2W58A

Crystal structure of the dnai
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
188
Chain Sequence
KRQESLIQSMFMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAAIANELAKRNVSSLIVYVPELFRELKHSQTMNEKLDYIKKVPVLMLDDLGAESWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQKVKAARIMERIRYLAYPIEITGPNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRIMOSOME COMPONENT (HELICASE LOADER)
publication title Molecular Interplay between the Replicative Helicase Dnac and its Loader Protein Dnai from Geobacillus Kaustophilus.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Hydrolase
total genus 54
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01695 IstB_IS21 IstB-like ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w58A01
3TUIC 3U3KA 3A1VA 4GOKA 2GXAA 2EFEB 2QBYA 1DAHA 3OAAD 3HYRA 1J7KA 4ON9A 4Q4JA 1ZINA 1SHKA 5EE1A 5KPDA 3GEHA 4HDCA 1ZU5A 5AJXA 3QKSB 1EXMA 4L4UA 2BV3A 3TAHA 2DWOA 1T6NA 4N3NA 1IONA 1ZRHA 3U4QB 1Q0UA 1X6VA 1T5LA 4LC0A 2PZFA 4JJZA 2A5GA 3VFDA 3C14C 3PUWA 5DI3A 1XF9A 2ZSEA 3GEIA 3AVWA 1C9KA 2FSFA 2KJQA 2AKAB 1OXUA 3B82A 4TLBA 1N5JA 4CT4B 3EZ9A 4EPTA 2BEKA 3AQ4A 3AUYA 2WJHA 4IVRA 2IBMA 2ATXA 2VHTA 1Q3HA 4QFMA 1CR1A 1YZQA 4IDPA 1U9IA 4BPBA 1IOZA 5J4YA 4TZ0A 4B3XA 4XVQA 3H2YA 4KFSA 4M1MA 2QMEA 1S2MA 2WSMA 3AVOA 1FTNA 2QP4A 3I32A 3BOSA 2PX0A 2GILA 1DAFA 2DWPA 2ZXUA 3KXKA 1XTIA 3NDBB 3GLHE 1PUIA 4TT3A 5IRCD 2QRNA 3SZRA 3R9WA 1G41A 3ZZUA 2C9OA 4NPHA 2W6IA 1GL6A 2PH1A 4YMWA 4OHVA 4DDVA 3BJIC 3QXSA 2XGJA 4TT3D 2ZE8A 1G7TA 1K8RA 2BBWA 1RW4A 4JZKA 3REGA 2FE4A 4OI0A 4B6FA 3TVTA 3NKVA 2ZJBA 1TPZA 3CNLA 1Z6XA 2WKQA 3BS4A 1VCNA 3K1JA 5K8UA 3PIRA 3L0OA 3SYNA 1KJYA 2PT7A 4AKGA 2ECKA 3RDPA 3SDZA 4GPTA 1SQ5A 1RJ9A 2OILA 3FKSD 4IRUB 4FCVA 3I62A 1E9CA 2HT6A 3SFVA 2FFHA 1P4SA 2VHQA 3QEJA 1G1MA 1T3HA 1QHSA 3THWA 2DPXA 2OZEA 3QNUA 4BFTA 2AN9A 4HLCA 4KSCA 2NPFA 1AIPA 5FPTA 5HKKA 1L7VC 2F43A 4PXAA 2VF8A 2P3SA 2WAYA 4X8MA 1A1VA 4BFYA 2ODBA 2Z83A 2JLWA 4XTRA 1R0WA 2GBLA 2V54A 2AFIE 3GLHB 4PQRA 5HKKD 4UNRA 2OLKA 1UBEA 4XTCS 3K0FA 3LA6A 3UMFA 1PLLA 3BXZA 3LW7A 4OQMA 4PPFA 4RD2A 4YC7A 5G3YA 2Q21A 4RZUA 4CYMA 5KDDA 3BH7A 1FFHA 1ZBDA 3K09A 2RGXA 4Q47A 5FPYA 1E9DA 1QHHB 4JYBA 4MKGA 3RS0A 3SE0A 1X1SA 1AQUA 1II8A 2QROA 3VKGA 3X1DA 3QVVA 2C77A 1XXHA 4M8NE 1GWNA 2DFNA 3PVSA 3THYA 4JS0A 2FMXA 4PSVA 1GL9B 2FWRA 2QQEA 1JI0A 1A7JA 2ZR0A 1LB1B 1ZD8A 4NU0A 1ZCBA 3EIEA 5AUQA 3DPUA 4MGKR 2QAJA 1UKEA 2ZJAA 3LX5A 4PPGA 1MT0A 4MKFA 4HAXA 3FPAA 4M22A 2RGEA 3TGPA 4PZYA 4YLGA 4LYFA 3X1YA 2WHXA 1JALA 3LD9A 3K70D 3DKVA 1W4AA 4KODA 4LPSA 3A6PC 2V8OA 2DFLA 4DLWA 2JDIA 4HYYA 3RAPR 4W5HA 3EPKA 3FFAA 4A6XA 5K8IA 1KI4A 2H7VA 4NYJQ 1XWIA 1GFIA 3C5CA 4IOLA 2JDID 4QM7A 2CNWD 3DZDA 1N0WA 1UPTA 3LWNA 3OIWA 5EXPA 4TL8A 3BIFA 1A82A 2Z4SA 1W2GA 1FX0B 3RYTC 3SBEA 1UF9A 3BRWD 3NXSA 1W36C 5C18A 1ZUIA 3U6KA 1JPNA 5LPNA 4DSNA 1YZNA 3FYHA 3PEUA 4PAOA 2IYVA 5B57C 2YOGA 4URYR 4KHZA 4DCTA 4YDHB 4LJ8A 2CJWA 1ZD9A 3LQRA 4M9XA 4Q9LA 5EP4A 1SVOA 2FN4A 2A30A 2VH5R 4UXIA 4P3YA 1OXVA 3UANA 2AK3A 1A5TA 1SHZA 3IGFA 3GJ7A 4KVGA 3SQXA 2IWRA 3B1VA 4B44A 1E4VA 4K8OA 1W1WA 3MG9A 2C99A 4DUGA 5TB5A 3DM5A 3CF2A 2EFHB 4LI0A 1EWQA 2RGDA 4I99A 1G8PA 5H1YA 2ZSBA 3WNBA 1X8LA 3EG5A 2BMEA 3NC0C 4DUGD 1S9DA 1TL7C 4XD7A 4GBMA 4KITB 2O8DA 4QBHA 1EX6A 1KMHB 1RRCA 4WBSA 2L0XA 2DFTA 2ZI7A 4RZ2A 4B2IA 4EPXA 2HYDA 3M4YA 4B71A 1C1YA 4U02A 1Z6TA 1BH2A 3LW8A 4XD7D 5FOXA 1VIAA 1W7AA 1X3SA 1OXXK 3C16C 2NO1A 3W5IA 2REXB 3L0IB 1KK1A 4GZMA 4JL8A 2O0JA 1ZJ6A 4QHYA 3VKWA 3OFNA 1EFUA 3KXIA 2IX3A 1CLUA 1UKYA 2ZJ8A 2P67A 3EC2A 4PSAA 5EZ6B 1G3IA 1TF2A 2XOKA 1WBDA 2YJTD 5JJLA 1ODFA 3OFND 2JLUA 3VAAA 4YMVA 3ZJYA 1MH1A 1T91A 2G88A 4PC1A 2IYQA 2XOKD 4CRWB 2UVQA 4Q4HB 2PL3A 3CX8A 2QT1A 1X8KA 4O25A 3SR0A 3DDCA 1BOFA 2W2XA 4I1SA 2OM2A 2AXNA 1RRGA 4M9ZA 1OPXA 4BEJA 2R65A 3CZPA 2C2HA 5E7MA 3C8UA 2NOAA 2F9MA 4GFDA 4DCNA 1E6CA 5TMPA 4HAUA 3ASYA 4BLQA 4H9GA 3KJHA 2GZHA 5EUQB 4RD1A 1QF9A 1UDXA 3RWMB 1IN8A 4TL7A 2ZVQX 1Q20A 2QA5A 2ZVPX 1KO7A 2CXXA 1FTSA 2IXGA 2FU5C 1ZNWA 1E4YA 3B78A 3E5HA 4FN5A 1KO1A 1E69A 1YVDA 4Q4AA 1QHXA 4KBFA 3LLMA 1XTKA 5EE5B 3TW4A 3FHOA 4FMBB 4PHFA 4R9UC 3OEHA 3EWSA 3SHWA 1H8ED 3NC1C 5BYJA 4MA4A 1OKKA 3IDQA 2V6JA 2YC2C 2F1RA 2N46A 1VHTA 4Q9JA 3Q3JB 2BBSA 2JLXA 1ZW6A 3OEHD 4LJAA 5DLQC 4W5WA 1VYVA 5SZHB 1OKKD 2AXPA 4F4JA 3QEOA 1UFQA 1DARA 1FMLA 3X2SA 3CZQA 4A9AA 1VMAA 2DB3A 1GNQA 3A1SA 4PPQA 4GP7A 1IY2A 3PITA 3EPHA 4ACAA 4LJ7A 1F2TA 1IBRA 2B8WA 4PZLA 3GLFB 1NJFA 1M74A 4NCHA 4DXAA 1E2MA 2MSEB 4OI2A 2BCGY 1SVLA 2RKOA 5TY0A 1DG1G 2QAGA 5DYGA 5EP3A 2YVUA 1JQLB 2ZYWX 1LF5A 5AUPB 1HQCA 2VP4A 4IXNA 4IXMA 3WYFA 3BGWA 3OE7A 4WZAE 4MRRA 2F1JA 1ESMA 2VF7A 1YZUA 2AWNA 1QRAA 5AJVB 1WXQA 4BZXA 2H8KA 4QXAA 2FSHA 5EXSA 1IJEA 1PLJA 3IBGA 1WF3A 2O52A 4DDWA 1CJKC 1NF3A 1XDBA 3TRFA 3W6NA 2XX3A 3OESA 3FFBA 5J4KA 1G7SA 1CU1A 2QBYB 2FZ4A 1W4BA 1KY3A 2JIZA 2QE7A 2HF9A 3VNUA 4Q4JB 1E9EA 2GVDC 4HEJA 2C8VA 2DYKA 2YINC 5A4JA 3O8RA 4TLDA 3AP3A 2H57A 4K46A 2QE7D 1Z0IA 1YU9A 4LRWA 3R9XA 4BLOA 3PEWA 4DKXA 4B34A 5CK5A 5BXQC 1IXRC 4LY6A 1Q1BA 5EP1A 2AHOA 3MLEA 3FOZA 