2W6BA

Crystal structure of the trimeric beta-pix coiled-coil domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
SKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 7
publication title Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 21
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2w6bA00
3EQ2A 2W6BA 3L4FA 2YKQA 1JOCA 3BRTB 3CL3D 2YKPA 2YKOA 3BRVB
chains in the Genus database with same CATH superfamily
3D70A 2I8DA 3RL0g 3BVHA 2QVAA 1JY3P 1T3JA 2K9JA 4N78E 1EZVG 1RQUA 1AJYA 1MKMA 2IFMA 1ZV8A 2B87B 2E74C 3L71D 1KTMA 2POHA 2R5DA 4OWFA 1T2KC 1BE3D 1KZUB 2YO3A 1DD3A 3B8EB 2O01N 1IC2A 3GMAA 2HG5D 1G1IA 1XTCC 1L4AB 1KQGB 1NTKJ 3H1LE 2RH0A 4DT0A 3ABVC 4MN4C 1A02J 4IFFA 1SQVJ 2IBZI 3H1HG 2RKLA 2WT7A 3VP9A 2GA1A 1FDIA 3U1AA 2OYHA 2Y0DA 1GZLA 3SWFA 1OFCX 1X9VA 1IZNB 2C9NY 1W2EA 3LW5H 5CCHA 3L72D 1YITP 1KC8Q 3E1RA 1L0NJ 2IZ0A 1M56D 3KHUA 4ZKUA 1UIXA 2PRRA 2GM4A 1U7JA 1FDMA 5AW8B 3Q5RA 1SQVE 3E1IA 1GTWA 4Y28J 4H44B 1BCCE 1KILC 3RK2C 4HKZH 4PD4I 3HD7A 4UB6E 2QRXA 2KZIA 3RL0B 2K9JB 1VF5C 1SVFA 2M0BA 2ZXEB 3H1IJ 1AVYA 3F89A 2ZT9C 2WMMA 2YMKA 1M7LA 1SFCA 3L74E 3PTZA 5AW0B 1GD2E 5CCGA 1YQ4C 3NMDA 3USSA 3B5NC 1KFNA 1LNQA 3V2NA 2NPSD 5BVZA 2O01J 2WT7B 1FC2C 1AA0A 3H1JE 2Q9IA 1JO5A 1L0LK 4GOEA 2OYHB 4KHXA 2WITA 3L73E 3N4XA 1QGKB 2M3EA 2Y9YA 1GDTA 3IR9A 1VPCA 2FYNC 1OWAA 1S9KE 1SQPE 1JOCA 1P84E 1HGZA 5AVSB 2N9YB 4WY4C 2O3JA 3L71G 1FS0E 2D2CB 1USDA 3HE4A 2XV5A 4L75A 4U3FD 1BE3G 1LTJC 2FXMA 1BSHA 1HWTC 1VL2A 3FXEA 3HD7B 1KD1Q 4BWNA 3LW5J 4NPDA 3PP5A 1L0LD 2WVRA 2A06E 3P7KA 2WWWA 3TF5A 2W27A 3HUSA 3AEFC 2YO2A 1SFCB 2H7HA 1KB9D 1GK6A 4ZMDA 1SQBJ 1BSNA 1M1JA 3BASA 1PGJA 3VMYA 4GOFA 1HBWA 1S3JA 4KJMA 3L72G 3CD6P 1M1KQ 4I7ZC 4XE5B 5AW9B 5AVTB 3L75E 2H43A 1RF1C 5KLIB 3T97A 1J1DB 1SQXJ 2K88A 3CXHH 5KLVK 5KAFH 1NVOA 5K5GB 2XDJA 1JY3N 5AVWB 3S4RA 4U7JA 1Q90D 2XZRA 3WU2E 2NRGA 1VQ8P 2J5UA 1N7SC 3Q3DA 2NZ2A 2M8RA 2GUSA 1LWUC 3IFMA 1WT6A 2WZ7A 3HE4B 4R4MA 1EDIA 3CX5I 4ZNCA 1RY3A 1EZVE 3CMEP 2N1TC 5APSA 1Z56A 2KSJA 3JCUH 4WVZA 3A5TA 5KLVD 2MJZA 1KQSO 3OJAB 4XA4A 1K8AQ 1DX7A 3HUSB 2J59M 1LTIC 1MZ9A 1FZCA 5C39A 4LGDE 5AVVB 1IO4A 2K3RA 2WSEH 2IX7C 4JPZB 3H1HE 2HLOA 4W7YA 1M1JB 1ZR4A 1CI6A 2WPSA 3MUDA 1T6AA 1PL5A 2FXOA 1KYOE 3KPEA 1FZEA 2C0WA 4U3FG 1NAYA 3T97B 4RESB 3P8MC 1SP4A 1YBKA 1L4AC 1H88A 3TSIA 3M06A 4JYBA 3EWKA 2LR2A 3CWBJ 3D6ZA 3UIAA 1LTAC 1L0LG 1X0TA 2JKVA 2WPVB 5TJHA 1S1CX 2FYUK 1URQC 2WTYA 1VQ6P 2WPQA 4K35A 3L70D 5TISE 2OYIA 2BCCD 2E76C 1NYHA 1JUNA 2Q7CA 3VMXA 4R4LA 3HRNA 1N8RQ 1IK9A 2BEZF 5B5EE 2P10A 3FXDA 2IYOA 3EFGA 4OH8B 1JY3O 2R3CA 4H44C 2YXQB 1BGYJ 1S2EA 2KSEA 2ZYDA 3IAOA 3CCLP 2FBWC 1GL2A 2L91A 3RL0C 2CPSA 4Y99C 1FZCB 1DEBA 2KLUA 3A0HE 1CZQA 5B66E 3M0DA 2FYUD 3CXHE 3CCJP 4D6TD 2PFXA 3GF7A 1CI6B 1YJ9P 1N2DC 2H88C 1X8YA 1MFZA 2AXTE 1SQQE 3P32A 3L36A 3TDKA 1ZRTD 1IK7A 2V7QH 1BDCA 3BCCD 3RGUA 2C9LY 1PV3A 4H13B 1J1EB 3SWYA 1QL2A 5H2FE 2WSEJ 1CSBA 1K73Q 1N7LA 2P58A 4H0LB 2QJPB 3AE2C 5KLVG 1BE3E 4WBAA 4UB6H 1S5LE 5CJ4A 3I56P 1NTMJ 2G8YA 2OYIB 2IBZD 5CCHD 2A45H 3TGUJ 1VQPP 5KTBA 5APVA 1KQFB 4N3YB 2D2CC 3LIDA 2MKVA 1H89A 3II6A 3CI9A 2YKOA 3HD7C 2E43A 1GL2B 3HD7D 1ZN5A 1JM0A 3L72E 1Y8AA 1ZXGA 2JP3A 4ASWA 1LTSC 3GW6A 2ZVOB 2LXBA 1MUUA 1RHZB 2R3SA 3TGUE 1YTZI 2JWDA 2KS1A 3AE3C 1SFCD 1G2CA 4PD4D 2IZ1A 3SFEC 2KK7A 3L70G 4TT3H 5CCGD 1LP1A 4TLFA 2FXPA 2BASA 2CPBA 1P84H 2BCCG 3H1LJ 2ZXXA 4IL6E 2QJYB 3CCVP 3V6IA 5KLIC 2O01H 1OVRA 3LIEA 2KZJA 1CW5A 2OTKE 2V7QJ 2FFDC 3Q2YA 3K5BA 5GTIE 3CLQA 1R8EA 1PP9E 1G1JA 2JR8A 2FYUG 2ZVNB 4D6TG 1NU1D 2QE7H 3G71P 1VQ4P 4IFDK 2M5AA 2QEXP 1BCCJ 2V4HA 1IFIA 3G3ZA 3WUUA 3BCCG 3TNUA 1DEEG 1KN7A 4PV1B 2AEMA 4YXDC 1JNMA 3V2QA 3CMAP 1YJWP 3L74J 1ZOYC 4U3FE 2KS1B 1G2CB 3WU2H 1K04A 4AQRD 1HJBA 4RJTA 1LP1B 2ITAA 2QJKC 4GODA 