2W58A

Crystal structure of the dnai
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
188
Chain Sequence
KRQESLIQSMFMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAAIANELAKRNVSSLIVYVPELFRELKHSQTMNEKLDYIKKVPVLMLDDLGAESWVRDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQKVKAARIMERIRYLAYPIEITGPNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Interplay between the Replicative Helicase Dnac and its Loader Protein Dnai from Geobacillus Kaustophilus.
pubmed doi rcsb
source organism Geobacillus kaustophilus hta426
molecule tags Hydrolase
molecule keywords PRIMOSOME COMPONENT (HELICASE LOADER)
total genus 54
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01695 IstB_IS21 IstB-like ATP binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w58A01
3PQCA 1EFUA 4ON9A 3UMRA 4QRHA 2Q9BA 2DFKB 1VCMA 1P5ZB 3CBQA 4Q48A 4MYCA 3L8ZA 3H2YA 3K9NA 2PZGA 2PEZA 2ZIAA 4PSVA 3U61B 4B3XA 1JJ7A 1KK2A 4HUTA 1UEIA 1F5NA 3NG1A 3QVVA 4C0BA 2JLSA 3SQXA 4B3CA 5BYKA 2ASEA 4TTPA 4YMTA 2GZDA 1VHTA 1DAFA 4KBFA 4BFZA 1KAGA 4Q9JA 3HP1A 4HLDA 4NL4H 1HTWA 2RGNC 2RH5A 2Z5FA 4DEXA 4KVGA 3LRPA 5KYKA 1R5BA 4JSTA 1ZCAA 1YZUA 1ZVQA 2HLDD 3TVDA 3SBDA 2IYXA 1DOAA 1UDXA 2GNOA 5D3MB 2GJ9A 5KDLA 3TNFA 4PC6A 1IN7A 2XX3A 3ECCA 5J4HA 3U7GA 5CITA 2O8FB 1E2JA 2GXUA 1RRPA 1H8HA 4MGYR 1N5KA 2C9YA 4TLDA 5LD2C 1T9HA 4DRZA 4CT4B 5JJIA 2WWWA 2QENA 4MRSA 2H16A 4R2IA 5A5GA 2G77B 3RRNA 4XIGS 2AX4A 3AF3A 2YINC 2VP0A 1RYFA 4WAUA 1DELA 1I4LD 1OHHA 3JZMA 1P4SA 4I99A 4IXNA 3SJZA 2WWXA 1G18A 4PZZA 2JDIA 4C30A 2XJ9A 5FUYA 2ZR0A 5CM8B 3IIKA 5G41A 4XWAA 1AK2A 1P9WA 1F48A 2J41A 1W1WA 3AKYA 2OHFA 1G6OA 3BH7A 4MYUA 3R7WA 4E03A 2F9LA 4PHTA 3O8BA 1JPJA 4DDUA 3M4YA 4NYIQ 3M1IA 4D81A 4F7WA 1KO7A 1ZBDA 2ZE6A 3AF1A 3BK7A 1ZNZA 3MMPA 1HT1E 4GI7A 2ZRCA 4KV9A 4HLUA 3WHLA 2J46A 2QBYB 5KDDA 3GLHA 5J40A 4CW7A 2Q21A 3TLXA 2BM0A 4LPSA 5CIQA 5BYJA 1L7VC 4JLNA 2GBLA 3MCAA 1KDPA 2BMFA 2UVQA 1E1RD 2IWRA 4K81B 2YVUA 3PR1A 1TQ4A 4NMMA 3P20A 4NYIR 1IN5A 5FBLB 4UNPA 3KX2A 1QBKC 2NIPA 5KPDA 4UKDA 4B48A 4JL6A 1GUAA 4OI1A 3ADCA 1E9AA 1SHKA 4D25A 1TF5A 4HUQA 1N5LA 3RC3A 5CJPA 2H5EA 1AA9A 1EXMA 5D3MA 1QHXA 2DFTA 4MUAA 1T6NA 3AUXA 5H68A 2PH1A 2QMOA 3NBFA 4NPHA 5HR5A 3DHWC 3THOA 3FHOA 2R6GA 4OK3A 1VCNA 4ERNA 3ZVNA 5EXXA 4G5GA 2Q3FA 2JLRA 4YQFA 2D74A 3F0TA 1JEEA 3REGA 3IUYA 4JKIA 3GEHA 3NH6A 5E7JA 4RKFA 2G3YA 4QM6A 3DOFA 3K0CC 4IW3B 1XCMA 2YHSA 4JLDA 1ANKA 3K9LA 1N0WA 1YR9A 1VHLA 2WWHA 4IDPA 4P33A 5GADl 4UXIA 1TU3A 1OKKA 4U00A 4E5UA 5ELXA 3PEWA 4P4TA 5GJCA 4DKXA 3I5YA 1XB2A 4O2RA 3FKSD 1XJ0A 2QPAA 5BW8A 1BIFA 2OESA 2OSBA 1OSNA 3BIFA 4ZKDA 1IHUA 2IHYA 4DBLC 1BKDR 3A8TA 4PQFA 3ZD6A 1UDWA 3BXZA 2AWNA 3LQRA 4KFRA 2NPFA 3TR5A 1L4YA 3ZZUA 3B1YA 4CEJB 3G0HA 4FW9A 4MRRA 1GG2A 5FI1B 2O0HA 3QF4B 4R71A 1Z63A 1HE1C 3HU2A 3GPLA 1FW6A 3QXSA 1SXJC 1T3HA 4G5RA 4A8JC 4OHYA 5B64A 2FSFA 4Q9HA 1PUJA 3KUDA 4LYJA 1FFHA 1RJ9B 3OHMA 4JVSB 1NRJB 3OIYA 1T5IA 4PHHA 1X8KA 2F43A 5JLJA 3AVYA 5TV2A 3CX7A 2V1UA 2WPDD 3HU3A 2XXAB 1YZQA 2JAQA 4PSKA 4WA7A 4M9ZA 4AYTA 3FHTA 1CR4A 3AVPA 1KKMA 2ZJ5A 4YMSA 4IEIA 4C7OA 5AUOB 4PPQA 1IXZA 5CLQA 1S2MA 2VPPA 4DDTA 2QUZA 2R6DA 5AWFC 4HB4A 2EFCB 5E4FA 1P62B 3WNCA 4QG7A 2WSMA 3ADKA 1YE8A 1VECA 1TQDA 4FMDB 2DR3A 2E9SA 3C14C 4PZYA 2PT7A 2XTMA 1G3RA 3IQXA 2BDTA 2H1LA 4AWXA 4AKEA 4OJQA 1N0UA 1S1CA 1NMXA 1GWNA 2BBWA 4PSAA 4BEBA 1LF0A 3B1WA 4NH0A 2QU8A 1XPOA 1VCIA 1ONBA 1SKYE 1ZM2A 3CWZA 4LYHA 5FBQB 3SNHA 1G64A 4IJMA 4MRVA 4L9SA 1G5TA 4Z1MA 1XNJA 2QM7A 2W2TA 5BN5A 4FCTA 5K8LA 5LBIA 1DAIA 2FSHA 2VTKA 1CJKC 1MABB 3BJIC 1A2KC 4Q9KA 5JCZA 3CH4B 3PEUA 1XD2B 3RSOA 4DLTA 3Q7QA 2PCLA 3TSZA 4Q9LA 4C3ZA 2PLRA 1OJLA 1Z28A 1N5JA 2RKOA 2IUSA 4NYJQ 4A2WA 3EPJA 5KHOC 1AQUA 1CS4C 3I73A 3QPVA 4TYWA 1GIAA 1AGRA 3R9IA 4US1R 4Q1DA 3K70C 3C16C 1E0AA 3THXA 3IBGA 4DSNA 1I4DD 4GL2A 4C0AC 4BGDA 5KPJA 4KLZA 4NYJR 5AJZA 1OKKD 4OHZA 1W46A 5JRJA 3U7EB 2E1RA 4Z8YA 4OQNA 5SZKB 3SE0A 2XJ4A 2IF0A 5AUPB 5EE3A 1E2GA 4QFMA 2WTUA 1W2GA 4XJXA 4V0NA 1E4VA 3W3AA 1JAIA 3K70D 4I1OA 2JIZD 1NLFA 1X1SA 4Q4HB 4UJ5A 3LX5A 3WBJA 3QEOA 3GLFB 2Z0MA 5DO9A 2I1VB 4LHXA 2GK6A 3B60A 2ZXUA 2GVDC 4RFSA 3AKCA 2BM1A 1KI2A 3DEFA 1IM2A 1LNZA 1QHIA 2GF9A 3CR7A 4URWR 5EP4A 5FUXA 3QXCA 1T91A 4IFBA 1G5PA 2EWWA 2YC2C 5B2ZA 6Q21A 1VIYA 4KO8A 2QL6A 4RZXA 3K1JA 1TAGA 1JPNA 4OHVA 1P9RA 2RGBA 1E2NA 3QBVA 4JJKA 1JJVA 1I2MA 1L4UA 2ZI6A 1E2HA 2BMDA 4B43A 3KQNA 2MSDB 3DM9B 3U7FB 3ZVMA 1OPXA 3KJHA 3KQLA 2CK3A 1XXHB 4A6PA 4GSYA 4IDNA 3VHXA 2ZJ8A 2OT3B 2ZUDA 2QAGC 2F1JA 3EA0A 2IXGA 3Q72A 3UMSA 1PV4A 2CCGA 4RCYA 3KXKA 4RSGA 2LCFA 3LW8A 4C7OB 2ZSEA 1G7RA 1OH6A 4TQAA 1KI8A 2JLYA 4BECA 2WMOB 1M1YE 3IO3A 2MMCA 1Q3TA 1CJTC 4WVFA 2OCAA 1BMFA 1W36C 1F6BA 4YXWD 3GEEA 4FXPA 4WBSA 3ZVRA 3U44B 1W4CA 1CLUA 1KI9A 3MSXA 4XD7A 3OFNA 2ONJA 2KB0A 2XITA 1OXUA 1EG7A 2ZI7A 1G3MA 3I5XA 3CH5A 1XD8A 1P2VA 1U90A 1G3QA 1P72A 3QG1A 1VG9B 1S9HA 4PR0A 3PJRA 2CNWA 3LBNA 1MRNA 2ZS7A 4Z1MD 3I1FA 4BZQA 4CVNA 1Q1QA 4YMUA 2QGZA 5H8WA 4BFUA 1R2QA 4LJ8A 3X2SA 5L3QA 3DL0A 2ZE8A 1UAAA 2QT0A 4AC9A 1E2EA 3U6BA 4LDJA 3GCGA 4KBGA 4Q1AA 4D0GA 3MUFA 5KSOA 