2W7NA

Crystal structure of kora bound to operator dna: insight into repressor cooperation in rp4 gene regulation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
b'KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRFB TRANSCRIPTIONAL REPRESSOR PROTEIN
publication title Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w7nA00
3M8JA 2W7NA 5CKTA
chains in the Genus database with same CATH superfamily
5BOXA 4XRFA 4Q47A 1PYVA 2Y9ZA 1RR7A 4IHTA 3S16J 4XKVA 5E1ZB 3I64A 1VI0A 2P5VA 3KIOA 5J4YA 2TCTA 1NG7A 2F4IA 2VBXA 4EGYA 1T0FA 1RPWA 2MYSA 2BGCA 2NVYJ 2IBDA 4CGZA 2PJRB 4M3BA 1T38A 2WAEA 2VASA 1VQPI 3MQ0A 4M3EA 1R4NB 2ZXHA 1FC3A 3SZGA 2EIJH 3W2WA 1D0ZA 4CZZA 5KNLA 3D5SC 3WTSC 2QA4I 3M8JA 3HKZN 2MGQA 5KAFC 4BAYA 2OC6A 3OR2C 4CCJA 3K70D 4A3FJ 4E6KG 2IA0A 2ELJA 4CH7A 5FB2A 2L7MP 5E3OA 2HXIA 4PGHA 1MMAA 4BL0B 3A0HC 2V9KA 1H0MA 2JJ7A 2E60A 2AQEA 4KT5C 4MHGA 3TO7A 1V3FA 2STWA 1QPIA 4LGWA 3FXJA 1UB9A 4XBFA 2BEOA 1ZR4A 4Z2YA 4KISA 3KCCA 3CCVI 3GXOA 2O03A 3HGYA 3CZ6A 4I76A 3BG3A 3HSFA 3S15J 2K5CA 2DFHA 4NQWB 5F04A 3O2PE 1SVOA 3HUGB 3LSTA 4M73A 5BQTA 4AIKA 2V1DA 3LQRA 3K2ZA 2X4HA 1KYZA 4G9YA 2Z99A 2HFHA 1JT6A 2FUG2 5F0CA 2M8GX 5FLXK 2H94A 3W2VA 4CCNA 4ZDOA 3P5JA 1G59A 2KJCA 3JREA 1JGSA 3HEFA 4BDZA 1FYMA 3A0BC 3FXRA 1KU7A 4BU2A 5GTHC 5LBQA 5E17F 2LP0A 1UMQA 2LY1A 2VL8A 5GTIC 1EKEA 2CFXA 2EZHA 4JP0A 4P1WA 5H6RA 2HQRA 3QOPA 2XF7A 4KN4X 3GZNB 1MGTA 4Y3OA 2BBYA 1ZK8A 4MTEA 1Q1VA 2H27A 5FLXZ 1TQIA 1Z9CA 3EYIA 5ICGA 4E7KA 1EF4A 1UFMA 1YG2A 5JLXA 1HBXG 2QSGX 2COBA 2VODA 2EZKA 1WKMA 2JA5J 1W7PD 3D0SA 5CLSA 2ME6A 1GUUA 4M74A 2XVCA 4UHTA 3AG2H 2BZTA 3V7SA 2EFQA 3WTYC 3GF2A 2LRDA 2QWWA 2MG4A 4EJOA 2R3SA 4G8XA 3VB2A 4B48A 3ECOA 3FHNA 4XLEA 5FKNA 2JVHA 1GV2A 1ERDA 2R7WA 4G7OF 2YUSA 4WXHA 2OBPA 1PUEE 3I9V2 4XORA 3GTPJ 1D5VA 2IXSA 2YPRA 2P5KA 1DP7P 1FP1D 1Z6TA 4EVIA 4HSRA 3JTGA 3JRBA 1U6GA 2F5EA 5GP9A 5DM7F 1YIOA 4EEFG 1IXCA 2DDAA 4E7ZA 3KP4A 1LDKB 1GVDA 2ID6A 3ZMZA 5HLTA 1RR8C 4IL6C 4U88A 3ERMA 5KK1A 2KRHA 5J4VA 2E2JJ 3LSGA 3SHFA 2R4GA 4GO1A 3GW2A 4L9VA 3LAJA 1FT9A 3IRQA 1WFXA 3GFJA 2X48A 4HF0A 3IRRA 4LITA 3GWZA 2LC2A 3IH2A 3TEDA 5FO5A 1B9NA 3C2HA 1W5SA 2STTA 4XN0A 1KA8A 4XONA 3AKZA 2XSDC 3CDHA 1UHSA 1PUFA 1BW5A 1O7LA 4B09A 2OUMA 1UELB 3BOQA 1WJCA 1JI8A 3EQLF 2X6YA 3DLAA 1IRZA 4ZJZA 1WRJA 2YR2A 1ON1A 1FMVA 2Y0SA 4Y17A 3SZTA 1OCTC 1WZ2A 4IOAF 1R9TJ 3V8LA 3PL8A 3HRUA 5IOZA 5HDNA 5CQEA 3K6GA 1F4KA 4GDFA 5F6FA 2O3FA 2COMA 3GTMJ 2JRTA 3LAPA 2JA8J 1XGNA 2FBHA 1S7OA 2GA1A 1FBUA 1OPCA 1FOWA 1X4OA 1JJ6C 3ZQLA 1LB2A 1IV6A 3LA7A 1KONA 1X19A 4E7HA 1U78A 1TWGJ 1X1AA 2M7AA 2FEZA 1HOMA 3SJMA 1Z0XA 3HTSB 3ZN0A 4LD5A 1FOXA 4GGGA 2FQ3A 1L0OC 2QCOA 3FDYA 5D4RA 1DU6A 2R7XA 2CO5A 2EILH 4RB2C 3OYEA 1VFCA 2HTJA 3P9CA 2DXIA 2MBFA 4LK0F 2DCEA 5H6QA 2M0CA 1YJ9I 2WV0A 2MSYA 2KLOA 2N8GA 2EIMH 2PI0A 2E1OA 3HB9A 3VSLA 1Y1WJ 5E18F 3OSGA 3LSIA 2DOFA 4QSHA 2XKOA 2HU9A 5JFRA 6PAXA 4MEXF 1FOYA 2NNNA 4XL9A 2HDWA 1SMTA 2QKMB 3HRTA 2ETHA 4BHCA 2IRFG 4NBQA 1T0FC 1UCRA 5K1YA 4DOZA 1N25A 1BBYA 3A4CA 4AWXB 4R8HA 4XICA 1RC9A 2LTPA 1F43A 2K85A 1WGXA 1K7AA 2PLYA 2HYJA 2KZVA 4C3IJ 4BE0A 3IV5A 5LD2C 2NYXA 1K61A 3I71A 1B9MA 1HSJA 2ZO4A 3C2GA 5TISC 2R92J 1APLC 4D7MA 4HEA2 4ZTJA 2RQPA 3BC8A 1MH4A 1J0RA 4A3DJ 2J5PA 4WF2A 4YELA 5L3FA 4DGWB 2LG4A 1IG7A 1JKRC 2WV1A 2L4MA 4UB8C 1JE8A 2Y30A 2HTSA 2L9VA 2L9SA 3KFWX 5HNFA 3EETA 4GYIA 1FZPB 3OYAA 1P4XA 5A2QK 2XPUA 3WU1B 1PUFB 2WAQA 2LY2A 2XB5A 2LNBA 4II3A 4M71A 1C0WA 2W85A 2HZTA 2A5YB 1OYWA 1R4MB 4FT8A 3R6SA 3BQYA 5DV5A 5E8IA 2LBFA 1AHDP 4I98B 2XAJA 4BE2A 5IP9J 1WHUA 5F64A 1RESA 4RAGA 1SC7A 4XKBA 5A2QZ 3CMMA 1KU2A 3WG9A 2DYSH 3JRGA 3KP3A 2XC7A 2ECBA 2DT7B 5ILSA 3U2RA 4FQGA 3ZCOA 1ZG3A 3VYUB 4W97A 2F5DA 3FKIJ 2M34A 3TO9A 4IHVA 2CW8A 4XNFA 4P9UA 2PJPA 2LREA 1QPMA 5FRNA 1JKPC 5EEHA 3KEYA 3R60A 2XGEA 4UY8I 4C30A 3TW6A 3ZP5A 2QSHX 3OYLA 4YIIA 2XF5A 4BBRJ 5LGUA 1EV7A 4D7NA 2RNJA 4J19A 2VC0A 5ICFA 2AQFA 2ZXIA 3JSOA 1RKWA 1UHWA 4PK4A 4DYQA 3GTGJ 4UV9A 3W6VA 4HQEA 4AIDA 5GAHJ 3KP5A 2DAOA 2A6EF 2AO9A 1GT0C 2DFFA 2ACJA 1T2KA 2DLLA 3DEEA 3IKTA 1ITYA 1Q1HA 1V5FA 4KMUX 5D8LB 1CQTA 1YW9A 2F5VA 2X51A 4BXUA 1ZHFA 3ML6A 3RKXA 3ZRGA 3RKYA 2EFWA 3A2KA 4F3QA 4Y13A 3KZYA 4I7HA 3MKYB 4M9XA 2OZ6A 2EBIA 3CP2A 5FROA 2DA1A 3G71I 3HBLA 3OY9A 1OCOH 3D1NI 3ZN1A 3OS0A 3E5UA 4XIDA 1ZAOA 3WTXC 1BIBA 3OYBA 2BYVE 1FTTA 4JK1X 5BS6A 3O3KA 2JPBA 2NOGA 3WODF 4Q4ZF 2GA2A 4BXFA 2Z1DA 5BPDA 3CUQC 3IP4B 1FSEA 1U2WA 3K1PA 1SFOJ 2ME0A 1XSVA 3OR1C 5CVIA 1J9IA 2D1VA 4YG2F 1KYWA 3HYIA 1IJWC 1K4SA 2LBFB 1YS7A 2CUEA 5F27A 2LKSA 2PBIA 2OCEA 1I1SA 2OJED 2R7OA 3GFLA 1R6RA 2EINH 3KLOA 2ICWG 2L4AA 3OOPA 1IUYA 2BY0A 3GZ5A 3DBRB 3RKWA 3F21A 1W0TA 1LNWA 3R4KA 2O6GE 5E1XA 3JRHA 5DD8A 5M5XJ 1RUOA 1YQAA 2CYYA 1R23A 1GV5A 3DEUA 3K10A 5IYBJ 3HOZJ 3KLNA 2K9SA 1LEBA 2QVOA 3HM5A 2A05A 3GO5A 4FE7A 1S8NA 5IOYA 4M6VA 1K79A 1KQ9A 2LFBA 2YS9A 1O3TA 3J7ZI 1YRNA 3FF5A 4Q48A 4FISA 1XSDA 1BM9A 5LGTA 4A3KJ 1G8XA 2DT6A 3U1DA 4UVBA 4PDKA 5CVUA 1B59A 2LLKA 3RYRA 4C2TA 5D6EA 2CQ7A 4UB6C 3WTVC 3H5AA 2W84A 3K0LA 3ZQIA 5J1YA 3JR9A 2JA6J 2DA5A 2PFBA 4QWQA 3TP0A 1XPXA 3HIFA 5GADJ 2E34A 2P0WA 3GFIA 3RCOA 1LUJB 3WHBA 4IOCF 4JQFA 4XN3A 5FD6A 4B44A 3K4BA 4KA4A 1OCRH 2DDBA 3JSPA 3AAFA 4IRIA 2HI3A 4KFCA 1FOKA 3CCQI 2CG4A 2RN7A 4D0PA 3TOBA 4BHBA 3FKJA 4EV0A 2IT0A 5GAEJ 5FKLA 2BXZA 2FSWA 4XMYA 4HF2A 3HTUA 3FBIB 5FKMA 3SDGA 2F4OB 5BMZA 3RZOJ 1JUPA 3L7WA 4ZYEA 2R0QC 2ZSIB 2AHQA 1B6AA 1YFHA 1RKTA 2Q8KA 3PNTA 2ECCA 4M3FA 1PP8F 2CV0A 3TKYA 1R5GA 1I27A 2HXOA 2VUMJ 4XK4A 2ADUA 3U21A 4IO9F 3ZQGA 1IN6A 3Q9SA 3T8TA 4CXFA 1GLNA 1YE9A 4JYKA 1DQUA 4HNVA 3MVPA 4RGRA 5H2FC 4FX4A 2VXDA 3DWLE 3OIPA 3A1YA 3E5QA 3OWTA 3TGNA 2DJNA 5EZHA 4YIFA 3OYGA 3BTJA 1R5ID 2V7FA 2WB1A 2B9SA 3U9GA 3I53A 5F08A 4X6AJ 3L1PA 5HDGA 2LF8A 5L3DA 4CYDA 1BI2A 4P96A 5J6XA 3DP7A 4XR6A 3CLQA 3ZQQA 4DNCA 3N4MA 1IV8A 3QYBA 4D5FA 1LDJA 4B3AA 4OOIA 3HDDA 4AYBN 1TTYA 4F55A 4Z6YA 3FHZA 1NK3P 1WJBA 3DTEA 1FBQA 4AVPA 4JOMA 4PFOA 1DPUA 1ZRDA 5FKOA 3A03A 1YW7A 1STZA 2ESNA 1MW7A 3FXUA 2E1MB 2BV6A 1D1BA 1XD7A 4U0WA 1Y39A 4EQQA 1X1BA 1HLVA 1QZYA 3KX2A 2NS7A 1F36A 1IXSB 3CC2I 3H9QA 1LFBA 1QVTA 5EYRA 2L9RA 3W2AA 1CGPA 2M45A 3KZZA 3ROUA 4XLCA 1S72I 2KKOA 5JLWA 1AU7A 2BW3A 2HKXA 3BWGA 5AIQA 2JRMA 1R71A 3HL2A 3ZMUA 5E3LA 2BVLA 2LKPA 2XASA 4DIQA 3CMEI 4MNUA 1T39A 3QODA 4RAFA 2KIUA 3CC4I 4E7JA 4HAMA 4RAYA 2B0LA 3CP8A 1TW3A 2QEXI 2V1UA 3WTUC 3OS2A 2HYGD 1FEXA 3BG5A 2MD5A 3EPZA 4A5MA 2VLAA 1IN5A 2CV2A 4ASNA 5JI6A 3WGHA 4HA8A 1E3PA 3UKGA 4PZJA 2OCCH 4QTRA 2R5YA 2H6BA 1JJ8C 2IS2A 4LG0A 2EPFA 1RIOH 5LRRA 2VJIA 2FOKA 1BOAA 1QRYA 2EB7A 2VQGA 3HZJA 3SFIA 5LEKA 1VNDA 2V26A 3E6CC 3F8CA 1U8RA 2Y48A 4IQJA 1TNSA 3FXOA 2X9DA 2XKPA 1DPRA 1MDMA 4MQVA 3HGGA 1SFKA 5HS7A 4CDGA 3J81K 3PM1A 3RTRA 4KYWA 2DK5A 3ASOH 2HYFA 4ENNA 2HR3A 3ZMTA 5M3MJ 1A36A 3BCBA 3V8JA 2JT1A 3HOVJ 1ZKGA 1JHFA 3L2VA 1ENHA 2L0KA 5K7FA 2FXAA 5BNGA 2FJ1A 5IT9K 1EH6A 3MZYA 1Y1VJ 2RKHA 2NS8A 2XPWA 1YITI 1ZN2A 3BR2A 3TDZC 2PMUA 3OMYA 5DCMA 1T6SA 3WTTC 3U1KA 3JRIA 3F8FA 4KNYA 2A5WA 2ZJPF 4M6XA 2DODA 5M3FJ 1XMKA 4KMFA 2DQLA 1RZ4A 2E1MC 3K4NA 3BY6A 1LKXA 3OYNA 5IT9Z 4AU7A 2CH0A 3CESA 1S9HA 4C9YA 5IYCJ 1AKHA 4UNOA 3GTOJ 1NK2P 1TT5B 3GVAA 4X0GA 4CA0A 2EZLA 2KDZA 4HLYA 3H9GA 1G4DA 1TQPA 1UJ8A 2MH9A 1DGRM 2BW3B 2HOSA 4NC6A 4HBLA 5D5UB 5IYDJ 3PNYA 1TWFJ 4MIMA 1O3QA 1IUFA 3B6AA 2EA2A 1O57A 1YHQI 2RQQA 3OOUA 2F5FA 4L5JA 