2IBZG 3P8CD 2P1JA 2R32A 1LT9C 1EDKA 1L0LE 1NTZD 2QA4P 2Q5UA 3L37A 3CCUP 3H1JJ 3MTUE 3WUTA 5KKZB 2R5BA 1M57D 1S72P 1KB9E 3L73J 4OGQB 3CXHI 1YTZT 2K37A 1SQPJ 2OGUA 1W5CE 1HUCA 3AEGC 5M1BA 1H8AA 1EXJA 2P67A 2NPSC 2E75D 1R5SA 1E5WA 1QVFO 1PPJD 1JEKA 2M5AB 1X79B 4AYCA 3D71A 5AVXB 1ZLLA 3CCQP 3PRJA 1KFMA 3TNUB 1LTTC 2Y9ZA 2O1KA 1KYOH 5DJUB 1N73A 4JQ0D 4L74A 3CX5D 2VRSA 4YTPC 2KP8A 3CC2P 4C7NA 1AQ5A 1QVGO 3V4QA 3Q1MA 1FZCC 3N7NA 5CMZA 3V5BA 3RK3D 1L0NK 5AVQB 2JJLA 5KLVE 3IF4A 3L75J 5TISH 1NU1G 4GT1A 2Z5HA 1KQLA 1NTKD 3FGAD 4H13C 4H13D 1SQVD 2W8ZA 4WB4A 5B5EH 4K3AA 3H1KE 4KT0J 2GUVA 4H0LC 1OZHA 4H0LD 1K05A 2AXCA 4I6MC 3W68A 1VQLP 2RMZA 1EQ7A 2Z4EA 5KJ7A 1OVUA 1FZAA 1L0ND 3EQ2A 3A0HH 2OYOA 1E79H 2CK3H 5B66H 1FDOA 4PJ0E 1DIPA 1AV1A 1KILA 1LT1A 2AXTH 1NTZG 1RF0A 1N73B 1NO4A 2YMYA 3F5HA 3CCSP 4A7PA 3L70E 4L73A 2E74B 2BCCE 3AEEC 4C7NB 5CBNA 1GL2D 5H2FH 2Q3EA 3CCMP 1USEA 3H1HJ 3H1ID 2R44A 1Y47A 3M9QA 1R5LA 5GTHE 3B5NA 1GU5A 1S5LH 3AEBC 1OW6A 1QLED 2G3AA 1LTBC 1TU3F 1PPJG 3A7OA 2W83C 5APYA 4LLHA 3C8VA 1YI2P 3SSUA 1JTHA 2FYUE 4D6TE 4DJGA 2OTJP 3PJSK 4EYYQ 3HE5A 5AVRB 2E5TA 3H1LG 3NTNA 1W2BO 4WY4A 1ZRTE 2J58A 3BCCE 2B88A 3A3YB 1SQBK 5AW3B 2A45I 5BU8B 1S4XA 1KILB 3RK2B 1LJ2A 2OTLP 4HYTB 1EDJA 4L76A 4DOJA 1VF5B 1N86A 2JDIH 4YPCA 1SQXK 3Q5SA 1NTKG 2ZT9B 4IL6H 2E75B 3RBZA 4PV1D 1SQVG 2JWAA 1IFMA 1JCCA 4BRYA 1VQNP 5AW5B 4DCKA 3PLNA 4NPEA 3ITKA 5AW2B 4EIJA 4N6JA 1VQMP 3HTKA 1JMMA 3B5NB 1SQQJ 1SQBD 5GTIH 1RF1A 1RE3A 1L0NG 4YXWH 1P84I 1JTHB 1T8ZA 2K9YA 1SQXD 1BE3J 3RK3B 3C9IA 1N7SA 3HE5B 1T3UA 4PD4E 3EFFK 2L5GB 4OGQD 1YJNP 3QWOC 3O8ZA 1LWUA 4WY4B 1OW8A 1QEXA 1EDLA 2PP6A 2KI7B 3H1IG 2UWJE 3FX0A 5BU5A 4I1LA 2QM7A 3L71E 3IN6A 1U57A 2IDBA 2AEFA 2OYHC 1NH4A 1EC5A 3L72J 3E7KA 2FY8A 3VN0A 3JSVC 4ASVA 5CCHC 4BRYB 3KZIE 3VOPA 1KB9H 3B4SA 3AEDC 1JY2P 3TK1A 3MD0A 3AE6C 1FU1A 1IFJA 2KLVA 2Z5IA 1FZGA 1RF1B 2Q3IA 3CL3D 1KV4A 1VQOP 1L4AA 2ZJSE 1NWQA 3S1KA 3G6EP 1AQTA 3CCEP 4B86A 3BATA 1VQ5P 4EI2A 1N7SB 1EZVI 1FAVA 1SFCC 1URQA 1YYCA 1LWUB 4NPFX 3L75G 3CWBD 1NU1K 5CCGC 1PP9J 3P8CE 4RKUJ 2XKMA 2KNCA 2OARA 3S9OA 1U7MA 1NTZE 3D6YA 1LGHB 3CXHD 3L4FA 3RBXA 1SQBG 1NJIQ 2DW3A 1IFNA 1J1DC 5E79E 1SQQD 3V2PA 1ZR2A 2Y0EA 5APTA 1YIJP 1N73C 1BGYD 3OAKA 1KYOI 2C0XA 3OA7A 1S5LX 1SQXG 4U3FJ 4JBZA 2ZAEB 2E74D 2WSCH 2O1JA 3M9HA 1PPJE 1FBMA 1T2KD 3U1CA 1NTZK 1J2JB 1NTMK 1VQ9P 1JCDA 2WSFH 3KXDA 1PGQA 5KAIE 1L0LJ 4GKGA 1VQ7P 1HVVA 3CX5E 1OX3A 5AW1B 2ZYGA 1OW7A 3HUSC 4PJ0H 1URQB 3BRVB 3RK3E 5APWA 4O9BA 3AE5C 1FZBA 1M1JC 2KNCB 2E76B 4UB8E 2XNDH 1SLQA 3GF3A 5CJ0A 3H32A 3H25A 3CPWO 1DD4A 1NTMD 5KJ7C 1NTKE 5KJ7D 3SFDC 3TGUD 2YKPA 4EOTA 4IL6X 3GHGA 4JYCA 1NAFA 5GTHH 2H8PD 1KILD 3AE7C 3RK2D 3V4WA 2Q6QA 4Y99B 1RF0C 1VF5D 1Y9BA 3H6PA 4QMAA 1RE4A 2QM8A 4N78D 1LTGC 1HTLC 1MV8A 2ZT9D 2E75C 4W7ZA 1L0NE 2HPCA 1FOSE 3FWNA 2KIKA 4JF7A 2WSSH 1H0TA 3CWBG 1DH3A 2B89A 3A0BE 3PHLA 5KLVJ 1PGOA 4CPGA 1NTKK 3B5ND 2JEEA 1M8OB 1PP9D 2M3BA 1SQVK 4EDFA 2Y0CA 1WRGA 3H1LD 3KQGA 2WSCJ 3I5CA 3MP7B 4ZKPA 1ZP0C 1FJPA 3H1IE 4W80A 1SQQG 2WPRA 3M0AA 3H1KJ 2WSFJ 4GIFA 2ZYAA 2FFDA 3RK3C 2YIUB 1BGYG 4LC1A 2QIWA 3MUDC 2W6JH 1JY2N 3H32B 1HGVA 4WY4D 2ZFCA 1KORA 3GHGB 2I1JA 1QL1A 1J1EC 1BCCD 1Q81Q 3AE1C 1HH0A 3L70J 2QJPC 4C7RA 2BCCJ 2OQQA 1OIPA 5AW6B 1FZFA 1QX8A 2HPCB 1SQPK 1GW4A 2OYIC 5AVZB 1L2PA 2YXRB 1H0TB 4Z1MH 3L74D 2KXPB 4PD4H 3OW2O 2HR3A 3GLMA 1LT9A 4BXLA 1VDFA 1NTMG 3U59A 4AUWA 3AE9C 1WMKA 1AVOA 3TGUG 1RE3C 2JO1A 3CCRP 4IFMA 3B71A 4M3LA 2HYNA 3NFQA 5CBOA 1SS1A 2FYUJ 1GL2C 3H1JD 4D6TJ 2KUBA 1Q7YQ 2P2UA 3A2AA 1IJDB 3WMM0 3AECC 3L73D 3ZDMA 2FFDB 1M90Q 2KB7P 3M0DC 3M9BA 1SQBE 1N7SD 2N9BA 3TYYA 3O6QA 2HFED 1S9KD 2E42A 1BDDA 3BCCJ 1SQPD 2NPSA 1P84D 1PIXA 1NKZB 1PZQA 2P7JA 3M91A 1A02F 1XTGB 3KZIH 3NXSA 3VP8A 2I1KA 2N1TD 1SQXE 1RH5B 2QJYC 