2W7NA

Crystal structure of kora bound to operator dna: insight into repressor cooperation in rp4 gene regulation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRFB TRANSCRIPTIONAL REPRESSOR PROTEIN
publication title Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w7nA00
2W7NA 3M8JA 5CKTA
chains in the Genus database with same CATH superfamily
1ENHA 3SHFA 2AS5F 2V1UA 2VBWA 5J1YA 3I56I 2QZ8A 2P81A 3FWEA 3VWBA 1MJAA 3CMMA 2XRNA 1KU3A 3ZMZA 4X0GA 3CUOA 1IAWA 5EZGA 1D0ZA 1X19A 1HC8A 2VC1A 5LGTA 4HSTA 5BMZA 1P7IA 1HW1A 2Y0SN 1UG2A 2HZTA 2DI3A 3RQ4A 1EF4A 1UCRA 1ZGAA 2JPCA 2L7ZA 2WB1A 4L5JA 5BPDA 1BW5A 5EGOB 2BW3B 2R0QC 2VUMJ 2L2OA 4AIDA 4BDYA 2MFZA 1YJ9I 3AAFA 5D4RA 2LRDA 4NQWB 3LSRA 2OBPA 3E97A 4XOPA 3J80Z 1G59A 1QU3A 4DBQA 1X4OA 1JUSA 2LG4A 4FE7A 2L7KA 5H20A 3OWTA 4M6VA 4R8HA 5F04A 2CFXA 1K78B 4BQAA 2DA1A 2FRHA 4F92B 1MD0A 3KETA 1TQIA 3TBIA 2HDWA 3G4SI 3EUAA 4PGHA 3CQZJ 3ZQCA 3B73A 3S32A 2FBIA 3I5UA 2O03A 2VQLA 2PFBA 3R4KA 2HXOA 2KKOA 3H3UA 4RGUA 1JKQC 2AXTC 5GTIC 5K7ZA 2GLOA 1W7PB 2QENA 5ICFA 1BJZA 2EZHA 1F43A 1P4AA 4KYWA 1LDDA 3AFHA 2VN2A 5FKLA 4BXUA 3K4JA 5E18F 1D8JA 2IRFG 1X1CA 4IF4A 4F7ZA 1D5YA 1BL0A 1YYVA 2EIKH 2AO9A 3BPVA 2HOAA 2IEKA 3TO6A 2PG4A 5FLMJ 5DUKA 3L09A 1KQ8A 4L0ZB 2KQRA 2VLAA 3J7AO 5JHFA 4IRIA 4E4HA 4G94A 3ZN1A 4XICA 3ONQA 2M30A 3BTIA 1FBUA 3O3KA 2I10A 3S93A 4JK1X 1F5TA 3C1DA 4MQ9F 1L0OC 2VXDA 3RYRA 1S29A 4IQJA 3BLYA 1SFOJ 1JHFA 2DTRA 3IUOA 2HOTA 3VYRB 3OYDA 3M9AA 5LLQA 2DQRA 3KP6A 2P5VA 4XONA 3TP0A 2MBFA 2HQNA 2JTVA 4UVAA 2DDBA 1XMAA 3BCAA 1Y39A 4ZDOA 1B72A 3SZTA 3ROUA 3IKTA 5E20A 5DCMA 1ZRCA 1ZR2A 3A01A 4YG2F 3ZRGA 2K86A 2LNBA 1LE8A 3S2DJ 1FWZA 3VYTB 5J8FA 2IJLA 1W36C 1U5TB 4FCYA 5JFRA 1AWCA 4E6KG 4P55A 3E6CC 4IEJA 3OR1C 2LREA 4EM2A 3BTJA 4KN4X 3I4NJ 4V2FA 1ZELA 3QAHA 2WAQA 5D8LB 4AYBN 2E35A 1G3WA 1XGSA 1Z9CA 1NK2P 1VTNC 1B6AA 3LOCA 4U0VA 3T5XA 5D4SA 4AIJA 2NAZA 4M9XA 3R60A 1OCPA 3CUQC 2DYRH 4N0BA 5E1ZB 5D5VB 1MMGA 4OINF 1JUPA 4XBFA 3WU2C 2HVSA 3MKWB 2XF5A 1WQ2A 1W36D 4WCGA 2RDPA 1A6IA 1MDMA 3JRDA 1PVEA 5J4VA 3R6SA 3C2HA 2XVCA 2KL4A 2KHMA 1LEAA 3DTEA 4RGSA 1WJBA 1TWGJ 4O5VA 3PNYA 3HTUA 1Z0XA 3LWFA 2EV5A 3MMYB 2IS4A 2X85A 1RIOH 2HYFA 2J5OA 3S2HJ 2VJ5A 1ON1A 5C3EJ 3GMEA 4IHYA 1NHAA 3QODA 2X1DA 5F64A 4BDZA 2ISZA 1JKOC 2ZXWH 3KEYA 4GO1A 1W5SA 3EDPA 4C30A 4IKFA 2O61A 4LLLA 2QKMB 2M45A 2XPVA 1LQ1A 1EH8A 3ASNH 5HNHA 4RM3A 5GP9A 4GRIA 2YX7A 4LB5A 1FC3A 4CCNA 1WH5A 3TW6A 3AL0C 4IHVA 2LSOA 1YLFA 4E70A 2DO7A 2MH9A 4IHSA 1O3SA 4A3DJ 5K1YA 4M6YA 3FIWA 4M6XA 4PFOA 2KMUA 5K5QA 1KYWA 2X6XA 4DIQA 1V5GA 4KIBA 3SEZA 5K5RA 4XNFA 1LVKA 2XV4S 3KCCA 4HG2A 3S15J 2IPQX 4RLQA 4A69C 2V6CA 3L9FA 1HKQA 3A1YA 4I01A 5L3CA 2FMYA 3D5LA 3OS0A 3LMMA 4ITVA 5IP6A 2YR2A 2A05A 4A6DA 4FX0A 3J80K 3KP5A 4KNYA 2GIVA 3QYEA 3RKYA 2XDVA 5IYDJ 2L4AA 3F8CA 4HW0A 4PGGA 2F4OB 5DCFA 3DKWA 3OYCA 1DP7P 2O9LA 2LYCA 4KUMA 2A61A 2KRCA 3H5NA 2K4JA 3HSFA 4A93J 4OOIA 3KZYA 3DV8A 4FASD 1SD5A 2RNJA 5FLVA 1ETQA 5H2FC 1I27A 5FKMA 5GPAA 5FKOA 1M1EB 3H0GJ 3PSIA 3GZ5A 1DGWY 1U2WA 2R4GA 2Y30A 3KPHA 1H89C 3V8KA 1HLVA 2UV1A 1SVOA 1OCTC 4KISA 4L9VA 4BBRJ 4BAYA 3CO7C 1T95A 3MFKA 1FTZA 1GV2A 1YRNB 1USTA 2A6TA 1LVAA 2LF7A 3KP2A 4XMYA 2MLKA 4XRSG 4OIQF 2ZO4A 5IPAA 3FISA 1YE9A 2TCTA 4F55A 4R79A 4RBOA 2RQPA 4GXOA 2H6CA 1IF1A 5J8CA 4HX7A 2XSJC 4AYBA 2KLOA 2QKLB 4P5OA 1UZCA 1BC8C 2IS1A 4BH9A 2RV8A 1PP7U 2KRFA 4F52A 1GV5A 2FEZA 1WJ5A 1FSEA 2D5VA 1HCRA 4OIOF 3CTAA 1Z6TA 3PUFA 2KZVA 2OU2A 4PJNA 4E7JA 3S1MJ 2A5YB 1DUXC 3MZ8A 1IN5A 4YIIA 2EK5A 3RPUD 2MC4A 3OIOA 1X3UA 2VJIA 3F6VA 5E3OA 5LHGA 4EJOA 1RPWA 2VIXA 2CQNA 3K2ZA 3KZIC 1KU9A 2R5ZB 2V4JC 3F21A 1QGPA 3IAM2 3GX4X 4N9HA 5FKNA 4KIFA 1I3AA 2DMNA 4LB6B 1J9IA 1KA8A 3H9QA 2I5UA 4HF2A 4B1RA 1K83J 2QQ8A 3VB2A 2FXAA 5K5OA 2XIGA 3L2WA 1D1AA 1E3OC 3P5JA 2LKPA 1QO0D 2NNYA 1XSVA 1KYZA 1AKHB 4U7DA 2LBFA 2VT3A 1IXRC 3FMQA 2L9NA 2W25A 3OYGA 4Q48A 2O5RA 1BI1A 4UVBA 1HKSA 2LKSA 2M9HA 4G7ZF 4I2OA 2VQGA 2EINH 2VKVA 3HXLA 4WK8F 2Y31A 3CCSI 1WHUA 1W1WE 3MAJA 2FOWA 2LDUA 4HV6A 4XIDA 1NG7A 5HDNA 1R6RA 2PMHA 4BJ6C 2P4WA 1S9HA 3DCFA 1BN5A 3CDLA 2JZYA 4A0YA 2MYSA 3ZQGA 4MTDA 3GXOA 1T0FA 2L9RA 1O7LA 4BHPA 2K40A 4UNOA 2BXYA 2E7XA 2QLZA 3OV8A 3GCMA 5ERIA 4KN7X 1KU2A 3UNGC 1BIBA 1TTYA 3WGIA 5GPCA 4HNTA 1VQ5I 1ZGWA 1SD6A 2IA0A 1LB2A 4M3FA 3H1CA 1ETKA 2GQQA 2V1DA 5F1JA 1UB9A 1BIAA 1EH6A 2ID6A 4LG0B 2MLGA 3CC7I 1RKWA 2OCCH 2CUEA 3GFMA 2R7VA 2P7CB 2RN7A 1SFKA 1R71A 2OC6A 5M3FJ 1IN6A 3HBLA 5CPRB 3VPRA 3WTVC 1FMWA 3P7NA 4XLPF 1CF7B 3GTGJ 2M2EA 3BOQA 3F23A 2HNHA 3K9TA 1ZLKA 3AG2H 1Y8RB 4W1UA 4D1QA 3S14J 1VQKI 4OAYA 1X1AA 3D0SA 1ORKA 2P8TA 2HPMA 4G6DA 4IVNA 1B1BA 4P9FA 1F9NA 1TWCJ 1KZHA 4ETSA 1R5ID 3MVPA 1WVRA 2ZMEA 3B02A 5DV5A 1IRZA 3PNVA 4GDFA 3GEZA 4G6QA 5LD2C 5BOXA 2F5VA 3JR9A 1YO5C 3I58A 4NHJA 3CP2A 3ABUA 1XDUA 3ERMA 4CYDA 4HNVA 2QQAA 2DMPA 5HLGA 1EJ9A 3GTOJ 2RKHA 2ZFUA 3CJRB 3HOTA 2CSOA 1G6NA 1OQYA 3WGHA 2CMPA 4DZPA 4JX6A 5H6QA 1A5JA 2B7EA 3H3ZA 4II2A 1F4KA 1G4DA 4OWRB 9ANTA 2V26A 1VQLI 1UFMA 1Y6IA 3IH4A 4HLXA 1YX3A 4F3QA 2L3DA 3BY6A 3CCVI 3JREA 4LIUA 4BQQA 2BHYA 3QYBA 1D8KA 3Q0UA 3FM3A 2OPTA 4XLCA 1REPC 2E34A 1IDZA 2FA5A 4E7HA 1K79A 2V9PA 3LQQA 4CA0A 2GAUA 1VI0A 1O57A 2E36A 3S8PA 1RUNA 4A2UA 3CUQA 1X2NA 4ENKA 5J47A 1MH4A 1O3QA 4OU0A 4ZZLA 4ZYHA 1Y0UA 2K27A 4AD9A 3JRHA 4PCQA 3DBRB 1SVLA 5M5WJ 3HHGA 2B9SA 2A3SA 2W85A 2DXIA 4JP0A 4EEFG 1FBQA 3CF2A 2BXZA 2G0EA 2OQRA 4PDKA 2HOSA 3W3CA 3DEWA 1KQ9A 4EATA 5C4JJ 1OYYA 4BU2A 4BJ5C 1SMTA 1OCOH 2W48A 3K4KA 4EGZA 1TQPA 2XGEA 2IGNA 2HZDA 2KISA 1HOMA 1KONA 4DYQA 1ZGJA 4C2MJ 2KP6A 2E5NA 3ZQHA 2YU9J 2WTEA 2DA2A 2GBYA 1XPXA 5DYMA 5HS8A 1N25A 4KFCA 2F5DA 4II3A 3SZPA 3IKVA 3P9IA 5DTDA 1XGNA 2F48A 3KP4A 5J6XA 3VSKA 2PJRB 3LSTA 1OKRA 2GA1A 2WA0A 3OYAA 3HOWJ 2R5YB 2RAEA 3I54A 2PX9A 4EJWA 3HG9A 3CLQA 3L2QA 1Z77A 2HEOA 2E2JJ 4KJZA 2XKOA 1BI0A 3KLOA 4G8XA 2XRLA 3OL3A 2HU9A 1VQOI 3R0AA 5D8KB 3PQJA 2OTJI 3TOAA 3H9GA 4DQ2A 4V2GA 2P6SA 3WG9A 2EWNA 1B9NA 3C2BA 3O2PE 3T0YA 4HDUA 1X58A 3HOYJ 3GF2A 3FXUA 2Z9OA 2M5WA 3BPXA 3HRSA 1MJ9A 2P0WA 3BG7A 1SEUA 1IRFA 1HSTA 1RESA 3A0HC 4LITA 3N97A 1BBYA 2MA3A 2Y2ZA 2XPWA 1S72I 1ZRDA 3CCLI 2XAQA 4I6ZA 4U88A 4ZTFA 5HLTA 4XN3A 4ZYEA 2HDCA 3JCUC 4N4OB 4JBAA 2TDXA 3CCYA 3F8FA 2H1KA 2B63J 2V7FA 1FOXA 3CJNA 5CVIA 2FSWA 3TEDA 2EPFA 1ZYRF 1LDJA 5CVJA 3JRCA 2IA1A 4G12A 2ECCA 2X1EA 4UUSA 3WE2A 2DTZA 1WH7A 2I8DA 2UXXA 2CU7A 1Y56A 4C2TA 2LD5A 3ZMUA 1Z05A 3DLLF 3WTZA 4L9TA 4XN0A 2L54A 1OPCA 3CDIA 2Y0MA 2A5WA 4D0PA 3Q0WA 3PQKA 3A02A 2R7XA 5A2QZ 1DGRM 3FBNB 1IC8A 3DEUA 1RUOA 4XLEA 5DEQA 5LEKA 2Z2SB 3KYLA 4J01A 1N77A 5DUIA 1GVJA 1YX5A 3JTHA 2M8GX 5HVQC 4OAZA 3BZKA 4XLFA 5IYBJ 4L5EA 4EQQA 1FX7A 1B4AA 2OTLI 4HEA2 2GA2A 1SAUA 2OJED 2DOAA 4A0ZA 4KMFA 2BY1A 1MNMC 3BG9A 3I59B 2A07F 2FJ1A 1IJWC 1XGOA 4Q4ZF 2RVCA 3BJ6A 5IP9J 3SDGA 1T2KA 3C3WA 2CW0F 2FQ4A 2K9QA 2JRMA 3E5QA 2DODA 2IGMA 5DD4A 3ISPA 2XF6A 3TDZC 2O7OA 3BTLA 4JQFA 4RM2A 4BHBA 3F22A 4BEHA 3R61A 5KK1A 1SMYF 3U1DA 1MSFC 4CSWA 4X1EA 1N78A 4HLYA 1LE8B 5LGNA 1BI2A 4TV7A 2O8KA 4A3LJ 3KP7A 1T0FC 3H5RA 1HW5A 3BR5A 1IXCA 2M7BA 3G3ZA 5J1UA 3M4OJ 1Q1HA 2IGOA 3CESA 2RQQA 4ASNA 2DMTA 3OSFA 4M73A 1B9MA 3CCUI 1AHDP 3M8EA 3HOSA 2OF7A 2C6YA 3FX3A 5JLXA 2LK2A 1JJ8C 2GXAA 4H0EA 1CGPA 3FDYA 3EPZA 4OIRF 3ABTA 4XKWA 1LFUP 3IAS2 2CH0A 5E1WA 3S1QJ 1T56A 1MW7A 4CGZA 4LG3A 2XB5A 2QSFX 2M4KA 1WI9A 2GXGA 4IL6C 3PFIA 3V8JA 5AONA 4QIWN 