2W6BA

Crystal structure of the trimeric beta-pix coiled-coil domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
b'SKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 7
publication title Structures of Dimeric Git1 and Trimeric Beta-Pix and Implications for Git-Pix Complex Assembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 21
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2w6bA00
2YKOA 1JOCA 2YKPA 3CL3D 3EQ2A 3L4FA 3BRVB 3BRTB 2W6BA 2YKQA
chains in the Genus database with same CATH superfamily
3MHVA 1GU4A 3SWKA 3IF4A 3PHLA 3M9BA 1KILD 1JMMA 1BSNA 1YJNP 4PJ0E 5KLVG 4HH2A 2IBZD 5KLVJ 5H2FH 1DEBA 4DJGA 3IFMA 3BRTB 3IN6A 1EZVG 3CCUP 3H1HG 2WSCJ 5DJTB 2NPSB 2KZJA 2ZYDA 3H1HJ 1PGOA 1QX8A 3E7KA 2C9NY 2A45H 1SVFA 1T3JA 1EZVI 3CC4P 1NYHA 1NU1K 1SQPD 3CCJP 4H0LC 1Y47A 1VQ4P 4JBZA 3I56P 1Q82Q 2JP3A 3H1LG 1GW4A 2WPVB 5GTHH 3B5NA 3AEDC 2AXTH 3MD0A 3VMXA 1W2EA 2YIUC 2B89A 3A0HH 1ZR2A 3VN0A 1PFIA 4WY4B 4PV1B 3B4SA 1QL2A 1BCCE 5B66H 1Q86Q 5B5EH 3L70D 2ZYGA 4JYCA 3RK3C 3KZIE 3A5TA 1BGYE 5AVYB 4D6TG 5TISE 2YKOA 2Y9YA 1WT6A 1KN7A 4D6TJ 4AUWA 1SQBK 4BRYA 1PV3A 2RMZA 3JSVC 3CCSP 1N7SC 3TGUD 1LWUA 3OW2O 5L8RJ 1X0TA 3TNUB 3L35A 3EFFK 5AVVB 2WMMA 3HE4B 5AVZB 4NPEA 3GHGB 3BVHA 4I1LA 2JEEA 1JMBA 2WSSH 3LIDA 3AE6C 1W5CE 1N7LA 3MP7B 1XTCC 1SQXD 4H0LD 1OXZA 5KAIH 3VTPC 3MUDA 1RQVA 4IL6H 3M9QA 4C7NB 4WWIA 4NPFX 4ZNCA 4WB4A 2QJYB 5BVZA 1JY3P 2B88A 4U7JA 2O1KA 1EDLA 1H0TA 2QRXA 3Q3DA 4OVNF 1PGQA 2K9JB 3B8EB 1P84D 1PPJE 3HD7A 3JCUE 1KB9H 1G2CB 3AE7C 1DEEG 1NKNA 3IR9A 1URQB 2J59M 3RK3D 2JDIH 1GDTA 2E76B 1QGKB 1IC2A 2BCCE 2E42A 2IZ0A 1M7LA 1JCCA 2H88C 3D6ZA 3N4XA 3HUSC 5CCGC 2QSIA 2OYHC 1ZV8A 1N7SD 4DZOA 1RE4C 2YO2A 2K88A 4U3FD 1L0NK 3AE1C 1JY2O 4IFDK 3RK2C 1NJIQ 1SQBJ 1N73C 1AV1A 2RKLA 3II6A 4PJ0H 2K1AA 3V4WA 3CMEP 1KD1Q 2RH0A 3GW6A 3AEGC 2M5AB 2ZJSE 4HYTB 2ZT9C 1SFCA 3CCLP 1K8AQ 2FYUE 1KB9D 4LC1A 3FWNA 1R8EA 4N6JA 1PP9D 1S5LX 2WPQA 3D70A 3H1KJ 1BE3E 2BASA 2PFXA 3NFQA 3H1IG 2LR2A 3PP5A 1ZN5A 1L0LK 3L72G 3AEFC 3W67A 3L72J 1LTTC 1A02F 2V7QJ 5H2FE 3PJSK 1AVYA 4XFJA 1S2EA 1HGZA 1S3JA 2B87A 3KHUA 1GK4A 4A7PA 3AE9C 1CSBA 3P7KA 2JKVA 1GTWA 3SSUA 1FDOA 3IAOA 5AVWB 2A06E 3FWLA 4K3AA 4EIJA 1VQ6P 2YO3A 4N78E 1SQQG 2WPRA 3KZIH 1SQQJ 5KKZB 3H1JE 1ZRTE 5APWA 5TISH 1FE6A 1N8RQ 1EXJA 5CCGD 3C8VA 3M91A 5GTHE 2O01N 1N7SA 2AXTE 1E79H 2W27A 3B5NC 1GL2D 1KC8Q 3CCQP 2WQYC 1FZCA 4Z1MH 1U7MA 3RK2D 1HWTC 2Y0EA 2VRSA 1M56D 1HTLC 1NTKE 1L0NG 1EQ7A 5CBNA 1L0NJ 1QVGO 2LXBA 2ZT9D 4OWFA 4KJMA 1MZ9A 4IFMA 2R44A 1AFOA 2OYOA 1RE3A 2KI7B 1BCCD 2Z5HA 3NMDA 3PH0A 1SQXK 5AW2B 1FZFA 1BGYD 1T6AA 4L75A 1FOSE 2ZAEB 3A2AA 3FX0A 4GDOA 4EOTA 1M1JB 1J1DC 2XKMA 1GMJA 3T97B 1PGJA 5AW6B 3Q5RA 1L4AB 5KLVE 1S4XA 1J1EB 1JO5A 2E74B 1OW6A 1L0LG 1OIPA 3PLNA 3V2PA 1EZVE 1VPCA 1L0LJ 2K3RA 3AEEC 2KSJA 3H1HE 3AECC 2AXCA 1RHZB 1FAVA 3Q1MA 3E1IA 2PAJA 3CMAP 5DJUB 2DW3A 1IFIA 4L74A 4BWNA 3JCUH 4XA4A 3B71A 3OAKA 3HE5B 1YI2P 3CWBG 2CPBA 2V4HA 1EDIA 2WWWA 3W68A 2CPSA 3CWBJ 3BCCG 1DD4A 1JTHA 3BCCJ 3MUDC 4IL6E 2QJKB 1SQVK 1PL5A 2IFMA 1NTMK 2JJLA 5CCGA 3H1LE 2K9YA 2KB7P 4I7ZC 4HJGH 3B5ND 1URQC 3D6YA 1GL2A 3TGUG 2I8DA 3TGUJ 3HD7C 4Y99B 3P8MC 2ZFCA 5BU5A 3AEBC 4UB8E 1PPJD 2YKQA 1FZAA 2H89C 5AW8B 4GOFA 2Q7CA 1UIIA 1FC2C 2R3SA 3U1AA 1D7MA 2BCCD 1YQ4C 1IFJA 1NO4A 4R4MA 2NPSA 2Y0DA 4B86A 2R5DA 1SQXG 5K5GB 4DT0A 3QH9A 1SQXJ 4O9BA 1VF5B 2WVRA 2MKVA 3NXSA 1SFCC 3CXHI 3RGUA 1Y8AA 4YTPC 3CCVP 1QEXA 2Y0CA 5AW0B 2FYUD 3I5CA 2W6BA 1JOCA 2FYNB 1KQGB 2KLUA 4WVZA 1K04A 4JYBA 1IO4A 2KXPB 2E5TA 1BE3D 2ZVNB 4WY4A 1FJPA 4I2LC 1LGHB 5AW4B 1KQLA 3AE3C 1SP4A 1YIJP 1URQD 1JB0J 1NAYA 3L4FA 4U3FG 1SQVG 5GTIH 1NTMG 4U3FJ 1SQVJ 2WSFJ 1U7JA 3L74E 1NTMJ 3V2RA 3HD7D 3V5BA 1E5WA 1VQOP 3LW5H 2Q6QA 2H8PD 1Q90D 3VOPA 2G3AA 2A06D 3TNUA 1PIXA 2Q5UA 3GLMA 