3VMAA 4IOIH 1PP9G 1NKNA 1HJ0A 3CC7P 3W67A 2A06D 1NGMB 4HB1A 2H89C 2K1AA 1FOSF 1PGPA 3JC22 1YHQP 1JY2O 5AW4B 1LTJA 1OXZA 1OMIA 2QJKB 4GDOA 1KB9I 3H1KD 3KDPB 3CC4P 5APXA 3PH0A 1LT9B 4HH2A 3R2PA 3G9RA 3VTPC 2QG4A 1GU4A 4OVNF 2W90A 5L8RJ 3L75D 1L4AD 4PV1C 5AW7B 1PFIA 2IBZE 2YKQA 2IFNA 1BCCG 2YNYA 3BRTB 1UIIA 5E79H 2W6BA 2QSIA 2FYZA 3O6QB 1JMBA 1URQD 2NPSB 2A45G 3MZWB 2E76D 1KMIZ 3L74G 3MHVA 3C1LA 1ZMEC 3L71J 1EXIA 1EZVD 2Q1KA 2HODA 5KKZC 2FYNB 3QH9A 4XFJA 2IPPA 4H44D 4OGQC 5KAIH 3CWBE 1D7MA 1ZW0A 2E5YA 2KOGA 3I55P 3Q5PA 3MIWA 3RL0D 3CX5H 2PAJA 3H1JG 1NU1J 2LKMA 1FJKA 3SWKA 1K9MQ 2AEJA 1LTJB 2XU6A 3L73G 4WWIA 1IFDA 5KAFE 2N1TA 5AVYB 3H1HD 1SQPG 1GW3A 5CHXA 3WUVA 4UB8H 1IFPA 1NHLA 1KYOD 3AE8C 1Q86Q 3AE4C 1BGYE 2XNXA 4RO0A 1YQ3C 1Q82Q 5EFWB 1AFOA 2WQYC 2LXCB 1NU1E 2B87A 1NOHA 3KYQA 5AVUB 3HTKB 1HF9A 2A06G 5DJTB 4C46A 4I7ZB 3JCUE 1NTZJ 2YIUC 3R4YA 1VQKP 4HJGH 3MGNA 2IYPA 2RN0A 2W6AA 1SQQK 3H1KG 3VMZA 5APQA 2D2CD 3GG2A 1Q2NA 1GK4A 2HODB 2FKWB 3GHGC 1X22A 3A0BH 3L35A 1MFTA 3VYIA 2BEQD 2B9BA 1FE6A 3FWLA 5APUA 4I2LC 4DZOA 1GMJA 3G4SP 3AEAC 2KYVA 1RE4C 1NTME 3V2RA 2N1TB 1JB0J 1RQVA 1OVVA 2SPZA 2PGDA 1KILE
chains in the Genus database with same CATH topology
1GL2A 1DH3A 3RL0C 3BVHA 2CPSA 4Y99C 1FZCB 3M9QA 1JY3P 1DEBA 1NTKK 1T3JA 3B5ND 4N78E 2JEEA 1CZQA 2M3BA 3M0DA 3B5NA 1SQVK 1GU5A 1WRGA 1CI6B 2IFMA 1ZV8A 1N2DC 3KQGA 3I5CA 2POHA 1X8YA 2R5DA 4ZKPA 1LTBC 1MFZA 3P32A 1FJPA 3L36A 4W80A 1T2KC 1KZUB 2YO3A 3A7OA 2WPRA 3B8EB 3M0AA 1IC2A 5APYA 4LLHA 2C9LY 4GIFA 2HG5D 2FFDA 1JTHA 1G1IA 3RK3C 1J1EB 3SWYA 1XTCC 1QL2A 1L4AB 4LC1A 1JY2N 1CSBA 3H32B 3HE5A 5AVRB 4IFFA 1A02J 1HGVA 4WY4D 1N7LA 3NTNA 2WT7A 2ZFCA 3VP9A 4WY4A 2J58A 3U1AA 4WBAA 2OYHA 3GHGB 3A3YB 1SQBK 5AW3B 1GZLA 3SWFA 5CJ4A 2I1JA 1X9VA 1QL1A 2C9NY 2OYIB 1J1EC 2A45I 5CCHD 2A45H 5BU8B 1W2EA 3LW5H 5CCHA 5KTBA 5APVA 1KILB 3RK2B 1HH0A 4HYTB 4N3YB 4C7RA 4DOJA 3LIDA 1N86A 4ZKUA 1H89A 2GM4A 5AW6B 1SQXK 1FZFA 2HPCB 1FDMA 5AW8B 3II6A 3CI9A 1SQPK 1GW4A 3E1IA 2OYIC 2YKOA 1GTWA 5AVZB 3HD7C 1IFMA 2E43A 1JCCA 1GL2B 3HD7D 1ZN5A 5AW5B 1KILC 3RK2C 3HD7A 5AW2B 1LTSC 4EIJA 3RL0B 4N6JA 1LT9A 1SVFA 3HTKA 1JMMA 2ZXEB 1MUUA 1VDFA 3B5NB 3U59A 4AUWA 1YTZI 1SFCD 1G2CA 1RE3C 4IFMA 1M7LA 1SFCA 4M3LA 1RF1A 2HYNA 1RE3A 3NFQA 5CCGD 1GL2C 5AW0B 2BASA 2CPBA 1GD2E 5CCGA 2P2UA 3A2AA 1IJDB 3WMM0 3NMDA 2FFDB 1JTHB 1T8ZA 2KB7P 3M0DC 3B5NC 3M9BA 1KFNA 3V2NA 1N7SD 2N9BA 3TYYA 3RK3B 2NPSD 2HFED 3C9IA 1S9KD 5BVZA 2E42A 1N7SA 3HE5B 2NPSA 1T3UA 2L5GB 2O01H 2WT7B 1NKZB 2P7JA 1LWUA 3O8ZA 4WY4B 3LIEA 3M91A 1A02F 2Q9IA 1JO5A 1XTGB 1L0LK 1CW5A 2OYHB 3NXSA 4KHXA 3VP8A 2WITA 2I1KA 3N4XA 2PP6A 2FFDC 2N1TD 3CLQA 1GDTA 3IR9A 1VPCA 1OWAA 1S9KE 1G1JA 5BU5A 1JOCA 4I1LA 2QM7A 1NKNA 1HGZA 5AVSB 4WY4C 4IFDK 2OYHC 3HE4A 2XV5A 1IFIA 1NH4A 1FOSF 3G3ZA 1LTJC 2FXMA 1JY2O 5AW4B 3TNUA 1LTJA 3VN0A 1OXZA 5CCHC 1JNMA 3V2QA 1HWTC 3HD7B 3KDPB 5APXA 3VOPA 3PP5A 1LT9B 4HH2A 3R2PA 1JY2P 3TK1A 3MD0A 3VTPC 3P7KA 1FU1A 1GU4A 2WWWA 1IFJA 2W27A 1G2CB 3HUSA 2KLVA 2YO2A 2Z5IA 4AQRD 1SFCB 2H7HA 1HJBA 1GK6A 1FZGA 1RF1B 1L4AD 2Q3IA 5AW7B 3CL3D 1PFIA 1L4AA 2YKQA 1NWQA 3P8CD 1M1JA 2P1JA 2IFNA 3BASA 3VMYA 1HBWA 2R32A 1LT9C 2YNYA 3BRTB 2Q5UA 2W6BA 3L37A 4B86A 3BATA 2FYZA 3MTUE 4XE5B 1N7SB 5AW9B 2R5BA 1URQD 2NPSB 5AVTB 1FAVA 1SFCC 1URQA 2A45G 2H43A 1RF1C 1YYCA 3T97A 1LWUB 1J1DB 1YTZT 5KLVK 1NU1K 5CCGC 3P8CE 2XKMA 2OARA 2XDJA 1JY3N 5AVWB 2XZRA 1LGHB 1HUCA 1H8AA 2P67A 2HODA 1N7SC 3L4FA 2NPSC 2M8RA 2IPPA 1IFNA 2GUSA 1LWUC 1J1DC 1E5WA 2KOGA 3IFMA 1WT6A 2WZ7A 3HE4B 3MIWA 1X79B 4AYCA 3V2PA 1ZR2A 3RL0D 2PAJA 5AVXB 1ZLLA 1RY3A 2LKMA 5APTA 1FJKA 1KFMA 3TNUB 1LTTC 2N1TC 1LTJB 1N73C 2XU6A 3OAKA 1IFDA 2O1KA 2C0XA 2N1TA 5AVYB 3OA7A 1N73A 5APSA 1Z56A 2KSJA 2WSCH 3A5TA 2O1JA 3M9HA 2VRSA 1GW3A 5CHXA 2MJZA 