2IP2A 3BG6A 1WJCA 2HGCA 3GO5A 1R1VA 1ZKGA 2R93J 4HA8A 3DPLC 2ZKZA 3WTSC 2DA7A 1DP3A 4BXXJ 4N4NB 3O8HA 3SDBA 1IXSB 1H9GA 1EKEA 2CW7A 4AIHA 2JA6J 1GDTA 2ESHA 2DT5A 1UAAA 1I1GA 5EEHA 1FYKA 4XKBA 5FFZA 2ZMEC 1PYVA 2Z3YA 1W0TA 2Y48A 2L02A 4IQ4A 2L0KA 4B09A 3BDDA 3WG7H 3I9V2 3P9CA 5D5XB 4CXFA 2VB6A 4BJTA 4EM1A 5E3LA 3EUHC 1ZLJA 4XKVA 3B6AA 2CW8A 4A3FJ 3SJMA 1DPUA 1P2FA 1XTAA 1D1CA 4IPAA 2JSCA 1UJ8A 3ZR8X 5DDGA 1V3FA 2FOKA 2A6EF 5GAGJ 1POGA 2DJIA 2BBYA 3MZYA 3ZMVA 5F0HA 2Y9ZA 5HDGA 4RB3C 2CV0A 2VONA 2QCOA 2QQBA 4FQGA 1IDYA 4NBQA 4XM3A 3GW2A 4B8XA 2VT2A 2DA6A 5AIQA 3JSPA 4GYIA 3PFYA 3NQOA 1MBJA 3G1LA 4BY7J 1SAXA 1Q1VA 3K4NA 4HBLA 2XSDC 1W5TA 2EJRA 1MBKA 2UUZA 3LFKA 2XAUA 4V19K 5EGOA 2BW3A 2KIFA 3QOEA 1OCCH 1OISA 4WX9A 5LGUA 2NS7A 3TP3A 2Y0SA 2LR8A 3OYJA 1WZ2A 2DAOA 2MABA 4NQWA 1VQ8I 4NDLA 1X1PA 2O3FA 1UHSA 3CCQI 4ESJA 4FE4A 2QVOA 3H0DA 1R49A 2O6GE 1T6SA 1K78A 1Z21A 1Z67A 2Q1ZB 1R5GA 4ON0A 1X1DA 1FT9A 2NVYJ 4RGRA 3U9GA 5CYVA 5JHUA 3ERED 3ZQLA 2CV2A 3PJRA 1F36A 1USSA 3ZQFA 4BHCA 3J7AY 2X4HA 4IJAA 1UHWA 2O8XA 2VQCA 1W7PA 3T8TA 2Y75A 3E0JB 3NEUA 3G6EI 3C7JA 1JGGA 2QBYA 2ZBKA 3M1EA 2R7SA 3J81Z 4A0XA 1D1BA 1VQ9I 1JXSA 1CQTA 4G7OF 5F27A 2XGDA 1MSEC 3I53A 1NTCA 2QYOA 3VYSB 5HOOA 3V7RA 3VDXA 1VQ7I 4M9ZA 3HGYA 1JE8A 3ECOA 4B47A 5HNFA 1IRXA 2DT6A 3DPTA 3TOBA 3TO7A 3OYKA 1QZYA 3OL4A 2VL8A 3VODA 1E3HA 2IT0A 4KMUX 5BNGA 5LHIA 2IA2A 3QPTA 5KNLA 2D1HA 4WXHA 4CCJA 3GYHX 5L3GA 3HRTA 2ELHA 4YEJA 3FM5A 2XGCA 1OCRH 4HF1A 5IP7J 4KA4A 4D7NA 1SANA 1P7JA 2IXSA 1SFXA 5EZHA 5TISC 3WTYC 3SEQA 2NOJB 3K70C 5GADJ 2M4GA 1YIOA 1K6YA 4JOMA 1IV6A 1R1TA 3AG3H 4Y15A 1U5TA 3WTWC 1TC3C 5L3DA 5B1BH 2E1CA 2Z1DA 3BG5A 3OMYA 2QGUA 3C2GA 4ZYDA 1R36A 3M1CA 2Q2EB 1W0UA 1MMNA 4PSXA 1JJ6C 5IYCJ 1A31A 1IW7F 1V5FA 4JX4A 1R5HA 4BY1J 1TWAJ 4C9YA 1QZEA 2OCEA 5L3FA 1S6LA 2XF7A 3K7AJ 2DQLA 4LGWA 3S3NA 2ME0A 3K70D 4FT8A 4M3BA 3TQNA 4E7SA 3IV5A 1J5YA 4A3JJ 4CHUA 5ICGA 2GXBA 2VE8A 2DN0A 4E7ZA 1ZG1A 2JRTA 4LK0F 4X6AJ 1XC5A 3F3XA 2BVMA 5FFXA 2X6WA 5EEGA 4HPQA 2H94A 3FBIB 5CVVA 2OD5A 5LRRA 1U0JA 1AOYA 2F5EA 2A68F 5KAFC 1R4MB 2CUZA 1W5CC 3REOA 3SXYA 1DU0A 5FO5A 2F5CA 1I50J 3KLNA 1XGMA 2E1MC 3FMSA 1Z91A 3IC7A 5BPIA 1R9TJ 1DDNA 1TLHB 4Y52J 4ZDPA 1YS7A 1AU7A 1WKMA 4ZC3A 1LEBA 1RKTA 3EYYA 2JJ7A 3HDDA 5HODA 1YG2A 2YPRA 2L9VA 3MZHA 4DZJA 1PP8F 2DBBA 1WWXA 2P7VB 4MIMA 4D5CA 3FK7A 2XPUA 1H88C 1YJWI 5GTHC 2Q8KA 2VI6A 1RI7A 3M7GA 4WF2A 4EM0B 1A6QA 4CCLA 3TO9A 2VJJA 2MH2A 3HUGB 2BE5F 3V42A 3U1KA 1FNNA 3FXJA 5EG0B 3W2VA 3FHZA 3HEFA 3W6JB 3DQVC 2IW5A 5BS6A 2VKDA 4DYRA 4A3KJ 1LKXA 1O4XA 4NC6A 3RDIA 4LD5A 1P9QC 1R4NB 4S0HB 2CG4A 4RAGA 3COAC 1XCBA 1FY7A 4A3GJ 2JMWA 2CWEA 1X3ZB 2FE3A 3J7YJ 2EILH 3G1OA 1I1SA 2E1OA 4BGDA 3CJTB 3JW4A 2KRHA 4Z6YA 3L2RA 4RLFA 1HBXG 2H8RA 4D7MA 4H4KC 2VPRA 2BY3A 2STWA 5E8IA 2H8WA 2FNPA 5B66C 5E1XA 3QYFA 1TW2A 5FD6A 3FXMA 1BR4A 3GVAA 1BM9A 3N05A 4UY8I 1TQMA 4M3EA 4WXCA 3LAPA 2DFIA 3DTKA 1MMDA 3Q3SA 2PMZN 4UVCA 5ILUA 3GFJA 3RKXA 1T98A 3DXJF 1O3TA 4HX8A 4BQOA 3CUQB 2K3PA 1GVDA 3FF5A 1JTXA 1TWFJ 2KIUA 1RC9A 1LFBA 3AKZA 1GLNA 3LA7A 1YRNA 4YELA 3F9KA 2K02A 1IUFA 3Q9SA 3ZGKA 3ZQIA 3E6DA 1PUFA 5EF6A 2FBKA 1XMXA 4E7KA 5IT9Z 4XK4A 1XDSA 5D6EA 5ILVA 2BHZA 3G1MA 4A3IJ 2YS9A 1GHCA 4HZFA 4DNCA 3ZN0A 2W7NA 1QPIA 4I76A 4FHTA 2LY1A 1XMKA 2LY2A 3BC8A 2AQEA 4MO7A 3L2UA 3ZQ7A 5J1RA 5HLIA 4FISA 2DOEA 4HNUA 2DCEA 4CO8A 3NARA 1Y8QB 1FP1D 1QHHD 2XB0X 3KX2A 2X6YA 4XLAA 3GLXA 4CUGA 3RKQA 2X48A 2NRAC 1ERDA 3E1SA 3HKZN 3AL0B 3KZZA 2FBHA 2CJJA 4GGGA 4IHWA 1RZ4A 3QU6A 1XS9A 4M9SA 2JA8J 1ULYA 2BGCA 3FK6A 2IVMA 2R5ZA 1WFXA 2VKEA 3EUHA 2WV0A 3OIPA 5E3NA 3JRGA 2YU3A 2HVQA 2DPDA 1Y0NA 1VQ4I 1TBXA 3F72A 1T08B 1E17A 5HLHA 1HSJA 5CJ9A 2XC7A 3Q0VA 2K4BA 2DDAA 1AKHA 4OMZA 2HYJA 3M07A 4DYCA 4MFDA 3QWLA 2L7MP 5FRMA 1YHQI 4L0YB 2EFQA 2LMDA 2JSPA 1U3EM 1ZREA 3G71I 1IZ1A 3F0CA 4EGYA 4L18B 2BVLA 1PDNC 2ESNA 4XSXF 2DFEA 1OYWA 2WY7Q 3OYIA 4E7IA 4CYCB 1ZQ3P 3PO2J 1P6RA 2BY2A 4A3MJ 4XLHA 3LSPA 4BUPA 4OIPF 1J59A 2R7UA 2XAGA 3IRRA 5DM6F 5D5UB 1OYIA 2CUFA 1VF9A 1WI3A 1XN7A 2VBZA 2DJNA 4DBRA 4YFKF 3LNQA 1OCZH 1S7AA 1XG1A 3QPSA 1R00A 5DD8A 3F8MA 2R7DA 4AUXA 2LFBA 4U0YA 1HDDC 3WU1B 2LP0A 1QHGA 1DPRA 4J00A 1QVTA 4UXNA 4FTHA 5FJ8J 3CO6C 2DA5A 3OYEA 1FLIA 3ZCOA 3CCEI 3OYFA 1ZK8A 3RIRA 5F1RA 2HVRA 3V8LA 4U7BA 2M0CA 2VPLA 4I0BA 3EETA 1TZLA 4WXDA 4LG0A 2E2HJ 1S3JA 1ZAOA 1R22A 4C3JJ 2PBIA 3OYHA 4IO9F 2H27A 4RDUA 4P1WA 1P4XA 4PUSA 4M71A 1NH3A 1S8NA 4U87A 3MQ0A 1ONVA 2ZJ2A 3D5RC 3BR0A 4YFNF 3Q5FA 2GZWA 3VYUB 3DFGA 1CF7A 2BOLA 1B8IA 3BZ6A 2A69F 2LC2A 3QPHA 2N8GA 1ACIA 4BE0A 5IY5H 3CLOA 2Y69H 1ETOA 5CVUA 3IWZA 3K1MA 1P92A 1WGXA 3LSIA 4Y7NJ 3A4CA 1U6GA 2KDZA 4NNJA 1W7PD 1Z1DA 1MBFA 1MGTA 2J5PA 3WHCA 4KITB 2X1CA 2JK3A 1BOBA 1APLC 3BZCA 2VBXA 4NC8A 4A6EA 2JA2A 2QWWA 3L1PA 2BV6A 2RGVA 5LFAA 3KIOA 1FZPB 1YS6A 1TP4A 1K6OA 5E8GA 2HI3A 4RGXA 3HPGA 4QPQA 2QQ9A 3OYLA 2JT1A 3H3VK 1FIPA 2ISYA 2XASA 2HXIA 1K4TA 3N4MA 1U5TC 3AG4H 2M1BA 1R1UA 2ZSHB 1WSUA 1GT0C 3ECHA 1Z7LA 4I09A 4P9UA 1BA5A 3CMAI 1HXDA 4MGRA 4MNUA 1U78A 2EA4A 4FX4A 4PSWA 5CQEA 3HOVJ 2ME6A 3CMEI 3HYIA 3GZ6A 4IHXA 2DT7B 3TDUC 2UXNA 1Z3XA 2ZSIB 2HKOA 4UV8A 5IOZA 2X6OA 2XGXA 1TT5B 5KVRA 2DU9A 2DK8A 3SZGA 5FLXZ 2R7FA 2W82A 3I4PA 3QPLA 4AM3A 1SC7A 4Y4RA 2KDOA 3S3OA 3LA2A 3PO3J 3QP6A 1OMIA 2HQRA 3ASOH 2VXZA 3A2KA 1I39A 1V54H 2NVUB 2NVQJ 3LSHA 2R3SA 3ABLH 4XL9A 4HSRA 3X2QH 5ILSA 2Z99A 3TGNA 3W6VA 4RAYA 2Z5UA 3NWSA 2E60A 1D5VA 1IRGA 1P4WA 3KYDB 4LIVA 1G3SA 3PSFA 3Q9VA 2EH3A 3HPHA 5B3SH 5HS9A 3V4GA 1X3WB 5F08A 1HA8A 4LLNA 1JT6A 1OR7A 2CQ7A 3A0BC 1R7JA 4CCKA 3DPUA 2F5FA 5JI6A 2ICWG 3BR2A 2OA4A 2VE9A 1I3QJ 1YOVB 1S7OA 5FGMA 2HYGD 3OOUA 2V1NA 2W24A 5JLWA 1NK3P 2H6BA 1I6HJ 3H9JA 1V4RA 3HSRA 2ECBA 3MKLA 4MLOA 1FYMA 3GFLA 2PN6A 3EYIA 3HZJA 1UELB 1XCVA 2DW4A 5E17F 4M3DA 2X0LA 1TNSA 5HS7A 3ML6A 4LK1F 3L2CA 5HDKA 2LKXA 4EJTA 1LPQA 2WWYA 2OV7A 5DM7F 1IUYA 3BG3A 5ICCA 1OFCX 3W2AA 3H5AA 4S04A 3K6GA 2PJRA 3HIFA 3OY9A 4BXFA 1B72B 2HR3A 1F1ZA 5F6FA 2KPMA 5DCMB 4G7HF 1LDKB 2DOFA 4GFBA 1U9OA 3ZXSA 4XRSA 3A01B 2JPBA 2R5YA 2KFDA 3E7LA 1XD7A 3MKZA 2E1NA 4PJLA 1XSXA 2WAQN 1WJDA 1MBHA 2L9SA 3NRVA 4ZYGA 2CRGA 2EV0A 3KEQA 4Y13A 4XQFA 2NVXJ 2CUJA 2RREA 1DU6A 1JUMA 1G3YA 4DJAA 1VNDA 2EQRA 4Q5SF 4LOCA 3CCRI 2QM3A 2XAHA 3SQNA 3RJPA 3NWTA 3CC2I 2F2EA 2TRTA 2E2IJ 3BQYA 3GZNB 1Z3YA 2PMUA 3CCMI 4IX7A 2AHQA 4UUTA 2EZIA 3GTPJ 3RCOA 2HPIA 1JTYA 4YIFA 2QEXI 1ODDA 3BTCA 4M74A 2KJBA 3RSNA 2DK5A 3GLLA 4YRVA 3HOXJ 4AVPA 1J0RA 3TW7A 3WE3A 3ZPLA 1MDMB 3PL8A 1FPQA 4D5FA 4RAFA 3CF5F 3FKJA 4IOCF 4CCOA 1H8AC 5TGTA 3BWGA 2V6EA 5D5WB 2STTA 4HOBA 3GTMJ 2COBA 1ON2A 2JUGA 3OR2C 3W6KB 2CYYA 3S1NJ 3ZMTA 4M3GA 1D3YA 3QU3A 4I98B 2VOOA 1VQ6I 3FXRA 2JQ7A 2FQ3A 1MMAA 2ID3A 3MN2A 2GM4A 2VODA 2R7RA 2Y9YA 4L5IA 2ZC2A 3FXLA 4A5NA 4ZZDA 3LSGA 5FB2A 1BW6A 1G3TA 4I99C 4IRGA 2WAEA 2QBYB 1N75A 3VFZA 4B43A 2B0LA 5LHHA 3HRMA 2W84A 4UB6C 1UHMA 3IH3A 4ABZA 4A3CJ 1Y1VJ 2QUFA 3BJOA 3ZMDA 2W00A 1SD4A 4HRIA 3V7SA 2HWVA 3CD6I 4YFXF 4A3BJ 1MH3A 3V7CA 1X2MA 1ETYA 2L4MA 1ZH5A 2A6HF 3KEOA 4ENJA 3LSKA 5C4XJ 3HOUJ 2HQAA 3FXKA 2ELKA 1ZR4A 2KZGA 3JRAA 3AG1H 3K4MA 2EB7A 1JI8A 2R7WA 2V9VA 3T8RA 3GTLJ 3LA3A 3K2AA 3OOPA 3RTRA 1OJLA 5M3MJ 3I59A 4PJMA 3HJEA 2HOEA 3MD2A 3NAUA 1V5EA 1YQAA 3S2WA 5L3BA 1V55H 5KAIC 3WGGA 4IOAF 5M5YJ 1U9NA 5FLXK 3BJAA 1S7EA 3BROA 3QP5A 3T1BA 1ZRFA 1LUJB 2YSRA 1D0YA 2DLLA 1RR7A 5J3LA 4MTEA 2WV1A 2R7QA 3LSMA 