1GU5A 1J2JB 3HE4A 1S9KE 1PP9G 2FFDB 1JCDA 3SWYA 4N78D 2OYIB 3P8CE 1PP9J 3GHGA 1ZW0A 1K9MQ 3SWFA 3H1JD 1ZRTD 3HTKB 3VMYA 1FZCC 4H13C 1BDCA 4DCKA 3CXHH 2R5BA 2XU6A 1KYOI 5APVA 1VQ5P 1QL1A 2N1TB 3ITKA 4EI2A 1T3UA 2WSEJ 5APUA 2HPCB 1X8YA 2LKMA 4KHXA 1SFCD 2PP6A 2K37A 1KV4A 1NTZE 2WSCH 4BXLA 1NTKD 1RF1B 4XE5B 2M3EA 1RE3C 4OGQC 2D2CB 2Y9ZA 1L4AC 4C7NA 4KT0J 3PTZA 3AE4C 4Y28J 1R5SA 5APYA 3H1IE 5KLIC 1KILB 1Q81Q 1JNMA 2QJPC 3CX5I 3Q5PA 3L72E 2K9JA 4W7YA 3O6QB 3MTUE 1IK7A 1G2CA 1NU1G 3VMZA 2O3JA 2POHA 1JY3N 1URQA 1NU1J 1Q7YQ 2KIKA 5AW5B 1KFNA 2HODB 5KLVD 1VQKP 3L75G 2KNCB 3EWKA 2E75B 3L75J 5E79E 1HJBA 3TSIA 2IFNA 1EZVD 4GKGA 3H1HD 4YXDC 4JPZB 2IYPA 2P58A 1SQQE 4UB8H 3CLQA 1FOSF 2Q3IA 1GZLA 4Y99C 2WITA 2M0BA 1JUNA 3A0BH 5AW1B 2M5AA 1Y9BA 1GL2C 4H44B 3L37A 5CJ0A 1VQ8P 1VQLP 4H13D 1VQ9P 1SQBG 3H1LD 1RH5B 2KS1B 4C7RA 1VDFA 1Z56A 1L0NE 3F5HA 2G8YA 1MFTA 4AYCA 2OQQA 4HB1A 5AW7B 3WUUA 2FYUK 1YQ3C 4OGQD 2FXMA 3H1KG 1L4AD 1L2PA 1SQPK 1ZOYC 4I6MC 2XV5A 4UB6H 1LT9B 1ZR4A 1JY2P 4ZKPA 2NPSC 4YXWH 1OVVA 1X79B 1CI6B 4ASWA 2MJZA 4ZMDA 2QVAA 1L0LE 3C9IA 3TDKA 3CD6P 1UIXA 5AVQB 4PD4I 1VQNP 3M06A 4IOIH 1AQTA 1JEKA 5CHXA 1KQFB 2O01J 2L5GB 5AVTB 2P67A 4NPDA 3CWBE 2XNXA 2YXQB 4CPGA 4L73A 3L73G 3BCCE 1PPJG 2N9BA 3L73J 4WY4C 4PV1C 2SPZA 3N7NA 1PGPA 2AEJA 1DD3A 2E43A 2BCCG 2YIUB 4RJTA 2CK3H 2BCCJ 5GTIE 1FU1A 2B9BA 1K73Q 1IFPA 1YTZT 1R5LA 5AW3B 2OYIC 3U1CA 2IBZG 3CC2P 2JR8A 1AQ5A 3BATA 3RK3B 3L74D 5KTBA 3L71E 1LP1B 1M1JA 4GT1A 1RF0C 3T97A 2AEMA 1L4AA 2N1TC 1S5LH 2IBZI 3GHGC 2H7HA 3TYYA 4N3YB 2FYUG 3S4RA 2NPSD 2FYUJ 1S9KD 1NH4A 1SQPG 3CXHE 1RF1C 3P8CD 1SQPJ 2V7QH 5KLVK 3KYQA 3KXDA 2WT7B 1LTJB 3HE5A 2LXCB 1USEA 3EQ2A 3H32B 2C9LY 1LTAC 3AE5C 3VP8A 5E79H 1NTZD 1OMIA 2QIWA 1OVUA 3VMAA 2PGDA 1FZEA 2QJYC 2XZRA 1NHLA 1USDA 3L70G 4JQ0D 1MKMA 2IZ1A 3L70J 2RN0A 1YITP 2E75C 4WY4D 4PV1D 2I1KA 5KJ7A 1LTIC 1AJYA 1HF9A 1FS0E 3H1ID 2M8RA 1GW3A 2E76C 1G1IA 4EDFA 2ZXXA 3L72D 1DX7A 1AA0A 1SQVE 1NTME 3PRJA 1WRGA 1DH3A 1H8AA 4ASVA 3CI9A 3WU2E 2BEQD 2YMYA 2C0XA 3G4SP 4HKZH 4M3LA 2FXPA 2JWDA 4H44C 4DOJA 4EYYQ 3TF5A 2IYOA 1OZHA 1T2KC 4D6TE 5KAFH 1LT1A 3V2QA 1M1KQ 2N1TD 3HUSB 3SFDC 3A0BE 4MN4C 2OYHB 1KTMA 1KYOE 1SQQD 2KLVA 2HYNA 1YBKA 2UWJE 5CCHC 3RBXA 1N73B 1CW5A 1GD2E 3CL3D 1HVVA 2Z5IA 2YXRB 1H89A 1LT9C 4AQRD 1KMIZ 1M57D 1JM0A 2ZT9B 4W7ZA 2E5YA 3AEAC 1EDKA 1IZNB 3M9HA 3C1LA 1L0ND 1VL2A 3CX5E 4UB6E 1Q2NA 1G1JA 1TU3F 2WZ7A 1SLQA 3V2NA 4GOEA 1IFDA 1NWQA 2E75D 2Q3EA 2P10A 1P84I 1KORA 4GODA 2P1JA 3VYIA 2O1JA 1BDDA 1NU1E 1WMKA 1OFCX 2E76D 3FXEA 1FZGA 2FXOA 3GF3A 3R2PA 2L91A 5KKZC 3EFGA 4IL6X 3L75E 4ZKUA 1NAFA 2FFDA 3AE8C 3H1LJ 3KDPB 1L0LD 2OYIA 2Q9IA 1EC5A 4RO0A 2KZIA 4H44D 3RL0B 3I55P 3HTKA 3MGNA 4LLHA 1A02J 2NZ2A 5EFWB 3RBZA 3FGAD 1T2KD 2GUVA 1RF0A 1OW8A 1NOHA 3WUVA 3BASA 2N1TA 2M3BA 3CWBD 2HPCA 2BEZF 3B5NB 1MV8A 3A7OA 3BCCD 2R32A 3K5BA 2GUSA 5CCHD 1KB9I 1N2DC 1SQBE 1RF1A 3GG2A 1MFZA 3F89A 5BU8B 2P7JA 3MIWA 2HG5D 4LGDE 1NTZK 1KILA 1M1JC 2I1JA 1ZLLA 4BRYB 1SS1A 2IX7C 1S5LE 3ZDMA 3M0DA 3O6QA 3H1KE 1J1EC 1OWAA 2E74C 1LWUB 1LTJC 3L71D 1P84H 2J58A 3GMAA 3CCRP 1IK9A 1JY3O 1S72P 1W2BO 2KK7A 3KPEA 2YNYA 2HODA 2C0WA 2KNCA 1J1DB 3E1RA 1AVOA 1KFMA 4RESB 1VQPP 4PD4E 3CXHD 1VQ7P 2KUBA 2W83C 3G6EP 4JF7A 3MZWB 2GM4A 1U57A 2QJKC 2WSFH 3H25A 2AEFA 3WU2H 1ZMEC 3R4YA 1RQUA 3CCEP 2OTLP 3V6IA 3L74G 1SQQK 2KS1A 1S1CX 3L73E 3L74J 5KJ7C 1QVFO 1HGVA 1BCCG 3HRNA 4I7ZB 2ITAA 1BCCJ 1KYOH 1BGYG 3D71A 1N86A 1BGYJ 2Q1KA 5APSA 5CCHA 2KOGA 1H0TB 2J5UA 1KILE 5AVRB 3HD7B 1LJ2A 1LT9A 3P32A 2WSEH 2OARA 2IBZE 1SQVD 1NTMD 3G3ZA 1HH0A 1CI6A 5KAFE 1VF5C 3L36A 5CMZA 3CX5H 5AVSB 2E74D 1NTZG 1JY2N 3S9OA 3NTNA 4D6TD 1NTZJ 2W6JH 2PRRA 2IDBA 3M0AA 2FYZA 3OA7A 2JO1A 1KYOD 1SQPE 4GIFA 1HBWA 2NRGA 3H6PA 1IFMA 5M1BA 3CPWO 3Q5SA 4QMAA 1SFCB 2FYNC 1OW7A 2W8ZA 