2R7ZJ 2QF7A 2V9PA 2LKXA 4L18B 2R93J 3P9IA 2VJ4A 2W7NA 1FX7A 2ZNYA 2K40A 1LEAA 3VOEA 3N05A 5IT3A 2O0YA 3GEZA 5K7ZA 3BP8A 1F5TA 4BBSJ 2PMZN 3RYPA 4AVZA 1WJAA 1GVJA 3DQVC 1HSTA 2IGOA 4PCQA 3VODA 3DTKA 2TRTA 5J1UA 3QWLA 2EWNA 2KL4A 5DUIA 4RGUA 2RV8A 5DUKA 4WXCA 4PJMA 1K6OA 2R5YB 4BNCA 2Z16A 1SFUA 4LG0B 3J7AO 3GX4X 4KT6A 3W3CA 4BJTA 5H20A 2Z33A 3J7AY 2E7WA 2JUCA 3CF2A 4B43A 3F0CA 4BKXA 1MDMB 3GFMA 1PDNC 2ZSHB 1JUSA 2M30A 4NUBA 5FGMA 1VQKI 3MZ8A 3NARA 1QGPA 1IW7F 1OCZH 2M8EA 5KCMA 1FYKA 2MABA 3IH4A 3PIOF 2E1CA 2ZFWA 5M5YJ 2B7EA 4I2OA 2D45A 4MGRA 5ILVA 2CQKA 4A0YA 1HW5A 2Y9YA 3M8FA 3WHCA 1HC8A 1YX3A 2HS5A 2FNPA 3HOTA 2HEOA 1T8IA 2MC4A 2VONA 2OA4A 3K4CA 3FK6A 4NNJA 2MW8A 1WPKA 1N77A 1U8BA 5IP6A 2VE8A 3ZQFA 5DCMB 2RAEA 1Z7LA 3ZR8X 1YYVA 3LA3A 1W1WE 2KP6A 2YX4A 2EIKH 3VYRB 2G7HA 3QOEA 3M1EA 2F2EA 1AWCA 5HLHA 4ZZLA 3F22A 1VQ8I 2Y2ZA 2XPVA 2XDVA 3BCAA 3MCZA 3TQNA 1AKHB 3IAM2 1JKQC 1WQ2A 4IEJA 3VYSB 1J59A 4IZZA 1E2XA 2EV5A 2DPDA 3QU6A 2VPLA 4BE1A 2Y31A 3LA2A 1SD5A 2VJJA 4HSTA 2GBYA 2X85A 3S2DJ 5J3LA 3HOUJ 3ABKH 1FY7A 5E3MA 3IC7A 4WWCA 3DU6A 2NVXJ 2IW5A 2M9HA 1GDTA 3NRVA 1VQMI 5D8KB 4KIFA 3CUQA 3JAMK 2PQ8A 4U7DA 2RC4A 1HF0A 3SEQA 1DU0A 4BDYA 5CPRB 1KGSA 3K4LA 3K4MA 4V2FA 2L54A 1IN8A 3C3WA 1P4AA 2JK3A 1JKOC 5CVRA 3OYFA 2K9LA 2K9QA 4D1QA 1L3LA 5KHDA 1ZTRA 4Y4RA 4U0YA 4XKCA 2A69F 1BI1A 3J80K 2W00A 1G3TA 4BEHA 1JTYA 3O6BB 3JAMZ 1CF7A 2DTRA 4OU0A 5FLVA 1MNMC 1MJ9A 2IS1A 4PJ0C 1MJAA 2FMLA 3GZ6A 3BR3A 2VN2A 4AIHA 4N0BA 2NAZA 2VOPA 3R0JA 2FNAA 4FETA 4E7SA 1ZELA 3H3ZA 1XX5A 5LGNA 4U7BA 4OAZA 2QLZA 1IDYA 1D0YA 3HPGA 4KN7X 5L3EA 4L0ZB 1QU3A 3J80Z 4XOPA 1Z05A 2OZUA 5J1RA 3FISA 2XIGA 3ZMSA 3CCYA 1BI3A 4AIJA 4PUSA 4LB5A 4F93B 2NVQJ 1AA7A 4BUPA 2X6OA 4YEJA 3LSMA 1K83J 4PSXA 2C6YA 4ETSA 5L3CA 4UVAA 1IXRC 1RNLA 5ICEA 2CQNA 3KEQA 4IPAA 4HNTA 3C2BA 1TC3C 2XGXA 3ZXSA 2YX7A 1IDZA 1BC8C 5HVQC 4JX4A 2DMTA 3QYFA 3RQIA 4XKWA 3ZMDA 1POGA 2V9VA 1QA6A 3S2HJ 3DTIA 2CUFA 2GM4A 4IVNA 2V79A 3FZVA 3MD2A 3QP5A 3T0YA 4XLNF 4RGXA 2R7VA 2EQRA 2PN6A 3CF5F 4CUGA 4P9FA 4M3DA 3PJRA 3HHHA 4RBOA 1G3YA 2CRGA 2VQCA 1R1TA 1X4PA 3E0JB 2Q2EA 4HX8A 2ZC2A 1PP7U 2L7KA 3ABMH 2WAFA 5D4SA 5JVGF 1IO2A 4O3MA 3CUQB 5F0FA 3VYTB 5EF6A 5FJ8J 4I6ZA 3LSRA 3TW7A 1OCCH 1VQLI 1XTAA 1Z67A 1H9TA 5D6FA 2E5NA 2OPTA 1P6RA 5D5WB 4M9SA 3F6VA 1HDPA 3ZQHA 2F5CA 5HNHA 5LLQA 1MBGA 2GXBA 4A2UA 3A02A 3H5NA 2VI6A 5IY5H 1X1PA 2J5OA 4C2UA 1P7JA 4BEHB 1MKMA 4WCGA 3JW4A 1CF7B 3K4JA 3WE2A 3AG3H 4BH9A 1HA8A 2MLKA 1WI9A 5JR3A 1R5HA 3CJRB 2FU4A 1AOYA 2PMHA 2E5ZA 5TRDA 3I4MJ 3G1OA 3BG7A 2CSOA 3QRFF 2Z5UA 4S05A 1R22A 4L0YB 2LMDA 2V1NA 1TLHB 3S3MA 3QPSA 4L5EA 1ZH5A 4I99C 3GYHX 1R58A 2WY8Q 3DBLB 4L9NA 1F1ZA 3HG9A 2IA2A 3BJ6A 3BZ6A 1XGMA 2K3FA 2OQRA 2F4MB 2I10A 2VBZA 1Z7UA 2QGUA 2PEXA 3EDPA 1IGNA 2XAQA 1QHHD 2F48A 3NWTA 4NDLA 2W25A 2VQLA 4JBAA 3TMOA 3KZIC 2GIVA 3P9KA 2IGNA 1I3QJ 2FOWA 2JPCA 2K86A 3F8BA 3Q9VA 1MSEC 1XN7A 2BHYA 3OIQA 4QLCU 3GTQJ 2KIMA 4CCMA 2OTLI 3FXMA 3CCLI 1XDSA 3E6BA 2M0MA 4MO7A 5K5QA 2ZBKA 2WADA 4LIVA 5LHGA 4G7HF 4DYRA 4E7IA 1K78A 3GTKJ 2ELKA 1BC7C 2BXYA 1A31A 5CYVA 1FBSA 1MBHA 3ZQ7A 1ZR2A 4OIQF 1ZLJA 3BTLA 3MFKA 3OS1A 3JCUC 2Q2EB 2O9LA 3Q5FA 4A0ZA 1IRXA 3CCJI 3S14J 4PGGA 3S8PA 2Q0OA 3ISPA 3SFZA 3S1MJ 3I55I 3QU3A 1MMSA 1U9OA 2DK8A 1A5JA 2ZKZA 4ZTFA 4KICA 4HNUA 2FQ4A 2OQGA 4BS9A 2BY1A 3BG6A 3RPUA 3JRCA 3PFYA 4O5VA 3ERED 2JN6A 2CUJA 3E97A 4O6JA 2DN0A 5C4JJ 4HOBA 4P5OA 3S32A 3EUKL 4EJVA 3ZPLA 3SQNA 3JRFA 5D5VB 3EUHC 1S6LA 4KJZA 2OV7A 3H9JA 2H1LA 2Y75A 3AG1H 1X2MA 2DFIA 4ZYAA 2GOXB 3F6OA 3CO7C 4P55A 1NTCA 4CHUA 1ZQ3P 1VF9A 4D9JA 1MSFC 1XG1A 4LJZF 5EZGA 2LK2A 4B47A 4ZC3A 1SANA 2XV4S 2TDXA 3HC7A 1MNDA 3MN2A 2M3AA 1G2HA 5B1AH 5IP7J 4FCYA 2GLOA 1K4TA 2GXGA 5CJ9A 5L3GA 3GLLA 3F23A 3UNGC 4KDPA 1R1VA 3KP7A 2DU9A 3CCRI 2EFPA 3GTLJ 4G6TB 3S17J 3L9FA 1SAUA 5J8FA 5B5EC 2DOEA 4BJ6C 1MMNA 2VC1A 1HW1A 1WH7A 1FJLA 3HOWJ 1P4WA 4RB0A 2DFEA 4NB5A 4XQFA 1QZEA 4BJ5C 4GYGA 4A3IJ 2RVCA 1LQ1A 1SFEA 3E6DA 2I8DA 1T08B 1Z91A 4RMNA 3OV8A 2HOTA 3DF8A 2M4GA 1K78B 5JHUA 2UUZA 1P92A 4UV8A 3L00A 2NRAC 2LYCA 2VBYA 1D1CA 3CDLA 1O3SA 4HRIA 2NS0A 2HOEA 1TBXA 1ON2A 1RETA 1T98A 4HDVA 1X58A 1EH8A 3SYTA 4N9IA 1MD0A 3FXKA 4V2GA 5KAIC 1BIAA 3RJPA 3J7YJ 3H3VK 4WK8F 3GBGA 3LFUA 4HW0A 3H92A 2VQHA 3I58A 3CJTB 3BJAA 2HKOA 4FX0A 3PFIA 2LOOA 3KETA 4PSWA 4EGZA 2LD5A 1RRJA 1Z6RA 1V55H 4FASD 3AL0B 1OLTA 2DJIA 4YFKF 1VZ0A 1IAWA 4OIOF 3V4GA 3ABLH 2XGDA 1BW6A 5KVRA 2MA3A 3E1SA 3H0GJ 2WA0A 4E70A 1ZG5A 3BPXA 2Y69H 3Q0UA 3REOA 1BN5A 1E3HA 3K4KA 1MIJA 4DJAA 2XROA 4KUMA 5DTDA 1NG6A 1ZGJA 3M8EA 5DM6F 1USTA 2XF6A 1TWAJ 2L7ZA 2CGPA 2AXTC 4FHTA 3LOCA 3VFZA 3OL4A 3KP2A 2K4JA 2DT5A 3X2QH 4FTHA 3Q0VA 2O61A 4G6QA 2HNHA 2E7XA 3ABUA 2WBMA 1ZYRF 2XSJC 1ETWA 1IRGA 4AD9A 4ON0A 3E3VA 3M07A 1P7IA 3VDXA 1IF1A 5ED4A 1ETOA 3BTIA 1XDUA 2DA7A 1H9GA 3BTCA 1YOVB 3LNQA 2L5QA 4FE4A 3KE2A 5HLGA 1Y56A 2ZXWH 5GPAA 1JHHA 4IQ4A 4OIRF 2M87A 2QZ8A 2ELHA 1MH3A 3OYJA 3PQKA 2YSRA 3R0AA 3WU2C 1G3SA 4BACA 3LMMA 2OAZA 4B3XA 4E4HA 4AM3A 2KIQA 2WWYA 3ZOBA 4ZZDA 1Y0UA 1SD7A 3HKZA 4EMSA 1QBJA 2X6XA 3CMYA 4M72A 4A3MJ 9ANTA 1ETVA 3OYKA 2ZXJA 4R79A 3CMAI 2EJRA 2KRCA 4A3GJ 1WI3A 4BXXJ 4LOCA 4DW6A 1DP3A 4N4NB 4ZYDA 3BT9A 4RM3A 1R7JA 3H5RA 1HDDC 1W4MA 2R7SA 1Y8QB 4RLFA 1BR1A 3CCUI 2QQAA 3T5XA 2GZWA 2GAUA 4CO8A 4UXNA 1H8AC 3DKYA 1JTXA 5F0HA 2W48A 3DBHB 3FMRA 2O8XA 2EK5A 3O8HA 5B3SH 1TP4A 2Z9OA 2XAFA 4DQ2A 2F6CA 2IEKA 2YU9J 4HX7A 2KQRA 4IHSA 2K9NA 1N75A 2A6HF 2O7OA 2MLGA 3UR3C 1V54H 3HHGA 3D5RC 3VPRA 1YX5A 3RZDJ 2V6EA 4HV6A 4C3HJ 2EV0A 4L5IA 2PG4A 4IX7A 1REPC 3QPHA 2JWTA 4CICA 2ZCWA 3AL0C 2P8TA 3ULQB 4DBRA 3K69A 1I50J 1V5GA 1LDDA 3VSKA 4Y7NJ 2W82A 4QIWN 1FWZA 2RDPA 4M6YA 2NVTJ 1QQIA 4S0HB 1G3WA 4YRVA 2P7VB 1OISA 2ZJ2A 2JA2A 5HDKA 3VWBA 2KJBA 2CUZA 2Z2SB 3MWMA 3G6EI 1BA5A 1MJBA 3L2QA 2ZFUA 3GTJJ 2KISA 1W5CC 3JTHA 4EM0B 1XMAA 1X3UA 1WJ5A 2VXZA 2V4JC 4HV5A 3SXYA 2UXXA 1Y8RB 3CLOA 1FSHA 2DMUA 1BJAA 1LFUP 3ABTA 2ISZA 4ZDPA 3J81Z 1SMYF 3FMSA 4YFNF 1FNNA 5TGTA 1SD4A 5B1BH 3NEUA 3IL2A 3FM5A 2AXLA 3KYCB 5F1JA 2CV1A 4M3GA 2VKHA 1U5TA 3CCEI 1PVEA 3ONQA 2H1KA 4ESBA 4GRIA 3HSEA 3DLLF 3HPHA 1WVRA 2M4KA 3I0TA 5DCFA 5LHHA 2R7UA 2DA3A 2VT2A 2DMPA 1QZZA 3L2WA 3ECHA 1TW2A 3SEZA 1QVUA 1LVAA 4V19K 1Z3XA 2VBWA 2HPIA 4KITB 5AIPA 3TDUC 4I09A 3RPUD 4Y33A 3G1MA 1OR7A 2IAIA 4L9TA 2H8RA 1PJRA 1WJDA 1I39A 4MTDA 3PSFA 4KIBA 4PJNA 4F7ZA 1GXQA 2P6SA 4IHWA 4M9ZA 3S2WA 3BPVA 5DEQA 2GOMA 1MMGA 1S5LC 1SEUA 4RGSA 3FM3A 5ERIA 1VQ4I 2VIXA 3ELKA 3HRMA 1BL0A 5DD4A 4F52A 4HX4A 3OYDA 4IRHA 3G73A 3T8RA 1I6HJ 3RQ4A 2WC2A 1A35A 2IGKA 3BZCA 1D1AA 3GLXA 1MBFA 4HQMA 3ESWB 4II2A 3TBIA 3OSFA 2ZNZA 4BQQA 3MZHA 1YJNI 2FMYA 1D0XA 2M5WA 2XGCA 1I3AA 3L2RA 3I59A 4ZYHA 2BVMA 3V42A 2QBYA 4ZH4F 4RDUA 3V8KA 3QP6A 2KT0A 2D2WA 4ZDLA 2ZJQF 3DPLC 5D5XB 1FMWA 1XC5A 4D5CA 3IHUA 4LK1F 4A3LJ 4A3JJ 4F91B 1ZLKA 2GXAA 2RREA 2A3SA 3WE3A 2KZGA 3F72A 4Y52J 2IVMA 2HDDA 3KYLA 3H35A 3ZMVA 2VB6A 1TNTA 1E17A 3TP3A 3IUOA 3CJNA 2JVGA 3E7LA 1LFPA 2E19A 2Z3YA 3LWFA 3LSHA 1OYIA 2L3DA 2RNGA 1J09A 1KU9A 1U5TB 4IKFA 1R49A 1HCRA 3VEPA 3BROA 3QQAA 1TZLA 4ENMA 1SFXA 3RIRA 5E3NA 2VE9A 3OL3A 1U3EM 3IWFA 5J8CA 2X6WA 2QQBA 3S1NJ 3ASNH 2VKDA 4TV7A 4F92B 3I3LA 5BPIA 1O4XA 3WTZA 3AFHA 4J01A 3CJQB 3BR0A 5J47A 5HS9A 2E35A 4RA2A 5LFAA 1I5ZA 5FD5A 2CS3A 1BI0A 4G7ZF 4A3BJ 4IHYA 2XAUA 1TQMA 3I4PA 3L09A 5M5WJ 4XLPF 1DUXC 4QPOA 3Q0WA 4HLXA 1R36A 3MKZA 4AUXA 4LLGF 1TL8A 