2W7NA

Crystal structure of kora bound to operator dna: insight into repressor cooperation in rp4 gene regulation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords TRFB TRANSCRIPTIONAL REPRESSOR PROTEIN
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w7nA00
2W7NA 5CKTA 3M8JA
chains in the Genus database with same CATH superfamily
2LNBA 4IF4A 3HRMA 2PX9A 3PFIA 1J5YA 5BOXA 2DYSH 2OV7A 3REOA 2NVUB 4P96A 2GXGA 3NAUA 4M74A 1LJ9A 1LVKA 2IXSA 3WTUC 3A01B 1RRJA 3W6VA 4A93J 5J8FA 2BY2A 3HRTA 3GLXA 2A3SA 1RESA 4QPOA 1OYWA 1MGTA 2QQAA 2O3FA 3I53A 3EUAA 5D8KB 5BPIA 5K7HA 3HTSB 2LOOA 1ZKGA 4RLFA 3FIWA 4EATA 2N8GA 3BZ6A 3DU6A 3MFKA 1Y0UA 2CMPA 1RPWA 4CYCA 2R7XA 2DAOA 4HA8A 3RYPA 2V9VA 5KAIC 2GA2A 2ZJQF 2OZ6A 4ANJA 4B44A 3NEUA 4A5NA 4IO9F 2EIMH 2BW3A 2G7UA 5BQTA 2M0MA 1OFCX 3R0JA 1VFCA 2IGMA 1P4XA 2ZB9A 3H5AA 1Y39A 4XN3A 3H35A 3F8CA 1FY7A 2M4GA 1ZELA 4IZZA 1GT0C 1NK2P 1RUNA 4Y52J 4C3HJ 2EINH 1EH6A 4DBQA 1U5TB 3L2RA 1HSTA 4ZYGA 4UNOA 2Q2EA 5DUKA 1H8AC 3G6EI 3OSFA 2H27A 2X9DA 1QZEA 5E3OA 2F5FA 2FD5A 4XORA 4BE2A 1J0RA 3K4JA 3LFKA 4D0PA 4G6QA 5GAEJ 4QIWN 2HOTA 2W57A 1ETKA 1K78B 3E97A 4CCNA 3GEZA 2L9RA 3TEDA 1Z91A 3HSFA 2LF8A 4ENJA 3LSIA 2H6BA 3RPQA 2ISYA 1T2KA 2PG4A 1SD6A 2NRAC 2VB6A 2XSJC 2JK3A 3TMOA 1Z3YA 4IHVA 1TL8A 1YRNB 2YS9A 3VYUB 4LLGF 3QYEA 1TNSA 4M3FA 1M1EB 4UB8C 2L9NA 4KMUX 2EB7A 4J00A 1ZGWA 4A3BJ 3KCCA 2QBYA 4DGWB 2TCTA 2IS1A 3WTZA 1KQ8A 2QGUA 4BHBA 3D0SA 2ZJ2A 2FNPA 4OU0A 3PIPF 1B72A 1KQ0A 2ME0A 4L5JA 1QVUA 3EETA 2VOPA 4N0BA 2UV1A 2R7RA 2VPLA 1D0YA 1HDPA 3H92A 4AWXB 3RQ4A 2P7CB 1YIOA 3I9V2 1KU3A 3I64A 1D8KA 1OYIA 3HRUA 5B5EC 2R7FA 2HTSA 2JMWA 1GV5A 3E6MA 4BY7J 3OR2C 4C2UA 3M8EA 5FKLA 2F4OB 4M73A 1VQNI 3FXJA 2JZYA 1BOBA 4A2UA 2KQRA 4I09A 3LA3A 5L3EA 4PUSA 3L2QA 2KJCA 5FO5A 1R7JA 5FKNA 3ULQB 3TBIA 1ODDA 2EBIA 2NS8A 3CTAA 2ZC2A 3S2DJ 4HG2A 3LA7A 1HA8A 3RJPA 4BH9A 1G59A 2LK2A 3V7RA 1VI0A 2HFHA 1TC3C 1ZR2A 3K1PA 1ACIA 3DEWA 2VQCA 1HCRA 2WB1A 3FHZA 2E1NA 5DYMA 2EJRA 5LHIA 4PCQA 3J81Z 4TV7A 3MWMA 1N25A 5TGTA 4XRSG 4KISA 4AVZA 5KHDA 3AKZA 4BL0B 4CDGA 1LQ1A 5JVTA 5FKOA 1DPRA 2K9MA 1B8IB 2K40A 2DW4A 1GV2A 4D9JA 1MBEA 1WJDA 3U21A 2RNGA 3OL3A 1Q1HA 3E7LA 5FB2A 2EIJH 3KFWX 3BCAA 3H0GJ 1TWFJ 3WE2A 2X85A 1S3JA 2UXXA 3JRFA 1S6LA 2H1KA 3VYTB 3W3CA 1FIAA 1MMNA 4ZDLA 4BQOA 2V26A 2JJ7A 4EJWA 5LD2C 2WAQN 1NG7A 3QWLA 5IPAA 3KZIC 3HTUA 4CZZA 3G1MA 5CVUA 2JUGA 3BR6A 1MBJA 5J6XA 2OTJI 1Z67A 1E0EA 2JTVA 2JPCA 1W5TA 2K85A 4P1WA 2HPMA 2MBFA 1R1VA 1T33A 1TQPA 3FXMA 4OOIA 1X3UA 3CLQA 2QA4I 2EV5A 2M2EA 3NQOA 2Q1ZB 3BZCA 4P5OA 3L7WA 2DOFA 3UKGA 3HRSA 4O3MA 4OMYA 2M3AA 3ZQGA 2CQXA 4MHGA 4XICA 3WTTC 1J09A 3G1OA 1X3ZB 2V4JC 4U0YA 2GXBA 4EJTA 1VZ0A 1MBHA 2ID3A 2M7AA 3DKWA 3HM5A 3MQ0A 2XF6A 1LEAA 4BDYA 2ACJA 2DFHA 1RZ4A 2JA5J 3L2UA 1R4NB 4AU7A 2HU9A 3EPZA 2IS6A 4EVIA 2YU9J 1S7AA 1BL0A 1LB2A 3RIRA 1TBXA 2F5DA 3CESA 3HC7A 2KP6A 1VQMI 4C3JJ 1U5TC 2JVGA 2E36A 2P8TA 2V1DA 2R4GA 5DD4A 1V5EA 3KX2A 3VYRB 1SEUA 5B1BH 4CCOA 2WAQA 3RYRA 4EEFG 2OU2A 4UUSB 1O3RA 2RNJA 4HPQA 3LOCA 2CUJA 3QU6A 4S0HB 3M8JA 2R3SA 3HHHA 3V7SA 1RKTA 3OR1C 2MSYA 4LK0F 3PJRA 2M1BA 3MVPA 4DZJA 3HSEA 4G8XA 1YS7A 2XPWA 2XASA 2RQPA 3C7JA 4XLCA 2FBIA 4L9NA 2VJ5A 2KPMA 4BBRJ 3ZMVA 2IGKA 2L4MA 1BI3A 1RI7A 2W25A 1B6AA 2RAEA 4ENMA 1X4OA 4BXFA 5D6FA 4YIIA 3OYCA 3HL2A 4XRMA 4E7KA 2I5UA 4A0XA 1BR4A 1HSJA 3ERED 4G6TB 2YUSA 3V42A 3S1MJ 1G3TA 1SVMA 1OR7A 1MNMC 3I55I 2VI6A 2BEOA 1HW1A 2DBBA 2Y48A 1BW6A 1B1BA 4ENKA 4CSWA 5F6FA 2A69F 3BTJA 1R4MB 4CCLA 2ESNA 1K79A 2MH9A 3TO6A 1KGSA 3PO2J 2GXAA 4C9YA 2DDAA 3LSKA 1LKXA 3ZQHA 5M5WJ 3BG5A 5ILSA 3G3ZA 4PK4A 2H6CA 1QBJA 2DYRH 4B3AA 4A3EJ 1SVOA 1TWHJ 3ZQQA 3HKZA 5EG0B 4UVBA 2KDOA 3FXLA 3BPVA 3OYAA 3BROA 4M71A 3DBLB 5IP9J 1SD4A 3FMQA 4MQVA 3A0BC 1REPC 4PJMA 2Y0MA 3FBIB 3HPHA 1PUFB 3CJQB 4PFPA 1XSXA 4HSRA 1YG2A 2HOAA 4FE7A 4DYCA 3IRQA 2QKLB 2RDPA 4F7ZA 5GAGJ 3Q0VA 1E3OC 1J7KA 3MMYB 2O9LA 4KJZA 2BV6A 4ESFA 5ICEA 2DQRA 3M4OJ 1AKHA 2OTLI 5ICCA 2L7KA 2TDXA 5DV5A 4BYYA 3Q0WA 1X2MA 2KRHA 1IF1A 4M3BA 1SMYF 3Q0UA 5HLHA 3JRDA 3A2KA 4H0EA 3BCBA 2WAFA 1BC7C 4OINF 1QRYA 5LRRA 2K5CA 3ESWB 3IKVA 3CC2I 3BZKA 2A07F 4WX9A 5D6EA 1FYLA 1PUEE 2ICWG 3HOXJ 2XAQA 2QKMB 4GO1A 2EFPA 5J3LA 1S29A 2E1OA 1SFXA 5JHFA 4CCMA 3G1LA 2L2OA 3CO6C 2HOSA 2LMDA 1Z6RA 4HBLA 1Z1DA 3CC7I 3SZTA 1MMDA 3COAC 1JT0A 1JUPA 2XAJA 4FHTA 2VL8A 3W2AA 3DTIA 3O8GA 3L2CA 3CQZJ 2OCEA 2VT2A 1ETXA 3CCYA 2P6SA 4A3LJ 3K1NA 2DXIA 5H6QA 4A3MJ 4KN7X 1FP2A 3ZMTA 1J59A 3GZ5A 3C2BA 2CW8A 3QQAA 3ABTA 1YYVA 5H20A 2GIVA 1IRZA 4HQEA 2DFEA 5B1AH 4U7DA 2FX0A 5CLSA 1W0UA 1WGXA 1B59A 1BR2A 5F1RA 2EH3A 3F8BA 3I4MJ 5L3DA 3IWZA 4ITVA 1ORKA 1U9NA 1FTZA 3KP4A 2LY9A 3V8LA 1VQPI 4BBSJ 5EF6A 1ETVA 4E7IA 1W5SA 1WI9A 2P6TA 4HV5A 1IN8A 2HZDA 3V8JA 3E5XA 1KQ9A 2FMYA 4HZFA 1IUFA 2H8WA 3FKJA 1OYYA 2O5RA 2WY7Q 3ZN1A 3HKZN 2HVRA 1I1SA 3FF5A 2G7HA 3H3UA 5E3NA 1ZLKA 3BTCA 3F3XA 3TL4X 2HXIA 1FOXA 3CP8A 3FMSA 5FLVA 3J7ZI 4BKXA 3CCEI 4A3KJ 2M9HA 3OYJA 3ZMZA 2DPUA 1RC9A 2FOKA 2KFDA 1LVAA 2RVCA 4L5IA 4A6DA 2O8XA 2XDVA 1K7AA 5FGMA 1IJWC 5DEQA 3BTLA 1T39A 2XPVA 2E5ZA 3D5RC 4RGXA 5C3EJ 2DMPA 2O6GE 4KN4X 2IAIA 2KT0A 4L9JA 1XGMA 2ZBKA 1OR7C 1IN5A 4II3A 3ECOA 1TWAJ 3SEZA 1CF7B 4JX5A 3ROUA 1X3WB 3TDUC 5ED4A 1F9NA 3KLOA 5CPRB 5LBQA 1BC8C 2M34A 4I76A 3HOZJ 1IRGA 2KRCA 3T1BA 2AXLA 5KVRA 2OBPA 2KISA 3P9CA 4F93B 1RR8C 5IP6A 1T56A 4B4CA 5DDGA 2CFOA 3DKYA 2VE9A 2QSHX 1ZREA 2X4HA 2V6CA 1QNTA 2F4IA 1K6OA 1IN4A 1OCZH 3DP7A 5J1YA 3HOTA 1R58A 1JKQC 2ZMEB 3IWFA 4F91B 2RN7A 3HYIA 3SJMA 1FWZA 2LKXA 3J7AO 3M1CA 4R8HA 3F6OA 2IPQX 1Z21A 5J4VA 4U0VA 2CG4A 2HZTA 3CZ6A 2ZJRF 1U0JA 2D2WA 2LSOA 2LREA 2XC7A 4XKVA 3DCFA 3AG3H 3PFYA 4DBRA 2E7XA 3JW4A 4N4OB 4B47A 3QP5A 1E3HA 4F92B 5LLQA 2JVHA 2MLGA 1X1PA 3O8HA 2BY1A 2DMNA 4MEYF 2CV2A 3CC4I 4F55A 4XLFA 1FTTA 3GUDA 3PO3J 3B6CA 1AHDP 2DMQA 3GYHX 1XX5A 5IYDJ 2W82A 5EZHA 4OIRF 3VWBA 2HKXA 1BIBA 1KONA 2DMUA 2B7EA 5ILVA 1E3PA 3P7NA 2H8RA 2EK5A 1YITI 2L02A 5K5RA 1PUFA 3NWTA 4BQAA 2YR2A 3OS0A 1ENHA 2CO5A 2Q0OA 1EV7A 1Z7LA 4CZCA 4LG0A 2PMHA 4CO8A 3PM1A 1Y8QB 5B3SH 3G71I 1MJ9A 4ZZDA 4JBAA 5D5XB 4DZPA 5E3LA 4IHWA 2VKDA 3EQLF 3TW7A 2JT1A 2VQHA 3C2HA 1MZBA 1D8JA 3JSOA 5F27A 2FU4A 3F9KA 2BZTA 4EJUA 5F64A 1A35A 2O61A 3GFMA 2DDBA 1JHHA 2E60A 2M87A 2A61A 4Y15A 5DM7F 3CMYA 5D5UB 3HXLA 4EM1A 4A3DJ 5D5VB 5JI6A 4XRFA 2XRLA 2ECBA 1P7IA 3ECHA 2P81A 3IP4B 5HLGA 1FJLA 2WADA 1I50J 5IT9Z 4HNVA 5DUIA 1USTA 4NUBA 5F0CA 5AONA 1XSDA 1NK3P 1HDDC 2X0LA 1DP7P 2NVYJ 3IRRA 3FMRA 3MEXA 1I3QJ 1Y56A 4IHYA 2E2HJ 2NVQJ 2OA4A 5LHGA 5IT3A 1XTAA 3OYHA 5LHHA 2D1HA 3L9FA 3L2VA 2HVSA 4GFBA 3E6DA 1F43A 4PZJA 3ZQLA 2Y9YA 1JUMA 5LRSA 2AO9A 2XSDC 2CRGA 5J1RA 3GXOA 5CJ9A 4IOAF 2K27A 1XDSA 1LE8A 4CYDA 1T08B 1S7OA 3IAM2 3UR3C 1ZH5A 1A04A 2OF7A 4BUPA 5H2FC 2HQNA 4EJVA 1AWCA 2HEOA 1IO2A 3MKWB 5EYRA 4EGZA 1SFEA 3HZJA 3IH4A 2CSOA 3SFZA 4FISA 5FJ8J 1EA3A 2ZNYA 3SDGA 4IOCF 3GBGA 2CQKA 3BP8A 1OQYA 4FT8A 4PFOA 4L18B 3OYGA 1R71A 2VJ4A 3FX3A 