3H1IJ 3KQGA 5AW9B 3O8ZA 2OTKE 2HLOA 2HFED 1YYCA 1KQSO 2KP8A 1DIPA 1FZBA 3U59A 3OJAB 4H0LB 3JC22 5CBOA 3CX5D 3L70E 3V4QA 3CCMP 2WPSA 4OH8B 1PZQA 5KJ7D 2KSEA 2QE7H 1EDJA 3WMM0 2W90A 1LNQA 2ZVOB 1HJ0A 3RL0C 2B87B 1ZP0C 1QLED 1LTBC 3TGUE 1FDIA 1LP1A 1FJKA 2XDJA 4TT3H 2FFDC 1NU1D 2JWAA 1NTKK 4WBAA 1YHQP 3Q2YA 3A0HE 1M90Q 3L75D 3BRVB 2H43A 2QG4A 2XNDH 2ZYAA 1NKZB 1VF5D 5B66E 1EXIA 1N7SB 5B5EE 1FDMA 2WT7A 1LTJA 1KZUB 5APXA 3S1KA 1FZCB 4H13B 2OTJP 1M8OB 3H32A 3RL0g 5APTA 3QWOC 1SQXE 4W80A 3WUTA 1BE3G 2D2CC 3SFEC 1BE3J 1OX3A 2WTYA 1X9VA 1LWUC 2GA1A 4C46A 4PD4H 1VQMP 1K05A 1SQBD 2QA4P 2QM8A 5CJ4A 1LTGC 2Z4EA 1FBMA 1NVOA 1KILC 4R4LA 2IPPA 1GK6A 1MUUA 4OGQB 2KYVA 2FBWC 1IFNA 3G71P 3M0DC 3GF7A 3AE2C 5APQA 1XTGB 1P84E 5AVUB 4TLFA 5TJHA 4IFFA 2O01H 5KLIB 1HUCA 5C39A 3RK3E 2A06G 2QJPB 3H1KD 2A45G 4L76A 1NGMB 5AVXB 1IJDB 1RY3A 3ABVC 1OVRA 2QEXP 3RL0D 1LTSC 3H1JG 5KAIE 4YPCA 2A45I 3H1JJ 4U3FE 1ZXGA 1H88A 1T8ZA 4PD4D 3G9RA 3CC7P 3HUSA 2FY8A 2OYHA 1RE4A 4K35A 2P2UA 2R3CA 2N9YB 1CZQA 2YKPA 1X22A 3UIAA 3FXDA 4RKUJ 1JTHB 2HR3A 1N73A 2W6AA 1NTKG 1KB9E 1YTZI 1NTKJ 1PP9E 3LW5J 1YJWP 1GL2B 2QM7A 3L73D 3L71G 2ZXEB 3A3YB 3LIEA 1YJ9P 2OGUA 3L71J 3RK2B 2YMKA 2D2CD 2FKWB 3USSA 1BSHA 3VP9A 3TK1A
chains in the Genus database with same CATH topology
4LGDE 1GU4A 5AW2B 1NTZK 1KILA 2FXMA 1L4AD 1M1JC 1FZFA 2I1JA 1SQPK 1FOSE 1ZLLA 3M9BA 1KILD 3A2AA 1JMMA 4I6MC 2XV5A 1LT9B 2IX7C 3M0DA 1ZR4A 1J1EC 1JY2P 1M1JB 4EOTA 1OWAA 4ZKPA 4HH2A 2NPSC 1J1DC 1LTJC 1LWUB 2XKMA 2J58A 1X79B 1CI6B 1DEBA 1IK9A 5AW6B 3IFMA 1L4AB 3BRTB 1JY3O 3KPEA 2YNYA 2HODA 2C0WA 1J1EB 2MJZA 1JO5A 2NPSB 1J1DB 3V2PA 1VPCA 2KSJA 1KFMA 4RESB 2C9NY 3C9IA 2A45H 1SVFA 1FAVA 1T3JA 3E1IA 2PAJA 5AVQB 1IFIA 4JF7A 4XA4A 1NU1K 3OAKA 3HE5B 2GM4A 2WSFH 3M06A 2CPBA 2WWWA 2CPSA 5CHXA 2L5GB 1JTHA 1GW4A 5AVTB 2P67A 2XNXA 1SQVK 2IFMA 1NTMK 2JJLA 3B5NA 2N9BA 5CCGA 2KB7P 3MD0A 4WY4C 3VMXA 1W2EA 1SQQK 3B5ND 3N7NA 1URQC 1GL2A 1ZR2A 5KJ7C 1HGVA 3VN0A 3HRNA 1PFIA 4WY4B 2E43A 1QL2A 1FU1A 3HD7C 1N86A 4Y99B 3P8MC 1YTZT 4JYCA 2ZFCA 3RK3C 5APSA 5CCHA 3A5TA 2KOGA 5AW3B 2OYIC 5AVYB 5BU5A 3U1CA 5AVRB 2YKOA 3HD7B 1WT6A 4AUWA 1AQ5A 3BATA 3RK3B 1SQBK 2YKQA 1LT9A 1FZAA 3P32A 2WSEH 2OARA 5KTBA 5AW8B 1N7SC 1M1JA 4GT1A 2Q7CA 1RF0C 1LWUA 3G3ZA 1HH0A 3T97A 1CI6A 3U1AA 1L4AA 2N1TC 3TNUB 3L35A 3GHGC 2H7HA 1IFJA 1NO4A 3TYYA 4N3YB 2NPSA 5AVVB 4B86A 2R5DA 3L36A 3HE4B 5CMZA 5AVSB 5AVZB 2NPSD 1JY2N 1S9KD 1NH4A 3NTNA 3GHGB 4O9BA 3BVHA 4I1LA 1RF1C 3P8CD 2JEEA 3M0AA 2FYZA 3NXSA 3OA7A 4GIFA 5KLVK 1SFCC 3KYQA 1HBWA 3LIDA 2WT7B 1LTJB 3H6PA 3HE5A 1IFMA 1N7LA 1SFCB 3EQ2A 3H32B 5AW0B 2C9LY 3KQGA 1LTAC 5AW9B 3VP8A 1XTCC 3O8ZA 3I5CA 1OXZA 2W6BA 1JOCA 2HLOA 2HFED 3VTPC 3MUDA 1YYCA 4JYBA 1IO4A 1FZEA 3M9QA 2XZRA 1NHLA 4C7NB 4WY4A 1FJPA 2KP8A 4I2LC 1LGHB 1FZBA 5AW4B 3U59A 4WB4A 3OJAB 1KQLA 4WY4D 1SP4A 2I1KA 5BVZA 5KJ7A 1LTIC 1JY3P 3V4QA 1URQD 2WPSA 4OH8B 5KJ7D 2O1KA 3L4FA 3WMM0 2M8RA 3B8EB 1GW3A 1G1IA 3HD7A 1DX7A 3RL0C 3V2RA 1G2CB 1LTBC 3HD7D 3V5BA 1E5WA 1NKNA 3IR9A 1URQB 2J59M 3RK3D 1GDTA 1WRGA 1DH3A 1H8AA 3CI9A 1FJKA 3LW5H 1IC2A 2E42A 2YMYA 2XDJA 2H8PD 3VOPA 1M7LA 1JCCA 2C0XA 2FFDC 3TNUA 2Q5UA 4M3LA 1GU5A 4DOJA 1NTKK 4WBAA 3N4XA 3HUSC 5CCGC 1J2JB 2OYHC 3HE4A 1ZV8A 1N7SD 1S9KE 4DZOA 1RE4C 2FFDB 1JCDA 2YO2A 1T2KC 3SWYA 4N78D 2OYIB 3P8CE 3GHGA 3BRVB 1L0NK 3V2QA 2H43A 2N1TD 3HUSB 1JY2O 3SWFA 4IFDK 2OYHB 1NKZB 3RK2C 3HTKB 3VMYA 1N73C 1FZCC 3II6A 2KLVA 2HYNA 1N7SB 3V4WA 1FDMA 2WT7A 2R5BA 1LTJA 2XU6A 5CCHC 1KZUB 5APXA 5APVA 1N73B 1FZCB 1CW5A 1GD2E 1QL1A 2N1TB 3CL3D 4HYTB 1T3UA 1SFCA 1HVVA 2Z5IA 5APUA 3H32A 2HPCB 5APTA 1X8YA 2LKMA 4KHXA 4W80A 1SFCD 2PP6A 1H89A 1LT9C 4LC1A 4AQRD 2WSCH 4N6JA 4W7ZA 2WTYA 1X9VA 2WPQA 1RF1B 4XE5B 1LWUC 4C46A 1RE3C 2BASA 3M9HA 1L4AC 2QM8A 5CJ4A 3NFQA 1LTGC 2Z4EA 