2W5YA

Binary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
170
Chain Sequence
PNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
total genus 48
structure length 170
sequence length 177
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5yA01
3CBMA 3CBPA 4RZ0A 3K5KA 1N3JA 5LSXA 5KJMA 4YPUA 4QENA 3MEKA 5T5GA 3RQ4A 1N6AA 4J7FA 4IJDA 4QEPA 3QWVA 5KJNA 5CPRB 2W5YA 5F6KC 3TG5A 4QEOA 4YNDA 2W5ZA 5KJLA 3MO2A 3OPEA 2O8JA 5F6LA 4YPEA 1ZKKA 5JIYA 3HNAA 3M55A 4O6FA 3DB5A 3S7JA 1MVHA 4MI5A 5EX3A 1MVXA 5EG2A 5T0KA 1H3IA 3RU0A 4JDSA 3RIBA 5ARGA 2JV0A 5HQ8A 4I51A 4YPAA 3KMTA 1PEGA 2BQZA 3RAYA 1XQHA 5ARFA 5F59A 3DALA 3VV0A 3SWCA 3PDNA 4J83A 3M53A 5JJ0A 3M57A 2G46A 3M59A 5JINA 3S7FA 5JHNA 4AU7A 1ML9A 3OXFA 5TH7A 4BUPA 3EP0A 3OXGA 2QPWA 4YNMA 3S8PA 5TEGA 3M56A 3M5AA 2RFIA 2F69A 1O9SA 3F9YA 3KMAA 3RJWA 3CBOA 3MO5A 3OOIA 4Z4PA 5LSZA 3FPDA 4MI0A 3S7BA 5T0MA 1MUFA 3M54A 5TTFA 5KJKA 4H12A 3MO0A 2R3AA 3OXLA 3KMJA 3VUZA 3IHXA 4LDGA 5CCMA 5CCLA 4NVQA 1MT6A 4WUYA 3S7DA 3F9XA 5F5EA 3F9ZA 3BO5A 4YNPA 4J7IA 4O30A 4FMUA 3OS5A 1N6CA 3N71A 3SW9A 3TG4A 3F9WA 3QWWA 4NJ5A 2IGQA 5HI7A 4C1QA 5AYFA 5EX0A 3QWPA 4IJ8A 4JLGA 3M58A 4E47A 4J8OA
chains in the Genus database with same CATH superfamily
3CBMA 3CBPA 4RZ0A 3K5KA 1N3JA 5LSXA 5KJMA 4YPUA 4QENA 3MEKA 5T5GA 3RQ4A 1N6AA 4J7FA 4IJDA 4QEPA 3QWVA 5KJNA 5CPRB 2W5YA 5F6KC 3TG5A 4QEOA 4YNDA 2W5ZA 5KJLA 3MO2A 3OPEA 2O8JA 5F6LA 4YPEA 1ZKKA 5JIYA 3HNAA 3M55A 4O6FA 3DB5A 3S7JA 1MVHA 4MI5A 5EX3A 1MVXA 5EG2A 5T0KA 1H3IA 3RU0A 4JDSA 3RIBA 5ARGA 2JV0A 5HQ8A 4I51A 4YPAA 3KMTA 1PEGA 2BQZA 3RAYA 1XQHA 5ARFA 5F59A 3DALA 3VV0A 3SWCA 3PDNA 4J83A 3M53A 5JJ0A 3M57A 2G46A 3M59A 5JINA 3S7FA 5JHNA 4AU7A 1ML9A 3OXFA 5TH7A 4BUPA 3EP0A 3OXGA 2QPWA 4YNMA 3S8PA 5TEGA 3M56A 3M5AA 2RFIA 2F69A 1O9SA 3F9YA 3KMAA 3RJWA 3CBOA 3MO5A 3OOIA 4Z4PA 5LSZA 3FPDA 4MI0A 3S7BA 5T0MA 1MUFA 3M54A 5TTFA 5KJKA 4H12A 3MO0A 2R3AA 3OXLA 3KMJA 3VUZA 3IHXA 4LDGA 5CCMA 5CCLA 4NVQA 1MT6A 4WUYA 3S7DA 3F9XA 5F5EA 3F9ZA 3BO5A 4YNPA 4J7IA 4O30A 4FMUA 3OS5A 1N6CA 3N71A 3SW9A 3TG4A 3F9WA 3QWWA 4NJ5A 2IGQA 5HI7A 4C1QA 5AYFA 5EX0A 3QWPA 4IJ8A 4JLGA 3M58A 4E47A 4J8OA
chains in the Genus database with same CATH topology