4US2R 3RRMA 2WIBA 2Q0HA 5DI3B 2IEZA 4BZPA 1UM8A 5DNYB 1IQPA 3B9QA 4PAQA 3W9YA 3KKQA 4W9MC 1NG1A 1KMQA 2GA8A 5TXGA 2JJ8A 1KSFX 4Q66C 5LD2B 1OFIA 2YYZA 2HXSA 1QHHA 2HT1A 1WP9A 2ZM5A 1P2UA 2ZRLA 5B2ZA 1KNXA 1G8YA 1U8YA 1G6HA 4BWYA 1E2EA 1Z83A 1IM2A 1A2KC 1QDEA 1RVDA 4IOKA 3V00A 2J9RA 3FWYA 4TN1A 1PV4A 2Y8EA 1SULA 3QXJA 2JA1A 3RHFA 3ICEA 2ORVA 2ZYUX 3DL0A 3IPYA 1R8SA 4A8JA 4AKHA 2OBMA 2ZETA 4W5JA 1OYYA 3ICQB 4WZBE 4PX9A 4P33A 5JBQA 1ESNA 1A4RA 3G5UA 1U94A 5EZ5A 5HCNA 1XTSA 2UZIR 1E1QA 3D31A 4CEHA 1TMKA 2IUUA 1GVNB 1KI6B 1HURA 2NO7A 2ZUCA 4D0LB 3A37A 3AKEA 1FP6A 4PSKA 1RC8A 1E1QD 4Q00A 3KX2A 3RVBA 1E94E 1GOTA 1N25A 1SVKA 2CCGA 3JVVA 3ND8A 2JEOA 1VCOA 2Q3MA 4P4SB 1XXHE 2D74A 1Z6GA 2WJGA 4LHYA 3CPJB 3ZYCA 3U61B 1RJ9B 2EFDB 2O8FA 1DAMA 3UK6A 1E79A 3K09C 3OIVA 3THWB 1G4UR 1IXZA 1E79D 1OHHD 1R10A 2ZR9A 4OK5A 3SBDA 3P32A 3KQUA 1G3QA 2F43B 4D4JA 2GWHA 2HF8A 1YRBA 1KKMA 2GCOA 3OZXA 3PQCA 1W4CA 2WTUA 4O3MA 1RPZA 1OH6A 3PENA 1N6PA 3CM0A 5CYPA 3GLIA 4WXPA 2IYRA 1JECA 2F1HA 2ZRKA 3K0FB 1XPOA 1GSIA 2GNOA 3CF6R 4OI4A 2GJ9A 3CO5A 3QXXA 1NMZA 1XEFA 1QG2A 2ZUDA 2RGNA 3U3MA 2YHSA 3UKDA 4NL4H 1II8B 1TEVA 1O3YA 5K8LA 2IYYA 4OKSA 1KIMA 1IN5A 3ONWA 4EPWA 1XXHB 2WBLC 3F3YA 4KFUA 4IHQA 1KJWA 1JR6A 2IYSA 2NQ2C 1M2OB 5HTKA 1E2QA 1TUEA 2P2LA 3T06B 3K70B 2WJYA 1ZVQA 1N0VC 1JR3A 2ATVA 1NKTA 3NBXX 4Z1MD 2OCYC 4LV5B 4KLZA 1HT2E 2XJ4A 1CTQA 2ZRDA 2IS6A 3U7FB 1JR3D 2QORA 3EXAA 2VP2A 3MWLA 1AGPA 4LHXA 1KK3A 2IXEA 5FPSA 1FQJA 4DDTA 3BC1A 1NI3A 2OBNA 3QPWA 2FFQA 5HZHA 3U2QA 4P0TA 1J90A 3AKYA 1AZSC 4C0AC 2YZ2A 4TMXA 4ZDWA 2JLQA 3QG1A 1EESA 1E0SA 3U7GA 4AI6A 3REFA 3K8YA 4C2UA 4QJ4A 4UJ3A 2E87A 3ZGXA 2P6RA 5HE9A 1OH8A 4DZZA 1TU3A 4JLBA 3FKQA 1E2JA 1OV4A 1U90A 2GDJA 5LBIA 1H65A 2GCNA 2CJWB 5TVKA 1G3MA 5JWOA 1P75A 3WYGA 4KVAA 4PO8A 2W00A 1T3LA 4QBFA 2JLVA 3NEJA 4JLAA 2IUSA 3AKDA 3FTQA 4JVLA 3SNHA 3SN6A 1DADA 4TSFA 1RIFA 2GF9A 1NKSA 5KUTA 4X8OA 2C98A 2W58A 3AF1A 3EIHA 2XB2A 3G82C 1WCV1 1XMVA 1TF7A 4QHSA 4LDJA 4TSFD 3UG7A 4M1WA 2EU8A 3SQWA 2QQ0A 4M4SA 4XJXA 2P5SA 4D2IA 1Z06A 1XZQA 4J0QA 4MQBA 5UKDA 4MRNA 3Q85A 2WOOA 4IDQA 5HPYB 1AQYA 2JLZA 5FI1B 4A2QA 5FUYA 1KDPA 2PEYA 3TMKA 1G19A 4C3ZA 4EPRA 5CB6A 2VRWA 5K8TA 2VTKA 3AVVA 2FF7A 1ZD1A 1LW7A 5AJYA 4B73A 5IF9A 5L3SB 3SC3A 1S1MA 1KOFA 1ZNZA 2ZROA 4Q48A 4E03A 2R6CA 1RKBA 1WA5A 4ACBA 2HXYA 4KLNA 1EX7A 1LS1A 2FX3A 4LHZA 3C5HA 4ZIRA 3CNOA 4G3XA 4GI7A 3IHLA 4NCNA 4HUTA 1JPJA 4NYMQ 4AYTA 2GXUA 2RAPA 3QE0A 4QG7A 5FR1A 4US1R 3B60A 4MYUA 2X8AA 3P1JA 3ZS9A 1TTTA 1SVIA 4LCBA 5F3WB 3ASZA 3EX7C 4G01B 3RLFA 1II0A 3B6EA 1TQ2A 4I81A 5JWHA 2LWIA 1MOZA 1W0KA 3MD0A 3WNDA 2VO1A 2GJAA 3VHXA 1U98A 3WRXC 3L0PA 2CL6X 3F8TA 2D7CA 4ZDKA 4L16A 3PEVA 1IY1A 2QRZA 4E09A 1PJRA 4XOIA 5E7JA 2A9KA 2GJKA 1E2FA 4Q7JB 2WWWA 1OJLA 3FMFA 3OAAA 5AK0A 4RZXA 1ZM7A 3LBNA 2ZE6A 3PR1A 3ZIAA 5LDDC 3LNCA 5CJ2A 3VX3A 4RD6A 3DZ8A 4F91B 4PPNA 1NN0A 5TARA 1ZUHA 2DWQA 2ZREA 3ZIAD 1DPFA 3U44B 1NY5A 5JLJA 2HCJB 4DLVA 3GJ6A 4JIMA 2VP0A 3WYAA 3LDAA 4KYIB 4LJ4A 1KDTA 4LOAA 1NLYA 4IDHA 4Q4AB 4G5GA 5BYKA 1LS6A 2ZU6A 3BFKA 4RKEA 3W8NA 2K5UA 1T9HA 4MITA 1J2JA 1KI8A 2EW1A 3B1XA 3TR5A 1LTQA 2HUPA 4Q1AA 4V0MA 2PX3A 2W0MA 1I4LD 2HCBA 2FEOA 4OHYA 2IYWA 2GHIA 3SJCA 1HQYE 4AIIA 1XRJA 2A2ZA 3K0EA 4Q18A 4QNMA 4L5BA 4M21A 2J1LA 4YONB 1MRSA 2Q9AA 2ZAMA 5H70A 3CONA 1WQ1R 4NHOA 4AC9A 1NLZA 3AGPA 4S35A 4OQLA 4R2HA 4RD0A 4BLSA 1E0KA 5CDFA 5EXXA 1RYFA 2KWIA 4L15A 1F2TB 1P7CA 3H86A 2W0SA 4RCYA 2OFXA 1XBTA 2YNMA 4TQ9A 3WHLA 4JVMA 4BLPA 2QAGB 1FOEB 4H1VA 5JHHB 1GNPA 3BE4A 4HB0A 4M9QA 1NBMA 2BHRA 2KSQA 2XNSA 1M6NA 4HDQB 4IJMA 4JBYA 1AS3A 1MKYA 1M7GA 1Q22A 3VMFA 2XJ9A 1KI6A 4C4PA 5CLQA 4KJZA 1NBMD 1JXMA 2J0QA 1JNYA 1G9XA 1KO8A 3I92A 3FKSA 4L9SA 2Q3HA 4DBLC 3QBTA 1NN1A 2FGJA 2R2AA 2PZEA 4P4SA 3ZD7A 1KK2A 1MV5A 4R71A 621PA 2ZSDA 4NCIA 2UZ3A 3CRRA 2C9CA 1GNRA 2IYZA 1YZLA 5JCZA 4URZR 1XEXB 4F92B 1BYIA 1I2DA 1XU4A 2O5VA 4HB4A 3MJRA 4Q9IA 3CX6A 5HR5A 4LZZA 1T0HB 4GMDA 4JLMA 2E9SA 3A4NA 6Q21A 3D7MA 1WBBA 3B8HA 3KTAA 5C1BA 1CULC 2QPOA 1UDWA 2ZS8A 3VQTA 1CEEA 4IVQA 3FHCB 2DCUA 3LAWA 1DS6A 4C7OA 3AP2A 1Q12A 1QG4A 3BBPA 1L4UA 1NJGA 1G7RA 1KI3A 2ERYA 4C0QC 4RSGA 1XCPA 1Z0KA 2ZAOA 1E0JA 1NMXA 2KBFA 2ZRFA 4FW9A 1FMJA 2VL7A 3QKTA 1G6OA 4EUNA 2QPAA 1BYUA 3MSXA 4HZIA 3M0EA 4OJKA 2NG1A 2IUTA 4NONA 4B2PA 4PO9A 3WY9A 1XPRA 2G1JA 4JMPA 2VA8A 3BB3A 5G40A 5J40A 1PUJA 4R2IA 2C04A 1KZ7B 3GJ4A 1Z08A 4XWOA 1DAEA 5AJWA 4EJSA 1OFHA 4PZZA 3LXRA 1DAIA 4URUR 3K53A 4UNPA 4QBIA 2J3EA 4JLJA 3U3JA 4A8JB 1S0UA 4CVNA 2XNDA 4QGHA 4TLCA 3GLIE 2ZRNA 3RS7A 4RFVA 1XCMA 4LX0A 2A78A 1R4AA 5E95A 5FPHA 5L3RA 5FI0B 2XNDD 4DIEA 2P6UA 3ZQJA 3C4JA 4CEHB 4FMCF 2AWOA 3ZZ0A 3X1WA 4PO1A 2DBYA 4IDOA 1TF5A 3EC1A 1XTQA 4BLTA 1W4RA 1CR2A 4II7A 2CNWA 1NRJB 4UNNA 3CLVA 2WIAA 5JSZA 2V3CC 3T5DA 4QOSA 1NN3A 1SXJA 3GJ5A 4WVFA 2VP5A 3RS5A 1D9ZA 3VHLB 1XJQA 5FOTA 2FG5A 4OHZA 4QBGB 3AB3A 5JMTA 2O8FB 1E2PA 3WBJA 4BECA 1WMSA 4OQFA 3AF4A 4EPVA 1SXJD 5BWMA 2RGNC 3N2IA 4M0LA 2ANCA 4GRAA 1XMSA 4MH0R 1LV7A 2QMOA 3KJEA 4DB2A 2GVZC 5DE3A 1N2CE 1OF1A 3EAQA 4NYMR 2XSZA 1R5NA 1IN6A 1P72A 2CVFA 5AUNB 2H5EA 4BFXA 3GFPA 