2KP8A 3OJAB 4XA4A 4C7NA 1AQ5A 1FBMA 1T2KD 3U1CA 1NTZK 3V4QA 1J2JB 1NTMK 1DX7A 1FZCC 1NHLA 1JCDA 3N7NA 3HUSB 5CMZA 2J59M 2WSFH 3V5BA 1LTIC 1MZ9A 2XNXA 1FZCA 4LGDE 3RK3D 5AVVB 1AFOA 1IO4A 2WSEH 1L0NK 2IX7C 4GKGA 2HLOA 4W7YA 1M1JB 5AVQB 1ZR4A 2JJLA 1CI6A 1HVVA 2WPSA 3MUDA 5AW1B 1NOHA 3KYQA 5AVUB 3HTKB 2Z5HA 4GT1A 1KQLA 3HUSC 3KPEA 4C46A 1URQB 3BRVB 1FZEA 2C0WA 4RESB 3P8MC 1SP4A 4WB4A 1L4AC 5APWA 3MGNA 4O9BA 1H88A 1FZBA 1M1JC 3TSIA 1SLQA 3M06A 5CJ0A 2W6AA 4JYBA 1SQQK 2GUVA 3H32A 3VMZA 5APQA 1GK4A 4I6MC 5KJ7C 3UIAA 2HODB 1LTAC 2FKWB 3GHGC 5KJ7D 1EQ7A 2Z4EA 2YKPA 5KJ7A 4EOTA 2FYUK 1URQC 3GHGA 4JYCA 2WTYA 2WPQA 3L35A 1FZAA 1NAFA 3VYIA 3EQ2A 5APUA 2OYIA 4I2LC 2H8PD 4DZOA 1JUNA 2Q7CA 1KILD 3RK2D 3HRNA 3VMXA 1IK9A 3V4WA 1KILA 4Y99B 2KYVA 1RE4C 1RF0C 3H6PA 3V2RA 1RE4A 1RF0A 2N1TB 2QM8A 1N73B 1NO4A 4N78D 1LTGC 2YMYA 1HTLC 1MV8A 3EFGA 4OH8B 4W7ZA 1JY3O 2HPCA 2R3CA 1FOSE 4C7NB 4JF7A 1GL2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQ2 A;  2W6B A;  3L4F A;  2YKQ A;  1JOC A;  3BRT B;  3CL3 D;  2YKP A;  2YKO A;  3BRV B; 
#chains in the Genus database with same CATH topology
 3D70 A;  2I8D A;  3RL0 g;  3BVH A;  2QVA A;  1JY3 P;  1T3J A;  2K9J A;  4N78 E;  1EZV G;  1RQU A;  1AJY A;  1MKM A;  2IFM A;  1ZV8 A;  2B87 B;  2E74 C;  3L71 D;  1KTM A;  2POH A;  2R5D A;  4OWF A;  1T2K C;  1BE3 D;  1KZU B;  2YO3 A;  1DD3 A;  3B8E B;  2O01 N;  1IC2 A;  3GMA A;  2HG5 D;  1G1I A;  1XTC C;  1L4A B;  1KQG B;  1NTK J;  3H1L E;  2RH0 A;  4DT0 A;  3ABV C;  4MN4 C;  1A02 J;  4IFF A;  1SQV J;  2IBZ I;  3H1H G;  2RKL A;  2WT7 A;  3VP9 A;  2GA1 A;  1FDI A;  3U1A A;  2OYH A;  2Y0D A;  1GZL A;  3SWF A;  1OFC X;  1X9V A;  1IZN B;  2C9N Y;  1W2E A;  3LW5 H;  5CCH A;  3L72 D;  1YIT P;  1KC8 Q;  3E1R A;  1L0N J;  2IZ0 A;  1M56 D;  3KHU A;  4ZKU A;  1UIX A;  2PRR A;  2GM4 A;  1U7J A;  1FDM A;  5AW8 B;  3Q5R A;  1SQV E;  3E1I A;  1GTW A;  4Y28 J;  4H44 B;  1BCC E;  1KIL C;  3RK2 C;  4HKZ H;  4PD4 I;  3HD7 A;  4UB6 E;  2QRX A;  2KZI A;  3RL0 B;  2K9J B;  1VF5 C;  1SVF A;  2M0B A;  2ZXE B;  3H1I J;  1AVY A;  3F89 A;  2ZT9 C;  2WMM A;  2YMK A;  1M7L A;  1SFC A;  3L74 E;  3PTZ A;  5AW0 B;  1GD2 E;  5CCG A;  1YQ4 C;  3NMD A;  3USS A;  3B5N C;  1KFN A;  1LNQ A;  3V2N A;  2NPS D;  5BVZ A;  2O01 J;  2WT7 B;  1FC2 C;  1AA0 A;  3H1J E;  2Q9I A;  1JO5 A;  1L0L K;  4GOE A;  2OYH B;  4KHX A;  2WIT A;  3L73 E;  3N4X A;  1QGK B;  2M3E A;  2Y9Y A;  1GDT A;  3IR9 A;  1VPC A;  2FYN C;  1OWA A;  1S9K E;  1SQP E;  1JOC A;  1P84 E;  1HGZ A;  5AVS B;  2N9Y B;  4WY4 C;  2O3J A;  3L71 G;  1FS0 E;  2D2C B;  1USD A;  3HE4 A;  2XV5 A;  4L75 A;  4U3F D;  1BE3 G;  1LTJ C;  2FXM A;  1BSH A;  1HWT C;  1VL2 A;  3FXE A;  3HD7 B;  1KD1 Q;  4BWN A;  3LW5 J;  4NPD A;  3PP5 A;  1L0L D;  2WVR A;  2A06 E;  3P7K A;  2WWW A;  3TF5 A;  2W27 A;  3HUS A;  3AEF C;  2YO2 A;  1SFC B;  2H7H A;  1KB9 D;  1GK6 A;  4ZMD A;  1SQB J;  1BSN A;  1M1J A;  3BAS A;  1PGJ A;  3VMY A;  4GOF A;  1HBW A;  1S3J A;  4KJM A;  3L72 G;  3CD6 P;  1M1K Q;  4I7Z C;  4XE5 B;  5AW9 B;  5AVT B;  3L75 E;  2H43 A;  1RF1 C;  5KLI B;  3T97 A;  1J1D B;  1SQX J;  2K88 A;  3CXH H;  5KLV K;  5KAF H;  1NVO A;  5K5G B;  2XDJ A;  1JY3 N;  5AVW B;  3S4R A;  4U7J A;  1Q90 D;  2XZR A;  3WU2 E;  2NRG A;  1VQ8 P;  2J5U A;  1N7S C;  3Q3D A;  2NZ2 A;  2M8R A;  2GUS A;  1LWU C;  3IFM A;  1WT6 A;  2WZ7 A;  3HE4 B;  4R4M A;  1EDI A;  3CX5 I;  4ZNC A;  1RY3 A;  1EZV E;  3CME P;  2N1T C;  5APS A;  1Z56 A;  2KSJ A;  3JCU H;  4WVZ A;  3A5T A;  5KLV D;  2MJZ A;  1KQS O;  3OJA B;  4XA4 A;  1K8A Q;  1DX7 A;  3HUS B;  2J59 M;  1LTI C;  1MZ9 A;  1FZC A;  5C39 A;  4LGD E;  5AVV B;  1IO4 A;  2K3R A;  2WSE H;  2IX7 C;  4JPZ B;  3H1H E;  2HLO A;  4W7Y A;  1M1J B;  1ZR4 A;  1CI6 