3CBMA 3CBPA 4RZ0A 3K5KA 1N3JA 5LSXA 5KJMA 4YPUA 4QENA 3MEKA 5T5GA 3RQ4A 1N6AA 4J7FA 4IJDA 4QEPA 3QWVA 5KJNA 5CPRB 2W5YA 5F6KC 3TG5A 4QEOA 4YNDA 2W5ZA 5KJLA 3MO2A 3OPEA 2O8JA 5F6LA 4YPEA 1ZKKA 5JIYA 3HNAA 3M55A 4O6FA 3DB5A 3S7JA 1MVHA 4MI5A 5EX3A 1MVXA 5EG2A 5T0KA 1H3IA 3RU0A 4JDSA 3RIBA 5ARGA 2JV0A 5HQ8A 4I51A 4YPAA 3KMTA 1PEGA 2BQZA 3RAYA 1XQHA 5ARFA 5F59A 3DALA 3VV0A 3SWCA 3PDNA 4J83A 3M53A 5JJ0A 3M57A 2G46A 3M59A 5JINA 3S7FA 5JHNA 4AU7A 1ML9A 3OXFA 5TH7A 4BUPA 3EP0A 3OXGA 2QPWA 4YNMA 3S8PA 5TEGA 3M56A 3M5AA 2RFIA 2F69A 1O9SA 3F9YA 3KMAA 3RJWA 3CBOA 3MO5A 3OOIA 4Z4PA 5LSZA 3FPDA 4MI0A 3S7BA 5T0MA 1MUFA 3M54A 5TTFA 5KJKA 4H12A 3MO0A 2R3AA 3OXLA 3KMJA 3VUZA 3IHXA 4LDGA 5CCMA 5CCLA 4NVQA 1MT6A 4WUYA 3S7DA 3F9XA 5F5EA 3F9ZA 3BO5A 4YNPA 4J7IA 4O30A 4FMUA 3OS5A 1N6CA 3N71A 3SW9A 3TG4A 3F9WA 3QWWA 4NJ5A 2IGQA 5HI7A 4C1QA 5AYFA 5EX0A 3QWPA 4IJ8A 4JLGA 3M58A 4E47A 4J8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBM A;  3CBP A;  4RZ0 A;  3K5K A;  1N3J A;  5LSX A;  5KJM A;  4YPU A;  4QEN A;  3MEK A;  5T5G A;  3RQ4 A;  1N6A A;  4J7F A;  4IJD A;  4QEP A;  3QWV A;  5KJN A;  5CPR B;  2W5Y A;  5F6K C;  3TG5 A;  4QEO A;  4YND A;  2W5Z A;  5KJL A;  3MO2 A;  3OPE A;  2O8J A;  5F6L A;  4YPE A;  1ZKK A;  5JIY A;  3HNA A;  3M55 A;  4O6F A;  3DB5 A;  3S7J A;  1MVH A;  4MI5 A;  5EX3 A;  1MVX A;  5EG2 A;  5T0K A;  1H3I A;  3RU0 A;  4JDS A;  3RIB A;  5ARG A;  2JV0 A;  5HQ8 A;  4I51 A;  4YPA A;  3KMT A;  1PEG A;  2BQZ A;  3RAY A;  1XQH A;  5ARF A;  5F59 A;  3DAL A;  3VV0 A;  3SWC A;  3PDN A;  4J83 A;  3M53 A;  5JJ0 A;  3M57 A;  2G46 A;  3M59 A;  5JIN A;  3S7F A;  5JHN A;  4AU7 A;  1ML9 A;  3OXF A;  5TH7 A;  4BUP A;  3EP0 A;  3OXG A;  2QPW A;  4YNM A;  3S8P A;  5TEG A;  3M56 A;  3M5A A;  2RFI A;  2F69 A;  1O9S A;  3F9Y A;  3KMA A;  3RJW A;  3CBO A;  3MO5 A;  3OOI A;  4Z4P A;  5LSZ A;  3FPD A;  4MI0 A;  3S7B A;  5T0M A;  1MUF A;  3M54 A;  5TTF A;  5KJK A;  4H12 A;  3MO0 A;  2R3A A;  3OXL A;  3KMJ A;  3VUZ A;  3IHX A;  4LDG A;  5CCM A;  5CCL A;  4NVQ A;  1MT6 A;  4WUY A;  3S7D A;  3F9X A;  5F5E A;  3F9Z A;  3BO5 A;  4YNP A;  4J7I A;  4O30 A;  4FMU A;  3OS5 A;  1N6C A;  3N71 A;  3SW9 A;  3TG4 A;  3F9W A;  3QWW A;  4NJ5 A;  2IGQ A;  5HI7 A;  4C1Q A;  5AYF A;  5EX0 A;  3QWP A;  4IJ8 A;  4JLG A;  3M58 A;  4E47 A;  4J8O A; 
#chains in the Genus database with same CATH topology