4XSZF 3HOSA 2IPQX 1QHGA 3LSKA 3MKLA 5EDNA 3L2CA 3HOYJ 2DTZA 3EUAA 3SZPA 4XOTA 1FPQA 1Y6IA 1YJWI 4X1EA 3MMYB 2L02A 4MLOA 1P2FA 4KIGA 3BR5A 4A5NA 5EJCA 3EUHA 2XRLA 2CWEA 2ZJRF 2ZMEA 1G6NA 3IAS2 4ABZA 2YU3A 4Q5SF 1LPQA 3KP6A 4DYCA 1DGWY 3WGGA 3F9KA 5GAGJ 3NQOA 1ORKA 3I59B 1ETQA 1WJFA 2DMQA 2KIFA 2OU2A 3BQZA 5EGOA 2DO7A 2QBYB 4B8XA 4OMYA 3QYEA 4CCLA 1W0UA 1D5YA 1XB4A 1MNEA 2K4BA 5FFXA 1VQ7I 2ESHA 3GCMA 1YS6A 5DDGA 5E8GA 2FD5A 2JUGA 1M1EB 3C1DA 1XGOA 3DKXA 3OYHA 2DOAA 2IGMA 4EJTA 2DA6A 3MEXA 2DW4A 2ISYA 4MFDA 3KYDB 1J2XA 2W57A 4I0AA 2CU7A 1X1DA 4W1UA 4LB6B 2LDUA 3FWEA 1FYLA 1JXSA 3M7GA 2HVSA 1LVKA 1R00A 1B8IA 2HZDA 2R7FA 3RDIA 3HXLA 3QPTA 4I01A 2KFDA 2FA5A 1ULYA 1KQ8A 3DV8A 3OYIA 2VOOA 3S3OA 1U5TC 3LL7A 4S04A 1ETKA 2R7QA 2EV6A 3K9TA 3K2AA 1SVMA 1SVLA 3PSIA 1D8KA 2FX0A 4G6DA 3BZKA 3V7RA 5LRSA 4IRGA 4GFBA 2L01A 2E36A 2K02A 2VKEA 2M7BA 2CW7A 3E6MA 2XRNA 1HKQA 2H8WA 2CW0F 2NNYA 2KRFA 2AS5F 3TL4X 5LHIA 2E2HJ 5C4XJ 4R1HA 4XLAA 2EFNA 2HVRA 1SAXA 1OR7C 2KPMA 4GCVA 4A0XA 1R1UA 3DU5A 3S93A 1ZRCA 1VQOI 3B02A 3RI4A 2HGCA 4I0BA 5K5OA 3WTWC 3V7CA 4ANJA 4HDUA 1OCPA 3DEWA 2HDCA 1XCBA 1OFCX 2IP2A 3OYMA 3DPTA 3K1NA 1W36C 2JTVA 4BHPA 2NOJB 1VQNI 2ZMEB 4RM2A 2JQ7A 2DBBA 2EH3A 5HOOA 5DS9A 2P4WA 2O5RA 2DI3A 3H0DA 1EH7A 2JA7J 1MBJA 3FX3A 3CDIA 3AG4H 3B73A 3IWZA 5EGOB 1UG0A 5LEJA 4IHXA 3H3UA 1QNTA 1IC8A 2HQAA 5EEGA 1OYYA 2JSPA 2FBIA 2W24A 1I6XA 2HPMA 2MFZA 4OWRB 2KMUA 3DFGA 5TJJA 2CJJA 1XSXA 2Y0SN 5HS8A 5K7HA 1VQ6I 1VQ9I 2G9WA 2LH9A 3LQQA 3F8MA 1U9NA 5HLIA 1ZG1A 2A68F 2DYRH 2L9NA 4XRMA 1U0JA 3OYCA 2L7FP 1B8IB 2M2EA 5GPCA 1ETXA 1D8JA 2K3PA 1FIAA 1UAAA 1LJ9A 2EZIA 1KZHA 1ACIA 4OMZA 3CO6C 2W1OA 3WU0A 1E0EA 4BY7J 4UUSA 4CZCA 1B72A 1J75A 5E20A 1EJ9A 4U0VA 4HF1A 2LF7A 5E79C 4BGDA 1W36D 3HJEA 4LMYA 2DQRA 1V5EA 3G4SI 5FRMA 2P7CB 1O3RA 1UZCA 1BR2A 3COAC 3BG9A 3HRSA 4IF4A 1A6QA 1I1GA 4HPQA 2WY7Q 4ESJA 1OJLA 2R7RA 2XHKA 3BR1A 1IN4A 3A01A 1RI7A 4LLLA 1KQ0A 2X1DA 5CVVA 3CD6I 2QM3A 2DA4A 3MKWB 4NHJA 2XAHA 3CTAA 4BY1J 1OMIA 5ILUA 5FFZA 4LLNA 1TWCJ 3FK7A 2BY2A 4CYCA 3NAUA 3OIOA 4ENKA 1EA3A 1XS9A 2FF4A 2JMWA 2R7DA 3RPQA 2O8KA 3LSPA 2UWMA 2BY3A 2XB0X 2ZB9A 4BYYA 2A61A 2K27A 1MMDA 2ZMEC 2QQ9A 3M9AA 1GXPA 2K9MA 1JUMA 4Y15A 2PX9A 2UXNA 2GIZA 2CQQA 3N97A 2WAQN 1XGSA 2IS4A 4LFUA 1B1BA 5HODA 3EYYA 1ZREA 1BOBA 5EG0A 4AYBA 1LE8A 1YW8A 4RLQA 1K6YA 3E5XA 2P5LC 3ZGKA 2A07F 3IH3A 2Y0MA 2IJLA 1J7KA 4C3JJ 1NH3A 4RAZA 4OINF 4RS8A 4YFXF 2W4SA 3PO3J 3CC7I 4PJJA 4ZYGA 1D3YA 5CVJA 4WX9A 1JGGA 2OD5A 3WGIA 2XAGA 1VQ5I 1B4AA 1RUNA 2HWVA 2QENA 1WJEA 4WXDA 3G2BA 4JX5A 4G94A 3C18A 5L3BA 2LR8A 3T1BA 3QAHA 2QKLB 4UUTA 4CCKA 4CCOA 3TO6A 2CMPA 2GQQA 3GUDA 1O7FA 1NHAA 2OF7A 4XRSG 4A6EA 1HKSA 4UUSB 1B72B 3DPUA 2MH2A 4IJAA 3PUBA 1XCVA 2CQXA 2UZKA 4RB3C 5C44J 3RKQA 3M3YJ 1FLIA 3I5UA 4OAYA 2V6CA 4AC0A 2BHZA 3PUFA 4A93J 2VPRA 4A69C 2EFOA 2E2IJ 2X0LA 1ZGWA 1YI2I 1MBEA 1Z21A 2QSFX 5DYMA 4A3EJ 1W7PA 1SD6A 1TT0A 1ZRFA 4DZJA 1FP2A 5FLMJ 2CFOA 1YIJI 2VKVA 1WCMJ 3S1RJ 1Y0NA 4H0EA 3A01B 1S29A 1OQYA 3F3XA 3C7JA 1XMXA 1T95A 2QQ8A 2R5ZA 4A12A 1KU3A 2X1CA 2OTJI 3F8NA 3P7NA 4CYCB 1ZARA 1JT0A 1H88C 4QPQA 4HZFA 3L2UA 1UG2A 4GXOA 2HQ5A 2K7LA 3PIPF 1QO0D 4EATA 4U87A 4LIUA 4ITVA 3JRDA 2B63J 3HSRA 1X3ZB 4MEYF 2HOAA 1S7AA 5AONA 3SDBA 4C2MJ 1MBKA 1IZ1A 3G1LA 2MC3A 3NWSA 1A6IA 1YLFA 1H89C 2JSCA 1ODDA 3BLYA 1ONVA 1ZGAA 2E1NA 1A04A 2D1HA 2LVSA 1MZBA 4EJWA 3I4NJ 2ID3A 4EM1A 1TWHJ 5EG0B 1LE8B 2EA4A 4ESFA 2X1EA 4DBQA 2FBKA 1DDNA 3K1MA 4YIRX 3D5LA 4XLFA 3W6KB 3FMQA 2IA1A 4IXAA 4EJUA 3IKVA 3PNVA 4K2EA 2BOLA 3BJOA 2P81A 2HQNA 3S3NA 1IN7A 3KPHA 5EEAA 2IS6A 2LY9A 5CQGA 1E3OC 5C3EJ 3PO2J 1S7EA 3LSJA 3BDDA 1GHCA 2KHMA 3H1CA 2BE5F 2FRHA 4XSXF 3KEOA 3JRAA 2GWRA 2VJ5A 3HOXJ 4G12A 2QYOA 2G0EA 4N4OB 5JVTA 2NXNB 3FIWA 1HKTA 4L9JA 5JHFA 4E7LA 1S3JA 3CCMI 1YRNB 4HYEA 1T33A 4BQNA 1T56A 3CCSI 2PJRA 3TOAA 5CKTA 3I56I 2VT3A 4I02A 2NVUB 2QUFA 5E1WA 3S1QJ 3ZQCA 1Z1DA 3DXJF 3M4OJ 1HQCA 2DMNA 2Q1ZB 4UVCA 4B1RA 2PMZA 4N9HA 1W7PB 2D5VA 2DA2A 1X3WB 2I5UA 3BR6A 4PFPA 1WH5A 3H36A 4DZPA 1P9QC 1X2NA 1Z3YA 2P6TA 3CUOA 3FXQA 4B4CA 5F1RA 1BR4A 3DCFA 5IPAA 3MAJA 1WSUA 4RB1A 3WG7H 4BQAA 5J40A 4H4KC 4LG3A 1FIPA 1VTNC 2R5ZB 2JZYA 1FTZA 1HXDA 4HG2A 4XM3A 3M1CA 3PQJA 5ICCA 3W6JB 4NC7A 4MFEA 3B6CA 3G3ZA 1V4RA 4CSWA 1HW2A 3I54A 4ENJA 2XUBA 4A6DA 2L2OA 4XRSA 1F9NA 1ETYA 3FBNB 1WWXA 1UHMA 3GMEA 4JX6A 4PJLA 2E71A 2FE3A 2A6TA 2UV1A 2KDOA 1N78A 3R61A 1BJZA 4NQWA 2WTEA 3HUGA 1X1CA 1IRFA 4BQOA 1USSA 3CQZJ 2RGVA 4EM2A 4J00A 3O8GA 4XLHA 1OKRA 2M1BA 2G7UA 3FXLA 2DPUA 4OIPF 3Q3SA 4UUVA 3K70C 3RSNA 1Z77A 1J5YA 2H6CA 3QPLA 2LSOA 5B66C 1YO5C 5FKKA 2V1XA 1W5TA 3DKWA 4MQ9F 3LFKA 2MD0A 4NC8A 2H09A 2R7TA 2HVQA 1YTYA 2WB1N 3K7AJ 4A3CJ 5K5RA
chains in the Genus database with same CATH topology
3MMYB 4MLOA 1PYVA 4XKVA 2ZSIB 3NWTA 1QHHD 3IAS2 3PNTA 2CV0A 1NG7A 2VQLA 2F4IA 1DGWY 3TMOA 2MYSA 3F9KA 3U21A 2IGNA 2PJRB 1WJFA 3OIQA 1GLNA 1YE9A 4CCMA 1DQUA 3QYEA 4CCLA 2WAEA 2VASA 2M0MA 2ZXHA 1MNEA 3SZGA 2VXDA 2WADA 3DWLE 3OIPA 4LIVA 3A1YA 3OWTA 4E7IA 2JUGA 3W2WA 3OYGA 3DKXA 1D0ZA 2V7FA 2DOAA 2WB1A 3OYHA 2IGMA 5KNLA 3D5SC 3M8JA 3OS1A 2Q2EB 1IRXA 2OC6A 3OR2C 4CCJA 3K70D 4E6KG 3S8PA 2ELJA 4CH7A 4XR6A 1X1DA 3ZQQA 1MMAA 4BL0B 3QYBA 2HVSA 1LVKA 2V9KA 4ZTFA 2HZDA 3HXLA 4F55A 4HNUA 2E60A 2AQEA 4BS9A 1WJBA 3DTEA 3OYIA 3BG6A 4JOMA 4PFOA 3PFYA 2CUJA 3S3OA 4KISA 3LL7A 1MW7A 2R7QA 2E1MB 3CZ6A 1D1BA 2K5CA 4P5OA 3S32A 4NQWB 3EUKL 3HUGB 3PSIA 1X1BA 3EUHC 3KX2A 4KJZA 2OV7A 3H9JA 2FUG2 2M7BA 2CW7A 3H9QA 4CCNA 4ZYAA 3W2VA 3W2AA 4ZDOA 2GOXB 1G59A 4XLCA 4BDZA 3TL4X 2BW3A 4BU2A 2LY1A 4XLAA 2VL8A 4D9JA 2HVRA 3HL2A 1OR7C 2KPMA 4B47A 4P1WA 2BVLA 3DU5A 4ZC3A 3S93A 4DIQA 2XF7A 3HC7A 1MNDA 2M3AA 3QODA 4Y3OA 4ANJA 4E7JA 4E7KA 3UNGC 3CP8A 3OYMA 4G6TB 3DPTA 1W36C 2NOJB 3OS2A 1SAUA 4RM2A 4BJ6C 2LRDA 1MMNA 3EPZA 5HOOA 2VLAA 2O5RA 2CV2A 3H0DA 4B48A 3FHNA 4XLEA 2JVHA 2IS2A 4XQFA 1ERDA 2R7WA 1UG0A 2VJIA 4BJ5C 2VQGA 3I9V2 2HQAA 4XORA 2I8DA 2IXSA 2V26A 2JSPA 4RMNA 4IQJA 2HPMA 2MFZA 2M4GA 4HSRA 2UUZA 1SFKA 4OWRB 3RTRA 2KMUA 2LYCA 1D1CA 4HRIA 4E7ZA 3BCBA 1LDKB 2LH9A 3SYTA 5HLTA 3L2VA 2KRHA 3LSGA 2R4GA 2L9NA 3GBGA 3LFUA 1U0JA 3OYCA 1WFXA 2VQHA 2K3PA 4LITA 2LOOA 2LC2A 4PSWA 1UAAA 3C2HA 4FASD 3AL0B 1OLTA 2DJIA 1VZ0A 3OMYA 4XN0A 4XONA 3AKZA 2W1OA 2A5WA 1E0EA 3E1SA 2OUMA 4CZCA 1UELB 2WA0A 1WJCA 1JI8A 2X6YA 3DLAA 1W36D 4BGDA 4ZJZA 3K4KA 2E1MC 3K4NA 4DJAA 1LKXA 3OYNA 4AU7A 1V5EA 2CH0A 1NG6A 1FMVA 1S9HA 2Y0SA 3CESA 4C9YA 5FRMA 3PL8A 5CQEA 3K6GA 1BR2A 2XF6A 4X0GA 4CA0A 3H9GA 3OL4A 1DGRM 2BW3B 1X4OA 3PNYA 2HNHA 4HPQA 2WY7Q 1KONA 1X19A 2WBMA 4E7HA 1X1AA 2M7AA 2RQQA 3OOUA 2XSJC 2R7RA 3VDXA 2X1DA 3FDYA 3MKWB 2VJ4A 2R7XA 2W7NA 3OYEA 2L5QA 2DXIA 1Y56A 3N05A 2DCEA 4IQ4A 1EA3A 3OYJA 2KLOA 4AVZA 1WJAA 3DQVC 2IGOA 3VSLA 4BACA 3LMMA 2UWMA 3DTKA 4B3XA 4E4HA 3LSIA 2KL4A 1MMDA 2HU9A 4PJMA 3HKZA 2K9MA 2Z16A 2X6XA 4XL9A 2HDWA 2QKMB 4KT6A 3W3CA 1T0FC 4BJTA 3OYKA 4DOZA 3A4CA 4R79A 2IS4A 3J7AY 2KRCA 3CF2A 4B43A 1BOBA 4AYBA 1DP3A 2KZVA 4BE0A 4N4NB 5LD2C 4RLQA 1K6YA 4RM3A 3H5RA 2ZSHB 3C2GA 4NUBA 3ZGKA 2R7SA 4RLFA 1BR1A 4HEA2 4ZTJA 3BC8A 5KCMA 3DKYA 2MABA 2W4SA 4PJJA 4YELA 4DGWB 2LG4A 2F6CA 1YX3A 3HOTA 2KQRA 2MC4A 1N75A 2L9SA 3K4CA 1WJEA 5HNFA 4NNJA 3G2BA 3UR3C 1N77A 3OYAA 3D5RC 1YX5A 2V6EA 2QKLB 4CCKA 1Z7LA 3ZR8X 2WAQA 4CCOA 4IX7A 2CMPA 2LY2A 4II3A 2KP6A 3AL0C 3VYRB 3QOEA 4DBRA 3DPUA 1V5GA 3VSKA 3PUBA 2LBFA 2W82A 4BE2A 