A;  2WPS A;  3MUD A;  1T6A A;  1PL5 A;  2FXO A;  1KYO E;  3KPE A;  1FZE A;  2C0W A;  4U3F G;  1NAY A;  3T97 B;  4RES B;  3P8M C;  1SP4 A;  1YBK A;  1L4A C;  1H88 A;  3TSI A;  3M06 A;  4JYB A;  3EWK A;  2LR2 A;  3CWB J;  3D6Z A;  3UIA A;  1LTA C;  1L0L G;  1X0T A;  2JKV A;  2WPV B;  5TJH A;  1S1C X;  2FYU K;  1URQ C;  2WTY A;  1VQ6 P;  2WPQ A;  4K35 A;  3L70 D;  5TIS E;  2OYI A;  2BCC D;  2E76 C;  1NYH A;  1JUN A;  2Q7C A;  3VMX A;  4R4L A;  3HRN A;  1N8R Q;  1IK9 A;  2BEZ F;  5B5E E;  2P10 A;  3FXD A;  2IYO A;  3EFG A;  4OH8 B;  1JY3 O;  2R3C A;  4H44 C;  2YXQ B;  1BGY J;  1S2E A;  2KSE A;  2ZYD A;  3IAO A;  3CCL P;  2FBW C;  1GL2 A;  2L91 A;  3RL0 C;  2CPS A;  4Y99 C;  1FZC B;  1DEB A;  2KLU A;  3A0H E;  1CZQ A;  5B66 E;  3M0D A;  2FYU D;  3CXH E;  3CCJ P;  4D6T D;  2PFX A;  3GF7 A;  1CI6 B;  1YJ9 P;  1N2D C;  2H88 C;  1X8Y A;  1MFZ A;  2AXT E;  1SQQ E;  3P32 A;  3L36 A;  3TDK A;  1ZRT D;  1IK7 A;  2V7Q H;  1BDC A;  3BCC D;  3RGU A;  2C9L Y;  1PV3 A;  4H13 B;  1J1E B;  3SWY A;  1QL2 A;  5H2F E;  2WSE J;  1CSB A;  1K73 Q;  1N7L A;  2P58 A;  4H0L B;  2QJP B;  3AE2 C;  5KLV G;  1BE3 E;  4WBA A;  4UB6 H;  1S5L E;  5CJ4 A;  3I56 P;  1NTM J;  2G8Y A;  2OYI B;  2IBZ D;  5CCH D;  2A45 H;  3TGU J;  1VQP P;  5KTB A;  5APV A;  1KQF B;  4N3Y B;  2D2C C;  3LID A;  2MKV A;  1H89 A;  3II6 A;  3CI9 A;  2YKO A;  3HD7 C;  2E43 A;  1GL2 B;  3HD7 D;  1ZN5 A;  1JM0 A;  3L72 E;  1Y8A A;  1ZXG A;  2JP3 A;  4ASW A;  1LTS C;  3GW6 A;  2ZVO B;  2LXB A;  1MUU A;  1RHZ B;  2R3S A;  3TGU E;  1YTZ I;  2JWD A;  2KS1 A;  3AE3 C;  1SFC D;  1G2C A;  4PD4 D;  2IZ1 A;  3SFE C;  2KK7 A;  3L70 G;  4TT3 H;  5CCG D;  1LP1 A;  4TLF A;  2FXP A;  2BAS A;  2CPB A;  1P84 H;  2BCC G;  3H1L J;  2ZXX A;  4IL6 E;  2QJY B;  3CCV P;  3V6I A;  5KLI C;  2O01 H;  1OVR A;  3LIE A;  2KZJ A;  1CW5 A;  2OTK E;  2V7Q J;  2FFD C;  3Q2Y A;  3K5B A;  5GTI E;  3CLQ A;  1R8E A;  1PP9 E;  1G1J A;  2JR8 A;  2FYU G;  2ZVN B;  4D6T G;  1NU1 D;  2QE7 H;  3G71 P;  1VQ4 P;  4IFD K;  2M5A A;  2QEX P;  1BCC J;  2V4H A;  1IFI A;  3G3Z A;  3WUU A;  3BCC G;  3TNU A;  1DEE G;  1KN7 A;  4PV1 B;  2AEM A;  4YXD C;  1JNM A;  3V2Q A;  3CMA P;  1YJW P;  3L74 J;  1ZOY C;  4U3F E;  2KS1 B;  1G2C B;  3WU2 H;  1K04 A;  4AQR D;  1HJB A;  4RJT A;  1LP1 B;  2ITA A;  2QJK C;  4GOD A;  2IBZ G;  3P8C D;  2P1J A;  2R32 A;  1LT9 C;  1EDK A;  1L0L E;  1NTZ D;  2QA4 P;  2Q5U A;  3L37 A;  3CCU P;  3H1J J;  3MTU E;  3WUT A;  5KKZ B;  2R5B A;  1M57 D;  1S72 P;  1KB9 E;  3L73 J;  4OGQ B;  3CXH I;  1YTZ T;  2K37 A;  1SQP J;  2OGU A;  1W5C E;  1HUC A;  3AEG C;  5M1B A;  1H8A A;  1EXJ A;  2P67 A;  2NPS C;  2E75 D;  1R5S A;  1E5W A;  1QVF O;  1PPJ D;  1JEK A;  2M5A B;  1X79 B;  4AYC A;  3D71 A;  5AVX B;  1ZLL A;  3CCQ P;  3PRJ A;  1KFM A;  3TNU B;  1LTT C;  2Y9Z A;  2O1K A;  1KYO H;  5DJU B;  1N73 A;  4JQ0 D;  4L74 A;  3CX5 D;  2VRS A;  4YTP C;  2KP8 A;  3CC2 P;  4C7N A;  1AQ5 A;  1QVG O;  3V4Q A;  3Q1M A;  1FZC C;  3N7N A;  5CMZ A;  3V5B A;  3RK3 D;  1L0N K;  5AVQ B;  2JJL A;  5KLV E;  3IF4 A;  3L75 J;  5TIS H;  1NU1 G;  4GT1 A;  2Z5H A;  1KQL A;  1NTK D;  3FGA D;  4H13 C;  4H13 D;  1SQV D;  2W8Z A;  4WB4 A;  5B5E H;  4K3A A;  3H1K E;  4KT0 J;  2GUV A;  4H0L C;  1OZH A;  4H0L D;  1K05 A;  2AXC A;  4I6M C;  3W68 A;  1VQL P;  2RMZ A;  1EQ7 A;  2Z4E A;  5KJ7 A;  1OVU A;  1FZA A;  1L0N D;  3EQ2 A;  3A0H H;  2OYO A;  1E79 H;  2CK3 H;  5B66 H;  1FDO A;  4PJ0 E;  1DIP A;  1AV1 A;  1KIL A;  1LT1 A;  2AXT H;  1NTZ G;  1RF0 A;  1N73 B;  1NO4 A;  2YMY A;  3F5H A;  3CCS P;  4A7P A;  3L70 E;  4L73 A;  2E74 B;  2BCC E;  3AEE C;  4C7N B;  5CBN A;  1GL2 D;  5H2F H;  2Q3E A;  3CCM P;  1USE A;  3H1H J;  3H1I D;  2R44 A;  1Y47 A;  3M9Q A;  1R5L A;  5GTH