1FBMA 4C7NA 1KILC 2IPPA 3PP5A 1ZN5A 1GK6A 1L0LK 1MUUA 1G1JA 5APYA 2KYVA 1IFNA 2WZ7A 3M0DC 1SLQA 1KILB 1LTTC 1JNMA 1A02F 3V2NA 5APQA 1XTGB 1IFDA 5AVUB 1NWQA 4W7YA 4IFFA 2O01H 1HUCA 1HGZA 3MTUE 1GK4A 1G2CA 3VMZA 2A45G 2POHA 1JY3N 1CSBA 2P1JA 1URQA 3VYIA 3P7KA 1GTWA 2O1JA 5AW5B 5AVXB 1IJDB 5AVWB 1KFNA 1RY3A 2HODB 1FZGA 3R2PA 3RL0D 1HJBA 1LTSC 4EIJA 3TSIA 2IFNA 3EFGA 2YO3A 2A45I 4GKGA 4ZKUA 4N78E 1NAFA 2WPRA 2FFDA 1H88A 3KDPB 1T8ZA 2OYIA 5APWA 2Q9IA 3HUSA 2OYHA 3RL0B 3CLQA 3HTKA 3MGNA 1FOSF 1RE4A 5CCGD 2Q3IA 4LLHA 3M91A 1A02J 1GZLA 2P2UA 2R3CA 1CZQA 1N7SA 1T2KD 2YKPA 2GUVA 1RF0A 2W27A 3B5NC 1GL2D 1NOHA 2WITA 4Y99C 3UIAA 1JUNA 1JTHB 5AW1B 1N73A 1FZCA 3BASA 2N1TA 2W6AA 2M3BA 3RK2D 1GL2C 1HWTC 2VRSA 3L37A 5CJ0A 2HPCA 3B5NB 1YTZI 1MV8A 3A7OA 2R32A 1HTLC 2GUSA 5CCHD 1GL2B 4C7RA 2QM7A 1EQ7A 1N2DC 1VDFA 1RF1A 2ZXEB 1Z56A 3A3YB 3LIEA 3RK2B 1MFZA 1MZ9A 5BU8B 2P7JA 3MIWA 2FKWB 4IFMA 4AYCA 1AFOA 5AW7B 1RE3A 2Z5HA 3NMDA 2FYUK 2HG5D 3VP9A 1SQXK 3TK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKO A;  1JOC A;  2YKP A;  3CL3 D;  3EQ2 A;  3L4F A;  3BRV B;  3BRT B;  2W6B A;  2YKQ A; 
#chains in the Genus database with same CATH topology
 3MHV A;  1GU4 A;  3SWK A;  3IF4 A;  3PHL A;  3M9B A;  1KIL D;  1JMM A;  1BSN A;  1YJN P;  4PJ0 E;  5KLV G;  4HH2 A;  2IBZ D;  5KLV J;  5H2F H;  1DEB A;  4DJG A;  3IFM A;  3BRT B;  3IN6 A;  1EZV G;  3CCU P;  3H1H G;  2WSC J;  5DJT B;  2NPS B;  2KZJ A;  2ZYD A;  3H1H J;  1PGO A;  1QX8 A;  3E7K A;  2C9N Y;  2A45 H;  1SVF A;  1T3J A;  1EZV I;  3CC4 P;  1NYH A;  1NU1 K;  1SQP D;  3CCJ P;  4H0L C;  1Y47 A;  1VQ4 P;  4JBZ A;  3I56 P;  1Q82 Q;  2JP3 A;  3H1L G;  1GW4 A;  2WPV B;  5GTH H;  3B5N A;  3AED C;  2AXT H;  3MD0 A;  3VMX A;  1W2E A;  2YIU C;  2B89 A;  3A0H H;  1ZR2 A;  3VN0 A;  1PFI A;  4WY4 B;  4PV1 B;  3B4S A;  1QL2 A;  1BCC E;  5B66 H;  1Q86 Q;  5B5E H;  3L70 D;  2ZYG A;  4JYC A;  3RK3 C;  3KZI E;  3A5T A;  1BGY E;  5AVY B;  4D6T G;  5TIS E;  2YKO A;  2Y9Y A;  1WT6 A;  1KN7 A;  4D6T J;  4AUW A;  1SQB K;  4BRY A;  1PV3 A;  2RMZ A;  3JSV C;  3CCS P;  1N7S C;  3TGU D;  1LWU A;  3OW2 O;  5L8R J;  1X0T A;  3TNU B;  3L35 A;  3EFF K;  5AVV B;  2WMM A;  3HE4 B;  5AVZ B;  4NPE A;  3GHG B;  3BVH A;  4I1L A;  2JEE A;  1JMB A;  2WSS H;  3LID A;  3AE6 C;  1W5C E;  1N7L A;  3MP7 B;  1XTC C;  1SQX D;  4H0L D;  1OXZ A;  5KAI H;  3VTP C;  3MUD A;  1RQV A;  4IL6 H;  3M9Q A;  4C7N B;  4WWI A;  4NPF X;  4ZNC A;  4WB4 A;  2QJY B;  5BVZ A;  1JY3 P;  2B88 A;  4U7J A;  2O1K A;  1EDL A;  1H0T A;  2QRX A;  3Q3D A;  4OVN F;  1PGQ A;  2K9J B;  3B8E B;  1P84 D;  1PPJ E;  3HD7 A;  3JCU E;  1KB9 H;  1G2C B;  3AE7 C;  1DEE G;  1NKN A;  3IR9 A;  1URQ B;  2J59 M;  3RK3 D;  2JDI H;  1GDT A;  2E76 B;  1QGK B;  1IC2 A;  2BCC E;  2E42 A;  2IZ0 A;  1M7L A;  1JCC A;  2H88 C;  3D6Z A;  3N4X A;  3HUS C;  5CCG C;  2QSI A;  2OYH C;  1ZV8 A;  1N7S D;  4DZO A;  1RE4 C;  2YO2 A;  2K88 A;  4U3F D;  1L0N K;  3AE1 C;  1JY2 O;  4IFD K;  3RK2 C;  1NJI Q;  1SQB J;  1N73 C;  1AV1 A;  2RKL A;  3II6 A;  4PJ0 H;  2K1A A;  3V4W A;  3CME P;  1KD1 Q;  2RH0 A;  3GW6 A;  3AEG C;  2M5A B;  2ZJS E;  4HYT B;  2ZT9 C;  1SFC A;  3CCL P;  1K8A Q;  2FYU E;  1KB9 D;  4LC1 A;  3FWN A;  1R8E A;  4N6J A;  1PP9 D;  1S5L X;  2WPQ A;  3D70 A;  3H1K J;  1BE3 E;  2BAS A;  2PFX A;  3NFQ A;  3H1I G;  2LR2 A;  3PP5 A;  1ZN5 A;  1L0L K;  3L72 G;  3AEF C;  3W67 A;  3L72 J;  1LTT C;  1A02 F;  2V7Q J;  5H2F E;  3PJS K;  1AVY A;  4XFJ A;  1S2E A;  1HGZ A;  1S3J A;  2B87 A;  3KHU A;  1GK4 A;  4A7P A;  3AE9 C;  1CSB A;  3P7K A;  2JKV A;  1GTW A;  3SSU A;  1FDO A;  3IAO A;  5AVW B;  2A06 E;  3FWL A;  4K3A A;  4EIJ A;  1VQ6 P;  2YO3 A;  4N78 E;  1SQQ G;  2WPR A;  3KZI H;  1SQQ J;  5KKZ B;  3H1J E;  1ZRT E;  