4AG6A 2XGJA 1GZSA 1Q1BA 4LYFA 5B58C 1AJEA 1P61B 1NBME 1JAHA 4J0QA 5EXPA 3IDQA 4Q7LA 4QGFA 5JHHB 2NO9A 2VSOA 3KDSE 3NBXX 2OCBA 1US8B 1CJMA 1K8RA 2ZETA 2ZYWX 3VAAA 4YLGA 1VYVA 2QE7A 3U5ZB 1E0JA 4MUBA 3VR5A 5SZJA 4BLOA 5EE1A 3QF4A 1K5DA 4MYTA 3B1XA 4PO9A 2QPTA 2O0JA 4ZO4A 4I4LA 3N5CA 1SVIA 1S8FA 4KHZA 1E2LA 1U0JA 2JJ8A 1X6VA 2ZU6A 1Y63A 2RGGA 4XH9B 1R0WA 2AHOA 4L5BA 3GJ5A 1VG8A 1GAJA 1OXVA 2BKUA 3LD9A 4PQYA 4QGGA 3VMFA 2W58A 5FH9A 3RS3A 3RVBA 5CB8A 1ZRHA 1II8B 2JA1A 2WIBA 1Z0JA 1GSIA 1HEIA 2AK2A 2ZRFA 1W7AA 1VG1A 1SVKA 3KL4A 1KO8A 1FQJA 3TKLA 3FGNA 3PENA 1NKTA 2ODWA 3TE6A 5K8TA 4Q02A 4JL5A 3NEJA 1HURA 4IRUB 4PC7A 4UNNA 1XTQA 3ZS9A 2ZJAA 2OEPA 1J7KA 2R6AA 1W36B 3DOEA 2H57A 4P4SA 5EUMA 1XBTA 1ZIPA 3AH8A 4HATA 1Z0AA 1SGWA 2Z6VA 1RRGA 3BD9A 2QROA 4RJLA 3T12A 1KO5A 3LAWA 2R6CA 3KKPA 1IJFA 3T34A 1WF3A 1UKEA 1EFCA 3UWOA 4OHXA 4PXAA 4XWKA 3W3ZB 2ZPTX 2OAQ1 1NKSA 3QG5A 4TYYA 1T4GA 3GJ4A 1OIWA 2A30A 3WP1B 4EAQA 5IDVA 4D0LB 4KYIB 2QBYA 4CIDA 1XU4A 1NY6A 2QQ0A 1IONA 1VG0B 4U5XA 4G5SA 4WIAA 1JI0A 3QKRB 1M7BA 2J45A 2FEMA 4M0LA 4B74A 1DO2A 5KNDA 4B6FA 2A5YB 1Q1EA 1NIJA 1G6HA 1G8FA 1TQ6A 2V54A 3FMPB 5HZHA 1U9IC 3D7MA 2J9RA 3S1AB 5J4YA 1P75A 4M22A 1RRCA 1FX0A 4G5OA 4U02A 2D7CA 2P5SA 5JZVA 3B1ZA 5DLQC 3A58B 1XFAA 2YOHA 1OYWA 1KSJA 2CCJA 2W6JD 1BH2A 3HYTA 2FX3A 4A2QA 3EX7C 1DPFA 1NI3A 2IYWA 2ODBA 5JS8A 4URXR 4JJZA 2F6RA 4EPRA 4NONA 2GHIA 2BVNA 2IK8A 1W44A 2IYZA 2VHUA 2WPDA 4DWJA 2CCKA 2CVHA 4LV5B 4LYAA 1KZ7B 2D2EA 2Q0HA 4JVNA 4IOMA 4G01B 3WYFA 1GNRA 3EIQA 5J4VA 1A4RA 3DDCA 3DKPA 1FUUA 1U81A 1XEXA 2VIIA 2ZRMA 3D8BA 2ZSBA 2EU8A 3NTUA 4GNKA 2VHCA 5DISB 2VP9A 4B2PA 2GAAA 1GNPA 3DZDA 3VKHA 1AGPA 2REBA 3CNOA 4RVCA 1FMLA 4HB3A 1A1VA 1XJCA 2GXSA 2OFWA 2DHRA 3A1WA 1F2TA 2HJVA 2N46A 2P6UA 5KO2A 3BB4A 1E9CA 5IK2A 3V4FA 4BFXA 4JLJA 4QKQA 1KO4A 2ZJBA 5J4LA 4A8JA 4M8NE 2C9OA 1WBDA 1KO1A 2DYKA 2CJWB 5FTMA 3R8FA 4IOLA 3KB1A 1II9A 2FE4A 1CJVC 3CPHA 5C2JB 1G7TA 1KSFX 1ZM4A 2WSSA 2JATA 1P3JA 4F91B 1NVXQ 3WP0A 4OI2A 2YJTD 4B6EA 3NIBA 3GFPA 2V8OA 4E09A 1XPUA 1B0UA 4KLNA 4NCIA 4O0MA 4EJSC 1OFIA 3O8RA 1NMYA 4Q1BA 5FPTA 4Q7KA 4ZCIA 1IJEA 3GP8A 4AYWA 3RS7A 1U0LA 2F9MA 2CHVA 3BGWA 1G4UR 3GLHB 4LY6A 4ARZA 2NZ8A 3K0EA 4CDGA 2C03A 2ODEA 2Z83A 5EXSA 2RGAA 2PX3A 4D26A 5J4KA 3MAAC 3GLGB 1E1QD 2FPMA 1UBFA 3A1TA 3AV0B 3L0SA 4M9QA 2WSSD 2EFGA 2G0TA 1LV7A 1NN3A 3P26A 4N3NA 4QBIA 3VU9A 2L0XA 3A6PC 3TQCA 2O8CA 3BFKA 1UEJA 4QJ3A 5F9HA 5JI3E 4O3MA 1N6NA 4DHEA 4DIDA 2IS6A 4TMZA 2ATXA 3I3SR 2JEOA 2P3SA 3KQUA 2CL7X 3TUIC 3CRW1 1RVDA 4GFDA 3ZS8A 2O8EA 1N6LA 2QEQA 1A2BA 4D82A 1MO4A 1EWRA 1QHSA 2IBMA 1JR3D 2W0SA 4TLEA 4CT5A 2OXRA 3U6KA 3TJZA 3TQFA 4L8GA 3A1UA 4HZUA 3LWNA 1ESNA 4PC1A 4MDEA 3EPHA 4GP6A 4DCVA 1Q22A 4F38A 1U0HC 1X3SA 3NBYC 4OYHA 4B3GA 1PZNA 4LBWA 1G17A 1NN0A 3C5CA 1CKEA 5DYIA 3MGCA 5DIFA 5K8UA 3SZRA 3BERA 4HLUC 4Q03A 1N3BA 4Q9IA 1SXJE 3VNUA 3CX6A 1FP6A 3KTAA 3OE7A 4C2UA 4KU4A 3RYTC 1XZQA 4UJ3A 1LB1B 1F3OA 2ZITA 3T15A 3A37A 2REXB 2FEOA 1CTQA 1KK3A 1W0KA 2NO6A 3ZJYA 3IKJA 2D06A 4KFSA 3B13B 2Z4SA 3GJ3A 2AK3A 4OHWA 5KSPA 2B21A 3DO6A 4IKEA 1N6OA 4M9XA 1TF7A 5KU1A 1E32A 3UMFA 3C5HA 2VQSA 3LV8A 1C9KA 3HU1A 2ZS9A 1AZSC 4KITB 2IC5A 1E1QA 4DVGA 3UANA 4GZMA 1Z0DA 1ZIOA 4LZZA 4PX9A 3GLIE 4LJ7A 1GKUB 1EFHA 3T06B 3RLFA 3T35A 3RC8A 5AUQA 3U3MA 3FKQA 2A78A 4M1MA 4X8HA 2CE7A 3SOPA 4A0GA 1QHGA 2AKYA 4PAQA 2JGNA 5FOVA 1Z83A 2ORIA 2QAGB 1IQPA 3T61A 2ZJYA 4BRUA 4PPGA 3B6EA 1YZTA 2V6JA 1V5WA 3VHLB 3ZGXA 4F4JA 1OFHA 3LA6A 5JEDA 4EDHA 1FNNA 4TMXA 3AP3A 1FP7A 1Z06A 2QQEA 1COWD 1OW3B 4OQXA 1GKIA 4LUCA 3TRFA 5C1BA 2J0SA 4BQSA 4DLUA 2H92A 1JR3A 3AF2A 3MWJA 1DAEA 5AJYA 4II7A 4XD7D 1R8SA 5E7IA 4Q4HA 1GRQA 1TQ2A 2FPLA 4DJTA 5L3SB 2KWIA 2ZE7A 3ZDQA 4RD3A 4RD1A 1QHNA 4HEJA 4OQMA 2NQ2C 2XOKD 2X19A 2I4IA 1UKYA 1LFDB 1VCOA 4DT1A 4EQ6A 4N0DA 3L0IB 2GKSA 1G3IA 1GTVA 4G3XA 1HQCA 1Z2AA 2Q9AA 4MITA 1KJYA 3CO5A 3LW7A 3KFVA 4XSHA 4URYR 3BWDD 1F2TB 2F1RA 2JLVA 1R5OA 2IYSA 4BRWA 2GK7A 4DXAA 4LV8B 4AKIA 2FPKA 4TT3D 3IHWA 4HZUB 3EZ7A 1PJRA 1UBGA 3NHAA 1SKQA 2HEIA 3PUWA 3QY0A 3CKLA 2WV9A 3IPXA 1YZGA 3GJ7A 4LHYA 3U3OA 2FZLA 1M7GA 2FMXA 2R65A 2ZREA 4TWZA 3VFDA 1A82A 2EYQA 3B78A 2WKPA 3W6NA 4CEIA 2QN6A 3K0AB 1RFLA 4MA4A 3IIMA 1H8EA 1NIPA 4A82A 3Q8XB 4OK6A 1W0JA 2ZUBA 2ZVPX 1X8LA 2XNDA 4JLPA 1JBKA 1RE0A 1AIPA 1S1MA 3AVXA 2QE7D 2ZI9A 4RD6A 3GFOA 2PCJA 3SQWA 1Z47A 4B75A 5JCPA 1LW7A 1QHHB 4I1UA 1R5NA 4C0SA 3H4MA 3WYGA 3QI2A 5SZHB 1CR2A 4AURA 5CB6A 2IS4A 4ZI3A 3CWQA 1UFQA 4GMXA 3UKDA 2JASA 2OXCA 2ZSDA 4HAVA 1AQYA 2N42A 2LWIA 1SKYB 4IOJA 1W36D 3ZLJA 4HAWA 4FMCF 5GJWC 4ARZB 1OV4A 2PMKA 3NDBB 2ERXA 4PO8A 4X8MA 1W49A 5IF9A 1XTKA 2HXSA 2NTYC 3G82C 1D2EA 1XTSA 4Q5IA 3QKSB 3W8RA 2ANBA 5EJEA 3OFND 4YONB 3C15C 1E9BA 5FBRB 4C0LA 1D2MA 1IAQA 2C99A 3ASYA 3LDAA 4OQLA 4ZIRA 3AVWA 4TL9A 5JSZB 1S9DA 2C5LA 1COWA 3O8DA 4ZI2A 5B57C 3KQKA 1AS3A 4TQ9A 3QEJA 1JXMA 3AEZA 4M2LA 5KNBA 2C98A 4JLMA 4NCKA 1T8TA 2VSFA 4AI6A 4BUJA 3LO5A 4MRPA 3N2IA 4PTLA 4TSFA 4DC9A 4MDFA 4KCGA 1KSGA 2R8RA 3NKVA 2KE5A 2D62A 1HE8B 1E96A 1R8QA 2IL1A 4TYQA 2P2LA 4ZPXA 4ASUA 4FI3C 5DYGA 3RWOA 4BASA 2P0EA 4KYUA 4NCJA 