB2A 4B48A 4ZKDA 3UIEA 1KO5A 3U3JA 3SBDA 4XSGA 2VHCA 4KU4A 1XD2A 3R7WB 4CT5A 1M2OB 2CVFA 1KO8A 4TMWA 2GEDA 4C4PA 4O0MA 4TTRA 4C3ZA 3NTUA 2QBYA 1W4RA 5EUMA 1LW7A 1KOFA 4XD7A 4TL7A 3GLGA 2F3TA 4EIWA 1SXJB 2QG6A 4M53A 4Q19A 2QGZA 5FI1B 4KBGA 5JWHA 3CPEA 3RC3A 4ASUD 4NBSA 2NMVA 1FFHA 1DPFA 2AKYA 1P60A 1BS1A 1P9WA 4EKDA 1II8B 2E9SA 1BH2A 4NU0A 1NVVQ 4HLDA 2JDIA 4IVQA 4NHOA 1OPXA 1N5LA 3ZVLA 4F38A 3GLIE 1KTVA 1KO7A 2C9YA 2ZIAA 4X8LA 4B43A 4NDZA 2AFIE 4PHGA 2AL7A 1XRJA 4IOMA 4WXRA 3TQFA 5B30A 1YZTA 3PUZA 3QKRA 4LK2A 5EUQB 5C4GB 3W90A 1PLLA 4LY6A 1E69A 1I2MA 4XIGS 3GPLA 4QJ5A 2JASA 2KSQA 3QVVA 3BJIC 3GP8A 3N5CA 2HUPA 4FIDA 5TVKA 5JJLA 2ZANA 1IM2A 5JCPA 1F6BA 2WJIA 3IIMA 4TMTA 5JEDA 4JLMA 1HE1C 4CT4B 4BECA 1G3QA 1PJRA 4B73A 1U8ZA 2G1KA 3BH6A 1ZD8A 2EFGA 1GNRA 1EFRA 3EPLA 1E9FA 1E2DA 2A5YB 3FTQA 1R5NA 4XWKA 1TAGA 2NQ2C 3K0FA 1OXXK 1U90A 1KO4A 3T1QA 2FH5B 1CRPA 1OB5A 1NY5A 2AXPA 4IVRA 3THYA 1XTKA 1W49A 5E95A 2HYIC 5AJZA 1LS1A 2IYQA 1E9EA 1Q22A 4MGIR 3W9YA 2SHKA 4ZDIA 2WKRA 2FNAA 4E03A 1FMLA 2R6GA 3I5YA 3U3MA 1NLYA 3TGPA 3IO3A 5B2ZA 2L0XA 3QXJA 2RHDA 2WJVA 3EARA 3KL4A 4BFZA 3SR0A 3KB1A 1GRRA 2IHBA 3PUYA 4DVGA 2CJWA 1WQ1R 2GJ8A 2VP9A 4RSGA 3QY0A 3B1VA 5H8WA 4LUCA 4BE7B 2C5LA 4OI1A 1S1MA 2YV5A 1FTNA 2C8VA 3GEHA 5HE9A 4H9GA 4DCTA 1Z28A 3C14C 2H57A 1ZJ6A 3K53A 4PO1A 4XD7D 5ELXA 3BE4A 1YQTA 4KYUA 1W47A 1MKYA 1F2TB 1Z0FA 2ZRHA 3VQTA 2O52A 4X8HA 2K5UA 3PIRA 1E32A 1XFAA 1ZM2A 3LH5A 2VHQA 2ZJ8A 1BMFD 1GILA 4LHYA 4PXAA 3OIWA 3WNBA 1Z6TA 1G3MA 4M9XA 1YU9A 5DYIA 1UPTA 4D4MA 4AKIA 2ZUCA 1D5CA 2R65A 4K81B 4LJ7A 4RD3A 3QF7A 4JYCA 3UXMA 3OIUA 4QJ4A 3KKPA 3RDPA 3ADCA 1KJZA 1R10A 4AYXA 5DO9A 4JYBA 2DB3A 1J99A 5BYJA 1XTQA 2AX4A 4WIAA 5ANRB 3BH7A 2JLZA 1TQDA 1ZUHA 2IXGA 2GZAA 4EAQA 2WHXA 4BFYA 1LFDB 1XEWY 2XTNA 4KXFB 3Q3JB 3ICQB 2J0QA 1WXQA 1S2MA 2QORA 2XB4A 1GIAA 4URWR 5CJ2A 1SQ5A 4G5QA 4ACAA 3EWAA 2Y8EA 3ZD6A 4A92A 1XWIA 3DM9B 2XX3A 1Z06A 5EXTA 5DNYB 2RGGA 3VX3A 2B6HA 5DIFA 1R0YA 4DUGD 1TQ2A 1Z63A 1W36D 4Q7LA 2IHYA 1GSIA 1W7AA 4DIDA 2FSFA 5IT5A 1KZGB 1W44A 2ZM5A 2A9KA 4BQSA 1JR3E 4JLJA 4PPQA 2FFAA 1DAMA 1VG0B 1QHIA 1SXJC 2W2VA 4TMVA 5CIQA 1TNDA 1RFLA 3TLXA 1C1YA 4Q1FA 3VU9B 2BBWA 1GL6A 4F4JA 3REGA 3THXA 3QI2A 4L15A 4D82A 3W8RA 2QUZA 4MYTA 4JLOA 4LHZA 4Q1AA 4YQFA 1YJ5A 2FSGA 2GJ9A 3W5JA 2GAOA 4PZYA 4Y0AA 3U44B 4Z8YA 3NXSA 4IDOA 3QOFA 3LXRA 3RVBA 2QMHA 3ASYA 1IHUA 1DO0A 1VPLA 1CJTC 3Q85A 1GZSA 1XEXA 2FOLA 2ANBA 2F43A 2OAP1 5HTKA 5KUTA 3KZ1E 2CE7A 2J46A 1G9XA 1SXJD 2CK3A 3LD9A 5KDDA 4A8JA 1T9HA 2ZRNA 3FHOA 1VYUA 3Q9LA 3OHMA 4KI0A 2DWOA 4Q4JB 4US1R 1VIYA 1OHHD 4RCYA 4OHZA 1P5ZB 1W36C 4C2TA 1U8AA 1U81A 3QE0A 4QHYA 2BCGY 2VF7A 4A0FA 2ERXA 2PEZA 3GEEA 5L3RA 1P72A 4HDOB 1IN8A 3PUWA 1XCPA 2VP2A 1OXSC 3WHLA 1Z2AA 5JHHB 3QKUA 1Z2CA 3BK7A 3BB3A 4UNQA 3SFZA 1XB2A 4OQXA 2C99A 2N42A 3FHCB 4ARZA 1R4AA 2OEPA 1ELOA 1T5IA 2PH1A 5JJIA 1FQJA 1I4DD 1J8YF 3CNOA 2X2FA 2ONKA 1RJ9A 3Q5EA 2BM0A 2DR3A 4ZDJA 4OJKA 4TYQA 4LZZA 3Q5DA 1F5NA 1NMYA 1UBCA 1GKIA 1ZM9A 2ZI6A 4LJ4A 3RS4A 2W6JD 1XJCA 4L9WA 4QNMA 4UKDA 3PCRB 3H2YA 3OE7D 3CRW1 2R6CA 4PQRA 3SI7A 2J59A 5J4HA 1Q21A 2JLYA 1VKJA 5IK2D 1N25A 1XTSA 1RRFA 3FOZA 2FG5A 1MRNA 2A5FA 2QTHA 3EXAA 4P33A 4DEXA 2BCJQ 3PUVA 4B47A 2WAXA 1O3YA 2ZI4A 3GLFE 1BYIA 1N5IA 1XCGB 4IXMA 4Q1DA 3KKNA 4XVQA 3I8XA 3CX7A 3A4NA 2Z5FA 1BOFA 4N1AA 3ADBA 2JDID 1VCMA 3WMGA 3DVLA 3QKSA 2YOGA 2YWGA 1CJKC 3QPVA 4PTLA 3T35A 4B76A 3W6PA 1QHHB 2GA8A 2Z4RA 4AKGA 