3BK7A 2GCOB 1XD2A 1Q1EA 5KSPA 5F2EA 1H8HA 4PC7A 4U7DA 2OCBA 2XSZD 3QKRA 1YQTA 3IIJA 4URVR 2D62A 4TL9A 4P31A 3H0KA 3GLIB 2CE7A 1S96A 1YE8A 2WICA 4D26A 2ZSFA 2JJ1A 1H8HD 4PQYA 3K0CC 4Q02A 5FBRB 5B64A 3P4YA 4TTRA 1HA3A 2VYFA 1X86B 3EZFA 3IPXA 3AV0B 2ZITA 4MYCA 4HLUC 2C5LA 2ZRMA 4BQSA 2JJ1D 1P6XA 2WSSA 5CYOA 2OAQ1 2FPKA 1XMJA 2WMOB 1Y63A 4JLPA 1E32A 1DAKA 3KKPA 1P73A 2WSSD 1TQDA 2J5XA 4D4KA 1GIAA 3RSOA 4C0LA 4JL5A 2TMKA 2WJVA 3OF5A 4TMKA 4WZ6A 4LYJA 1CRQA 3NEYA 3KJGA 3BB4A 2O0HA 4N1AA 1MO6A 2HV8A 1VYUA 3P4XA 2O0KA 3HPRA 3B5JA 4IEEA 4Q5IA 5L3SA 2PEZA 3KKMA 1R0XA 3NTUA 1ZNXA 4NH0A 3OIYA 5E4FA 1C4OA 4EAQA 4MDEA 1G3RA 1G4AE 4FCTA 5FTKA 4B2LA 1NP6A 2CDNA 4RFSA 4QNRA 3PEYA 1JQJC 2OT3B 4NP6A 4B33A 5J4VA 2PJRA 2LKDA 1BMFA 1VKJA 1Z3IX 2ZPTX 2GXSA 4FINA 4WOPA 4X8LA 5JFGA 2GTPA 1B23P 1V5WA 3L2OB 1GG2A 3UPUA 1BMFD 3TBKA 3RS2A 2J41A 4CF7A 3T34A 3KB2A 3QF4B 4A36A 5BW8A 2YOHA 5KYKA 1E98A 1Q44A 1Z63A 1Q3TA 1W5SA 4OQNA 2PCJA 1KTVA 2ZRCA 3TQFA 5KSOA 1GRQA 4QJ3A 4YQFA 2D3WA 2R6DA 1SZPA 1Q1ZA 5FOSA 2ZRAA 4AG6A 5JJIA 4FWTA 3GLFE 3ZDQA 1RE0A 1HY3A 2BOVA 1G8HA 3QXHA 3GJ8A 4F38A 4FD2A 3TE6A 2ZS9A 3U44A 1E9RA 4DCSA 5DH9A 4UQOA 5J4HA 1XEWX 4TMZA 1S3SA 2UKDA 4BGDA 1Z47A 2QENA 4D0NA 4OK3A 4MRPA 4TYYA 3PUZA 4DVGA 2A5DA 1KHTA 2ODEA 3IUYA 1G16A 1H8EA 1KO4A 4V03A 1N6RA 2V1UA 2QY9A 3QPVA 2G1KA 4JLNA 2MSCB 1WRBA 4IW3B 4JBWA 4DJTA 2R6AA 3DEFA 1I2MA 3PXGA 1US8B 4B3FX 1GKYA 1E9BA 2ZI9A 3AH8A 2XTNA 1E9FA 5KHOC 5JRJA 5FTJA 1VCIA 1ZM3A 2A7QA 2RCNA 1DVRA 4E5UA 1W36B 2XB4A 1W5TA 3B1ZA 1M8PA 1Z22A 3PJRA 5LB4A 1UKZA 3RC3A 2QMUA 3LVRE 4I4LA 2N42A 4D80A 4ZIRB 1GKUB 2QGNA 4A1FA 721PA 4BEBA 1NSTA 3T12A 4DWJA 4LJYA 1VTKA 5CJPA 3I73A 3K0AA 1SKYE 5LB2A 3A58B 3I4LA 4LSGA 2IL1A 3V4RA 3MUFA 2G3YA 1EFTA 4JYCA 4IVPA 4V02A 5DO9A 3QOFA 1XMIA 4HDOB 4XVUA 5JI3E 1FPMA 3Q5DA 2IHBA 2MMCA 4HAZA 4OL0A 1DAGA 3KKOA 4KO8A 2FJUA 2GK6A 2BDTA 1XFAA 1LF0A 2ZI6A 1S4QA 2OHFA 5DIFA 4DLTA 4X8HA 4RZ3A 3UMSA 3RS3A 3SHFA 1N6NA 3L82B 5FUVA 3WMEA 5JI2E 3AM1A 3RS4A 4GNKA 5CDFE 3TLXA 3ZD6A 2IF2A 2AX4A 3P26A 4OHXA 1HE8B 3I5YA 3CR7A 2CCJA 5DISB 3KFVA 3ND9A 3C41J 1XEXA 2C95A 5LD2C 2O8BA 1T5IA 1HYQA 1OB5A 3A1TA 2EYQA 1KY2A 4LJ6A 1U9IC 5KSZA 3R9IA 3VR3A 5CIQA 5FTLA 2Q6TA 5JCPA 2WJJA 1D6JA 1NBME 4PTLA 2QTHA 4BFZA 3OEEA 4C0HA 2P0EA 1R6BX 4RVCA 2G77B 1DG3A 1NNEA 4NYJR 2CL0X 4B32A 1OB2A 3PV0A 1SKYB 3OEED 4W7SA 4LWZA 1YZTA 5J4LA 2I4IA 2IYUA 4HAYA 5EXTA 2B21A 1E99A 3O47A 4ARZA 2VP9A 1K5DA 1N6KA 3FB4A 2B92A 3IHWA 4MUAA 5BN4A 1TEXA 2J45A 4DSUA 3BERA 3MWKA 1ZAKA 2BBTA 5JS7A 1RFLA 1XEWY 1Z6AA 2KI5A 1HH4A 2W6JA 1UBCA 2GEVA 4B74A 3FMOB 4RJLA 2FNAA 3BORA 4HZUB 1FQKA 2R6FA 3SOPA 1CKEA 4C30A 2W6JD 4KYUA 1OFTA 1CF4A 4A2PA 4A0HA 3I3SR 4BFSA 1IXSB 1OXTA 2OSBA 5GJCA 2WWXA 4B3BA 1E0AA 2G6BA 1OLOA 4DLSA 2F3TA 3W8RA 4PANA 4Q9HA 1ETUA 1GDDA 4IFBA 1QVAA 3Q5EA 4FI3C 4TYWA 4AD8A 2BWJA 3BB1A 2DFKB 3AVYA 1QHIA 1JXOA 3HU3A 1G8GA 3I72A 2Z6VA 3TJZA 3VR6A 3TAUA 3ZVNA 1UBFA 2BMJA 4G5OA 3GEEA 2J0SA 1N6OA 2GBLC 4YMTA 4DLXA 4MKIA 2DY1A 3NVAA 5JZVA 4ITRC 2RGGA 2WWYA 3SYKA 1NIPA 5A5GA 2XZLA 1P2SA 3I5XA 3ADCA 2IWHA 2QSZA 5CIWA 3TR0A 4C0BA 3EPJA 5FBVB 1OHHA 2QMHA 1G5PA 1VYTA 1Z2CA 1JEDA 3FVQA 1T0JB 1R5BA 3VR1A 4ZI3A 1CRPA 2N1BA 3NH6A 5EP2A 3LBHA 4BE7B 2Q9CA 3KTAB 2YWGA 2OBLA 5KDLA 4EJSC 3K0SA 1R0ZA 2EWVA 4XVRA 4C7OB 4OK6A 2QTFA 3K70C 2CCKA 2H18A 2WWFA 2HJVA 3TH5A 1SXJE 2H1LA 4EPYA 1E2IA 2EYUA 2RHMA 3U3RA 1TU4A 4DB4A 2J0UA 4G5QA 2WWHA 2V55B 1XZPA 3TUZC 1M34E 5ELXA 2OG2A 4LYHA 4HLQB 1WB9A 4Q1DA 5CITA 3FDIA 2X2FA 2GEUA 1TNDA 3MJHA 1E9SA 1ZCAA 1U0HC 3LH5A 2CBZA 5FOUA 2A5YB 3FE2A 5KNCA 5TDHA 4L8GA 4GT1A 1OT3A 2D4HA 2KB0A 2CHVA 1SXJC 4EJSB 4TZ6A 1E2NA 3O8CA 4UNQA 3V4FA 2H16A 1HUQA 4QL3A 1EK0A 4Z1MA 4F4CA 1YR8A 4KFRA 2NO9A 2D06A 1E2LA 5J5CA 5TV2A 4FMDF 4PFSA 1KDRA 3QENA 221PA 3ETLA 2OXRA 4B3CA 1AGRA 3OHMA 1I4TD 3QUSA 3EZ6A 1KNQA 4DSTA 2IYLD 4MYHA 4FIDA 2CK3A 3CH4B 4WXRA 2I3BA 2G0TA 4KSBA 4C9BA 1W36D 2QU8A 1AA9A 4TTQA 5AR1A 3R20A 2BC9A 5JJKA 4DT1A 5JSZB 2F1IA 3WRYC 2ZE7A 2EFGA 3RWOA 5ANRB 1SXJB 2CK3D 2JLSA 5KO2A 1G291 2RH5A 3LY5A 3GFTA 4TLEA 2CLSA 2PCLA 1OIVA 4V0LA 4RKFA 1P61B 3AP1A 4Q1CA 3X1XA 3QF4A 3IIMA 5SZJA 3CRW1 3AGQA 2YKGA 4AYWA 4DLRA 3TKLA 4ZO4A 3SJBA 3BFXA 1Z5ZA 3MWYW 1GUAA 3MWJA 1VIYA 1UADA 5EUMA 2XXAA 2ZIAA 4BUJA 2JLRA 5IK2A 1G21E 1XD2B 3DM9B 1N5KA 4LGMA 5A0FA 3QKRB 5FUWA 2BMDA 3BD9A 4M1KA 2IHYA 3UWKA 2HYIC 3QI2A 4B3DA 4KV9A 5IK2D 2KBEA 4LK2A 2PT5A 3ZVRA 4TMWA 1KI2A 2FDCA 2XTZA 1GZSA 5L3QA 1KYIA 5B30A 1IAQA 1Z0DA 4H1UA 4XH9B 5B58C 2J7KA 1PVOA 4PHTA 2NTYC 2Q9BA 2P6NA 4C0SA 3THOA 3AVTA 1TADA 2YOFA 4PC6A 4BLRA 1D9XA 4ZKDA 3MCAA 1ZM2A 3QF7A 3EA0A 3EZ2A 3GD7A 3B1YA 1NVVQ 4ASUD 1OIXA 1F60A 1US8A 2IC5A 3SJZA 2HJGA 4UNSA 3AVUA 3CRQA 3T1VA 1J8YF 4GSYA 4OQXA 1D2NA 1R8QA 1TAGA 4HLDA 1OH7A 4URWR 3W3AA 3NG1A 3R7WA 4A92A 2FPMA 4C0JA 2NPIA 2WOJA 3IEUA 5JS8A 3FMPB 3IO3A 4LPKA 4RFSB 4Q1BA 4ZPXA 1O87A 4QM6A 2CHGA 2CLDX 2X2EA 3HDTA 4TWZA 4FXPA 4LHVA 2JATA 5JEEA 1IN7A 3MRSA 4DHEA 5BN3A 1RRFA 1YHNA 3LRPA 5KPJA 4D82A 3NBFA 4NYIQ 5KNBA 3WNCA 1G3UA 3T1QA 3B2EA 3B85A 2WAXA 3ZLJA 2QT0A 1XX6A 1JBKA 1F2UA 