2W2XA 1LTQA 3D3QA 3LVQE 3FOZA 3MLEA 5HCNA 2FSIA 1E99A 1XCGB 2QZ4A 1RKBA 4C4PA 1E3MA 1YQTA 5DSZA 1SXJA 1XDBA 4BFWA 1JQLB 1CR1A 1R0YA 1T0HB 1ZMXA 5FFMA 3PEYA 4OI0A 3LH5A 4M21A 3K53A 2XB2A 2Q3MA 5TY0A 1NVWQ 2ZRBA 3ZH9B 4V0OA 1P2UA 621PA 1US8A 1ZC3A 1G8YA 1ZCBA 4IXMA 3CF2A 4A0RA 4ASUD 3TAHA 4JYCA 3KZ1E 3E2IA 4DLSA 2VHQA 4C0JA 5KSYA 1NJGA 1GOTA 2WAYA 1E2QA 1P9NA 1G21E 1ZP6A 2FG5A 4QHTA 2IX3A 1ZW6A 3OIWA 2X2FA 2ZYUX 1R6BX 4TLCA 5A0FA 2Z43A 4TZ6A 4RKEA 4Z51A 5AJWA 1W5SA 5FPHA 3TAUA 3CF6R 1DAMA 2GF0A 4H9GA 3X1WA 5FOSA 4B47A 1QZXA 2AD5A 1A5TA 3QKUA 4P4UA 4GRAA 3SFZA 4PHGA 1IXSB 4M53A 1VDZA 4QJ5A 4FMBB 4KSCA 3DMDA 2J5XA 4W7SA 3FWYA 4KFTA 2CHQA 1GKYA 2QG6A 3SFVA 3CM0A 5JWHA 2A5JA 1SVWA 2CBZA 2VA8A 3W6OA 1OFUX 2GILA 4KFUA 4YMVA 3PFIA 1QVAA 1NN5A 2ZEJA 5DN6A 2GVZC 3GLIA 3D31A 1X1RA 2Z4RA 3PITA 2PJRA 4LRWA 2MMGA 4A92A 4JS0A 1Q12A 3NEYA 3THYB 1SZPA 1TF2A 1W48A 1ZINA 3H84A 3L0PA 4X8OA 5CJ2A 4HUQB 4EFLA 4PPFA 3AVVA 3MRSA 4BFTA 1U8YA 3A36A 2R44A 5EXTA 1KY3A 4LBZA 3EC1A 2XOKA 1XPRA 1YR8A 2P67A 2ZJZA 3BOSA 5KDOA 2WJVA 2F7SA 2QGNA 4QGAA 1OH8A 2WWIA 5JSZA 1EFTA 2FGJA 1IOZA 2DWPA 3F3YA 2AFIE 1MR3F 2BBOA 2ZU0C 4TSFD 4Q7MB 3RAPR 1CEEA 3A1VA 3IPYA 1M2OB 2XNSA 3CRQA 1ZU4A 4ZDJA 4JBYA 2ZRDA 3FMIA 4QGHA 4TL6A 5BXQC 1J2JA 1DE0A 2W00A 3AVTA 2BWJA 4OI4A 3GJ6A 2ZYVX 3K0CA 4Y0AA 5TDHA 2J3EA 2PT5A 3AVUA 1I2DA 3JVUA 4IDHA 1CF4A 2BV3A 4B71A 3NXSA 3P1JA 4P3YA 1GL6A 1T3LA 1G5RA 1CJUC 4M4SA 3AVQA 1GILA 3QF7A 2QM8A 3QQ5A 1HA3A 1Z6XA 2IS1A 3PV0A 4AKGA 3IILA 4V0ME 1NNEA 4IDQA 3S1AA 1OHHD 4WOPA 3GLFE 2BOVA 2C8VA 1P2SA 2EVWX 4XVUA 1HY3A 3B9PA 3TMKA 1K5GA 3RABA 4DCSA 4BWYA 1YRAA 3U3RA 2J0QA 1IN8A 4QM7A 3MFYA 4FMDF 4BPBA 1KI7A 2FFAA 4DSOA 4LPKA 1UJ2A 4QJ4A 2F55A 4G5QA 4GOJA 5CK4A 3BBPA 1CXZA 1UBCA 4F92B 2WWFA 1G7CA 1N6PA 5LDDC 3KQHA 2CXXA 1DG3A 4ZKEA 5JWOA 5KTYA 5LB4A 2IWHA 1M74A 1TPZA 2HF8A 2NZJA 3UIEA 4N1AA 4BZXA 2P5TB 2ZR7A 2C04A 2QSZA 1F2UB 2REOA 1SXJD 1KJWA 1VYUA 2OG2A 1WRBA 3IEUA 3E5HA 2ZROA 3SHFA 2SHKA 2WHXA 4JT4A 4W5HA 1QDEA 5E7MA 3T1OA 1Z6GA 3CRRA 3QKSA 1YR6A 2ANCA 3K0FA 3HR7A 3EWAA 4NTZA 1HV8A 4GDFA 3HPRA 2XZOA 1XRJA 4H1VA 3U4QA 2P6NA 2ZRGA 1NMZA 4WXPA 2BJVA 4TMWA 4BFSA 1FPMA 2GJSA 1XMSA 2ZI4A 2V9PA 1JXOA 3A4MA 3NVAA 1OE0A 3FKSA 2O8BB 1O3YA 2NO0A 4NCHA 3SDZA 1KAOA 1OXTA 1AS2A 1XMIA 1XMJA 2J7PD 1S4QA 1BO6A 4YXWA 2IT1A 2C9CA 5FTLA 1JR6A 2O5VA 2BMEA 3JVVA 1RJ9A 5FOTA 1LS1A 3AGPA 4M1SA 2R6FA 1LVGA 3UPUA 1OH7A 2FGKA 4LC1A 3F8TA 4L15A 4TQUS 3P4YA 3D6TB 1W47A 3L8YA 1FOEB 2BKEA 4Z8XA 1KYIA 4ESHA 1N6RA 2ZRLA 5CYPA 4IVQA 3QPUA 4URVR 3R9WA 3W6PA 3KKMA 2IYRA 4K8OA 3UK6A 4I1VA 1EK0A 2XSZD 4MH0R 4XWOA 5DE3A 3KUCA 3CPEA 1QHYA 2VP2A 4US2R 1XWIA 2O8DA 4HB0A 4MKFA 3AM1A 1EESA 2QSYA 1CULC 2GCOA 1XD2A 3IQWA 4ACBA 821PA 1T3SA 1NVVQ 2OZEA 3VX3A 2G6BA 3GQBA 3BB1A 1Q0UA 2EFEB 4HYYA 3TW8B 4QHSA 4BLQA 3REFA 4N0EA 4TTQA 2FFBA 5L3RA 3QSYA 2F1IA 5BQ5A 1Y3AA 2RGEA 4RD2A 1XZPA 1OB2A 1E0SA 1DBSA 4LK2A 2K5UA 3QJYA 3EZ2A 3BS4A 5TMPA 1E2FA 4LHWA 4TTRA 3IGFA 3C7KA 3BH6A 2B7CA 4DZZA 2HYDA 1XTJA 3PIRA 3TSWA 2C95A 4JT2A 1MRSA 1U98A 3I4LA 5FL7A 3I32A 4A0FA 4FIDA 3QKTA 2V4ZA 2VH5R 5IT5A 4DDWA 3LFUA 2NO7A 2ZANA 5EP3A 4TN1A 2XAUA 2BEKA 1E0KA 8OHMA 4IVRA 3TGPA 4OKSA 4C9BA 3EARA 1C1YA 3TUJC 1X86B 1J90A 1WP9A 3CZPA 2KBFA 2PJZA 2J0VA 4CEHA 2YOFA 3QXXA 2IA5A 2OM2A 3VR6A 4TYPA 1IY0A 5DH9A 2V55B 1YZKA 4MKGA 2AXNA 5HKKA 3EAQA 4LC0A 5HE9A 5JBQA 1DTSA 2FA9A 2PX0A 5L3QB 4JMPA 3OIVA 2OAP1 4LGMA 4Q66C 1OXSC 1GP2A 3Q9LA 4JKYA 1UPTA 2JDID 2BBSA 3LBIA 5LD2B 2JIZA 3HDTA 2QMEA 2YKGA 4X8LA 2H18A 2J87A 1FTSA 1KOFA 5IRCD 2XZLA 3CUEF 4UXHA 4WZAE 4RZ2A 5AR1A 2F3RA 2WAXA 1SVMA 2DWQA 2X1VA 3DZ8A 3K0FB 2V7QA 3AP2A 4IFEA 1NVUQ 1T5LA 2OCYC 1XXHE 3GLGA 4JBXA 3ZD7A 2QAGA 1ZUIA 2H8KA 3RWMB 4A2PA 1N5IA 2EWVA 2DY1A 3CZQA 2ZI5A 5AJXA 5EE0A 2LKCA 3P27A 4IHQA 3R20A 4PQRA 4MRNA 5CDFE 2WOOA 4HZIA 1F60A 1FL9A 2WKRA 3IBYA 1WCV1 1E1RA 1KGDA 3Q7PA 3QOFA 4GOKA 4W5JA 3BC1A 3O8CA 3ICQB 2HDNB 3THWA 4RD0A 2ZI3A 3SJCA 4EPXA 3DM5A 2EYUA 1KDTA 2BJWA 4JIMA 1YJ5A 1ZD1A 3EPLA 1Z5ZA 2WWGA 4Q4JA 3B2EA 1VMAA 1Z08A 4Q47A 4QNRA 1W0KD 2O8DB 4Q4LA 2B6HA 1SVLA 4D4MA 1Z8FA 3G5UA 4RZUA 1U99A 5DI3B 3I92A 2XTNA 1YZNA 5HTKA 1HT2E 1ZNYA 3FVQA 5CK5A 3SI7A 4NCNA 3PVSA 1ZAKA 3P32A 4D4KA 3FMOB 3PXGA 2WKQA 4Q1CA 2YWEA 1PLKA 5IHPA 4I81A 2QY9A 3LXXA 1ZNXA 1W4AA 1PVOA 1M34E 2DPXA 3TK1A 1SVSA 3IO5A 4JBWA 5DGXA 4DCUA 2ZYTX 2JJ2D 1DVRA 3EWSA 1CR0A 1ODFA 3VTKA 2BC9A 2ZS8A 3ONWA 3DPUA 1RIFA 5E95A 1XEXB 2RAPA 3I72A 4A8JB 5JWRA 2ZRHA 3K09C 4AKHA 1ZM3A 3U7HB 3B1VA 2Q9CA 1YZLA 5BN3A 2EFDB 1XF9A 5KOYA 3MG9A 2XZPA 2D3WA 4PC3A 5JHGB 4LJ6A 1IN6A 1J99A 3A4LA 3QNUA 4NDZA 3THXB 2D2FA 2GJAA 5G53C 4ACAA 4B33A 2GCPA 2QTHA 1N6HA 2XB4A 2ZRPA 2OBNA 5J5CA 3RDPA 4TMTA 2ORWA 3BH0A 3LLMA 3GFTA 4HDQB 2O8FA 1QF9A 2CVFA 1NN1A 1D6JA 2A5GA 3MWYW 5FPSA 3AF0A 421PA 1XCPA 2WM9B 5CDFA 4ZCLA 1UKZA 4BLSA 4OQFA 3BAFA 1VTKA 2B92A 3TIFA 1Z07A 4M1OA 1DADA 1JNYA 1OT3A 1Z3IX 1KI3A 3K8YA 1TUIA 2HF9A 2ZAOA 3QVUA 5FBWB 1VPLA 5FBVB 1ZJ6A 1ZC4A 2VF7A 1T0JB 4V0KA 4D4LA 4Q4AB 3GJXC 2J59A 2IEYA 2YNMA 1OIXA 3SN6A 4D2IA 5EP1A 1CP2A 2W6JA 4M1KA 2QRNA 2FF7A 1G4AE 