2WC2A 1V5FA 3M7GA 1H88C 5H6RA 1MJAA 1YX5A 4DW6A 5HVQC 2NNNA 4NHJA 3LSJA 4C3IJ 1P6RA 1MIJA 5E18F 2CW7A 5LFAA 5L3BA 5EGOB 2IP2A 2PMUA 4KUMA 3RI4A 1MMGA 1OPCA 2PFBA 4BQNA 3SYTA 4MLOA 1CQTA 3ISPA 3WU1B 1SFOJ 3GTJJ 2O0YA 1O57A 2Z99A 4AIDA 2E2IJ 2CUFA 3DPLC 3OWTA 5CVRA 5E3MA 4WCGA 4J19A 4DJAA 4BE1A 5IYBJ 2IA2A 2Z2SB 5CVVA 2R7QA 4A3IJ 2X48A 3HIFA 1YJWI 3DPUA 3AG2H 4JOMA 2CFXA 1WJ5A 1POGA 3K69A 4Y33A 4ZYAA 4M72A 1FBQA 1XMAA 4GYGA 3GTKJ 4ENNA 2P7VB 5F0HA 1XGOA 4FE4A 2XB0X 3R60A 5BPDA 4CICA 1TP4A 1ZHFA 3DEEA 5ILUA 4ZJZA 3F8FA 2MFZA 2AS5F 1N75A 4IRHA 4P9FA 4U0WA 1JJ8C 4II2A 2XAUA 3TP3A 2ELJA 5DM6F 3RKQA 1BI0A 4KIGA 2CWEA 2WBMA 4M6VA 4A3FJ 2COMA 1A6IA 1OKRA 3HOYJ 3MN2A 2G0EA 5EJCA 2Q2EB 3CO7C 2FOWA 2KZVA 4LIVA 3K70D 2K3PA 3FXRA 1O3TA 3ML6A 3PL8A 1BN5A 4IL6C 3JREA 3HB9A 3JRHA 2MD0A 4MGRA 4XSZF 4RAGA 1YO5C 4L5EA 3BPXA 5ICFA 1T38A 2HVQA 1YW9A 2STWA 2VBWA 1ERDA 3SXYA 3BLYA 3D5LA 1DQUA 4MFEA 3S15J 1GVJA 1Z0XA 2H1LA 1GXPA 4LOCA 1Y0NA 3CLOA 3ZP5A 1JXSA 1FPQA 3SFIA 2VE8A 2ETHA 3PNTA 1WHUA 3HOVJ 1B72B 3WG9A 2RV8A 2A5WA 2QZ8A 3BQYA 2HNHA 2X6XA 1YQAA 3U2RA 3BT9A 1ONVA 1JKPC 4CCKA 1R23A 2EZHA 4EMSA 3S1QJ 3CF2A 2EZIA 3ZMDA 2DOEA 2ZFUA 2ZKZA 4ZYHA 1Q1VA 1I6XA 5FD6A 4RAZA 1XGSA 3HBLA 5GTHC 2CUZA 4X0GA 2MG4A 5HDKA 4IQJA 2E1MC 4CA0A 3WTXC 3GTQJ 4UV8A 2XF5A 4IKFA 2M5WA 1D5YA 4E7SA 1UAAA 1K61A 1O7FA 5E79C 1NTCA 2X1DA 1XPXA 5JR3A 2KL4A 2KIMA 2VT3A 2ECCA 2PMZN 2WA0A 1VQKI 4OIPF 3QPHA 3I56I 2P0WA 1H0MA 1T98A 1W7PD 2K3FA 1LDJA 2D45A 4A0ZA 1D3YA 1YOVB 4I7HA 4NC6A 2K9QA 3R0AA 1F1ZA 4BXUA 1KZHA 3HUGA 4JP0A 3KP5A 1SAUA 1VQ9I 4UUTA 3T8RA 5F08A 4CHUA 3JRBA 4IQ4A 2F5VA 2VUMJ 5TISC 4GRIA 2DFFA 1IG7A 1EH7A 4BJTA 5HDGA 4MEXF 1OISA 3LMMA 3GTGJ 4IHTA 3CDIA 3QODA 2L7FP 1FOKA 3EDPA 3FKIJ 1TW2A 3A1YA 4YIFA 3BJAA 3GFIA 3HDDA 4LB5A 1ZG3A 4BHCA 3B6AA 1G4DA 1USSA 4EV0A 4HF2A 4A5MA 4ZDPA 5E1ZB 1N77A 1ETOA 1MMSA 4AUXA 2EPFA 2L4AA 1WH5A 1FIPA 2D5VA 2MC3A 5FLXK 3QAHA 1Y8RB 3JSPA 3FHNA 2R7ZJ 1YE9A 2W7NA 3GO5A 1OCPA 3GTOJ 3I71A 1VQ4I 2XROA 3KPHA 1S5LC 4XKBA 2CV0A 4YG2F 4V2FA 3PSIA 5F0FA 3Q3SA 2DU9A 1RETA 3WE3A 3L00A 3I3LA 3V8KA 4U7BA 1DP3A 5K5QA 2GA1A 4N4NB 2W1OA 2R7WA 3D1NI 1FOWA 4BDZA 1STZA 1TZLA 3HGGA 1R1UA 5A2QK 3A01A 3CP2A 2LFBA 2HTJA 1B9MA 3I5UA 3VSLA 3MKZA 4RBOA 1UZCA 3KETA 2D1VA 1G3WA 4Y7NJ 3GW2A 1P7JA 5EGOA 4W97A 2M8EA 2KRFA 5KK1A 2QSFX 3N97A 2L7ZA 1EJ9A 4E4HA 1K6YA 1G6NA 2F5EA 1VQOI 1RR7A 2O7OA 4Q47A 1P4WA 1ULYA 3K9TA 1O3SA 1IN7A 3TQNA 1X2NA 4RGUA 2Z3YA 2CU7A 2DCEA 5B66C 2AQEA 2W4SA 3DFGA 4RMNA 1S8NA 2Y30A 2OC6A 3S93A 1FEXA 5LEKA 1YW7A 5LGUA 5ICGA 1LDDA 2CV1A 1VQ8I 4ESJA 1K83J 2K02A 1S7EA 2DQLA 3A0HC 3EUHC 1T8IA 1ZARA 1FYKA 3DXJF 4GDFA 3CCSI 2FEZA 2BOLA 4YRVA 3F72A 3A03A 3WODF 1W4MA 2WAEA 3M07A 2XIGA 1SFUA 1FSEA 3LFUA 3LSRA 2XV4S 2IRFG 1FBUA 2LD5A 5EEHA 3TW6A 3Q9SA 1JI8A 1IAWA 4IHSA 2V1UA 4DQ2A 3M1EA 4ZYEA 3S14J 3PSFA 4A0YA 2GOXB 1B4AA 1ZGJA 2FA5A 1QO0D 4P55A 4I6ZA 1YJ9I 1VTNC 5JFRA 1MSFC 2BHYA 1IRXA 4XNFA 3TO9A 2M8GX 1XB4A 2PN6A 4OWRB 2L01A 2LG4A 2GM4A 3BG7A 1TLHB 3CJNA 3H9JA 4IEJA 1L3LA 2KLOA 4Y17A 2VC1A 2ISZA 1WPKA 4B3XA 1P9QC 4QWQA 4XOTA 3HPGA 2ZJPF 3ZR8X 1ON1A 3H3VK 4E7HA 3N05A 3PUFA 3EUHA 4K2EA 3G73A 3RPUD 3W6KB 2A68F 2AXTC 5J8CA 2EA4A 4JYKA 2DLLA 3MZHA 5EG0A 2VC0A 5J40A 2K9NA 4LB6B 1KU2A 3LSPA 2QSGX 4XIDA 3OS2A 2XGEA 1PDNC 2CYYA 3FZVA 4HOBA 3SHFA 5CQEA 5F04A 4FASD 4AM3A 1I5ZA 2L0KA 1MBKA 4LK1F 4YFKF 2ZCWA 1FYMA 2R7VA 4V19K 4E7JA 2XAGA 1YX3A 4P9UA 5IOYA 3ELKA 4WWCA 3K4NA 3TOBA 4RDUA 1FX7A 3MCZA 2X6WA 3MZ8A 3A02A 3MAJA 3M9AA 4JX4A 5E20A 1KU9A 1WRJA 2PMZA 4IRGA 1DU6A 3GMEA 1IV6A 1WCMJ 2AHQA 3FM5A 4AIJA 2P5VA 4PJLA 4Z2YA 1DPUA 4NB5A 4XLNF 4ZYDA 3RPUA 3T0YA 2EFQA 1BA5A 4JK1X 4LG3A 2XB5A 2PJRA 1W5CC 3CMMA 1E17A 4XRSA 2EV6A 4UV9A 2ZXJA 4XONA 3PQKA 2HDDA 1NG6A 2IS4A 4G7OF 2V9KA 4RB2C 3HOWJ 2KZGA 4KA4A 5BS6A 4D7MA 5L3GA 1HC8A 1XDUA 3LWFA 1I27A 4CH7A 4AYBN 5JLXA 1HKQA 4C2MJ 2IGOA 4HX7A 1GDTA 1WZ2A 1XMKA 4FTHA 2W84A 1HQCA 1LEBA 1XN7A 1JUSA 5HS9A 3O2PE 1ZRFA 1MNDA 3ZQCA 2DJNA 1WWXA 4G9YA 2FSWA 2QQBA 2JQ7A 1HXDA 1Z3XA 4XSXF 5FRMA 3HG9A 4RM2A 3LSGA 1A36A 1KA8A 2BHZA 2OUMA 2IA1A 1G8XA 1NHAA 1DGRM 4BNCA 2VN2A 3T5XA 5E17F 1AA7A 2M45A 5GP9A 5E1WA 2MD5A 1UMQA 2FQ4A 2ELKA 4I98B 3BR0A 4LJZF 3OYNA 1FBSA 4XMYA 1T0FA 3HUGB 3RZOJ 3GFJA 1R9TJ 4OIOF 2VXDA 3K4LA 4B48A 2NXNB 3ABLH 4PJ0C 2COBA 2XGCA 4MO7A 3K2ZA 2NVXJ 5FLXZ 4XLEA 3FBNB 4L0ZB 1D0XA 2DPDA 2VQGA 3J80Z 2DFIA 3TGNA 2ZXWH 3K4CA 4NQWB 5TRDA 3F8NA 3ERMA 5HODA 1MBFA 4FETA 1U5TA 2WB1N 3PIOF 3DU5A 4IRIA 4LD5A 3BG3A 3K7AJ 5EEAA 3AFHA 1WH7A 2HR3A 2OD5A 3HSRA 3GLLA 2NS0A 1BJZA 4BHPA 2VKEA 2VXZA 3IHUA 4Q4ZF 2STTA 1BW5A 3CF5F 3L2WA 3C18A 1D0ZA 4UUVA 3LQRA 1K78A 2HWVA 1VNDA 2HPIA 2RQQA 3JAMZ 2P4WA 3BOQA 3I59B 3MZYA 3JRCA 4IPAA 1CGPA 4UVAA 3WU2C 5K5OA 2M30A 5FKKA 2L54A 2TRTA 2KJBA 5DCMB 4HF1A 3DTEA 5KNLA 1A6QA 3RQIA 4NC7A 3L1PA 4HYEA 1W1WE 1OCTC 1UG2A 3OIOA 3AL0C 2ZXIA 2EQRA 3BR3A 4KIFA 3BDDA 2LKPA 2DMTA 3H9QA 1XCVA 3OIPA 1QGPA 4JQFA 2ZO4A 3RCOA 2NYXA 2L9SA 4HLYA 1G3YA 1SANA 3S3MA 1BBYA 1Z6TA 5JVGF 5CYVA 3ZGKA 3SZGA 2R7DA 4BE0A 5M5XJ 2CS3A 2F2EA 2RREA 2NOJB 4D5FA 3H5NA 3CCQI 4AYBA 5HLTA 3K4MA 3H3ZA 3O3KA 1YJNI 4C2TA 2L7MP 2YPRA 4HW0A 2WV0A 2FBKA 1FMWA 1C0WA 5C4JJ 2XVCA 2DT6A 5J4YA 2E2JJ 2DO7A 4RGRA 2R5ZB 2QM3A 1VQ7I 1QHHD 1NH3A 4N9IA 1IXRC 2DA2A 3P9KA 2VLAA 3FXQA 3QPTA 4HDVA 3K1MA 4E7LA 1V55H 1ZGAA 1YFHA 1O3QA 1KU7A 1D5VA 1X1CA 3DF8A 2R5YB 4BXXJ 1QA6A 4G7HF 1U9OA 1ZK8A 4X1EA 2QYOA 2VOOA 4B09A 2J5OA 3R4KA 4HF0A 3ZMSA 4U88A 1IXCA 3CJRB 3DPTA 1TQIA 2LP0A 2ZSIB 3O6BB 2BW3B 3BG6A 1XS9A 3KP2A 3QOPA 4PSXA 5FRNA 1ZR4A 1OCCH 4YEJA 3DBHB 4RS8A 1GXQA 2WWYA 5GAHJ 3VB2A 1BJAA 3S1NJ 1RUOA 5C4XJ 2ZNZA 4IJAA 3H0DA 3F0CA 3CUOA 4X6AJ 2CQQA 4L9TA 9ANTA 4BQQA 3BJ6A 1BR1A 3BR1A 4RLQA 4BGDA 3F23A 3CMAI 2F4MB 2ZFWA 3JR9A 1U6GA 3OIQA 3P9IA 1S72I 3CUQC 1JTYA 3W2VA 1XC5A 2V6EA 4LIUA 4FX4A 1OLTA 1UG0A 1X19A 4A3CJ 5JLWA 3ZQFA 2A6HF 2A5YB 2XAHA 4NBQA 3JAMK 1WJCA 1MSEC 4F52A 2FF4A 2K86A 4KFCA 5K7ZA 5FLMJ 4KT6A 1R00A 1ITYA 4HAMA 2DT7B 2LDUA 2ADUA 4A3GJ 4ETSA 1BI2A 2A6TA 5CVJA 3N4MA 1KYWA 3JRGA 5E8GA 3ZCOA 3FISA 2V7FA 2VJIA 4HNUA 3VSKA 4BACA 1WQ2A 3WTWC 3WGHA 1V4RA 1V5GA 4PGGA 3MD2A 2GLOA 2E1CA 4BEHA 3P5JA 3GZNB 3TDZC 2OZUA 2YU3A 1J75A 2HQRA 3RDIA 1IZ1A 1UCRA 4BJ5C 2LVSA 2X1CA 2LLKA 4A3JJ 1JKOC 1QHGA 1GVDA 2V1NA 2VPRA 1Z77A 2JRMA 2XPUA 4IVNA 1K4TA 3BY6A 4HRIA 2QENA 3K70C 2F6CA 2K7LA 3B73A 1LE8B 1YIJI 2E5NA 3AG1H 3K0LA 2X51A 1ZTRA 1SD5A 4I0BA 1P2FA 1V54H 3S3NA 1TTYA 4XKWA 4J01A 3KP6A 1WSUA 1LNWA 1MNEA 4S04A 2BVLA 2PJRB 2CQNA 1L0OC 2DI3A 1A31A 1P4AA 3IL2A 1EH8A 4HDUA 2CGPA 2LY2A 2HYGD 4XLPF 5FD5A 3KLNA 2P5LC 2VODA 3H36A 4BS9A 4I2OA 3F22A 2R93J 1PP7U 4UVCA 1U8RA 2GZWA 4RB3C 2LH9A 2IA0A 1MH4A 4KMFA 4A12A 2M0CA 2VBZA 3S2HJ 1OJLA 2HYFA 5HLIA 1UHSA 1FOYA 4WXCA 3OYEA 3CCUI 3SDBA 1JT6A 4Y3OA 4Y13A 3BG9A 1WVRA 2B63J 2OAZA 1X4PA 3KZYA 3J7YJ 1WI3A 1T6SA 1Z9CA 4W1UA 1MKMA 2LBFA 3CCLI 4QTRA 1ZAOA 4XQFA 4I99C 4IHXA 4ZDOA 