1OIXA 3AF0A 3AVTA 5JECA 2EW1A 2CJWB 3A1WA 3KDSE 2VHUA 3KKOA 4BFTA 2E87A 3TAHA 5JMTA 1KKMA 3U3KA 2WSMA 1E98A 4CEJA 4B3GA 1Z6GA 2YJTD 2GWHA 2QM8A 3UMSA 2X77A 4GI7A 4V02A 5JFGA 1KK0A 5DHFA 1GOTA 2D06A 2JLSA 1IBRA 1AM4D 1QG4A 3LRPA 3E70C 3EZ7A 1ANKA 5CITA 4PPNA 2WPDA 4A1FA 1HY3A 4EPWA 1UADA 4GNKA 1RW4A 2REBA 1KDRA 2ZI5A 3RS0A 3BH0A 821PA 3O8DA 2ZJYA 1UKVY 2WSSD 1G6HA 4ZCMA 2ZVQX 3ZZ0A 2JLRA 4DHEA 1Q44A 1FOEB 1COWD 4Q7KA 3HP1A 5AJXA 4MGKR 4PHTA 4P4TA 1AIPA 1AA9A 1QG2A 1I2DA 1SKQA 2F9LA 3AGQA 1YHNA 3LW7A 4NL4H 4BWYA 5EP3A 2JLXA 4TYPA 1WRBA 3ZIAD 2OT3B 4ZI2A 1ZCAA 1VMAA 3AF3A 2H5EA 2HF8A 3LNCA 4Q7JB 1E2JA 3TVTA 3MSXA 1UF9A 3OF5A 1SHKA 4NYJR 3TW8B 1JPJA 2EYQA 1W2HA 1WA5A 2C95A 1GNPA 5EXSA 1E4VA 1KJWA 4BEBA 3JVVA 3HJNA 3BS4A 3THWA 4D0LB 1HV8A 2ZXUA 2IUUA 1XF9A 1ZD9A 2RGDA 2W6ID 3KUCA 1E0SA 5IDVA 5EE1A 5JWRA 4PC7A 3FMIA 3U4QB 4PPGA 2NO1A 4NH0A 4XOIA 2FV8A 2WIBA 1IOZA 2O0HA 4LBWA 4NCNA 3EAQA 4MITA 2OCBA 2X8AA 4Q4HA 4OK6A 4MRPA 4KFUA 3UG7A 1PLJA 2P0EA 3DOFA 2FMXA 2BV3A 4CEJB 4IFEA 3AP3A 2D4HA 4HZUA 2R8RA 4W7SA 5JRJA 3IO5A 3NWJA 5TDHA 1NN3A 4PR0A 3ZS8A 4BZQA 4JSYA 2NO9A 1U9IC 1MOZA 3C15C 2WWHA 1RRGA 3VKGA 5FOSA 2VRWA 1LS6A 2ZPTX 2ZRPA 2GEVA 3MFYA 3ZDQA 4Z54A 4LJYA 2A7QA 3GLGE 2Q9AA 4H1VA 4HAVA 2J1LA 2ZYUX 1KSJA 1B23P 4TL6A 4EPTA 2UZ3A 3W3AA 3SHFA 3CR7A 1AS0A 5FH9A 5J40A 3I3SR 4BLQA 2D7DA 2GK6A 1DAFA 5KSPA 3SZRA 1XXHE 4DLWA 2QE7D 2FWRA 3TSZA 1F2TA 3I92A 4JIMA 3KQNA 1G7SA 4RVCA 1P2TA 2ERYA 5CJPA 2XZPA 4R7ZA 2NO0A 3GLIA 4JLDA 1KI6A 1MO6A 1ZYUA 2PT5A 5FOVA 2Q3HA 1KI7A 2FPLA 2XEXA 3Q7QA 4LJ6A 4MRRA 4DLZA 1JR6A 1T8UA 2IS6A 1SXJE 2VPPA 1E2FA 1W0JA 1HURA 3TRFA 3TR0A 4D0NA 3P32A 4W5HA 3VR4A 2QE7A 3RC8A 3HYRA 2D2FA 3EPKA 2AD1A 1DVRA 4QGAA 5F98A 3B1XA 1F2UB 2WJYA 3AKDA 3G82C 1XP8A 4AYTA 3GFPA 2V6JA 1OH5A 2IYUA 3UWKA 4A2PA 3LBHA 2P6UA 4TZ0A 1KI1A 2P5TB 5H70A 2VP4A 1JQJC 1HQCA 5CYPA 4NYIR 5DGXA 3LBNA 3QF4B 3CRRA 3THYB 3OEEA 2J0VA 1A7JA 5FR1A 3AH8A 1UBFA 3I5XA 4GZLA 1A2BA 4LYAA 1W46A 3QIAA 1DO2A 4QGFA 3WMFA 5GJCA 4LBZA 5KSYA 4I1SA 1KDPA 2BKUA 3WYAA 2DFNA 621PA 1SULA 4RD2A 5K8LA 4EFLA 4EJSB 4JKYA 1J7KA 4KHZA 3NDBB 1G3IA 1KI4A 2BDTA 2FX3A 4TLBA 3E1SA 1KAOA 2A5GA 4BFVA 3BB4A 3K0AB 1XEFA 1TTTA 3A1VA 3EIHA 4M22A 2CHQA 3MJHA 2HDNB 2UVQA 3AVOA 1VYTA 1NP6A 3PUXA 3T34A 5J4VA 1IJFA 4DLSA 3L0IB 3VR6A 5JZVA 3LLUA 2PZEA 1SZPA 3WBJA 3W6OA 1GKUB 4WVFA 4JVMA 3K9LA 3GLIB 3QBVA 4DDTA 1VTKA 1HTWA 2J87A 3MWJA 2IC5A 1YR9A 3F5FA 4D0GA 1QHGA 1W2GA 2WWWA 1E2NA 1W36B 3H84A 1P9RA 2FEMA 2WWIA 3HU3A 4RJLA 5G41A 4ZO4A 2QTFA 2Z0MA 3CBQA 1KMHA 4M1SA 1XNJA 1M7GA 4QKQA 1OB2A 1P4SA 2QN6A 4UNNA 1OF1A 1HT1E 2ZI7A 2VA8A 1TQ6A 3TSWA 3SYNA 2PJRA 1T4GA 3I8SA 2XB2A 2CNWD 2QQ0A 3GEIA 3PQCA 1Z0JA 2IUSA 2IT1A 2NIPA 4BZPA 3JZAA 3KJGA 2ZS8A 4OK3A 4O2LA 4LDJA 2J7PA 3IQXA 1NJGA 2MSDB 4YMTA 1HUQA 2EYUA 3FMPB 2C9CA 2YHSA 5EP2A 8OHMA 1RRPA 4LJ9A 3ZVRA 3SE0A 2ZJOA 3QXXA 2V7QD 2RGXA 2YWHA 1UBGA 2WTUA 3BFKA 1ZNWA 4JLBA 4ESHA 2IUTA 3AVUA 5JS8A 4TQAA 5C1BA 2O8FB 2DFKB 3PEWA 2AKAB 3FWYA 3A8TA 2AXNA 4CVNA 3G0HA 2RGAA 4A9AA 2PBRA 3VU9A 4M1TA 2UKDA 4PZZA 1ZAKA 1YR6A 2BEJA 2CMKA 1H65A 4PHHA 1KKLA 1VG9B 4OHWA 3PXGA 2GTPA 2GXQA 3K0CA 4JL8A 3GJ4A 5A0FA 2WBLC 2KBEA 3UANA 2F1JA 2FSIA 3RANA 1U98A 3IPXA 2DPXA 3K0EA 1E0JA 1GWNA 3OEED 1G8FA 3TE6A 2DWPA 2HJGA 3ASZA 4FCWA 4DDWA 1XDBA 4HZUB 2XXAB 2OUKA 3HPRA 3BWDD 5KO2A 2P6RA 3SYLA 1NKSA 2ZRMA 4QXAA 1P62B 3N70A 4HAWA 1MO4A 3EPJA 4OQNA 4M1YA 5KTYA 2V1UA 3ZQJA 2RKOA 