4JVSB 5FOVA 1YZGA 1TUIA 2HLDA 4AWXA 1DOAA 1XTRA 2J46A 2VBCA 3IQXA 3PCRB 4KAXA 1GM5A 1LNZA 5C2JB 4P32A 2I1QA 5IHPA 2GEDA 2QP9X 3NBYC 4RD4A 5F98A 4EFMA 4C2TA 5DGXA 5H8WA 2CE2X 5FBQB 2HLDD 4A0RA 1P9NA 2ZI5A 1I4DD 1Z8FA 2GETA 3RRNA 1MO5A 2BJVA 3B9PA 3WBKA 5JHGB 4MGIR 4OHWA 5JECA 3Q7QA 3SI7A 3WP0A 1II9A 2P5TB 1NIJA 5KU1A 1G18A 3TW8B 1ZP6A 3FGNA 4M53A 2Z5FA 1G17A 2ODNA 2ZRPA 4Q1FA 3TK1A 3GJXC 2B7CA 2F6RA 1P3JA 4KCGA 3U7EB 1KAOA 5EQTA 3X1ZA 3W5JA 4LYAA 2D2FA 3EPLA 3S1AA 4XIGS 1Z28A 1Z0FA 3KFXA 5IDVA 2QAGC 1NG9A 5FPKA 5FOWA 5CK4A 2WVJA 4BRUA 3ADBA 5KNDA 1GP2A 1Q1QA 2ODWA 1AS2A 1SVSA 4PHHA 2G0NA 1AKYA 2OE2A 2VSOA 3BH6A 3MFYA 2GCPA 3ECCA 3VR5A 4MRVA 3TQCA 2OAP1 3WMGA 3CF0A 3GLGA 4GZLA 4QGFA 1Y3AA 3LQQA 3KXLA 2BJWA 2GXQA 2W2TA 4IFEA 1IY0A 1XD9A 4HATA 5BN5A 3O8DA 1ZMXA 2EQBA 2REOA 2RHDA 4HZUA 4B76A 2KE5A 4HAWA 1F48A 1LVGA 1Q57A 521PA 2EFCB 4URXR 1F3OA 3EZ7A 3I8XA 1FP7A 3OIUA 3QKUA 5H68A 3K0AB 1L2TA 4PC3A 2QN6A 3JZAA 1V43A 4ESVA 3K9HA 3P20A 4NBSA 3CNNA 4CEJA 2Z0MA 4Q19A 2HEIA 4Q21A 4QGGA 2AL7A 2QG6A 2NZ8A 2VLIA 2OCPA 4DRZA 4NKRA 3E1SA 1W48A 3WHKA 1OYWA 2FV8A 1FW6A 4NMMA 1KI1A 1N6LA 3RABA 1XD8A 4XWKA 3MAAC 1EG7A 1KZGB 2FZLA 4IKEA 4BFVA 1W47A 2NO0A 1VG8A 1FZQA 4CT5A 1XPUA 2O8BB 1U2RA 1U0JA 3BH0A 1QZXA 2V7QA 2BIFA 4LBZA 2MMGA 1N3BA 4B75A 3RRYA 4B3GA 5FTNA 2R6GA 2W6ID 2XITA 3PUXA 3GP8A 4CEIA 5GJVC 3THXA 1CBUA 4M1OA 4JBXA 2V7QD 1YR9A 3FMIA 5KDOA 4JJKA 5GADl 4YXWA 3ZVMA 4A8JC 4Q03A 2O8CA 1AKEA 3O8BA 2QUZA 4ZDJA 3A36A 3I1FA 4MUBA 1BKDR 4AK9A 5FTMA 4BZQA 4MKHA 4YXWD 4ARZB 4EKDA 1UJ2A 3UWOA 1T3SA 1MRNA 2DR3A 1ZIOA 3CBQA 821PA 2P65A 4JLKA 5DN6A 1S3GA 3T61A 3LVQE 2QEQA 4FWIB 1YR7A 1ZM4A 2XZOA 3TVDA 2QGZA 2GAAA 2OCAA 4M1TA 5FH9A 5GVSA 1QHYA 2VQSA 4IEIA 5DN6D 1T8TA 1VG9B 3K9NA 2RGCA 2JGNA 2E1RA 2GZDA 5SZIA 3JVUA 2OEPA 3AF3A 3GCGA 1KSJA 4GP6A 3DOFA 1X1RA 2DHRA 1E2KA 1TQ4A 4M1SA 2OO7A 3NHAA 1MABA 1E1RA 4DLUA 4D4MA 3KZ1E 2QI9C 3PFIA 4TYNA 3ADKA 3ZH9B 1JEEA 3T1TA 2EWWA 1NVVR 4UXJA 2GF0A 1E1RD 4HUQB 4LV6A 2GZAA 5CM8B 5C46F 3TSZA 1ZC3A 1NSFA 2RGBA 4D6PA 1OIWA 1E9AA 4MRSA 3KQKA 2VHCA 1T4GA 2RMKA 4I1OA 2QM8A 3ZQ6A 3Q9LA 1N6IA 2F3RA 3KQHA 1CJVC 1MR3F 1JR3E 1YR6A 2GJSA 4M9SA 4DLYA 4G0NA 4JKYA 3Q8XB 3Q7PA 1R7RA 2FOLA 4EFLA 3DOEA 2AD1A 1BO6A 3QJYA 1WE2A 2G83A 1OXSC 1VG0B 4A6PA 2YWHA 1KGDA 5FBLB 2GKSA 4V0OA 1F6BA 3DMDA 1ZM9A 4DEXA 4ZI2A 4NYIR 5FUXA 1U8AA 4AURA 3AF2A 4TYPA 1OE0A 3EA5A 4BRWA 4Y0AA 2D2EA 4PR0A 4NZYA 3IQWA 2C96A 3DMNA 3EARA 2BCJQ 5G53C 4LJ5A 2J7PA 2J0UB 3NIBA 1PZNA 2CLCX 3H1TA 4A2WA 3BFVA 3SU8A 1G7CA 3PUYA 2FFAA 1COWA 1P9WA 2ASEA 3NWJA 2ZI4A 4OBEA 2J7PD 5G3ZA 4AYXA 2NO6A 4RCZA 4A82A 4MDFA 2ERXA 4G5SA 3N5CA 4TLAA 1COWD 1S9HA 1CR0A 2OLJA 2IS1A 2A5FA 4I1VA 3A1WA 1DEKA 2BM1A 1HE1C 2ZS7A 2NIPA 1E2GA 4KBGA 1P2VA 4RY2A 2O8EA 2ZJZA 1KKLA 2ZRIA 1VECA 2GAOA 2IEYA 3CWZA 3CRVA 3EWAA 4ILEA 4LBWA 3C15C 4P4TA 4QGAA 2FA9A 1JJ7A 3W34A 3PUVA 2ZYVX 2WKRA 3HJNA 1Z0JA 3VNVA 3F5FA 3WP1B 4XWAA 4FMCB 2FPLA 4AKIA 2Q3FA 4LC1A 4DT1B 1N5LA 4ERNA 3NDPA 1N0UA 2B7BA 4WA7A 2XTMA 2ZRBA 4Y0VA 5EE0A 1W46A 1D2MA 4U5XA 1DELA 1ZIPA 3D8BA 3B13B 3IKJA 1QHNA 2AFHE 2QNRA 3IILA 3RANA 1CIPA 3VX4A 3K9GA 2Z4RA 4NCKA 4JLDA 4ZV4A 4M2LA 2J0VA 1U8ZA 1Z07A 2BEJA 1S1CA 3QBVA 4Z8YA 1RRPA 5BQ5A 4TMVA 1NVWQ 3MGCA 4GMXA 2WPDA 3SJAA 3VU9B 3F0TA 3A1UA 3D6TB 1CS4C 3HYTA 2XXAB 3GJ0A 4YMUA 4Z54A 1LY1A 3HR7A 4JT2A 5HCIA 2IF0A 2I1VB 4Z51A 5GJBA 2WPDD 1K5GA 1TQ6A 1DO2A 1CXZA 2ZQ5A 3HWSA 3B7GA 1RZ3A 4NCJA 1AM4D 1FNMA 2V4ZA 3BWDD 4LBYA 5AUOB 2LKCA 3BAFA 2VHJA 4Q7KA 1NL3A 1P9RA 1EFHA 2IYTA 5FL7A 4EQ6B 2MSDB 3CPHA 4D25A 1L8QA 5L3QB 1ANKA 1OSNA 1W2HA 4AG5A 3QSYA 1W0JA 4RD3A 4Q1EA 2V9PA 2W83A 2ZU0C 4UXHA 5FL7D 3IO5A 5D3MB 1KO5A 4P4UA 1OH5A 1W0JD 1G64A 2FSIA 3UIEA 1R2QA 2ZJOA 4LBVA 1XCGB 1G20E 2ZRJA 4JSTA 4BFWA 4U00A 4GOJA 2PZGA 1W44A 4F93B 5F9FA 4ZCMA 1CP2A 4BASA 2AD5A 121PA 3QKSA 3PG5A 5CM9C 3LLUA 2A5JA 4QC2A 5C4MA 1YKSA 3R7WB 3RNLA 3U4QA 3CPEA 4V0KA 3DHWC 3NBZC 2IXFA 4I1UA 1E2DA 1EWRA 1YRAA 5J47A 3FHTA 2VPPA 3GMTA 4HSEA 1K6MA 2GJ8A 4L9WA 2YC4C 4OYHA 4R7ZA 1FL9A 4FCWA 3IEVA 4GL2A 1BIFA 3QXCA 4TYQA 2ZEJA 2R9VA 2C03A 3U7HB 1EFCA 2YV5A 4CGZA 1CJMA 3E2IA 2R44A 1AS0A 5EE3A 4DC9A 1ZUNB 3TNFA 2WJIA 3WMFA 2OFWA 2B6HA 4V0ME 4LUCA 1AK2A 4A15A 2BBOA 2BMFA 4JLOA 3J81k 1F2UB 3LV8A 3GLGE 1LFDB 3N2EA 2PBRA 2IT1A 4JSYA 1YJ5A 3HR8A 3C7KA 1E96A 5SZKB 2PMKA 2CHQA 1DBSA 2D7DA 3KDSE 3P27A 1GILA 2JAQA 4DCUA 5EJEA 3AVPA 1CR4A 5DI9A 1TX4B 421PA 1N6HA 2AK2A 4WIAA 3U5ZB 4A0GA 3DKPA 1VHLA 2YWEA 3AEZA 5CB8A 1DO0A 1WDTA 1M7BA 4IDNA 4BFUA 5JEDA 1D2EA 4TMTA 3AVXA 5FL3A 4POAA 1NVUQ 3L8YA 4MGYR 3ADDA 2FFBA 1U0LA 3CB4A 3W6PA 3HP1A 1XJCA 1NN5A 2JASA 3GJ3A 3T1OA 4E07A 2V6IA 3AF0A 4KFTA 4TQUS 3V9PA 4Q01A 3OE7D 3KB1A 2FEMA 2PMDA 4ESHA 4ZCIA 2ORIA 3H4MA 3S1AB 2CEAA 4UJ5A 1XB2A 1F5NA 1XNJA 1IJFA 5AJZA 4D81A 3QPUA 1JJVA 2LCFA 3LO5A 4EFNA 1OFUX 4O2LA 3U60B 3LX8A 5DYIA 1G5RA 1EFRA 4WAUA 3UMRA 3GLGB 4Z8XA 5EE9A 4LJ9A 3ZZTA 2JIZD 4QRHA 2ZI3A 3U6BA 3A8TA 3VTKA 1JB1A 3HPQA 1EFRD 2ZRGA 4HI0E 2WWIA 2FSGA 2X77A 3CWQA 1XTJA 3GLHA 1J99A 3L0SA 1M7HA 1GL7A 1SKQA 1RYHA 1SVWA 2CL7X 4DLZA 3NH9A 5JWRA 