5ICEA 4ZH4F 3CZ6A 1FBSA 5EYRA 2V79A 2VJ4A 1BC7C 2JA5J 3G2BA 1EV7A 4Z2YA 3BR1A 3GUDA 1FOYA 3B6CA 3L2VA 1K4SA 3OS1A 2DFFA 1R58A 1JKPC 5FRNA 1YW7A 3DBLB 1FP2A 2P5KA 4CZCA 2IS2A 5JR3A 3O6BB 3KYCB 2HS5A 4EJVA 1XSDA 1BJAA 3VOEA 1Z7UA 2ELJA 1KU7A 2LH9A 2EFNA 2WC2A 3SFIA 4L9JA 5A2QK 1YW9A 3K0LA 2QSHX 4EJUA 2R7TA 3R0JA 3FHNA 2ZB9A 2MD0A 3P9KA 4S05A 1JT0A 3MWMA 3WTUC 3CCJI 5DS9A 1RR8C 4M72A 4Y17A 2JN6A 3FXQA 4O3MA 2LF8A 1KGSA 1T8IA 4KDPA 3ZMSA 1G8XA 1EH7A 1TWHJ 2HDDA 3UR3C 4MFEA 5IT3A 1Y1WJ 3GTJJ 4CICA 3DF8A 1ETVA 1G2HA 5B5EC 3PUBA 2ZJRF 4RB1A 3FZVA 5F0CA 3S1RJ 1YJNI 2FD5A 4MEYF 1YTYA 1VZ0A 1O7FA 3JRFA 2K9NA 4I02A 3E6BA 4O6JA 4BBSJ 1WRJA 2FX0A 2XUBA 3ESWB 2NS0A 2LBFB 2WAFA 5CLSA 2EZKA 1C0WA 2E71A 4ESBA 1BR2A 1QPMA 1ZARA 4L9NA 2XKPA 4Q47A 2EFPA 4B44A 1NG6A 4HX4A 2M7AA 2L01A 3BCBA 3TMOA 3TL4X 1MBGA 2KT0A 3HRUA 3K10A 4A5MA 2H1LA 1ZN2A 5BQTA 3IHUA 2NXNB 2P6TA 4JX5A 3I71A 3MKYB 1GXPA 5F0FA 2LTPA 2LLKA 2IAIA 1IG7A 1E2XA 2AQFA 4QWQA 4YIRX 2EBIA 3CC4I 2MC3A 3GBGA 3EUKL 3HGGA 3K1NA 5GAEJ 3SYTA 1IN8A 3K69A 1QBJA 1U8RA 4AVZA 1FEXA 4KIGA 2F4IA 2LOOA 3CJQB 5FD5A 2Z33A 1STZA 4MEXF 3BR6A 4LMYA 3GWZA 3I55I 1MKMA 4C3HJ 3K1PA 4IZZA 1J75A 2Z16A 5CQGA 1FJLA 3IH2A 2ZJPF 5EJCA 1ZTRA 3F6OA 2X9DA 2D2WA 2HQ5A 1OR7C 2DFHA 1ITYA 2OZ6A 4RA2A 1PUFB 2PEXA 3RZOJ 1WCMJ 2K3FA 2MW8A 5E3MA 2G9WA 1WJAA 3HM5A 3OYBA 1QRYA 1MZBA 2OQGA 3A03A 2FF4A 3L00A 4RB0A 3IRQA 3HTSB 3HC7A 2NVTJ 3S16J 3JRIA 1YFHA 2CO5A 4BACA 3JAMZ 2ZXJA 3RYPA 2VQHA 3WTXC 1QVUA 3DU5A 3I3LA 1LNWA 3H36A 5D6FA 2V9KA 2ZMEB 3QOPA 2Q0OA 4RMNA 4AWXB 4NB5A 1I6XA 2COMA 2UZKA 4PZJA 1K61A 2ADUA 3GFIA 4IXAA 5LEJA 2LY9A 3DU6A 3QQAA 3QRFF 1XB4A 2FNAA 4G6TB 1ETXA 1J7KA 3KP3A 2LVSA 3FMRA 1LFPA 2R7ZJ 2UWMA 3ZOBA 2OUMA 1HDPA 3VSLA 1QNTA 4DGWB 4J19A 2K9SA 4P96A 3RI4A 2X51A 3VEPA 3DWLE 1TW3A 2M0MA 3LSJA 1JKRC 4Y3OA 3MEXA 4EV0A 1HQCA 1X4PA 3PIPF 3E5XA 2VBYA 3DTIA 2MGQA 1W4MA 4KICA 5AIPA 1MNDA 3C18A 4PK4A 2E7WA 5TJJA 2KIMA 4IRHA 1TL8A 2IS6A 1MBEA 4BKXA 3F8BA 3CDHA 5JVGF 3HHHA 4CZZA 1FIAA 2BY0A 4QPOA 1IN7A 2AXLA 2XHKA 4CH7A 1JGSA 2Q2EA 5H6RA 5CKTA 4HYEA 4BQNA 3GTQJ 1E3PA 2R7OA 3WTTC 1FYLA 3U2RA 1EA3A 3RKWA 1T38A 2PLYA 4RS8A 2CGPA 1YIJI 2KIQA 2NNNA 2O0YA 4HQEA 2CV1A 3S3MA 3D1NI 1U8BA 2BEOA 3J81K 4GYGA 3WHBA 2H09A 3E5UA 1LJ9A 4EVIA 3PIOF 2FMLA 4FETA 1YITI 3K4LA 1H0MA 2L7FP 1ZHFA 1VQNI 4ZJZA 1VQMI 4PJ0C 3F8NA 2K9LA 2PJPA 3DKXA 2M87A 2W1OA 2ZNZA 3HB9A 1I5ZA 1A35A 3ELKA 2IBDA 3OS2A 2QA4I 1WPKA 1HF0A 2M8EA 3H35A 2KJCA 2F4MB 2V1XA 3ZP5A 1BR1A 1ZG3A 4BE2A 4HV5A 1B8IB 5J4YA 5GAHJ 5M5XJ 2WBMA 5K7HA 2ZXIA 3IP4B 2K7LA 2ETHA 4CCMA 2EIJH 3LQRA 3K4CA 2K85A 4B3AA 5FROA 4B3XA 1MMSA 1QQIA 1BOAA 2FUG2 4A3EJ 1SFEA 3HUGA 2FU4A 2MSYA 2VOPA 2GOMA 1RNLA 2WY8Q 1S5LC 1QZZA 3SFZA 5C44J 5IOYA 5EG0A 2ZFWA 4AU7A 2D45A 4ZDLA 1T33A 5KHDA 4LLGF 3RZDJ 4XR6A 3LAJA 1FOWA 2JA7J 2WADA 2GWRA 3BT9A 3DKYA 3M3YJ 2G7HA 1GXQA 3I0TA 4C3IJ 2EFWA 1TT0A 2K9MA 3O8GA 4D9JA 3TKYA 2EIMH 1AA7A 5ED4A 1PUEE 2CQXA 1JHHA 1R23A 4OMYA 2W4SA 1A36A 4ZTJA 2CQQA 3DEEA 5B1AH 2JUCA 3KFWX 3WODF 1J09A 3L7WA 2DA3A 4F91B 4HF0A 2CQKA 1RETA 1ZG5A 4ANJA 3PM1A 1H9TA 3G73A 1RRJA 1XX5A 2NS8A 1FSHA 3PNTA 2OZUA 4UHTA 1IV8A 4ZYAA 1K7AA 2M3AA 5J40A 2MG4A 2DPUA 4IHTA 4BS9A 2EA2A 2QF7A 4BYYA 4LFUA 3HOZJ 5LBQA 3ZQQA 1YW8A 2XROA 3JAMK 2PMZA 4RAZA 4E7LA 1O3RA 3RQIA 2P5LC 4F93B 3OIQA 2GOXB 4UUSB 4K2EA 1FMVA 4ENMA 3IWFA 6PAXA 3I64A 2PQ8A 3D5SC 1UG0A 1B59A 4KT5C 4KT6A 2JWTA 1J2XA 3HSEA 2E1MB 2E19A 3ABKH 3LFUA 1HW2A 1TNTA 3H92A 1IO2A 4EMSA 3MCZA 1X1BA 3CMYA 4HDVA 3BQZA 3LL7A 2BYVE 1DQUA 3ULQB 2K5CA 4BNCA 1VFCA 5K7FA 2E5ZA 4XKCA 2JVGA 4I0AA 3HL2A 4AC0A 2WB1N 3M8JA 2JVHA 5EEAA 4UUVA 3HKZA 4DOZA 2GIZA 4MQVA 4N9IA 1YI2I 1SD7A 1WJFA 2G7UA 2CS3A 2VASA 2NYXA 2ZXHA 4HQMA 3JSOA 2M34A 5FKKA 2VC0A 1UMQA 2RC4A 2YX4A 3DBHB 1MIJA 4RB2C 4G9YA 5KCMA 4BEHB 4GCVA 3E3VA 1WJEA 1FOKA 2HFHA 2NOGA 2DMUA 1D0XA 4U0WA 3GTKJ 3EQLF 3I4MJ 3K4BA 1BI3A 4XRMA 4Y33A 3M8FA 2MD5A 1HKTA 2L5QA 4I7HA 4XOTA 2DMQA 1E0EA 1OLTA 4CYCA 4QTRA 2BZTA 5IT9K 3OYMA 4AIKA 2ZJQF 4DW6A 4C2UA 3DP7A 3OYNA 5LRSA 3IL2A 2XAFA 1L3LA 2HTJA 2ZNYA 4XLNF 2XAJA 4BL0B 4WWCA 1ETWA 5TRDA 3UKGA 1MJBA 4ENNA 4UV9A 2CFOA 4XORA 5L3EA 3ABMH 3FKIJ 1Z6RA 4PFPA 3W2WA 1MNEA 2QSGX 5E79C 3U21A 2W57A 4UB8C 4XRFA 3FXOA 1FTTA 4QLCU 3RPUA 4JYKA 2DA4A 1VQPI 2R92J 2EFOA 4BE1A 2YUSA 1PJRA 2OAZA 3OSGA 2DYSH 2EV6A 3WU0A 4NC7A 2IGKA 5JVTA 2VKHA 4ESFA 3E6MA 1GUUA 4CDGA 3S17J 2HTSA 4PJJA 2PI0A 1SFUA 4LJZF 2ZCWA 2EZLA 4W97A 5EDNA 2F6CA 1QA6A 2ACJA 3J7ZI 4XSZF 4B48A 1SVMA 3JRBA 2HKXA 3RPQA 2D1VA 3JTGA 3BP8A 2RNGA 4HAMA 3KE2A 3CP8A 4QSHA 4MHGA 1IN4A 3BR3A 3DLAA 1IGNA 1T39A 5CVRA 4R1HA 1KQ0A 4A12A 4B4CA 1A04A 4NUBA
chains in the Genus database with same CATH topology
2VJJA 3HUGB 4CZCA 2IS2A 3V42A 3VWBA 3W2VA 2ELJA 2LH9A 3CMMA 3DQVC 2VKDA 4X0GA 1LKXA 2R7TA 1D0ZA 1P9QC 1X19A 3FHNA 2DXIA 4HSTA 2MD0A 3CF2A 3RQ4A 4BGDA 2WB1A 2KRHA 3W3CA 2BW3B 4EATA 3L2RA 4RLFA 4BU2A 4BJ5C 2L2OA 4BDYA 4H4KC 2MFZA 1G8XA 3K4KA 3QYFA 3UR3C 2IGNA 2LRDA 4NQWB 2HZDA 1BR4A 4XOPA 1G59A 1QU3A 3N05A 4DBQA 1KONA 1X4OA 2LG4A 3DTKA 1MMDA 2KP6A 2E5NA 3PUBA 2L7KA 3OWTA 1VZ0A 4F92B 4BQOA 2K3PA 4II3A 3TBIA 2HDWA 3EUAA 2PJRB 3VSKA 2LBFB 3AKZA 1GLNA 3S32A 2WAFA 2WA0A 4YELA 3F9KA 3OYAA 1BR2A 3ZGKA 2VQLA 4E7KA 4B44A 1NG6A 2M7AA 3HG9A 2W7NA 3BCBA 3TMOA 2LY1A 2LY2A 3TL4X 3BC8A 3L2QA 2AQEA 3K10A 3L2UA 4KJZA 3AFHA 3K4JA 1X1CA 4HNUA 2DCEA 3OL3A 1QHHD 2HU9A 3KX2A 2X6YA 4XLAA 3MKYB 4CUGA 3H9GA 1ERDA 3E1SA 3AL0B 2KQRA 2VLAA 2AQFA 5JHFA 4E4HA 3GBGA 3EUKL 3ONQA 3S93A 3SYTA 1WFXA 2P0WA 3BG7A 4AVZA 2VXDA 3OIPA 2F4IA 2LOOA 4LITA 4IQJA 3BLYA 3CJQB 3IUOA 2HVQA 3VYRB 3OYDA 4IZZA 4ZTFA 5HLTA 4XONA 4XN3A 4N4OB 2Z16A 5CQGA 2XC7A 2V7FA 3BCAA 4ZDOA 1OR7C 5FRMA 2JSPA 3ZRGA 1WJAA 2X1EA 3OYBA 3VYTB 4C2TA 2I8DA 1W36C 1Y56A 4E6KG 2BVLA 3OYIA 4E7IA 2WY7Q 3HC7A 3OR1C 2LREA 4XN0A 4BACA 2VQHA 4XLHA 4BUPA 2A5WA 3DU5A 2R7UA 3I3LA 1ZELA 2WAQA 2R7XA 2V9KA 4RMNA 1DGRM 3FBNB 4DBRA 4XLEA 2Z2SB 3KYLA 3DU6A 4J01A 1N77A 1MMGA 1YX5A 4G6TB 5HVQC 2HVSA 1QHGA 4J00A 4OAZA 2XF5A 3MKWB 4XLFA 1W36D 4HEA2 1LFPA 3OYEA 3ZCOA 1SAUA 3OYFA 2KL4A 2KHMA 2DOAA 3C2HA 3DTEA 2HVRA 2UWMA 1WJBA 2OUMA 4U7BA 2VPLA 3VSLA 3PNYA 1TZLA 4DGWB 3MMYB 2IS4A 2X85A 2X51A 2VJ5A 3DWLE 2IGMA 2M0MA 3QODA 2X1DA 2XF6A 4Y3OA 3OYHA 4BDZA 4JQFA 3KEYA 4IKFA 4C30A 4RM2A 1X4PA 4P1WA 4BEHA 4PUSA 2QKMB 3DTIA 4CSWA 1N78A 4U87A 5HNHA 4RM3A 1MNDA 3D5RC 4GRIA 4PK4A 3VYUB 4CCNA 3AL0C 2BOLA 1T0FC 2IS6A 2LC2A 3H5RA 2M7BA 2IGOA 4QPOA 4BE0A 3CESA 4CH7A 4BQNA 5CKTA 2RQQA 3LSIA 2R7OA 3A4CA 4PFOA 2KMUA 1EA3A 4NNJA 2X6XA 4DIQA 3HOSA 1V5GA 3SEZA 2X1CA 4KITB 4XNFA 1BOBA 3S3MA 2CV1A 1LVKA 3FDYA 3EPZA 4NC8A 4HG2A 2JA2A 4XKWA 4RLQA 3IAS2 5LFAA 2CH0A 3A1YA 1MW7A 4FETA 4LG3A 3D5LA 3K4LA 3OS0A 3LMMA 3HPGA 4ITVA 4QPQA 3OYLA 2M4KA 4ZJZA 3BG6A 2K9LA 3QYEA 3DKXA 1WJCA 2ZSHB 2XDVA 1Z7LA 2W1OA 3DPLC 3OS2A 1DP3A 4N4NB 3SDBA 3H35A 4PSWA 3OYCA 5CQEA 2CW7A 1BR1A 2LYCA 1UAAA 2KRCA 3H5NA 4BE2A 4XKBA 1PYVA 2DT7B 4FASD 1Z3XA 4IQ4A 2ZSIB 3I9V2 2WBMA 3PSIA 2ZXIA 2VB6A 3IP4B 4BJTA 1DGWY 4CCMA 2R4GA 3K4CA 3EUHC 3SZGA 2W82A 4XKVA 5FROA 2CW8A 2UV1A 4B3XA 4Y4RA 2KDOA 1D1CA 3S3OA 4KISA 2FUG2 2VXZA 3A2KA 1T95A 3ZR8X 3LSHA 2GOMA 2A6TA 2WY8Q 4XMYA 4XL9A 2DJIA 1YE9A 4F55A 4AU7A 4R79A 4HSRA 2CV0A 4ZDLA 5KHDA 3NWSA 2E60A 4XR6A 2XSJC 4XM3A 2KLOA 4AYBA 2QKLB 4LIVA 4P5OA 3PSFA 3HPHA 2WADA 3DKYA 3PFYA 2IS1A 4F52A 1WJ5A 1HA8A 