2W5YA

Binary complex of the mixed lineage leukaemia (mll1) set domain with the cofactor product s-adenosylhomocysteine.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
177
structure length
170
Chain Sequence
PNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFKLPCNCGAKKCRKFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Requirement of Additional Factors for Mll1 Set Domain Activity and Recognition of Epigenetic Marks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HISTONE-LYSINE N-METHYLTRANSFERASE HRX
total genus 48
structure length 170
sequence length 177
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 2w5yA01
4MI5A 3F9XA 5JIYA 5TEGA 3M56A 3K5KA 3VUZA 4YNDA 3M53A 3TG5A 2BQZA 4I51A 5HI7A 4NJ5A 4YNPA 5JJ0A 3OS5A 5ARFA 3RJWA 5CCLA 4AU7A 1ZKKA 4IJDA 5KJMA 5AYFA 3PDNA 1N6CA 2G46A 3S7FA 5ARGA 2R3AA 3KMTA 5TH7A 3HNAA 3M58A 5KJKA 4JDSA 2O8JA 5CPRB 5KJNA 5EX0A 3S7BA 3RQ4A 3N71A 5T5GA 3OXLA 3OXGA 3SWCA 3S7DA 5T0MA 1N6AA 3CBPA 4E47A 3OOIA 2IGQA 1ML9A 2JV0A 4NVQA 5HQ8A 4J7FA 5LSXA 3F9YA 3S7JA 3CBMA 3M59A 2RFIA 1XQHA 4IJ8A 4YPEA 3TG4A 5LSZA 3MO2A 5TTFA 3MO0A 3KMAA 4BUPA 4O30A 3DB5A 5KJLA 3M5AA 5F5EA 1MT6A 4YPUA 3RU0A 3MO5A 3MEKA 3RIBA 3DALA 4O6FA 5JINA 3F9ZA 3CBOA 3M57A 3M55A 3QWVA 1MVHA 5EX3A 4Z4PA 5T0KA 4LDGA 4H12A 3IHXA 3S8PA 1H3IA 5F6LA 4JLGA 1PEGA 3BO5A 3OPEA 5JHNA 4WUYA 4QENA 5F59A 1N3JA 3QWPA 4J8OA 4FMUA 4YNMA 3EP0A 5F6KC 1O9SA 2W5YA 5CCMA 2W5ZA 4QEPA 3SW9A 1MVXA 4QEOA 4MI0A 3VV0A 1MUFA 3F9WA 5EG2A 4YPAA 4RZ0A 3FPDA 3QWWA 4C1QA 4J7IA 3RAYA 4J83A 3M54A 3KMJA 2F69A 3OXFA 2QPWA
chains in the Genus database with same CATH superfamily
4MI5A 3F9XA 5JIYA 5TEGA 3M56A 3K5KA 3VUZA 4YNDA 3M53A 3TG5A 2BQZA 4I51A 5HI7A 4NJ5A 4YNPA 5JJ0A 3OS5A 5ARFA 3RJWA 5CCLA 4AU7A 1ZKKA 4IJDA 5KJMA 5AYFA 3PDNA 1N6CA 2G46A 3S7FA 5ARGA 2R3AA 3KMTA 5TH7A 3HNAA 3M58A 5KJKA 4JDSA 2O8JA 5CPRB 5KJNA 5EX0A 3S7BA 3RQ4A 3N71A 5T5GA 3OXLA 3OXGA 3SWCA 3S7DA 5T0MA 1N6AA 3CBPA 4E47A 3OOIA 2IGQA 1ML9A 2JV0A 4NVQA 5HQ8A 4J7FA 5LSXA 3F9YA 3S7JA 3CBMA 3M59A 2RFIA 1XQHA 4IJ8A 4YPEA 3TG4A 5LSZA 3MO2A 5TTFA 3MO0A 3KMAA 4BUPA 4O30A 3DB5A 5KJLA 3M5AA 5F5EA 1MT6A 4YPUA 3RU0A 3MO5A 3MEKA 3RIBA 3DALA 4O6FA 5JINA 3F9ZA 3CBOA 3M57A 3M55A 3QWVA 1MVHA 5EX3A 4Z4PA 5T0KA 4LDGA 4H12A 3IHXA 3S8PA 1H3IA 5F6LA 4JLGA 1PEGA 3BO5A 3OPEA 5JHNA 4WUYA 4QENA 5F59A 1N3JA 3QWPA 4J8OA 4FMUA 4YNMA 3EP0A 5F6KC 1O9SA 2W5YA 5CCMA 2W5ZA 4QEPA 3SW9A 1MVXA 4QEOA 4MI0A 3VV0A 1MUFA 3F9WA 5EG2A 4YPAA 4RZ0A 3FPDA 3QWWA 4C1QA 4J7IA 3RAYA 4J83A 3M54A 3KMJA 2F69A 3OXFA 2QPWA
chains in the Genus database with same CATH topology