E;  3B5N A;  1GU5 A;  1S5L H;  3AEB C;  1OW6 A;  1QLE D;  2G3A A;  1LTB C;  1TU3 F;  1PPJ G;  3A7O A;  2W83 C;  5APY A;  4LLH A;  3C8V A;  1YI2 P;  3SSU A;  1JTH A;  2FYU E;  4D6T E;  4DJG A;  2OTJ P;  3PJS K;  4EYY Q;  3HE5 A;  5AVR B;  2E5T A;  3H1L G;  3NTN A;  1W2B O;  4WY4 A;  1ZRT E;  2J58 A;  3BCC E;  2B88 A;  3A3Y B;  1SQB K;  5AW3 B;  2A45 I;  5BU8 B;  1S4X A;  1KIL B;  3RK2 B;  1LJ2 A;  2OTL P;  4HYT B;  1EDJ A;  4L76 A;  4DOJ A;  1VF5 B;  1N86 A;  2JDI H;  4YPC A;  1SQX K;  3Q5S A;  1NTK G;  2ZT9 B;  4IL6 H;  2E75 B;  3RBZ A;  4PV1 D;  1SQV G;  2JWA A;  1IFM A;  1JCC A;  4BRY A;  1VQN P;  5AW5 B;  4DCK A;  3PLN A;  4NPE A;  3ITK A;  5AW2 B;  4EIJ A;  4N6J A;  1VQM P;  3HTK A;  1JMM A;  3B5N B;  1SQQ J;  1SQB D;  5GTI H;  1RF1 A;  1RE3 A;  1L0N G;  4YXW H;  1P84 I;  1JTH B;  1T8Z A;  2K9Y A;  1SQX D;  1BE3 J;  3RK3 B;  3C9I A;  1N7S A;  3HE5 B;  1T3U A;  4PD4 E;  3EFF K;  2L5G B;  4OGQ D;  1YJN P;  3QWO C;  3O8Z A;  1LWU A;  4WY4 B;  1OW8 A;  1QEX A;  1EDL A;  2PP6 A;  2KI7 B;  3H1I G;  2UWJ E;  3FX0 A;  5BU5 A;  4I1L A;  2QM7 A;  3L71 E;  3IN6 A;  1U57 A;  2IDB A;  2AEF A;  2OYH C;  1NH4 A;  1EC5 A;  3L72 J;  3E7K A;  2FY8 A;  3VN0 A;  3JSV C;  4ASV A;  5CCH C;  4BRY B;  3KZI E;  3VOP A;  1KB9 H;  3B4S A;  3AED C;  1JY2 P;  3TK1 A;  3MD0 A;  3AE6 C;  1FU1 A;  1IFJ A;  2KLV A;  2Z5I A;  1FZG A;  1RF1 B;  2Q3I A;  3CL3 D;  1KV4 A;  1VQO P;  1L4A A;  2ZJS E;  1NWQ A;  3S1K A;  3G6E P;  1AQT A;  3CCE P;  4B86 A;  3BAT A;  1VQ5 P;  4EI2 A;  1N7S B;  1EZV I;  1FAV A;  1SFC C;  1URQ A;  1YYC A;  1LWU B;  4NPF X;  3L75 G;  3CWB D;  1NU1 K;  5CCG C;  1PP9 J;  3P8C E;  4RKU J;  2XKM A;  2KNC A;  2OAR A;  3S9O A;  1U7M A;  1NTZ E;  3D6Y A;  1LGH B;  3CXH D;  3L4F A;  3RBX A;  1SQB G;  1NJI Q;  2DW3 A;  1IFN A;  1J1D C;  5E79 E;  1SQQ D;  3V2P A;  1ZR2 A;  2Y0E A;  5APT A;  1YIJ P;  1N73 C;  1BGY D;  3OAK A;  1KYO I;  2C0X A;  3OA7 A;  1S5L X;  1SQX G;  4U3F J;  4JBZ A;  2ZAE B;  2E74 D;  2WSC H;  2O1J A;  3M9H A;  1PPJ E;  1FBM A;  1T2K D;  3U1C A;  1NTZ K;  1J2J B;  1NTM K;  1VQ9 P;  1JCD A;  2WSF H;  3KXD A;  1PGQ A;  5KAI E;  1L0L J;  4GKG A;  1VQ7 P;  1HVV A;  3CX5 E;  1OX3 A;  5AW1 B;  2ZYG A;  1OW7 A;  3HUS C;  4PJ0 H;  1URQ B;  3BRV B;  3RK3 E;  5APW A;  4O9B A;  3AE5 C;  1FZB A;  1M1J C;  2KNC B;  2E76 B;  4UB8 E;  2XND H;  1SLQ A;  3GF3 A;  5CJ0 A;  3H32 A;  3H25 A;  3CPW O;  1DD4 A;  1NTM D;  5KJ7 C;  1NTK E;  5KJ7 D;  3SFD C;  3TGU D;  2YKP A;  4EOT A;  4IL6 X;  3GHG A;  4JYC A;  1NAF A;  5GTH H;  2H8P D;  1KIL D;  3AE7 C;  3RK2 D;  3V4W A;  2Q6Q A;  4Y99 B;  1RF0 C;  1VF5 D;  1Y9B A;  3H6P A;  4QMA A;  1RE4 A;  2QM8 A;  4N78 D;  1LTG C;  1HTL C;  1MV8 A;  2ZT9 D;  2E75 C;  4W7Z A;  1L0N E;  2HPC A;  1FOS E;  3FWN A;  2KIK A;  4JF7 A;  2WSS H;  1H0T A;  3CWB G;  1DH3 A;  2B89 A;  3A0B E;  3PHL A;  5KLV J;  1PGO A;  4CPG A;  1NTK K;  3B5N D;  2JEE A;  1M8O B;  1PP9 D;  2M3B A;  1SQV K;  4EDF A;  2Y0C A;  1WRG A;  3H1L D;  3KQG A;  2WSC J;  3I5C A;  3MP7 B;  4ZKP A;  1ZP0 C;  1FJP A;  3H1I E;  4W80 A;  1SQQ G;  2WPR A;  3M0A A;  3H1K J;  2WSF J;  4GIF A;  2ZYA A;  2FFD A;  3RK3 C;  2YIU B;  1BGY G;  4LC1 A;  2QIW A;  3MUD C;  2W6J H;  1JY2 N;  3H32 B;  1HGV A;  4WY4 D;  2ZFC A;  1KOR A;  3GHG B;  2I1J A;  1QL1 A;  1J1E C;  1BCC D;  1Q81 Q;  3AE1 C;  1HH0 A;  3L70 J;  2QJP C;  4C7R A;  2BCC J;  2OQQ A;  1OIP A;  5AW6 B;  1FZF A;  1QX8 A;  2HPC B;  1SQP K;  1GW4 A;  2OYI C;  5AVZ B;  1L2P A;  2YXR B;  1H0T B;  4Z1M H;  3L74 D;  2KXP B;  4PD4 H;  3OW2 O;  2HR3 A;  3GLM A;  1LT9 A;  4BXL A;  1VDF A;  1NTM G;  3U59 A;  4AUW A;  3AE9 C;  1WMK A;  1AVO A;  3TGU G;  1RE3 C;  2JO1 A;  3CCR P;  4IFM A;  3B71 A;  4M3L A;  2HYN A;  