2RMKA 1TMKA 5KYKA 1ZVQA 2GHIA 1KY2A 2GXUA 2KE5A 4DXAA 2OCYC 1Z22A 1MV5A 1Z0DA 3I4LA 1R0XA 1Z8FA 3KKMA 5FL7D 5JHGB 1Z6AA 2YKGA 2ORVA 3M0EA 1GL7A 1LNZA 2DWQA 3IUYA 5DI3A 5DI9A 3TKLA 4QBHA 3VNUA 2REXB 2YWFA 2OXCA 4FCVA 1M8PA 1G41A 2ONJA 4MYCA 3OE7A 1T91A 4TLCA 4B3FX 3A58B 1XMVA 1NN0A 4TT3D 1S9DA 1SVWA 2VLIA 4QFMA 1TL7C 1DG1G 2HEIA 2JIZD 2H7VA 5LPNA 3LV8A 2BBTA 2J0SA 4YMVA 4MA4A 4QL3A 5BN5A 2A78A 4AY2A 1FL9A 1MH1A 4BASA 3K09C 5FOXA 4RD4A 4S2EA 2BBOA 2G3YA 1EGAA 4JT4A 1T5LA 4WBSA 1NKTA 1X1SA 3I72A 2PT7A 2OE2A 3LWNA 1TPZA 3SJCA 3WNDA 4BUJA 4IOKA 1U99A 2J7PD 3U2QA 5TB5A 1YZQA 2JGNA 2QTVB 1KNQA 3HWSA 1P2SA 6Q21A 4GP6A 3PENA 1W4CA 3S1AB 1RIFA 2C03A 4TL8A 4W9MC 3PV0A 1F3OA 2CVHA 3L43A 4FN5A 1MT0A 3PR1A 2EQBA 2OO7A 4LYJA 2DFTA 3WYFA 4TTPA 2QQEA 5AWFC 4FCTA 4D26A 3RRZA 2QENA 1SKYB 3W5IA 2D62A 1TU3A 2VHJA 3EC1A 3FFAA 4MRNA 1J90A 1XU4A 4DT1B 3T61A 3BBPA 4DDUA 2GZHA 3WYGA 4IDPA 3CF0A 2C2HA 5CB8A 1Q3TA 2PZGA 2QAGB 1ZNZA 3OIYA 4TMXA 1G3RA 1KI8A 3D7MA 5FFMA 1SVMA 3SDZA 2F43B 1NI3A 4OYHA 2DCUA 3BGWA 4HB3A 2ZRFA 2VO1A 3S1AA 2F55A 3CZQA 4KFRA 5KPDA 2ZRKA 4M4SA 1UKZA 4NE2A 5CLLA 1AZSC 1CTQA 3K1JA 1WF3A 4RD1A 1T0HB 4PANA 4N3NA 4ZCIA 1WB9A 4CGZA 2X2EA 4OBEA 2QROA 5FPKA 3LA6A 1EWRA 4MH0R 1XX6A 2O0JA 4IOJA 1NVWQ 3UG6A 4B75A 1OKKD 3GFTA 1P9NA 2Q9BA 3HU1A 3RRNA 2ZYVX 3B1ZA 1JALA 1OH6A 3KJHA 2XJ9A 5HCIA 2XITA 3GQBA 1KI6B 4KCGA 3LLMA 5AJYA 3B6EA 2FZLA 4JSTA 3THOA 4F7WA 4XTRA 4BRUA 3ZQ6A 3B8HA 1UJ2A 4KFTA 3CRVA 4QM7A 2DBYA 2QP9X 4A2WA 3CPJB 2R44A 2QBYB 2XTZA 1HH4A 1W0KD 4GBMA 4LBYA 3WP1B 4RZUA 3C5CA 3LDAA 1MABA 5G3YA 5A4JA 1E79D 3SJZA 2W0MA 3I32A 1KI2A 4PAOA 5CK4A 4B3DA 5DN6A 2WWXA 4LX0A 2OLKA 1IN5A 1EX6A 2RGEA 3OEHA 1KI3A 4LC0A 4D4LA 1G4UR 3R8FA 1AK2A 4M21A 1HA3A 2ZS9A 1XCMA 1QHSA 4TZ6A 2GCNA 1EX7A 3GJ8A 4D2IA 3CM0A 4EQ6B 4G5GA 2ZVPX 1NY6A 4U00A 4XJXA 1N6NA 3CWQA 2W83A 2GBLA 5FUYA 1E4YA 5FTMA 3ZD7A 2JJ1A 2ZS7A 1EFTA 4TN1A 4GDFA 4JLKA 4Q03A 1PV4A 1Q1EA 2IYTA 3LFUA 1D2EA 1D2NA 1SKYE 2ZRDA 2X19A 3IEUA 4Q21A 5GJWC 3CPHA 2QU8A 1GRNA 4OQFA 2JJ1D 1S0UA 1NN1A 1OH7A 1KYIA 4HLQB 1WMSA 4JKIA 4DLTA 4ZIRA 3SJAA 3X1XA 5KHOC 1JQLB 3SBEA 1QHNA 1TX4B 2JATA 5FUWA 4M1WA 1QF9A 1EFRD 3NBYC 1OHHA 1X86B 3GLHE 4LYHA 4PAQA 1P73A 3X1ZA 4DC9A 3GJ7A 5FBRB 4URVR 3ZH9B 2ZRGA 2FF7A 1YZNA 4O2RA 5GVRA 1FTSA 4IEEA 4A6XA 4DSNA 1US8B 2QAGC 2WICA 1E99A 2HLDA 3BD9A 1II0A 4U7DA 2HXYA 1E9AA 3AEZA 3W6NA 3AGPA 1E96A 2BM1A 1NBMA 2BVNA 3PITA 1D8TA 1KIMA 1YRAA 1Z47A 1VHTA 3U4QA 1B0UA 4GZMA 4ZIRB 5KSZA 1H8ED 1R8QA 4RFVA 5GJVC 2ZI9A 1AGRA 2IS4A 5JSZA 4WW0A 3ADKA 1XPUA 1WCV1 1NBMD 5DH9A 5F9FA 4UNPA 4RD6A 1S9HA 1DAKA 3EZ9A 2BMDA 3BB1A 4TYWA 4MKIA 2Q21A 4DBLC 3NBFA 3RWMB 1OKKA 2VL7A 2ZE7A 2Z83A 3K0FB 3ADDA 3LXXA 1ZW6A 4MGZR 4GL2A 3GMTA 3K9GA 4OL0A 1DELA 3C8UA 4D25A 1VYVA 1ZD1A 2GF9A 1KSHA 2W0SA 4H1UA 4I81A 3ECCA 4NCHA 4CDGA 1G5PA 4XVRA 4D4KA 2LKDA 4PZLA 2ZYTX 1FNNA 5FTNA 4JT2A 4B2LA 5HKKA
chains in the Genus database with same CATH superfamily
5G02A 1C1DB 1FSFA 2FUCA 1RQ7A 3KVNA 2O3SA 3S1LA 4EJ6A 2Y9MB 4J49A 3UOGA 2QR5A 3CZ9A 2ZZMA 3OQJA 3IC5A 1KEEB 1WULS 4UBIA 2IEAA 4NPAA 1AUQA 4ZV9A 4DR7B 3FX2A 1VMKA 3Q3GE 4NATA 3TLGB 2OFXA 2ATVA 4C0XA 1YDGA 4IJ5A 1Z6YA 1O96A 3AUAA 2WJZB 4RTMA 4ZARA 1USGA 5B58C 3TSOA 1LX7A 1I6KA 2HJVA 4W6QA 1QZXA 3WL8A 1GCOA 3E35A 5A5EA 1XAGA 3IKLA 1R16A 1DTWB 3F8WA 3H5RA 2PWBA 3EPHA 1LB1B 3OC0A 3WGIA 5BR8B 2I6UA 3E9RA 4LQCA 3QE9Y 5T57A 4LY0A 2Q1YA 1WU7A 2GYVA 4LY3A 3DVAA 3WADA 1XDGA 5LKRA 1Q0QA 1LV7A 1TD1A 3FKQA 4YMUA 3W06A 1OYVA 3HMKA 3SM3A 3ENZA 5EIFA 1QLHA 1NG1A 3KUDA 1NSYA 4TRMA 4I1VA 4YALA 3BWVA 5HZHA 2CBXA 2GEBA 1QKJA 2R7NA 2JBAA 3GJ3A 2WF6A 4HNHA 2XMRA 3DLCA 3ENKA 2NWQA 4NFSA 2AOUB 3ROXA 4F60A 3GOHA 1XI2A 1N2EA 4GQIA 5FI5A 5T3UA 1SC4A 4ALMA 4CNQA 2BMFA 4G5OA 1QFSA 1DBPA 3O31A 1B0AA 1CY8A 3DEIA 4TS1A 1EVKA 2FRXA 2NSLA 4R0VA 5IARA 5L95A 2JLWA 4TT3A 1LVUA 4DQKA 4WDQA 2YUIA 1E77A 2IPMA 3FOEC 3A6PC 2RBKA 1SQ0A 2F6RA 4CIYA 2VQFB 3QV1A 1COZA 1P75A 1RHMA 1HZZC 2Z4SA 2AFVA 3O4FA 1N5OX 4XUDA 2HA4A 3AUYA 3RNLA 3DEYX 1CHNA 3QU9A 5REQA 1XKLA 4XJSA 1L5LA 2O20A 3PNVA 4FHEA 5KWJA 5CM2Z 2XCOA 5CNKA 1CUXA 2UVDA 5FR2A 4EENA 1ODFA 1N7HA 1WBJB 5AOVA 3A06A 2QYSA 1DDGA 1UJ4A 5C8YF 5KX5A 4CT0A 3GBVA 3QKRB 5LDHA 2EFDB 3HJFA 3SBOA 1PVDA 3OZVA 2ZROA 5DU2A 3CLSD 4Q0MA 3P27A 3H9EO 4MKFA 5FV7A 4H4EA 1QFZA 2ZTUA 2ZYWX 3HDVA 1C4WA 4K6MA 2A0WA 1CY1A 4MV4A 3ZKWA 4Z8XA 2GCPA 2I55A 3F67A 3ZLBA 2X0IA 4IVNA 2AWOA 4MUBA 3QG1A 5CLIA 4FWTA 4RNCA 3TXYA 2OM2A 2HFJA 2QAIA 4H0FA 2XF2A 3NRJA 2O2CA 3UK7A 5BOSB 3OLQA 1ATIA 4DMUB 5JCJA 3ZHBA 4CNBA 3U6BA 1TD9A 1DWQA 2BBSA 3NYQA 1G9SA 1BVRA 4L22A 3KLMX 3WZ2A 5KTKA 3LXMA 3QEJA 4YP1A 2FJUA 4LF8B 4HNGA 1G9TA 1EFCA 1WW2A 5AK5A 5G4KA 1XSEA 2H2FA 1M5TA 3ND5A 1PNQA 1P29A 3MTJA 1QP8A 1NLZA 3QJGA 1E61A 1VCNA 3FZNA 3EVDA 4IMJB 5EXDA 2VQEB 1K06A 3RRXA 2QIOA 2AZDA 2I3ZA 1VQ1A 5JYBA 3BIWA 1E7WA 5IH3A 1LW6E 3MCZA 3CLVA 1NVVR 3O93A 1Q0RA 4KG7A 4C1NA 1SPBS 1UBJS 4KPFC 4ENSA 1QFMA 4UM8B 3O90A 2H00A 1O7JA 3INNA 3MJEA 1I0LA 5B2FA 3AHFA 4DDVA 1WMEA 4BV2A 1OXTA 2C0QA 2CF5A 4WJLA 5EWMB 3QU5A 3EWNA 5KJ1A 4KN9S 1BWRA 4H6WA 2VEDA 3ONNA 4L50A 3WV5A 4UVIA 5CLGA 3IBFA 1M2NA 1SVNA 1A8SA 2RH8A 4N3AA 4QELA 3W78A 5DM60 1Y6GA 1TIKA 2PUFA 1ZN9A 3OZSA 3JD1A 5CNJA 1KVUA 1WEHA 3G1UA 3QEMA 1XVIA 2IQ5A 2CLKB 3CTPA 3FNHA 4G67A 4OYLA 5ALOA 5EJIA 5FL3A 4U2FA 5JTTA 1N0WA 1KU0A 1F8GA 3HCFA 4ISBA 4ZODA 3ZVMA 1KDZA 4NYMQ 2HWXA 1OA1A 4PZPA 1Q7TA 1T4MA 2XMZA 1Z15A 3BBLA 2FCAA 5FF9A 1N78A 2YL2A 4I8IA 1R9GA 4R51A 4Z7OB 4KKVA 3KWJA 3AR3A 2GUWA 1L7DA 3WGKA 1THTA 3PJDA 4DLBA 1HETA 3PKZA 3NXKA 3QJYA 3GGSA 3C5HA 4TKVB 4TTVA 5H1YA 3V9PA 1YJXA 4ZAFA 2I1WA 3AZQA 3ILHA 2Z8ZA 4Q9IA 1IYZA 5JATA 1U7ZA 3FROA 1PJAA 5FD8A 2Q3JA 4O1MA 4CQNA 1QYXA 2E4VA 1V35A 2KB0A 2DBZA 2XYGA 3B2EA 4BMZA 3JQGA 1QQBA 4RPKA 1C3OA 1W88A 1DQPA 2MTBA 4KQGA 3P2JA 3W6ZA 2LV8A 3G6WA 4NV0A 3EMVA 3C24A 4EPRA 1QFJA 3ZE0B 5KNCD 4OQMA 1DS6A 4HS9A 4B35A 1XN1A 2NYVA 5I9NA 1P0MA 1JSXA 4EY5A 5FL7A 5DZSA 4OI0A 3F1KA 3MQ2A 2QE6A 3A2NA 4J4TA 1RBMA 1FNMA 2XCIA 5LWHA 2IL1A 1HNZB 4KNWA 1KL7A 5JBIA 1ISFA 1R64A 2H2HA 4RORA 5IHPA 1U0EA 1NURA 3BN3A 4LJ8A 4LZJA 3QVWA 2PU5A 3ZHUA 5FI0B 5FA6A 1LI5A 4JR0A 4OGKA 3VAAA 4PYKA 4MYHA 3VU3A 1IHXA 2FRVA 3LPAA 4RENA 1AKTA 3PXBA 5HZMA 1HYEA 1JWAB 4QUKA 4F1WA 4I4TA 4Z0HO 2B4TO 5IF9A 1Y7LA 2CNKA 1DINA 1ZMXA 2AFRA 1D2HA 4ZYZA 1XZPA 2Q0HA 4YDSA 1AZWA 2VT2A 3LGSA 4HUQA 3DL0A 3WI7A 5BY2A 1VRVA 2FR8A 1ZS9A 4DLVA 1N2ZA 1YS4A 2OGTA 3TTUA 2XUDA 1CC1S 3PDIB 1H0RA 1DC3A 3NQ41 1KMQA 1FBTA 3C6MA 1E1CA 3DDNA 4Y2SA 4JVOA 4QECA 3AMVA 1FYXA 5DWQA 1KH3A 4GEKA 3TK1A 1BA2A 3KQKA 2G9VA 3RM3A 3TLZA 2UZ1B 5J2TB 4K3UA 1SFRA 1VBFA 5LU9A 3UHPA 1XVVA 1PGNA 4FMCB 5HR5A 2JAUA 3MUEA 5HZGA 5JANA 2CFOA 1GQRA 2D8AA 5JJ5A 2ZTLA 5GJBA 2NM0A 3PJGA 2J3EA 3UQZA 1VYHA 2X3FA 4ZT3A 1QOZA 1W9HA 5CBKA 1Y1QA 3O8CA 1SUFA 2RHCA 3D0RA 4DB4A 4XEHA 5ES3A 3T95A 2BR4A 1YASA 3LKBA 1H0KA 2C83A 2F3PA 3GMDA 