5GPAA 1W36D 4XOPA 4E7ZA 1RKWA 3LQQA 3OYBA 2EFOA 3H5RA 1MW7A 4RAFA 1ZQ3P 3DLLF 1BM9A 4RB1A 3WTYC 4XK4A 2QLZA 4QSHA 2R7UA 3WHBA 4QPQA 3I54A 4MNUA 3NARA 2CW0F 3CCVI 4ZTJA 2OJED 3W6JB 3DWLE 1IN6A 2EILH 2L3DA 4V2GA 3PUBA 1OCOH 3KIOA 5EEGA 2OCCH 3ONQA 3DLAA 5DCFA 1TT0A 3CDLA 1LFBA 1QZYA 2KHMA 3CCRI 3OOPA 2Y0SA 4AIKA 2KMUA 5TJJA 1MDMB 1HLVA 4L9VA 5E1XA 2ME6A 2DA3A 2FXAA 3ABKH 2XGDA 3U1KA 1JJ6C 3ASNH 1V3FA 2ZMEA 1PVEA 3KYLA 2MH2A 3GTMJ 1P92A 2DJIA 2LKSA 3EUKL 2DA5A 1FC3A 4LMYA 1U8BA 2JA6J 3KEQA 4XR6A 5AIPA 3HOUJ 4HX8A 2XUBA 4XBFA 2R92J 5JHUA 3OYMA 3OYIA 1HOMA 1W36C 4AC0A 4R79A 3J80K 3QPLA 3OYLA 1SD7A 3DBRB 1ON2A 4ZH4F 2O03A 2R0QC 4U87A 3LL7A 3U9GA 3U1DA 1SAXA 3CJTB 4ASNA 3ZQIA 2F48A 1E2XA 3GTLJ 1FZPB 1T0FC 3ZMUA 1TT5B 1X1AA 2E34A 2QQ8A 2XAFA 5HDNA 1I3AA 1I39A 2LY1A 2E35A 4A6EA 5J47A 2MC4A 4CCJA 1VQ5I 2HXOA 2X1EA 2PLYA 1MBGA 4R1HA 2I10A 4I01A 4M6YA 3K4KA 4WXHA 1Y1WJ 2E1MB 1GUUA 3GCMA 4DIQA 3OYFA 2HDCA 3C2GA 1WKMA 3CMEI 1H9TA 4YELA 3GFLA 3C1DA 2Z9OA 2VQLA 2YX7A 2EIKH 3E6BA 3S3OA 1YI2I 4PJJA 1U78A 1JGGA 1HBXG 2VONA 4HNTA 5DS9A 1ETQA 1QZZA 1B9NA 4PJNA 2WY8Q 4ESBA 1BI1A 4M6XA 2H09A 2PJPA 1JGSA 2M4KA 1VQLI 5M5YJ 1Z7UA 4ON0A 2Z5UA 2LC2A 3E5QA 2JA8J 1IUYA 2KDZA 3J7AY 3ABUA 3K2AA 1Y6IA 1LFUP 4DOZA 1HKSA 1A5JA 3NWSA 3FK6A 2EZKA 3E3VA 5L3FA 5K7FA 1WJAA 4UB6C 4EQQA 1UFMA 1FT9A 2LRDA 4QLCU 1UB9A 1Y1VJ 3E0JB 5FFZA 2LF7A 3IV5A 3IH2A 1AU7A 1W0TA 5LEJA 4A69C 4PGHA 3RKWA 2O8KA 3HGYA 3MKLA 3D5SC 3CCMI 3WHCA 5FFXA 2DTZA 1R1TA 2MABA 2W00A 1FNNA 1OCRH 4CYCB 1FP1D 2OQGA 3R61A 1IRFA 5HNFA 2EA2A 2YX4A 4DYRA 4LGWA 4E6KG 2HS5A 2W85A 2RC4A 3RKXA 1SC7A 4CGZA 4XM3A 4I02A 4HEA2 3OYDA 4M9ZA 2VKHA 4RAYA 2IT0A 2JSPA 3T8TA 1S9HA 3GWZA 4G12A 2PEXA 3KE2A 2DODA 4CXFA 1JKRC 1YTYA 4KYWA 1IW7F 2FE3A 3HOSA 1X1DA 3ZOBA 4KITB 5LGNA 4PSWA 2QF7A 3GVAA 3SZPA 1CF7A 1XMXA 1YRNA 4ZTFA 3GZ6A 1O4XA 3JCUC 3RKYA 4M9SA 2B0LA 5CKTA 3TO7A 5HNHA 1MJBA 1D1CA 3OOUA 2X6YA 2E19A 4WXDA 2K9LA 2GBYA 4PDKA 3FK7A 1R5ID 5DCMA 5BNGA 1IDZA 2PBIA 3KZZA 1PJRA 2IGNA 2L9VA 2MYSA 2LTPA 3TP0A 1IV8A 5GPCA 3LSTA 1BIAA 1WFXA 2KKOA 1PYVA 3OL4A 1ZLJA 2DA6A 3M8FA 3PNYA 5BMZA 4M3GA 1B8IA 1FMVA 2HQ5A 3QYFA 1MH3A 1HKTA 4BAYA 2DT5A 1F36A 1LFPA 4B1RA 4D7NA 1YLFA 2VBYA 2K4JA 4MIMA 2BGCA 2JUCA 3VYSB 2QEXI 2JA2A 2K4BA 3DV8A 4OAYA 3WG7H 2HI3A 4LLLA 2GAUA 3BTIA 3FM3A 3EYIA 1QPMA 1R5GA 3L09A 4D5CA 4LG0B 3I58A 2QVOA 2HYJA 5KCMA 2FNAA 1EF4A 4GGGA 4ZZLA 3WU0A 2DA7A 2JSCA 4NNJA 4RGSA 4HV6A 6PAXA 1R5HA 2CUEA 2IEKA 3ABMH 1DU0A 1BOAA 1KYZA 2W24A 3H9GA 4OIQF 1O7LA 3CDHA 2HDWA 1VQ6I 2V79A 3HEFA 2A6EF 3LNQA 1SFKA 2V9PA 2EFNA 1HW5A 1OMIA 2UWMA 1GLNA 1TWGJ 3ASOH 2JRTA 2EWNA 1UELB 1SVLA 2VASA 3F8MA 3RTRA 5FROA 3Q9VA 3ZPLA 3JRAA 1J9IA 3HJEA 3V7CA 2DOAA 3I59A 5DD8A 3IC7A 2DA4A 1LPQA 2NVTJ 1UJ8A 3AL0B 2FRHA 1GHCA 4RB0A 3I0TA 1AOYA 4Q48A 1RIOH 2BY3A 4YFNF 2XF7A 1G2HA 1G3SA 4WK8F 5LGTA 3BR2A 1J2XA 1N78A 4WF2A 2PI0A 4E70A 2GIZA 4UUSA 5E8IA 3S16J 5A2QZ 3B02A 3W2WA 3K4BA 5CQGA 3E5UA 2R7SA 4GXOA 4RA2A 3KEYA 5M3MJ 2ESHA 3IAS2 1APLC 2RKHA 3WTSC 2V1XA 3RZDJ 2EZLA 3KEOA 3LAJA 4D1QA 1H89C 3S2WA 3QPSA 2R7OA 3IH3A 2UXNA 3QP6A 3QRFF 2FUG2 2Z1DA 5HOOA 3GTPJ 3E1SA 4NDLA 4BY1J 4O6JA 3ZQ7A 3BQZA 4DYQA 2GOMA 2Y31A 3LA2A 5D5WB 3MKYB 3VEPA 1F4KA 3TOAA 1ZG5A 3LSMA 1WJEA 3CCJI 3DQVC 4AVPA 2ID6A 4UXNA 2A05A 3ZN0A 1ZN2A 2VBXA 2VIXA 4UY8I 2YSRA 1VF9A 2NS7A 3WTVC 4H4KC 2OPTA 3LAPA 2Z33A 5AIQA 1ETWA 4KDPA 4IXAA 4Q5SF 2Y0SN 3Q5FA 4EJOA 4L0YB 3QYBA 1LUJB 3QU3A 4HQMA 3ZXSA 2KIUA 3VDXA 5D4RA 3I4PA 1YS6A 1IGNA 1DUXC 2QWWA 1ZYRF 2XHKA 3SQNA 2JPBA 3VODA 4XN0A 2I8DA 2R7TA 3C3WA 3IUOA 4M9XA 3CUQB 2E71A 4LITA 1XGNA 2XRNA 2UUZA 5IY5H 3FDYA 1TQMA 2R5YA 3JTHA 2QUFA 1XD7A 5M3FJ 2MLKA 3KYDB 2IS2A 3PQJA 2DA1A 3OY9A 1YHQI 4BEHB 2CQ7A 1JHFA 1R36A 2OQRA 3A4CA 2C6YA 1K4SA 4HSTA 3HHGA 3JRIA 3NRVA 3S8PA 5HS8A 4MQ9F 4YFXF 4M3DA 3FXUA 5KAFC 2MA3A 3RSNA 4F3QA 1FSHA 1ZRDA 3H1CA 2JA7J 2Y75A 3E6CC 1QPIA 2XKOA 1I6HJ 2PQ8A 3FWEA 4XLHA 4NQWA 3X2QH 3F21A 2H94A 2KIFA 2J5PA 4KT5C 3DTKA 4I0AA 4IX7A 1W7PA 4HX4A 4N9HA 2GQQA 5GADJ 3OV8A 3VOEA 2HQAA 5FKMA 3IKTA 1WJBA 1XSVA 3M3YJ 4FX0A 2F5CA 3BR5A 2CH0A 2FBHA 1Z05A 1QVTA 3OMYA 1IDYA 5C44J 3AAFA 3BWGA 5IT9K 1T95A 4LFUA 3KYCB 3FXOA 1UHWA 2IJLA 2BXZA 4GYIA 4Z6YA 2Z16A 5F1JA 4EGYA 1D1BA 3WGIA 3J81K 4EM0B 4NC8A 1JTXA 2FJ1A 4FQGA 2FQ3A 1X58A 1X1BA 2CJJA 1UHMA 2BXYA 2IVMA 3KP7A 1TWCJ 3JTGA 2Y9ZA 4GCVA 5J1UA 1JE8A 2Q8KA 5DTDA 2JWTA 2IW5A 5EDNA 5IYCJ 2NNYA 4JX6A 4C30A 1I1GA 2LYCA 5HS7A 2LBFB 4Y4RA 5D4SA 3OYKA 3OSGA 2ELHA 3QOEA 3S1RJ 2BBYA 4KNYA 1U3EM 2WV1A 1HW2A 1WJFA 2VJJA 3KP3A 4O5VA 3I4NJ 5IOZA 4EM2A 1D1AA 4XLAA 3BJOA 3CUQA 4AD9A 1EKEA 2Y69H 2BE5F 1QU3A 2HOEA 2BVMA 2X6OA 1RNLA 1XG1A 2AQFA 3DEUA 3ZRGA 3K6GA 1MD0A 3BC8A 2IBDA 2NOGA 1ETYA 3AG4H 4AIHA 4LLNA 1R22A 4BU2A 2RGVA 1R49A 2Y2ZA 4KIBA 1AKHB 1W7PB 1HF0A 2HGCA 4XKCA 2WTEA 4M3EA 2R5ZA 4G94A 4OMZA 1FLIA 4G7ZF 4DNCA 2M7BA 3LSHA 1ZG1A 2JN6A 4B43A 4HLXA 2FMLA 4ZC3A 2DK5A 4G6DA 4OAZA 1H9GA 1TW3A 3PNVA 5IP7J 1YW8A 2DK8A 2P5KA 3TKYA 4FCYA 3G2BA 4S05A 1MDMA 2HKOA 2EV0A 2DTRA 2MW8A 4MTDA 5K1YA 1IXSB 1ZRCA 1TNTA 4RM3A 4MTEA 2E7WA 2NAZA 3DKXA 2UZKA 3VPRA 1F5TA 5CVIA 2QBYB 5ERIA 2LR8A 4ABZA 5GTIC 3EYYA 2B9SA 4XL9A 2W48A 2DN0A 3F6VA 2GWRA 3FXKA 3GF2A 2ZXHA 4KICA 4UHTA 3UNGC 2KIQA 2L5QA 2ZSHB 3SEQA 4CUGA 4BJ6C 5L3CA 1XCBA 5D8LB 1MMAA 1U2WA 1DGWY 2XKPA 2ZMEC 1SMTA 3K10A 3V4GA 3S32A 4MFDA 3VFZA 1LDKB 1DDNA 3R6SA 3G4SI 3WGGA 3CD6I 3GX4X 1QQIA 2QCOA 2EFWA 2QQ9A 1PP8F 2XGXA 2K9SA 2VKVA 5EZGA 4YIRX 1R6RA 2BYVE 1IC8A 4B8XA 2MGQA 2BY0A 3OS1A 3S17J 2G9WA
chains in the Genus database with same CATH topology
4XNFA 1IRXA 2E5ZA 3D5RC 1T0FC 4OWRB 2OV7A 1X1AA 2LG4A 3BG7A 3H9JA 2KLOA 2LY1A 2MC4A 4CCJA 2IXSA 1LVKA 1OR7C 4II3A 2X1EA 4B3XA 1P9QC 4XOTA 3HPGA 3SEZA 4QPOA 3ZR8X 3K4KA 4E7HA 3N05A 2E1MB 5CPRB 4DIQA 3OYFA 3C2GA 3EUAA 2KRCA 3RPUD 2LOOA 4F93B 4RLFA 4YELA 4EATA 2CFOA 3DKYA 2VQLA 3DU6A 3S3OA 2CMPA 4PJJA 2R7XA 4HNTA 3OS2A 4ANJA 2F4IA 4B44A 4PJNA 2WY8Q 5CQEA 4FASD 3HOTA 2BW3A 4F91B 2M0MA 2M4KA 2IGMA 3M1CA 2R7VA 2LC2A 1Z21A 3H5AA 4XN3A 3H35A 3CZ6A 4E7JA 3J7AY 1YX3A 1U0JA 1ZELA 2M4GA 2LREA 2XC7A 4XKVA 1Y6IA 3K4NA 4DOZA 4IZZA 3L2RA 4DBQA 3PFYA 4DBRA 2X6WA 3NWSA 4N4OB 4B47A 4F92B 1WJAA 2JVHA 2LRDA 3E0JB 2PMZA 4XORA 4BE2A 2CV2A 3K4JA 4PJLA 4XLFA 4F55A 4CCNA 3D5SC 4LG3A 2PJRA 2MABA 2W00A 3CMMA 2W82A 3VWBA 3LSIA 4XONA 1KONA 5HNFA 1NG6A 2IS4A 2VB6A 2V9KA 2XSJC 3NWTA 4E6KG 3TMOA 1Z3YA 3OS0A 3VYUB 3QYEA 4XM3A 1Z7LA 4CH7A 2L9NA 4CZCA 4HEA2 3OYDA 4J00A 2IGOA 2VKHA 2JSPA 4DGWB 1S9HA 2IS1A 1MNDA 2VKDA 2VQHA 3C2HA 3HOSA 1X1DA 3F9KA 4KITB 4PSWA 2UV1A 1Z3XA 2R7RA 5FRMA 3HG9A 2VPLA 1D0YA 4RM2A 2E60A 3LSGA 3RQ4A 4ZTFA 3I9V2 2OUMA 5CKTA 5HNHA 3HXLA 1G8XA 1DGRM 1D1CA 3OOUA 2X6YA 3IP4B 1AA7A 3OR2C 4C2UA 2K9LA 2WADA 4NUBA 3OYNA 1BOBA 2KQRA 4XMYA 3L2QA 3HUGB 1PJRA 4PUSA 2IGNA 2MYSA 2VXDA 3K4LA 4B48A 3TBIA 1Y56A 1WFXA 4XLEA 1PYVA 3FBNB 3OL4A 1D0XA 3PNYA 1FMVA 2VQGA 3OYHA 3K4CA 3QYFA 4NQWB 3L2VA 