5APW A;  5TIS H;  1FE6 A;  1N8R Q;  1EXJ A;  5CCG D;  3C8V A;  3M91 A;  5GTH E;  2O01 N;  1N7S A;  2AXT E;  1E79 H;  2W27 A;  3B5N C;  1GL2 D;  1KC8 Q;  3CCQ P;  2WQY C;  1FZC A;  4Z1M H;  1U7M A;  3RK2 D;  1HWT C;  2Y0E A;  2VRS A;  1M56 D;  1HTL C;  1NTK E;  1L0N G;  1EQ7 A;  5CBN A;  1L0N J;  1QVG O;  2LXB A;  2ZT9 D;  4OWF A;  4KJM A;  1MZ9 A;  4IFM A;  2R44 A;  1AFO A;  2OYO A;  1RE3 A;  2KI7 B;  1BCC D;  2Z5H A;  3NMD A;  3PH0 A;  1SQX K;  5AW2 B;  1FZF A;  1BGY D;  1T6A A;  4L75 A;  1FOS E;  2ZAE B;  3A2A A;  3FX0 A;  4GDO A;  4EOT A;  1M1J B;  1J1D C;  2XKM A;  1GMJ A;  3T97 B;  1PGJ A;  5AW6 B;  3Q5R A;  1L4A B;  5KLV E;  1S4X A;  1J1E B;  1JO5 A;  2E74 B;  1OW6 A;  1L0L G;  1OIP A;  3PLN A;  3V2P A;  1EZV E;  1VPC A;  1L0L J;  2K3R A;  3AEE C;  2KSJ A;  3H1H E;  3AEC C;  2AXC A;  1RHZ B;  1FAV A;  3Q1M A;  3E1I A;  2PAJ A;  3CMA P;  5DJU B;  2DW3 A;  1IFI A;  4L74 A;  4BWN A;  3JCU H;  4XA4 A;  3B71 A;  3OAK A;  3HE5 B;  1YI2 P;  3CWB G;  2CPB A;  2V4H A;  1EDI A;  2WWW A;  3W68 A;  2CPS A;  3CWB J;  3BCC G;  1DD4 A;  1JTH A;  3BCC J;  3MUD C;  4IL6 E;  2QJK B;  1SQV K;  1PL5 A;  2IFM A;  1NTM K;  2JJL A;  5CCG A;  3H1L E;  2K9Y A;  2KB7 P;  4I7Z C;  4HJG H;  3B5N D;  1URQ C;  3D6Y A;  1GL2 A;  3TGU G;  2I8D A;  3TGU J;  3HD7 C;  4Y99 B;  3P8M C;  2ZFC A;  5BU5 A;  3AEB C;  4UB8 E;  1PPJ D;  2YKQ A;  1FZA A;  2H89 C;  5AW8 B;  4GOF A;  2Q7C A;  1UII A;  1FC2 C;  2R3S A;  3U1A A;  1D7M A;  2BCC D;  1YQ4 C;  1IFJ A;  1NO4 A;  4R4M A;  2NPS A;  2Y0D A;  4B86 A;  2R5D A;  1SQX G;  5K5G B;  4DT0 A;  3QH9 A;  1SQX J;  4O9B A;  1VF5 B;  2WVR A;  2MKV A;  3NXS A;  1SFC C;  3CXH I;  3RGU A;  1Y8A A;  4YTP C;  3CCV P;  1QEX A;  2Y0C A;  5AW0 B;  2FYU D;  3I5C A;  2W6B A;  1JOC A;  2FYN B;  1KQG B;  2KLU A;  4WVZ A;  1K04 A;  4JYB A;  1IO4 A;  2KXP B;  2E5T A;  1BE3 D;  2ZVN B;  4WY4 A;  1FJP A;  4I2L C;  1LGH B;  5AW4 B;  1KQL A;  3AE3 C;  1SP4 A;  1YIJ P;  1URQ D;  1JB0 J;  1NAY A;  3L4F A;  4U3F G;  1SQV G;  5GTI H;  1NTM G;  4U3F J;  1SQV J;  2WSF J;  1U7J A;  3L74 E;  1NTM J;  3V2R A;  3HD7 D;  3V5B A;  1E5W A;  1VQO P;  3LW5 H;  2Q6Q A;  2H8P D;  1Q90 D;  3VOP A;  2G3A A;  2A06 D;  3TNU A;  1PIX A;  2Q5U A;  3GLM A;  1GU5 A;  1J2J B;  3HE4 A;  1S9K E;  1PP9 G;  2FFD B;  1JCD A;  3SWY A;  4N78 D;  2OYI B;  3P8C E;  1PP9 J;  3GHG A;  1ZW0 A;  1K9M Q;  3SWF A;  3H1J D;  1ZRT D;  3HTK B;  3VMY A;  1FZC C;  4H13 C;  1BDC A;  4DCK A;  3CXH H;  2R5B A;  2XU6 A;  1KYO I;  5APV A;  1VQ5 P;  1QL1 A;  2N1T B;  3ITK A;  4EI2 A;  1T3U A;  2WSE J;  5APU A;  2HPC B;  1X8Y A;  2LKM A;  4KHX A;  1SFC D;  2PP6 A;  2K37 A;  1KV4 A;  1NTZ E;  2WSC H;  4BXL A;  1NTK D;  1RF1 B;  4XE5 B;  2M3E A;  1RE3 C;  4OGQ C;  2D2C B;  2Y9Z A;  1L4A C;  4C7N A;  4KT0 J;  3PTZ A;  3AE4 C;  4Y28 J;  1R5S A;  5APY A;  3H1I E;  5KLI C;  1KIL B;  1Q81 Q;  1JNM A;  2QJP C;  3CX5 I;  3Q5P A;  3L72 E;  2K9J A;  4W7Y A;  3O6Q B;  3MTU E;  1IK7 A;  1G2C A;  1NU1 G;  3VMZ A;  2O3J A;  2POH A;  1JY3 N;  1URQ A;  1NU1 J;  1Q7Y Q;  2KIK A;  5AW5 B;  1KFN A;  2HOD B;  5KLV D;  1VQK P;  3L75 G;  2KNC B;  3EWK A;  2E75 B;  3L75 J;  5E79 E;  1HJB A;  3TSI A;  2IFN A;  1EZV D;  4GKG A;  3H1H D;  4YXD C;  4JPZ B;  2IYP A;  2P58 A;  1SQQ E;  4UB8 H;  3CLQ A;  1FOS F;  2Q3I A;  1GZL A;  4Y99 C;  2WIT A;  2M0B A;  1JUN A;  3A0B H;  5AW1 B;  2M5A A;  1Y9B A;  1GL2 C;  4H44 B;  3L37 A;  5CJ0 A;  1VQ8 P;  1VQL P;  4H13 D;  1VQ9 P;  1SQB G;  3H1L D;  1RH5 B;  2KS1 B;  4C7R A;  1VDF A;  1Z56 A;  1L0N E;  3F5H A;  2G8Y A;  1MFT A;  4AYC A;  2OQQ A;  4HB1 A;  5AW7 B;  3WUU A;  2FYU K;  1YQ3 C;  4OGQ D;  2FXM A;  3H1K G;  1L4A D;  1L2P A;  1SQP K;  1ZOY C;  4I6M C;  2XV5 A;  4UB6 H;  1LT9 B;  1ZR4 A;  1JY2 