2QP4A 2H7VA 2GEDA 1FUKA 2BCJQ 2ZE5A 1GL9B 5G3ZA 4DSTA 3HJNA 5C4MA 1KMHA 3EA5A 5TB5A 1YVDA 3NDPA 1G41A 3ADBA 1U94A 2V1XA 4R2HA 1P7CA 3LY5A 2VLIA 4C0QC 1KI6A 3RRYA 1PUIA 2V6IA 1II8A 4ITRC 5GVRA 1KI4A 1WBBA 4B2IA 3AKDA 4AIIA 4KJZA 2OUKA 2ZJ2A 2FFHA 4HB2A 1AN0A 1XP8A 5BN4A 4KI0A 5G40A 4TL7A 2IW3A 1Z0KA 3L82B 4RFVA 5LB2A 5P21A 5TXGA 2RGXA 4K46A 1J70A 5E3HA 3GEIA 4PAMA 4W5WA 3W34A 1R7RA 4F93B 2JLXA 4QBFA 4LBYA 4NYMR 4A1FA 5CM9C 2ZR9A 4DLRA 4B3BA 1TADA 3WNBA 1FTNA 2ORVA 4LOAA 4IDOA 4CGZA 4LWZA 3SHWA 2CL6X 3CIOA 5TARA 4NE2A 5DI9A 4JYBA 3V00A 4MYHA 4AYXA 1NJFA 4P4SB 2F3TA 5CIWA 1HQYE 3ICEA 3F5FA 2PL3A 3CLVA 2JJ2A 2CHGA 1Z6AA 2QI9C 1HUQA 3OAAD 4A0HA 2KSQA 4JVMA 1H65A 3QE0A 3ZQJA 5H70A 3RS4A 2MSCB 2HJGA 1OLOA 2GJ8A 1JR3E 2KJQA 3U3JA 1CIPA 2FU5C 1EGAA 1Z29A 1PLLA 4YC7A 1Z2CA 1JQJC 5SZIA 2RMKA 3C4JA 5TVKA 3SYKA 3L2OB 3TUZC 3W9YA 2GZHA 2GRJA 2G88A 4QNMA 3WMGA 3FFAA 4MKIA 2W0MA 3KKNA 3N70A 4DLYA 4DSUA 2AN9A 1TEVA 2ERYA 1J8YF 3M6AA 4LI0A 1BS1A 2XEXA 3MD0A 4DB4A 2ZSAA 2FNAA 4GZLA 4XVQA 2GCNA 4L4UA 4ZIRB 3VKGA 1XX6A 1P6XA 2A5DA 2QP9X 2ZRJA 2ZSFA 4LJAA 4O2LA 1TU4A 3IHLA 4R7ZA 1OIVA 1Q21A 4HLCA 3A4NA 3B85A 3ZYCA 4FWTA 5JI2E 3IEVA 2CK3D 1UADA 2HT6A 5D3QA 3B9QA 2GCOB 3PUVA 1G3UA 1QG4A 4AK9A 2NOAA 3V4RA 2RB4A 4DB2A 3CB4A 3FB4A 2EFHB 2JJ1D 1E2MA 2VP6A 1RRFA 2HV8A 3CR8A 1OYYA 1H8ED 3CPJB 5CYOA 2HUPA 5EQTA 3L43A 4CF7A 1WMSA 3I61A 3I8XA 3SC3A 4LJ4A 1E69A 3GLHE 1N2CE 4DLZA 5JS7A 2VSXA 1TTTA 2YWHA 2GXAA 1ZUHA 2QNRA 4GBMA 3UG7A 4B44A 4EIWA 3AP1A 3AKEA 3HYRA 4OJKA 4TT3A 1U8ZA 1FZQA 5L3VA 3VNVA 3ND9A 3NH9A 3CRVA 1Z6TA 1AZTA 1JB1A 2A7QA 4JLKA 5HKKD 2BBTA 4WZ6A 4BFVA 4WW0A 3BFVA 2ZRIA 4OL0A 4IOKA 1DARA 2BEJA 2KBEA 1KDOA 1ZD8A 3LXRA 4KVAA 2IF2A 4DEYA 5BWMA 1MH1A 2VEDA 4US0R 3SYLA 4P32A 3PEVA 1R0ZA 1D9ZA 1W0JD 1W4RA 2GESA 4G0NA 1LS6A 4CEHB 1KDRA 1TUEA 3K70B 2HXYA 2NMVA 2PZEA 4EUNA 1KK1A 1D9XA 1YHNA 3FTQA 1M8PA 2GA8A 1G19A 1RZ3A 3KXIA 3W90A 1G9XA 2G9NA 5FL7D 2BIFA 3KB2A 5HZKA 3B8HA 3RS0A 1FMJA 2IYYA 2I1QA 3PUYA 2QMHA 2DBYA 1MO3A 4A6XA 4EKDA 5IK2D 1TX4B 3MJRA 4GMDA 1MABA 3BFXA 4P0TA 1ZNWA 3KJEA 4URUR 4BLRA 2B7BA 2ODNA 4B34A 4A4DA 3U44A 1IBRA 2P65A 2W6ID 1R4AA 4M9SA 4XTRA 5F3WB 3BE4A 2QTVB 1D8TA 2WWYA 5GJBA 3WY9A 2IYTA 2VF8A 4QBHA 1OFTA 2OE2A 1KSHA 3Q3JB 1E9RA 1NVVR 4Y0VA 4EJSA 2IUTA 1MOZA 4HAUA 5L8VA 2D7DA 1W5TA 3RANA 3SU8A 2VO1A 1ZM9A 1XEFA 1NSFA 2J0UB 3EZFA 4FD2A 4Q18A 3X1XA 3VR4A 2VYFA 2ZVQX 2IHBA 3UXMA 3EZ6A 2QMUA 1G1MA 1E9FA 3L0OA 4DT1B 2RGDA 4EQ6B 4LHVA 2X8AA 4FMCB 2HT1A 2N1BA 3RHFA 1F2UA 2VBCA 1H8HD 2Q6TA 3SYNA 2BMJA 2PZFA 3FDIA 1ZYUA 2YZ2A 1KKLA 4FCWA 1NF3A 4L16A 2EQBA 4JZKA 1MV5A 2JLUA 4XOIA 4XVRA 3VQTA 4B2LA 4S2EA 1Q3HA 2F43B 4CEJA 1MO5A 2FH5B 5GVSA 1XTRA 4MGZR 4Q00A 2O8BA 4O25A 3R8CA 2FSGA 4ZDKA 1GL7A 5C18A 3EZ9A 3RRZA 4D4JA 3M0EA 5AK0A 1YKSA 2J7PA 4A36A 5G3YA 4D6PA 3FPAA 3QBTA 3PUXA 4ZCMA 1OF1A 1HYQA 4CEIB 4RFSB 4HAXA 3X1ZA 4DUGD 1G8PA 2R9VA 3IIJA 2ZQ5A 2DFLA 5F98A 3DKVA 3DVLA 4QOSA 3WRYC 121PA 2AWOA 4KAXA 3E1SA 2IXFA 4PAOA 4DLXA 3NC1C 2ECKA 1VYTA 3GJ8A 1UM8A 1WB9A 4URZR 3EIHA 2NPIA 4TMVA 3ASZA 2PBRA 1DS6A 3KFXA 1V43A 4DDVA 3PG5A 2YC4C 4LV6A 3B7GA 3RS2A 3KJIA 4LHZA 5F2EA 2G83A 2OILA 3FFBA 3CNNA 4HDCA 1Q44A 1TNDA 2OO7A 3T5GA 3NC0C 4DCNA 2HYIC 3Q5DA 1E9SA 1N0VC 1QG2A 3EASA 3N2EA 1BYUA 3OIUA 4YDHB 3T5DA 3ZIAD 4DLWA 3PUZA 2W6IA 4L9WA 3ND8A 2YWGA 5FTJA 5KNCA 2J0UA 721PA 1S0UA 4PO1A 3RS5A 2MSEB 1IY1A 2DCUA 4LJ9A 1N6KA 1ZM7A 4RCZA 5FOUA 2WJYA 2NGRA 2WOJA 5JJKA 3T1QA 5FPKA 1E2IA 3ZZ0A 1DEKA 2J7KA 3VKWA 4GPTA 1KNQA 4UNQA 3FHCB 4PC2A 3NBZC 3BB3A 2QTFA 5JRZA 2D4HA 3AQ4A 2RHDA 4C0HA 3LVRE 2C78A 4BE7B 4TYNA 2PMDA 4D0NA 3VR2A 5A4JA 2FV8A 4AY2A 1L2TA 2A3RA 1JALA 2E87A 3CNLA 4C2TA 4Q21A 1L8QA 2FFQA 1QVRA 2GWHA 2DWOA 4XTCS 3TVTA 2XXAA 3SJAA 2WMNB 3RSLA 1DAHA 3I62A 4JLBA 1U9IA 2NG1A 3X1DA 1GFIA 2Q3HA 1Z22A 3R7WB 4NYMQ 2NO1A 3ETLA 1OXXK 2XNDD 1G8HA 4QL3A 2JLQA 4JL8A 3THYA 2R62A 2QRZA 4KXFB 1E9DA 3GMTA 1W2HA 2OBLA 2QPOA 2OV2A 1MKYA 4AD8A 4V02A 5K8IA 5DHFA 4S35A 4BLPA 3EPKA 3CRMA 1G7SA 1GVNB 1G16A 4M1YA 4I1SA 3K09A 1BOFA 2JCSA 3EC2A 2IEZA 2WJHA 1S96A 3EXAA 1SXJB 5KSZA 3SR0A 1EX6A 1RYHA 3P4XA 2CLDX 3H1TA 4V0MA 1ETUA 4NP6A 1RC8A 3ZZTA 2O0KA 4HSEA 2O52A 1XEWX 3QPWA 2O8EB 4B73A 4R98A 2EW1A 4M1WA 5JJLA 1UBEA 3W5IA 4EPYA 3I8SA 2CLCX 2RGNA 1OH5A 4LJ5A 1G8GA 2AD1A 2GXQA 2VHJA 4CRWB 4QHYA 2OCPA 2RGCA 2WJIA 1NBMA 2B8TA 1KK0A 1VKJA 5JEEA 3GLIB 2UKDA 2FOLA 3RRMA 1QRAA 1DG1G 2VL7A 4M1TA 2CDNA 2RCNA 4ESVA 1KMQA 4AG5A 1Z6YA 1KI6B 4ABYA 4Z54A 2BHRA 2Y8EA 5F9FA 1N25A 1FNMA 2XTZA 1KMHB 1KI1A 2C2HA 1IY2A 4Q19A 1NL3A 3QKRA 1Z0FA 1RPZA 3SS8A 1E6CA 4GP7A 2CE2X 5FOXA 1JECA 1TEXA 4E22A 2VP5A 1HH4A 3TSOA 3Q85A 2VRWA 4EPTA 2G1KA 3VX4A 4EFNA 3H86A 1FQKA 1KNXA 3W5JA 4Q1FA 2GEUA 3JZAA 3SJBA 1SQ5A 1UF9A 4FWIB 1GDDA 2H17A 4MQBA 4PZLA 1J8MF 1XTIA 1BYIA 1WA5A 2ZRAA 2OLKA 4YDSA 3FE2A 1P2TA 2DFNA 4RY2A 1M7HA 1NLZA 3EG5A 3R9XA 3U60B 1KJZA 3ZIAA 1G20E 5FL3A 1U2RA 1QHHA 3OEHD 4B3DA 4DCTA 5DI3A 2IYLD 4KSBA 4RZ3A 1JEDA 2WJGA 3OE7D 4JLAA 1MT0A 1NP6A 2CEAA 3CF0A 3WMFA 5FPYA 1NLYA 4WZBE 2ZRNA 1E79D 2GZAA 1SVOA 4PANA 3TBKA 2YV5A 4IVPA 1ZD9A 4YMWA 