2HVSA 4FETA 4HG2A 1LFPA 1HA8A 1G59A 3DU5A 3VYSB 3AFHA 2JA2A 4OAYA 2VQCA 2WB1A 2VXZA 3IAM2 3UR3C 1D0ZA 3L2WA 4KISA 4BUPA 5TGTA 5KCMA 4AVZA 5KHDA 3AKZA 4BL0B 2HPIA 2RQQA 4NNJA 2K9MA 3MKWB 4D9JA 3H9GA 1WJDA 3U21A 2RNGA 3OL3A 2HDWA 1EA3A 3BCAA 3DTEA 2X85A 3GBGA 5KNLA 1SFKA 4NC7A 3VYTB 3W3CA 4PFOA 3OYGA 1MMNA 2VJ4A 1V5FA 4ZDLA 2UWMA 3AL0C 1GLNA 2ZXIA 5HVQC 1YX5A 1UELB 2V26A 2VASA 3RTRA 5FROA 4BQOA 5LD2C 1NG7A 2CW7A 5LFAA 3H9QA 3OIPA 2DOAA 1MMGA 2JUGA 4JQFA 3RCOA 4BQNA 3SYTA 3AL0B 2L9SA 4MLOA 1E0EA 4P1WA 2HPMA 3S3MA 2XF7A 3ZGKA 3SZGA 4BE0A 1N78A 2CS3A 3DPLC 3OWTA 2RREA 2NOJB 3H5NA 3W2WA 4AYBA 3K4BA 3K4MA 5CQGA 4DJAA 5HLTA 4BE1A 4C2TA 2Z2SB 2R7QA 2R7SA 2Q1ZB 3DPUA 3KEYA 1FMWA 4P5OA 4JOMA 3IAS2 1WJ5A 4Y33A 2DT6A 4ZYAA 2M3AA 1QHHD 2VLAA 4D1QA 1J09A 2V4JC 3DEEA 1VZ0A 4ZJZA 4E7LA 2MFZA 1N75A 2R7OA 4II2A 2XAUA 2FUG2 2M7AA 2Z1DA 2ELJA 1X1CA 5HOOA 2XF6A 4BDYA 3E1SA 2WBMA 3L2UA 4AU7A 2GOMA 2HU9A 3EPZA 2IS6A 2Q2EB 3MKYB 2KZVA 4LIVA 3K70D 3LSMA 1WJEA 2K3PA 3DQVC 3CJRB 3CESA 3HC7A 3DPTA 3PL8A 2ZSIB 2BW3B 2KP6A 3BG6A 2VIXA 2MD0A 4PSXA 5FRNA 2JVGA 4H4KC 2R4GA 4YEJA 1V5EA 3KX2A 2HVQA 3VYRB 4CCOA 2WAQA 1ERDA 3BLYA 3D5LA 1DQUA 4HPQA 3QYBA 3ZXSA 2CUJA 3M8JA 3H0DA 3VDXA 3PNTA 3OR1C 3PJRA 4BQQA 2A5WA 2HNHA 2X6XA 4XN0A 1BR1A 4RLQA 4BGDA 2I8DA 2R7TA 4CCKA 4XLCA 3OIQA 3CF2A 3IUOA 4LITA 2VJ5A 2KPMA 3W2VA 2IGKA 2ZFUA 2V6EA 4LIUA 1OLTA 1UG0A 1X19A 2UUZA 3FDYA 1X4OA 4BXFA 2CUZA 4X0GA 3OYCA 3HL2A 2E1MC 4IQJA 2IS2A 4CA0A 4E7KA 3OY9A 1WJCA 2XF5A 4F52A 1BR4A 4BEHB 3A4CA 4IKFA 4G6TB 4E7SA 1UAAA 4HSTA 4KT6A 3V42A 2X1DA 3S8PA 2DT7B 2KL4A 3RSNA 4F3QA 2WA0A 2A6TA 4CSWA 3ZCOA 2P0WA 2V7FA 2VJIA 4XLHA 4HNUA 3VSKA 4BACA 3DTKA 4CCLA 4IX7A 1V5GA 3MD2A 4BEHA 4C9YA 3LSKA 1LKXA 1SAUA 2HQAA 1WJBA 2CH0A 2F5VA 4IQ4A 4PK4A 4BJ5C 4GRIA 3OMYA 4BJTA 2X1CA 1T95A 3ZQQA 3HKZA 3LMMA 1QHGA 2KDOA 3QODA 3OYAA 2Z16A 1D1BA 3A1YA 2V1NA 4NC8A 4HRIA 4PJMA 3K70C 2F6CA 1X1BA 3FBIB 3HPHA 3CJQB 4PFPA 2E5NA 4HSRA 2X51A 2QKLB 4ZDPA 1N77A 3MMYB 3S3NA 4KJZA 4C30A 4XKWA 2LYCA 4J01A 1MNEA 2LBFB 2BVLA 2PJRB 4Y4RA 3OYKA 3QOEA 2L7KA 2KRHA 3FHNA 1YE9A 2W7NA 1WJFA 2VJJA 3A2KA 2LY2A 1D1AA 4XLAA 4XKBA 2CV0A 3BCBA 3PSIA 2WAFA 1QU3A 2BVMA 4BS9A 2AQFA 2K5CA 3ZRGA 3I3LA 3K6GA 3BC8A 4U7BA 1DP3A 2LH9A 4BU2A 2QKMB 4N4NB 2W1OA 2R7WA 4BDZA 1TZLA 4XKCA 5JHFA 4CCMA 3CP2A 3OYEA 2L2OA 2M7BA 3SDBA 3LSHA 4B43A 1MMDA 3VSLA 3MKZA 4Y3OA 4ZC3A 2VL8A 3W2AA 4OAZA 3DTIA 1X4PA 2LBFA 3PNVA 2DXIA 4E4HA 4XQFA 1K6YA 4ZDOA 1W36D 4XOPA 4E7ZA 3OYBA 3G2BA 2CW8A 3H5RA 1MW7A 1BR2A 4RM3A 2R7UA 3DKXA 4QPQA 4ITVA 2DCEA 4ZTJA 2AQEA 2W4SA 3DWLE 4E7IA 4XL9A 3PUBA 4RMNA 3ONQA 3DLAA 1TT0A 2HZDA 2OC6A 3S93A 2KHMA 2ZXHA 2Y0SA 2CV1A 3UNGC 2KMUA 2L5QA 2ZSHB 3SEQA 3EUHC 3FKJA 2O5RA 4BJ6C 2WY7Q 4CUGA 1MMAA 2HVRA 1DGWY 3KYLA 2BOLA 3K10A 3S32A 4YRVA 2DJIA 2WAEA 3EUKL 1LDKB 3TL4X 3LFUA 3CP8A 4XR6A 3OYMA 3OYIA 1W36C 1JI8A 3OYJA 4R79A 3OYLA 3PSFA 1R6RA 2GOXB 4U87A 3LL7A 3OS1A 2XDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7N A;  5CKT A;  3M8J A; 
#chains in the Genus database with same CATH topology
 2LNB A;  4IF4 A;  3HRM A;  2PX9 A;  3PFI A;  1J5Y A;  5BOX A;  2DYS H;  2OV7 A;  3REO A;  2NVU B;  4P96 A;  2GXG A;  3NAU A;  4M74 A;  1LJ9 A;  1LVK A;  2IXS A;  3WTU C;  3A01 B;  1RRJ A;  3W6V A;  4A93 J;  5J8F A;  2BY2 A;  3HRT A;  3GLX A;  2A3S A;  1RES A;  4QPO A;  1OYW A;  1MGT A;  2QQA A;  2O3F A;  3I53 A;  3EUA A;  5D8K B;  5BPI A;  5K7H A;  3HTS B;  2LOO A;  1ZKG A;  4RLF A;  3FIW A;  4EAT A;  2N8G A;  3BZ6 A;  3DU6 A;  3MFK A;  1Y0U A;  2CMP A;  1RPW A;  4CYC A;  2R7X A;  2DAO A;  4HA8 A;  3RYP A;  2V9V A;  5KAI C;  2GA2 A;  2ZJQ F;  2OZ6 A;  4ANJ A;  4B44 A;  3NEU A;  4A5N A;  4IO9 F;  2EIM H;  2BW3 A;  2G7U A;  5BQT A;  2M0M A;  1OFC X;  3R0J A;  1VFC A;  2IGM A;  1P4X A;  2ZB9 A;  3H5A A;  1Y39 A;  4XN3 A;  3H35 A;  3F8C A;  1FY7 A;  2M4G A;  1ZEL A;  4IZZ A;  1GT0 C;  1NK2 P;  1RUN A;  4Y52 J;  4C3H J;  2EIN H;  1EH6 A;  4DBQ A;  1U5T B;  3L2R A;  1HST A;  4ZYG A;  4UNO A;  2Q2E A;  5DUK A;  1H8A C;  3G6E I;  3OSF A;  2H27 A;  2X9D A;  1QZE A;  5E3O A;  2F5F A;  2FD5 A;  4XOR A;  4BE2 A;  1J0R A;  3K4J A;  3LFK A;  4D0P A;  4G6Q A;  5GAE J;  4QIW N;  2HOT A;  2W57 A;  1ETK A;  1K78 B;  3E97 A;  4CCN A;  3GEZ A;  2L9R A;  3TED A;  1Z91 A;  3HSF A;  2LF8 A;  4ENJ A;  3LSI A;  2H6B A;  3RPQ A;  2ISY A;  1T2K A;  2PG4 A;  1SD6 A;  2NRA C;  2VB6 A;  2XSJ C;  2JK3 A;  3TMO A;  1Z3Y A;  4IHV A;  1TL8 A;  1YRN B;  2YS9 A;  3VYU B;  4LLG F;  3QYE A;  1TNS A;  4M3F A;  1M1E B;  4UB8 C;  2L9N A;  4KMU X;  2EB7 A;  4J00 A;  1ZGW A;  4A3B J;  3KCC A;  2QBY A;  4DGW B;  2TCT A;  2IS1 A;  3WTZ A;  1KQ8 A;  2QGU A;  4BHB A;  3D0S A;  2ZJ2 A;  2FNP A;  4OU0 A;  3PIP F;  1B72 A;  1KQ0 A;  2ME0 A;  4L5J A;  1QVU A;  3EET A;  2VOP A;  4N0B A;  2UV1 A;  2R7R A;  2VPL A;  1D0Y A;  1HDP A;  3H92 A;  4AWX B;  3RQ4 A;  2P7C B;  1YIO A;  3I9V 2;  1KU3 A;  3I64 A;  1D8K A;  1OYI A;  3HRU A;  5B5E C;  2R7F A;  2HTS A;  2JMW A;  1GV5 A;  3E6M A;  4BY7 J;  3OR2 C;  4C2U A;  3M8E A;  5FKL A;  2F4O B;  4M73 A;  1VQN I;  3FXJ A;  2JZY A;  1BOB A;  4A2U A;  2KQR A;  4I09 A;  3LA3 A;  5L3E A;  4PUS A;  3L2Q A;  2KJC A;  5FO5 A;  1R7J A;  5FKN A;  3ULQ B;  3TBI A;  1ODD A;  2EBI A;  2NS8 A;  3CTA A;  2ZC2 A;  3S2D J;  4HG2 A;  3LA7 A;  1HA8 A;  3RJP A;  4BH9 A;  1G59 A;  2LK2 A;  3V7R A;  1VI0 A;  2HFH A;  1TC3 C;  1ZR2 A;  3K1P A;  1ACI A;  3DEW A;  2VQC A;  1HCR A;  2WB1 A;  3FHZ A;  2E1N A;  5DYM A;  2EJR A;  5LHI A;  4PCQ A;  3J81 Z;  4TV7 A;  3MWM A;  1N25 A;  5TGT A;  4XRS G;  4KIS A;  4AVZ A;  5KHD A;  3AKZ A;  4BL0 B;  4CDG A;  1LQ1 A;  5JVT A;  5FKO A;  1DPR A;  2K9M A;  1B8I B;  2K40 A;  2DW4 A;  1GV2 A;  4D9J A;  1MBE A;  1WJD A;  3U21 A;  2RNG A;  3OL3 A;  1Q1H A;  3E7L A;  5FB2 A;  2EIJ H;  3KFW X;  3BCA A;  3H0G J;  1TWF J;  3WE2 A;  2X85 A;  1S3J A;  2UXX A;  3JRF A;  1S6L A;  2H1K A;  3VYT B;  3W3C A;  1FIA A;  1MMN A;  4ZDL A;  4BQO A;  2V26 A;  2JJ7 A;  4EJW A;  5LD2 C;  2WAQ N;  1NG7 A;  3QWL A;  5IPA A;  3KZI C;  3HTU A;  4CZZ A;  3G1M A;  5CVU A;  2JUG A;  3BR6 A;  1MBJ A;  5J6X A;  2OTJ I;  1Z67 A;  1E0E A;  2JTV A;  2JPC A;  1W5T A;  2K85 A;  4P1W A;  2HPM A;  2MBF A;  1R1V A;  1T33 A;  1TQP A;  3FXM A;  4OOI A;  1X3U A;  3CLQ A;  2QA4 I;  2EV5 A;  2M2E A;  3NQO A;  2Q1Z B;  3BZC A;  4P5O A;  3L7W A;  2DOF A;  3UKG A;  3HRS A;  4O3M A;  4OMY A;  2M3A A;  3ZQG A;  2CQX A;  4MHG A;  4XIC A;  3WTT C;  1J09 A;  3G1O A;  1X3Z B;  2V4J C;  4U0Y A;  2GXB A;  4EJT A;  1VZ0 A;  1MBH A;  2ID3 A;  2M7A A;  3DKW A;  3HM5 A;  3MQ0 A;  2XF6 A;  1LEA A;  4BDY A;  2ACJ A;  2DFH A;  1RZ4 A;  2JA5 J;  3L2U A;  1R4N B;  4AU7 A;  2HU9 A;  3EPZ A;  2IS6 A;  4EVI A;  2YU9 J;  1S7A A;  1BL0 A;  1LB2 A;  3RIR A;  1TBX A;  2F5D A;  3CES A;  3HC7 A;  2KP6 A;  1VQM I;  4C3J J;  1U5T C;  2JVG A;  2E36 A;  2P8T