3HBFA 4GMXA 2HRZA 5JSZB 1GA4A 2C7RA 2FUG6 1SU4A 1ZD4A 2WWGA 3N87A 4YRAA 1GSOA 2R62A 1UDWA 1VHWA 1BA3A 2GAAA 4KR3A 2OZLB 4MEAA 4MKZA 2HA6A 4UVEA 1Z0AA 1TM4E 4P36A 4RANA 4GMKA 1I3CA 1QUEA 4Z99A 4NDAA 4MMXB 2AEEA 2ODBA 4B3CA 1FW6A 3UAVA 3RLFA 2O5EA 1J2RA 1PZEA 4FDUA 4IG4A 5D01A 1S3GA 1QP7A 2GM4A 3ZI4A 1DKPA 2PWYA 4DWOA 3HFSA 1AXEA 2QMYA 3LYHA 4I55F 1JGTA 2O1SA 4CKCB 4V0LA 5FNVA 1DIHA 2WEKA 3AILA 16PKA 2PX0A 1GA1A 4XWAA 5HBRA 2COKA 4CDRA 1OH8A 1XYYA 1N57A 5I9LA 3UHFA 3TTVA 4QICA 1E5LA 2J9RA 3JQPA 4UZEA 1F9EA 5BQ5A 3X1YA 1GQSA 4G5YA 3B2QA 5KYYB 2ONCA 2JLUA 2JJ2A 5THXA 1HQYE 1SXGA 4HEA6 2DC1A 3ROZA 3RYHB 2V4MA 4AX4A 5BSVA 3NTRA 4YUYA 2GAJA 5BWNA 3MTQA 2WUVA 4BX0A 2W00A 4NZOA 1N2XA 5LP6F 2D8MA 3O8QA 1MUUA 1UMBB 3L7IA 4JODA 4AO7A 3TNFA 4YDQA 2BGMA 1ENPA 3LP5A 2Z1DA 4IXNA 4KXYA 3ZXYA 4FMDF 4DFDA 5IK2A 1YMUA 1KJIA 1Z3IX 2FFHA 1X3SA 5TARA 2X5KO 3H9QA 4KTTE 2JJ2D 1QGUB 4TWIA 3K0AA 5BYKA 1ILEA 2CCJA 4HFNA 3P9CA 4K2HA 3RS3A 3EODA 3CF4A 4BC0A 4MI1A 4K1LA 1N1DA 2PDAA 3O5AA 1EVIA 3OLXA 2J5XA 3W34A 3I39X 4TSFA 2O8BA 2A1UA 3MMXA 4L27A 1ZISA 2G82A 1ORRA 2PD6A 3G9XA 1PR0A 2NOAA 4TUYB 3I2FA 5EYPA 1D9XA 1XP5A 5GMOA 4AWAA 1U0LA 4QBTA 2EGHA 1B3RA 4Q4DA 1XT6A 3LUDA 1EFPB 4YR9A 1EE1A 4FFSA 4L6AA 5ALPA 1YKFA 4O8CA 4B83A 4EITA 1UFOA 5AVVA 3T3EA 1IONA 3DXXA 3GVHA 1G16A 2DRIA 2GK7A 1LUAA 2HCBA 1WVIA 4P2GA 3UA3A 3FLEA 3N9IA 3B70A 3DFIA 1WQ3A 3I9FA 3TBFA 1DAEA 3AR2A 2WV7A 1YBHA 4TLAA 3WC4A 3ZJ4A 2QNRA 3Q0EA 1CR2A 3DMPA 3IJ5A 4EFKA 1BROA 3ZK9A 1DBSA 2AOVA 1SD2A 4FFBA 2IYXA 1YOBA 4IZIA 5CTJA 3L1JA 3EMDA 4F3TA 3N0RA 3DCJA 3G2KA 4K03A 3LECA 1EBBA 1S2OA 3WRXA 4WV3A 1ACJA 2AQKA 5HDQA 2VSFA 4CL2A 5JI3E 4FOPA 4YYEA 2DG2A 3JQBC 4EB0A 3WO1A 3DPIA 2FEAA 2MHCA 3IGFA 1S2LA 4D7AA 5ENVA 2OTCA 3NCTA 2VWGA 3PEUA 4X65B 5DE3A 3WYBA 5KSWB 2HTEA 4X44A 4HGRA 2WRZA 3HRHA 2PBLA 2WT9A 3CNLA 4BMOB 2C5HA 4BVGA 4DCSA 1QM5A 1XTBA 5CEEA 4D97A 5KQGA 4DL9A 1NQUA 5EMJA 3E0QA 5EG5A 4NOMA 4OY3A 1FXUA 1PL0A 4KYVA 3N74A 1L1EA 4B7CA 2QRUA 2YJGA 1NVXQ 2MSWA 4TLEA 1KZ9A 4GOMD 4XE5A 3O94A 6REQA 1LBQA 1K5GA 2OP1A 1R8XA 4QYWA 1J00A 3WLKX 4FHZA 1QAOA 4DSTA 3DGEC 3TM4A 3KHKA 1PUIA 2IYYA 1LPPA 4CZ2A 1XMQB 2ENUA 2O05A 3UKOA 3LQRA 3BE6A 4EY3A 5FQOA 2NZXA 3E3MA 4E08A 2ILVA 5KYGA 4KI7A 2ZIVB 3EJ6A 3LL7A 3K2BA 1B43A 3EQ9A 4EPXA 4GICA 5BN5A 3NBUA 721PA 2PH5A 4GMHA 2G9RA 4Y7CA 1YJAA 4FOTA 1W8DA 3JQGB 2UUAB 1ZY2A 3OPYI 3WNVA 3KAKA 4EG7A 4QBFA 4PU0A 1UOEA 4ZO6A 1QNLA 2NZ8A 2ZE8A 4UDXX 3SOPA 3RB8A 5IDQA 2OHVA 3AP2A 3TTWA 2PL1A 5KOIA 5E7QA 3MLEA 3LUJA 1K92A 1CVIA 4KO8A 2GJKA 4WZBB 3HWRA 4YRFA 2O8EA 3KZVA 3TQCA 1FZQA 2V65A 3K8QA 1H1LA 4BUZA 5TQ0B 1T3SA 1DUSA 4CKEA 2QM0A 3ET5A 3DYVA 3P2EA 5K99A 4TV8B 1EJBA 4N5IX 1X92A 2DHQA 3C7CB 3DHYA 4NENB 4YIHA 3NKLA 1QTIA 3HP7A 2JH3A 2G07A 4ARVA 2BISA 3KCNA 4NYIQ 3V8BA 3L8MA 4RJIA 1P7ZA 1AKRA 1A9PA 1JFSA 1NBAA 1BE0A 1NP7A 3E8MA 4M0KA 2Y0EA 4QUJA 4R7TA 3G85A 2QVGA 3HR4A 4OJMX 4AURA 1T6NA 1WP9A 2YZMA 4ZHQB 4LJLA 1OFUA 1G5RA 4G0MA 4URYR 3LT0A 3TMKA 4MSUA 3A9RA 4LV5B 4RCZA 1X80B 2DF8A 3MZ0A 4GM1A 3R7AA 1SVLA 1W4LA 2F8TA 1X7XB 4O29A 3KT8A 1MQ9A 2D0IA 1KYQA 3QM1A 2EQ5A 3S2UA 3L8EA 3RBXA 3RYTC 1P7YA 4FN4A 1N7IA 3DV0A 1A69A 2C3PA 2UUPA 3OTIA 3NVMB 3EZFA 4J1TC 4J0QA 4RABA 1E1DA 4XGQA 4J2TA 4WI1A 1BN6A 2R6JA 4P5DA 2GETA 3WRYC 2C54A 3I2HA 3KXLA 5TMDA 3RRBA 1QV7A 1VOTA 1WG8A 4MCIA 3KZMA 1DFHA 5JALA 4I1RA 3KTAB 4UARA 5K8TA 4V3BA 2QRKA 1XRRA 2NAFA 5IH7A 2FWNA 5K4HA 3EVGA 3DE5X 3C3PA 