3NFQ A;  5CBO A;  1SS1 A;  2FYU J;  1GL2 C;  3H1J D;  4D6T J;  2KUB A;  1Q7Y Q;  2P2U A;  3A2A A;  1IJD B;  3WMM 0;  3AEC C;  3L73 D;  3ZDM A;  2FFD B;  1M90 Q;  2KB7 P;  3M0D C;  3M9B A;  1SQB E;  1N7S D;  2N9B A;  3TYY A;  3O6Q A;  2HFE D;  1S9K D;  2E42 A;  1BDD A;  3BCC J;  1SQP D;  2NPS A;  1P84 D;  1PIX A;  1NKZ B;  1PZQ A;  2P7J A;  3M91 A;  1A02 F;  1XTG B;  3KZI H;  3NXS A;  3VP8 A;  2I1K A;  2N1T D;  1SQX E;  1RH5 B;  2QJY C;  3VMA A;  4IOI H;  1PP9 G;  1NKN A;  1HJ0 A;  3CC7 P;  3W67 A;  2A06 D;  1NGM B;  4HB1 A;  2H89 C;  2K1A A;  1FOS F;  1PGP A;  3JC2 2;  1YHQ P;  1JY2 O;  5AW4 B;  1LTJ A;  1OXZ A;  1OMI A;  2QJK B;  4GDO A;  1KB9 I;  3H1K D;  3KDP B;  3CC4 P;  5APX A;  3PH0 A;  1LT9 B;  4HH2 A;  3R2P A;  3G9R A;  3VTP C;  2QG4 A;  1GU4 A;  4OVN F;  2W90 A;  5L8R J;  3L75 D;  1L4A D;  4PV1 C;  5AW7 B;  1PFI A;  2IBZ E;  2YKQ A;  2IFN A;  1BCC G;  2YNY A;  3BRT B;  1UII A;  5E79 H;  2W6B A;  2QSI A;  2FYZ A;  3O6Q B;  1JMB A;  1URQ D;  2NPS B;  2A45 G;  3MZW B;  2E76 D;  1KMI Z;  3L74 G;  3MHV A;  3C1L A;  1ZME C;  3L71 J;  1EXI A;  1EZV D;  2Q1K A;  2HOD A;  5KKZ C;  2FYN B;  3QH9 A;  4XFJ A;  2IPP A;  4H44 D;  4OGQ C;  5KAI H;  3CWB E;  1D7M A;  1ZW0 A;  2E5Y A;  2KOG A;  3I55 P;  3Q5P A;  3MIW A;  3RL0 D;  3CX5 H;  2PAJ A;  3H1J G;  1NU1 J;  2LKM A;  1FJK A;  3SWK A;  1K9M Q;  2AEJ A;  1LTJ B;  2XU6 A;  3L73 G;  4WWI A;  1IFD A;  5KAF E;  2N1T A;  5AVY B;  3H1H D;  1SQP G;  1GW3 A;  5CHX A;  3WUV A;  4UB8 H;  1IFP A;  1NHL A;  1KYO D;  3AE8 C;  1Q86 Q;  3AE4 C;  1BGY E;  2XNX A;  4RO0 A;  1YQ3 C;  1Q82 Q;  5EFW B;  1AFO A;  2WQY C;  2LXC B;  1NU1 E;  2B87 A;  1NOH A;  3KYQ A;  5AVU B;  3HTK B;  1HF9 A;  2A06 G;  5DJT B;  4C46 A;  4I7Z B;  3JCU E;  1NTZ J;  2YIU C;  3R4Y A;  1VQK P;  4HJG H;  3MGN A;  2IYP A;  2RN0 A;  2W6A A;  1SQQ K;  3H1K G;  3VMZ A;  5APQ A;  2D2C D;  3GG2 A;  1Q2N A;  1GK4 A;  2HOD B;  2FKW B;  3GHG C;  1X22 A;  3A0B H;  3L35 A;  1MFT A;  3VYI A;  2BEQ D;  2B9B A;  1FE6 A;  3FWL A;  5APU A;  4I2L C;  4DZO A;  1GMJ A;  3G4S P;  3AEA C;  2KYV A;  1RE4 C;  1NTM E;  3V2R A;  2N1T B;  1JB0 J;  1RQV A;  1OVV A;  2SPZ A;  2PGD A;  1KIL E; 
#chains in the Genus database with same CATH homology
 1GL2 A;  1DH3 A;  3RL0 C;  3BVH A;  2CPS A;  4Y99 C;  1FZC B;  3M9Q A;  1JY3 P;  1DEB A;  1NTK K;  1T3J A;  3B5N D;  4N78 E;  2JEE A;  1CZQ A;  2M3B A;  3M0D A;  3B5N A;  1SQV K;  1GU5 A;  1WRG A;  1CI6 B;  2IFM A;  1ZV8 A;  1N2D C;  3KQG A;  3I5C A;  2POH A;  1X8Y A;  2R5D A;  4ZKP A;  1LTB C;  1MFZ A;  3P32 A;  1FJP A;  3L36 A;  4W80 A;  1T2K C;  1KZU B;  2YO3 A;  3A7O A;  2WPR A;  3B8E B;  3M0A A;  1IC2 A;  5APY A;  4LLH A;  2C9L Y;  4GIF A;  2HG5 D;  2FFD A;  1JTH A;  1G1I A;  3RK3 C;  1J1E B;  3SWY A;  1XTC C;  1QL2 A;  1L4A B;  4LC1 A;  1JY2 N;  1CSB A;  3H32 B;  3HE5 A;  5AVR B;  4IFF A;  1A02 J;  1HGV A;  4WY4 D;  1N7L A;  3NTN A;  2WT7 A;  2ZFC A;  3VP9 A;  4WY4 A;  2J58 A;  3U1A A;  4WBA A;  2OYH A;  3GHG B;  3A3Y B;  1SQB K;  5AW3 B;  1GZL A;  3SWF A;  5CJ4 A;  2I1J A;  1X9V A;  1QL1 A;  2C9N Y;  2OYI B;  1J1E C;  2A45 I;  5CCH D;  2A45 H;  5BU8 B;  1W2E A;  3LW5 H;  5CCH A;  5KTB A;  5APV A;  1KIL B;  3RK2 B;  1HH0 A;  4HYT B;  4N3Y B;  4C7R A;  4DOJ A;  3LID A;  1N86 A;  4ZKU A;  1H89 A;  2GM4 A;  5AW6 B;  1SQX K;  1FZF A;  2HPC B;  1FDM A;  5AW8 B;  3II6 A;  3CI9 A;  1SQP K;  1GW4 A;  3E1I A;  2OYI C;  2YKO A;  1GTW A;  5AVZ B;  3HD7 C;  1IFM A;  2E43 A;  1JCC A;  1GL2 B;  3HD7 D;  1ZN5 A;  5AW5 B;  1KIL C;  3RK2 C;  3HD7 A;  5AW2 B;  1LTS C;  4EIJ A;  3RL0 B;  4N6J A;  1LT9 A;  1SVF A;  3HTK A;  1JMM A;  2ZXE B;  1MUU A;  1VDF A;  3B5N B;  3U59 A;  4AUW A;  1YTZ I;  1SFC D;  1G2C A;  1RE3 C;  4IFM A;  