1CBUA 5JMTA 3KKQA 2CJWA 1G291 3J81k 4ZDIA 3QUSA 4OK5A 5AUNB 3O47A 1D5CA 2P6RA 2B8WA 4Q4AA 4A15A 1GITA 3B5JA 4NU0A 1ELOA 1ZUNB 4DUGA 4Q7JB 3LNCA 3C41J 4GOXA 4IEEA 1BMFD 4R9UC 1NG9A 3B82A 2G1JA 2ZAMA 4CZ2A 1CRPA 4QBGB 2WJJA 1AKEA 4V0LA 3GLFA 4DIEA 2GAOA 3LLUA 1TMKA 3X1YA 2PLFA 3AB3A 2WZQA 5L3SA 1KZGB 3WBKA 2CLSA 4NBSA 4Q4JB 3AGQA 1GRRA 1R10A 2DB3A 3LBHA 3QENA 2FN4A 2ZM5A 3H0KA 4JLOA 2QP3A 5H1YA 5HPYB 2WICA 4H1UA 4BZPA 1WQ1R 3U3KA 5UKDA 4E07A 5ANRB 1I4TD 1DAKA 1IXRC 3ZQ6A 2RHMA 3HPQA 4QC2A 2YYZA 3WMEA 1DAGA 3EW9A 4OBEA 5EUQB 1XMVA 4ZV4A 2ZRKA 1N6IA 1R0XA 1T8UA 4FCVA 2AFHE 4MGKR 3HR8A 5C46F 5FTKA 4Q1EA 1EWQA 2QA5A 1YRBA 3OAAA 2AKAB 3TH5A 1B23P 5DN6D 5JFGA 1KHTA 2A2ZA 2GJKA 3K9HA 4PFSA 5C4GB 3TW4A 5LPNA 1KTVA 1W4BA 4V03A 1OB5A 2PEYA 1O87A 3VR3A 2AXPA 4PHFA 4HAYA 5EE5B 2OFOA 1E4YA 3V9PA 5J47A 4BFYA 2TMKA 1GRNA 1Q20A 1SHZA 1CRQA 2UZ3A 2V7QD 2ZJOA 3WXMA 1KY2A 1VIAA 1WDTA 1P73A 3THWB 4D80A 1MO6A 5JECA 3KTAB 221PA 4WXRA 1C4OA 4UQOA 3KKOA 1AKYA 1TL7C 1X8JA 1XXHA 3GLGE 4FINA 5EE9A 3FYHA 5CLLA 4HLQB 5EP2A 521PA 4UNRA 2ZTSA 4TLAA 4MKHA 4DLVA 1NY5A 3C8UA 3EIEA 2OFXA 3CONA 3ADDA 3WNDA 3PCRB 4JSYA 5DNYB 2FJUA 3VU9B 2O8CB 1IN4A 3AF4A 2VHTA 4JVLA 3Q5EA 2IUUA 3QIAA 2CMKA 3GD7A 3GJ0A 3QXHA 4A9AA 4PPNA 3HWSA 3OEHA 4Q01A 2GEVA 2FDCA 3CW2A 1EFRA 3UWKA 1NBMD 1RW4A 2KI5A 1E94E 4TZ0A 4RD4A 3BRWD 3W8NA 2A9KA 3A1SA 2GDJA 3RNLA 3LX8A 4TMKA 3K0SA 2JLWA 1Q57A 1KIMA 2WVJA 2FWRA 2YWFA 2X77A 4JLVA 1LF5A 1ZU5A 2C77A 3AUYA 2QORA 4MGIR 5FOWA 2WIAA 4NKRA 4B76A 3WHKA 1M6NA 1UKVY 2WBLC 4QXAA 4P31A 5FI0B 3DMNA 4LSGA 1U8AA 3QXJA 2QAJA 4FN5A 5EZ5A 1SULA 1XJQA 3OESA 2LKDA 2I3BA 1YR7A 2OLJA 2JJ1A 2X2EA 2R2AA 1NG1A 2G0NA 3K0AA 5FTNA 2UZIR 3U4QB 3SBEA 1EX7A 1EFRD 1E2KA 3E70C 3OEEA 2IYUA 3KJGA 4C0KA 2YOGA 1S3GA 3T1TA 2IYVA 4BEJA 5HE8A 1PLJA 4B3FX 3FMFA 3ZVLA 5HCIA 2ZUCA 2QT1A 4GT1A 4F4CA 3AVOA 3KXLA 5FR2A 4POAA 2IXEA 1YU9A 1Q1ZA 2XSZA 3OEED 1WE2A 3WRXC 2J1LA 4BLTA 5GJVC 3WYAA 4TLBA 3NWJA 1E2DA 2HCJB 2GETA 3OF5A 2OBMA 1E79A 4UXJA 2C96A 4HI0E 2HCBA 1XEWY 3MWKA 1D2NA 3CX8A 3BORA 4NZYA 4HAZA 1K6MA 1DO0A 1E98A 4ILEA 4B32A 4EJSB 3LQQA 2IS2A 4LJYA 4LBVA 4TL8A 1AS0A 2FZ4A 5DHAA 4UNSA 3UG6A 2ONKA 3T1VA 4KODA 4XSGA 4W9MC 2ATVA 2BCGY 1FX0B 4CYMA 3SEAA 2V3CC 2F1HA 1GNQA 5FUWA 4EPWA 2CL0X 4G1UC 1E9EA 5EZ6B 4B35A 4ZDWA 2GBLC 1LY1A 2AR7A 2IYQA 4F4IA 4NHOA 3MWLA 1Z0IA 1GM5A 2JLZA 2W2VA 5FUVA 5FR1A 4LCBA 1CU1A 2A5FA 2AL7A 2W83A 3U2QA 1II0A 3NHBA 3VR1A 1XD9A 5M04A 2CNWD 5B30A 2VP4A 4HDOB 4EFMA 4EPVA 2GTPA 3OZXA 1ESMA 1AM4D 3MJHA 1WXQA 3K9GA 3UATA 4LX0A 1S3SA 3TR0A 1NSTA 1P60A 1A7JA 1E2PA 5KUTA 5AJVB 2HLDA 4U7DA
chains in the Genus database with same CATH superfamily
3PQCA 3D6JA 2QVZX 2IHTA 1LLUA 4NOMA 4J6FA 3DF7A 4AMVA 5CU7A 1S2GA 2AZDA 1Z26A 5ITWA 3T7RA 3KZNA 1QH8B 1U8EA 3IKTA 1A76A 3L8ZA 5ICGA 1IB6A 2PEZA 4GHWA 4LRUA 4PSVA 3U61B 1DP4A 1GTJ1 2WFZA 3GIDA 3HVKA 3PQ7A 2FW1A 5GOTA 3UUWA 4MWTA 1KK2A 4HUTA 1UEIA 4JI4B 3SQXA 2OQVA 1YRYE 1ZVMA 1QPBA 3K4HA 1VHTA 2F3QA 3EQ9A 1PL7A 1VJDA 4BGVA 1KAGA 2J3JA 4MUHA 1OXMA 3LOQA 4KQHA 4HLDA 4UE3S 4NL4H 2EBWA 5AKGA 1LFAA 1IB0A 3PE6A 4LSMA 4C6TA 4YAUA 1R5BA 4JSTA 1ZCAA 1FRNA 2HPAA 4PYKA 4EB0A 2HLDD 4N4AA 3SBDA 3V80A 3DV0A 1DOAA 2WTXA 2RONA 5D3MB 5KDLA 5BT9A 1E61A 1IN7A 4PC6A 4AW9A 5A5EA 5JPCA 5KNDH 2B8EA 3OMXA 5AM1A 1KYZA 4OMUA 5ES3A 5LD2C 1B8NA 3RRFA 4E6EA 1IK6A 1A7UA 1H1LA 4DDKA 1ZH4A 4G1MB 2GMWA 2RHHA 3FTEA 1YSCA 2G77B 3RRNA 2VXCA 1YGYA 2AX4A 2YINC 5D7NA 1RYFA 3E53A 2Q5OA 3H16A 4RVFA 4GE3A 3R6WA 4DS3A 3QV1A 1LDMA 1TJPB 3OG9A 1KQGA 1LLQA 2ZIGA 4YJ3F 5FUYA 3HFRA 3JD0A 3F4LA 4JD5A 1VBFA 2OHFA 2XW6A 4TROA 4E03A 3R7WA 2F9LA 1MQ9A 1QG0A 1Y8RA 2GAFA 1N2JA 3H9JA 3HCEA 5H02A 3Q8MA 3M4YA 2XYVA 2Z95A 1YJBA 4FVTA 5E6SB 4CM9A 1E4EA 2FWPA 1M1YA 3CMCO 1KO7A 1VKZA 2HU5A 3WJAA 3AQIA 1X70A 4OXNA 2I4MA 4FLEA 1BCSB 4C1NA 5KDDA 2AE2A 4CW7A 2W6ZA 3N53A 2B5WA 1VHJA 3HRHA 1FC0A 1UKAA 2E5WA 2PSFA 4TLMB 5CIQA 4ZYZA 1RYNA 5D5PA 4FS8A 4MVWA 3AERA 4PRLA 3EXIA 1GCOA 2IWRA 9MHTA 1IN5A 1CUYA 3HM2A 4DRXA 2VPTA 3TG2A 3OETA 3W9BA 2EP5A 2I66A 3Q88A 3HNOA 5F4BA 3VOAA 4F9GA 3J81A 3EXG1 4RULA 1JQAA 3WB9A 1TO2E 3OE4A 4G1BA 4EMBA 1E58A 2AGVA 2YV3A 4LRXA 4D25A 3U0BA 3M6LA 1BVHA 3W7AA 3OPYA 5CJPA 3KZCA 4NF2A 4XYLA 2A9JA 2DFTA 2YIMA 4FB4A 1T6NA 1U7TA 3NBFA 4L8VA 3DHWC 3NTLA 3THOA 4NBKA 1ZJ4A 4E13A 3ZVNA 4UHBA 3WRXA 4IO1A 1O77A 5BSRA 4YR9A 4WRRA 2FQYA 2EQ5A 3ILYA 2D74A 1CDDA 1NLUA 1KRWA 4JDUA 5DLDA 1DNPA 2TS1A 1QIDA 3N7AA 2J3QA 4JEUA 2G3YA 1WVIA 3K0CC 1J4AA 4QM6A 3H17A 1UT5A 2RH8A 3L8EA 4RWZA 4B3JA 5AIBA 821PA 1YR9A 4QEKA 1M2KA 1UFOA 3CR3C 2PGIA 2WWHA 3L6CA 4RF4A 5JQGA 3H5NA 1NR5A 1P4JA 1TU3A 1CZHA 1OKKA 1Z88A 3DKIA 4ZARA 2BHTA 2X7JA 3ZWAA 4E5UA 5C9ZA 3BRCA 1XB2A 2GNAA 3FKSD 1D2CA 1GU0A 5EWJA 4QPZA 3OLYA 1U7XA 1BWRA 1UFKA 1T9BA 4ZKDA 2NVUB 2BE9A 4DBLC 4CV3A 3SC6A 1L7PA 2HH9A 3W1VA 2EOAA 1RBQA 2NYRA 1PS8A 1UDWA 4E7OA 5CB4B 1LSSA 5EMHA 3ZZUA 5KYGA 4PNZA 4CEJB 3OQBA 3O90A 1GG2A 2OVBA 4MRRA 2VT6A 5CX4A 2O0HA 3TX6A 3RK4A 2MR6A 3PS9A 3P4UA 5JAIA 5A0VA 2FEPA 4GWGA 3ZU3A 1SXJC 1T3HA 7GPBA 2O2IA 1IVNA 3DD5A 3LCUA 2NADA 3D54D 2FSFA 1XRNA 