1TT0A 3K4NA 2K9MA 4D9JA 2UUZA 1AA7A 2KZVA 2XAUA 4PJNA 4CCKA 4E7JA 3DPUA 2BW3A 3QOEA 3RPUD 2MC4A 3OOUA 2V1NA 2W4SA 4ZTJA 3DEEA 2VJIA 3H9JA 2Y0SA 2VIXA 4MLOA 3OYJA 2MABA 1J09A 2V4JC 3IAM2 1UELB 4F91B 4ANJA 3H9QA 3H0DA 3PNTA 1Z21A 4ZYAA 2OV7A 2M3AA 3L2WA 2Q1ZB 1D1AA 3W2AA 1X1DA 3H5AA 4BS9A 3K6GA 2PJRA 3OY9A 2LBFA 3ZQQA 4BXFA 2PMZA 2KPMA 1LDKB 2CV2A 2L9NA 4E7LA 3PJRA 3ZXSA 3OYGA 3J7AY 2O5RA 4F93B 3OIQA 2GOXB 1FMVA 3MKZA 2VQCA 4PJLA 3D5SC 2VQGA 3HXLA 1WJDA 2L9SA 3E0JB 1UG0A 4KT6A 4XQFA 2E1MB 2CUJA 2RREA 2R7SA 3LFUA 4DJAA 1NG7A 1R6RA 4BJ6C 1D1BA 1X1BA 1S9HA 3NWTA 2MYSA 3VYSB 5HOOA 3VDXA 3LL7A 1Z3YA 5HNFA 4B47A 4IX7A 1DQUA 1IRXA 2DT6A 2K5CA 3DPTA 3RCOA 2E5ZA 2HPIA 3UNGC 4XKCA 2JVGA 3OYKA 3HL2A 3OL4A 2VL8A 3M8JA 2JVHA 3RSNA 4YRVA 3HKZA 4DOZA 4HNTA 5KNLA 3PL8A 4CCJA 3FKJA 1WJFA 4CCOA 5TGTA 2CS3A 4YEJA 2VASA 2ZXHA 2V6EA 2JUGA 3OR2C 2IXSA 2R7VA 3SEQA 2NOJB 5KCMA 4BEHB 1SFKA 2OC6A 1WJEA 3K70C 5CPRB 1D0XA 2M4GA 1MMAA 1K6YA 4JOMA 1FMWA 3K4BA 2R7RA 4Y33A 3LSGA 2L5QA 1E0EA 2Z1DA 4XOTA 1OLTA 2HNHA 2WAEA 1N75A 4B43A 3OMYA 3OYMA 3C2GA 4D1QA 4C2UA 4OAYA 3OYNA 1X1AA 3M1CA 2Q2EB 2HPMA 1MMNA 2W00A 4PSXA 4BL0B 4HRIA 1V5FA 3PNVA 4C9YA 5LD2C 2CFOA 2F5VA 2XF7A 4XORA 4PFPA 3W2WA 1MNEA 3S3NA 3LSKA 3CP2A 3K70D 2HQAA 4E7SA 3U21A 4E7ZA 3K4MA 1JI8A 2R7WA 2BVMA 2ZFUA 3CJRB 2X6WA 3HOTA 4HPQA 3RTRA 3FBIB 4BE1A 1PJRA 2CMPA 4PJMA 3MD2A 1U0JA 4II2A 4OWRB 2V26A 2CUZA 1V5EA 1Y6IA 4NC7A 2IGKA 1YX3A 4F3QA 2VKHA 2E1MC 4PJJA 2F6CA 4LIUA 4BQQA 1D0YA 4ZDPA 3QYBA 4B48A 2R7QA 4ZC3A 3LSMA 3CZ6A 2VJ4A 4XLCA 2RNGA 3CP8A 3G2BA 4E7HA 3DLAA 4CA0A 3L2VA 3OS1A 3S8PA 5FRNA 4NUBA 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7N A;  3M8J A;  5CKT A; 
#chains in the Genus database with same CATH topology
 1ENH A;  3SHF A;  2AS5 F;  2V1U A;  2VBW A;  5J1Y A;  3I56 I;  2QZ8 A;  2P81 A;  3FWE A;  3VWB A;  1MJA A;  3CMM A;  2XRN A;  1KU3 A;  3ZMZ A;  4X0G A;  3CUO A;  1IAW A;  5EZG A;  1D0Z A;  1X19 A;  1HC8 A;  2VC1 A;  5LGT A;  4HST A;  5BMZ A;  1P7I A;  1HW1 A;  2Y0S N;  1UG2 A;  2HZT A;  2DI3 A;  3RQ4 A;  1EF4 A;  1UCR A;  1ZGA A;  2JPC A;  2L7Z A;  2WB1 A;  4L5J A;  5BPD A;  1BW5 A;  5EGO B;  2BW3 B;  2R0Q C;  2VUM J;  2L2O A;  4AID A;  4BDY A;  2MFZ A;  1YJ9 I;  3AAF A;  5D4R A;  2LRD A;  4NQW B;  3LSR A;  2OBP A;  3E97 A;  4XOP A;  3J80 Z;  1G59 A;  1QU3 A;  4DBQ A;  1X4O A;  1JUS A;  2LG4 A;  4FE7 A;  2L7K A;  5H20 A;  3OWT A;  4M6V A;  4R8H A;  5F04 A;  2CFX A;  1K78 B;  4BQA A;  2DA1 A;  2FRH A;  4F92 B;  1MD0 A;  3KET A;  1TQI A;  3TBI A;  2HDW A;  3G4S I;  3EUA A;  4PGH A;  3CQZ J;  3ZQC A;  3B73 A;  3S32 A;  2FBI A;  3I5U A;  2O03 A;  2VQL A;  2PFB A;  3R4K A;  2HXO A;  2KKO A;  3H3U A;  4RGU A;  1JKQ C;  2AXT C;  5GTI C;  5K7Z A;  2GLO A;  1W7P B;  2QEN A;  5ICF A;  1BJZ A;  2EZH A;  1F43 A;  1P4A A;  4KYW A;  1LDD A;  3AFH A;  2VN2 A;  5FKL A;  4BXU A;  3K4J A;  5E18 F;  1D8J A;  2IRF G;  1X1C A;  4IF4 A;  4F7Z A;  1D5Y A;  1BL0 A;  1YYV A;  2EIK H;  2AO9 A;  3BPV A;  2HOA A;  2IEK A;  3TO6 A;  2PG4 A;  5FLM J;  5DUK A;  3L09 A;  1KQ8 A;  4L0Z B;  2KQR A;  2VLA A;  3J7A O;  5JHF A;  4IRI A;  4E4H A;  4G94 A;  3ZN1 A;  4XIC A;  3ONQ A;  2M30 A;  3BTI A;  1FBU A;  3O3K A;  2I10 A;  3S93 A;  4JK1 X;  1F5T A;  3C1D A;  4MQ9 F;  1L0O C;  2VXD A;  3RYR A;  1S29 A;  4IQJ A;  3BLY A;  1SFO J;  1JHF A;  2DTR A;  3IUO A;  2HOT A;  3VYR B;  3OYD A;  3M9A A;  5LLQ A;  2DQR A;  3KP6 A;  2P5V A;  4XON A;  3TP0 A;  2MBF A;  2HQN A;  2JTV A;  4UVA A;  2DDB A;  1XMA A;  3BCA A;  1Y39 A;  4ZDO A;  1B72 A;  3SZT A;  3ROU A;  3IKT A;  5E20 A;  5DCM A;  1ZRC A;  1ZR2 A;  3A01 A;  4YG2 F;  3ZRG A;  2K86 A;  2LNB A;  1LE8 A;  3S2D J;  1FWZ A;  3VYT B;  5J8F A;  2IJL A;  1W36 C;  1U5T B;  4FCY A;  5JFR A;  1AWC A;  4E6K G;  4P55 A;  3E6C C;  4IEJ A;  3OR1 C;  2LRE A;  4EM2 A;  3BTJ A;  4KN4 X;  3I4N J;  4V2F A;  1ZEL A;  3QAH A;  2WAQ A;  5D8L B;  4AYB N;  2E35 A;  1G3W A;  1XGS A;  1Z9C A;  1NK2 P;  1VTN C;  1B6A A;  3LOC A;  4U0V A;  3T5X A;  5D4S A;  4AIJ A;  2NAZ A;  4M9X A;  3R60 A;  1OCP A;  3CUQ C;  2DYR H;  4N0B A;  5E1Z B;  5D5V B;  1MMG A;  4OIN F;  1JUP A;  4XBF A;  3WU2 C;  2HVS A;  3MKW B;  2XF5 A;  1WQ2 A;  1W36 D;  4WCG A;  2RDP A;  1A6I A;  1MDM A;  3JRD A;  1PVE A;  5J4V A;  3R6S A;  3C2H A;  2XVC A;  2KL4 A;  2KHM A;  1LEA A;  3DTE A;  4RGS A;  1WJB A;  1TWG J;  4O5V A;  3PNY A;  3HTU A;  1Z0X A;  3LWF A;  2EV5 A;  3MMY B;  2IS4 A;  2X85 A;  1RIO H;  2HYF A;  2J5O A;  3S2H J;  2VJ5 A;  1ON1 A;  5C3E J;  3GME A;  4IHY A;  1NHA A;  3QOD A;  2X1D A;  5F64 A;  4BDZ A;  2ISZ A;  1JKO C;  2ZXW H;  3KEY A;  4GO1 A;  1W5S A;  3EDP A;  4C30 A;  4IKF A;  2O61 A;  4LLL A;  2QKM B;  2M45 A;  2XPV A;  1LQ1 A;  1EH8 A;  3ASN H;  5HNH A;  4RM3 A;  5GP9 A;  4GRI A;  2YX7 A;  4LB5 A;  1FC3 A;  4CCN A;  1WH5 A;  3TW6 A;  3AL0 C;  4IHV A;  2LSO A;  1YLF A;  4E70 A;  2DO7 A;  2MH9 A;  4IHS A;  1O3S A;  4A3D J;  5K1Y A;  4M6Y A;  3FIW A;  4M6X A;  4PFO A;  2KMU A;  5K5Q A;  1KYW A;  2X6X A;  4DIQ A;  1V5G A;  4KIB A;  3SEZ A;  5K5R A;  4XNF A;  1LVK A;  2XV4 S;  3KCC A;  4HG2 A;  3S15 J;  2IPQ X;  4RLQ A;  4A69 C;  2V6C A;  3L9F A;  1HKQ A;  3A1Y A;  4I01 A;  5L3C A;  2FMY A;  3D5L A;  3OS0 A;  3LMM A;  4ITV A;  5IP6 A;  2YR2 A;  2A05 A;  4A6D A;  4FX0 A;  3J80 K;  3KP5 A;  4KNY A;  2GIV A;  3QYE A;  3RKY A;  2XDV A;  5IYD J;  2L4A A;  3F8C A;  4HW0 A;  4PGG A;  2F4O B;  5DCF A;  3DKW A;  3OYC A;  1DP7 P;  2O9L A;  2LYC A;  4KUM A;  2A61 A;  2KRC A;  3H5N A;  2K4J A;  3HSF A;  4A93 J;  4OOI A;  3KZY A;  3DV8 A;  4FAS D;  1SD5 A;  2RNJ A;  5FLV A;  1ETQ A;  5H2F C;  1I27 A;  5FKM A;  5GPA A;  5FKO A;  1M1E B;  3H0G J;  3PSI A;  3GZ5 A;  1DGW Y;  1U2W A;  2R4G A;  2Y30 A;  3KPH A;  1H89 C;  3V8K A;  1HLV A;  2UV1 A;  1SVO A;  1OCT C;  4KIS A;  4L9V A;  4BBR J;  4BAY A;  3CO7 C;  1T95 A;  3MFK A;  1FTZ A;  1GV2 A;  1YRN B;  1UST A;  2A6T A;  1LVA A;  2LF7 A;  3KP2 A;  4XMY A;  2MLK A;  4XRS G;  4OIQ F;  2ZO4 A;  5IPA A;  3FIS A;  1YE9 A;  2TCT A;  4F55 A;  4R79 A;  4RBO A;  2RQP A;  4GXO A;  2H6C A;  1IF1 A;  5J8C A;  4HX7 A;  2XSJ C;  4AYB A;  2KLO A;  2QKL B;  4P5O A;  1UZC A;  1BC8 C;  2IS1 A;  4BH9 A;  2RV8 A;  1PP7 U;  2KRF A;  4F52 A;  1GV5 A;  2FEZ A;  1WJ5 A;  1FSE A;  2D5V A;  1HCR A;  4OIO F;  3CTA A;  1Z6T A;  3PUF A;  2KZV A;  2OU2 A;  4PJN A;  4E7J A;  3S1M J;  2A5Y B;  1DUX C;  3MZ8 A;  1IN5 A;  4YII A;  2EK5 A;  3RPU D;  2MC4 A;  3OIO A;  1X3U A;  2VJI A;  3F6V A;  5E3O A;  5LHG A;  4EJO A;  1RPW A;  2VIX A;  2CQN A;  3K2Z A;  3KZI C;  1KU9 A;  2R5Z B;  2V4J C;  3F21 A;  1QGP A;  3IAM 2;  3GX4 X;  4N9H A;  5FKN A;  4KIF A;  1I3A A;  2DMN A;  4LB6 B;  1J9I A;  1KA8 A;  3H9Q A;  2I5U A;  4HF2 A;  4B1R A;  1K83 J;  2QQ8 A;  3VB2 A;  2FXA A;  5K5O A;  2XIG A;  3L2W A;  1D1A A;  1E3O C;  3P5J A;  2LKP A;  1QO0 D;  2NNY A;  1XSV A;  1KYZ A;  1AKH B;  4U7D A;  2LBF A;  2VT3 A;  1IXR C;  3FMQ A;  2L9N A;  2W25 A;  3OYG A;  4Q48 A;  2O5R A;  1BI1 A;  4UVB A;  1HKS A;  2LKS A;  2M9H A;  4G7Z F;  4I2O A;  2VQG A;  2EIN H;  2VKV A;  3HXL A;  4WK8 F;  2Y31 A;  3CCS I;  1WHU A;  1W1W E;  3MAJ A;  2FOW A;  2LDU A;  4HV6 A;  4XID A;  1NG7 A;  5HDN A;  1R6R A;  2PMH A;  4BJ6 C;  2P4W A;  1S9H A;  3DCF A;  1BN5 A;  3CDL A;  2JZY A;  4A0Y A;  