2NMVA 1XJ0A 5FR2A 4QJ5A 3M1IA 3EW9A 5C4GB 1UEIA 4CEJB 4N0EA 3NHBA 3QQ5A 3AUXA 1R0YA 1KI9A 3B1WA 1L4YA 2PLFA 4EDHA 2AKYA 2BVNA 1XP8A 1VPLA 4G5RA 3G0HA 5D3QA 4F4IA 1Q21A 2VIIA 3KUDA 1QBKC 3AKCA 5M04A 4D4LA 4XSHA 3LFUA 4HUQA 2JJ2A 2OXCA 4V0NA 4CDGA 2H92A 1R5OA 2ORWA 3W90A 2IA5A 3KKNA 4MYTA 1HV8A 4AKEA 1FUUA 2ZRHA 1J8MF 4IOJA 2JJ2D 3U3OA 5HZKA 1P60A 4JLVA 3TIFA 2QL6A 3E70C 2ZTSA 3CW2A 3DVLA 1DTSA 4NDZA 1UBGA 3KUCA 4YDSA 1YZKA 2IK8A 5P21A 2C78A 1P2TA 4A4DA 1VCMA 3N70A 4CEIB 4CZ2A 1J70A 3K9LA 1MO4A 3THXB 5KTYA 2QSYA 1E2HA 2FH5B 3I61A 1NY6A 4HAVA 5CLLA 1CJTC 4CW7A 3M6AA 4D0GA 2GESA 2O8CB 1Z6YA 2VEDA 2REBA 3W6OA 3SYLA 3GQBA 4F7WA 5L8VA 1ZU4A 2F55A 5F9HA 2WM9B 4IOMA 1FX0A 1BS1A 1VDZA 2WKPA 1GAJA 3AVQA 3IIKA 1OW3B 3W3ZB 1HEIA 2X19A 2YWFA 2ZE5A 1KK0A 4ABYA 4PHGA 1T8UA 4O2RA 4KXFB 2VSXA 4B35A 1CJUC 3CX7A 5AWFC 2W2VA 5DSZA 3GFOA 4KU4A 1HTWA 4Q7MB 3A4MA 3EIQA 3SS8A 4DIDA 3QY0A 5DHAA 4UKDA 1U81A 3Q72A 1QVRA 2WV9A 5HE8A 5JRZA 1MABB 2A3RA 4QHTA 3T5GA 3KL4A 2XZPA 4GOXA 3THYB 4TQAA 1KJZA 1P62B 2BKUA 2X1VA 2IW3A 4Q9KA 1GRRA 1AN0A 2ZSAA 2PJZA 4M1YA 1E3MA 2F9LA 1KMHA 3KJIA 1JAHA 3L8ZA 3DO6A 3UATA 4DSOA 3CIOA 2GRJA 2OV2A 2AR7A 3VR4A 4E22A 4HB3A 3K0CA 1PLKA 4PAMA 2JLYA 4R98A 4DDUA 1S8FA 2ZJ2A 2R62A 2OESA 1UKVY 1M1YE 2WWGA 4HLUA 2ONJA 1GKIA 1MO3A 4MGZR 4YMSA 3UG6A 3VU9A 4ZDIA 5G41A 3RRZA 1SGWA 2HDNB 5L3VA 3SFZA 4GDFA 3KQLA 4PQFA 1ZYUA 3JZMA 4DCVA 1FUKA 4JL6A 1ZC4A 3CKLA 3HU1A 4HB2A 2VHUA 4LV8B 1KSHA 5FFMA 1NMYA 4B6EA 3EASA 4Q4HA 4US0R 1SVMA 4EQ6A 1KDOA 2CVHA 2ZUBA 1B0UA 3R8CA 2B8TA 1EGAA 4TTPA 3T15A 1IHUA 4B47A 3QVUA 2FGKA 3WXMA 2GK7A 5D3MA 1A2BA 1D5CA 4ASUA 1G5TA 1N5IA 2QZ4A 3I8SA 4Q4LA 1Z29A 2QPTA 3CR8A 4TL6A 1P5ZB 2SHKA 4XSGA 4N0DA 2IYXA 4QKQA 1G8FA 1GTVA 2IS2A 1HT1E 2XAUA 4O0MA 2RGAA 2ZANA 1X8JA 1UAAA 3VR2A 2C9YA 2J59A 3CH5A 2QTVB 1DE0A 5KOYA 2OFOA 8OHMA 3CRMA 3T35A 3IBYA 2O8EB 2G9NA 1NVXQ 2VP6A 1ZNYA 4Q7LA 2QM7A 3MMPA 2CMKA 4LHWA 1D8TA 2V1XA 1W49A 4JVNA 2Z43A 3TSOA 4FMDB 2WZQA 3LBIA 4B48A 4CIDA 3SEAA 3HU2A 1VG1A 2J87A 2ZYTX 3UXMA 4NE2A 5GJWC 2O8DB 3QIAA 1AJEA 4NTZA 5FBWB 3H84A 1GRNA 3TUJC 3R8FA 1UEJA 5DHFA 5KSYA 4EIWA 1GITA 1NLFA 5GVRA 4OJQA 4KI0A 2ZR7A 2NZJA 3TSWA 3VKHA 1IN4A 2BM0A 3GPLA 3QG5A 4JT4A 2IS4A 3D3QA 1FNNA 2XEXA 3ZS8A 1QHGA 4OI1A 2ANBA 2ZJYA 1KAGA 3KQNA 3GLFA 3RSLA 4C0KA 2OUKA 4AY2A 2EVWX 1KI7A 1JAIA 2F7SA 3L43A 3LXXA 4G1UC 4S2EA 4ZCLA 5IT5A 1AZTA 5E7IA 3CUEF 2H17A 1Z0AA 2VSFA 2ZJ5A 1Z2AA 4A0FA 2ONKA 2WMNB 1ELOA 4K81B 2PLRA 4JKIA 4WW0A 4B43A 1U99A 1ONBA 2NGRA 4DEYA 2RB4A 1KSGA 1W0KD 2R8RA 2BKEA 2QP3A 3A4LA 4ZKEA 2JCSA 3ZVLA 5E3HA 3RC8A 4PC2A
chains in the Genus database with same CATH superfamily
1U2DC 4ZAWA 5GAJA 1BCSB 1DAHA 2VOEA 3B1FA 3ECSA 3HYRA 1DOZA 3ND5A 2YYAA 1J7KA 1X1DA 3LDGA 4YUYA 1J25A 1ZINA 3D7KA 1MEJA 3DQPA 5SY4A 3ZE8A 4GI1A 5KPDA 1GZHB 2C1XA 2RG1A 3QBJA 3VVCA 3QKSB 1FSPA 2JRCA 2IH2A 4L4UA 1KVSA 2BV3A 4GF5A 4RUKA 9ABPA 1GA6A 4S2UA 5AMXA 4N3NA 4DQUA 5EMJA 1ZRHA 1RPJA 3Q7EA 3BXHA 3KSMA 1T5LA 3PX3A 5E6UB 2PZFA 4JJZA 4OHOA 3VFDA 3VSAA 1XF9A 4TVBA 3C3XA 2DP4E 5JG7A 1C9KA 2H5LA 2JGIA 4I14A 5BNTA 2ZTLA 1XZGA 3QVXA 2YRFA 3X43A 2Q5CA 3H0CA 2NYVA 4IO0A 4Y3UA 1ZICA 2IZ6A 1KQNA 2FN3A 3BMNB 3WIEA 3OCJA 4IVRA 3AQ4A 4RK0A 2ZIFA 1NHWA 2UUCB 1NM5C 2VHTA 4N41A 2UYYA 2G72A 1CR1A 3C70A 3UK0A 5LMCA 1L1QA 3AY0A 4NR0A 3PYLA 2XT0A 1JDUA 1TKBA 3V4VB 4B3XA 4M1MA 2IXDA 1HKUA 1XRSB 2P6MA 2WSMA 5DM2A 4ZVOA 1NUQA 3FVWA 1HO3A 3KDPA 3LPLA 2AOTB 2RHGB 2BKLA 3NHJA 3BOSA 1UANA 2PX0A 3MJDA 2WTNA 2X5KO 3RASA 3LT1A 2P3LA 4LZWA 1DAFA 3A25A 2FW1A 4I9HA 4ZEVA 2VRCD 3CGGA 4ED9A 4K9LA 1VHQA 4JNKA 3S2ZA 1PUIA 3WKDA 1E3TA 1DHRA 4EEKA 2HLHA 3AZOA 1P1RA 3VZCA 3RVNA 3HYSA 1C1XA 3BHMA 2C9OA 3QELA 5KOIA 2W6IA 1DRJA 2M6LA 4CL0A 2X1LA 4CIYA 4YMWA 5KOJA 3FNRA 5I7RA 3W9SA 4WMLA 3I9NA 3NUQA 2RGRA 4B6FA 4PICA 3NKVA 2ZJBA 4E2WA 2W90A 2VSQA 3ZWMA 2WKQA 3AJEA 4TTVA 1WKCA 4JQOA 5C5CA 4G8JA 1MNAA 1WUHS 3FPKA 4HDNB 2R5WA 2WTEA 4TZTA 4YAIA 3PIRA 4UVDA 3SYNA 1KJYA 2Q50A 3VDQA 1L7EA 3RDPA 3NHMA 4YGXB 2WP0A 2Y0BA 3IDAA 2E82A 2DZDA 1NBWB 2HT6A 4MIEA 1QGUA 2C5EA 1EI9A 2VHQA 3H2SA 3KXDA 4R8RA 1NVMB 3TI7A 3IE0A 3GRFA 2J3IA 3LPDA 1AN9A 4DQVA 4FGJA 4RJIA 2ILVA 4OJMX 1PG5A 4ENQA 2HA7A 1EVZA 3HEAA 2M6RA 5ALHA 1HEYA 2F43A 4RVFA 1OZ0A 1A1VA 2XDAA 1O97C 1UBHS 2ODBA 3DDUA 3CMMA 2W93A 3KT8A 3T9DA 2GBLA 5BWOA 1O4VA 2RARA 3D8NA 4PQRA 5HKKD 4FGLA 2I33A 3J7TA 2OLKA 4BNDB 4XTCS 3K0FA 3OJCA 3LA6A 2ZJ6A 4HY3A 1PLLA 3BXZA 3LW7A 3FPFA 4LVNA 5G3YA 2VKQA 5KDDA 2FMFA 2Q21A 1B93A 4MQFB 4BTEA 3UWMA 5DM4A 2CNBA 2J32A 2RGXA 5FPYA 5LCXA 1GV1A 4MKGA 2P4UA 4Z4HA 1WABA 1IBSA 3SE0A 3AFMA 1X1SA 3ACCA 3I28A 3PD0A 3GT7A 3B6IA 4KAFA 3X1DA 4QFCA 5KVVA 3A3PA 3QVVA 2GD1O 5EINA 4GX1A 4Y9TA 3WYBA 1VKOA 1XXHA 2N47A 3WO1A 4QDOA 1RAGA 5DNEA 2W37A 4RF5A 1UJ4A 2FW6A 4C7XA 5AKIA 1JSRA 2PUDA 1LB1B 1VQ1A 3PHBE 4F71A 1MC4A 4NU0A 5AYVA 4BLWA 1M2OA 4MUFA 1UKEA 2XBLA 1UC9A 3OO0A 4QUJA 4MKFA 4RDHA 1LUAA 4HAXA 4M22A 2O20A 3RUAA 1QPBA 1TK3A 2H48A 3F8WA 3K5WA 4Y2GA 5JC1A 4E6EA 4HNAB 2WHXA 3FY4A 1EFDN 1JALA 2Z2ZA 3V8BA 1W4AA 3AEKA 4B6RA 4KODA 4LPSA 4OREX 4QOHA 5F12A 4MW0A 