A;  2V1D A;  2R4G A;  5DD4 A;  1V5E A;  3KX2 A;  3VYR B;  1SEU A;  5B1B H;  4CCO A;  2WAQ A;  3RYR A;  4EEF G;  2OU2 A;  4UUS B;  1O3R A;  2RNJ A;  4HPQ A;  3LOC A;  2CUJ A;  3QU6 A;  4S0H B;  3M8J A;  2R3S A;  3HHH A;  3V7S A;  1RKT A;  3OR1 C;  2MSY A;  4LK0 F;  3PJR A;  2M1B A;  3MVP A;  4DZJ A;  3HSE A;  4G8X A;  1YS7 A;  2XPW A;  2XAS A;  2RQP A;  3C7J A;  4XLC A;  2FBI A;  4L9N A;  2VJ5 A;  2KPM A;  4BBR J;  3ZMV A;  2IGK A;  2L4M A;  1BI3 A;  1RI7 A;  2W25 A;  1B6A A;  2RAE A;  4ENM A;  1X4O A;  4BXF A;  5D6F A;  4YII A;  3OYC A;  3HL2 A;  4XRM A;  4E7K A;  2I5U A;  4A0X A;  1BR4 A;  1HSJ A;  3ERE D;  4G6T B;  2YUS A;  3V42 A;  3S1M J;  1G3T A;  1SVM A;  1OR7 A;  1MNM C;  3I55 I;  2VI6 A;  2BEO A;  1HW1 A;  2DBB A;  2Y48 A;  1BW6 A;  1B1B A;  4ENK A;  4CSW A;  5F6F A;  2A69 F;  3BTJ A;  1R4M B;  4CCL A;  2ESN A;  1K79 A;  2MH9 A;  3TO6 A;  1KGS A;  3PO2 J;  2GXA A;  4C9Y A;  2DDA A;  3LSK A;  1LKX A;  3ZQH A;  5M5W J;  3BG5 A;  5ILS A;  3G3Z A;  4PK4 A;  2H6C A;  1QBJ A;  2DYR H;  4B3A A;  4A3E J;  1SVO A;  1TWH J;  3ZQQ A;  3HKZ A;  5EG0 B;  4UVB A;  2KDO A;  3FXL A;  3BPV A;  3OYA A;  3BRO A;  4M71 A;  3DBL B;  5IP9 J;  1SD4 A;  3FMQ A;  4MQV A;  3A0B C;  1REP C;  4PJM A;  2Y0M A;  3FBI B;  3HPH A;  1PUF B;  3CJQ B;  4PFP A;  1XSX A;  4HSR A;  1YG2 A;  2HOA A;  4FE7 A;  4DYC A;  3IRQ A;  2QKL B;  2RDP A;  4F7Z A;  5GAG J;  3Q0V A;  1E3O C;  1J7K A;  3MMY B;  2O9L A;  4KJZ A;  2BV6 A;  4ESF A;  5ICE A;  2DQR A;  3M4O J;  1AKH A;  2OTL I;  5ICC A;  2L7K A;  2TDX A;  5DV5 A;  4BYY A;  3Q0W A;  1X2M A;  2KRH A;  1IF1 A;  4M3B A;  1SMY F;  3Q0U A;  5HLH A;  3JRD A;  3A2K A;  4H0E A;  3BCB A;  2WAF A;  1BC7 C;  4OIN F;  1QRY A;  5LRR A;  2K5C A;  3ESW B;  3IKV A;  3CC2 I;  3BZK A;  2A07 F;  4WX9 A;  5D6E A;  1FYL A;  1PUE E;  2ICW G;  3HOX J;  2XAQ A;  2QKM B;  4GO1 A;  2EFP A;  5J3L A;  1S29 A;  2E1O A;  1SFX A;  5JHF A;  4CCM A;  3G1L A;  2L2O A;  3CO6 C;  2HOS A;  2LMD A;  1Z6R A;  4HBL A;  1Z1D A;  3CC7 I;  3SZT A;  1MMD A;  3COA C;  1JT0 A;  1JUP A;  2XAJ A;  4FHT A;  2VL8 A;  3W2A A;  3DTI A;  3O8G A;  3L2C A;  3CQZ J;  2OCE A;  2VT2 A;  1ETX A;  3CCY A;  2P6S A;  4A3L J;  3K1N A;  2DXI A;  5H6Q A;  4A3M J;  4KN7 X;  1FP2 A;  3ZMT A;  1J59 A;  3GZ5 A;  3C2B A;  2CW8 A;  3QQA A;  3ABT A;  1YYV A;  5H20 A;  2GIV A;  1IRZ A;  4HQE A;  2DFE A;  5B1A H;  4U7D A;  2FX0 A;  5CLS A;  1W0U A;  1WGX A;  1B59 A;  1BR2 A;  5F1R A;  2EH3 A;  3F8B A;  3I4M J;  5L3D A;  3IWZ A;  4ITV A;  1ORK A;  1U9N A;  1FTZ A;  3KP4 A;  2LY9 A;  3V8L A;  1VQP I;  4BBS J;  5EF6 A;  1ETV A;  4E7I A;  1W5S A;  1WI9 A;  2P6T A;  4HV5 A;  1IN8 A;  2HZD A;  3V8J A;  3E5X A;  1KQ9 A;  2FMY A;  4HZF A;  1IUF A;  2H8W A;  3FKJ A;  1OYY A;  2O5R A;  2WY7 Q;  3ZN1 A;  3HKZ N;  2HVR A;  1I1S A;  3FF5 A;  2G7H A;  3H3U A;  5E3N A;  1ZLK A;  3BTC A;  3F3X A;  3TL4 X;  2HXI A;  1FOX A;  3CP8 A;  3FMS A;  5FLV A;  3J7Z I;  4BKX A;  3CCE I;  4A3K J;  2M9H A;  3OYJ A;  3ZMZ A;  2DPU A;  1RC9 A;  2FOK A;  2KFD A;  1LVA A;  2RVC A;  4L5I A;  4A6D A;  2O8X A;  2XDV A;  1K7A A;  5FGM A;  1IJW C;  5DEQ A;  3BTL A;  1T39 A;  2XPV A;  2E5Z A;  3D5R C;  4RGX A;  5C3E J;  2DMP A;  2O6G E;  4KN4 X;  2IAI A;  2KT0 A;  4L9J A;  1XGM A;  2ZBK A;  1OR7 C;  1IN5 A;  4II3 A;  3ECO A;  1TWA J;  3SEZ A;  1CF7 B;  4JX5 A;  3ROU A;  1X3W B;  3TDU C;  5ED4 A;  1F9N A;  3KLO A;  5CPR B;  5LBQ A;  1BC8 C;  2M34 A;  4I76 A;  3HOZ J;  1IRG A;  2KRC A;  3T1B A;  2AXL A;  5KVR A;  2OBP A;  2KIS A;  3P9C A;  4F93 B;  1RR8 C;  5IP6 A;  1T56 A;  4B4C A;  5DDG A;  2CFO A;  3DKY A;  2VE9 A;  2QSH X;  1ZRE A;  2X4H A;  2V6C A;  1QNT A;  2F4I A;  1K6O A;  1IN4 A;  1OCZ H;  3DP7 A;  5J1Y A;  3HOT A;  1R58 A;  1JKQ C;  2ZME B;  3IWF A;  4F91 B;  2RN7 A;  3HYI A;  3SJM A;  1FWZ A;  2LKX A;  3J7A O;  3M1C A;  4R8H A;  3F6O A;  2IPQ X;  1Z21 A;  5J4V A;  4U0V A;  2CG4 A;  2HZT A;  3CZ6 A;  2ZJR F;  1U0J A;  2D2W A;  2LSO A;  2LRE A;  2XC7 A;  4XKV A;  3DCF A;  3AG3 H;  3PFY A;  4DBR A;  2E7X A;  3JW4 A;  4N4O B;  4B47 A;  3QP5 A;  1E3H A;  4F92 B;  5LLQ A;  2JVH A;  2MLG A;  1X1P A;  3O8H A;  2BY1 A;  2DMN A;  4MEY F;  2CV2 A;  3CC4 I;  4F55 A;  4XLF A;  1FTT A;  3GUD A;  3PO3 J;  3B6C A;  1AHD P;  2DMQ A;  3GYH X;  1XX5 A;  5IYD J;  2W82 A;  5EZH A;  4OIR F;  3VWB A;  2HKX A;  1BIB A;  1KON A;  2DMU A;  2B7E A;  5ILV A;  1E3P A;  3P7N A;  2H8R A;  2EK5 A;  1YIT I;  2L02 A;  5K5R A;  1PUF A;  3NWT A;  4BQA A;  2YR2 A;  3OS0 A;  1ENH A;  2CO5 A;  2Q0O A;  1EV7 A;  1Z7L A;  4CZC A;  4LG0 A;  2PMH A;  4CO8 A;  3PM1 A;  1Y8Q B;  5B3S H;  3G71 I;  1MJ9 A;  4ZZD A;  4JBA A;  5D5X B;  4DZP A;  5E3L A;  4IHW A;  2VKD A;  3EQL F;  3TW7 A;  2JT1 A;  2VQH A;  3C2H A;  1MZB A;  1D8J A;  3JSO A;  5F27 A;  2FU4 A;  3F9K A;  2BZT A;  4EJU A;  5F64 A;  1A35 A;  2O61 A;  3GFM A;  2DDB A;  1JHH A;  2E60 A;  2M87 A;  2A61 A;  4Y15 A;  5DM7 F;  3CMY A;  5D5U B;  3HXL A;  4EM1 A;  4A3D J;  5D5V B;  5JI6 A;  4XRF A;  2XRL A;  2ECB A;  1P7I A;  3ECH A;  2P81 A;  3IP4 B;  5HLG A;  1FJL A;  2WAD A;  1I50 J;  5IT9 Z;  4HNV A;  5DUI A;  1UST A;  4NUB A;  5F0C A;  5AON A;  1XSD A;  1NK3 P;  1HDD C;  2X0L A;  1DP7 P;  2NVY J;  3IRR A;  3FMR A;  3MEX A;  1I3Q J;  1Y56 A;  4IHY A;  2E2H J;  2NVQ J;  2OA4 A;  5LHG A;  5IT3 A;  1XTA A;  3OYH A;  5LHH A;  2D1H A;  3L9F A;  3L2V A;  2HVS A;  4GFB A;  3E6D A;  1F43 A;  4PZJ A;  3ZQL A;  2Y9Y A;  1JUM A;  5LRS A;  2AO9 A;  2XSD C;  2CRG A;  5J1R A;  3GXO A;  5CJ9 A;  4IOA F;  2K27 A;  1XDS A;  1LE8 A;  4CYD A;  1T08 B;  1S7O A;  3IAM 2;  3UR3 C;  1ZH5 A;  1A04 A;  2OF7 A;  4BUP A;  5H2F C;  2HQN A;  4EJV A;  1AWC A;  2HEO A;  1IO2 A;  3MKW B;  5EYR A;  4EGZ A;  1SFE A;  3HZJ A;  3IH4 A;  2CSO A;  3SFZ A;  4FIS A;  5FJ8 J;  1EA3 A;  2ZNY A;  3SDG A;  4IOC F;  3GBG A;  2CQK A;  3BP8 A;  1OQY A;  4FT8 A;  4PFO A;  4L18 B;  3OYG A;  1R71 A;  2VJ4 A;  3FX3 A;  2WC2 A;  1V5F A;  3M7G A;  1H88 C;  5H6R A;  1MJA A;  1YX5 A;  4DW6 A;  5HVQ C;  2NNN A;  4NHJ A;  3LSJ A;  4C3I J;  1P6R A;  1MIJ A;  5E18 F;  2CW7 A;  5LFA A;  5L3B A;  5EGO B;  2IP2 A;  2PMU A;  4KUM A;  3RI4 A;  1MMG A;  1OPC A;  2PFB A;  4BQN A;  3SYT A;  4MLO A;  1CQT A;  3ISP A;  3WU1 B;  1SFO J;  3GTJ J;  2O0Y A;  1O57 A;  2Z99 A;  4AID A;  2E2I J;  2CUF A;  3DPL C;  3OWT A;  5CVR A;  5E3M A;  4WCG A;  4J19 A;  4DJA A;  4BE1 A;  5IYB J;  2IA2 A;  2Z2S B;  5CVV A;  2R7Q A;  4A3I J;  2X48 A;  3HIF A;  1YJW I;  3DPU A;  3AG2 H;  4JOM A;  2CFX A;  1WJ5 A;  1POG A;  3K69 A;  4Y33 A;  4ZYA A;  4M72 A;  1FBQ A;  1XMA A;  4GYG A;  3GTK J;  4ENN A;  2P7V B;  5F0H A;  1XGO A;  4FE4 A;  2XB0 X;  3R60 A;  5BPD A;  4CIC A;  1TP4 A;  1ZHF A;  3DEE A;  5ILU A;  4ZJZ A;  3F8F A;  2MFZ A;  2AS5 F;  1N75 A;  4IRH A;  4P9F A;  4U0W A;  1JJ8 C;  4II2 A;  2XAU A;  3TP3 A;  2ELJ A;  5DM6 F;  3RKQ A;  1BI0 A;  4KIG A;  2CWE A;  2WBM A;  4M6V A;  4A3F J;  2COM A;  1A6I A;  1OKR A;  3HOY J;  3MN2 A;  2G0E A;  5EJC A;  2Q2E B;  3CO7 C;  2FOW A;  2KZV A;  4LIV A;  3K70 D;  2K3P A;  3FXR A;  1O3T A;  3ML6 A;  3PL8 A;  1BN5 A;  4IL6 C;  3JRE A;  3HB9 A;  3JRH A;  2MD0 A;  4MGR A;  4XSZ F;  4RAG A;  1YO5 C;  4L5E A;  3BPX A;  5ICF A;  1T38 A;  2HVQ A;  1YW9 A;  2STW A;  2VBW A;  1ERD A;  3SXY A;  3BLY A;  3D5L A;  1DQU A;  4MFE A;  3S15 J;  1GVJ A;  1Z0X A;  2H1L A;  1GXP A;  4LOC A;  1Y0N A;  3CLO A;  3ZP5 A;  1JXS A;  1FPQ A;  3SFI A;  2VE8 A;  2ETH A;  3PNT A;  1WHU A;  3HOV J;  1B72 B;  3WG9 A;  2RV8 A;  2A5W A;  2QZ8 A;  3BQY A;  2HNH A;  2X6X A;  1YQA A;  3U2R A;  3BT9 A;  1ONV A;  1JKP C;  4CCK A;  1R23 A;  2EZH A;  4EMS A;  3S1Q J;  3CF2 A;  2EZI A;  3ZMD A;  2DOE A;  2ZFU A;  2ZKZ A;  4ZYH A;  1Q1V A;  1I6X A;  5FD6 A;  4RAZ A;  1XGS A;  3HBL A;  5GTH C;  2CUZ A;  4X0G A;  2MG4 A;  5HDK A;  4IQJ A;  2E1M C;  4CA0 A;  3WTX C;  3GTQ J;  4UV8 A;  2XF5 A;  4IKF A;  2M5W A;  1D5Y A;  4E7S A;  1UAA A;  1K61 A;  1O7F A;  5E79 C;  1NTC A;  2X1D A;  1XPX A;  5JR3 A;  2KL4 A;  2KIM A;  2VT3 A;  2ECC A;  2PMZ N;  2WA0 A;  1VQK I;  4OIP F;  3QPH A;  3I56 I;  2P0W A;  1H0M A;  1T98 A;  1W7P D;  2K3F A;  1LDJ A;  2D45 A;  4A0Z A;  1D3Y A;  1YOV B;  4I7H A;  4NC6 A;  2K9Q A;  3R0A A;  1F1Z A;  4BXU A;  1KZH A;  3HUG A;  4JP0 A;  3KP5 A;  1SAU A;  1VQ9 I;  4UUT A;  3T8R A;  5F08 A;  4CHU A;  3JRB A;  4IQ4 A;  2F5V A;  2VUM J;  5TIS C;  4GRI A;  2DFF A;  1IG7 A;  1EH7 A;  4BJT A;  5HDG A;  4MEX F;  1OIS A;  3LMM A;  3GTG J;  4IHT A;  3CDI A;  3QOD A;  2L7F P;  1FOK A;  3EDP A;  3FKI J;  1TW2 A;  3A1Y A;  4YIF A;  3BJA A;  3GFI A;  3HDD A;  4LB5 A;  1ZG3 A;  4BHC A;  3B6A A;  1G4D A;  1USS A;  4EV0 A;  4HF2 A;  4A5M A;  4ZDP A;  5E1Z B;  1N77 A;  1ETO A;  1MMS A;  4AUX A;  2EPF A;  2L4A A;  1WH5 A;  1FIP A;  2D5V A;  2MC3 A;  5FLX K;  3QAH A;  1Y8R B;  3JSP A;  3FHN A;  2R7Z J;  1YE9 A;  2W7N A;  3GO5 A;  1OCP A;  3GTO J;  3I71 A;  1VQ4 I;  2XRO A;  3KPH A;  1S5L C;  4XKB A;  2CV0 A;  4YG2 F;  4V2F A;  3PSI A;  5F0F A;  3Q3S A;  2DU9 A;  1RET A;  3WE3 A;  3L00 A;  3I3L A;  3V8K A;  4U7B A;  1DP3 A;  5K5Q A;  2GA1 A;  4N4N B;  2W1O A;  2R7W A;  3D1N I;  1FOW A;  4BDZ A;  1STZ A;  1TZL A;  3HGG A;  1R1U A;  5A2Q K;  3A01 A;  3CP2 A;  2LFB A;  2HTJ A;  1B9M A;  3I5U A;  3VSL A;  3MKZ A;  4RBO A;  1UZC A;  3KET A;  2D1V A;  1G3W A;  4Y7N J;  3GW2 A;  1P7J A;  5EGO A;  4W97 A;  2M8E A;  2KRF A;  5KK1 A;  2QSF X;  3N97 A;  2L7Z A;  1EJ9 A;  4E4H A;  1K6Y A;  1G6N A;  2F5E A;  1VQO I;  1RR7 A;  2O7O A;  4Q47 A;  1P4W A;  1ULY A;  3K9T A;  1O3S A;  1IN7 A;  3TQN A;  1X2N A;  4RGU A;  2Z3Y A;  2CU7 A;  2DCE A;  5B66 C;  2AQE A;  2W4S A;  3DFG A;  4RMN A;  1S8N A;  2Y30 A;  2OC6 A;  3S93 A;  1FEX A;  5LEK A;  1YW7 A;  5LGU A;  5ICG A;  1LDD A;  2CV1 A;  1VQ8 I;  4ESJ A;  1K83 J;  2K02 A;  1S7E A;  2DQL A;  3A0H C;  3EUH C;  1T8I A;  1ZAR A;  1FYK A;  3DXJ F;  4GDF A;  3CCS I;  2FEZ A;  2BOL A;  4YRV A;  3F72 A;  3A03 A;  3WOD F;  1W4M A;  2WAE A;  3M07 A;  2XIG A;  1SFU A;  1FSE A;  3LFU A;  3LSR A;  2XV4 S;  2IRF G;  1FBU A;  2LD5 A;  5EEH A;  3TW6 A;  3Q9S A;  1JI8 A;  1IAW A;  4IHS A;  2V1U A;  4DQ2 A;  3M1E A;  4ZYE A;  3S14 J;  3PSF A;  4A0Y A;  2GOX B;  1B4A A;  1ZGJ A;  2FA5 A;  1QO0 D;  4P55 A;  4I6Z A;  1YJ9 I;  1VTN C;  5JFR A;  1MSF C;  2BHY A;  1IRX A;  4XNF A;  3TO9 A;  2M8G X;  1XB4 A;  2PN6 A;  4OWR B;  2L01 A;  2LG4 A;  2GM4 A;  3BG7 A;  1TLH B;  3CJN A;  3H9J A;  4IEJ A;  1L3L A;  2KLO A;  4Y17 A;  2VC1 A;  2ISZ A;  1WPK A;  4B3X A;  1P9Q C;  4QWQ A;  4XOT A;  3HPG A;  2ZJP F;  3ZR8 X;  1ON1 A;  3H3V K;  4E7H A;  3N05 A;  3PUF A;  3EUH A;  4K2E A;  3G73 A;  3RPU D;  3W6K B;  2A68 F;  2AXT C;  5J8C A;  2EA4 A;  4JYK A;  2DLL A;  3MZH A;  5EG0 A;  2VC0 A;  5J40 A;  2K9N A;  4LB6 B;  1KU2 A;  3LSP A;  2QSG X;  4XID A;  3OS2 A;  2XGE A;  1PDN C;  2CYY A;  3FZV A;  4HOB A;  3SHF A;  5CQE A;  5F04 A;  4FAS D;  4AM3 A;  1I5Z A;  2L0K A;  1MBK A;  4LK1 F;  4YFK F;  2ZCW A;  1FYM A;  2R7V A;  4V19 K;  4E7J A;  2XAG A;  1YX3 A;  4P9U A;  5IOY A;  3ELK A;  4WWC A;  3K4N A;  3TOB A;  4RDU A;  1FX7 A;  3MCZ A;  2X6W A;  3MZ8 A;  3A02 A;  3MAJ A;  3M9A A;  4JX4 A;  5E20 A;  1KU9 A;  1WRJ A;  2PMZ A;  4IRG A;  1DU6 A;  3GME A;  1IV6 A;  1WCM J;  2AHQ A;  3FM5 A;  4AIJ A;  2P5V A;  4PJL A;  4Z2Y A;  1DPU A;  4NB5 A;  4XLN F;  4ZYD A;  3RPU A;  3T0Y A;  2EFQ A;  1BA5 A;  4JK1 X;  4LG3 A;  2XB5 A;  2PJR A;  1W5C C;  3CMM A;  1E17 A;  4XRS A;  2EV6 A;  4UV9 A;  2ZXJ A;  4XON A;  3PQK A;  2HDD A;  1NG6 A;  2IS4 A;  4G7O F;  2V9K A;  4RB2 C;  3HOW J;  2KZG A;  4KA4 A;  5BS6 A;  4D7M A;  5L3G A;  1HC8 A;  1XDU A;  3LWF A;  1I27 A;  4CH7 A;  4AYB N;  5JLX A;  1HKQ A;  4C2M J;  2IGO A;  4HX7 A;  1GDT A;  1WZ2 A;  1XMK A;  4FTH A;  2W84 A;  1HQC A;  1LEB A;  1XN7 A;  1JUS A;  5HS9 A;  3O2P E;  1ZRF A;  1MND A;  3ZQC A;  2DJN A;  1WWX A;  4G9Y A;  2FSW A;  2QQB A;  2JQ7 A;  1HXD A;  1Z3X A;  4XSX F;  5FRM A;  3HG9 A;  4RM2 A;  3LSG A;  1A36 A;  1KA8 A;  2BHZ A;  2OUM A;  2IA1 A;  1G8X A;  1NHA A;  1DGR M;  4BNC A;  2VN2 A;  3T5X A;  5E17 F;  1AA7 A;  2M45 A;  5GP9 A;  5E1W A;  2MD5 A;  1UMQ A;  2FQ4 A;  2ELK A;  4I98 B;  3BR0 A;  4LJZ F;  3OYN A;  1FBS A;  4XMY A;  1T0F A;  3HUG B;  3RZO J;  3GFJ A;  1R9T J;  4OIO F;  2VXD A;  3K4L A;  4B48 A;  2NXN B;  3ABL H;  4PJ0 C;  2COB A;  2XGC A;  4MO7 A;  3K2Z A;  2NVX J;  5FLX Z;  4XLE A;  3FBN B;  4L0Z B;  1D0X A;  2DPD A;  2VQG A;  3J80 Z;  2DFI A;  3TGN A;  2ZXW H;  3K4C A;  4NQW B;  5TRD A;  3F8N A;  3ERM A;  5HOD A;  1MBF A;  4FET A;  1U5T A;  2WB1 N;  3PIO F;  3DU5 A;  4IRI A;  4LD5 A;  3BG3 A;  3K7A J;  5EEA A;  3AFH A;  1WH7 A;  2HR3 A;  2OD5 A;  3HSR A;  3GLL A;  2NS0 A;  1BJZ A;  4BHP A;  2VKE A;  2VXZ A;  3IHU A;  4Q4Z F;  2STT A;  1BW5 A;  3CF5 F;  3L2W A;  3C18 A;  1D0Z A;  4UUV A;  3LQR A;  1K78 A;  2HWV A;  1VND A;  2HPI A;  2RQQ A;  3JAM Z;  2P4W A;  3BOQ A;  3I59 B;  3MZY A;  3JRC A;  4IPA A;  1CGP A;  4UVA A;  3WU2 C;  5K5O A;  2M30 A;  5FKK A;  2L54 A;  2TRT A;  2KJB A;  5DCM B;  4HF1 A;  3DTE A;  5KNL A;  1A6Q A;  3RQI A;  4NC7 A;  3L1P A;  4HYE A;  1W1W E;  1OCT C;  1UG2 A;  3OIO A;  3AL0 C;  2ZXI A;  2EQR A;  3BR3 A;  4KIF A;  3BDD A;  2LKP A;  2DMT A;  3H9Q A;  1XCV A;  3OIP A;  1QGP A;  4JQF A;  2ZO4 A;  3RCO A;  2NYX A;  2L9S A;  4HLY A;  1G3Y A;  1SAN A;  3S3M A;  1BBY A;  1Z6T A;  5JVG F;  5CYV A;  3ZGK A;  3SZG A;  2R7D A;  4BE0 A;  5M5X J;  2CS3 A;  2F2E A;  2RRE A;  2NOJ B;  4D5F A;  3H5N A;  3CCQ I;  4AYB A;  5HLT A;  3K4M A;  3H3Z A;  3O3K A;  1YJN I;  4C2T A;  2L7M P;  2YPR A;  4HW0 A;  2WV0 A;  2FBK A;  1FMW A;  1C0W A;  5C4J J;  2XVC A;  2DT6 A;  5J4Y A;  2E2J J;  2DO7 A;  4RGR A;  2R5Z