5CCXA 3AM3A 1L5MA 1XMQB 1P33A 1RJ9B 1BDHA 4ZYYA 1CVLA 4IF4A 4JVSB 4AMBA 1BW9B 1S2LA 2ZUUA 3OIYA 3KPVA 1GFZA 1MQ8B 3GR6A 3CVJA 4C89A 2GM4A 3WO1A 1WCYA 1GZ5A 3C7DB 4Y2JA 2WY2D 4C4ZA 2G25A 2B20A 2X58A 3IL2A 3D9QX 4PHHA 4DZTA 4MYDA 3P9CA 3JQAD 2GFIA 1QK3A 2I6SA 3NWOA 4P7GA 5JLJA 1TXGA 1CR6A 2J33A 2VPZA 1TW3A 4H7JA 3E0XA 2ACKA 2G9QA 2Y76A 5CTAA 5F7ZA 3HU3A 5JD3A 5L6LB 2JAQA 5LXTB 3IKVA 2XXAB 1CJCA 4AYTA 3MT0A 1AKWA 4I4IA 2DTEA 5ALMA 1RP1A 1LQTA 3L1IA 3CLTC 2QE6A 4YMSA 5F78A 5HZMA 4XFJA 2PWZA 1QO9A 2I3AA 2GN4A 3I01A 4IX1A 2VPPA 3ZIDA 1YASA 2R6DA 4QXOA 2DFPA 2EFCB 3Q4GA 5BR4A 4C3UA 2H1VA 1YE3A 4YP6A 2X76A 5BUQA 5K1ZA 1FYFA 1C8KA 1GQ2A 1VECA 4R0NA 1ZJJA 4US0R 3ZBUA 3KETA 3C14C 4PZYA 4AWXA 2XTMA 1G3RA 5F1YA 1JR2A 2O3QA 1XVLA 4AKEA 4ENTA 1DRVA 1NMXA 1GWNA 2BBWA 2CD7A 3JQQA 3DOOA 4PSAA 2FSVC 3RD5A 4EJMA 1E77A 2FN9A 5IAEA 3CTMA 3OFVA 1XPOA 2XCIA 4WX2B 2YCBA 4MRVA 1MXFA 4GMKA 4JNCA 4R8RA 4MPRA 4F97A 3HCBA 4BB9A 2AJ8A 3AC0A 5KC8A 2R48A 4IZHA 2C7OA 2DECA 5H5JA 2VTKA 4MW0A 4DRYA 4JBIA 4LF5B 3RIHA 1V2GA 1K63A 4KIUA 1TUBB 3B3GA 2Q41A 1IK4A 3PEUA 3Q7QA 5DYYA 1E3SA 3DFIA 5ILGA 2AFIA 4FDUA 4C3ZA 5KKCA 1Z28A 4CKBA 2IUSA 1VFPA 3GWGA 4BGIA 1DKMA 1BFKA 3G2OA 3G13A 3ODGA 3OX3A 5GOZA 3WJ7A 4CM5A 3QPVA 1AA6A 1Q19A 4IH1A 4O59O 1PKEA 4DQDA 1AGRA 2K6GA 2DT8A 2WHYA 4LDZA 4US1R 3R9IA 3SXUB 2HNBA 4U7GA 4RK7A 3THXA 3UJ9A 1KZYC 1CB0A 1D7OA 3Q11A 2C9ZA 2W4MA 4TV9A 4XYMA 5CT9A 5KPJA 5A4IS 1V8FA 2Y66A 4NYJR 1H2ZA 4G67A 3L41A 1QO7A 1JKIA 1W46A 4HO1X 5AJZA 4OHZA 3KVRA 3TTSA 1MCZA 4Z99A 2PFKA 3BZUA 5TQ0B 5TLSA 2XB8A 2D6FA 4OQNA 5SZKB 3UENA 1TMGE 3GAZA 4WFJA 1ESCA 2WUFA 4GBED 4Y2HA 2YFHA 5HK9A 4QYSA 1VE3A 4G1EB 1W2GA 4R1NA 3LF2A 3QNMA 1E4VA 3F6SA 3NATA 4DMRA 1XZIA 4EYQA 4EW2A 4XA8A 3IPLA 3ZGYA 5ALNA 2B7LA 1NLFA 2OO5A 1X1SA 4RK1A 5CFLA 3NHFA 4UJ5A 1L5RA 3HXOA 3C6QA 1XA3A 3N74A 4HKTA 4JBHA 5DO9A 2I1VB 4RGBA 2QZSA 4LHXA 1LNQA 2B1RA 4RFSA 2DBZA 2C2GA 3DEFA 2PH3A 1LNZA 3IX7A 1H4TA 3QXCA 3U7QA 1W29A 2EWWA 3EGDB 2HA2A 2O50A 3O2JA 4KO8A 4OPMA 4YEDA 4FPXA 4IHJB 1J07A 3LXMA 1JE1A 3AI1A 3E5MA 3NC4A 4FK8A 3D1LA 1E2NA 3N1UA 3BTOA 3A9TA 3E58A 3V2UA 2HEGA 3B8EA 4DJJA 1JJVA 1I2MA 1NC3A 1H22A 3ZYZA 2BMDA 3COSA 1GCAA 1I01A 2MSDB 3BFPA 3DM9B 3DUFA 2AFIB 3R23A 2V0CA 3UYKA 1WMBA 3KJHA 3M3DA 3V8NA 1RXCA 4KQIA 1Y3FE 3KQLA 2PKEA 3DNMA 3D6UA 4G23A 3CGGA 4EO9A 3PXBA 1AQNA 5K4AA 3VHXA 1NF9A 1WPQA 2OT3B 2YYAA 3EA0A 4LI3X 2IXGA 3I9V1 4TTJA 3HO1A 4Q3KA 4QREA 2JCBA 5BSHA 5C8XA 5K0FA 1PV4A 5IARA 3KXKA 4XWYA 3ABRB 2Z30A 4P9NA 1Y1LA 4GRIA 1DRKA 4B4OA 5JCXA 1OH6A 2I8CA 1KI8A 1BGXT 1WHTB 1M1YE 1Q3TA 1ENYA 4V0RA 2JC3A 2AFHB 2OCAA 2XHZA 2ZIXB 4HMOA 4YXWD 5AVYA 4PU0A 2D4AA 3U44B 5AHRA 3MPOA 1CLUA 4W5TA 1UQTA 4CKYA 5IEBA 3AESA 4F4HA 2DKNA 4KX5A 4LIPD 4LRYA 3DZJA 4PZCA 2QT9A 2QD5A 3DE3X 3BXHA 2QQFA 3I5XA 3FTFA 3GEDA 4G81A 5DWVA 3T94A 4F1KA 4BNXA 1T0IA 1ZOPA 4LYGA 1QF7A 1K2VN 2BP7A 4OSPA 4F85A 4YMUA 4BFUA 3M5CA 1R2QA 3ZKWA 1DSSG 1W88A 3IP6A 2I9PA 3T9DA 3CGWA 4EHNA 1M2NA 1Z45A 2C2ZA 3D5EA 3O8QB 4LDJA 1CQPA 4PXYA 4Q1AA 5LP1A 1N4DA 5KSOA 1IUNA 3LI2A 1GV0A 4XDYA 5B58C 1AJEA 1EUDA 1JAHA 2O5RA 2RKBA 2UDPA 3ZNPA 5G4LA 1WOYA 4CHTA 3RU7A 4ND2A 3FLEA 3VDMA 1XZMA 4F04A 2VFAA 3NBXX 2OCBA 1FNDA 3KTFA 3NIGB 2ZYAA 3ORRA 4EHIA 4H1TA 2AW5A 2I7DA 2IIBA 4YLGA 4KIJA 3T7TA 1O0BA 1YA6A 4QDJA 4BLOA 4QUEA 4BHTA 2E4ZA 1E2UA 3B1XA 4PGHA 4KFCA 3HDHA 2QPTA 4XEHA 3URKA 4ZO4A 1PW7A 3M6XA 3UHPA 4RVUA 1E2LA 5EINA 1Y63A 4XH9B 1A95A 3MYRA 4Z4QA 1BROA 4IIHA 3UHFA 4KV7A 2GR9A 1YQ9A 3FBGA 2BKUA 1Z4MA 4PQYA 4QGGA 5FH9A 3OH8A 3RS3A 2ECPA 3RVBA 4CM7A 3U80A 2JA1A 2WIBA 1Z0JA 1W7AA 4MVJE 2EERA 1FQJA 3FGNA 4YRFA 4AZTA 1CUIA 1NKTA 1SFRA 4GD3Q 5K8TA 1ACJA 3DLCA 4QU9A 1I51A 3DDZX 3IA2A 1PWZA 3G5MA 3NEJA 4PC7A 1XTQA 1MX5A 2HB6A 1Y8QB 3HEAA 2ZJAA 3HDVA 3MCWA 4H0NA 4W8OA 2H57A 4D9BA 1YKGA 1EU1A 1MB0A 1NM5A 1P4AA 3KPJA 4IIJB 4OHCA 4P4SA 5B4VA 2XD4A 1AMNA 1YS9A 3VOTA 1M1NA 2W7TA 3BM5A 1LLCA 3DMTC 1JLLA 3TLCA 1HNZB 1E3WB 4AMYA 1SGWA 2Z6VA 4PG4A 3H0EA 5FIUA 4DNFA 2OCGA 4JGBA 4E4TA 3JS5A 2PH7A 5U4XA 3T12A 1MMFB 3M4JA 3QYJA 3LAWA 2VG8A 2PUAA 1F20A 4M76B 4N3CA 2W2LA 2GKGA 3T34A 4B4KA 3R4VA 4O08A 2L18A 1UKEA 1ORRA 3IAS1 5F1KA 3ISVA 2C8JA 4PXAA 4XWKA 2IDMA 5ENZA 2ID8A 2P1RA 1NKSA 2WG1A 3ZK8A 4HVLA 2GOYA 2A30A 4NNJA 1VIDA 3EQ2A 2NTVA 3WP1B 4BRSA 2XGMA 2JEZA 2ZKLA 4L76A 4Q3LA 4KYIB 4RQAA 4RETA 1WKCA 5TR9A 3HNPA 1XALA 4DZRA 4U5XA 4EY3A 4C7KA 3IDZA 4WIAA 1M7BA 2FEMA 2J45A 4P7JA 1UOOA 1DO2A 1GZVA 1XLTA 1ZJZA 4Y2XA 4ZJZA 5JZBA 3VKVA 1KRXA 1Q1EA 4UDNA 2VZ0A 3CLRD 3IOBA 3FMPB 4PZPA 2XXBA 4JI8B 1CFZA 3D7MA 2J9RA 3S1AB 1DMRA 1KZ4A 3HBMA 1ECJA 1IAVA 1QLHA 3G2KA 5K01A 3AV3A 2E37A 4U7WA 3OMWA 1RRCA 4G5OA 4QO8A 1JHYA 3A7DA 2D7CA 3VPAA 1XZEA 5FA6A 2CCJA 2W6JD 2JAPA 1E4EB 4HNQA 3ZQ4A 3WFJA 3G0DA 3AU9A 1AF7A 4G4SO 2HHJA 5JS8A 4RPGA 3L7DA 1UR5A 3FTDA 2IK8A 2VHUA 4ZGBA 2EXXA 4DWJA 4YPFA 1KZ7B 2Q0HA 1K7CA 4IOMA 1KRHA 3WYFA 1T9ZA 4MQ5A 4RTSA 5J4VA 2NTEA 2WSYB 3BMNB 3UA3A 1FUUA 2JHCA 1CB7A 1VHDA 1DIGA 4J0EA 1BCRA 2GTHA 4ZTZB 2ZCVA 1D1PA 3MXOA 4GNKA 2A0FA 5BVHA 1U11A 4OO3A 5CG2A 4GM0A 3WMXA 4JOCA 5FA8A 4X00A 5CLHA 1GPUA 