P;  4ZKP A;  2NPS C;  4YXW H;  1OVV A;  1X79 B;  1CI6 B;  4ASW A;  2MJZ A;  4ZMD A;  2QVA A;  1L0L E;  3C9I A;  3TDK A;  3CD6 P;  1UIX A;  5AVQ B;  4PD4 I;  1VQN P;  3M06 A;  4IOI H;  1AQT A;  1JEK A;  5CHX A;  1KQF B;  2O01 J;  2L5G B;  5AVT B;  2P67 A;  4NPD A;  3CWB E;  2XNX A;  2YXQ B;  4CPG A;  4L73 A;  3L73 G;  3BCC E;  1PPJ G;  2N9B A;  3L73 J;  4WY4 C;  4PV1 C;  2SPZ A;  3N7N A;  1PGP A;  2AEJ A;  1DD3 A;  2E43 A;  2BCC G;  2YIU B;  4RJT A;  2CK3 H;  2BCC J;  5GTI E;  1FU1 A;  2B9B A;  1K73 Q;  1IFP A;  1YTZ T;  1R5L A;  5AW3 B;  2OYI C;  3U1C A;  2IBZ G;  3CC2 P;  2JR8 A;  1AQ5 A;  3BAT A;  3RK3 B;  3L74 D;  5KTB A;  3L71 E;  1LP1 B;  1M1J A;  4GT1 A;  1RF0 C;  3T97 A;  2AEM A;  1L4A A;  2N1T C;  1S5L H;  2IBZ I;  3GHG C;  2H7H A;  3TYY A;  4N3Y B;  2FYU G;  3S4R A;  2NPS D;  2FYU J;  1S9K D;  1NH4 A;  1SQP G;  3CXH E;  1RF1 C;  3P8C D;  1SQP J;  2V7Q H;  5KLV K;  3KYQ A;  3KXD A;  2WT7 B;  1LTJ B;  3HE5 A;  2LXC B;  1USE A;  3EQ2 A;  3H32 B;  2C9L Y;  1LTA C;  3AE5 C;  3VP8 A;  5E79 H;  1NTZ D;  1OMI A;  2QIW A;  1OVU A;  3VMA A;  2PGD A;  1FZE A;  2QJY C;  2XZR A;  1NHL A;  1USD A;  3L70 G;  4JQ0 D;  1MKM A;  2IZ1 A;  3L70 J;  2RN0 A;  1YIT P;  2E75 C;  4WY4 D;  4PV1 D;  2I1K A;  5KJ7 A;  1LTI C;  1AJY A;  1HF9 A;  1FS0 E;  3H1I D;  2M8R A;  1GW3 A;  2E76 C;  1G1I A;  4EDF A;  2ZXX A;  3L72 D;  1DX7 A;  1AA0 A;  1SQV E;  1NTM E;  3PRJ A;  1WRG A;  1DH3 A;  1H8A A;  4ASV A;  3CI9 A;  3WU2 E;  2BEQ D;  2YMY A;  2C0X A;  3G4S P;  4HKZ H;  4M3L A;  2FXP A;  2JWD A;  4H44 C;  4DOJ A;  4EYY Q;  3TF5 A;  2IYO A;  1OZH A;  1T2K C;  4D6T E;  5KAF H;  1LT1 A;  3V2Q A;  1M1K Q;  2N1T D;  3HUS B;  3SFD C;  3A0B E;  4MN4 C;  2OYH B;  1KTM A;  1KYO E;  1SQQ D;  2KLV A;  2HYN A;  1YBK A;  2UWJ E;  5CCH C;  3RBX A;  1N73 B;  1CW5 A;  1GD2 E;  3CL3 D;  1HVV A;  2Z5I A;  2YXR B;  1H89 A;  1LT9 C;  4AQR D;  1KMI Z;  1M57 D;  1JM0 A;  2ZT9 B;  4W7Z A;  2E5Y A;  3AEA C;  1EDK A;  1IZN B;  3M9H A;  3C1L A;  1L0N D;  1VL2 A;  3CX5 E;  4UB6 E;  1Q2N A;  1G1J A;  1TU3 F;  2WZ7 A;  1SLQ A;  3V2N A;  4GOE A;  1IFD A;  1NWQ A;  2E75 D;  2Q3E A;  2P10 A;  1P84 I;  1KOR A;  4GOD A;  2P1J A;  3VYI A;  2O1J A;  1BDD A;  1NU1 E;  1WMK A;  1OFC X;  2E76 D;  3FXE A;  1FZG A;  2FXO A;  3GF3 A;  3R2P A;  2L91 A;  5KKZ C;  3EFG A;  4IL6 X;  3L75 E;  4ZKU A;  1NAF A;  2FFD A;  3AE8 C;  3H1L J;  3KDP B;  1L0L D;  2OYI A;  2Q9I A;  1EC5 A;  4RO0 A;  2KZI A;  4H44 D;  3RL0 B;  3I55 P;  3HTK A;  3MGN A;  4LLH A;  1A02 J;  2NZ2 A;  5EFW B;  3RBZ A;  3FGA D;  1T2K D;  2GUV A;  1RF0 A;  1OW8 A;  1NOH A;  3WUV A;  3BAS A;  2N1T A;  2M3B A;  3CWB D;  2HPC A;  2BEZ F;  3B5N B;  1MV8 A;  3A7O A;  3BCC D;  2R32 A;  3K5B A;  2GUS A;  5CCH D;  1KB9 I;  1N2D C;  1SQB E;  1RF1 A;  3GG2 A;  1MFZ A;  3F89 A;  5BU8 B;  2P7J A;  3MIW A;  2HG5 D;  4LGD E;  1NTZ K;  1KIL A;  1M1J C;  2I1J A;  1ZLL A;  4BRY B;  1SS1 A;  2IX7 C;  1S5L E;  3ZDM A;  3M0D A;  3O6Q A;  3H1K E;  1J1E C;  1OWA A;  2E74 C;  1LWU B;  1LTJ C;  3L71 D;  1P84 H;  2J58 A;  3GMA A;  3CCR P;  1IK9 A;  1JY3 O;  1S72 P;  1W2B O;  2KK7 A;  3KPE A;  2YNY A;  2HOD A;  2C0W A;  2KNC A;  1J1D B;  3E1R A;  1AVO A;  1KFM A;  4RES B;  1VQP P;  4PD4 E;  3CXH D;  1VQ7 P;  2KUB A;  2W83 C;  3G6E P;  4JF7 A;  3MZW B;  2GM4 A;  1U57 A;  2QJK C;  2WSF H;  3H25 A;  2AEF A;  3WU2 H;  1ZME C;  3R4Y A;  1RQU A;  3CCE P;  2OTL P;  3V6I A;  3L74 G;  1SQQ K;  2KS1 A;  1S1C X;  3L73 E;  3L74 J;  5KJ7 C;  1QVF O;  1HGV A;  1BCC G;  3HRN A;  4I7Z B;  2ITA A;  1BCC J;  1KYO H;  1BGY G;  3D71 A;  1N86 A;  1BGY J;  2Q1K A;  5APS A;  5CCH A;  2KOG A;  1H0T B;  2J5U A;  1KIL E;  5AVR B;  3HD7 B;  1LJ2 A;  1LT9 A;  3P32 A;  2WSE H;  2OAR A;  2IBZ E;  1SQV