4MI5A 3F9XA 5JIYA 5TEGA 3M56A 3K5KA 3VUZA 4YNDA 3M53A 3TG5A 2BQZA 4I51A 5HI7A 4NJ5A 4YNPA 5JJ0A 3OS5A 5ARFA 3RJWA 5CCLA 4AU7A 1ZKKA 4IJDA 5KJMA 5AYFA 3PDNA 1N6CA 2G46A 3S7FA 5ARGA 2R3AA 3KMTA 5TH7A 3HNAA 3M58A 5KJKA 4JDSA 2O8JA 5CPRB 5KJNA 5EX0A 3S7BA 3RQ4A 3N71A 5T5GA 3OXLA 3OXGA 3SWCA 3S7DA 5T0MA 1N6AA 3CBPA 4E47A 3OOIA 2IGQA 1ML9A 2JV0A 4NVQA 5HQ8A 4J7FA 5LSXA 3F9YA 3S7JA 3CBMA 3M59A 2RFIA 1XQHA 4IJ8A 4YPEA 3TG4A 5LSZA 3MO2A 5TTFA 3MO0A 3KMAA 4BUPA 4O30A 3DB5A 5KJLA 3M5AA 5F5EA 1MT6A 4YPUA 3RU0A 3MO5A 3MEKA 3RIBA 3DALA 4O6FA 5JINA 3F9ZA 3CBOA 3M57A 3M55A 3QWVA 1MVHA 5EX3A 4Z4PA 5T0KA 4LDGA 4H12A 3IHXA 3S8PA 1H3IA 5F6LA 4JLGA 1PEGA 3BO5A 3OPEA 5JHNA 4WUYA 4QENA 5F59A 1N3JA 3QWPA 4J8OA 4FMUA 4YNMA 3EP0A 5F6KC 1O9SA 2W5YA 5CCMA 2W5ZA 4QEPA 3SW9A 1MVXA 4QEOA 4MI0A 3VV0A 1MUFA 3F9WA 5EG2A 4YPAA 4RZ0A 3FPDA 3QWWA 4C1QA 4J7IA 3RAYA 4J83A 3M54A 3KMJA 2F69A 3OXFA 2QPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI5 A;  3F9X A;  5JIY A;  5TEG A;  3M56 A;  3K5K A;  3VUZ A;  4YND A;  3M53 A;  3TG5 A;  2BQZ A;  4I51 A;  5HI7 A;  4NJ5 A;  4YNP A;  5JJ0 A;  3OS5 A;  5ARF A;  3RJW A;  5CCL A;  4AU7 A;  1ZKK A;  4IJD A;  5KJM A;  5AYF A;  3PDN A;  1N6C A;  2G46 A;  3S7F A;  5ARG A;  2R3A A;  3KMT A;  5TH7 A;  3HNA A;  3M58 A;  5KJK A;  4JDS A;  2O8J A;  5CPR B;  5KJN A;  5EX0 A;  3S7B A;  3RQ4 A;  3N71 A;  5T5G A;  3OXL A;  3OXG A;  3SWC A;  3S7D A;  5T0M A;  1N6A A;  3CBP A;  4E47 A;  3OOI A;  2IGQ A;  1ML9 A;  2JV0 A;  4NVQ A;  5HQ8 A;  4J7F A;  5LSX A;  3F9Y A;  3S7J A;  3CBM A;  3M59 A;  2RFI A;  1XQH A;  4IJ8 A;  4YPE A;  3TG4 A;  5LSZ A;  3MO2 A;  5TTF A;  3MO0 A;  3KMA A;  4BUP A;  4O30 A;  3DB5 A;  5KJL A;  3M5A A;  5F5E A;  1MT6 A;  4YPU A;  3RU0 A;  3MO5 A;  3MEK A;  3RIB A;  3DAL A;  4O6F A;  5JIN A;  3F9Z A;  3CBO A;  3M57 A;  3M55 A;  3QWV A;  1MVH A;  5EX3 A;  4Z4P A;  5T0K A;  4LDG A;  4H12 A;  3IHX A;  3S8P A;  1H3I A;  5F6L A;  4JLG A;  1PEG A;  3BO5 A;  3OPE A;  5JHN A;  4WUY A;  4QEN A;  5F59 A;  1N3J A;  3QWP A;  4J8O A;  4FMU A;  4YNM A;  3EP0 A;  5F6K C;  1O9S A;  2W5Y A;  5CCM A;  2W5Z A;  4QEP A;  3SW9 A;  1MVX A;  4QEO A;  4MI0 A;  3VV0 A;  1MUF A;  3F9W A;  5EG2 A;  4YPA A;  4RZ0 A;  3FPD A;  3QWW A;  4C1Q A;  4J7I A;  3RAY A;  4J83 A;  3M54 A;  3KMJ A;  2F69 A;  3OXF A;  2QPW A; 
#chains in the Genus database with same CATH topology