2GPNA 1C80A 2IU6A 4ZGGA 2V6BA 1FMLA 1MP0A 3TSAA 2GXSA 1DQPA 1XTVA 2N46A 1DZIA 3MSCA 4NMWA 4YYEA 3N0TA 4R1OA 2I1WA 3LYLA 1FU4A 3OLCX 3WWZA 5CA0A 5LYJB 4L78A 4GYWA 2UXDB 4Z3DA 4MHOA 2ZJBA 1BS2A 1E9VA 1LD3A 2FPSA 2XOEA 3T9CA 4RENA 3PF9A 4A8JA 1XAJA 2RI1A 2CJWB 4CTJA 1SO8A 3R8FA 3KB1A 4GWLA 5ALIA 1KC1A 4WDRA 2ZUWA 2FE4A 1CJVC 1X1EA 3R3XA 1RU3A 3QEKA 4YNBA 4PLVA 2HMTA 3GA7A 4GOLD 2WD7B 4RV9A 3UVEA 3WA6A 4I4TF 1RYDA 3D3JA 1NVXQ 3AHJA 3G85A 4I8DA 4KYTA 4AKTA 1H66A 5CYFA 1JLLB 4DPKA 1OPRA 3HA2A 3SKXA 1X39A 4N3BA 4YCMA 4BQRA 1Q1GA 4O0MA 4CG0A 4EJSC 1ZESA 2YXDA 3H5TA 5C51B 1SC9A 1IJEA 4MIOA 3I30X 3X1JA 1U0LA 3DZIA 4FZ3A 1E8DA 2F9MA 2CBXA 4LY6A 3ZE8A 1PGNA 3TB6A 3F74A 4KQFA 2W6PA 2C4UA 5DNWA 3R5SA 3TLBA 4DM7A 2ZJ4A 3GROA 3CURA 3ZCVA 3MAAC 5HA5A 3GLGB 1E1QD 3O94A 1IIBA 2AE1A 4U7PB 1ML3A 1J9GA 3L0SA 4JUBA 1JIXA 2WSSD 5AM2A 1LV7A 3ZX4A 2Q62A 4R9VA 5FLKA 2H7XA 4QBIA 1P7PA 2EKZA 1Y9JA 3EPPA 1QCDA 1UEJA 1ADYA 3V4SA 4QJ3A 3H7IA 4M0MA 5EI5A 2ADMA 4CLEA 3SZUA 3WK8A 4O3MA 2FPGB 3CHYA 1WXIA 4DIDA 2BFDB 3K9BA 1PR9A 1N77A 2GX6A 2FW9A 1N0IA 4Z0NA 5A05A 4IY1A 3RREA 1F9AA 1ZEJA 1M3SA 3CRW1 4MI1A 4YAEA 1V3QE 4GFDA 2PS1A 3ZS8A 1LLFA 1FLAA 2CVZA 2G6TA 3ENZA 4MKXA 1Y3BE 4X1IA 5LQCA 1EBFA 2O4UX 4A0QA 5K0LA 1N3IA 5TGZA 1LZKA 2GZ3A 2P9CA 3TQFA 4CCAA 3T3EA 1PJAA 3M6WA 2V7WA 1UMBB 2ST1A 4CM8A 4UBJA 2ECQA 2X5OA 1BKYA 3N2GB 4F38A 2PA0A 5T8KA 4KUGA 4FYHA 2I4TA 2Q2NA 4J3NA 5B5SA 1CKEA 4Y1GA 4R7GA 3A3NA 3FDXA 1ZGAA 2AB0A 3GEBA 4MVJA 1PJZA 3B6JA 4N49A 5DRYA 4Q9IA 1ZOIA 3UOWA 3AUUA 2GHQA 3ZI0A 3C4QA 4S04A 1RYZA 3C4VA 3Q9NA 4UJ3A 1LB1B 3WJ2A 3DBHA 4J7AA 1F3OA 1IMOA 2KLHA 1UPFA 1ZLYA 2REXB 1ZONA 1MJGM 3HDQA 1VP3A 4KAJA 4EG8A 4FEGA 4CM6A 1F6WA 3GD5A 1SU7A 3IKJA 4M9RA 1VJTA 4JENA 1PV2A 5HS4A 4H6PA 1NQ5A 2ZUVA 3ZV4A 2RARA 3AHGA 4MAMA 5K8CA 2AFHA 1A9OA 2ZIXA 4R3NA 4BMSA 4OGKA 2XWSA 3BWXA 3VO9A 2B6NA 4BYMA 5F7JA 4JEHA 8ABPA 1EUYA 3CKKA 4CIXA 4RH0A 1NJ6A 1AZSC 3Q1KA 4KPUB 3URMA 4YXFA 2WDZA 4PX9A 3UANA 1ZIOA 5HBGA 2CLLB 5TQJA 1YI0A 5HEKA 1EFHA 1KPHA 2QB5A 1A97A 1C2YA 4U8GA 3NRJA 1YUNA 5AUQA 1I36A 2A78A 2OSVA 2B4YA 3BL8A 5K2MA 5AHOA 5HHTA 2AKYA 2OK8A 3NBQA 5FOVA 5F64A 2EX1A 2QAGB 2XWPA 3TFQA 3TYXA 4BRUA 4OLBA 3HZZA 1D6MA 2V6JA 3VHLB 4EECA 1TU0A 3EZGA 1I5EA 4I1YA 5H9WA 3NDRA 2CFTA 3LA6A 2QY6A 4XARA 3TTXA 1IWOA 5JEDA 5K3BA 1W5EA 1DWOA 3KOZA 1PJCA 1RP7A 5B37A 4IIVA 3DC2A 3GAMA 2Y71A 4Q1VA 5DM60 5DM70 5A4AA 1RZVA 1Z06A 4OQXA 3M6IA 1L5KA 5JNRA 1GKIA 1A71A 5C1BA 2J0SA 5M29A 3IP5A 3K2QA 4BQSA 3Q6NA 1ICEA 3CO0S 3DDWA 3IPCA 3NNNA 1DAEA 1G42A 1ZJYA 4IBOA 3LUPA 1RLTA 4XD7D 2MJLA 4YB8A 1R8SA 4KWIA 5AW6A 3LLVA 4J4TA 4GKJB 1SC1A 4IGKA 5L3SB 4W9MC 2ZE7A 4MHTA 1NT4A 2X9GA 1IPFA 1EINA 1CETA 1NE7A 1IDOA 1XZLA 5DTMA 4OQMA 4LF8B 1W93A 2ZDGA 2H5LA 2X19A 1PL8A 4JCOA 2TYSB 3AZOA 1XUOA 1U7WA 5AXDA 1MOPA 4DYVA 1W8IA 2GKSA 3QK7A 2DBRA 4IF6A 4QOGA 2PT6A 4NOKA 4UAUA 3RSGA 2ZCUA 3TL6A 5K4HA 3CT4A 4EWLA 2I62A 1KJYA 4ZOAA 4F3TA 5REQB 2IZ5A 1FCJA 4XSHA 2XMQA 4URYR 5D87A 3U3DA 4LCJA 5A0TA 5I7VA 2PR2A 1GUFA 1VIMA 3PXDA 1TCVA 3GRPA 4QOEA 1UDRA 3VPHA 3ENQA 3DH0A 4KRGA 4LV8B 4AKIA 1NVGA 3IHWA 3NHAA 4LHYA 2CXQA 1H9BA 2HEIA 3U40A 5EHZA 1BQEA 1FP1D 1YH3A 1YZGA 4H2DA 2W11A 4MQEA 4BLVA 4YI5A 1ULUA 5DXJA 1PI3A 2ECFA 3BXGA 2IP1A 4NPAA 3VFDA 5AW7A 3WI7A 2BHLA 2GYVA 4OL9A 4B46A 1LEHA 2WKPA 1YBMA 1YI1A 4YJ3B 5K8JB 4CEIA 1KERA 1LNSA 1RFLA 4PYNA 1XDGA 3DMPA 1JG4A 1H8EA 2X3UA 4ERXA 1GYRA 4OK6A 2ZUBA 4TZTA 1X8LA 3DEYX 3GZNB 1JBKA 3KOOA 5FFNA 2YUTA 1S1MA 2GZRA 1ID1A 4RD6A 4MZXA 2IJGX 3AW8A 3DDHA 3TKYA 3FLBA 3SQWA 3NEPX 1HM5A 3EXHC 3RUCA 1Z47A 3DLBA 1D2HA 2AOTB 1LSOA 1V45E 4UTOA 5IANA 4WK0B 1E7YA 3VPXA 3H4MA 3SY8A 3WYGA 2FAXA 3PRYA 4K40A 4MS3B 4AURA 5CB6A 3H0CA 3E84A 5HVNA 3KEGA 2X9VA 3OZCA 1J97A 2QVYX 2ZIVB 1KE2A 2F00A 2VF4X 4GMXA 3UKDA 2YZMA 2ZSDA 2XH8A 2C3PA 3GBSA 5ICCA 2DH6A 2N42A 3QVSA 2LWIA 3R09A 3ZLJA 2P9QA 4BV8A 3OO1A 4B3MB 5IH3A 1K2WA 1K0FA 4G0XA 3TBHA 5IFKA 4GE0A 5HG0A 2EG5A 4BZWA 3EZNA 2NTYC 3IV6A 4R2JA 2G72A 4WLFA 1GPH1 1J2TA 5EKSA 3S44A 1PNTA 3G82C 1EQAA 2BDEA 1A1SA 1D2EA 1NI4A 2VNSA 4GPIB 2BFBA 3WKDA 2CV0A 2HSGA 1S8AA 1PJ2A 2NXJA 1TVMA 1E9BA 2XMGA 4C0LA 4YAWA 3OZFA 3PRJA 1D2MA 4X6LA 3UK1A 2C99A 3LDAA 5CJJA 3T7EA 5AW4A 5L7WA 4WK2B 1LTKA 3M1LA 1S9DA 5LA6B 8MHTA 3O8DA 4ZI2A 4DHWA 1QYXA 3NNSA 4KE7A 4Q93A 4QUAA 4MLZA 3FZYA 3BBLA 2NU8A 4M9UA 1C9YA 5DYNA 1QH0A 2C98A 1OROA 3L0CA 4P36A 1ZKDA 4D0SA 1T8TA 3ZJTA 4AI6A 1HT0A 2QVBA 4XQEA 4TSFA 4PTLA 5KZMB 3IKMB 3DO5A 3GLTA 2NZWA 4KCGA 1PFWA 2R8RA 1KSGA 4DE5A 3OQIA 4Y6OA 1MJHA 4G0ZA 1QJ4A 1HE8B 1E96A 1ORWA 1LX6A 1R8QA 2IL1A 2P2LA 3L05A 4B4DA 1EM8B 4LTMA 4BVJA 4AY5A 2P0EA 4KYUA 3ONVA 5J63A 1E6MA 2H7CA 2W2XA 1LTQA 1ZXBA 2INGX 3D3QA 5HCNA 3DAPA 1K86A 1VJGA 1E99A 2FSIA 1UBJS 4OJNA 5BNZA 3ZNOA 1YJXA 1RKBA 1Z33A 2E5FA 2WHEA 3NHLA 4WPGA 2GK4A 1YQTA 3BRWA 5DSZA 1KBZA 1XDBA 4BWFB 4GM4A 2AEMA 4YACA 4GSLA 1JQLB 1R0YA 1LRLA 3PPXA 5ALSA 1OX4A 1RQNA 5FYQA 2CXNA 3SZGA 1WB6A 4LWQA 3ZN2A 3L7BA 2Q3MA 4IIXA 2DTDA 2HO4A 5TY0A 2LNDA 1GGHA 2QW0X 1XL1A 2EKPA 2XCOA 1P2UA 3AM4A 1ZC3A 4DGSA 621PA 4PG7A 4MYRA 1YVEI 2HREA 3KDAA 2X0JA 3RIXA 