B;  2QM3 A;  1VQ7 I;  1QHH D;  1NH3 A;  4N9I A;  1IXR C;  2DA2 A;  3P9K A;  2VLA A;  3FXQ A;  3QPT A;  4HDV A;  3K1M A;  4E7L A;  1V55 H;  1ZGA A;  1YFH A;  1O3Q A;  1KU7 A;  1D5V A;  1X1C A;  3DF8 A;  2R5Y B;  4BXX J;  1QA6 A;  4G7H F;  1U9O A;  1ZK8 A;  4X1E A;  2QYO A;  2VOO A;  4B09 A;  2J5O A;  3R4K A;  4HF0 A;  3ZMS A;  4U88 A;  1IXC A;  3CJR B;  3DPT A;  1TQI A;  2LP0 A;  2ZSI B;  3O6B B;  2BW3 B;  3BG6 A;  1XS9 A;  3KP2 A;  3QOP A;  4PSX A;  5FRN A;  1ZR4 A;  1OCC H;  4YEJ A;  3DBH B;  4RS8 A;  1GXQ A;  2WWY A;  5GAH J;  3VB2 A;  1BJA A;  3S1N J;  1RUO A;  5C4X J;  2ZNZ A;  4IJA A;  3H0D A;  3F0C A;  3CUO A;  4X6A J;  2CQQ A;  4L9T A;  9ANT A;  4BQQ A;  3BJ6 A;  1BR1 A;  3BR1 A;  4RLQ A;  4BGD A;  3F23 A;  3CMA I;  2F4M B;  2ZFW A;  3JR9 A;  1U6G A;  3OIQ A;  3P9I A;  1S72 I;  3CUQ C;  1JTY A;  3W2V A;  1XC5 A;  2V6E A;  4LIU A;  4FX4 A;  1OLT A;  1UG0 A;  1X19 A;  4A3C J;  5JLW A;  3ZQF A;  2A6H F;  2A5Y B;  2XAH A;  4NBQ A;  3JAM K;  1WJC A;  1MSE C;  4F52 A;  2FF4 A;  2K86 A;  4KFC A;  5K7Z A;  5FLM J;  4KT6 A;  1R00 A;  1ITY A;  4HAM A;  2DT7 B;  2LDU A;  2ADU A;  4A3G J;  4ETS A;  1BI2 A;  2A6T A;  5CVJ A;  3N4M A;  1KYW A;  3JRG A;  5E8G A;  3ZCO A;  3FIS A;  2V7F A;  2VJI A;  4HNU A;  3VSK A;  4BAC A;  1WQ2 A;  3WTW C;  3WGH A;  1V4R A;  1V5G A;  4PGG A;  3MD2 A;  2GLO A;  2E1C A;  4BEH A;  3P5J A;  3GZN B;  3TDZ C;  2OZU A;  2YU3 A;  1J75 A;  2HQR A;  3RDI A;  1IZ1 A;  1UCR A;  4BJ5 C;  2LVS A;  2X1C A;  2LLK A;  4A3J J;  1JKO C;  1QHG A;  1GVD A;  2V1N A;  2VPR A;  1Z77 A;  2JRM A;  2XPU A;  4IVN A;  1K4T A;  3BY6 A;  4HRI A;  2QEN A;  3K70 C;  2F6C A;  2K7L A;  3B73 A;  1LE8 B;  1YIJ I;  2E5N A;  3AG1 H;  3K0L A;  2X51 A;  1ZTR A;  1SD5 A;  4I0B A;  1P2F A;  1V54 H;  3S3N A;  1TTY A;  4XKW A;  4J01 A;  3KP6 A;  1WSU A;  1LNW A;  1MNE A;  4S04 A;  2BVL A;  2PJR B;  2CQN A;  1L0O C;  2DI3 A;  1A31 A;  1P4A A;  3IL2 A;  1EH8 A;  4HDU A;  2CGP A;  2LY2 A;  2HYG D;  4XLP F;  5FD5 A;  3KLN A;  2P5L C;  2VOD A;  3H36 A;  4BS9 A;  4I2O A;  3F22 A;  2R93 J;  1PP7 U;  4UVC A;  1U8R A;  2GZW A;  4RB3 C;  2LH9 A;  2IA0 A;  1MH4 A;  4KMF A;  4A12 A;  2M0C A;  2VBZ A;  3S2H J;  1OJL A;  2HYF A;  5HLI A;  1UHS A;  1FOY A;  4WXC A;  3OYE A;  3CCU I;  3SDB A;  1JT6 A;  4Y3O A;  4Y13 A;  3BG9 A;  1WVR A;  2B63 J;  2OAZ A;  1X4P A;  3KZY A;  3J7Y J;  1WI3 A;  1T6S A;  1Z9C A;  4W1U A;  1MKM A;  2LBF A;  3CCL I;  4QTR A;  1ZAO A;  4XQF A;  4I99 C;  4IHX A;  4ZDO A;  5GPA A;  1W36 D;  4XOP A;  4E7Z A;  1RKW A;  3LQQ A;  3OYB A;  2EFO A;  3H5R A;  1MW7 A;  4RAF A;  1ZQ3 P;  3DLL F;  1BM9 A;  4RB1 A;  3WTY C;  4XK4 A;  2QLZ A;  4QSH A;  2R7U A;  3WHB A;  4QPQ A;  3I54 A;  4MNU A;  3NAR A;  2CW0 F;  3CCV I;  4ZTJ A;  2OJE D;  3W6J B;  3DWL E;  1IN6 A;  2EIL H;  2L3D A;  4V2G A;  3PUB A;  1OCO H;  3KIO A;  5EEG A;  2OCC H;  3ONQ A;  3DLA A;  5DCF A;  1TT0 A;  3CDL A;  1LFB A;  1QZY A;  2KHM A;  3CCR I;  3OOP A;  2Y0S A;  4AIK A;  2KMU A;  5TJJ A;  1MDM B;  1HLV A;  4L9V A;  5E1X A;  2ME6 A;  2DA3 A;  2FXA A;  3ABK H;  2XGD A;  3U1K A;  1JJ6 C;  3ASN H;  1V3F A;  2ZME A;  1PVE A;  3KYL A;  2MH2 A;  3GTM J;  1P92 A;  2DJI A;  2LKS A;  3EUK L;  2DA5 A;  1FC3 A;  4LMY A;  1U8B A;  2JA6 J;  3KEQ A;  4XR6 A;  5AIP A;  3HOU J;  4HX8 A;  2XUB A;  4XBF A;  2R92 J;  5JHU A;  3OYM A;  3OYI A;  1HOM A;  1W36 C;  4AC0 A;  4R79 A;  3J80 K;  3QPL A;  3OYL A;  1SD7 A;  3DBR B;  1ON2 A;  4ZH4 F;  2O03 A;  2R0Q C;  4U87 A;  3LL7 A;  3U9G A;  3U1D A;  1SAX A;  3CJT B;  4ASN A;  3ZQI A;  2F48 A;  1E2X A;  3GTL J;  1FZP B;  1T0F C;  3ZMU A;  1TT5 B;  1X1A A;  2E34 A;  2QQ8 A;  2XAF A;  5HDN A;  1I3A A;  1I39 A;  2LY1 A;  2E35 A;  4A6E A;  5J47 A;  2MC4 A;  4CCJ A;  1VQ5 I;  2HXO A;  2X1E A;  2PLY A;  1MBG A;  4R1H A;  2I10 A;  4I01 A;  4M6Y A;  3K4K A;  4WXH A;  1Y1W J;  2E1M B;  1GUU A;  3GCM A;  4DIQ A;  3OYF A;  2HDC A;  3C2G A;  1WKM A;  3CME I;  1H9T A;  4YEL A;  3GFL A;  3C1D A;  2Z9O A;  2VQL A;  2YX7 A;  2EIK H;  3E6B A;  3S3O A;  1YI2 I;  4PJJ A;  1U78 A;  1JGG A;  1HBX G;  2VON A;  4HNT A;  5DS9 A;  1ETQ A;  1QZZ A;  1B9N A;  4PJN A;  2WY8 Q;  4ESB A;  1BI1 A;  4M6X A;  2H09 A;  2PJP A;  1JGS A;  2M4K A;  1VQL I;  5M5Y J;  1Z7U A;  4ON0 A;  2Z5U A;  2LC2 A;  3E5Q A;  2JA8 J;  1IUY A;  2KDZ A;  3J7A Y;  3ABU A;  3K2A A;  1Y6I A;  1LFU P;  4DOZ A;  1HKS A;  1A5J A;  3NWS A;  3FK6 A;  2EZK A;  3E3V A;  5L3F A;  5K7F A;  1WJA A;  4UB6 C;  4EQQ A;  1UFM A;  1FT9 A;  2LRD A;  4QLC U;  1UB9 A;  1Y1V J;  3E0J B;  5FFZ A;  2LF7 A;  3IV5 A;  3IH2 A;  1AU7 A;  1W0T A;  5LEJ A;  4A69 C;  4PGH A;  3RKW A;  2O8K A;  3HGY A;  3MKL A;  3D5S C;  3CCM I;  3WHC A;  5FFX A;  2DTZ A;  1R1T A;  2MAB A;  2W00 A;  1FNN A;  1OCR H;  4CYC B;  1FP1 D;  2OQG A;  3R61 A;  1IRF A;  5HNF A;  2EA2 A;  2YX4 A;  4DYR A;  4LGW A;  4E6K G;  2HS5 A;  2W85 A;  2RC4 A;  3RKX A;  1SC7 A;  4CGZ A;  4XM3 A;  4I02 A;  4HEA 2;  3OYD A;  4M9Z A;  2VKH A;  4RAY A;  2IT0 A;  2JSP A;  3T8T A;  1S9H A;  3GWZ A;  4G12 A;  2PEX A;  3KE2 A;  2DOD A;  4CXF A;  1JKR C;  1YTY A;  4KYW A;  1IW7 F;  2FE3 A;  3HOS A;  1X1D A;  3ZOB A;  4KIT B;  5LGN A;  4PSW A;  2QF7 A;  3GVA A;  3SZP A;  1CF7 A;  1XMX A;  1YRN A;  4ZTF A;  3GZ6 A;  1O4X A;  3JCU C;  3RKY A;  4M9S A;  2B0L A;  5CKT A;  3TO7 A;  5HNH A;  1MJB A;  1D1C A;  3OOU A;  2X6Y A;  2E19 A;  4WXD A;  2K9L A;  2GBY A;  4PDK A;  3FK7 A;  1R5I D;  5DCM A;  5BNG A;  1IDZ A;  2PBI A;  3KZZ A;  1PJR A;  2IGN A;  2L9V A;  2MYS A;  2LTP A;  3TP0 A;  1IV8 A;  5GPC A;  3LST A;  1BIA A;  1WFX A;  2KKO A;  1PYV A;  3OL4 A;  1ZLJ A;  2DA6 A;  3M8F A;  3PNY A;  5BMZ A;  4M3G A;  1B8I A;  1FMV A;  2HQ5 A;  3QYF A;  1MH3 A;  1HKT A;  4BAY A;  2DT5 A;  1F36 A;  1LFP A;  4B1R A;  4D7N A;  1YLF A;  2VBY A;  2K4J A;  4MIM A;  2BGC A;  2JUC A;  3VYS B;  2QEX I;  2JA2 A;  2K4B A;  3DV8 A;  4OAY A;  3WG7 H;  2HI3 A;  4LLL A;  2GAU A;  3BTI A;  3FM3 A;  3EYI A;  1QPM A;  1R5G A;  3L09 A;  4D5C A;  4LG0 B;  3I58 A;  2QVO A;  2HYJ A;  5KCM A;  2FNA A;  1EF4 A;  4GGG A;  4ZZL A;  3WU0 A;  2DA7 A;  2JSC A;  4NNJ A;  4RGS A;  4HV6 A;  6PAX A;  1R5H A;  2CUE A;  2IEK A;  3ABM H;  1DU0 A;  1BOA A;  1KYZ A;  2W24 A;  3H9G A;  4OIQ F;  1O7L A;  3CDH A;  2HDW A;  1VQ6 I;  2V79 A;  3HEF A;  2A6E F;  3LNQ A;  1SFK A;  2V9P A;  2EFN A;  1HW5 A;  1OMI A;  2UWM A;  1GLN A;  1TWG J;  3ASO H;  2JRT A;  2EWN A;  1UEL B;  1SVL A;  2VAS A;  3F8M A;  3RTR A;  5FRO A;  3Q9V A;  3ZPL A;  3JRA A;  1J9I A;  3HJE A;  3V7C A;  2DOA A;  3I59 A;  5DD8 A;  3IC7 A;  2DA4 A;  1LPQ A;  2NVT J;  1UJ8 A;  3AL0 B;  2FRH A;  1GHC A;  4RB0 A;  3I0T A;  1AOY A;  4Q48 A;  1RIO H;  2BY3 A;  4YFN F;  2XF7 A;  1G2H A;  1G3S A;  4WK8 F;  5LGT A;  3BR2 A;  1J2X A;  1N78 A;  4WF2 A;  2PI0 A;  4E70 A;  2GIZ A;  4UUS A;  5E8I A;  3S16 J;  5A2Q