2MYS A;  3ZQG A;  4MTD A;  3GXO A;  1T0F A;  2L9R A;  1O7L A;  4BHP A;  2K40 A;  4UNO A;  2BXY A;  2E7X A;  2QLZ A;  3OV8 A;  3GCM A;  5ERI A;  4KN7 X;  1KU2 A;  3UNG C;  1BIB A;  1TTY A;  3WGI A;  5GPC A;  4HNT A;  1VQ5 I;  1ZGW A;  1SD6 A;  2IA0 A;  1LB2 A;  4M3F A;  3H1C A;  1ETK A;  2GQQ A;  2V1D A;  5F1J A;  1UB9 A;  1BIA A;  1EH6 A;  2ID6 A;  4LG0 B;  2MLG A;  3CC7 I;  1RKW A;  2OCC H;  2CUE A;  3GFM A;  2R7V A;  2P7C B;  2RN7 A;  1SFK A;  1R71 A;  2OC6 A;  5M3F J;  1IN6 A;  3HBL A;  5CPR B;  3VPR A;  3WTV C;  1FMW A;  3P7N A;  4XLP F;  1CF7 B;  3GTG J;  2M2E A;  3BOQ A;  3F23 A;  2HNH A;  3K9T A;  1ZLK A;  3AG2 H;  1Y8R B;  4W1U A;  4D1Q A;  3S14 J;  1VQK I;  4OAY A;  1X1A A;  3D0S A;  1ORK A;  2P8T A;  2HPM A;  4G6D A;  4IVN A;  1B1B A;  4P9F A;  1F9N A;  1TWC J;  1KZH A;  4ETS A;  1R5I D;  3MVP A;  1WVR A;  2ZME A;  3B02 A;  5DV5 A;  1IRZ A;  3PNV A;  4GDF A;  3GEZ A;  4G6Q A;  5LD2 C;  5BOX A;  2F5V A;  3JR9 A;  1YO5 C;  3I58 A;  4NHJ A;  3CP2 A;  3ABU A;  1XDU A;  3ERM A;  4CYD A;  4HNV A;  2QQA A;  2DMP A;  5HLG A;  1EJ9 A;  3GTO J;  2RKH A;  2ZFU A;  3CJR B;  3HOT A;  2CSO A;  1G6N A;  1OQY A;  3WGH A;  2CMP A;  4DZP A;  4JX6 A;  5H6Q A;  1A5J A;  2B7E A;  3H3Z A;  4II2 A;  1F4K A;  1G4D A;  4OWR B;  9ANT A;  2V26 A;  1VQL I;  1UFM A;  1Y6I A;  3IH4 A;  4HLX A;  1YX3 A;  4F3Q A;  2L3D A;  3BY6 A;  3CCV I;  3JRE A;  4LIU A;  4BQQ A;  2BHY A;  3QYB A;  1D8K A;  3Q0U A;  3FM3 A;  2OPT A;  4XLC A;  1REP C;  2E34 A;  1IDZ A;  2FA5 A;  4E7H A;  1K79 A;  2V9P A;  3LQQ A;  4CA0 A;  2GAU A;  1VI0 A;  1O57 A;  2E36 A;  3S8P A;  1RUN A;  4A2U A;  3CUQ A;  1X2N A;  4ENK A;  5J47 A;  1MH4 A;  1O3Q A;  4OU0 A;  4ZZL A;  4ZYH A;  1Y0U A;  2K27 A;  4AD9 A;  3JRH A;  4PCQ A;  3DBR B;  1SVL A;  5M5W J;  3HHG A;  2B9S A;  2A3S A;  2W85 A;  2DXI A;  4JP0 A;  4EEF G;  1FBQ A;  3CF2 A;  2BXZ A;  2G0E A;  2OQR A;  4PDK A;  2HOS A;  3W3C A;  3DEW A;  1KQ9 A;  4EAT A;  5C4J J;  1OYY A;  4BU2 A;  4BJ5 C;  1SMT A;  1OCO H;  2W48 A;  3K4K A;  4EGZ A;  1TQP A;  2XGE A;  2IGN A;  2HZD A;  2KIS A;  1HOM A;  1KON A;  4DYQ A;  1ZGJ A;  4C2M J;  2KP6 A;  2E5N A;  3ZQH A;  2YU9 J;  2WTE A;  2DA2 A;  2GBY A;  1XPX A;  5DYM A;  5HS8 A;  1N25 A;  4KFC A;  2F5D A;  4II3 A;  3SZP A;  3IKV A;  3P9I A;  5DTD A;  1XGN A;  2F48 A;  3KP4 A;  5J6X A;  3VSK A;  2PJR B;  3LST A;  1OKR A;  2GA1 A;  2WA0 A;  3OYA A;  3HOW J;  2R5Y B;  2RAE A;  3I54 A;  2PX9 A;  4EJW A;  3HG9 A;  3CLQ A;  3L2Q A;  1Z77 A;  2HEO A;  2E2J J;  4KJZ A;  2XKO A;  1BI0 A;  3KLO A;  4G8X A;  2XRL A;  3OL3 A;  2HU9 A;  1VQO I;  3R0A A;  5D8K B;  3PQJ A;  2OTJ I;  3TOA A;  3H9G A;  4DQ2 A;  4V2G A;  2P6S A;  3WG9 A;  2EWN A;  1B9N A;  3C2B A;  3O2P E;  3T0Y A;  4HDU A;  1X58 A;  3HOY J;  3GF2 A;  3FXU A;  2Z9O A;  2M5W A;  3BPX A;  3HRS A;  1MJ9 A;  2P0W A;  3BG7 A;  1SEU A;  1IRF A;  1HST A;  1RES A;  3A0H C;  4LIT A;  3N97 A;  1BBY A;  2MA3 A;  2Y2Z A;  2XPW A;  1S72 I;  1ZRD A;  3CCL I;  2XAQ A;  4I6Z A;  4U88 A;  4ZTF A;  5HLT A;  4XN3 A;  4ZYE A;  2HDC A;  3JCU C;  4N4O B;  4JBA A;  2TDX A;  3CCY A;  3F8F A;  2H1K A;  2B63 J;  2V7F A;  1FOX A;  3CJN A;  5CVI A;  2FSW A;  3TED A;  2EPF A;  1ZYR F;  1LDJ A;  5CVJ A;  3JRC A;  2IA1 A;  4G12 A;  2ECC A;  2X1E A;  4UUS A;  3WE2 A;  2DTZ A;  1WH7 A;  2I8D A;  2UXX A;  2CU7 A;  1Y56 A;  4C2T A;  2LD5 A;  3ZMU A;  1Z05 A;  3DLL F;  3WTZ A;  4L9T A;  4XN0 A;  2L54 A;  1OPC A;  3CDI A;  2Y0M A;  2A5W A;  4D0P A;  3Q0W A;  3PQK A;  3A02 A;  2R7X A;  5A2Q Z;  1DGR M;  3FBN B;  1IC8 A;  3DEU A;  1RUO A;  4XLE A;  5DEQ A;  5LEK A;  2Z2S B;  3KYL A;  4J01 A;  1N77 A;  5DUI A;  1GVJ A;  1YX5 A;  3JTH A;  2M8G X;  5HVQ C;  4OAZ A;  3BZK A;  4XLF A;  5IYB J;  4L5E A;  4EQQ A;  1FX7 A;  1B4A A;  2OTL I;  4HEA 2;  2GA2 A;  1SAU A;  2OJE D;  2DOA A;  4A0Z A;  4KMF A;  2BY1 A;  1MNM C;  3BG9 A;  3I59 B;  2A07 F;  2FJ1 A;  1IJW C;  1XGO A;  4Q4Z F;  2RVC A;  3BJ6 A;  5IP9 J;  3SDG A;  1T2K A;  3C3W A;  2CW0 F;  2FQ4 A;  2K9Q A;  2JRM A;  3E5Q A;  2DOD A;  2IGM A;  5DD4 A;  3ISP A;  2XF6 A;  3TDZ C;  2O7O A;  3BTL A;  4JQF A;  4RM2 A;  4BHB A;  3F22 A;  4BEH A;  3R61 A;  5KK1 A;  1SMY F;  3U1D A;  1MSF C;  4CSW A;  4X1E A;  1N78 A;  4HLY A;  1LE8 B;  5LGN A;  1BI2 A;  4TV7 A;  2O8K A;  4A3L J;  3KP7 A;  1T0F C;  3H5R A;  1HW5 A;  3BR5 A;  1IXC A;  2M7B A;  3G3Z A;  5J1U A;  3M4O J;  1Q1H A;  2IGO A;  3CES A;  2RQQ A;  4ASN A;  2DMT A;  3OSF A;  4M73 A;  1B9M A;  3CCU I;  1AHD P;  3M8E A;  3HOS A;  2OF7 A;  2C6Y A;  3FX3 A;  5JLX A;  2LK2 A;  1JJ8 C;  2GXA A;  4H0E A;  1CGP A;  3FDY A;  3EPZ A;  4OIR F;  3ABT A;  4XKW A;  1LFU P;  3IAS 2;  2CH0 A;  5E1W A;  3S1Q J;  1T56 A;  1MW7 A;  4CGZ A;  4LG3 A;  2XB5 A;  2QSF X;  2M4K A;  1WI9 A;  2GXG A;  4IL6 C;  3PFI A;  3V8J A;  5AON A;  4QIW N;  2IP2 A;  3BG6 A;  1WJC A;  2HGC A;  3GO5 A;  1R1V A;  1ZKG A;  2R93 J;  4HA8 A;  3DPL C;  2ZKZ A;  3WTS C;  2DA7 A;  1DP3 A;  4BXX J;  4N4N B;  3O8H A;  3SDB A;  1IXS B;  1H9G A;  1EKE A;  2CW7 A;  4AIH A;  2JA6 J;  1GDT A;  2ESH A;  2DT5 A;  1UAA A;  1I1G A;  5EEH A;  1FYK A;  4XKB A;  5FFZ A;  2ZME C;  1PYV A;  2Z3Y A;  1W0T A;  2Y48 A;  2L02 A;  4IQ4 A;  2L0K A;  4B09 A;  3BDD A;  3WG7 H;  3I9V 2;  3P9C A;  5D5X B;  4CXF A;  2VB6 A;  4BJT A;  4EM1 A;  5E3L A;  3EUH C;  1ZLJ A;  4XKV A;  3B6A A;  2CW8 A;  4A3F J;  3SJM A;  1DPU A;  1P2F A;  1XTA A;  1D1C A;  4IPA A;  2JSC A;  1UJ8 A;  3ZR8 X;  5DDG A;  1V3F A;  2FOK A;  2A6E F;  5GAG J;  1POG A;  2DJI A;  2BBY A;  3MZY A;  3ZMV A;  5F0H A;  2Y9Z A;  5HDG A;  4RB3 C;  2CV0 A;  2VON A;  2QCO A;  2QQB A;  4FQG A;  1IDY A;  4NBQ A;  4XM3 A;  3GW2 A;  4B8X A;  2VT2 A;  2DA6 A;  5AIQ A;  3JSP A;  4GYI A;  3PFY A;  3NQO A;  1MBJ A;  3G1L A;  4BY7 J;  1SAX A;  1Q1V A;  3K4N A;  4HBL A;  2XSD C;  1W5T A;  2EJR A;  1MBK A;  2UUZ A;  3LFK A;  2XAU A;  4V19 K;  5EGO A;  2BW3 A;  2KIF A;  3QOE A;  1OCC H;  1OIS A;  4WX9 A;  5LGU A;  2NS7 A;  3TP3 A;  2Y0S A;  2LR8 A;  3OYJ A;  1WZ2 A;  2DAO A;  2MAB A;  4NQW A;  1VQ8 I;  4NDL A;  1X1P A;  2O3F A;  1UHS A;  3CCQ I;  4ESJ A;  4FE4 A;  2QVO A;  3H0D A;  1R49 A;  2O6G E;  1T6S A;  1K78 A;  1Z21 A;  1Z67 A;  2Q1Z B;  1R5G A;  4ON0 A;  1X1D A;  1FT9 A;  2NVY J;  4RGR A;  3U9G A;  5CYV A;  5JHU A;  3ERE D;  3ZQL A;  2CV2 A;  3PJR A;  1F36 A;  1USS A;  3ZQF A;  4BHC A;  3J7A Y;  2X4H A;  4IJA A;  1UHW A;  2O8X A;  2VQC A;  1W7P A;  3T8T A;  2Y75 A;  3E0J B;  3NEU A;  3G6E I;  3C7J A;  1JGG A;  2QBY A;  2ZBK A;  3M1E A;  2R7S A;  3J81 Z;  4A0X A;  1D1B A;  1VQ9 I;  1JXS A;  1CQT A;  4G7O F;  5F27 A;  2XGD A;  1MSE C;  3I53 A;  1NTC A;  2QYO A;  3VYS B;  5HOO A;  3V7R A;  3VDX A;  1VQ7 I;  4M9Z A;  3HGY A;  1JE8 A;  3ECO A;  4B47 A;  5HNF A;  1IRX A;  2DT6 A;  3DPT A;  3TOB A;  3TO7 A;  3OYK A;  1QZY A;  3OL4 A;  2VL8 A;  3VOD A;  1E3H A;  2IT0 A;  4KMU X;  5BNG A;  5LHI A;  2IA2 A;  3QPT A;  5KNL A;  2D1H A;  4WXH A;  4CCJ A;  3GYH X;  5L3G A;  3HRT A;  2ELH A;  4YEJ A;  3FM5 A;  2XGC A;  1OCR H;  4HF1 A;  5IP7 J;  4KA4 A;  4D7N A;  1SAN A;  1P7J A;  2IXS A;  1SFX A;  5EZH A;  5TIS C;  3WTY C;  3SEQ A;  2NOJ B;  3K70 C;  5GAD J;  2M4G A;  1YIO A;  1K6Y A;  4JOM A;  1IV6 A;  1R1T A;  3AG3 H;  4Y15 A;  1U5T A;  3WTW C;  1TC3 C;  5L3D