4Y7CA 4X65B 1ZESA 4NF2A 2ES4A 3A4VA 3RAPR 4M9UA 4W5HA 4UUAA 5E2BA 2CVZA 5KMGA 2Z6QA 1S2LA 5ADWA 1KI4A 4HFNA 2HA2A 2XQGA 1XWIA 4NYJQ 1EUDB 5E9QA 3LDUA 4IOLA 4K5QA 2JDID 3O4FA 3S27A 4R9SA 3D9QX 1JEAA 2Y0CA 1OWLA 3BRWA 4QM7A 3OIWA 1N5RA 2H1CA 1DNPA 5BV8A 2BHSA 2QRUA 1CY1A 3MS7A 4G1CA 4HFJA 1M34A 4CG3A 4E6PA 5DB4A 4P58A 1UF9A 3NXSA 1W36C 3WNZA 1ZVJA 4BQRA 3URKA 4AO6A 2EC5A 2EARA 4AX8A 2C84A 2VCYA 3RTEA 2BGLA 2XGMA 3Q6IA 4R8MA 3U0BA 4DSNA 3FPGA 1UZUA 3PEUA 2HF2A 4H18A 4UVGA 3G2IA 4MEBA 4AY4A 1Q0LA 1QBGA 4URYR 3BTSA 4EH1A 2Q5QA 1KY5A 1NNSA 4LGVA 4UHHA 2V5AA 3HNOA 3QE2A 2EWMA 5ENDA 2XD4A 1EVQA 2HJRA 3E1GA 3V2GA 1CF9A 1SVOA 2X4GA 4V2UA 5EP4A 2W70A 4P3YA 3W7VA 4AL4A 4CM5A 1E5QA 4TM8A 2QTVA 3UANA 2BEUA 1SHZA 2OB1A 4JU9A 4TKMA 1LTKA 3WWZA 3GJ7A 2IWRA 1P1KA 3B1VA 5BSMA 1E4VA 2G40A 2PGOA 1W1WA 3IUQA 5LZ5A 3MG9A 1OZAA 3CTPA 3A9VA 3KWMA 1X2BA 2RGDA 3CLRC 4I99A 4YJHB 1K08A 3W7BA 5H1YA 4EW3A 3EG5A 2W43A 3MAGA 2BMEA 3NC0C 3SC2A 1S9DA 3ZNPA 3EXHA 2FEWB 3G5AA 1NUPA 4Z53A 4XD7A 5EAIA 4GBMA 5CB4F 4KITB 4RACA 1VE6A 4QBHA 1QMGA 3A28A 3K1TA 5G0SA 4CN8A 5K0BA 1DQPA 2L0XA 4FYHA 1NW5A 5HRUA 1RRCA 2ZI7A 4W1RA 3G17A 4B2IA 5CFMA 1ADGA 3M4YA 4B71A 5I4BA 2DPGA 4WI1A 1Z6TA 1BH2A 1PFWA 2WWRA 2XNCA 1VIAA 1W7AA 3A6ZA 1SHUX 3UHPA 1E1NA 1OXXK 2WNIA 2NO1A 1CIJA 4J3FA 1XMPA 4YJKA 3JQPA 1NQOA 1VGQA 1EFUA 3BKWA 3UJ8A 3KXIA 4YRIA 1DOHA 2ZUUA 4PSAA 3RUPA 1ZHHA 3PQFA 1OU0A 1YHZA 3QLTA 1QFJA 1TF2A 4OAPA 4TT8A 3WV5A 2YJTD 3ISTA 3ZN2A 4CHGA 4F96A 2YDXA 4UC0A 3SEQA 2HCRA 1ODFA 3IVXA 4C6TA 2OG1A 4BAZA 2JLUA 1B0PA 1ZO8A 1NDHA 5FYQA 3TLMA 5IH3A 2ESRA 1SFRA 2J4CA 4GBGA 4I3FA 3ZJYA 3ZVMA 2IYQA 2GHRA 1EUCA 3ASUA 1M73E 4KGVA 1X8KA 1B6SA 2AEJA 5EHIA 4ZT3A 5F77A 2P9QA 3IT1A 4RAOA 4I1SA 1USIA 2LTAA 1SK9A 2CNKA 2JGMA 2Y1XA 2Y6VA 4M9ZA 2JHFA 3UWSA 4BEJA 5IVHA 1ADBA 2O2ZA 3G7NA 1PGNA 3CZPA 4E2FA 3G2JA 5E7MA 1T9AA 3P52A 3VH3A 5CA0B 3D6VA 4OJTA 1VPTA 1VIVA 1P91A 4P7JA 1R3UA 2NO5A 5TMPA 4V1CA 1I4EB 3PD1A 3BJZA 4NESA 2PFSA 3LKBA 4ZVPA 3KAPA 1U9JA 3S1LA 1E64A 1ZG3A 3M2TA 3VH2A 3MYYA 1IPEA 3T5MA 3UXEA 2ZVQX 1Q20A 3ZK9A 2ZVPX 1KO7A 2CXXA 2BD0A 3S70A 4MROA 2WFAA 1RMTA 8LDHA 4CKCA 1ZNWA 3F1KA 4LY3A 4TGLA 1E4YA 2PG3A 3AUJB 3RS8A 3U62A 5EJ6A 4NBNA 3BEOA 1CUWA 2A1TS 3E5HA 4J7UA 4OXYA 3L1VA 1CZNA 4OMCA 4Q4AA 4KBFA 4AMVA 3O75A 3S7ZA 1XTKA 3PR3A 1A5BB 1M83A 4NU5A 3NOOA 4FMBB 2P41A 7MHTA 5TT0A 1T0IA 3QOYA 1GTZA 1TZJA 4U9HS 2L2QA 4LF6B 3LZDA 3S55A 3R5JA 1KVRA 4IH1A 2NN3C 1NJ8A 2V6JA 2YC2C 3M5WA 2PLAA 2YV3A 1XLTA 3KFLA 2CEKA 4EWLA 4HRXA 1E3WA 2D5AA 2J9YB 3STTA 4AZ3B 1ZH8A 1KKUA 1E5TA 1OKKD 2AXPA 5I7UA 5TEVA 1RHRA 1DARA 1FMLA 1UFQA 3IMKA 2OQVA 3X2SA 2CXTA 3DOIA 1GNQA 2J9FB 2B0JA 4MRAA 3GRCA 1O6CA 4GP7A 4C4AA 1A0OA 3LOQA 4MWCA 4ACAA 4E46A 3TG2A 1P3Y1 1IBRA 2B8WA 2J07A 3WLAA 2WMYA 2GUGA 4NCHA 2A1TR 5LMZA 4EX7A 5IAAA 2GI4A 4OI2A 1LBHA 2BCGY 1SO8A 1EK2A 3CMCO 2BELA 3WLLA 4BNJA 3WWPA 1ECLA 2TMYA 2YVUA 3F7TA 3K6SB 1FJXA 2VJYA 4ARUA 2XB9A 4Z3KA 1HQCA 2GH1A 1NW7A 3VKVA 3FLBA 4BB5A 3NTLA 1TZ2A 1I3CA 3B6KA 3G2HA 4PLYA 1XV5A 4MRRA 1JMVA 1DWUA 4JGBA 2PKWA 4BC0A 2F1JA 1KMIY 4QYIA 5E6SB 4CCAA 2CHFA 5SY6A 3ULKA 1P4HA 3QBDA 3UCFA 1QRAA 5AJVB 5MN5A 1FPQA 2H8KA 3JSXA 4GLJA 2PKEA 3OPQA 3Q3HA 3NVMB 4N3BA 1OTXA 3DZBA 1XDBA 3A6HA 3EOBI 4K9OA 4DKJA 1V9CA 2I22A 4GPBA 5K3FB 3FB1A 5C5IA 1W4BA 3PUJA 1BFKA 1KY3A 3EW7A 4NS4A 4LRYA 4C76A 2EFYA 4RMGA 3VNUA 2VZLA 4HEJA 2EKLA 5HOQA 5K1ZA 4MPJA 3LXMA 3T3DA 4UTRA 2B69A 2XUQA 2ZB4A 2C2YA 4RW0A 3RG2A 5LQCA 1Z0IA 1MOQA 5FI5A 4DZTA 3PEWA 4WNCA 4DKXA 1UWLA 4RL4A 1IXRC 4PX5A 4LY6A 4RHXA 5LZ9A 2Z8YM 4Z0HO 2AHOA 3GJZA 5F73A 3FOZA 5BSVA 1G55A 2QLLA 3RRMA 4I4NA 5A3QA 4BZPA 1OWPA 2VHWA 3DTVD 4ZHQF 3MGGA 3W9YA 1U8XX 1Y9JA 1G2IA 1WXEA 1RR6A 1RAAA 1RQGA 2PX5A 3FMGA 3CPSA 2ZCUA 3QMVA 4IWYA 4FT2A 1WL8A 5I8ZA 5TXGA 5LD2B 3INYA 1OFIA 1RRKA 2V0CA 3HNRA 2EIXA 3MHPA 4NLLA 5COBA 3WWEA 4B4OA 1WP9A 2C2WA 1QANA 3E3AA 1C8BA 3WWOA 2R7LA 3SVZA 4BWYA 3GEGA 4WCDA 5EMHA 6YASA 4Y2JA 1LBQA 4IOKA 4YECA 4J1TC 5A04A 2J9RA 4TN1A 3N8HA 5JD5A 3QXJA 2JA1A 1E6KA 4H35A 3RHFA 2G71A 1ZJ4A 2HNBA 3JWIA 2EW8A 4A8JA 4H7EA 4AKHA 5TQ0A 1PWXA 2R96A 1M0WA 3SX2A 3I2JA 4QAQA 2ZETA 3UO8B 4C7MA 5B1IA 4W5OA 1T9GR 3ICQB 4WZBE 1G8SA 4PX9A 5EHXA 2R7MA 1C1XB 5JBQA 1Z6PA 1A4RA 3K5PA 1U94A 3KALA 3QELB 5FKJA 3D64A 4EYOA 5KOJB 5BR7A 1SEVA 2C83A 2IUEA 3F5DA 3D31A 1H4VB 2RIPA 2PNJA 4CEHA 1VJRA 2IUUA 1EAYA 1ZOPA 1EUZA 1U8TA 2NZ2A 1EE2A 3A37A 5E2AA 1DT3A 3G7UA 4XR4A 3SIXA 1V6AA 3VSCA 1KAQA 3RVBA 1N25A 1SVKA 1GUBA 2CCGA 2I4TA 1JWBB 3JVVA 2JEOA 1RM0A 3VZBA 2Q3MA 1VBFA 2D74A 2WJGA 1D1SA 4CKWA 4LHYA 3CPJB 3IAS6 3L0ZA 3U61B 3H6KA 3QWFA 1QGUB 1PV1A 1Z4QA 3OIVA 3JYHA 3SYRA 1F8GA 1M67A 2D1YA 1G4UR 3H8VA 3NHFA 5BV2P 3HXOA 4B87A 4YAGA 2VG8A 1OHHD 2CFRA 1YE5A 4O5OA 3HJCA 3ZHQA 5TGZA 5BWLA 2ZYHA 4JUCA 1V4NA 1ZSYA 3VGPA 4HNRA 2F43B 3EGXA 4D4JA 2GBIA 2GCOA 2AJDA 4GNRA 1EK1A 1T4BA 1JH8A 3SM3A 1HX7A 3I42A 2YVAA 1EHYA 1B1AA 1U0TA 1N6PA 3GLIA 4E30A 4MW1A 4K9QA 4E32A 4FFBB 4QU8A 5D84A 3K0FB 3R3JA 4Y6RA 3WKBA 4F11A 2GR9A 1ISMA 1DBPA 4N5HX 1XPOA 2NVWA 4OI4A 3U9LA 4RELA 3PWKA 3WRWA 1EE1A 1QTRA 3SZUA 3DCNA 