4OAYA 2XDVA 3BCAA 4YRVA 3IAM2 4XKBA 3VYSB 4IZZA 2JA2A 3VWBA 2CUZA 2Z2SB 2VPLA 3CMMA 1Z21A 4BE1A 3L2QA 1TT0A 2VJJA 2ZFUA 4HSTA 2X85A 2CFOA 2VXZA 1WJ5A 2XC7A 2V4JC 2DT7B 3DU6A 3ZCOA 1T95A 4ZDPA 3VYUB 2X1CA 5TGTA 3SEQA 4BDYA 5CPRB 2CW8A 3K4LA 3K4MA 4XNFA 2LREA 2CV1A 2VKHA 5FRNA 3ONQA 4QPQA 3L2UA 3KEYA 4GRIA 3OYFA 2K9LA 3HPHA 4C30A 4D1QA 5KHDA 4EATA 4U87A 4Y4RA 4LIUA 4ITVA 4XKCA 3OYLA 2M4KA 2XF5A 2R7UA 3L2WA 3SDBA 2W00A 2AQFA 2ZXIA 3SEZA 4BEHA 4PK4A 3NWSA 1Z3XA 2HPIA 4KITB 2IS1A 3BLYA 3RPUD 3DEEA 4Y33A 1V5FA 4FETA 2X1EA 4E7SA 1ZELA 4DBQA 4U7BA 1PJRA 1WJDA 2F5VA 3D5LA 4OAZA 2X51A 4XLFA 1D0YA 3HPGA 3PSFA 1QU3A 4PJNA 3ZRGA 4XOPA 3A2KA 3PNVA 4F3QA 2BOLA 3MKYB 3S3NA 2GOMA 1MMGA 4PUSA 3CP2A 5FROA 4F93B 2IS6A 1AA7A 4BUPA 4YEJA 5CQGA 3OY9A 3LSMA 4PSXA 2VIXA 3OS0A 2KHMA 3OYBA 4F52A 3OYDA 3RQ4A 2IGKA 2VJ5A 4N4OB 4BXFA 2Z1DA 1D1AA 3IP4B 4HNTA 3TBIA 4II2A 3OR1C 5JHFA 4E7LA 4BQQA 3ZXSA 1D0XA 5HVQC 3QYFA 4BQNA 4XKWA 3DTIA 3L2RA 2PJRA 2LBFB 2BVMA 5CKTA 3V42A 2R7OA 1R6RA 3MD2A 2R7VA 4ZDLA 3DPLC 2Q1ZB 4CUGA 1FMWA 2PMZA 3PJRA 4PFPA 1P9QC 1Z3YA 2VQCA 4F91B 2RREA 1X4PA 3E0JB 1BR4A 2L7KA 2WAFA 3KYLA 3H35A 4H4KC 4LG3A 2VB6A 3VYTB 3IUOA 4HG2A 4XM3A 2JVGA 3K10A 1LFPA 3M1CA 3LSHA 2RNGA 1J09A 4NC7A 2E5NA 4IKFA 4CSWA 1TZLA 2L2OA 3OL3A 5HNHA 1G8XA 3FBNB 2DT6A 2X6WA 3H5NA 4PJLA 2VKDA 2A6TA 2UV1A 2KDOA 4C2UA 1N78A 4F92B 4BEHB 1X1CA 3I3LA 4BQOA 4C2TA 3K4JA 4J00A 3AFHA 4XLHA 4J01A 3CJQB 3H5AA 1HA8A 5LFAA 3CJRB 3K70C 3RSNA 2P0WA 2CS3A 2E5ZA 3RCOA 4JQFA 4XN3A 2XAUA 3BG7A 4QPOA 4B44A 3K4BA 3MKZA 2V1NA 3S3MA 2MD0A 2WY8Q 4NC8A 3HOSA 3LSKA 1QHGA 3HG9A 3FKJA 3EUAA 4XOTA 2R7TA 2HVQA 4XMYA 1Y6IA 3FBIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8J A;  2W7N A;  5CKT A; 
#chains in the Genus database with same CATH topology
 5BOX A;  4XRF A;  4Q47 A;  1PYV A;  2Y9Z A;  1RR7 A;  4IHT A;  3S16 J;  4XKV A;  5E1Z B;  3I64 A;  1VI0 A;  2P5V A;  3KIO A;  5J4Y A;  2TCT A;  1NG7 A;  2F4I A;  2VBX A;  4EGY A;  1T0F A;  1RPW A;  2MYS A;  2BGC A;  2NVY J;  2IBD A;  4CGZ A;  2PJR B;  4M3B A;  1T38 A;  2WAE A;  2VAS A;  1VQP I;  3MQ0 A;  4M3E A;  1R4N B;  2ZXH A;  1FC3 A;  3SZG A;  2EIJ H;  3W2W A;  1D0Z A;  4CZZ A;  5KNL A;  3D5S C;  3WTS C;  2QA4 I;  3M8J A;  3HKZ N;  2MGQ A;  5KAF C;  4BAY A;  2OC6 A;  3OR2 C;  4CCJ A;  3K70 D;  4A3F J;  4E6K G;  2IA0 A;  2ELJ A;  4CH7 A;  5FB2 A;  2L7M P;  5E3O A;  2HXI A;  4PGH A;  1MMA A;  4BL0 B;  3A0H C;  2V9K A;  1H0M A;  2JJ7 A;  2E60 A;  2AQE A;  4KT5 C;  4MHG A;  3TO7 A;  1V3F A;  2STW A;  1QPI A;  4LGW A;  3FXJ A;  1UB9 A;  4XBF A;  2BEO A;  1ZR4 A;  4Z2Y A;  4KIS A;  3KCC A;  3CCV I;  3GXO A;  2O03 A;  3HGY A;  3CZ6 A;  4I76 A;  3BG3 A;  3HSF A;  3S15 J;  2K5C A;  2DFH A;  4NQW B;  5F04 A;  3O2P E;  1SVO A;  3HUG B;  3LST A;  4M73 A;  5BQT A;  4AIK A;  2V1D A;  3LQR A;  3K2Z A;  2X4H A;  1KYZ A;  4G9Y A;  2Z99 A;  2HFH A;  1JT6 A;  2FUG 2;  5F0C A;  2M8G X;  5FLX K;  2H94 A;  3W2V A;  4CCN A;  4ZDO A;  3P5J A;  1G59 A;  2KJC A;  3JRE A;  1JGS A;  3HEF A;  4BDZ A;  1FYM A;  3A0B C;  3FXR A;  1KU7 A;  4BU2 A;  5GTH C;  5LBQ A;  5E17 F;  2LP0 A;  1UMQ A;  2LY1 A;  2VL8 A;  5GTI C;  1EKE A;  2CFX A;  2EZH A;  4JP0 A;  4P1W A;  5H6R A;  2HQR A;  3QOP A;  2XF7 A;  4KN4 X;  3GZN B;  1MGT A;  4Y3O A;  2BBY A;  1ZK8 A;  4MTE A;  1Q1V A;  2H27 A;  5FLX Z;  1TQI A;  1Z9C A;  3EYI A;  5ICG A;  4E7K A;  1EF4 A;  1UFM A;  1YG2 A;  5JLX A;  1HBX G;  2QSG X;  2COB A;  2VOD A;  2EZK A;  1WKM A;  2JA5 J;  1W7P D;  3D0S A;  5CLS A;  2ME6 A;  1GUU A;  4M74 A;  2XVC A;  4UHT A;  3AG2 H;  2BZT A;  3V7S A;  2EFQ A;  3WTY C;  3GF2 A;  2LRD A;  2QWW A;  2MG4 A;  4EJO A;  2R3S A;  4G8X A;  3VB2 A;  4B48 A;  3ECO A;  3FHN A;  4XLE A;  5FKN A;  2JVH A;  1GV2 A;  1ERD A;  2R7W A;  4G7O F;  2YUS A;  4WXH A;  2OBP A;  1PUE E;  3I9V 2;  4XOR A;  3GTP J;  1D5V A;  2IXS A;  2YPR A;  2P5K A;  1DP7 P;  1FP1 D;  1Z6T A;  4EVI A;  4HSR A;  3JTG A;  3JRB A;  1U6G A;  2F5E A;  5GP9 A;  5DM7 F;  1YIO A;  4EEF G;  1IXC A;  2DDA A;  4E7Z A;  3KP4 A;  1LDK B;  1GVD A;  2ID6 A;  3ZMZ A;  5HLT A;  1RR8 C;  4IL6 C;  4U88 A;  3ERM A;  5KK1 A;  2KRH A;  5J4V A;  2E2J J;  3LSG A;  3SHF A;  2R4G A;  4GO1 A;  3GW2 A;  4L9V A;  3LAJ A;  1FT9 A;  3IRQ A;  1WFX A;  3GFJ A;  2X48 A;  4HF0 A;  3IRR A;  4LIT A;  3GWZ A;  2LC2 A;  3IH2 A;  3TED A;  5FO5 A;  1B9N A;  3C2H A;  1W5S A;  2STT A;  4XN0 A;  1KA8 A;  4XON A;  3AKZ A;  2XSD C;  3CDH A;  1UHS A;  1PUF A;  1BW5 A;  1O7L A;  4B09 A;  2OUM A;  1UEL B;  3BOQ A;  1WJC A;  1JI8 A;  3EQL F;  2X6Y A;  3DLA A;  1IRZ A;  4ZJZ A;  1WRJ A;  2YR2 A;  1ON1 A;  1FMV A;  2Y0S A;  4Y17 A;  3SZT A;  1OCT C;  1WZ2 A;  4IOA F;  1R9T J;  3V8L A;  3PL8 A;  3HRU A;  5IOZ A;  5HDN A;  5CQE A;  3K6G A;  1F4K A;  4GDF A;  5F6F A;  2O3F A;  2COM A;  3GTM J;  2JRT A;  3LAP A;  2JA8 J;  1XGN A;  2FBH A;  1S7O A;  2GA1 A;  1FBU A;  1OPC A;  1FOW A;  1X4O A;  1JJ6 C;  3ZQL A;  1LB2 A;  1IV6 A;  3LA7 A;  1KON A;  1X19 A;  4E7H A;  1U78 A;  1TWG J;  1X1A A;  2M7A A;  2FEZ A;  1HOM A;  3SJM A;  1Z0X A;  3HTS B;  3ZN0 A;  4LD5 A;  1FOX A;  4GGG A;  2FQ3 A;  1L0O C;  2QCO A;  3FDY A;  5D4R A;  1DU6 A;  2R7X A;  2CO5 A;  2EIL H;  4RB2 C;  3OYE A;  1VFC A;  2HTJ A;  3P9C A;  2DXI A;  2MBF A;  4LK0 F;  2DCE A;  5H6Q A;  2M0C A;  1YJ9 I;  2WV0 A;  2MSY A;  2KLO A;  2N8G A;  2EIM H;  2PI0 A;  2E1O A;  3HB9 A;  3VSL A;  1Y1W J;  5E18 F;  3OSG A;  3LSI A;  2DOF A;  4QSH A;  2XKO A;  2HU9 A;  5JFR A;  6PAX A;  4MEX F;  1FOY A;  2NNN A;  4XL9 A;  2HDW A;  1SMT A;  2QKM B;  3HRT A;  2ETH A;  4BHC A;  2IRF G;  4NBQ A;  1T0F C;  1UCR A;  5K1Y A;  4DOZ A;  1N25 A;  1BBY A;  3A4C A;  4AWX B;  4R8H A;  4XIC A;  1RC9 A;  2LTP A;  1F43 A;  2K85 A;  1WGX A;  1K7A A;  2PLY A;  2HYJ A;  2KZV A;  4C3I J;  4BE0 A;  3IV5 A;  5LD2 C;  2NYX A;  1K61 A;  3I71 A;  1B9M A;  1HSJ A;  2ZO4 A;  3C2G A;  5TIS C;  2R92 J;  1APL C;  4D7M A;  4HEA 2;  4ZTJ A;  2RQP A;  3BC8 A;  1MH4 A;  1J0R A;  4A3D J;  2J5P A;  4WF2 A;  4YEL A;  5L3F A;  4DGW B;  2LG4 A;  1IG7 A;  1JKR C;  2WV1 A;  2L4M A;  4UB8 C;  1JE8 A;  2Y30 A;  2HTS A;  2L9V A;  2L9S A;  3KFW X;  5HNF A;  3EET A;  4GYI A;  1FZP B;  3OYA A;  1P4X A;  5A2Q K;  2XPU A;  3WU1 B;  1PUF B;  2WAQ A;  2LY2 A;  2XB5 A;  2LNB A;  4II3 A;  4M71 A;  1C0W A;  2W85 A;  2HZT A;  2A5Y B;  1OYW A;  1R4M B;  4FT8 A;  3R6S A;  3BQY A;  5DV5 A;  5E8I A;  2LBF A;  1AHD P;  4I98 B;  2XAJ A;  4BE2 A;  5IP9 J;  1WHU A;  5F64 A;  1RES A;  4RAG A;  1SC7 A;  4XKB A;  5A2Q Z;  3CMM A;  1KU2 A;  3WG9 A;  2DYS H;  3JRG A;  3KP3 A;  2XC7 A;  2ECB A;  2DT7 B;  5ILS A;  3U2R A;  4FQG A;  3ZCO A;  1ZG3 A;  3VYU B;  4W97 A;  2F5D A;  3FKI J;  2M34 A;  3TO9 A;  4IHV A;  2CW8 A;  4XNF A;  4P9U A;  2PJP A;  2LRE A;  1QPM A;  5FRN A;  1JKP C;  5EEH A;  3KEY A;  3R60 A;  2XGE A;  4UY8 I;  4C30 A;  3TW6 A;  3ZP5 A;  2QSH X;  3OYL A;  4YII A;  2XF5 A;  4BBR J;  5LGU A;  1EV7 A;  4D7N A;  2RNJ A;  4J19 A;  2VC0 A;  5ICF A;  2AQF A;  2ZXI A;  3JSO A;  1RKW A;  1UHW A;  4PK4 A;  4DYQ A;  3GTG J;  4UV9 A;  3W6V A;  4HQE A;  4AID A;  5GAH J;  3KP5 A;  2DAO A;  2A6E F;  2AO9 A;  1GT0 C;  2DFF A;  2ACJ A;  1T2K A;  2DLL A;  3DEE A;  3IKT A;  1ITY A;  1Q1H A;  1V5F A;  4KMU X;  5D8L B;  1CQT A;  1YW9 A;  2F5V A;  2X51 A;  4BXU A;  1ZHF