A;  5B1B H;  2E1C A;  2Z1D A;  3BG5 A;  3OMY A;  2QGU A;  3C2G A;  4ZYD A;  1R36 A;  3M1C A;  2Q2E B;  1W0U A;  1MMN A;  4PSX A;  1JJ6 C;  5IYC J;  1A31 A;  1IW7 F;  1V5F A;  4JX4 A;  1R5H A;  4BY1 J;  1TWA J;  4C9Y A;  1QZE A;  2OCE A;  5L3F A;  1S6L A;  2XF7 A;  3K7A J;  2DQL A;  4LGW A;  3S3N A;  2ME0 A;  3K70 D;  4FT8 A;  4M3B A;  3TQN A;  4E7S A;  3IV5 A;  1J5Y A;  4A3J J;  4CHU A;  5ICG A;  2GXB A;  2VE8 A;  2DN0 A;  4E7Z A;  1ZG1 A;  2JRT A;  4LK0 F;  4X6A J;  1XC5 A;  3F3X A;  2BVM A;  5FFX A;  2X6W A;  5EEG A;  4HPQ A;  2H94 A;  3FBI B;  5CVV A;  2OD5 A;  5LRR A;  1U0J A;  1AOY A;  2F5E A;  2A68 F;  5KAF C;  1R4M B;  2CUZ A;  1W5C C;  3REO A;  3SXY A;  1DU0 A;  5FO5 A;  2F5C A;  1I50 J;  3KLN A;  1XGM A;  2E1M C;  3FMS A;  1Z91 A;  3IC7 A;  5BPI A;  1R9T J;  1DDN A;  1TLH B;  4Y52 J;  4ZDP A;  1YS7 A;  1AU7 A;  1WKM A;  4ZC3 A;  1LEB A;  1RKT A;  3EYY A;  2JJ7 A;  3HDD A;  5HOD A;  1YG2 A;  2YPR A;  2L9V A;  3MZH A;  4DZJ A;  1PP8 F;  2DBB A;  1WWX A;  2P7V B;  4MIM A;  4D5C A;  3FK7 A;  2XPU A;  1H88 C;  1YJW I;  5GTH C;  2Q8K A;  2VI6 A;  1RI7 A;  3M7G A;  4WF2 A;  4EM0 B;  1A6Q A;  4CCL A;  3TO9 A;  2VJJ A;  2MH2 A;  3HUG B;  2BE5 F;  3V42 A;  3U1K A;  1FNN A;  3FXJ A;  5EG0 B;  3W2V A;  3FHZ A;  3HEF A;  3W6J B;  3DQV C;  2IW5 A;  5BS6 A;  2VKD A;  4DYR A;  4A3K J;  1LKX A;  1O4X A;  4NC6 A;  3RDI A;  4LD5 A;  1P9Q C;  1R4N B;  4S0H B;  2CG4 A;  4RAG A;  3COA C;  1XCB A;  1FY7 A;  4A3G J;  2JMW A;  2CWE A;  1X3Z B;  2FE3 A;  3J7Y J;  2EIL H;  3G1O A;  1I1S A;  2E1O A;  4BGD A;  3CJT B;  3JW4 A;  2KRH A;  4Z6Y A;  3L2R A;  4RLF A;  1HBX G;  2H8R A;  4D7M A;  4H4K C;  2VPR A;  2BY3 A;  2STW A;  5E8I A;  2H8W A;  2FNP A;  5B66 C;  5E1X A;  3QYF A;  1TW2 A;  5FD6 A;  3FXM A;  1BR4 A;  3GVA A;  1BM9 A;  3N05 A;  4UY8 I;  1TQM A;  4M3E A;  4WXC A;  3LAP A;  2DFI A;  3DTK A;  1MMD A;  3Q3S A;  2PMZ N;  4UVC A;  5ILU A;  3GFJ A;  3RKX A;  1T98 A;  3DXJ F;  1O3T A;  4HX8 A;  4BQO A;  3CUQ B;  2K3P A;  1GVD A;  3FF5 A;  1JTX A;  1TWF J;  2KIU A;  1RC9 A;  1LFB A;  3AKZ A;  1GLN A;  3LA7 A;  1YRN A;  4YEL A;  3F9K A;  2K02 A;  1IUF A;  3Q9S A;  3ZGK A;  3ZQI A;  3E6D A;  1PUF A;  5EF6 A;  2FBK A;  1XMX A;  4E7K A;  5IT9 Z;  4XK4 A;  1XDS A;  5D6E A;  5ILV A;  2BHZ A;  3G1M A;  4A3I J;  2YS9 A;  1GHC A;  4HZF A;  4DNC A;  3ZN0 A;  2W7N A;  1QPI A;  4I76 A;  4FHT A;  2LY1 A;  1XMK A;  2LY2 A;  3BC8 A;  2AQE A;  4MO7 A;  3L2U A;  3ZQ7 A;  5J1R A;  5HLI A;  4FIS A;  2DOE A;  4HNU A;  2DCE A;  4CO8 A;  3NAR A;  1Y8Q B;  1FP1 D;  1QHH D;  2XB0 X;  3KX2 A;  2X6Y A;  4XLA A;  3GLX A;  4CUG A;  3RKQ A;  2X48 A;  2NRA C;  1ERD A;  3E1S A;  3HKZ N;  3AL0 B;  3KZZ A;  2FBH A;  2CJJ A;  4GGG A;  4IHW A;  1RZ4 A;  3QU6 A;  1XS9 A;  4M9S A;  2JA8 J;  1ULY A;  2BGC A;  3FK6 A;  2IVM A;  2R5Z A;  1WFX A;  2VKE A;  3EUH A;  2WV0 A;  3OIP A;  5E3N A;  3JRG A;  2YU3 A;  2HVQ A;  2DPD A;  1Y0N A;  1VQ4 I;  1TBX A;  3F72 A;  1T08 B;  1E17 A;  5HLH A;  1HSJ A;  5CJ9 A;  2XC7 A;  3Q0V A;  2K4B A;  2DDA A;  1AKH A;  4OMZ A;  2HYJ A;  3M07 A;  4DYC A;  4MFD A;  3QWL A;  2L7M P;  5FRM A;  1YHQ I;  4L0Y B;  2EFQ A;  2LMD A;  2JSP A;  1U3E M;  1ZRE A;  3G71 I;  1IZ1 A;  3F0C A;  4EGY A;  4L18 B;  2BVL A;  1PDN C;  2ESN A;  4XSX F;  2DFE A;  1OYW A;  2WY7 Q;  3OYI A;  4E7I A;  4CYC B;  1ZQ3 P;  3PO2 J;  1P6R A;  2BY2 A;  4A3M J;  4XLH A;  3LSP A;  4BUP A;  4OIP F;  1J59 A;  2R7U A;  2XAG A;  3IRR A;  5DM6 F;  5D5U B;  1OYI A;  2CUF A;  1VF9 A;  1WI3 A;  1XN7 A;  2VBZ A;  2DJN A;  4DBR A;  4YFK F;  3LNQ A;  1OCZ H;  1S7A A;  1XG1 A;  3QPS A;  1R00 A;  5DD8 A;  3F8M A;  2R7D A;  4AUX A;  2LFB A;  4U0Y A;  1HDD C;  3WU1 B;  2LP0 A;  1QHG A;  1DPR A;  4J00 A;  1QVT A;  4UXN A;  4FTH A;  5FJ8 J;  3CO6 C;  2DA5 A;  3OYE A;  1FLI A;  3ZCO A;  3CCE I;  3OYF A;  1ZK8 A;  3RIR A;  5F1R A;  2HVR A;  3V8L A;  4U7B A;  2M0C A;  2VPL A;  4I0B A;  3EET A;  1TZL A;  4WXD A;  4LG0 A;  2E2H J;  1S3J A;  1ZAO A;  1R22 A;  4C3J J;  2PBI A;  3OYH A;  4IO9 F;  2H27 A;  4RDU A;  4P1W A;  1P4X A;  4PUS A;  4M71 A;  1NH3 A;  1S8N A;  4U87 A;  3MQ0 A;  1ONV A;  2ZJ2 A;  3D5R C;  3BR0 A;  4YFN F;  3Q5F A;  2GZW A;  3VYU B;  3DFG A;  1CF7 A;  2BOL A;  1B8I A;  3BZ6 A;  2A69 F;  2LC2 A;  3QPH A;  2N8G A;  1ACI A;  4BE0 A;  5IY5 H;  3CLO A;  2Y69 H;  1ETO A;  5CVU A;  3IWZ A;  3K1M A;  1P92 A;  1WGX A;  3LSI A;  4Y7N J;  3A4C A;  1U6G A;  2KDZ A;  4NNJ A;  1W7P D;  1Z1D A;  1MBF A;  1MGT A;  2J5P A;  3WHC A;  4KIT B;  2X1C A;  2JK3 A;  1BOB A;  1APL C;  3BZC A;  2VBX A;  4NC8 A;  4A6E A;  2JA2 A;  2QWW A;  3L1P A;  2BV6 A;  2RGV A;  5LFA A;  3KIO A;  1FZP B;  1YS6 A;  1TP4 A;  1K6O A;  5E8G A;  2HI3 A;  4RGX A;  3HPG A;  4QPQ A;  2QQ9 A;  3OYL A;  2JT1 A;  3H3V K;  1FIP A;  2ISY A;  2XAS A;  2HXI A;  1K4T A;  3N4M A;  1U5T C;  3AG4 H;  2M1B A;  1R1U A;  2ZSH B;  1WSU A;  1GT0 C;  3ECH A;  1Z7L A;  4I09 A;  4P9U A;  1BA5 A;  3CMA I;  1HXD A;  4MGR A;  4MNU A;  1U78 A;  2EA4 A;  4FX4 A;  4PSW A;  5CQE A;  3HOV J;  2ME6 A;  3CME I;  3HYI A;  3GZ6 A;  4IHX A;  2DT7 B;  3TDU C;  2UXN A;  1Z3X A;  2ZSI B;  2HKO A;  4UV8 A;  5IOZ A;  2X6O A;  2XGX A;  1TT5 B;  5KVR A;  2DU9 A;  2DK8 A;  3SZG A;  5FLX Z;  2R7F A;  2W82 A;  3I4P A;  3QPL A;  4AM3 A;  1SC7 A;  4Y4R A;  2KDO A;  3S3O A;  3LA2 A;  3PO3 J;  3QP6 A;  1OMI A;  2HQR A;  3ASO H;  2VXZ A;  3A2K A;  1I39 A;  1V54 H;  2NVU B;  2NVQ J;  3LSH A;  2R3S A;  3ABL H;  4XL9 A;  4HSR A;  3X2Q H;  5ILS A;  2Z99 A;  3TGN A;  3W6V A;  4RAY A;  2Z5U A;  3NWS A;  2E60 A;  1D5V A;  1IRG A;  1P4W A;  3KYD B;  4LIV A;  1G3S A;  3PSF A;  3Q9V A;  2EH3 A;  3HPH A;  5B3S H;  5HS9 A;  3V4G A;  1X3W B;  5F08 A;  1HA8 A;  4LLN A;  1JT6 A;  1OR7 A;  2CQ7 A;  3A0B C;  1R7J A;  4CCK A;  3DPU A;  2F5F A;  5JI6 A;  2ICW G;  3BR2 A;  2OA4 A;  2VE9 A;  1I3Q J;  1YOV B;  1S7O A;  5FGM A;  2HYG D;  3OOU A;  2V1N A;  2W24 A;  5JLW A;  1NK3 P;  2H6B A;  1I6H J;  3H9J A;  1V4R A;  3HSR A;  2ECB A;  3MKL A;  4MLO A;  1FYM A;  3GFL A;  2PN6 A;  3EYI A;  3HZJ A;  1UEL B;  1XCV A;  2DW4 A;  5E17 F;  4M3D A;  2X0L A;  1TNS A;  5HS7 A;  3ML6 A;  4LK1 F;  3L2C A;  5HDK A;  2LKX A;  4EJT A;  1LPQ A;  2WWY A;  2OV7 A;  5DM7 F;  1IUY A;  3BG3 A;  5ICC A;  1OFC X;  3W2A A;  3H5A A;  4S04 A;  3K6G A;  2PJR A;  3HIF A;  3OY9 A;  4BXF A;  1B72 B;  2HR3 A;  1F1Z A;  5F6F A;  2KPM A;  5DCM B;  4G7H F;  1LDK B;  2DOF A;  4GFB A;  1U9O A;  3ZXS A;  4XRS A;  3A01 B;  2JPB A;  2R5Y A;  2KFD A;  3E7L A;  1XD7 A;  3MKZ A;  2E1N A;  4PJL A;  1XSX A;  2WAQ N;  1WJD A;  1MBH A;  2L9S A;  3NRV A;  4ZYG A;  2CRG A;  2EV0 A;  3KEQ A;  4Y13 A;  4XQF A;  2NVX J;  2CUJ A;  2RRE A;  1DU6 A;  1JUM A;  1G3Y A;  4DJA A;  1VND A;  2EQR A;  4Q5S F;  4LOC A;  3CCR I;  2QM3 A;  2XAH A;  3SQN A;  3RJP A;  3NWT A;  3CC2 I;  2F2E A;  2TRT A;  2E2I J;  3BQY A;  3GZN B;  1Z3Y A;  2PMU A;  3CCM I;  4IX7 A;  2AHQ A;  4UUT A;  2EZI A;  3GTP J;  3RCO A;  2HPI A;  1JTY A;  4YIF A;  2QEX I;  1ODD A;  3BTC A;  4M74 A;  2KJB A;  3RSN A;  2DK5 A;  3GLL A;  4YRV A;  3HOX J;  4AVP A;  1J0R A;  3TW7 A;  3WE3 A;  3ZPL A;  1MDM B;  3PL8 A;  1FPQ A;  4D5F A;  4RAF A;  3CF5 F;  3FKJ A;  4IOC F;  4CCO A;  1H8A C;  5TGT A;  3BWG A;  2V6E A;  5D5W B;  2STT A;  4HOB