 4MI5 A;  3F9X A;  5JIY A;  5TEG A;  3M56 A;  3K5K A;  3VUZ A;  4YND A;  3M53 A;  3TG5 A;  2BQZ A;  4I51 A;  5HI7 A;  4NJ5 A;  4YNP A;  5JJ0 A;  3OS5 A;  5ARF A;  3RJW A;  5CCL A;  4AU7 A;  1ZKK A;  4IJD A;  5KJM A;  5AYF A;  3PDN A;  1N6C A;  2G46 A;  3S7F A;  5ARG A;  2R3A A;  3KMT A;  5TH7 A;  3HNA A;  3M58 A;  5KJK A;  4JDS A;  2O8J A;  5CPR B;  5KJN A;  5EX0 A;  3S7B A;  3RQ4 A;  3N71 A;  5T5G A;  3OXL A;  3OXG A;  3SWC A;  3S7D A;  5T0M A;  1N6A A;  3CBP A;  4E47 A;  3OOI A;  2IGQ A;  1ML9 A;  2JV0 A;  4NVQ A;  5HQ8 A;  4J7F A;  5LSX A;  3F9Y A;  3S7J A;  3CBM A;  3M59 A;  2RFI A;  1XQH A;  4IJ8 A;  4YPE A;  3TG4 A;  5LSZ A;  3MO2 A;  5TTF A;  3MO0 A;  3KMA A;  4BUP A;  4O30 A;  3DB5 A;  5KJL A;  3M5A A;  5F5E A;  1MT6 A;  4YPU A;  3RU0 A;  3MO5 A;  3MEK A;  3RIB A;  3DAL A;  4O6F A;  5JIN A;  3F9Z A;  3CBO A;  3M57 A;  3M55 A;  3QWV A;  1MVH A;  5EX3 A;  4Z4P A;  5T0K A;  4LDG A;  4H12 A;  3IHX A;  3S8P A;  1H3I A;  5F6L A;  4JLG A;  1PEG A;  3BO5 A;  3OPE A;  5JHN A;  4WUY A;  4QEN A;  5F59 A;  1N3J A;  3QWP A;  4J8O A;  4FMU A;  4YNM A;  3EP0 A;  5F6K C;  1O9S A;  2W5Y A;  5CCM A;  2W5Z A;  4QEP A;  3SW9 A;  1MVX A;  4QEO A;  4MI0 A;  3VV0 A;  1MUF A;  3F9W A;  5EG2 A;  4YPA A;  4RZ0 A;  3FPD A;  3QWW A;  4C1Q A;  4J7I A;  3RAY A;  4J83 A;  3M54 A;  3KMJ A;  2F69 A;  3OXF A;  2QPW A; 
#chains in the Genus database with same CATH homology
 4MI5 A;  3F9X A;  5JIY A;  5TEG A;  3M56 A;  3K5K A;  3VUZ A;  4YND A;  3M53 A;  3TG5 A;  2BQZ A;  4I51 A;  5HI7 A;  4NJ5 A;  4YNP A;  5JJ0 A;  3OS5 A;  5ARF A;  3RJW A;  5CCL A;  4AU7 A;  1ZKK A;  4IJD A;  5KJM A;  5AYF A;  3PDN A;  1N6C A;  2G46 A;  3S7F A;  5ARG A;  2R3A A;  3KMT A;  5TH7 A;  3HNA A;  3M58 A;  5KJK A;  4JDS A;  2O8J A;  5CPR B;  5KJN A;  5EX0 A;  3S7B A;  3RQ4 A;  3N71 A;  5T5G A;  3OXL A;  3OXG A;  3SWC A;  3S7D A;  5T0M A;  1N6A A;  3CBP A;  4E47 A;  3OOI A;  2IGQ A;  1ML9 A;  2JV0 A;  4NVQ A;  5HQ8 A;  4J7F A;  5LSX A;  3F9Y A;  3S7J A;  3CBM A;  3M59 A;  2RFI A;  1XQH A;  4IJ8 A;  4YPE A;  3TG4 A;  5LSZ A;  3MO2 A;  5TTF A;  3MO0 A;  3KMA A;  4BUP A;  4O30 A;  3DB5 A;  5KJL A;  3M5A A;  5F5E A;  1MT6 A;  4YPU A;  3RU0 A;  3MO5 A;  3MEK A;  3RIB A;  3DAL A;  4O6F A;  5JIN A;  3F9Z A;  3CBO A;  3M57 A;  3M55 A;  3QWV A;  1MVH A;  5EX3 A;  4Z4P A;  5T0K A;  4LDG A;  4H12 A;  3IHX A;  3S8P A;  1H3I A;  5F6L A;  4JLG A;  1PEG A;  3BO5 A;  3OPE A;  5JHN A;  4WUY A;  4QEN A;  5F59 A;  1N3J A;  3QWP A;  4J8O A;  4FMU A;  4YNM A;  3EP0 A;  5F6K C;  1O9S A;  2W5Y A;  5CCM A;  2W5Z A;  4QEP A;  3SW9 A;  1MVX A;  4QEO A;  4MI0 A;  3VV0 A;  1MUF A;  3F9W A;  5EG2 A;  4YPA A;  4RZ0 A;  3FPD A;  3QWW A;  4C1Q A;  4J7I A;  3RAY A;  4J83 A;  3M54 A;  3KMJ A;  2F69 A;  3OXF A;  2QPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...