A;  3ML6 A;  3RKX A;  3ZRG A;  3RKY A;  2EFW A;  3A2K A;  4F3Q A;  4Y13 A;  3KZY A;  4I7H A;  3MKY B;  4M9X A;  2OZ6 A;  2EBI A;  3CP2 A;  5FRO A;  2DA1 A;  3G71 I;  3HBL A;  3OY9 A;  1OCO H;  3D1N I;  3ZN1 A;  3OS0 A;  3E5U A;  4XID A;  1ZAO A;  3WTX C;  1BIB A;  3OYB A;  2BYV E;  1FTT A;  4JK1 X;  5BS6 A;  3O3K A;  2JPB A;  2NOG A;  3WOD F;  4Q4Z F;  2GA2 A;  4BXF A;  2Z1D A;  5BPD A;  3CUQ C;  3IP4 B;  1FSE A;  1U2W A;  3K1P A;  1SFO J;  2ME0 A;  1XSV A;  3OR1 C;  5CVI A;  1J9I A;  2D1V A;  4YG2 F;  1KYW A;  3HYI A;  1IJW C;  1K4S A;  2LBF B;  1YS7 A;  2CUE A;  5F27 A;  2LKS A;  2PBI A;  2OCE A;  1I1S A;  2OJE D;  2R7O A;  3GFL A;  1R6R A;  2EIN H;  3KLO A;  2ICW G;  2L4A A;  3OOP A;  1IUY A;  2BY0 A;  3GZ5 A;  3DBR B;  3RKW A;  3F21 A;  1W0T A;  1LNW A;  3R4K A;  2O6G E;  5E1X A;  3JRH A;  5DD8 A;  5M5X J;  1RUO A;  1YQA A;  2CYY A;  1R23 A;  1GV5 A;  3DEU A;  3K10 A;  5IYB J;  3HOZ J;  3KLN A;  2K9S A;  1LEB A;  2QVO A;  3HM5 A;  2A05 A;  3GO5 A;  4FE7 A;  1S8N A;  5IOY A;  4M6V A;  1K79 A;  1KQ9 A;  2LFB A;  2YS9 A;  1O3T A;  3J7Z I;  1YRN A;  3FF5 A;  4Q48 A;  4FIS A;  1XSD A;  1BM9 A;  5LGT A;  4A3K J;  1G8X A;  2DT6 A;  3U1D A;  4UVB A;  4PDK A;  5CVU A;  1B59 A;  2LLK A;  3RYR A;  4C2T A;  5D6E A;  2CQ7 A;  4UB6 C;  3WTV C;  3H5A A;  2W84 A;  3K0L A;  3ZQI A;  5J1Y A;  3JR9 A;  2JA6 J;  2DA5 A;  2PFB A;  4QWQ A;  3TP0 A;  1XPX A;  3HIF A;  5GAD J;  2E34 A;  2P0W A;  3GFI A;  3RCO A;  1LUJ B;  3WHB A;  4IOC F;  4JQF A;  4XN3 A;  5FD6 A;  4B44 A;  3K4B A;  4KA4 A;  1OCR H;  2DDB A;  3JSP A;  3AAF A;  4IRI A;  2HI3 A;  4KFC A;  1FOK A;  3CCQ I;  2CG4 A;  2RN7 A;  4D0P A;  3TOB A;  4BHB A;  3FKJ A;  4EV0 A;  2IT0 A;  5GAE J;  5FKL A;  2BXZ A;  2FSW A;  4XMY A;  4HF2 A;  3HTU A;  3FBI B;  5FKM A;  3SDG A;  2F4O B;  5BMZ A;  3RZO J;  1JUP A;  3L7W A;  4ZYE A;  2R0Q C;  2ZSI B;  2AHQ A;  1B6A A;  1YFH A;  1RKT A;  2Q8K A;  3PNT A;  2ECC A;  4M3F A;  1PP8 F;  2CV0 A;  3TKY A;  1R5G A;  1I27 A;  2HXO A;  2VUM J;  4XK4 A;  2ADU A;  3U21 A;  4IO9 F;  3ZQG A;  1IN6 A;  3Q9S A;  3T8T A;  4CXF A;  1GLN A;  1YE9 A;  4JYK A;  1DQU A;  4HNV A;  3MVP A;  4RGR A;  5H2F C;  4FX4 A;  2VXD A;  3DWL E;  3OIP A;  3A1Y A;  3E5Q A;  3OWT A;  3TGN A;  2DJN A;  5EZH A;  4YIF A;  3OYG A;  3BTJ A;  1R5I D;  2V7F A;  2WB1 A;  2B9S A;  3U9G A;  3I53 A;  5F08 A;  4X6A J;  3L1P A;  5HDG A;  2LF8 A;  5L3D A;  4CYD A;  1BI2 A;  4P96 A;  5J6X A;  3DP7 A;  4XR6 A;  3CLQ A;  3ZQQ A;  4DNC A;  3N4M A;  1IV8 A;  3QYB A;  4D5F A;  1LDJ A;  4B3A A;  4OOI A;  3HDD A;  4AYB N;  1TTY A;  4F55 A;  4Z6Y A;  3FHZ A;  1NK3 P;  1WJB A;  3DTE A;  1FBQ A;  4AVP A;  4JOM A;  4PFO A;  1DPU A;  1ZRD A;  5FKO A;  3A03 A;  1YW7 A;  1STZ A;  2ESN A;  1MW7 A;  3FXU A;  2E1M B;  2BV6 A;  1D1B A;  1XD7 A;  4U0W A;  1Y39 A;  4EQQ A;  1X1B A;  1HLV A;  1QZY A;  3KX2 A;  2NS7 A;  1F36 A;  1IXS B;  3CC2 I;  3H9Q A;  1LFB A;  1QVT A;  5EYR A;  2L9R A;  3W2A A;  1CGP A;  2M45 A;  3KZZ A;  3ROU A;  4XLC A;  1S72 I;  2KKO A;  5JLW A;  1AU7 A;  2BW3 A;  2HKX A;  3BWG A;  5AIQ A;  2JRM A;  1R71 A;  3HL2 A;  3ZMU A;  5E3L A;  2BVL A;  2LKP A;  2XAS A;  4DIQ A;  3CME I;  4MNU A;  1T39 A;  3QOD A;  4RAF A;  2KIU A;  3CC4 I;  4E7J A;  4HAM A;  4RAY A;  2B0L A;  3CP8 A;  1TW3 A;  2QEX I;  2V1U A;  3WTU C;  3OS2 A;  2HYG D;  1FEX A;  3BG5 A;  2MD5 A;  3EPZ A;  4A5M A;  2VLA A;  1IN5 A;  2CV2 A;  4ASN A;  5JI6 A;  3WGH A;  4HA8 A;  1E3P A;  3UKG A;  4PZJ A;  2OCC H;  4QTR A;  2R5Y A;  2H6B A;  1JJ8 C;  2IS2 A;  4LG0 A;  2EPF A;  1RIO H;  5LRR A;  2VJI A;  2FOK A;  1BOA A;  1QRY A;  2EB7 A;  2VQG A;  3HZJ A;  3SFI A;  5LEK A;  1VND A;  2V26 A;  3E6C C;  3F8C A;  1U8R A;  2Y48 A;  4IQJ A;  1TNS A;  3FXO A;  2X9D A;  2XKP A;  1DPR A;  1MDM A;  4MQV A;  3HGG A;  1SFK A;  5HS7 A;  4CDG A;  3J81 K;  3PM1 A;  3RTR A;  4KYW A;  2DK5 A;  3ASO H;  2HYF A;  4ENN A;  2HR3 A;  3ZMT A;  5M3M J;  1A36 A;  3BCB A;  3V8J A;  2JT1 A;  3HOV J;  1ZKG A;  1JHF A;  3L2V A;  1ENH A;  2L0K A;  5K7F A;  2FXA A;  5BNG A;  2FJ1 A;  5IT9 K;  1EH6 A;  3MZY A;  1Y1V J;  2RKH A;  2NS8 A;  2XPW A;  1YIT I;  1ZN2 A;  3BR2 A;  3TDZ C;  2PMU A;  3OMY A;  5DCM A;  1T6S A;  3WTT C;  3U1K A;  3JRI A;  3F8F A;  4KNY A;  2A5W A;  2ZJP F;  4M6X A;  2DOD A;  5M3F J;  1XMK A;  4KMF A;  2DQL A;  1RZ4 A;  2E1M C;  3K4N A;  3BY6 A;  1LKX A;  3OYN A;  5IT9 Z;  4AU7 A;  2CH0 A;  3CES A;  1S9H A;  4C9Y A;  5IYC J;  1AKH A;  4UNO A;  3GTO J;  1NK2 P;  1TT5 B;  3GVA A;  4X0G A;  4CA0 A;  2EZL A;  2KDZ A;  4HLY A;  3H9G A;  1G4D A;  1TQP A;  1UJ8 A;  2MH9 A;  1DGR M;  2BW3 B;  2HOS A;  4NC6 A;  4HBL A;  5D5U B;  5IYD J;  3PNY A;  1TWF J;  4MIM A;  1O3Q A;  1IUF A;  3B6A A;  2EA2 A;  1O57 A;  1YHQ I;  2RQQ A;  3OOU A;  2F5F A;  4L5J A;  2R7Z J;  2QF7 A;  2V9P A;  2LKX A;  4L18 B;  2R93 J;  3P9I A;  2VJ4 A;  2W7N A;  1FX7 A;  2ZNY A;  2K40 A;  1LEA A;  3VOE A;  3N05 A;  5IT3 A;  2O0Y A;  3GEZ A;  5K7Z A;  3BP8 A;  1F5T A;  4BBS J;  2PMZ N;  3RYP A;  4AVZ A;  1WJA A;  1GVJ A;  3DQV C;  1HST A;  2IGO A;  4PCQ A;  3VOD A;  3DTK A;  2TRT A;  5J1U A;  3QWL A;  2EWN A;  2KL4 A;  5DUI A;  4RGU A;  2RV8 A;  5DUK A;  4WXC A;  4PJM A;  1K6O A;  2R5Y B;  4BNC A;  2Z16 A;  1SFU A;  4LG0 B;  3J7A O;  3GX4 X;  4KT6 A;  3W3C A;  4BJT A;  5H20 A;  2Z33 A;  3J7A Y;  2E7W A;  2JUC A;  3CF2 A;  4B43 A;  3F0C A;  4BKX A;  1MDM B;  3GFM A;  1PDN C;  2ZSH B;  1JUS A;  2M30 A;  4NUB A;  5FGM A;  1VQK I;  3MZ8 A;  3NAR A;  1QGP A;  1IW7 F;  1OCZ H;  2M8E A;  5KCM A;  1FYK A;  2MAB A;  3IH4 A;  3PIO F;  2E1C A;  2ZFW A;  5M5Y J;  2B7E A;  4I2O A;  2D45 A;  4MGR A;  5ILV A;  2CQK A;  4A0Y A;  1HW5 A;  2Y9Y A;  3M8F A;  3WHC A;  1HC8 A;  1YX3 A;  2HS5 A;  2FNP A;  3HOT A;  2HEO A;  1T8I A;  2MC4 A;  2VON A;  2OA4 A;  3K4C A;  3FK6 A;  4NNJ A;  2MW8 A;  1WPK A;  1N77 A;  1U8B A;  5IP6 A;  2VE8 A;  3ZQF A;  5DCM B;  2RAE A;  1Z7L A;  3ZR8 X;  1YYV A;  3LA3 A;  1W1W E;  2KP6 A;  2YX4 A;  2EIK H;  3VYR B;  2G7H A;  3QOE A;  3M1E A;  2F2E A;  1AWC A;  5HLH A;  4ZZL A;  3F22 A;  1VQ8 I;  2Y2Z A;  2XPV A;  2XDV A;  3BCA A;  3MCZ A;  3TQN A;  1AKH B;  3IAM 2;  1JKQ C;  1WQ2 A;  4IEJ A;  3VYS B;  1J59 A;  4IZZ A;  1E2X A;  2EV5 A;  2DPD A;  3QU6 A;  2VPL A;  4BE1 A;  2Y31 A;  3LA2 A;  1SD5 A;  2VJJ A;  4HST A;  2GBY A;  2X85 A;  3S2D J;  5J3L A;  3HOU J;  3ABK H;  1FY7 A;  5E3M A;  3IC7 A;  4WWC A;  3DU6 A;  2NVX J;  2IW5 A;  2M9H A;  1GDT A;  3NRV A;  1VQM I;  5D8K B;  4KIF A;  3CUQ A;  3JAM K;  2PQ8 A;  4U7D A;  2RC4 A;  1HF0 A;  3SEQ A;  1DU0 A;  4BDY A;  5CPR B;  1KGS A;  3K4L A;  3K4M A;  4V2F A;  2L54 A;  1IN8 A;  3C3W A;  1P4A A;  2JK3 A;  1JKO C;  5CVR A;  3OYF A;  2K9L A;  2K9Q A;  4D1Q A;  1L3L A;  5KHD A;  1ZTR A;  4Y4R A;  4U0Y A;  4XKC A;  2A69 F;  1BI1 A;  3J80 K;  2W00 A;  1G3T A;  4BEH A;  1JTY A;  3O6B B;  3JAM Z;  1CF7 A;  2DTR A;  4OU0 A;  5FLV A;  1MNM C;  1MJ9 A;  2IS1 A;  4PJ0 C;  1MJA A;  2FML A;  3GZ6 A;  3BR3 A;  2VN2 A;  4AIH A;  4N0B A;  2NAZ A;  2VOP A;  3R0J A;  2FNA A;  4FET A;  4E7S A;  1ZEL A;  3H3Z A;  1XX5 A;  5LGN A;  4U7B A;  4OAZ A;  2QLZ A;  1IDY A;  1D0Y A;  3HPG A;  4KN7 X;  5L3E A;  4L0Z B;  1QU3 A;  3J80 Z;  4XOP A;  1Z05 A;  2OZU A;  5J1R A;  3FIS A;  2XIG A;  3ZMS A;  3CCY A;  1BI3 A;  