2WTBA 2OR3A 4X7MA 4XDGA 1NYRA 4G26A 3H97A 4CQMA 1QGUB 4QLBA 2RC6A 2VDVE 4OQEA 3UJAA 4G37A 3UK2A 1OUMA 2BEUA 5GGXA 3SNKA 4YRIA 7ABPA 3MUOA 4BFCA 4UULA 2ZCJA 1TCCA 1D7AA 1ZP6A 2OORC 2FG5A 2WF9A 1ADBA 4J0DA 1WXWA 4U2FA 1R6BX 1J25A 1SBCA 4UDXX 5FXMA 3OQOA 4Z51A 1S7GA 1V7PC 4OCZA 2BI8A 4EJ0A 4QZVA 2GF0A 4H9GA 3NRBA 2BFFB 4B47A 4P2BA 3QKUA 3ND7A 4GRAA 1C1XB 1DIHA 2YHIA 5HS6A 4QJ5A 5CMLA 4AECA 1BQ3A 2H2HA 3OM1A 4MWCA 3CEHA 4EYEA 5TMBA 1XYYA 1GKYA 2QTMA 1GU7A 1I1NA 1O6BA 3D4IA 3O7MA 4I7EA 3ID6C 4LYDA 2VA8A 1UZUA 5JWHA 4NULA 3RVRA 3HFGA 4D9KA 1OFUX 2WJ3A 4QOIA 4LE2A 5SICE 3PFIA 3K2IA 3QGMA 3ANYB 2CLOB 2GVZC 2OBFA 2YMLA 3V48A 1FJXA 1QRSA 2MMGA 1SD2A 1SR8A 4HN9A 1CUVA 1Q12A 2FSUA 1SZPA 1ZINA 3L0PA 4FGLA 1HDIA 1GAEO 3CV3A 4PPFA 3QWAA 5K3AA 2ON6A 3WR5A 1U8YA 2R44A 4X97A 2PGOA 3AXTA 2VDQB 4NWIA 1XPRA 4QO7A 3TOZA 3BOSA 3VU8A 2F7SA 5C3MA 2WWIA 5K3FA 4UTRA 1Q50A 4Q3CA 4BO4A 4ZFNA 2VNKA 2OOKA 1MR3F 3I04M 1VGQA 3FGPA 4HAOA 3CLSD 5EZYA 1CD5A 2VK4A 4CKEA 3LPMA 2X9NA 4G2NA 3SF0A 1L4BA 3VR6H 1EFLA 3UCEA 3ORFA 5IWCA 2ZRDA 3A6ZA 2VUIB 2VT7A 3R9XB 1O95D 4NI5A 5CBPB 2BWJA 2BKLA 1L8XA 1BN6A 3ZU5A 3GJ6A 1ZL0A 5FQOA 4WXEA 2PSDA 2QOEA 3UMBA 4FILA 1N4AA 2Q99A 4N5LA 1A5BB 4N5NA 4XPIB 4UM9B 5JVDF 3JVUA 1IDN1 5HNKA 4A10A 3NXSA 3P1JA 4G07A 1AURA 3PPIA 5JJ5A 2P6MA 1PR1A 4M4SA 2B82A 4YRMA 1HA3A 1IWPB 2QN1A 3PV0A 4AKGA 2VYND 4V0ME 1MOSA 3DDUA 2O2EA 4TKUA 1E1NA 5ULLA 5B12A 5B55A 5J3JA 3NP9A 1OHHD 2A9RA 5K0NA 3ZKWB 1FS6A 2BZSA 1P2SA 3LS2A 3HO6A 2G1UA 1K5GA 4JI7B 3HUEA 3QSGA 3TTTA 4BWYA 4MUNA 1OZFA 1M2HA 3PA6A 4LDQA 4QM7A 3MFYA 2Z04A 1KI7A 3DYVA 1ULAA 2I80A 2IXBA 3W4IA 5DNCA 2YQ4A 3JQ8A 4QJ4A 2HFKA 3II6X 4FJ2A 4G5QA 2FWIA 1UBCA 2WQZA 4UM8B 2WWFA 3I5MA 4TS3A 3PI6A 1DG3A 4DLLA 2DY0A 1AE1A 4D9EA 1F14A 5P8WA 4EHAA 2JK1A 1DJNA 5KI6A 2ZR7A 4M8SA 1RXIA 4L72A 1F2UB 3IEKA 2B1IA 2CHFA 3OOEA 4DFDA 4GKBA 2FTKE 1JQBA 2EZUA 1UDAA 2TMDA 1PFVA 2X40A 4WVLA 5HIMA 5C7YA 2JCYA 5J2TF 3SHFA 4Y6LA 1AUXA 1I14A 1PHRA 1V9LA 2QYTA 4W5HA 1T36B 3F6CA 1Z6GA 2XB9A 4YJ2F 4GIBA 1GR0A 4JYZA 2BE7A 4JQSA 1HV8A 1ZI6A 3FI0A 3FNQA 1XRJA 1U1EA 3LUCA 3DQQA 4DWWA 2P6NA 2W2MA 4Y2QA 4KQ2A 5AXBA 3FNEA 3N2YA 2ZYIA 5BSTA 1J21A 4NCBA 5TSDA 1EH5A 3GIWA 4KPFC 3EDMA 3MTDA 1SK8A 4WXPA 5CT8A 3ROFA 1UM9B 3IP3A 1ZL2A 2W43A 1SC6A 3LLSA 4QBTA 3ST7A 4CV0A 2GJSA 2PNFA 3GVHA 3T6KA 1UBRS 4EUFA 3FYUB 1RAFA 2VNIA 2ZI4A 4LXUA 3BJMA 4XAQA 2V9PA 3PHJA 4NQRA 3A4MA 3NVAA 2LP4Y 1OE0A 3FKSA 3Q7RA 3BN3A 3GFFA 5REQA 2O8BB 2G9RA 2HQSA 2NO0A 1EFKA 1T5BA 3IELA 4NCHA 4F4DA 3GUYA 1XMIA 2FMIA 3FYTA 3AUFA 1XMJA 2NUAA 1QH8A 2R66A 5LU8A 3L4SO 4NMHA 3VI4B 1UC9A 3RHZA 3HDGA 1QYWA 2QRVA 3JVVA 2WF6A 3KQVA 4ZCTA 4M60A 2C8LA 2HTEA 3AGPA 3RYHA 3O4HA 5CDSA 2B34A 3EHEA 1FDIA 3WLJA 2RH9B 1LLDA 2FGKA 1SU4A 5DHPA 3SVLA 4LC1A 1ZSVA 1TM3E 1YI8A 2C4KA 3BILA 4AJJA 2BKEA 4D4IA 4BQEA 1TYZA 3S7TA 4ESHA 4V39A 2ZRLA 5CYPA 2DZDA 2QJRA 3W6PA 1PP4A 5BQXA 4BQOA 2ZT6A 3P2EA 4LNUB 3ADOA 4LY9A 1XAGA 4BX2A 4MVJG 1W8DA 4LS3A 3N58A 1OU4A 1ZGGA 2P91A 4GI1A 3G0HA 2O8DA 1YU6A 3HQ4O 1FP2A 2DJ5A 5CAEB 1FJHA 3AM1A 2UAGA 3OT4A 1N1MA 1CULC 2QX6A 3NW9A 3IQWA 1WHSB 3OJEA 4RE5A 4QJIA 1NBIA 4EUKA 2Z8XA 1NVVQ 3EGEA 4LZAA 2XMSA 2G6BA 3PHLA 4FDAA 3BB1A 4S12A 5EJMA 3VX3A 1UMKA 4CLRA 1ZA2A 4HYYA 3QU9A 2ACEA 1PHPA 4ZN6A 3FVVA 4RDXA 4DIOA 3HG7A 4UDYX 2BGWA 1KVUA 3GA5A 3OURA 4MW7A 2F1IA 2N1MA 2X15A 4PAGA 2RGEA 2SCUB 3HP4A 2BRUA 4KKVA 4MV9A 4Y1EA 2WF5A 6CHYA 1AK1A 1JDJA 3ZHQA 1RLMA 3OVMA 2P11A 1L4GA 4XX0A 3DFMA 2DUNA 1FBNA 1YB6A 2DQYA 3MTEA 2VJNA 3G0CA 4I9NA 1E2FA 4LHWA 4TTRA 3DT9A 4WLVA 1BVYF 5AK6A 3C7KA 4DAEA 5LZ9A 1X0XA 3JTEA 3JQEA 4UD2A 3L4KA 3DR3A 2ROQA 2C95A 2GN6A 3TLGB 3OD5A 1MRSA 1FXWA 3E18A 3I4LA 3I32A 3MMXA 3O74A 4U9IS 1U28A 3EDYA 1W4ZA 2X8JB 1VB5A 3JSAA 4AJEA 4D74A 1KEKA 4B7XA 3D1VA 3UBTA 2ZANA 1JKMA 2GK3A 2YJNA 4M99A 1KEZA 2DR0A 3GFSA 5MHTA 4JH0A 1G8MA 2BEKA 2XAUA 1X7ZB 4IVRA 2W4QA 1P0IA 1JIVA 1ZVKA 2ZKIA 1A8PA 1E5QA 2SCUA 2AZ4A 3FGZA 3P96A 5EFZA 1LJLA 1UMBA 3EARA 3TUJC 2IOFA 1J90A 5LDHA 1WP9A 1ZMTA 3PZRA 2GYYA 3RSQA 4L5YA 1RQXA 2KBFA 4YYZA 1C29B 1I2BA 2FN7A 2C0CA 4J43A 3C3MA 3QXXA 2IA5A 1ONNA 3AETB 4TYPA 4ND8A 4GO1A 4F8YA 3ZDCA 2QUIA 1Y5LA 4MKGA 2NP7A 3F98A 3I2JA 2C59A 2HPZA 1YVRA 3NIWA 2PX0A 5AI4A 5L3QB 3NHMA 2OAP1 3JQFC 4R8KA 3WKEA 1JJIA 2D1RA 1D07A 1IMJA 2M1XA 4EJFA 4L73A 4U5QA 1BJRE 2HM7A 3SGLA 2R4TA 3UB2A 1DUVG 3CEJA 1F8UA 2PPLA 3EGCA 3WHPA 4K9MA 1SD1A 1XMOB 1S02A 1JDBB 2W98A 4R6WA 3U81A 3NHYA 4ER0A 5IRCD 1HFJA 4JLWA 4GS5A 2DH5A 4C7MA 3RF6A 2DWQA 1DUSA 2V7UA 1D0SA 1DHRA 3DPSA 2VNHA 3K0FB 2VYVA 1EI9A 2V7QA 4B8WA 1MFPA 4X64B 2XY4A 1XXHE 2B35A 4Y1FA 4JBXA 4X66B 3GLGA 3MEQA 1JHZA 3G2MA 4FIZA 1W4LA 4QLAA 1IH8A 1Z4KA 3IJEB 4INAA 4IR7A 2G76A 5AJXA 3TSYA 4LC9A 4RSRA 2LKCA 4YUWA 2WNSA 3KK0A 3R20A 3AIOA 1M8GA 2ATIA 4FSHA 5FNVB 1GGNA 2VYNA 1X7DA 4DC1A 2GT1A 2IS6A 1WCV1 1KGDA 1PJQA 4MUMA 4ND3A 1EHIA 4W5JA 3BC1A 4YP1A 1GDTA 1C1HA 4NEHB 3THWA 5DX8A 1W75A 1YV9A 4HFNA 2PZ8A 1Y1QA 3DM5A 3SJCA 1KDTA 2BJWA 4JJ6A 4BTLA 5BYAA 1PJTA 4FYVA 2CLKB 4JIMA 2Z3ZA 2ODPA 2QRJA 4AO8A 3EPLA 3D4NA 2WWGA 2IH5A 2XRYA 3VZQA 4LNHA 5IKXA 3U16A 2WHQA