3AK4A 1RAIA 3H99A 3T0FA 5D1HA 3GJSA 3BGSA 3RU3A 5JZOA 4YRPA 2AE2A 3H2BA 2PCLA 4LGMA 4GDMA 4CMIB 5CG1A 2EKPA 4PSVA 4J6EA 2JA2A 2ODPA 1FDIA 4FVTA 2P4EA 4M9SA 5IXSA 4U6SA 4HQ6A 5K0EA 1BXKA 1WJGA 5ENZA 4YUAA 5AXBA 1F1JA 3IBTA 2OXRA 3BF8A 1A71A 5CIWA 3VKFA 4S35A 2JFBA 3ETLA 2DZDA 2J09A 1HDIA 1XZGA 3CR8A 4OJQA 1JEJA 2W93A 1AQNA 1FFAA 1JIQA 4W1QA 4ADSG 1NBWB 2P2YA 3PC3A 3K30A 3EWIA 1B6GA 1WDKA 3EK2A 2ZR8A 3CCBA 5D6OA 5LYJF 3FSJX 4X45A 1IMOA 3PFBA 4RW0A 3MJFA 3L79A 4QO8A 4TYMA 3CCFA 3ELUA 7REQB 2JGLA 3CE6A 1IXZA 3WDLA 2O3RA 4TS4A 3U0BA 1UUFA 4FUQA 2Y2VA 3WKEA 3N28A 2EXXA 2BGWA 4MI9A 3F73A 5KYNA 3QEOA 4MARA 4MRVA 4DDKA 1WB4A 3EFOA 3DAPA 1CY7A 4I4LA 5FORA 4L76A 2BMWA 2FUKA 3R23A 8ABPA 1ZIPA 1S3SA 5IJWA 5AUQA 3SU8A 5G1NA 2VJPA 2LWIA 3PE4A 3JW8A 1H23A 1I4TD 2FW9A 1ZC3A 3PUIA 5BSFA 5JRZA 1N0UA 4RNDB 2NVBA 2YUTA 4J9UE 1DJOA 1UZAA 2B1QA 4UASA 4V03A 2PD4A 2EX1A 4XUCA 5CX4A 5JQWA 1IMJA 4WXMA 1PS9A 4MUGA 2ZBPA 5EYPB 1Q74A 3MCUA 1G291 3AJRA 3IS3A 5KWIA 1C29B 3WTCA 1FPQA 3UT5B 1XXHB 1EMDA 4JZKA 2H7CA 5H3HA 3U7EB 3H86A 1WTAA 5GTDA 5IS2A 4JL5A 3TOSA 4MWEA 2C2MA 4G5FA 1T8WA 5FNZA 4BZWA 5JXGA 2GKSA 4AJIA 1XEWX 1QCDA 4FXPA 1LDGA 3PF9A 3DPSA 2IPNA 1FXWF 4NYJQ 3E8SA 2OG1A 5BXQC 2XLBA 1EZZA 2AR9A 3D4LA 3L8DA 2WMOB 4O4JB 4PG7A 3VU0A 3RIMA 3SVLA 4KPEC 4G0VA 2KWIA 2GZ1A 1SVIA 1NLFA 1RJ9B 3ZHRA 4LV8B 1ODJA 3FDJA 1KSGA 1TA4A 1JHQA 4IH4A 1EZ1A 3EZGA 4KXWA 3EIXA 1Y3DE 3SSAA 4ZI3A 1JYSA 5F2OA 1JAHA 2I33A 1D1SA 4BMDA 5EJGA 4WZ6A 1AJEA 4MVCA 3PR2B 1ZRSA 1FFGA 3NIWA 5AK6A 5ED4A 1SCNE 5AVXA 2FUEA 2ZT5A 1BG6A 2OHIA 4G1VA 4PAMA 2Y1XA 3H1PA 5EXPA 2D2XA 2HSWA 3MCWA 3T3HA 3GJ0A 4WH0A 2VXBA 3EXIA 1EXWA 4JI2B 2H7YA 4G86A 1Z6ZA 3F6CA 5GQSA 4ZT7A 4YRBA 2BDUA 2W2TA 2YHIA 4JOBA 1M1NA 3X2FA 4MKHA 5F3RA 4DEVA 1LK5A 5CYGA 1G8KA 1S2DA 3VNVA 1EBUA 2Q6OA 2QEQA 3FRHA 2E4WA 3GPCA 4PYLA 3ROKA 4MKGA 1T2EA 1V11B 5D3MA 4S0ZA 4Q4CA 1GGVA 3DEJA 3ONVA 3TUJC 2I4OA 1FRZA 2VQDA 4HFMA 5CGQB 3B60A 4P4SB 3FFWA 1Z07A 2GZRA 3ESCA 4XLTA 3WLTA 4C1BA 4LMPA 3QPAA 3GN1A 3JY6A 1O6GA 3MAAC 1XLTC 3CW2A 4AIIA 2V7UA 3AINA 1G2OA 1CK4A 4LQDA 3UXEA 5FBVB 1FXWA 5HJ5A 3GLFA 5DP1A 4WHMA 3WK4A 4S05A 1CHDA 1KGDA 2JCSA 3EVTA 2BJVA 1Q84A 1ZEMA 3KFXA 4S2UA 4UEKA 4LOIA 2BEWA 1EI9A 2OBBA 1YZGA 1JVSA 3IQDB 4J90A 2DFPA 4JGIA 4NOJA 4Q4AB 5DTRA 3UICA 3BMNA 4HH1A 1I9GA 2BJWA 3TG2A 3BCRA 3TZCA 3HYLA 4BBPA 2PX4A 2QSZA 3NASA 1PJZA 2WR8A 2Z3WA 5FOTA 1L9KA 1QE0A 2D5IA 4H16A 4IWYA 3I6ZA 2WKPA 3TD6A 1QU3A 2ZCJA 4FP9A 1JDBC 3KWLA 1EG7A 2QJWA 2HMSA 3RSGA 3WLFA 1XZCA 2PXAA 1SNYA 3STHA 4AJJA 2FK7A 2C77A 3GGDA 1PIWA 2EKDA 4FZVA 3WGQA 1AGYA 4C6SA 3KR0A 4MICA 1OV4A 3CONA 3ZR4B 5A0TA 4QOEA 4Q1EA 1JSLA 3AXTA 2Q2WA 1T5HX 4ER5A 3T0IA 1SPXA 3I2IA 4HFRA 2VDQB 1NXTA 2PKQP 3GJRA 3L8ZA 3MT7A 4PRLA 3ZVNA 4TM7A 4EB6B 1BU5A 4D6YA 1RP1A 2OV2A 3T0GA 1S89A 1PWXA 1JHDA 1NNSA 4JC0A 1ATZA 2W2PA 4TQUS 3DWIA 2IBMA 1Q7EA 4EKYA 2OA0A 1SHLA 2KYRA 4URHA 3TDNA 2ABWA 3EXG1 3AKEA 3DCIA 1XJQA 5L3VA 5AHXA 4XDZA 1MQ8B 4CN9A 5BQXA 5EJAA 4IEFB 2VNJA 2ZIGA 1ECLA 1V9CA 1T2NA 2H17A 3RS2A 5EVJA 1U11A 3C8ZA 5CLQA 1NR1A 3O75A 1H0HA 5AIAA 2JJQA 2HTFA 1ZGCA 3U9TA 4XDGA 3LX4A 5I7RA 2CYAA 3DF9A 5DWDA 1WETA 3ESDA 4E88A 3AT1A 3PQ4A 3UJ7A 4ALKA 1H4TA 4KLNA 2PRZA 3ZHXA 2C88A 1RQNA 5AKGA 2PAAA 3EX7C 2HSZA 3CMCO 3NKVA 4DQLA 4RH3A 2X0DA 1N2CE 3AEKA 1YZVA 3F6YA 4EHAA 3AOEA 4X93A 1CR1A 5IAGA 1LWNA 1SVKA 3L5KA 2DSNA 4LRTB 4X60A 4ZGWA 2NADA 4OSOA 5JCZA 1V1RA 3C16C 3NIFB 3W2GA 4YFYA 