4AIJ A;  4PUS A;  4LB5 A;  4F93 B;  2NVQ J;  1AA7 A;  4BUP A;  2X6O A;  4YEJ A;  3LSM A;  1K83 J;  4PSX A;  2C6Y A;  4ETS A;  5L3C A;  4UVA A;  1IXR C;  1RNL A;  5ICE A;  2CQN A;  3KEQ A;  4IPA A;  4HNT A;  3C2B A;  1TC3 C;  2XGX A;  3ZXS A;  2YX7 A;  1IDZ A;  1BC8 C;  5HVQ C;  4JX4 A;  2DMT A;  3QYF A;  3RQI A;  4XKW A;  3ZMD A;  1POG A;  2V9V A;  1QA6 A;  3S2H J;  3DTI A;  2CUF A;  2GM4 A;  4IVN A;  2V79 A;  3FZV A;  3MD2 A;  3QP5 A;  3T0Y A;  4XLN F;  4RGX A;  2R7V A;  2EQR A;  2PN6 A;  3CF5 F;  4CUG A;  4P9F A;  4M3D A;  3PJR A;  3HHH A;  4RBO A;  1G3Y A;  2CRG A;  2VQC A;  1R1T A;  1X4P A;  3E0J B;  2Q2E A;  4HX8 A;  2ZC2 A;  1PP7 U;  2L7K A;  3ABM H;  2WAF A;  5D4S A;  5JVG F;  1IO2 A;  4O3M A;  3CUQ B;  5F0F A;  3VYT B;  5EF6 A;  5FJ8 J;  4I6Z A;  3LSR A;  3TW7 A;  1OCC H;  1VQL I;  1XTA A;  1Z67 A;  1H9T A;  5D6F A;  2E5N A;  2OPT A;  1P6R A;  5D5W B;  4M9S A;  3F6V A;  1HDP A;  3ZQH A;  2F5C A;  5HNH A;  5LLQ A;  1MBG A;  2GXB A;  4A2U A;  3A02 A;  3H5N A;  2VI6 A;  5IY5 H;  1X1P A;  2J5O A;  4C2U A;  1P7J A;  4BEH B;  1MKM A;  4WCG A;  3JW4 A;  1CF7 B;  3K4J A;  3WE2 A;  3AG3 H;  4BH9 A;  1HA8 A;  2MLK A;  1WI9 A;  5JR3 A;  1R5H A;  3CJR B;  2FU4 A;  1AOY A;  2PMH A;  2E5Z A;  5TRD A;  3I4M J;  3G1O A;  3BG7 A;  2CSO A;  3QRF F;  2Z5U A;  4S05 A;  1R22 A;  4L0Y B;  2LMD A;  2V1N A;  1TLH B;  3S3M A;  3QPS A;  4L5E A;  1ZH5 A;  4I99 C;  3GYH X;  1R58 A;  2WY8 Q;  3DBL B;  4L9N A;  1F1Z A;  3HG9 A;  2IA2 A;  3BJ6 A;  3BZ6 A;  1XGM A;  2K3F A;  2OQR A;  2F4M B;  2I10 A;  2VBZ A;  1Z7U A;  2QGU A;  2PEX A;  3EDP A;  1IGN A;  2XAQ A;  1QHH D;  2F48 A;  3NWT A;  4NDL A;  2W25 A;  2VQL A;  4JBA A;  3TMO A;  3KZI C;  2GIV A;  3P9K A;  2IGN A;  1I3Q J;  2FOW A;  2JPC A;  2K86 A;  3F8B A;  3Q9V A;  1MSE C;  1XN7 A;  2BHY A;  3OIQ A;  4QLC U;  3GTQ J;  2KIM A;  4CCM A;  2OTL I;  3FXM A;  3CCL I;  1XDS A;  3E6B A;  2M0M A;  4MO7 A;  5K5Q A;  2ZBK A;  2WAD A;  4LIV A;  5LHG A;  4G7H F;  4DYR A;  4E7I A;  1K78 A;  3GTK J;  2ELK A;  1BC7 C;  2BXY A;  1A31 A;  5CYV A;  1FBS A;  1MBH A;  3ZQ7 A;  1ZR2 A;  4OIQ F;  1ZLJ A;  3BTL A;  3MFK A;  3OS1 A;  3JCU C;  2Q2E B;  2O9L A;  3Q5F A;  4A0Z A;  1IRX A;  3CCJ I;  3S14 J;  4PGG A;  3S8P A;  2Q0O A;  3ISP A;  3SFZ A;  3S1M J;  3I55 I;  3QU3 A;  1MMS A;  1U9O A;  2DK8 A;  1A5J A;  2ZKZ A;  4ZTF A;  4KIC A;  4HNU A;  2FQ4 A;  2OQG A;  4BS9 A;  2BY1 A;  3BG6 A;  3RPU A;  3JRC A;  3PFY A;  4O5V A;  3ERE D;  2JN6 A;  2CUJ A;  3E97 A;  4O6J A;  2DN0 A;  5C4J J;  4HOB A;  4P5O A;  3S32 A;  3EUK L;  4EJV A;  3ZPL A;  3SQN A;  3JRF A;  5D5V B;  3EUH C;  1S6L A;  4KJZ A;  2OV7 A;  3H9J A;  2H1L A;  2Y75 A;  3AG1 H;  1X2M A;  2DFI A;  4ZYA A;  2GOX B;  3F6O A;  3CO7 C;  4P55 A;  1NTC A;  4CHU A;  1ZQ3 P;  1VF9 A;  4D9J A;  1MSF C;  1XG1 A;  4LJZ F;  5EZG A;  2LK2 A;  4B47 A;  4ZC3 A;  1SAN A;  2XV4 S;  2TDX A;  3HC7 A;  1MND A;  3MN2 A;  2M3A A;  1G2H A;  5B1A H;  5IP7 J;  4FCY A;  2GLO A;  1K4T A;  2GXG A;  5CJ9 A;  5L3G A;  3GLL A;  3F23 A;  3UNG C;  4KDP A;  1R1V A;  3KP7 A;  2DU9 A;  3CCR I;  2EFP A;  3GTL J;  4G6T B;  3S17 J;  3L9F A;  1SAU A;  5J8F A;  5B5E C;  2DOE A;  4BJ6 C;  1MMN A;  2VC1 A;  1HW1 A;  1WH7 A;  1FJL A;  3HOW J;  1P4W A;  4RB0 A;  2DFE A;  4NB5 A;  4XQF A;  1QZE A;  4BJ5 C;  4GYG A;  4A3I J;  2RVC A;  1LQ1 A;  1SFE A;  3E6D A;  2I8D A;  1T08 B;  1Z91 A;  4RMN A;  3OV8 A;  2HOT A;  3DF8 A;  2M4G A;  1K78 B;  5JHU A;  2UUZ A;  1P92 A;  4UV8 A;  3L00 A;  2NRA C;  2LYC A;  2VBY A;  1D1C A;  3CDL A;  1O3S A;  4HRI A;  2NS0 A;  2HOE A;  1TBX A;  1ON2 A;  1RET A;  1T98 A;  4HDV A;  1X58 A;  1EH8 A;  3SYT A;  4N9I A;  1MD0 A;  3FXK A;  4V2G A;  5KAI C;  1BIA A;  3RJP A;  3J7Y J;  3H3V K;  4WK8 F;  3GBG A;  3LFU A;  4HW0 A;  3H92 A;  2VQH A;  3I58 A;  3CJT B;  3BJA A;  2HKO A;  4FX0 A;  3PFI A;  2LOO A;  3KET A;  4PSW A;  4EGZ A;  2LD5 A;  1RRJ A;  1Z6R A;  1V55 H;  4FAS D;  3AL0 B;  1OLT A;  2DJI A;  4YFK F;  1VZ0 A;  1IAW A;  4OIO F;  3V4G A;  3ABL H;  2XGD A;  1BW6 A;  5KVR A;  2MA3 A;  3E1S A;  3H0G J;  2WA0 A;  4E70 A;  1ZG5 A;  3BPX A;  2Y69 H;  3Q0U A;  3REO A;  1BN5 A;  1E3H A;  3K4K A;  1MIJ A;  4DJA A;  2XRO A;  4KUM A;  5DTD A;  1NG6 A;  1ZGJ A;  3M8E A;  5DM6 F;  1UST A;  2XF6 A;  1TWA J;  2L7Z A;  2CGP A;  2AXT C;  4FHT A;  3LOC A;  3VFZ A;  3OL4 A;  3KP2 A;  2K4J A;  2DT5 A;  3X2Q H;  4FTH A;  3Q0V A;  2O61 A;  4G6Q A;  2HNH A;  2E7X A;  3ABU A;  2WBM A;  1ZYR F;  2XSJ C;  1ETW A;  1IRG A;  4AD9 A;  4ON0 A;  3E3V A;  3M07 A;  1P7I A;  3VDX A;  1IF1 A;  5ED4 A;  1ETO A;  3BTI A;  1XDU A;  2DA7 A;  1H9G A;  3BTC A;  1YOV B;  3LNQ A;  2L5Q A;  4FE4 A;  3KE2 A;  5HLG A;  1Y56 A;  2ZXW H;  5GPA A;  1JHH A;  4IQ4 A;  4OIR F;  2M87 A;  2QZ8 A;  2ELH A;  1MH3 A;  3OYJ A;  3PQK A;  2YSR A;  3R0A A;  3WU2 C;  1G3S A;  4BAC A;  3LMM A;  2OAZ A;  4B3X A;  4E4H A;  4AM3 A;  2KIQ A;  2WWY A;  3ZOB A;  4ZZD A;  1Y0U A;  1SD7 A;  3HKZ A;  4EMS A;  1QBJ A;  2X6X A;  3CMY A;  4M72 A;  4A3M J;  9ANT A;  1ETV A;  3OYK A;  2ZXJ A;  4R79 A;  3CMA I;  2EJR A;  2KRC A;  4A3G J;  1WI3 A;  4BXX J;  4LOC A;  4DW6 A;  1DP3 A;  4N4N B;  4ZYD A;  3BT9 A;  4RM3 A;  1R7J A;  3H5R A;  1HDD C;  1W4M A;  2R7S A;  1Y8Q B;  4RLF A;  1BR1 A;  3CCU I;  2QQA A;  3T5X A;  2GZW A;  2GAU A;  4CO8 A;  4UXN A;  1H8A C;  3DKY A;  1JTX A;  5F0H A;  2W48 A;  3DBH B;  3FMR A;  2O8X A;  2EK5 A;  3O8H A;  5B3S H;  1TP4 A;  2Z9O A;  2XAF A;  4DQ2 A;  2F6C A;  2IEK A;  2YU9 J;  4HX7 A;  2KQR A;  4IHS A;  2K9N A;  1N75 A;  2A6H F;  2O7O A;  2MLG A;  3UR3 C;  1V54 H;  3HHG A;  3D5R C;  3VPR A;  1YX5 A;  3RZD J;  2V6E A;  4HV6 A;  4C3H J;  2EV0 A;  4L5I A;  2PG4 A;  4IX7 A;  1REP C;  3QPH A;  2JWT A;  4CIC A;  2ZCW A;  3AL0 C;  2P8T A;  3ULQ B;  4DBR A;  3K69 A;  1I50 J;  1V5G A;  1LDD A;  3VSK A;  4Y7N J;  2W82 A;  4QIW N;  1FWZ A;  2RDP A;  4M6Y A;  2NVT J;  1QQI A;  4S0H B;  1G3W A;  4YRV A;  2P7V B;  1OIS A;  2ZJ2 A;  2JA2 A;  5HDK A;  3VWB A;  2KJB A;  2CUZ A;  2Z2S B;  3MWM A;  3G6E I;  1BA5 A;  1MJB A;  3L2Q A;  2ZFU A;  3GTJ J;  2KIS A;  1W5C C;  3JTH A;  4EM0 B;  1XMA A;  1X3U A;  1WJ5 A;  2VXZ A;  2V4J C;  4HV5 A;  3SXY A;  2UXX A;  1Y8R B;  3CLO A;  1FSH A;  2DMU A;  1BJA A;  1LFU P;  3ABT A;  2ISZ A;  4ZDP A;  3J81 Z;  1SMY F;  3FMS A;  4YFN F;  1FNN A;  5TGT A;  1SD4 A;  5B1B H;  3NEU A;  3IL2 A;  3FM5 A;  2AXL A;  3KYC B;  5F1J A;  2CV1 A;  4M3G A;  2VKH A;  1U5T A;  3CCE I;  1PVE A;  3ONQ A;  2H1K A;  4ESB A;  4GRI A;  3HSE A;  3DLL F;  3HPH A;  1WVR A;  2M4K A;  3I0T A;  5DCF A;  5LHH A;  2R7U A;  2DA3 A;  2VT2 A;  2DMP A;  1QZZ A;  3L2W A;  3ECH A;  1TW2 A;  3SEZ A;  1QVU A;  1LVA A;  4V19 K;  1Z3X A;  2VBW A;  2HPI A;  4KIT B;  5AIP A;  3TDU C;  4I09 A;  3RPU D;  4Y33 A;  3G1M A;  1OR7 A;  2IAI A;  4L9T A;  2H8R A;  1PJR A;  1WJD A;  1I39 A;  4MTD A;  3PSF A;  4KIB A;  4PJN A;  4F7Z A;  1GXQ A;  2P6S A;  4IHW A;  4M9Z A;  3S2W A;  3BPV A;  5DEQ A;  2GOM A;  1MMG A;  1S5L C;  1SEU A;  4RGS A;  3FM3 A;  5ERI A;  1VQ4 I;  2VIX A;  3ELK A;  3HRM A;  1BL0 A;  5DD4 A;  4F52 A;  4HX4 A;  3OYD A;  4IRH A;  3G73 A;  3T8R A;  1I6H J;  3RQ4 A;  2WC2 A;  1A35 A;  2IGK A;  3BZC A;  1D1A A;  3GLX A;  1MBF A;  4HQM A;  3ESW B;  4II2 A;  3TBI A;  3OSF A;  2ZNZ A;  