D;  1NTM D;  3G3Z A;  1HH0 A;  1CI6 A;  5KAF E;  1VF5 C;  3L36 A;  5CMZ A;  3CX5 H;  5AVS B;  2E74 D;  1NTZ G;  1JY2 N;  3S9O A;  3NTN A;  4D6T D;  1NTZ J;  2W6J H;  2PRR A;  2IDB A;  3M0A A;  2FYZ A;  3OA7 A;  2JO1 A;  1KYO D;  1SQP E;  4GIF A;  1HBW A;  2NRG A;  3H6P A;  1IFM A;  5M1B A;  3CPW O;  3Q5S A;  4QMA A;  1SFC B;  2FYN C;  1OW7 A;  2W8Z A;  3H1I J;  3KQG A;  5AW9 B;  3O8Z A;  2OTK E;  2HLO A;  2HFE D;  1YYC A;  1KQS O;  2KP8 A;  1DIP A;  1FZB A;  3U59 A;  3OJA B;  4H0L B;  3JC2 2;  5CBO A;  3CX5 D;  3L70 E;  3V4Q A;  3CCM P;  2WPS A;  4OH8 B;  1PZQ A;  5KJ7 D;  2KSE A;  2QE7 H;  1EDJ A;  3WMM 0;  2W90 A;  1LNQ A;  2ZVO B;  1HJ0 A;  3RL0 C;  2B87 B;  1ZP0 C;  1QLE D;  1LTB C;  3TGU E;  1FDI A;  1LP1 A;  1FJK A;  2XDJ A;  4TT3 H;  2FFD C;  1NU1 D;  2JWA A;  1NTK K;  4WBA A;  1YHQ P;  3Q2Y A;  3A0H E;  1M90 Q;  3L75 D;  3BRV B;  2H43 A;  2QG4 A;  2XND H;  2ZYA A;  1NKZ B;  1VF5 D;  5B66 E;  1EXI A;  1N7S B;  5B5E E;  1FDM A;  2WT7 A;  1LTJ A;  1KZU B;  5APX A;  3S1K A;  1FZC B;  4H13 B;  2OTJ P;  1M8O B;  3H32 A;  3RL0 g;  5APT A;  3QWO C;  1SQX E;  4W80 A;  3WUT A;  1BE3 G;  2D2C C;  3SFE C;  1BE3 J;  1OX3 A;  2WTY A;  1X9V A;  1LWU C;  2GA1 A;  4C46 A;  4PD4 H;  1VQM P;  1K05 A;  1SQB D;  2QA4 P;  2QM8 A;  5CJ4 A;  1LTG C;  2Z4E A;  1FBM A;  1NVO A;  1KIL C;  4R4L A;  2IPP A;  1GK6 A;  1MUU A;  4OGQ B;  2KYV A;  2FBW C;  1IFN A;  3G71 P;  3M0D C;  3GF7 A;  3AE2 C;  5APQ A;  1XTG B;  1P84 E;  5AVU B;  4TLF A;  5TJH A;  4IFF A;  2O01 H;  5KLI B;  1HUC A;  5C39 A;  3RK3 E;  2A06 G;  2QJP B;  3H1K D;  2A45 G;  4L76 A;  1NGM B;  5AVX B;  1IJD B;  1RY3 A;  3ABV C;  1OVR A;  2QEX P;  3RL0 D;  1LTS C;  3H1J G;  5KAI E;  4YPC A;  2A45 I;  3H1J J;  4U3F E;  1ZXG A;  1H88 A;  1T8Z A;  4PD4 D;  3G9R A;  3CC7 P;  3HUS A;  2FY8 A;  2OYH A;  1RE4 A;  4K35 A;  2P2U A;  2R3C A;  2N9Y B;  1CZQ A;  2YKP A;  1X22 A;  3UIA A;  3FXD A;  4RKU J;  1JTH B;  2HR3 A;  1N73 A;  2W6A A;  1NTK G;  1KB9 E;  1YTZ I;  1NTK J;  1PP9 E;  3LW5 J;  1YJW P;  1GL2 B;  2QM7 A;  3L73 D;  3L71 G;  2ZXE B;  3A3Y B;  3LIE A;  1YJ9 P;  2OGU A;  3L71 J;  3RK2 B;  2YMK A;  2D2C D;  2FKW B;  3USS A;  1BSH A;  3VP9 A;  3TK1 A; 
#chains in the Genus database with same CATH homology
 4LGD E;  1GU4 A;  5AW2 B;  1NTZ K;  1KIL A;  2FXM A;  1L4A D;  1M1J C;  1FZF A;  2I1J A;  1SQP K;  1FOS E;  1ZLL A;  3M9B A;  1KIL D;  3A2A A;  1JMM A;  4I6M C;  2XV5 A;  1LT9 B;  2IX7 C;  3M0D A;  1ZR4 A;  1J1E C;  1JY2 P;  1M1J B;  4EOT A;  1OWA A;  4ZKP A;  4HH2 A;  2NPS C;  1J1D C;  1LTJ C;  1LWU B;  2XKM A;  2J58 A;  1X79 B;  1CI6 B;  1DEB A;  1IK9 A;  5AW6 B;  3IFM A;  1L4A B;  3BRT B;  1JY3 O;  3KPE A;  2YNY A;  2HOD A;  2C0W A;  1J1E B;  2MJZ A;  1JO5 A;  2NPS B;  1J1D B;  3V2P A;  1VPC A;  2KSJ A;  1KFM A;  4RES B;  2C9N Y;  3C9I A;  2A45 H;  1SVF A;  1FAV A;  1T3J A;  3E1I A;  2PAJ A;  5AVQ B;  1IFI A;  4JF7 A;  4XA4 A;  1NU1 K;  3OAK A;  3HE5 B;  2GM4 A;  2WSF H;  3M06 A;  2CPB A;  2WWW A;  2CPS A;  5CHX A;  2L5G B;  1JTH A;  1GW4 A;  5AVT B;  2P67 A;  2XNX A;  1SQV K;  2IFM A;  1NTM K;  2JJL A;  3B5N A;  2N9B A;  5CCG A;  2KB7 P;  3MD0 A;  4WY4 C;  3VMX A;  1W2E A;  1SQQ K;  3B5N D;  3N7N A;  1URQ C;  1GL2 A;  1ZR2 A;  5KJ7 C;  1HGV A;  3VN0 A;  3HRN A;  1PFI A;  4WY4 B;  2E43 A;  1QL2 A;  1FU1 A;  3HD7 C;  1N86 A;  4Y99 B;  3P8M C;  1YTZ T;  4JYC A;  2ZFC A;  3RK3 C;  5APS A;  5CCH A;  3A5T A;  2KOG A;  5AW3 B;  2OYI C;  5AVY B;  5BU5 A;  3U1C A;  5AVR B;  2YKO A;  3HD7 B;  1WT6 A;  4AUW A;  1AQ5 A;  3BAT A;  3RK3 B;  1SQB K;  2YKQ A;  1LT9 A;  1FZA A;  3P32 A;  2WSE H;  2OAR A;  5KTB A;  5AW8 B;  1N7S C;  1M1J A;  4GT1 A;  2Q7C A;  1RF0 C;  1LWU A;  3G3Z A;  1HH0 A;  3T97 A;  1CI6 A;  3U1A