A;  3GTM J;  2COB A;  1ON2 A;  2JUG A;  3OR2 C;  3W6K B;  2CYY A;  3S1N J;  3ZMT A;  4M3G A;  1D3Y A;  3QU3 A;  4I98 B;  2VOO A;  1VQ6 I;  3FXR A;  2JQ7 A;  2FQ3 A;  1MMA A;  2ID3 A;  3MN2 A;  2GM4 A;  2VOD A;  2R7R A;  2Y9Y A;  4L5I A;  2ZC2 A;  3FXL A;  4A5N A;  4ZZD A;  3LSG A;  5FB2 A;  1BW6 A;  1G3T A;  4I99 C;  4IRG A;  2WAE A;  2QBY B;  1N75 A;  3VFZ A;  4B43 A;  2B0L A;  5LHH A;  3HRM A;  2W84 A;  4UB6 C;  1UHM A;  3IH3 A;  4ABZ A;  4A3C J;  1Y1V J;  2QUF A;  3BJO A;  3ZMD A;  2W00 A;  1SD4 A;  4HRI A;  3V7S A;  2HWV A;  3CD6 I;  4YFX F;  4A3B J;  1MH3 A;  3V7C A;  1X2M A;  1ETY A;  2L4M A;  1ZH5 A;  2A6H F;  3KEO A;  4ENJ A;  3LSK A;  5C4X J;  3HOU J;  2HQA A;  3FXK A;  2ELK A;  1ZR4 A;  2KZG A;  3JRA A;  3AG1 H;  3K4M A;  2EB7 A;  1JI8 A;  2R7W A;  2V9V A;  3T8R A;  3GTL J;  3LA3 A;  3K2A A;  3OOP A;  3RTR A;  1OJL A;  5M3M J;  3I59 A;  4PJM A;  3HJE A;  2HOE A;  3MD2 A;  3NAU A;  1V5E A;  1YQA A;  3S2W A;  5L3B A;  1V55 H;  5KAI C;  3WGG A;  4IOA F;  5M5Y J;  1U9N A;  5FLX K;  3BJA A;  1S7E A;  3BRO A;  3QP5 A;  3T1B A;  1ZRF A;  1LUJ B;  2YSR A;  1D0Y A;  2DLL A;  1RR7 A;  5J3L A;  4MTE A;  2WV1 A;  2R7Q A;  3LSM A;  5ICE A;  4ZH4 F;  3CZ6 A;  1FBS A;  5EYR A;  2V79 A;  2VJ4 A;  1BC7 C;  2JA5 J;  3G2B A;  1EV7 A;  4Z2Y A;  3BR1 A;  3GUD A;  1FOY A;  3B6C A;  3L2V A;  1K4S A;  3OS1 A;  2DFF A;  1R58 A;  1JKP C;  5FRN A;  1YW7 A;  3DBL B;  1FP2 A;  2P5K A;  4CZC A;  2IS2 A;  5JR3 A;  3O6B B;  3KYC B;  2HS5 A;  4EJV A;  1XSD A;  1BJA A;  3VOE A;  1Z7U A;  2ELJ A;  1KU7 A;  2LH9 A;  2EFN A;  2WC2 A;  3SFI A;  4L9J A;  5A2Q K;  1YW9 A;  3K0L A;  2QSH X;  4EJU A;  2R7T A;  3R0J A;  3FHN A;  2ZB9 A;  2MD0 A;  3P9K A;  4S05 A;  1JT0 A;  3MWM A;  3WTU C;  3CCJ I;  5DS9 A;  1RR8 C;  4M72 A;  4Y17 A;  2JN6 A;  3FXQ A;  4O3M A;  2LF8 A;  1KGS A;  1T8I A;  4KDP A;  3ZMS A;  1G8X A;  1EH7 A;  1TWH J;  2HDD A;  3UR3 C;  4MFE A;  5IT3 A;  1Y1W J;  3GTJ J;  4CIC A;  3DF8 A;  1ETV A;  1G2H A;  5B5E C;  3PUB A;  2ZJR F;  4RB1 A;  3FZV A;  5F0C A;  3S1R J;  1YJN I;  2FD5 A;  4MEY F;  1YTY A;  1VZ0 A;  1O7F A;  3JRF A;  2K9N A;  4I02 A;  3E6B A;  4O6J A;  4BBS J;  1WRJ A;  2FX0 A;  2XUB A;  3ESW B;  2NS0 A;  2LBF B;  2WAF A;  5CLS A;  2EZK A;  1C0W A;  2E71 A;  4ESB A;  1BR2 A;  1QPM A;  1ZAR A;  4L9N A;  2XKP A;  4Q47 A;  2EFP A;  4B44 A;  1NG6 A;  4HX4 A;  2M7A A;  2L01 A;  3BCB A;  3TMO A;  3TL4 X;  1MBG A;  2KT0 A;  3HRU A;  3K10 A;  4A5M A;  2H1L A;  1ZN2 A;  5BQT A;  3IHU A;  2NXN B;  2P6T A;  4JX5 A;  3I71 A;  3MKY B;  1GXP A;  5F0F A;  2LTP A;  2LLK A;  2IAI A;  1IG7 A;  1E2X A;  2AQF A;  4QWQ A;  4YIR X;  2EBI A;  3CC4 I;  2MC3 A;  3GBG A;  3EUK L;  3HGG A;  3K1N A;  5GAE J;  3SYT A;  1IN8 A;  3K69 A;  1QBJ A;  1U8R A;  4AVZ A;  1FEX A;  4KIG A;  2F4I A;  2LOO A;  3CJQ B;  5FD5 A;  2Z33 A;  1STZ A;  4MEX F;  3BR6 A;  4LMY A;  3GWZ A;  3I55 I;  1MKM A;  4C3H J;  3K1P A;  4IZZ A;  1J75 A;  2Z16 A;  5CQG A;  1FJL A;  3IH2 A;  2ZJP F;  5EJC A;  1ZTR A;  3F6O A;  2X9D A;  2D2W A;  2HQ5 A;  1OR7 C;  2DFH A;  1ITY A;  2OZ6 A;  4RA2 A;  1PUF B;  2PEX A;  3RZO J;  1WCM J;  2K3F A;  2MW8 A;  5E3M A;  2G9W A;  1WJA A;  3HM5 A;  3OYB A;  1QRY A;  1MZB A;  2OQG A;  3A03 A;  2FF4 A;  3L00 A;  4RB0 A;  3IRQ A;  3HTS B;  3HC7 A;  2NVT J;  3S16 J;  3JRI A;  1YFH A;  2CO5 A;  4BAC A;  3JAM Z;  2ZXJ A;  3RYP A;  2VQH A;  3WTX C;  1QVU A;  3DU5 A;  3I3L A;  1LNW A;  3H36 A;  5D6F A;  2V9K A;  2ZME B;  3QOP A;  2Q0O A;  4RMN A;  4AWX B;  4NB5 A;  1I6X A;  2COM A;  2UZK A;  4PZJ A;  1K61 A;  2ADU A;  3GFI A;  4IXA A;  5LEJ A;  2LY9 A;  3DU6 A;  3QQA A;  3QRF F;  1XB4 A;  2FNA A;  4G6T B;  1ETX A;  1J7K A;  3KP3 A;  2LVS A;  3FMR A;  1LFP A;  2R7Z J;  2UWM A;  3ZOB A;  2OUM A;  1HDP A;  3VSL A;  1QNT A;  4DGW B;  4J19 A;  2K9S A;  4P96 A;  3RI4 A;  2X51 A;  3VEP A;  3DWL E;  1TW3 A;  2M0M A;  3LSJ A;  1JKR C;  4Y3O A;  3MEX A;  4EV0 A;  1HQC A;  1X4P A;  3PIP F;  3E5X A;  2VBY A;  3DTI A;  2MGQ A;  1W4M A;  4KIC A;  5AIP A;  1MND A;  3C18 A;  4PK4 A;  2E7W A;  5TJJ A;  2KIM A;  4IRH A;  1TL8 A;  2IS6 A;  1MBE A;  4BKX A;  3F8B A;  3CDH A;  5JVG F;  3HHH A;  4CZZ A;  1FIA A;  2BY0 A;  4QPO A;  1IN7 A;  2AXL A;  2XHK A;  4CH7 A;  1JGS A;  2Q2E A;  5H6R A;  5CKT A;  4HYE A;  4BQN A;  3GTQ J;  1E3P A;  2R7O A;  3WTT C;  1FYL A;  3U2R A;  1EA3 A;  3RKW A;  1T38 A;  2PLY A;  4RS8 A;  2CGP A;  1YIJ I;  2KIQ A;  2NNN A;  2O0Y A;  4HQE A;  2CV1 A;  3S3M A;  3D1N I;  1U8B A;  2BEO A;  3J81 K;  4GYG A;  3WHB A;  2H09 A;  3E5U A;  1LJ9 A;  4EVI A;  3PIO F;  2FML A;  4FET A;  1YIT I;  3K4L A;  1H0M A;  2L7F P;  1ZHF A;  1VQN I;  4ZJZ A;  1VQM I;  4PJ0 C;  3F8N A;  2K9L A;  2PJP A;  3DKX A;  2M87 A;  2W1O A;  2ZNZ A;  3HB9 A;  1I5Z A;  1A35 A;  3ELK A;  2IBD A;  3OS2 A;  2QA4 I;  1WPK A;  1HF0 A;  2M8E A;  3H35 A;  2KJC A;  2F4M B;  2V1X A;  3ZP5 A;  1BR1 A;  1ZG3 A;  4BE2 A;  4HV5 A;  1B8I B;  5J4Y A;  5GAH J;  5M5X J;  2WBM A;  5K7H A;  2ZXI A;  3IP4 B;  2K7L A;  2ETH A;  4CCM A;  2EIJ H;  3LQR A;  3K4C A;  2K85 A;  4B3A A;  5FRO A;  4B3X A;  1MMS A;  1QQI A;  1BOA A;  2FUG 2;  4A3E J;  1SFE A;  3HUG A;  2FU4 A;  2MSY A;  2VOP A;  2GOM A;  1RNL A;  2WY8 Q;  1S5L C;  1QZZ A;  3SFZ A;  5C44 J;  5IOY A;  5EG0 A;  2ZFW A;  4AU7 A;  2D45 A;  4ZDL A;  1T33 A;  5KHD A;  4LLG F;  3RZD J;  4XR6 A;  3LAJ A;  1FOW A;  2JA7 J;  2WAD A;  2GWR A;  3BT9 A;  3DKY A;  3M3Y J;  2G7H A;  1GXQ A;  3I0T A;  4C3I J;  2EFW A;  1TT0 A;  2K9M A;  3O8G A;  4D9J A;  3TKY A;  2EIM H;  1AA7 A;  5ED4 A;  1PUE E;  2CQX A;  1JHH A;  1R23 A;  4OMY A;  2W4S A;  1A36 A;  4ZTJ A;  2CQQ A;  3DEE A;  5B1A H;  2JUC A;  3KFW X;  3WOD F;  1J09 A;  3L7W A;  2DA3 A;  4F91 B;  4HF0 A;  2CQK A;  1RET A;  1ZG5 A;  4ANJ A;  3PM1 A;  1H9T A;  3G73 A;  1RRJ A;  1XX5 A;  2NS8 A;  1FSH A;  3PNT A;  2OZU A;  4UHT A;  1IV8 A;  4ZYA A;  1K7A A;  2M3A A;  5J40 A;  2MG4 A;  2DPU A;  4IHT A;  4BS9 A;  2EA2 A;  2QF7 A;  4BYY A;  4LFU A;  3HOZ J;  5LBQ A;  3ZQQ A;  1YW8 A;  2XRO A;  3JAM K;  2PMZ A;  4RAZ A;  4E7L A;  1O3R A;  3RQI A;  2P5L C;  4F93 B;  3OIQ A;  2GOX B;  4UUS B;  4K2E A;  1FMV A;  4ENM A;  3IWF A;  6PAX A;  3I64 A;  2PQ8 A;  3D5S C;  1UG0 A;  1B59 A;  4KT5 C;  4KT6 A;  2JWT A;  1J2X A;  3HSE A;  2E1M B;  2E19 A;  3ABK H;  3LFU A;  1HW2 A;  1TNT A;  3H92 A;  1IO2 A;  4EMS A;  3MCZ A;  1X1B A;  3CMY A;  4HDV A;  3BQZ A;  3LL7 A;  2BYV E;  1DQU A;  3ULQ B;  2K5C A;  4BNC A;  1VFC A;  5K7F A;  2E5Z A;  4XKC A;  2JVG A;  4I0A A;  3HL2 A;  4AC0 A;  2WB1 N;  3M8J A;  2JVH A;  5EEA A;  4UUV A;  3HKZ A;  4DOZ A;  2GIZ A;  4MQV A;  4N9I A;  1YI2 I;  1SD7 A;  1WJF A;  2G7U A;  2CS3 A;  2VAS A;  2NYX A;  2ZXH A;  4HQM A;  3JSO A;  2M34 A;  5FKK A;  2VC0 A;  1UMQ A;  2RC4 A;  2YX4 A;  3DBH B;  1MIJ A;  4RB2 C;  4G9Y A;  5KCM A;  4BEH B;  4GCV A;  3E3V A;  1WJE A;  1FOK A;  2HFH A;  2NOG A;  2DMU A;  1D0X A;  4U0W A;  3GTK J;  3EQL F;  3I4M J;  3K4B A;  1BI3 A;  4XRM A;  4Y33 A;  3M8F A;  2MD5 A;  1HKT A;  2L5Q A;  4I7H A;  4XOT A;  2DMQ A;  1E0E A;  1OLT A;  4CYC A;  4QTR A;  2BZT A;  5IT9 K;  3OYM A;  4AIK A;  2ZJQ F;  4DW6 A;  4C2U A;  3DP7 A;  3OYN A;  5LRS A;  3IL2 A;  2XAF A;  1L3L A;  2HTJ A;  2ZNY A;  4XLN F;  2XAJ A;  4BL0 B;  4WWC A;  1ETW A;  5TRD A;  3UKG A;  1MJB A;  4ENN A;  4UV9 A;  2CFO A;  4XOR A;  5L3E A;  3ABM H;  3FKI J;  1Z6R A;  4PFP A;  3W2W A;  1MNE A;  2QSG X;  5E79 C;  3U21 A;  2W57 A;  4UB8 C;  4XRF A;  3FXO A;  1FTT A;  4QLC U;  3RPU A;  4JYK A;  2DA4 A;  1VQP I;  2R92 J;  2EFO A;  4BE1 A;  2YUS A;  1PJR A;  2OAZ A;  3OSG A;  2DYS H;  2EV6 A;  3WU0 A;  4NC7 A;  2IGK A;  5JVT A;  2VKH A;  4ESF A;  3E6M A;  1GUU A;  4CDG A;  3S17 J;  2HTS A;  4PJJ A;  2PI0 A;  1SFU A;  4LJZ F;  2ZCW A;  2EZL A;  4W97 A;  5EDN A;  2F6C A;  1QA6 A;  2ACJ A;  3J7Z I;  4XSZ F;  4B48 A;  1SVM A;  3JRB A;  2HKX A;  3RPQ A;  2D1V A;  3JTG A;  3BP8 A;  2RNG A;  4HAM A;  3KE2 A;  3CP8 A;  4QSH A;  4MHG A;  1IN4 A;  3BR3 A;  3DLA A;  1IGN A;  1T39 A;  5CVR A;  4R1H A;  1KQ0 A;  4A12 A;  4B4C A;  1A04 A;  4NUB A; 