2DVMA 4F5ZA 3N74A 3U3MA 2YHSA 3UKDA 1HLDA 2VTVA 3T8YA 4WFQA 1NQXA 5BT9A 1O3YA 2FDXA 2QMYA 2SKDA 4IIHA 2EJVA 4QUGA 4EPWA 4NECA 2Z6UA 3F78A 4P34A 1XQXA 1XXHB 1JEYB 4ZQEA 3N7TA 3P0RA 4L6CA 2Y1WA 2HSEA 3KS9A 4O4IF 1KVQA 2QRGA 4DMFA 4XKJA 1U04A 2FQYA 2R4QA 4N8EA 4QYWA 1VSBA 2YN0A 4YUAA 5DYYA 5KU7A 1M2OB 1E2QA 1TUEA 3QUQA 3K70B 3COSA 1XWFA 2B2XA 2H1VA 5EJ9A 3GAZA 4WLEA 4PZ9A 3FSRA 4RGBA 5IJWA 4OQYA 1K3UB 4P36A 2CGEA 3ZCSA 1EX1A 1GQ2A 1JN0A 2OCYC 1ORWA 4B0OA 5IVKA 2Q3LA 3PEFA 3AEKB 1AO0A 1NJ5A 5DCWA 1LLDA 4PGHA 1JR3D 3EMDA 1TJNA 4E70A 2G06A 4R2LA 3OTIA 2QORA 1DC3A 2VP2A 1KK3A 1IVSA 3DDOA 2WA2A 3ETDA 1EXNA 1UJ6A 3IA2A 4B6GA 4DNXA 4DDTA 3AWDA 4UZEA 1NI3A 4YT8A 2OBNA 2OO5A 1HL3A 2PX8A 2FWAA 4WGGA 5H7XA 4MYSA 1F6WA 1MZVA 2VPWA 2WVAA 4FZJA 4RIHA 1J90A 1MTZA 3EVCA 3R09A 1AZSC 1QKJA 2YBDA 3D3EA 3BE6A 2FLVA 4FIZA 5JSKA 4Z7NB 1EESA 2JJQA 4B81A 5H0IA 4ZXPA 4BUZA 1M34B 1VLHA 1DMRA 1YJBA 3RU7A 3OX3A 4MHTA 3USZA 4X00A 2ZSJA 3MELA 3VOAA 2GO1A 1L4EA 1KH3A 5IABA 4V0QA 4RY8A 3FSGD 3C5WP 4JLBA 3FKQA 4IILA 1U7ZA 3D2BA 1OV4A 5HRAA 5FYDA 5J2TF 2GDJA 1BVRA 2QD4A 4QE3A 4HHEA 5LBIA 2I99A 2J30A 3JD3A 4MV5A 1PT5A 3A4IA 1G3MA 1QZZA 2X2OA 2DSNA 4KVAA 4BNLA 1JUDA 4GEGA 2FETA 2W00A 3WWCA 2JLVA 1U2QA 1PJ2A 3NEJA 5K0CA 4OYYA 5E7QA 1BW9A 3V8VA 4QZVA 2BEUB 1P4GA 1RIFA 1EP2B 1GQYA 1RWWA 4X8OA 3AF1A 3O92A 1FIUA 3EIHA 5F1YA 2WFMA 1PO7A 4DPMA 2J67A 4UOQA 4ZZ3A 4ZZ0A 1WNTA 2VAPA 1VJDA 3VOBA 1NQUA 3PI6A 1TE2A 1DEXA 2BJHA 4B9EA 2GCGA 5AW8A 2F67A 2QQ0A 4K3VA 4UCXA 4E5MA 1UFVA 3PDUA 4E7PA 2P5SA 2QV0A 3SC2B 3Q8LA 4J0QA 4YHBA 3EXHB 3L9WA 2GBCA 1W2WB 2WOOA 1V71A 1AQYA 3RIYA 5FI1B 4ER7A 3ROZA 5FUYA 2ZOSA 2PEYA 3DFIA 1G19A 1Y48E 4JJFA 2E6KA 2VRWA 4QTYA 5B7PA 1QX3A 3H65A 1ZD1A 2DH5A 1QC5A 5IF9A 1Y7LA 3VJLA 5L3SB 1GUDA 1S1MA 1ZEJA 4Q48A 4R68A 3R3HA 2R6CA 5EUBA 3OZVA 2J5RA 2LDXA 3UCEA 4OHUA 2ZIZA 3DEIA 2HXYA 1GG8A 2Y0EA 3EDYA 4D8VA 1FQOA 4NEHB 1CUZA 4G3XA 4HUTA 1JPJA 3B8EA 4NYMQ 4U5QA 5ER6A 3MJCA 4LXUA 4AYTA 3QE0A 4X1KA 1Q0ZA 2H63A 1A4UA 1ZD3A 2PGIA 4FP9A 3W5HA 5CVTA 4DWVA 1CUGA 1DU4A 3ZS9A 5J2UF 1V9LA 3ASZA 3ILYA 4PYMA 2NXWA 4XLZA 4C6TB 3MNFA 2VDNB 4LF8B 1TQ2A 4DV4B 3X44A 1QH0A 2OBXA 2UZ0A 3R7SA 5JMOA 1EXWA 1XDDA 1MOZA 3C3JA 3IEXA 3VHXA 1U98A 2BR5A 3OPYI 3WRXC 4AX4A 4BO5A 5DNDA 4AJKA 4L16A 1RMYA 1B2LA 2I6SA 4OHKA 4RK6A 1SA0A 3TTUA 1KE2A 4NHEA 1TTHA 1XVTA 2QGFA 3IT0A 4G2TA 4W4TA 3T41A 3FPBA 3D7NA 4Q7JB 1IOVA 1V2GA 3C3WA 3ZJVA 9LDBA 4IDAA 4YDRA 3RKRA 1KPGA 4V1CB 5LQDA 3ZIAA 3DULA 2HQBA 3UMJA 5UKDA 1D0IA 1ULUA 1JVSA 3Q5GA 2H2AA 2PU5A 4BP9A 5TARA 2I71A 2JD0A 4HGYA 2DWQA 3ZBTA 1XQWA 5DYTA 3VO2A 3QH4A 5JLJA 4IUCS 3LTNC 1NI5A 5IXYA 4DLVA 1RZRA 1F06A 1FLDA 4KYIB 4CKCB 4LOHA 2HRZA 3DS8A 4HQOA 1U0OC 2KQUA 5HX7A 3KSRA 4XZ3A 4GKKB 1NLYA 1YVUA 2WY2D 2WW8A 1Y8CA 4Q4AB 5JD3A 3R23A 3JQBC 5EGSA 4X90A 4QLBA 1FS6A 2EXXA 2K5UA 3DMHA 1T9HA 3HJGA 3LOPA 2A9OA 3H8SA 4MITA 4TRMA 7GPBA 4IQFA 1KI8A 3SZ3A 3ZXSA 2IIQA 2D5LA 4UEJA 1VE7A 4ZAVA 5TT1A 2H0RA 4P2GA 3RC1A 3PU6A 1TT5A 4NXMB 2PX3A 2W0MA 1I4LD 1EFPB 3KQWA 3OQMA 5ICCA 1WMBA 1UMDA 3WRVA 2PS0A 3LA8A 2P3OA 3K0EA 3MCZA 3GLRA 5JXGA 5FUBA 4GIBA 1MRSA 3OT4A 2ZAMA 3ENKA 3G0BA 4J0KA 5H70A 4AC9A 3TZLA 1QR2A 1NLZA 4XCXA 5EG5A 2XNKA 4GGMX 4RD0A 4TRRA 4GOMD 2FKNA 3DTTA 3DV9A 1RYFA 1H2YA 2KWIA 4L15A 4NC9A 1DKNA 2W0SA 1D2RA 1KMMA 2HMTA 3PBKA 4RCYA 3FOCA 4UM8B 4L3OA 5AK3A 3CVWA 5FJJA 1J00A 4MOWA 1ESEA 4BCBA 4IIVA 1RZVA 4M9QA 3GRVA 5KSWB 3TLAA 2BHRA 2VQFB 4HDQB 4ZT5A 3PLAE 2JF0A 2BE7A 2B9VA 1SURA 1AS3A 2QD5A 4F84A 1Q22A 1TLTA 1V37A 2AF3C 2FP4A 3BREA 5HP4A 1IUPA 1PJZA 3PHGA 5AVTA 1G9XA 2ZWAA 4O6VA 4WFIA 4Q7QA 3I92A 3NNSA 5I48A 4DBLC 2NU9B 4XAQA 1N2ZA 5DIZA 5JXWA 4FFNA 1UXGA 1IG0A 1DIGA 2OGWA 3C87A 4NCIA 1P31A 1BMTA 2UZ3A 3CRRA 5TGDA 2I87A 5CMLA 3EIXA 3H05A 1LBTA 4PNPA 2VHYA 5TE9A 5TRTA 4EUEA 2I6XA 5IM4A 5D01A 4URZR 1W6UA 2Z2XA 3GG2A 1L5VA 3NHLA 4X6LA 3UHJA 2VJPA 5B1DA 5IASA 4YV7A 1FVOA 2XKKA 4TTTS 2CDAA 3OT1A 4LZZA 1Q0QA 1T0HB 1V41E 3H5NA 1VBKA 4GMDA 4NMHA 4XJVA 3RREA 1XC7A 1WCXA 3CSDA 3ER6A 3GYGA 3B8HA 3O4VA 3NHKA 6Q21A 1NW3A 3ZWOA 4Z3OA 2ABWA 4RJJA 2DCMA 3L7OA 1IY9A 4OHFA 1UDWA 1KXJA 1BZYA 4HVCA 3A2LA 3B6ZA 4LDRA 4DV1B 2BEWA 1AQ6A 3L05A 5DWDA 3I3OA 4D9HA 1MXFA 3SNKA 5LWHA 3PTAA 4C7OA 2LD4A 2BTEA 2BW0A 5EZYA 3BKXA 1RAHA 2HJWA 2X5OA 4FS8A 3D3JA 4KX3A 2BP7B 3BIOA 4TKUA 4K40A 3TS1A 4CMCA 4EI8A 1Z0KA 5EJ5A 5KNBH 2W2QA 1Y9AA 2V3WA 4D9BA 4K6OA 5I4KA 2H0QA 1UAGA 3FW1A 2HDWA 3QKTA 4YO8A 3UMBA 3ZW8A 4EUNA 3MSXA 3K32A 1M2HA 2IUTA 3RK1A 4KDCA 4NONA 3N2YA 1Q3KA 3WY9A 3IOEA 4MS1A 2ZATA 4EFDA 4IHAA 3L79A 4I5IA 4XGIA 2VF5X 1LPAB 3DW3X 4Z9BA 1AE1A 5ISMA 2ID7A 3CCBA 1R0SA 4PS1A 2LXNA 2E5FA 4EGSA 4NPCA 1DAIA 4URUR 1GPH1 3K53A 1O0CA 4DMCA 4JLJA 4MGEA 1DL5A 3C6ZA 3DE2X 4A8JB 4KACA 4B84A 1AU9A 1F8FA 2NNLD 2XNDA 4NENB 5TQ0B 5LXTA 3H04A 2MSWA 2DX7A 2QXUA 5L95A 2OYCA 1MA0A 4DIOA 1XRMA 1SWWA 4IMJB 3FBGA 5A4MS 4TKVA 1WXDA 4GZ6A 5E95A 5L3RA 2IU0A 5K45A 5FI0B 1Y5RA 3C4JA 3PNKA 1WTAA 5B5SA 4CEHB 3ZZ0A 4K8RB 1V26A 1I6LA 2GX6A 1U0BB 3WJ7A 3EB9A 3ACDA 4KTVE 5IUJC 5KJFA 1MDBA 4F06A 3HEMA 1OYVA 3TNLA 4II7A 2CNWA 2R00A 4R69A 5DHQA 5B3LA 