 3CBM A;  3CBP A;  4RZ0 A;  3K5K A;  1N3J A;  5LSX A;  5KJM A;  4YPU A;  4QEN A;  3MEK A;  5T5G A;  3RQ4 A;  1N6A A;  4J7F A;  4IJD A;  4QEP A;  3QWV A;  5KJN A;  5CPR B;  2W5Y A;  5F6K C;  3TG5 A;  4QEO A;  4YND A;  2W5Z A;  5KJL A;  3MO2 A;  3OPE A;  2O8J A;  5F6L A;  4YPE A;  1ZKK A;  5JIY A;  3HNA A;  3M55 A;  4O6F A;  3DB5 A;  3S7J A;  1MVH A;  4MI5 A;  5EX3 A;  1MVX A;  5EG2 A;  5T0K A;  1H3I A;  3RU0 A;  4JDS A;  3RIB A;  5ARG A;  2JV0 A;  5HQ8 A;  4I51 A;  4YPA A;  3KMT A;  1PEG A;  2BQZ A;  3RAY A;  1XQH A;  5ARF A;  5F59 A;  3DAL A;  3VV0 A;  3SWC A;  3PDN A;  4J83 A;  3M53 A;  5JJ0 A;  3M57 A;  2G46 A;  3M59 A;  5JIN A;  3S7F A;  5JHN A;  4AU7 A;  1ML9 A;  3OXF A;  5TH7 A;  4BUP A;  3EP0 A;  3OXG A;  2QPW A;  4YNM A;  3S8P A;  5TEG A;  3M56 A;  3M5A A;  2RFI A;  2F69 A;  1O9S A;  3F9Y A;  3KMA A;  3RJW A;  3CBO A;  3MO5 A;  3OOI A;  4Z4P A;  5LSZ A;  3FPD A;  4MI0 A;  3S7B A;  5T0M A;  1MUF A;  3M54 A;  5TTF A;  5KJK A;  4H12 A;  3MO0 A;  2R3A A;  3OXL A;  3KMJ A;  3VUZ A;  3IHX A;  4LDG A;  5CCM A;  5CCL A;  4NVQ A;  1MT6 A;  4WUY A;  3S7D A;  3F9X A;  5F5E A;  3F9Z A;  3BO5 A;  4YNP A;  4J7I A;  4O30 A;  4FMU A;  3OS5 A;  1N6C A;  3N71 A;  3SW9 A;  3TG4 A;  3F9W A;  3QWW A;  4NJ5 A;  2IGQ A;  5HI7 A;  4C1Q A;  5AYF A;  5EX0 A;  3QWP A;  4IJ8 A;  4JLG A;  3M58 A;  4E47 A;  4J8O A; 
#chains in the Genus database with same CATH homology
 3CBM A;  3CBP A;  4RZ0 A;  3K5K A;  1N3J A;  5LSX A;  5KJM A;  4YPU A;  4QEN A;  3MEK A;  5T5G A;  3RQ4 A;  1N6A A;  4J7F A;  4IJD A;  4QEP A;  3QWV A;  5KJN A;  5CPR B;  2W5Y A;  5F6K C;  3TG5 A;  4QEO A;  4YND A;  2W5Z A;  5KJL A;  3MO2 A;  3OPE A;  2O8J A;  5F6L A;  4YPE A;  1ZKK A;  5JIY A;  3HNA A;  3M55 A;  4O6F A;  3DB5 A;  3S7J A;  1MVH A;  4MI5 A;  5EX3 A;  1MVX A;  5EG2 A;  5T0K A;  1H3I A;  3RU0 A;  4JDS A;  3RIB A;  5ARG A;  2JV0 A;  5HQ8 A;  4I51 A;  4YPA A;  3KMT A;  1PEG A;  2BQZ A;  3RAY A;  1XQH A;  5ARF A;  5F59 A;  3DAL A;  3VV0 A;  3SWC A;  3PDN A;  4J83 A;  3M53 A;  5JJ0 A;  3M57 A;  2G46 A;  3M59 A;  5JIN A;  3S7F A;  5JHN A;  4AU7 A;  1ML9 A;  3OXF A;  5TH7 A;  4BUP A;  3EP0 A;  3OXG A;  2QPW A;  4YNM A;  3S8P A;  5TEG A;  3M56 A;  3M5A A;  2RFI A;  2F69 A;  1O9S A;  3F9Y A;  3KMA A;  3RJW A;  3CBO A;  3MO5 A;  3OOI A;  4Z4P A;  5LSZ A;  3FPD A;  4MI0 A;  3S7B A;  5T0M A;  1MUF A;  3M54 A;  5TTF A;  5KJK A;  4H12 A;  3MO0 A;  2R3A A;  3OXL A;  3KMJ A;  3VUZ A;  3IHX A;  4LDG A;  5CCM A;  5CCL A;  4NVQ A;  1MT6 A;  4WUY A;  3S7D A;  3F9X A;  5F5E A;  3F9Z A;  3BO5 A;  4YNP A;  4J7I A;  4O30 A;  4FMU A;  3OS5 A;  1N6C A;  3N71 A;  3SW9 A;  3TG4 A;  3F9W A;  3QWW A;  4NJ5 A;  2IGQ A;  5HI7 A;  4C1Q A;  5AYF A;  5EX0 A;  3QWP A;  4IJ8 A;  4JLG A;  3M58 A;  4E47 A;  4J8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...