A;  1L4A A;  2N1T C;  3TNU B;  3L35 A;  3GHG C;  2H7H A;  1IFJ A;  1NO4 A;  3TYY A;  4N3Y B;  2NPS A;  5AVV B;  4B86 A;  2R5D A;  3L36 A;  3HE4 B;  5CMZ A;  5AVS B;  5AVZ B;  2NPS D;  1JY2 N;  1S9K D;  1NH4 A;  3NTN A;  3GHG B;  4O9B A;  3BVH A;  4I1L A;  1RF1 C;  3P8C D;  2JEE A;  3M0A A;  2FYZ A;  3NXS A;  3OA7 A;  4GIF A;  5KLV K;  1SFC C;  3KYQ A;  1HBW A;  3LID A;  2WT7 B;  1LTJ B;  3H6P A;  3HE5 A;  1IFM A;  1N7L A;  1SFC B;  3EQ2 A;  3H32 B;  5AW0 B;  2C9L Y;  3KQG A;  1LTA C;  5AW9 B;  3VP8 A;  1XTC C;  3O8Z A;  3I5C A;  1OXZ A;  2W6B A;  1JOC A;  2HLO A;  2HFE D;  3VTP C;  3MUD A;  1YYC A;  4JYB A;  1IO4 A;  1FZE A;  3M9Q A;  2XZR A;  1NHL A;  4C7N B;  4WY4 A;  1FJP A;  2KP8 A;  4I2L C;  1LGH B;  1FZB A;  5AW4 B;  3U59 A;  4WB4 A;  3OJA B;  1KQL A;  4WY4 D;  1SP4 A;  2I1K A;  5BVZ A;  5KJ7 A;  1LTI C;  1JY3 P;  3V4Q A;  1URQ D;  2WPS A;  4OH8 B;  5KJ7 D;  2O1K A;  3L4F A;  3WMM 0;  2M8R A;  3B8E B;  1GW3 A;  1G1I A;  3HD7 A;  1DX7 A;  3RL0 C;  3V2R A;  1G2C B;  1LTB C;  3HD7 D;  3V5B A;  1E5W A;  1NKN A;  3IR9 A;  1URQ B;  2J59 M;  3RK3 D;  1GDT A;  1WRG A;  1DH3 A;  1H8A A;  3CI9 A;  1FJK A;  3LW5 H;  1IC2 A;  2E42 A;  2YMY A;  2XDJ A;  2H8P D;  3VOP A;  1M7L A;  1JCC A;  2C0X A;  2FFD C;  3TNU A;  2Q5U A;  4M3L A;  1GU5 A;  4DOJ A;  1NTK K;  4WBA A;  3N4X A;  3HUS C;  5CCG C;  1J2J B;  2OYH C;  3HE4 A;  1ZV8 A;  1N7S D;  1S9K E;  4DZO A;  1RE4 C;  2FFD B;  1JCD A;  2YO2 A;  1T2K C;  3SWY A;  4N78 D;  2OYI B;  3P8C E;  3GHG A;  3BRV B;  1L0N K;  3V2Q A;  2H43 A;  2N1T D;  3HUS B;  1JY2 O;  3SWF A;  4IFD K;  2OYH B;  1NKZ B;  3RK2 C;  3HTK B;  3VMY A;  1N73 C;  1FZC C;  3II6 A;  2KLV A;  2HYN A;  1N7S B;  3V4W A;  1FDM A;  2WT7 A;  2R5B A;  1LTJ A;  2XU6 A;  5CCH C;  1KZU B;  5APX A;  5APV A;  1N73 B;  1FZC B;  1CW5 A;  1GD2 E;  1QL1 A;  2N1T B;  3CL3 D;  4HYT B;  1T3U A;  1SFC A;  1HVV A;  2Z5I A;  5APU A;  3H32 A;  2HPC B;  5APT A;  1X8Y A;  2LKM A;  4KHX A;  4W80 A;  1SFC D;  2PP6 A;  1H89 A;  1LT9 C;  4LC1 A;  4AQR D;  2WSC H;  4N6J A;  4W7Z A;  2WTY A;  1X9V A;  2WPQ A;  1RF1 B;  4XE5 B;  1LWU C;  4C46 A;  1RE3 C;  2BAS A;  3M9H A;  1L4A C;  2QM8 A;  5CJ4 A;  3NFQ A;  1LTG C;  2Z4E A;  1FBM A;  4C7N A;  1KIL C;  2IPP A;  3PP5 A;  1ZN5 A;  1GK6 A;  1L0L K;  1MUU A;  1G1J A;  5APY A;  2KYV A;  1IFN A;  2WZ7 A;  3M0D C;  1SLQ A;  1KIL B;  1LTT C;  1JNM A;  1A02 F;  3V2N A;  5APQ A;  1XTG B;  1IFD A;  5AVU B;  1NWQ A;  4W7Y A;  4IFF A;  2O01 H;  1HUC A;  1HGZ A;  3MTU E;  1GK4 A;  1G2C A;  3VMZ A;  2A45 G;  2POH A;  1JY3 N;  1CSB A;  2P1J A;  1URQ A;  3VYI A;  3P7K A;  1GTW A;  2O1J A;  5AW5 B;  5AVX B;  1IJD B;  5AVW B;  1KFN A;  1RY3 A;  2HOD B;  1FZG A;  3R2P A;  3RL0 D;  1HJB A;  1LTS C;  4EIJ A;  3TSI A;  2IFN A;  3EFG A;  2YO3 A;  2A45 I;  4GKG A;  4ZKU A;  4N78 E;  1NAF A;  2WPR A;  2FFD A;  1H88 A;  3KDP B;  1T8Z A;  2OYI A;  5APW A;  2Q9I A;  3HUS A;  2OYH A;  3RL0 B;  3CLQ A;  3HTK A;  3MGN A;  1FOS F;  1RE4 A;  5CCG D;  2Q3I A;  4LLH A;  3M91 A;  1A02 J;  1GZL A;  2P2U A;  2R3C A;  1CZQ A;  1N7S A;  1T2K D;  2YKP A;  2GUV A;  1RF0 A;  2W27 A;  3B5N C;  1GL2 D;  1NOH A;  2WIT A;  4Y99 C;  3UIA A;  1JUN A;  1JTH B;  5AW1 B;  1N73 A;  1FZC A;  3BAS A;  2N1T A;  2W6A A;  2M3B A;  3RK2 D;  1GL2 C;  1HWT C;  2VRS A;  3L37 A;  5CJ0 A;  2HPC A;  3B5N B;  1YTZ I;  1MV8 A;  3A7O A;  2R32 A;  1HTL C;  2GUS A;  5CCH D;  1GL2 B;  4C7R A;  2QM7 A;  1EQ7 A;  1N2D C;  1VDF A;  1RF1 A;  2ZXE B;  1Z56 A;  3A3Y B;  3LIE A;  3RK2 B;  1MFZ A;  1MZ9 A;  5BU8 B;  2P7J A;  3MIW A;  2FKW B;  4IFM A;  4AYC A;  1AFO A;  5AW7 B;  1RE3 A;  2Z5H A;  3NMD A;  2FYU K;  2HG5 D;  3VP9 A;  1SQX K;  3TK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...