4BQQ A;  3MZH A;  1YJN I;  2FMY A;  1D0X A;  2M5W A;  2XGC A;  1I3A A;  3L2R A;  3I59 A;  4ZYH A;  2BVM A;  3V42 A;  2QBY A;  4ZH4 F;  4RDU A;  3V8K A;  3QP6 A;  2KT0 A;  2D2W A;  4ZDL A;  2ZJQ F;  3DPL C;  5D5X B;  1FMW A;  1XC5 A;  4D5C A;  3IHU A;  4LK1 F;  4A3L J;  4A3J J;  4F91 B;  1ZLK A;  2GXA A;  2RRE A;  2A3S A;  3WE3 A;  2KZG A;  3F72 A;  4Y52 J;  2IVM A;  2HDD A;  3KYL A;  3H35 A;  3ZMV A;  2VB6 A;  1TNT A;  1E17 A;  3TP3 A;  3IUO A;  3CJN A;  2JVG A;  3E7L A;  1LFP A;  2E19 A;  2Z3Y A;  3LWF A;  3LSH A;  1OYI A;  2L3D A;  2RNG A;  1J09 A;  1KU9 A;  1U5T B;  4IKF A;  1R49 A;  1HCR A;  3VEP A;  3BRO A;  3QQA A;  1TZL A;  4ENM A;  1SFX A;  3RIR A;  5E3N A;  2VE9 A;  3OL3 A;  1U3E M;  3IWF A;  5J8C A;  2X6W A;  2QQB A;  3S1N J;  3ASN H;  2VKD A;  4TV7 A;  4F92 B;  3I3L A;  5BPI A;  1O4X A;  3WTZ A;  3AFH A;  4J01 A;  3CJQ B;  3BR0 A;  5J47 A;  5HS9 A;  2E35 A;  4RA2 A;  5LFA A;  1I5Z A;  5FD5 A;  2CS3 A;  1BI0 A;  4G7Z F;  4A3B J;  4IHY A;  2XAU A;  1TQM A;  3I4P A;  3L09 A;  5M5W J;  4XLP F;  1DUX C;  4QPO A;  3Q0W A;  4HLX A;  1R36 A;  3MKZ A;  4AUX A;  4LLG F;  1TL8 A;  4XSZ F;  3HOS A;  2IPQ X;  1QHG A;  3LSK A;  3MKL A;  5EDN A;  3L2C A;  3HOY J;  2DTZ A;  3EUA A;  3SZP A;  4XOT A;  1FPQ A;  1Y6I A;  1YJW I;  4X1E A;  3MMY B;  2L02 A;  4MLO A;  1P2F A;  4KIG A;  3BR5 A;  4A5N A;  5EJC A;  3EUH A;  2XRL A;  2CWE A;  2ZJR F;  2ZME A;  1G6N A;  3IAS 2;  4ABZ A;  2YU3 A;  4Q5S F;  1LPQ A;  3KP6 A;  4DYC A;  1DGW Y;  3WGG A;  3F9K A;  5GAG J;  3NQO A;  1ORK A;  3I59 B;  1ETQ A;  1WJF A;  2DMQ A;  2KIF A;  2OU2 A;  3BQZ A;  5EGO A;  2DO7 A;  2QBY B;  4B8X A;  4OMY A;  3QYE A;  4CCL A;  1W0U A;  1D5Y A;  1XB4 A;  1MNE A;  2K4B A;  5FFX A;  1VQ7 I;  2ESH A;  3GCM A;  1YS6 A;  5DDG A;  5E8G A;  2FD5 A;  2JUG A;  1M1E B;  3C1D A;  1XGO A;  3DKX A;  3OYH A;  2DOA A;  2IGM A;  4EJT A;  2DA6 A;  3MEX A;  2DW4 A;  2ISY A;  4MFD A;  3KYD B;  1J2X A;  2W57 A;  4I0A A;  2CU7 A;  1X1D A;  4W1U A;  4LB6 B;  2LDU A;  3FWE A;  1FYL A;  1JXS A;  3M7G A;  2HVS A;  1LVK A;  1R00 A;  1B8I A;  2HZD A;  2R7F A;  3RDI A;  3HXL A;  3QPT A;  4I01 A;  2KFD A;  2FA5 A;  1ULY A;  1KQ8 A;  3DV8 A;  3OYI A;  2VOO A;  3S3O A;  1U5T C;  3LL7 A;  4S04 A;  1ETK A;  2R7Q A;  2EV6 A;  3K9T A;  3K2A A;  1SVM A;  1SVL A;  3PSI A;  1D8K A;  2FX0 A;  4G6D A;  3BZK A;  3V7R A;  5LRS A;  4IRG A;  4GFB A;  2L01 A;  2E36 A;  2K02 A;  2VKE A;  2M7B A;  2CW7 A;  3E6M A;  2XRN A;  1HKQ A;  2H8W A;  2CW0 F;  2NNY A;  2KRF A;  2AS5 F;  3TL4 X;  5LHI A;  2E2H J;  5C4X J;  4R1H A;  4XLA A;  2EFN A;  2HVR A;  1SAX A;  1OR7 C;  2KPM A;  4GCV A;  4A0X A;  1R1U A;  3DU5 A;  3S93 A;  1ZRC A;  1VQO I;  3B02 A;  3RI4 A;  2HGC A;  4I0B A;  5K5O A;  3WTW C;  3V7C A;  4ANJ A;  4HDU A;  1OCP A;  3DEW A;  2HDC A;  1XCB A;  1OFC X;  2IP2 A;  3OYM A;  3DPT A;  3K1N A;  1W36 C;  2JTV A;  4BHP A;  2NOJ B;  1VQN I;  2ZME B;  4RM2 A;  2JQ7 A;  2DBB A;  2EH3 A;  5HOO A;  5DS9 A;  2P4W A;  2O5R A;  2DI3 A;  3H0D A;  1EH7 A;  2JA7 J;  1MBJ A;  3FX3 A;  3CDI A;  3AG4 H;  3B73 A;  3IWZ A;  5EGO B;  1UG0 A;  5LEJ A;  4IHX A;  3H3U A;  1QNT A;  1IC8 A;  2HQA A;  5EEG A;  1OYY A;  2JSP A;  2FBI A;  2W24 A;  1I6X A;  2HPM A;  2MFZ A;  4OWR B;  2KMU A;  3DFG A;  5TJJ A;  2CJJ A;  1XSX A;  2Y0S N;  5HS8 A;  5K7H A;  1VQ6 I;  1VQ9 I;  2G9W A;  2LH9 A;  3LQQ A;  3F8M A;  1U9N A;  5HLI A;  1ZG1 A;  2A68 F;  2DYR H;  2L9N A;  4XRM A;  1U0J A;  3OYC A;  2L7F P;  1B8I B;  2M2E A;  5GPC A;  1ETX A;  1D8J A;  2K3P A;  1FIA A;  1UAA A;  1LJ9 A;  2EZI A;  1KZH A;  1ACI A;  4OMZ A;  3CO6 C;  2W1O A;  3WU0 A;  1E0E A;  4BY7 J;  4UUS A;  4CZC A;  1B72 A;  1J75 A;  5E20 A;  1EJ9 A;  4U0V A;  4HF1 A;  2LF7 A;  5E79 C;  4BGD A;  1W36 D;  3HJE A;  4LMY A;  2DQR A;  1V5E A;  3G4S I;  5FRM A;  2P7C B;  1O3R A;  1UZC A;  1BR2 A;  3COA C;  3BG9 A;  3HRS A;  4IF4 A;  1A6Q A;  1I1G A;  4HPQ A;  2WY7 Q;  4ESJ A;  1OJL A;  2R7R A;  2XHK A;  3BR1 A;  1IN4 A;  3A01 A;  1RI7 A;  4LLL A;  1KQ0 A;  2X1D A;  5CVV A;  3CD6 I;  2QM3 A;  2DA4 A;  3MKW B;  4NHJ A;  2XAH A;  3CTA A;  4BY1 J;  1OMI A;  5ILU A;  5FFZ A;  4LLN A;  1TWC J;  3FK7 A;  2BY2 A;  4CYC A;  3NAU A;  3OIO A;  4ENK A;  1EA3 A;  1XS9 A;  2FF4 A;  2JMW A;  2R7D A;  3RPQ A;  2O8K A;  3LSP A;  2UWM A;  2BY3 A;  2XB0 X;  2ZB9 A;  4BYY A;  2A61 A;  2K27 A;  1MMD A;  2ZME C;  2QQ9 A;  3M9A A;  1GXP A;  2K9M A;  1JUM A;  4Y15 A;  2PX9 A;  2UXN A;  2GIZ A;  2CQQ A;  3N97 A;  2WAQ N;  1XGS A;  2IS4 A;  4LFU A;  1B1B A;  5HOD A;  3EYY A;  1ZRE A;  1BOB A;  5EG0 A;  4AYB A;  1LE8 A;  1YW8 A;  4RLQ A;  1K6Y A;  3E5X A;  2P5L C;  3ZGK A;  2A07 F;  3IH3 A;  2Y0M A;  2IJL A;  1J7K A;  4C3J J;  1NH3 A;  4RAZ A;  4OIN F;  4RS8 A;  4YFX F;  2W4S A;  3PO3 J;  3CC7 I;  4PJJ A;  4ZYG A;  1D3Y A;  5CVJ A;  4WX9 A;  1JGG A;  2OD5 A;  3WGI A;  2XAG A;  1VQ5 I;  1B4A A;  1RUN A;  2HWV A;  2QEN A;  1WJE A;  4WXD A;  3G2B A;  4JX5 A;  4G94 A;  3C18 A;  5L3B A;  2LR8 A;  3T1B A;  3QAH A;  2QKL B;  4UUT A;  4CCK A;  4CCO A;  3TO6 A;  2CMP A;  2GQQ A;  3GUD A;  1O7F A;  1NHA A;  2OF7 A;  4XRS G;  4A6E A;  1HKS A;  4UUS B;  1B72 B;  3DPU A;  2MH2 A;  4IJA A;  3PUB A;  1XCV A;  2CQX A;  2UZK A;  4RB3 C;  5C44 J;  3RKQ A;  3M3Y J;  1FLI A;  3I5U A;  4OAY A;  2V6C A;  4AC0 A;  2BHZ A;  3PUF A;  4A93 J;  2VPR A;  4A69 C;  2EFO A;  2E2I J;  2X0L A;  1ZGW A;  1YI2 I;  1MBE A;  1Z21 A;  2QSF X;  5DYM A;  4A3E J;  1W7P A;  1SD6 A;  1TT0 A;  1ZRF A;  4DZJ A;  1FP2 A;  5FLM J;  2CFO A;  1YIJ I;  2VKV A;  1WCM J;  3S1R J;  1Y0N A;  4H0E A;  3A01 B;  1S29 A;  1OQY A;  3F3X A;  3C7J A;  1XMX A;  1T95 A;  2QQ8 A;  2R5Z A;  4A12 A;  1KU3 A;  2X1C A;  2OTJ I;  3F8N A;  3P7N A;  4CYC B;  1ZAR A;  1JT0 A;  1H88 C;  4QPQ A;  4HZF A;  3L2U A;  1UG2 A;  4GXO A;  2HQ5 A;  2K7L A;  3PIP F;  1QO0 D;  4EAT A;  4U87 A;  4LIU A;  4ITV A;  3JRD A;  2B63 J;  3HSR A;  1X3Z B;  4MEY F;  2HOA A;  1S7A A;  5AON A;  3SDB A;  4C2M J;  1MBK A;  1IZ1 A;  3G1L A;  2MC3 A;  3NWS A;  1A6I A;  1YLF A;  1H89 C;  2JSC A;  1ODD A;  3BLY A;  1ONV A;  1ZGA A;  2E1N A;  1A04 A;  2D1H A;  2LVS A;  1MZB A;  4EJW A;  3I4N J;  2ID3 A;  4EM1 A;  1TWH J;  5EG0 B;  1LE8 B;  2EA4 A;  4ESF A;  2X1E A;  4DBQ A;  2FBK A;  1DDN A;  3K1M A;  4YIR X;  3D5L A;  4XLF A;  3W6K B;  3FMQ A;  2IA1 A;  4IXA A;  4EJU A;  3IKV A;  3PNV A;  4K2E A;  2BOL A;  3BJO A;  2P81 A;  2HQN A;  3S3N A;  1IN7 A;  3KPH A;  5EEA A;  2IS6 A;  2LY9 A;  5CQG A;  1E3O C;  5C3E J;  3PO2 J;  1S7E A;  3LSJ A;  3BDD A;  1GHC A;  2KHM A;  3H1C A;  2BE5 F;  2FRH A;  4XSX F;  3KEO A;  3JRA A;  2GWR A;  2VJ5 A;  3HOX J;  4G12 A;  2QYO A;  2G0E A;  4N4O B;  5JVT A;  2NXN B;  3FIW A;  1HKT A;  4L9J A;  5JHF A;  4E7L A;  1S3J A;  3CCM I;  1YRN B;  4HYE A;  1T33 A;  4BQN A;  1T56 A;  3CCS I;  2PJR A;  3TOA A;  5CKT A;  3I56 I;  2VT3 A;  4I02 A;  2NVU B;  2QUF A;  5E1W A;  3S1Q J;  3ZQC A;  1Z1D A;  3DXJ F;  3M4O J;  1HQC A;  2DMN A;  2Q1Z B;  4UVC A;  4B1R A;  2PMZ A;  4N9H A;  1W7P B;  2D5V A;  2DA2 A;  1X3W B;  2I5U A;  3BR6 A;  4PFP A;  1WH5 A;  3H36 A;  4DZP A;  1P9Q C;  1X2N A;  1Z3Y A;  2P6T A;  3CUO A;  3FXQ A;  4B4C A;  5F1R A;  1BR4 A;  3DCF A;  5IPA A;  3MAJ A;  1WSU A;  4RB1 A;  3WG7 H;  4BQA A;  5J40 A;  4H4K C;  4LG3 A;  1FIP A;  1VTN C;  2R5Z B;  2JZY A;  1FTZ A;  1HXD A;  4HG2 A;  4XM3 A;  3M1C A;  3PQJ A;  5ICC A;  3W6J B;  4NC7 A;  4MFE A;  3B6C A;  3G3Z A;  1V4R A;  4CSW A;  1HW2 A;  3I54 A;  4ENJ A;  2XUB A;  4A6D A;  2L2O A;  4XRS A;  1F9N A;  1ETY A;  3FBN B;  1WWX A;  1UHM A;  3GME A;  4JX6 A;  4PJL A;  2E71 A;  2FE3 A;  2A6T A;  2UV1 A;  2KDO A;  1N78 A;  3R61 A;  1BJZ A;  4NQW A;  2WTE A;  3HUG A;  1X1C A;  1IRF A;  4BQO A;  1USS A;  3CQZ J;  2RGV A;  4EM2 A;  4J00 A;  3O8G A;  4XLH A;  1OKR A;  2M1B A;  2G7U A;  3FXL A;  2DPU A;  4OIP F;  3Q3S A;  4UUV A;  3K70 C;  3RSN A;  1Z77 A;  1J5Y A;  2H6C A;  3QPL A;  2LSO A;  5B66 C;  1YO5 C;  5FKK A;  2V1X A;  1W5T A;  3DKW A;  4MQ9 F;  3LFK A;  2MD0 A;  4NC8 A;  2H09 A;  2R7T A;  2HVQ A;  1YTY A;  2WB1 N;  3K7A J;  4A3C J;  5K5R A; 