2WIAA 3VGJA 4N8DA 4XRRA 3NEAA 1UK6A 1NN3A 1SXJA 1TW2A 2VJBA 4WKCA 1GZ7A 2TYSB 1LVHA 2FG5A 3M3HA 3T7IA 4UTOA 3R3YA 4QQKA 3W1WA 2EAUA 1AHHA 1M66A 2I54A 3VR5H 2XR1A 8ATCA 3RFFA 3T4PA 4H6WA 4H60A 1QRTA 4JQSA 4HAOA 1DKOA 3N2IA 4M0LA 4EHDA 3WDLA 3UK2A 4Z4EA 1H4SA 5AH0A 4L6AA 2WAOA 3OEYA 4DVJA 2GVZC 1Z5UA 4JYZA 3OCCA 3ZDZB 1N2CE 1OF1A 2XSZA 2OBFA 1IN6A 1P72A 5U4XA 4EYQA 2H5EA 1HBJA 4RWEA 3EGXB 4BO2A 2V9CA 4UPDA 4DCCA 1E63A 2GCOB 1C4XA 5KTSA 2PVSA 1S2GA 1NFRA 5F76A 5KSPA 4X7RA 4V39A 5F2EA 3WDKA 4U7DA 1D7AA 3FYUA 3M5CA 1ZVMA 1YQTA 5BUSA 3QMMA 5FP0A 4TL9A 3H0KA 3GLIB 3WRYA 4EB8A 1A98A 1FNSA 2XQIA 1YE8A 4TWIA 1X94A 3OJEA 2VQEB 2JFUA 1NRWA 4TTRA 1HA3A 3Q8MA 2F8TA 5MHTA 3AV0B 4FN4A 1XDGA 1Y8QA 2HSJA 2P9EA 2ZITA 3KBOA 4HLUC 4BQSA 3DO5A 5IARA 1Z74A 3M33A 4TV9B 3WSVA 1H94A 1TPYA 5ARBA 2F62A 9GPBA 2FPKA 3NIDB 4BOYA 4JLPA 1GCIA 1K2WA 1BJKA 5U9CA 3VZSA 4GWKA 2WSSD 4XA8A 2P68A 3L1HA 4BNTA 4D46A 3Q3EA 3WOVA 3IPAA 2WJVA 3F6RA 4KO2S 4TMKA 2JFZA 5FIUA 3TMYA 1K6IA 3T0FA 3LF2A 2PHZA 3AI1A 2HU7A 1RXUA 3KJGA 1GTJ1 1PTJC 1RWVA 2O0HA 3ZXIA 3GL9A 1H4QA 2O0KA 2R751 3HPRA 2FSPA 2P11A 4ZHSA 4DMKA 1XWWA 1QE0A 2D2XA 3GZTB 2ZYIA 4ZTUB 4EAQA 3MBIA 3V6MA 4ZO8A 4FCTA 4QQ8A 2W2MA 3NWOA 5FTKA 4YCMA 5CFLA 1Y7PA 4AS2A 3JRNA 3UW3A 3PEYA 1Q16A 3FPJA 4RMJA 1GSHA 3LUPA 4QDJA 2E5LB 4NEGA 1H22A 1Z3IX 2ZPTX 3SIRA 4IVNA 2C5AA 1HG0A 5WRFA 4WOPA 3QVLA 3Q2IA 1ZA2A 4AWBA 2JFNA 2ZDGA 4LFCB 2NU6A 1V5WA 3L2OB 1GG2A 2Y1GA 1Q0HA 3DR5A 1BMFD 2BFAA 3LP8A 3RS2A 5T6MA 4AJJA 3QF4B 3C3EA 4YR9A 5BW8A 5DNAA 4P3OA 1ORVA 4M1ZA 2YZMA 2V9ZA 4ZRMA 2X0JA 1Q3TA 1W5SA 1UR5A 2OHJA 1BS9A 4OQNA 4B09A 4DPKA 5EHZA 1KJIA 3EE6A 5I7FA 1DB3A 1EJ2A 1KQPA 2QX4A 5A03A 4E08A 1ZIXA 1WVMA 4FZVA 3PCTA 2JAHA 5CDTA 2A0FA 2R6DA 2HSDA 4YV2A 1DC6A 3GF4A 2ZRAA 4X7MA 1KRWA 3H5AA 1UT6A 2DTXA 4X6XA 1KFBB 4AUEA 3Q0EA 3FGPA 1P2BA 1JJIA 2EGHA 1YH3A 1JW9B 3KHKA 4NICA 4F38A 3EXG1 3OBBA 3WC4A 1JWAB 3U44A 4ND8A 1BW9B 2AYZA 5J4HA 1RSZA 1QYWA 3PE3A 1YUBA 4FYMA 4TMZA 2XRZA 4RAQA 1WDLA 2O8NA 3M1AA 4KPUA 2W6CX 2QENA 3JZIA 1PT8A 4NOLA 4D0NA 1H5UA 1W59A 3DHYA 1U5CA 3IAEA 5ENZA 4BO3A 4CR7A 2JA2A 1IMJA 3IUYA 4V03A 1H8EA 3VPSA 5HNKA 2IE0A 3DHNA 2V1UA 4XJSA 2VJDA 1WETA 3L1IA 1ZL2A 2OCGA 3C4QA 4JI8B 2F48A 2MSCB 1WRBA 2ZJ0A 1SQSA 2I7VA 3HUEA 1YR2A 2R6AA 1I2MA 1MG0A 4JBWA 4B5LA 3ZY6A 5DF1A 2AFHB 2NT3A 2ZI9A 1W0CA 3A6LA 3LS2A 4R2JA 3HRIA 1PEDA 1JQKA 3M6VA 1GGNA 2VEOA 3TCKA 2RCNA 3DHVA 1KIFA 5TR9A 1WAMA 1C0EA 3B1ZA 2DUWA 1K8XB 3T3HA 5I8PA 1QC5B 3OD1A 4CMBA 5JS2A 1ZNQO 3PJRA 4V0RA 4OJYA 5LB4A 1UKZA 5BQPA 4AIRA 2BISA 3HDVA 1YD7A 2NPOA 1P6QA 4P7GA 1P80A 5DDIP 6AT1A 4I4LA 2N42A 4O29A 3VYVA 4TV8F 5KVAA 2FOXA 4KUEA 4OUDA 4ZT4A 5C32A 721PA 2O7RA 4BNZA 1U7XA 2JD2A 2ZZMA 3T12A 2DMRA 2I7CA 4CTKA 4X1KB 3I05A 3UJNA 2PL5A 5CJPA 3FMVA 1QV7A 5AVRA 4AJ9A 4P84A 3K0AA 1IY8A 4O2AF 3TDKA 2GF2A 5KTPA 1E1DA 3GXBA 3L07A 4IIGA 5LB2A 4Z6KA 5I4CA 4RHFA 4LSGA 4Q39A 3FNGA 2IL1A 4N6NA 5H16A 3S28A 3V4RA 4HP8A 1J21A 3PICA 4GW3A 3VHXB 2C4VA 1ZW1A 2F17A 2Q2QA 4YT4A 1FPMA 3IOYA 3NFRA 1TYEB 2PZAA 2WK1A 4K9DA 4RH0A 1SA0B 2GK6A 2UXDB 4INAA 1OBOA 2OGUA 4RA9A 1FFSA 3I2GA 1M6VA 4ZQFA 3WMEA 5IN4A 3C48A 4KUHA 2B36A 2WLSA 4JP1A 3ZNQA 1PYOA 1S3IA 4HH0A 4D9IA 5LN1A 3ZD6A 2IF2A 5KTRA 4CL2A 1HE8B 3I5YA 1YQWA 2DETA 5DISB 4CDRA 2XKJE 4I4CA 4Y0NA 4BP1A 5JQWA 4F5DA 1T5IA 4KWTA 1H2FA 3A1TA 4DR1B 4F9EA 1ZJJA 1U9IC 4LJ6A 5H59A 3H4IA 3RRBA 5I7WA 5AW4A 3RAEC 1VRWA 3TBHA 4RLQA 5DW3A 3P0IA 4Y2RA 3A31A 2H4HA 3H13A 3H2HA 4MKXA 4QUAA 5JCPA 3L1KA 1R6BX 5P8WA 4IKPA 2CKMA 1MJHA 1ZJ5A 1NNEA 1NE7A 4NNJA 1XZLA 4NYJR 3PXBA 3OEED 3HWX1 4LWZA 2YS7A 4NOKA 4RLSA 2VNJA 1Z56C 2ZYDA 4U8GA 3WGZA 4XWKA 2CNDA 5AHXA 4P3PA 4JH0A 2A9VA 1E99A 1F8YA 1TT5B 2GA9A 3GVPA 2DOKA 3M7IA 3O47A 5CVUA 4ARZA 3SGLA 1ZI8A 1K5DA 2VP9A 4LK3A 3GFGA 4WA8A 3IHWA 4QQNA 4F97A 5BN4A 4B8ZA 4U3JA 1L1RA 1Y98A 3HDJA 4L7QA 5KX5F 1PT6A 2CVPA 4WERA 3SDSA 1Z6AA 5JQGF 1HH4A 2W6JA 4KN9S 5BN5B 2RFLA 2FUG1 1E4EA 1OU4A 1SN7A 4J9UE 3BORA 4HZUB 4OGLA 1FQKA 2XUZA 2JIDA 2J5QA 2IDKA 4DGQA 1CKEA 4TS9A 1HXHA 2LIPA 4EHJA 2L69A 5K4GA 3GBVA 1CF4A 4A2PA 4A0HA 4I6JA 3UMGA 1IXSB 1OXTA 5GJCA 4UTPA 4RYDA 4AUMA 3TI9A 1OLOA 4RHEA 3IOMA 5IAJA 3IAM1 2G04A 4ALNA 4R9VA 4DLSA 2RI6A 3IVCA 4YCLA 4QDXA 4PANA 1ZN7A 4Q9HA 5I9SA 4EECA 1COZA 1MEOA 5AVKA 1Z37A 3UAWA 2WF5A 4FI3C 4AO7A 2BWJA 4ZMSA 3BDIA 2FP4B 5CFRA 1YR3A 2FUNB 3HU3A 5KVQA 1Q2XA 2RG7A 4WRRA 2HIAA 4G5OA 4Z7QB 4IQ4A 2G08A 2IZ1A 4DLXA 4TM7A 4ARBA 2WD9A 4PWYA 5ARCA 3VR6D 2RGGA 5L4NA 1PNQA 1H23A 1L6IA 3E58A 4M49A 4XQ0A 3VBCA 1NIPA 1ZN8A 2B82A 2ILTA 2QD1A 1U9CA 1GN8A 3PA8A 4FZ3A 5CPBA 4YRCA 2G82A 3ADCA 2QSZA 5CIWA 3EPJA 5FBVB 2LNDA 1B8VA 1VYTA 4ZOLF 1BEUB 1JEDA 3PDJA 3FVQA 5I8WA 5IT0A 3NPAA 1R5BA 4ZO9A 5IUKC 4ZI3A 3I9MA 3RYCA 1ECPA 4IIUA 3LBHA 3ENQA 4BU1A 5D86A 2OP1A 3L41A 4HR7A 2MJLA 4Y9SA 5AQEA 4B6QA 1WLSA 2PVPA 4G23A 4GLLA 1EIWA 2BEWB 3HB1A 4B17A 4BO0A 4C7OB 4JR1A 1T3GA 2FR8C 2MSLA 5EZYB 1D0SA 1M8GA 3BF7A 4OK6A 4TKUB 3HCWA 4Z9YA 4Z7OB 1RXIA 2P91A 3TH5A 3PFHA 2B83A 1FSFA 1AKUA 2RHMA 4KR2A 4P0QB 1TU4A 3I04M 5B6PA 4IO1A 1XDSA 2JARA 2V55B 1XZPA 1M34E 2J4FA 2HQSA