1M5RA 4QBIA 1JBEA 1ZITA 1YBFA 4WGFA 2YMMA 4W9NC 3UHAA 3M34A 3N0WA 3UUGA 3JYQA 4QYIA 4E5DA 1IZ9A 4RL6A 3F5MA 2IH2A 3S0JA 1NA5A 3PICA 3D8BA 1U0HC 3EZYA 2UZ0A 3OO0A 2MYUA 2QVLA 3O0TA 3OQIB 1L7RA 2ZSAA 3K6RA 4FT4A 1LDBA 1WABA 1ESCA 2B5VA 5DCUA 2JGFA 2C0CA 1KIFA 3N5KA 1GFSA 2ZIFA 3UKJA 5BORA 2F3QA 4RZIA 1X39A 4RJKA 1GPMA 2PGIA 1ZL2A 5C51B 5L7WA 2FR0A 1H2RS 3QEBZ 3QKIA 1CUEA 1ZKDA 5FBZA 4BE4A 2B35A 4J2HA 1M73E 1X13A 3KHTA 4DIUA 2C7BA 2MWMA 2GHTA 2VJAA 4ZZ1A 1Q6YA 3Q2OA 4DJAA 4H7FA 1TYAE 3WAGA 1W94A 4WZAA 3HCBA 4XX0A 4UXHA 1ZBDA 3HDTA 3OOWA 2V4UA 4PSCA 1YI0A 3OPMA 5IVDA 4D9MA 3R5KA 2ZG6A 4KLRA 4GR9A 4YT2A 4MCJA 5TS3A 4QT0A 3BWCA 5E7JA 1JJ7A 5CDFA 2I99A 4IV0A 2ET6A 1DARA 3KQUA 1KAMA 4IWXA 5SICE 1BMFA 5AVQA 1YDFA 3Q3IA 3FXAA 1E5XA 3NEJA 3WLHA 1OAOA 2J5QA 4I1OA 5HIKA 1YZ3A 2FX2A 4CIXA 1TVEA 1L3BA 5LXTF 1M83A 1BNCA 1VG8A 1ULAA 1OIWA 1C0IA 1Z4PX 4BO6A 1BIFA 2QP3A 3EG9A 3HGQA 3EA0A 4LK3A 2IX3A 2H1LA 4POOA 2GM5A 3NAMA 2PR2A 4WECA 2G0AA 2EOAA 3F4LA 4B32A 4UREA 4LX8A 2P2SA 4AKHA 2J7KA 3OPXA 4D5EA 2QI9C 5EHGA 1A72A 2LPMA 3PNKA 3GRFA 1EDDA 4O4IF 4XM2A 3RARA 4BGDA 1K6JA 3GPBA 4TKMA 2ZBRA 3KPUA 3LM8A 2X4GA 4ENUA 4CKEB 3QPUA 1ZP6A 1E2QA 3VV3A 2NTNA 1H6CA 2I22A 3DQZA 3R41A 4FQ5A 3I34X 2VHZA 5FOUA 3E61A 5LLTA 3UTCA 1J70A 1RI5A 3GRCA 2M1XA 4QODA 2GM3A 4C3VA 5JS6A 4PBRA 3UJ9A 3MC1A 1XGKA 3FYUB 5LDDC 2JLQA 4Z6KA 3K0BA 4B7UA 3H4TA 1X7YB 3NH9A 3L0BA 4DCVA 4XJVA 5KREA 3ROPA 4DPLA 4DXHA 1QTQA 2F3UA 4HWGA 1CERA 4YN3A 4MIKA 4WQMA 1E3MA 3BXPA 3ZIDA 4M8SA 4PF1A 2R8XA 3U0VA 3X3HA 4NG4A 2ZSKA 2B3TA 3D6JA 2DKNA 4RXMA 3DBRB 1AKVA 2MMGA 4XM0A 1YQXA 2ZITA 3W1WA 4E32A 1GKLA 2IFTA 3I9JA 4RMIA 4QEZA 4NIMA 2B69A 5F5NA 4G0XA 3TQIA 1QO7A 5FEMA 3EGXB 4EG4A 3ANXA 1M6EX 4KR0A 5ELMA 4OUKX 1FDUA 2V6FA 3B9BA 4ILKA 1YKSA 4PSDA 1GU0A 2EWVA 4EO9A 3WRXC 3ID6C 1SWWA 3BTSA 3OU2A 3FETA 1UJBA 2GILA 3VYUB 1P7CA 2JEYA 4RDIA 1KRXA 1N5KA 1H2AS 4NDNE 2B1RA 1N5JA 1QO0D 2X0JA 2V5UA 3JQEA 5CYOA 4D96A 3HV2A 1E3SA 5F64A 2I3GA 4G24A 1MZVA 1YL6A 1NW3A 3ZE1B 2A3NA 5HCUA 1MX3A 2WNHA 1YVDA 3CNHA 4FZRA 3SIPA 1IAQA 4PPFA 2XB8A 3IRUA 1NLUA 1L4GA 2FW6A 5AVZA 3T5GA 4G0YA 1QH9A 5FXMA 2XXJA 1T6XA 1TJPB 4HB2A 3SDBA 4DWJA 3IL2A 1OE0A 2VVTA 3B1YA 5KTRA 4GOXA 5CW1A 2B5WA 3OLYA 5JO0A 1PG5A 3DB2A 1XXHA 4EA7A 3CMMA 3M89A 4OBBA 4EG3A 3I01A 2EZ4A 3DPUA 2FPSA 4R9UC 4CCAA 2GCIA 1KS2A 3GARA 1LSOA 3NM4A 1NQXA 4HAZA 4PZAA 2G5TA 4U2BA 4Y3UA 3RGWS 1T2VA 5FTWA 5B3KA 2PJUA 2XCSB 1A8IA 2VP0A 1TO1E 3DNFA 1ZK3A 4HBGA 3IE2A 3SSNA 4PXYA 3RREA 5EE5B 5IDYA 4ID3A 1N0IA 2IA5A 1JPUA 2QXYA 3DYIA 4DCGA 5HOEA 1DIRA 9ABPA 3ZQKA 3P1JA 2ZB7A 2HL6A 4GOJA 1V1MA 2IOFA 2DTEA 4UEOA 2BW0A 1MIOB 2Z9DA 3KXIA 3NVDA 4KLZA 1U5AA 3WIVA 2GCEA 1Q0TA 2XNHA 2OHXA 1A9XB 5I7FA 1UBOS 2XSZD 4N4AA 1SY7A 1H5NA 5FBQB 1E2MA 1FUIA 4P0TA 1GDHA 3O8LA 4PFKA 4YMSA 1P7WA 2XHEA 1VKRA 3HUTA 5C2JB 3Q10A 3CRMA 1Y1RA 2IWHA 4BVJA 2JIZA 1RPZA 5EE3A 2J3LA 3T7EA 2ZRQA 8MHTA 2Q9UA 3AFGA 3S81A 1KYZA 2H3EA 2O8FA 1E1RA 2CHGA 2G6BA 1YFKA 3L7MA 3RYIA 5FLXA 1J24A 4WLNA 3FFBA 2GJAA 3RFCA 5C5EA 2PT9A 1B2LA 2R6DA 1XU7A 2GFHA 1V1RB 3D3KA 1ACLA 4D8WA 4D9EA 1OC2A 1E2EA 1L5OA 1W59A 3D8TA 1SHTX 2F7SA 1PX2A 1YZKA 2CLEB 3OFNA 3D6TB 3PUJA 3C4VA 1CQJA 1QHEA 3NHSA 5D00A 4ND8B 3IBGA 3R3VA 4FZ3A 3BMOB 4IRMA 3H42B 4X6LA 4M98A 1DIGA 4BQPA 5D5PA 4DYVA 2YFKA 4KWIA 4CE6A 4AMGA 1V8DA 1X1CA 4EJFA 1XKQA 2UYHA 5IVKA 3IEMA 2GPYA 3E1KA 2TS1A 3H9CA 4HG2A 5EPEA 1JAXA 3V8PA 1YVPA 4J1TA 2R48A 1E8NA 5FKJA 