1M7L A;  1SFC A;  4M3L A;  1RF1 A;  2HYN A;  1RE3 A;  3NFQ A;  5CCG D;  1GL2 C;  5AW0 B;  2BAS A;  2CPB A;  1GD2 E;  5CCG A;  2P2U A;  3A2A A;  1IJD B;  3WMM 0;  3NMD A;  2FFD B;  1JTH B;  1T8Z A;  2KB7 P;  3M0D C;  3B5N C;  3M9B A;  1KFN A;  3V2N A;  1N7S D;  2N9B A;  3TYY A;  3RK3 B;  2NPS D;  2HFE D;  3C9I A;  1S9K D;  5BVZ A;  2E42 A;  1N7S A;  3HE5 B;  2NPS A;  1T3U A;  2L5G B;  2O01 H;  2WT7 B;  1NKZ B;  2P7J A;  1LWU A;  3O8Z A;  4WY4 B;  3LIE A;  3M91 A;  1A02 F;  2Q9I A;  1JO5 A;  1XTG B;  1L0L K;  1CW5 A;  2OYH B;  3NXS A;  4KHX A;  3VP8 A;  2WIT A;  2I1K A;  3N4X A;  2PP6 A;  2FFD C;  2N1T D;  3CLQ A;  1GDT A;  3IR9 A;  1VPC A;  1OWA A;  1S9K E;  1G1J A;  5BU5 A;  1JOC A;  4I1L A;  2QM7 A;  1NKN A;  1HGZ A;  5AVS B;  4WY4 C;  4IFD K;  2OYH C;  3HE4 A;  2XV5 A;  1IFI A;  1NH4 A;  1FOS F;  3G3Z A;  1LTJ C;  2FXM A;  1JY2 O;  5AW4 B;  3TNU A;  1LTJ A;  3VN0 A;  1OXZ A;  5CCH C;  1JNM A;  3V2Q A;  1HWT C;  3HD7 B;  3KDP B;  5APX A;  3VOP A;  3PP5 A;  1LT9 B;  4HH2 A;  3R2P A;  1JY2 P;  3TK1 A;  3MD0 A;  3VTP C;  3P7K A;  1FU1 A;  1GU4 A;  2WWW A;  1IFJ A;  2W27 A;  1G2C B;  3HUS A;  2KLV A;  2YO2 A;  2Z5I A;  4AQR D;  1SFC B;  2H7H A;  1HJB A;  1GK6 A;  1FZG A;  1RF1 B;  1L4A D;  2Q3I A;  5AW7 B;  3CL3 D;  1PFI A;  1L4A A;  2YKQ A;  1NWQ A;  3P8C D;  1M1J A;  2P1J A;  2IFN A;  3BAS A;  3VMY A;  1HBW A;  2R32 A;  1LT9 C;  2YNY A;  3BRT B;  2Q5U A;  2W6B A;  3L37 A;  4B86 A;  3BAT A;  2FYZ A;  3MTU E;  4XE5 B;  1N7S B;  5AW9 B;  2R5B A;  1URQ D;  2NPS B;  5AVT B;  1FAV A;  1SFC C;  1URQ A;  2A45 G;  2H43 A;  1RF1 C;  1YYC A;  3T97 A;  1LWU B;  1J1D B;  1YTZ T;  5KLV K;  1NU1 K;  5CCG C;  3P8C E;  2XKM A;  2OAR A;  2XDJ A;  1JY3 N;  5AVW B;  2XZR A;  1LGH B;  1HUC A;  1H8A A;  2P67 A;  2HOD A;  1N7S C;  3L4F A;  2NPS C;  2M8R A;  2IPP A;  1IFN A;  2GUS A;  1LWU C;  1J1D C;  1E5W A;  2KOG A;  3IFM A;  1WT6 A;  2WZ7 A;  3HE4 B;  3MIW A;  1X79 B;  4AYC A;  3V2P A;  1ZR2 A;  3RL0 D;  2PAJ A;  5AVX B;  1ZLL A;  1RY3 A;  2LKM A;  5APT A;  1FJK A;  1KFM A;  3TNU B;  1LTT C;  2N1T C;  1LTJ B;  1N73 C;  2XU6 A;  3OAK A;  1IFD A;  2O1K A;  2C0X A;  2N1T A;  5AVY B;  3OA7 A;  1N73 A;  5APS A;  1Z56 A;  2KSJ A;  2WSC H;  3A5T A;  2O1J A;  3M9H A;  2VRS A;  1GW3 A;  5CHX A;  2MJZ A;  2KP8 A;  3OJA B;  4XA4 A;  4C7N A;  1AQ5 A;  1FBM A;  1T2K D;  3U1C A;  1NTZ K;  3V4Q A;  1J2J B;  1NTM K;  1DX7 A;  1FZC C;  1NHL A;  1JCD A;  3N7N A;  3HUS B;  5CMZ A;  2J59 M;  2WSF H;  3V5B A;  1LTI C;  1MZ9 A;  2XNX A;  1FZC A;  4LGD E;  3RK3 D;  5AVV B;  1AFO A;  1IO4 A;  2WSE H;  1L0N K;  2IX7 C;  4GKG A;  2HLO A;  4W7Y A;  1M1J B;  5AVQ B;  1ZR4 A;  2JJL A;  1CI6 A;  1HVV A;  2WPS A;  3MUD A;  5AW1 B;  1NOH A;  3KYQ A;  5AVU B;  3HTK B;  2Z5H A;  4GT1 A;  1KQL A;  3HUS C;  3KPE A;  4C46 A;  1URQ B;  3BRV B;  1FZE A;  2C0W A;  4RES B;  3P8M C;  1SP4 A;  4WB4 A;  1L4A C;  5APW A;  3MGN A;  4O9B A;  1H88 A;  1FZB A;  1M1J C;  3TSI A;  1SLQ A;  3M06 A;  5CJ0 A;  2W6A A;  4JYB A;  1SQQ K;  2GUV A;  3H32 A;  3VMZ A;  5APQ A;  1GK4 A;  4I6M C;  5KJ7 C;  3UIA A;  2HOD B;  1LTA C;  2FKW B;  3GHG C;  5KJ7 D;  1EQ7 A;  2Z4E A;  2YKP A;  5KJ7 A;  4EOT A;  2FYU K;  1URQ C;  3GHG A;  4JYC A;  2WTY A;  2WPQ A;  3L35 A;  1FZA A;  1NAF A;  3VYI A;  3EQ2 A;  5APU A;  2OYI A;  4I2L C;  2H8P D;  4DZO A;  1JUN A;  2Q7C A;  1KIL D;  3RK2 D;  3HRN A;  3VMX A;  1IK9 A;  3V4W A;  1KIL A;  4Y99 B;  2KYV A;  1RE4 C;  1RF0 C;  3H6P A;  3V2R A;  1RE4 A;  1RF0 A;  2N1T B;  2QM8 A;  1N73 B;  1NO4 A;  4N78 D;  1LTG C;  2YMY A;  1HTL C;  1MV8 A;  3EFG A;  4OH8 B;  4W7Z A;  1JY3 O;  2HPC A;  2R3C A;  1FOS E;  4C7N B;  4JF7 A;  1GL2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...