#chains in the Genus database with same CATH homology
 2VJJ A;  3HUG B;  4CZC A;  2IS2 A;  3V42 A;  3VWB A;  3W2V A;  2ELJ A;  2LH9 A;  3CMM A;  3DQV C;  2VKD A;  4X0G A;  1LKX A;  2R7T A;  1D0Z A;  1P9Q C;  1X19 A;  3FHN A;  2DXI A;  4HST A;  2MD0 A;  3CF2 A;  3RQ4 A;  4BGD A;  2WB1 A;  2KRH A;  3W3C A;  2BW3 B;  4EAT A;  3L2R A;  4RLF A;  4BU2 A;  4BJ5 C;  2L2O A;  4BDY A;  4H4K C;  2MFZ A;  1G8X A;  3K4K A;  3QYF A;  3UR3 C;  2IGN A;  2LRD A;  4NQW B;  2HZD A;  1BR4 A;  4XOP A;  1G59 A;  1QU3 A;  3N05 A;  4DBQ A;  1KON A;  1X4O A;  2LG4 A;  3DTK A;  1MMD A;  2KP6 A;  2E5N A;  3PUB A;  2L7K A;  3OWT A;  1VZ0 A;  4F92 B;  4BQO A;  2K3P A;  4II3 A;  3TBI A;  2HDW A;  3EUA A;  2PJR B;  3VSK A;  2LBF B;  3AKZ A;  1GLN A;  3S32 A;  2WAF A;  2WA0 A;  4YEL A;  3F9K A;  3OYA A;  1BR2 A;  3ZGK A;  2VQL A;  4E7K A;  4B44 A;  1NG6 A;  2M7A A;  3HG9 A;  2W7N A;  3BCB A;  3TMO A;  2LY1 A;  2LY2 A;  3TL4 X;  3BC8 A;  3L2Q A;  2AQE A;  3K10 A;  3L2U A;  4KJZ A;  3AFH A;  3K4J A;  1X1C A;  4HNU A;  2DCE A;  3OL3 A;  1QHH D;  2HU9 A;  3KX2 A;  2X6Y A;  4XLA A;  3MKY B;  4CUG A;  3H9G A;  1ERD A;  3E1S A;  3AL0 B;  2KQR A;  2VLA A;  2AQF A;  5JHF A;  4E4H A;  3GBG A;  3EUK L;  3ONQ A;  3S93 A;  3SYT A;  1WFX A;  2P0W A;  3BG7 A;  4AVZ A;  2VXD A;  3OIP A;  2F4I A;  2LOO A;  4LIT A;  4IQJ A;  3BLY A;  3CJQ B;  3IUO A;  2HVQ A;  3VYR B;  3OYD A;  4IZZ A;  4ZTF A;  5HLT A;  4XON A;  4XN3 A;  4N4O B;  2Z16 A;  5CQG A;  2XC7 A;  2V7F A;  3BCA A;  4ZDO A;  1OR7 C;  5FRM A;  2JSP A;  3ZRG A;  1WJA A;  2X1E A;  3OYB A;  3VYT B;  4C2T A;  2I8D A;  1W36 C;  1Y56 A;  4E6K G;  2BVL A;  3OYI A;  4E7I A;  2WY7 Q;  3HC7 A;  3OR1 C;  2LRE A;  4XN0 A;  4BAC A;  2VQH A;  4XLH A;  4BUP A;  2A5W A;  3DU5 A;  2R7U A;  3I3L A;  1ZEL A;  2WAQ A;  2R7X A;  2V9K A;  4RMN A;  1DGR M;  3FBN B;  4DBR A;  4XLE A;  2Z2S B;  3KYL A;  3DU6 A;  4J01 A;  1N77 A;  1MMG A;  1YX5 A;  4G6T B;  5HVQ C;  2HVS A;  1QHG A;  4J00 A;  4OAZ A;  2XF5 A;  3MKW B;  4XLF A;  1W36 D;  4HEA 2;  1LFP A;  3OYE A;  3ZCO A;  1SAU A;  3OYF A;  2KL4 A;  2KHM A;  2DOA A;  3C2H A;  3DTE A;  2HVR A;  2UWM A;  1WJB A;  2OUM A;  4U7B A;  2VPL A;  3VSL A;  3PNY A;  1TZL A;  4DGW B;  3MMY B;  2IS4 A;  2X85 A;  2X51 A;  2VJ5 A;  3DWL E;  2IGM A;  2M0M A;  3QOD A;  2X1D A;  2XF6 A;  4Y3O A;  3OYH A;  4BDZ A;  4JQF A;  3KEY A;  4IKF A;  4C30 A;  4RM2 A;  1X4P A;  4P1W A;  4BEH A;  4PUS A;  2QKM B;  3DTI A;  4CSW A;  1N78 A;  4U87 A;  5HNH A;  4RM3 A;  1MND A;  3D5R C;  4GRI A;  4PK4 A;  3VYU B;  4CCN A;  3AL0 C;  2BOL A;  1T0F C;  2IS6 A;  2LC2 A;  3H5R A;  2M7B A;  2IGO A;  4QPO A;  4BE0 A;  3CES A;  4CH7 A;  4BQN A;  5CKT A;  2RQQ A;  3LSI A;  2R7O A;  3A4C A;  4PFO A;  2KMU A;  1EA3 A;  4NNJ A;  2X6X A;  4DIQ A;  3HOS A;  1V5G A;  3SEZ A;  2X1C A;  4KIT B;  4XNF A;  1BOB A;  3S3M A;  2CV1 A;  1LVK A;  3FDY A;  3EPZ A;  4NC8 A;  4HG2 A;  2JA2 A;  4XKW A;  4RLQ A;  3IAS 2;  5LFA A;  2CH0 A;  3A1Y A;  1MW7 A;  4FET A;  4LG3 A;  3D5L A;  3K4L A;  3OS0 A;  3LMM A;  3HPG A;  4ITV A;  4QPQ A;  3OYL A;  2M4K A;  4ZJZ A;  3BG6 A;  2K9L A;  3QYE A;  3DKX A;  1WJC A;  2ZSH B;  2XDV A;  1Z7L A;  2W1O A;  3DPL C;  3OS2 A;  1DP3 A;  4N4N B;  3SDB A;  3H35 A;  4PSW A;  3OYC A;  5CQE A;  2CW7 A;  1BR1 A;  2LYC A;  1UAA A;  2KRC A;  3H5N A;  4BE2 A;  4XKB A;  1PYV A;  2DT7 B;  4FAS D;  1Z3X A;  4IQ4 A;  2ZSI B;  3I9V 2;  2WBM A;  3PSI A;  2ZXI A;  2VB6 A;  3IP4 B;  4BJT A;  1DGW Y;  4CCM A;  2R4G A;  3K4C A;  3EUH C;  3SZG A;  2W82 A;  4XKV A;  5FRO A;  2CW8 A;  2UV1 A;  4B3X A;  4Y4R A;  2KDO A;  1D1C A;  3S3O A;  4KIS A;  2FUG 2;  2VXZ A;  3A2K A;  1T95 A;  3ZR8 X;  3LSH A;  2GOM A;  2A6T A;  2WY8 Q;  4XMY A;  4XL9 A;  2DJI A;  1YE9 A;  4F55 A;  4AU7 A;  4R79 A;  4HSR A;  2CV0 A;  4ZDL A;  5KHD A;  3NWS A;  2E60 A;  4XR6 A;  2XSJ C;  4XM3 A;  2KLO A;  4AYB A;  2QKL B;  4LIV A;  4P5O A;  3PSF A;  3HPH A;  2WAD A;  3DKY A;  3PFY A;  2IS1 A;  4F52 A;  1WJ5 A;  1HA8 A;  1TT0 A;  3K4N A;  2K9M A;  4D9J A;  2UUZ A;  1AA7 A;  2KZV A;  2XAU A;  4PJN A;  4CCK A;  4E7J A;  3DPU A;  2BW3 A;  3QOE A;  3RPU D;  2MC4 A;  3OOU A;  2V1N A;  2W4S A;  4ZTJ A;  3DEE A;  2VJI A;  3H9J A;  2Y0S A;  2VIX A;  4MLO A;  3OYJ A;  2MAB A;  1J09 A;  2V4J C;  3IAM 2;  1UEL B;  4F91 B;  4ANJ A;  3H9Q A;  3H0D A;  3PNT A;  1Z21 A;  4ZYA A;  2OV7 A;  2M3A A;  3L2W A;  2Q1Z B;  1D1A A;  3W2A A;  1X1D A;  3H5A A;  4BS9 A;  3K6G A;  2PJR A;  3OY9 A;  2LBF A;  3ZQQ A;  4BXF A;  2PMZ A;  2KPM A;  1LDK B;  2CV2 A;  2L9N A;  4E7L A;  3PJR A;  3ZXS A;  3OYG A;  3J7A Y;  2O5R A;  4F93 B;  3OIQ A;  2GOX B;  1FMV A;  3MKZ A;  2VQC A;  4PJL A;  3D5S C;  2VQG A;  3HXL A;  1WJD A;  2L9S A;  3E0J B;  1UG0 A;  4KT6 A;  4XQF A;  2E1M B;  2CUJ A;  2RRE A;  2R7S A;  3LFU A;  4DJA A;  1NG7 A;  1R6R A;  4BJ6 C;  1D1B A;  1X1B A;  1S9H A;  3NWT A;  2MYS A;  3VYS B;  5HOO A;  3VDX A;  3LL7 A;  1Z3Y A;  5HNF A;  4B47 A;  4IX7 A;  1DQU A;  1IRX A;  2DT6 A;  2K5C A;  3DPT A;  3RCO A;  2E5Z A;  2HPI A;  3UNG C;  4XKC A;  2JVG A;  3OYK A;  3HL2 A;  3OL4 A;  2VL8 A;  3M8J A;  2JVH A;  3RSN A;  4YRV A;  3HKZ A;  4DOZ A;  4HNT A;  5KNL A;  3PL8 A;  4CCJ A;  3FKJ A;  1WJF A;  4CCO A;  5TGT A;  2CS3 A;  4YEJ A;  2VAS A;  2ZXH A;  2V6E A;  2JUG A;  3OR2 C;  2IXS A;  2R7V A;  3SEQ A;  2NOJ B;  5KCM A;  4BEH B;  1SFK A;  2OC6 A;  1WJE A;  3K70 C;  5CPR B;  1D0X A;  2M4G A;  1MMA A;  1K6Y A;  4JOM A;  1FMW A;  3K4B A;  2R7R A;  4Y33 A;  3LSG A;  2L5Q A;  1E0E A;  2Z1D A;  4XOT A;  1OLT A;  2HNH A;  2WAE A;  1N75 A;  4B43 A;  3OMY A;  3OYM A;  3C2G A;  4D1Q A;  4C2U A;  4OAY A;  3OYN A;  1X1A A;  3M1C A;  2Q2E B;  2HPM A;  1MMN A;  2W00 A;  4PSX A;  4BL0 B;  4HRI A;  1V5F A;  3PNV A;  4C9Y A;  5LD2 C;  2CFO A;  2F5V A;  2XF7 A;  4XOR A;  4PFP A;  3W2W A;  1MNE A;  3S3N A;  3LSK A;  3CP2 A;  3K70 D;  2HQA A;  4E7S A;  3U21 A;  4E7Z A;  3K4M A;  1JI8 A;  2R7W A;  2BVM A;  2ZFU A;  3CJR B;  2X6W A;  3HOT A;  4HPQ A;  3RTR A;  3FBI B;  4BE1 A;  1PJR A;  2CMP A;  4PJM A;  3MD2 A;  1U0J A;  4II2 A;  4OWR B;  2V26 A;  2CUZ A;  1V5E A;  1Y6I A;  4NC7 A;  2IGK A;  1YX3 A;  4F3Q A;  2VKH A;  2E1M C;  4PJJ A;  2F6C A;  4LIU A;  4BQQ A;  1D0Y A;  4ZDP A;  3QYB A;  4B48 A;  2R7Q A;  4ZC3 A;  3LSM A;  3CZ6 A;  2VJ4 A;  4XLC A;  2RNG A;  3CP8 A;  3G2B A;  4E7H A;  3DLA A;  4CA0 A;  3L2V A;  3OS1 A;  3S8P A;  5FRN A;  4NUB A;  4CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...