2WHRA 1IZ7A 1P31A 1K2VN 1NFRA 3DT8A 4EJSA 4EDHA 5I01A 3KKLA 2QN8A 2DFDA 3FKSD 3D0OA 3IUBA 4G01B 1UPFA 3GJTA 3BXZA 3H1GA 4IGKA 4CXMA 3T06B 1MABB 5E8JA 3TCKA 1J2JA 1P61B 2JLBA 5LMUB 2CHFA 1WU8A 3D6AA 1JMKC 5F7JA 4UZSA 3AEUB 1XR3A 1TKCA 3NG1A 3K73O 3PU6A 3T4PA 3EMBA 1N3IA 1YHZA 2FPGA 3OUUA 4L02A 3H5NA 1RS0A 1UPAA 3G2OA 1GUDA 3MXOA 3MJSA 4HH4A 1FX0A 4B6FA 4CV1A 2N1BA 4MDFA 4C7OB 4AKSA 2EFCB 1XRPA 3EHEA 3V00A 4MYDA 4FK8A 2QV0A 4NAHA 3OT4A 2AMYA 1P1KA 4WXEA 2PSEA 3A0UA 2IW1A 3EGXA 5KTTA 3ZDRA 2LCFA 4KIUA 2GWRA 1KPIA 4QASA 5TVGA 4FFRA 2WFAA 4JLUA 4L9RA 3AM4A 3N2LA 1IG0A 1KHTA 2HF7A 3E7WA 3GQBB 2OLEA 2X0KA 3LCVB 5I48A 3KS9A 2IK8A 1L5HA 3B9QA 5EJ8A 2PPVA 3EZNA 3ZCSA 3OZUA 2H18A 4JJIA 3H4MA 3L7CA 5F9HA 1Z33A 1GYPA 2J67A 1RRVA 1YB7A 2ZXFA 1HTBA 3GG9A 4IWNA 2AOTB 5K7SA 2IOYA 2XQFA 3BSSA 3G6KA 3OCJA 1K88A 2ZJ2A 3DEZA 2WTEA 2PCJA 3DMDA 4IHQA 2E7ZA 3DZDA 1OREA 3N2IA 3MT8A 4OMDA 2XOXA 4U02A 5LMZA 2I2FA 4ES6A 1H8HA 3K32A 4E33A 3FJYA 1N6HA 1NJ6A 4BNFA 1LTQA 1Z34A 4HTFB 4KQMA 5DK6A 3GLFB 1NNEA 1AZTA 2OLJA 2OD7A 1EWYA 3V4VB 1K4MA 4ND1A 4JJKA 4AKEA 3AVWA 4A6DA 2J4DA 5JSQA 3QG5A 1JYEA 5EE0A 2GLXA 3FOCA 3PNPA 1NVTA 4FR0A 4LSMA 1YFJA 1ZZGA 2IJGX 2B1IA 4QDUA 3AW8A 2RGCA 3QELB 2JCXA 3AI3A 2NACA 1N8TA 1FNCA 2O7RA 2YWEA 1AB5A 4OA8A 1UWLA 3DP9A 2YHBA 4R6XA 2FFQA 3PNQA 1F7VA 2D6FA 1CR4A 1X8JA 3L4BC 3QNWA 4GZ3A 5SZHB 2IEDA 3BIFA 3LLVA 1IIBA 2ISCA 3H97A 4X66B 3JATA 1RLOA 3LPCA 2Z6VA 3H04A 1QVWA 2DR2A 1GAEO 2IYSA 4MVYA 2XNDD 1T9GR 2ZREA 3C7DB 4IQ4A 2HK6A 3IV6A 3MG9A 3EQ7A 5EMLA 2DJ5A 3LIIA 1Z2OX 2H1IA 3R0XA 1VBNA 5ALMA 4ZAYA 2WHPB 2H51A 4P3YA 2OSBA 4WZBA 1RHKA 4KMMA 4MMYB 2IQIA 2P2DA 3M6WA 1CXZA 5IYZF 1EA7A 3V4OA 1CLUA 5TPWA 2CSUA 3LSTA 2B1JA 2HPHA 4YR7A 1ICIA 2Z3VA 1JU9A 3RC2A 4URXR 4I4IA 1T43A 1AKEA 4NVRA 1UAGA 1UC5B 3BFXA 3L7NA 4QVGA 3K4QA 5ESXA 2JFNA 4JA2A 5IKEA 2ZE5A 3B1WA 2XUQA 3R3XA 3W3AD 1F8YA 1KMMA 1Q1ZA 1NQ5A 4AECA 2YXPX 1HE3A 1NJ2A 4AO6A 2QM7A 3HDGA 1FRFS 3OQ1A 3ILXA 4Q66C 2OCPA 1IEVA 4B6OA 2WMNB 4G5HA 4D6PA 2IZ1A 4LFAB 3EBOA 5B6IA 2OCGA 1F2UA 1DG3A 2FW8A 2DKFA 1H66A 2WZDA 1RWOA 1UDCA 4C78A 2K87A 3TAUA 5IF3A 4FI3F 2PLWA 4URFA 4DN6A 4R5HA 2ZT7A 5ULLA 3I23A 4ND7A 4QGBA 2NLOA 1O97D 5B57C 4NCIA 3W77A 4D3DA 4WA7A 4HGQA 1JKJB 1F6DA 4RM3A 1U9IA 1B6TA 4OQLA 3IAXA 3PX3A 3JU3A 4O4IB 5L7TA 4MLPA 3DCNA 4YBRA 3CZAA 1ZUNB 1RYDA 2ZYGA 1NJ1A 4JS0A 3ZDDA 1JECA 3A10A 4KRFA 1ORIA 1YC5A 3TW6A 4LXGA 3SKVA 4JBWA 4ZZIA 3J81k 1XDDA 4PLGA 5JD6A 3B53X 2IBTA 1DKNA 4ZT2A 1F06A 2GZMA 1T36B 2A9RA 2IYPA 3O4JA 4RLHA 3IERA 4DANA 4HTAA 1U2QA 1C9JA 1QTRA 1SU6A 2AQ8A 3GIWA 5FNVF 1W0CA 4BLUA 3L04A 3ICVA 1MOPA 3L6RA 3GD7A 3AVVA 3MBOA 1E9BA 3ETCA 4I1UA 1AQYA 1VP3A 2RJ3A 5HE8A 4EMUA 1CLEA 3BAZA 1TYZA 3ZNPA 1WZ2A 4LGCA 1VKHA 4JXJA 3D0QA 1UP4A 3FI9A 2H4FA 1TU4A 1MC5A 2YH2A 4KAXA 1E2LA 2R1UA 2IE0A 2SECE 3WZLA 1ZCFA 2X3UA 4UOQA 2I65A 4B3SB 4CR8A 2G63A 3OY2A 4GGOA 2BEKA 1JDBB 3Q2KA 3V3KA 2QL7A 1KNXA 3A6LA 3ORYA 2HA3A 3EOAI 4XTCS 5LB2A 2PL3A 3S7TA 1L4KA 1PYGA 4DTCA 3DFFA 3G8CA 3NFRA 2NP6A 2I2XB 1XQWA 1GCAA 1IFXA 1TM2A 4GOOD 3AJDA 4CF3A 2VOJA 1HDYA 3K96A 1SBHA 1XELA 4GRIA 4PYQA 4HOYA 2CVFA 2PTGA 3EVAA 4GGPA 4ZYXA 4FCCA 1XHEA 4BMXA 2JIPA 4TTRA 4LYDA 5ARDA 1ID8A 3TZQA 4EAAA 3PTAA 2HMUA 2I80A 3QLVA 3WKCA 3N58A 1JJFA 1W6RA 1OTHA 5BPHA 4G2TA 4AROA 1YQ9A 4B6GA 4YHBA 3RQIA 4KQ2A 3E8XA 3LUGA 1G5HA 2X1HA 3QLJA 4Q19A 1OLUB 4KBGA 2EBHX 1J22A 3OCXA 2PSJA 1UEXC 2P4HX 2V45A 1FF9A 3RC3A 2NYAA 3TOCA