#chains in the Genus database with same CATH homology
 3MMY B;  4MLO A;  1PYV A;  4XKV A;  2ZSI B;  3NWT A;  1QHH D;  3IAS 2;  3PNT A;  2CV0 A;  1NG7 A;  2VQL A;  2F4I A;  1DGW Y;  3TMO A;  2MYS A;  3F9K A;  3U21 A;  2IGN A;  2PJR B;  1WJF A;  3OIQ A;  1GLN A;  1YE9 A;  4CCM A;  1DQU A;  3QYE A;  4CCL A;  2WAE A;  2VAS A;  2M0M A;  2ZXH A;  1MNE A;  3SZG A;  2VXD A;  2WAD A;  3DWL E;  3OIP A;  4LIV A;  3A1Y A;  3OWT A;  4E7I A;  2JUG A;  3W2W A;  3OYG A;  3DKX A;  1D0Z A;  2V7F A;  2DOA A;  2WB1 A;  3OYH A;  2IGM A;  5KNL A;  3D5S C;  3M8J A;  3OS1 A;  2Q2E B;  1IRX A;  2OC6 A;  3OR2 C;  4CCJ A;  3K70 D;  4E6K G;  3S8P A;  2ELJ A;  4CH7 A;  4XR6 A;  1X1D A;  3ZQQ A;  1MMA A;  4BL0 B;  3QYB A;  2HVS A;  1LVK A;  2V9K A;  4ZTF A;  2HZD A;  3HXL A;  4F55 A;  4HNU A;  2E60 A;  2AQE A;  4BS9 A;  1WJB A;  3DTE A;  3OYI A;  3BG6 A;  4JOM A;  4PFO A;  3PFY A;  2CUJ A;  3S3O A;  4KIS A;  3LL7 A;  1MW7 A;  2R7Q A;  2E1M B;  3CZ6 A;  1D1B A;  2K5C A;  4P5O A;  3S32 A;  4NQW B;  3EUK L;  3HUG B;  3PSI A;  1X1B A;  3EUH C;  3KX2 A;  4KJZ A;  2OV7 A;  3H9J A;  2FUG 2;  2M7B A;  2CW7 A;  3H9Q A;  4CCN A;  4ZYA A;  3W2V A;  3W2A A;  4ZDO A;  2GOX B;  1G59 A;  4XLC A;  4BDZ A;  3TL4 X;  2BW3 A;  4BU2 A;  2LY1 A;  4XLA A;  2VL8 A;  4D9J A;  2HVR A;  3HL2 A;  1OR7 C;  2KPM A;  4B47 A;  4P1W A;  2BVL A;  3DU5 A;  4ZC3 A;  3S93 A;  4DIQ A;  2XF7 A;  3HC7 A;  1MND A;  2M3A A;  3QOD A;  4Y3O A;  4ANJ A;  4E7J A;  4E7K A;  3UNG C;  3CP8 A;  3OYM A;  4G6T B;  3DPT A;  1W36 C;  2NOJ B;  3OS2 A;  1SAU A;  4RM2 A;  4BJ6 C;  2LRD A;  1MMN A;  3EPZ A;  5HOO A;  2VLA A;  2O5R A;  2CV2 A;  3H0D A;  4B48 A;  3FHN A;  4XLE A;  2JVH A;  2IS2 A;  4XQF A;  1ERD A;  2R7W A;  1UG0 A;  2VJI A;  4BJ5 C;  2VQG A;  3I9V 2;  2HQA A;  4XOR A;  2I8D A;  2IXS A;  2V26 A;  2JSP A;  4RMN A;  4IQJ A;  2HPM A;  2MFZ A;  2M4G A;  4HSR A;  2UUZ A;  1SFK A;  4OWR B;  3RTR A;  2KMU A;  2LYC A;  1D1C A;  4HRI A;  4E7Z A;  3BCB A;  1LDK B;  2LH9 A;  3SYT A;  5HLT A;  3L2V A;  2KRH A;  3LSG A;  2R4G A;  2L9N A;  3GBG A;  3LFU A;  1U0J A;  3OYC A;  1WFX A;  2VQH A;  2K3P A;  4LIT A;  2LOO A;  2LC2 A;  4PSW A;  1UAA A;  3C2H A;  4FAS D;  3AL0 B;  1OLT A;  2DJI A;  1VZ0 A;  3OMY A;  4XN0 A;  4XON A;  3AKZ A;  2W1O A;  2A5W A;  1E0E A;  3E1S A;  2OUM A;  4CZC A;  1UEL B;  2WA0 A;  1WJC A;  1JI8 A;  2X6Y A;  3DLA A;  1W36 D;  4BGD A;  4ZJZ A;  3K4K A;  2E1M C;  3K4N A;  4DJA A;  1LKX A;  3OYN A;  4AU7 A;  1V5E A;  2CH0 A;  1NG6 A;  1FMV A;  1S9H A;  2Y0S A;  3CES A;  4C9Y A;  5FRM A;  3PL8 A;  5CQE A;  3K6G A;  1BR2 A;  2XF6 A;  4X0G A;  4CA0 A;  3H9G A;  3OL4 A;  1DGR M;  2BW3 B;  1X4O A;  3PNY A;  2HNH A;  4HPQ A;  2WY7 Q;  1KON A;  1X19 A;  2WBM A;  4E7H A;  1X1A A;  2M7A A;  2RQQ A;  3OOU A;  2XSJ C;  2R7R A;  3VDX A;  2X1D A;  3FDY A;  3MKW B;  2VJ4 A;  2R7X A;  2W7N A;  3OYE A;  2L5Q A;  2DXI A;  1Y56 A;  3N05 A;  2DCE A;  4IQ4 A;  1EA3 A;  3OYJ A;  2KLO A;  4AVZ A;  1WJA A;  3DQV C;  2IGO A;  3VSL A;  4BAC A;  3LMM A;  2UWM A;  3DTK A;  4B3X A;  4E4H A;  3LSI A;  2KL4 A;  1MMD A;  2HU9 A;  4PJM A;  3HKZ A;  2K9M A;  2Z16 A;  2X6X A;  4XL9 A;  2HDW A;  2QKM B;  4KT6 A;  3W3C A;  1T0F C;  4BJT A;  3OYK A;  4DOZ A;  3A4C A;  4R79 A;  2IS4 A;  3J7A Y;  2KRC A;  3CF2 A;  4B43 A;  1BOB A;  4AYB A;  1DP3 A;  2KZV A;  4BE0 A;  4N4N B;  5LD2 C;  4RLQ A;  1K6Y A;  4RM3 A;  3H5R A;  2ZSH B;  3C2G A;  4NUB A;  3ZGK A;  2R7S A;  4RLF A;  1BR1 A;  4HEA 2;  4ZTJ A;  3BC8 A;  5KCM A;  3DKY A;  2MAB A;  2W4S A;  4PJJ A;  4YEL A;  4DGW B;  2LG4 A;  2F6C A;  1YX3 A;  3HOT A;  2KQR A;  2MC4 A;  1N75 A;  2L9S A;  3K4C A;  1WJE A;  5HNF A;  4NNJ A;  3G2B A;  3UR3 C;  1N77 A;  3OYA A;  3D5R C;  1YX5 A;  2V6E A;  2QKL B;  4CCK A;  1Z7L A;  3ZR8 X;  2WAQ A;  4CCO A;  4IX7 A;  2CMP A;  2LY2 A;  4II3 A;  2KP6 A;  3AL0 C;  3VYR B;  3QOE A;  4DBR A;  3DPU A;  1V5G A;  3VSK A;  3PUB A;  2LBF A;  2W82 A;  4BE2 A;  4OAY A;  2XDV A;  3BCA A;  4YRV A;  3IAM 2;  4XKB A;  3VYS B;  4IZZ A;  2JA2 A;  3VWB A;  2CUZ A;  2Z2S B;  2VPL A;  3CMM A;  1Z21 A;  4BE1 A;  3L2Q A;  1TT0 A;  2VJJ A;  2ZFU A;  4HST A;  2X85 A;  2CFO A;  2VXZ A;  1WJ5 A;  2XC7 A;  2V4J C;  2DT7 B;  3DU6 A;  3ZCO A;  1T95 A;  4ZDP A;  3VYU B;  2X1C A;  5TGT A;  3SEQ A;  4BDY A;  5CPR B;  2CW8 A;  3K4L A;  3K4M A;  4XNF A;  2LRE A;  2CV1 A;  2VKH A;  5FRN A;  3ONQ A;  4QPQ A;  3L2U A;  3KEY A;  4GRI A;  3OYF A;  2K9L A;  3HPH A;  4C30 A;  4D1Q A;  5KHD A;  4EAT A;  4U87 A;  4Y4R A;  4LIU A;  4ITV A;  4XKC A;  3OYL A;  2M4K A;  2XF5 A;  2R7U A;  3L2W A;  3SDB A;  2W00 A;  2AQF A;  2ZXI A;  3SEZ A;  4BEH A;  4PK4 A;  3NWS A;  1Z3X A;  2HPI A;  4KIT B;  2IS1 A;  3BLY A;  3RPU D;  3DEE A;  4Y33 A;  1V5F A;  4FET A;  2X1E A;  4E7S A;  1ZEL A;  4DBQ A;  4U7B A;  1PJR A;  1WJD A;  2F5V A;  3D5L A;  4OAZ A;  2X51 A;  4XLF A;  1D0Y A;  3HPG A;  3PSF A;  1QU3 A;  4PJN A;  3ZRG A;  4XOP A;  3A2K A;  3PNV A;  4F3Q A;  2BOL A;  3MKY B;  3S3N A;  2GOM A;  1MMG A;  4PUS A;  3CP2 A;  5FRO A;  4F93 B;  2IS6 A;  1AA7 A;  4BUP A;  4YEJ A;  5CQG A;  3OY9 A;  3LSM A;  4PSX A;  2VIX A;  3OS0 A;  2KHM A;  3OYB A;  4F52 A;  3OYD A;  3RQ4 A;  2IGK A;  2VJ5 A;  4N4O B;  4BXF A;  2Z1D A;  1D1A A;  3IP4 B;  4HNT A;  3TBI A;  4II2 A;  3OR1 C;  5JHF A;  4E7L A;  4BQQ A;  3ZXS A;  1D0X A;  5HVQ C;  3QYF A;  4BQN A;  4XKW A;  3DTI A;  3L2R A;  2PJR A;  2LBF B;  2BVM A;  5CKT A;  3V42 A;  2R7O A;  1R6R A;  3MD2 A;  2R7V A;  4ZDL A;  3DPL C;  2Q1Z B;  4CUG A;  1FMW A;  2PMZ A;  3PJR A;  4PFP A;  1P9Q C;  1Z3Y A;  2VQC A;  4F91 B;  2RRE A;  1X4P A;  3E0J B;  1BR4 A;  2L7K A;  2WAF A;  3KYL A;  3H35 A;  4H4K C;  4LG3 A;  2VB6 A;  3VYT B;  3IUO A;  4HG2 A;  4XM3 A;  2JVG A;  3K10 A;  1LFP A;  3M1C A;  3LSH A;  2RNG A;  1J09 A;  4NC7 A;  2E5N A;  4IKF A;  4CSW A;  1TZL A;  2L2O A;  3OL3 A;  5HNH A;  1G8X A;  3FBN B;  2DT6 A;  2X6W A;  3H5N A;  4PJL A;  2VKD A;  2A6T A;  2UV1 A;  2KDO A;  4C2U A;  1N78 A;  4F92 B;  4BEH B;  1X1C A;  3I3L A;  4BQO A;  4C2T A;  3K4J A;  4J00 A;  3AFH A;  4XLH A;  4J01 A;  3CJQ B;  3H5A A;  1HA8 A;  5LFA A;  3CJR B;  3K70 C;  3RSN A;  2P0W A;  2CS3 A;  2E5Z A;  3RCO A;  4JQF A;  4XN3 A;  2XAU A;  3BG7 A;  4QPO A;  4B44 A;  3K4B A;  3MKZ A;  2V1N A;  3S3M A;  2MD0 A;  2WY8 Q;  4NC8 A;  3HOS A;  3LSK A;  1QHG A;  3HG9 A;  3FKJ A;  3EUA A;  4XOT A;  2R7T A;  2HVQ A;  4XMY A;  1Y6I A;  3FBI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...