Z;  3B02 A;  3W2W A;  3K4B A;  5CQG A;  3E5U A;  2R7S A;  4GXO A;  4RA2 A;  3KEY A;  5M3M J;  2ESH A;  3IAS 2;  1APL C;  2RKH A;  3WTS C;  2V1X A;  3RZD J;  2EZL A;  3KEO A;  3LAJ A;  4D1Q A;  1H89 C;  3S2W A;  3QPS A;  2R7O A;  3IH3 A;  2UXN A;  3QP6 A;  3QRF F;  2FUG 2;  2Z1D A;  5HOO A;  3GTP J;  3E1S A;  4NDL A;  4BY1 J;  4O6J A;  3ZQ7 A;  3BQZ A;  4DYQ A;  2GOM A;  2Y31 A;  3LA2 A;  5D5W B;  3MKY B;  3VEP A;  1F4K A;  3TOA A;  1ZG5 A;  3LSM A;  1WJE A;  3CCJ I;  3DQV C;  4AVP A;  2ID6 A;  4UXN A;  2A05 A;  3ZN0 A;  1ZN2 A;  2VBX A;  2VIX A;  4UY8 I;  2YSR A;  1VF9 A;  2NS7 A;  3WTV C;  4H4K C;  2OPT A;  3LAP A;  2Z33 A;  5AIQ A;  1ETW A;  4KDP A;  4IXA A;  4Q5S F;  2Y0S N;  3Q5F A;  4EJO A;  4L0Y B;  3QYB A;  1LUJ B;  3QU3 A;  4HQM A;  3ZXS A;  2KIU A;  3VDX A;  5D4R A;  3I4P A;  1YS6 A;  1IGN A;  1DUX C;  2QWW A;  1ZYR F;  2XHK A;  3SQN A;  2JPB A;  3VOD A;  4XN0 A;  2I8D A;  2R7T A;  3C3W A;  3IUO A;  4M9X A;  3CUQ B;  2E71 A;  4LIT A;  1XGN A;  2XRN A;  2UUZ A;  5IY5 H;  3FDY A;  1TQM A;  2R5Y A;  3JTH A;  2QUF A;  1XD7 A;  5M3F J;  2MLK A;  3KYD B;  2IS2 A;  3PQJ A;  2DA1 A;  3OY9 A;  1YHQ I;  4BEH B;  2CQ7 A;  1JHF A;  1R36 A;  2OQR A;  3A4C A;  2C6Y A;  1K4S A;  4HST A;  3HHG A;  3JRI A;  3NRV A;  3S8P A;  5HS8 A;  4MQ9 F;  4YFX F;  4M3D A;  3FXU A;  5KAF C;  2MA3 A;  3RSN A;  4F3Q A;  1FSH A;  1ZRD A;  3H1C A;  2JA7 J;  2Y75 A;  3E6C C;  1QPI A;  2XKO A;  1I6H J;  2PQ8 A;  3FWE A;  4XLH A;  4NQW A;  3X2Q H;  3F21 A;  2H94 A;  2KIF A;  2J5P A;  4KT5 C;  3DTK A;  4I0A A;  4IX7 A;  1W7P A;  4HX4 A;  4N9H A;  2GQQ A;  5GAD J;  3OV8 A;  3VOE A;  2HQA A;  5FKM A;  3IKT A;  1WJB A;  1XSV A;  3M3Y J;  4FX0 A;  2F5C A;  3BR5 A;  2CH0 A;  2FBH A;  1Z05 A;  1QVT A;  3OMY A;  1IDY A;  5C44 J;  3AAF A;  3BWG A;  5IT9 K;  1T95 A;  4LFU A;  3KYC B;  3FXO A;  1UHW A;  2IJL A;  2BXZ A;  4GYI A;  4Z6Y A;  2Z16 A;  5F1J A;  4EGY A;  1D1B A;  3WGI A;  3J81 K;  4EM0 B;  4NC8 A;  1JTX A;  2FJ1 A;  4FQG A;  2FQ3 A;  1X58 A;  1X1B A;  2CJJ A;  1UHM A;  2BXY A;  2IVM A;  3KP7 A;  1TWC J;  3JTG A;  2Y9Z A;  4GCV A;  5J1U A;  1JE8 A;  2Q8K A;  5DTD A;  2JWT A;  2IW5 A;  5EDN A;  5IYC J;  2NNY A;  4JX6 A;  4C30 A;  1I1G A;  2LYC A;  5HS7 A;  2LBF B;  4Y4R A;  5D4S A;  3OYK A;  3OSG A;  2ELH A;  3QOE A;  3S1R J;  2BBY A;  4KNY A;  1U3E M;  2WV1 A;  1HW2 A;  1WJF A;  2VJJ A;  3KP3 A;  4O5V A;  3I4N J;  5IOZ A;  4EM2 A;  1D1A A;  4XLA A;  3BJO A;  3CUQ A;  4AD9 A;  1EKE A;  2Y69 H;  2BE5 F;  1QU3 A;  2HOE A;  2BVM A;  2X6O A;  1RNL A;  1XG1 A;  2AQF A;  3DEU A;  3ZRG A;  3K6G A;  1MD0 A;  3BC8 A;  2IBD A;  2NOG A;  1ETY A;  3AG4 H;  4AIH A;  4LLN A;  1R22 A;  4BU2 A;  2RGV A;  1R49 A;  2Y2Z A;  4KIB A;  1AKH B;  1W7P B;  1HF0 A;  2HGC A;  4XKC A;  2WTE A;  4M3E A;  2R5Z A;  4G94 A;  4OMZ A;  1FLI A;  4G7Z F;  4DNC A;  2M7B A;  3LSH A;  1ZG1 A;  2JN6 A;  4B43 A;  4HLX A;  2FML A;  4ZC3 A;  2DK5 A;  4G6D A;  4OAZ A;  1H9G A;  1TW3 A;  3PNV A;  5IP7 J;  1YW8 A;  2DK8 A;  2P5K A;  3TKY A;  4FCY A;  3G2B A;  4S05 A;  1MDM A;  2HKO A;  2EV0 A;  2DTR A;  2MW8 A;  4MTD A;  5K1Y A;  1IXS B;  1ZRC A;  1TNT A;  4RM3 A;  4MTE A;  2E7W A;  2NAZ A;  3DKX A;  2UZK A;  3VPR A;  1F5T A;  5CVI A;  2QBY B;  5ERI A;  2LR8 A;  4ABZ A;  5GTI C;  3EYY A;  2B9S A;  4XL9 A;  2W48 A;  2DN0 A;  3F6V A;  2GWR A;  3FXK A;  3GF2 A;  2ZXH A;  4KIC A;  4UHT A;  3UNG C;  2KIQ A;  2L5Q A;  2ZSH B;  3SEQ A;  4CUG A;  4BJ6 C;  5L3C A;  1XCB A;  5D8L B;  1MMA A;  1U2W A;  1DGW Y;  2XKP A;  2ZME C;  1SMT A;  3K10 A;  3V4G A;  3S32 A;  4MFD A;  3VFZ A;  1LDK B;  1DDN A;  3R6S A;  3G4S I;  3WGG A;  3CD6 I;  3GX4 X;  1QQI A;  2QCO A;  2EFW A;  2QQ9 A;  1PP8 F;  2XGX A;  2K9S A;  2VKV A;  5EZG A;  4YIR X;  1R6R A;  2BYV E;  1IC8 A;  4B8X A;  2MGQ A;  2BY0 A;  3OS1 A;  3S17 J;  2G9W A; 
#chains in the Genus database with same CATH homology
 4XNF A;  1IRX A;  2E5Z A;  3D5R C;  1T0F C;  4OWR B;  2OV7 A;  1X1A A;  2LG4 A;  3BG7 A;  3H9J A;  2KLO A;  2LY1 A;  2MC4 A;  4CCJ A;  2IXS A;  1LVK A;  1OR7 C;  4II3 A;  2X1E A;  4B3X A;  1P9Q C;  4XOT A;  3HPG A;  3SEZ A;  4QPO A;  3ZR8 X;  3K4K A;  4E7H A;  3N05 A;  2E1M B;  5CPR B;  4DIQ A;  3OYF A;  3C2G A;  3EUA A;  2KRC A;  3RPU D;  2LOO A;  4F93 B;  4RLF A;  4YEL A;  4EAT A;  2CFO A;  3DKY A;  2VQL A;  3DU6 A;  3S3O A;  2CMP A;  4PJJ A;  2R7X A;  4HNT A;  3OS2 A;  4ANJ A;  2F4I A;  4B44 A;  4PJN A;  2WY8 Q;  5CQE A;  4FAS D;  3HOT A;  2BW3 A;  4F91 B;  2M0M A;  2M4K A;  2IGM A;  3M1C A;  2R7V A;  2LC2 A;  1Z21 A;  3H5A A;  4XN3 A;  3H35 A;  3CZ6 A;  4E7J A;  3J7A Y;  1YX3 A;  1U0J A;  1ZEL A;  2M4G A;  2LRE A;  2XC7 A;  4XKV A;  1Y6I A;  3K4N A;  4DOZ A;  4IZZ A;  3L2R A;  4DBQ A;  3PFY A;  4DBR A;  2X6W A;  3NWS A;  4N4O B;  4B47 A;  4F92 B;  1WJA A;  2JVH A;  2LRD A;  3E0J B;  2PMZ A;  4XOR A;  4BE2 A;  2CV2 A;  3K4J A;  4PJL A;  4XLF A;  4F55 A;  4CCN A;  3D5S C;  4LG3 A;  2PJR A;  2MAB A;  2W00 A;  3CMM A;  2W82 A;  3VWB A;  3LSI A;  4XON A;  1KON A;  5HNF A;  1NG6 A;  2IS4 A;  2VB6 A;  2V9K A;  2XSJ C;  3NWT A;  4E6K G;  3TMO A;  1Z3Y A;  3OS0 A;  3VYU B;  3QYE A;  4XM3 A;  1Z7L A;  4CH7 A;  2L9N A;  4CZC A;  4HEA 2;  3OYD A;  4J00 A;  2IGO A;  2VKH A;  2JSP A;  4DGW B;  1S9H A;  2IS1 A;  1MND A;  2VKD A;  2VQH A;  3C2H A;  3HOS A;  1X1D A;  3F9K A;  4KIT B;  4PSW A;  2UV1 A;  1Z3X A;  2R7R A;  5FRM A;  3HG9 A;  2VPL A;  1D0Y A;  4RM2 A;  2E60 A;  3LSG A;  3RQ4 A;  4ZTF A;  3I9V 2;  2OUM A;  5CKT A;  5HNH A;  3HXL A;  1G8X A;  1DGR M;  1D1C A;  3OOU A;  2X6Y A;  3IP4 B;  1AA7 A;  3OR2 C;  4C2U A;  2K9L A;  2WAD A;  4NUB A;  3OYN A;  1BOB A;  2KQR A;  4XMY A;  3L2Q A;  3HUG B;  1PJR A;  4PUS A;  2IGN A;  2MYS A;  2VXD A;  3K4L A;  4B48 A;  3TBI A;  1Y56 A;  1WFX A;  4XLE A;  1PYV A;  3FBN B;  3OL4 A;  1D0X A;  3PNY A;  1FMV A;  2VQG A;  3OYH A;  3K4C A;  3QYF A;  4NQW B;  3L2V A;  2HVS A;  4FET A;  4HG2 A;  1LFP A;  1HA8 A;  1G59 A;  3DU5 A;  3VYS B;  3AFH A;  2JA2 A;  4OAY A;  2VQC A;  2WB1 A;  2VXZ A;  3IAM 2;  3UR3 C;  1D0Z A;  3L2W A;  4KIS A;  4BUP A;  5TGT A;  5KCM A;  4AVZ A;  5KHD A;  3AKZ A;  4BL0 B;  2HPI A;  2RQQ A;  4NNJ A;  2K9M A;  3MKW B;  4D9J A;  3H9G A;  1WJD A;  3U21 A;  2RNG A;  3OL3 A;  2HDW A;  1EA3 A;  3BCA A;  3DTE A;  2X85 A;  3GBG A;  5KNL A;  1SFK A;  4NC7 A;  3VYT B;  3W3C A;  4PFO A;  3OYG A;  1MMN A;  2VJ4 A;  1V5F A;  4ZDL A;  2UWM A;  3AL0 C;  1GLN A;  2ZXI A;  5HVQ C;  1YX5 A;  1UEL B;  2V26 A;  2VAS A;  3RTR A;  5FRO A;  4BQO A;  5LD2 C;  1NG7 A;  2CW7 A;  5LFA A;  3H9Q A;  3OIP A;  2DOA A;  1MMG A;  2JUG A;  4JQF A;  3RCO A;  4BQN A;  3SYT A;  3AL0 B;  2L9S A;  4MLO A;  1E0E A;  4P1W A;  2HPM A;  3S3M A;  2XF7 A;  3ZGK A;  3SZG A;  4BE0 A;  1N78 A;  2CS3 A;  3DPL C;  3OWT A;  2RRE A;  2NOJ B;  3H5N A;  3W2W A;  4AYB A;  3K4B A;  3K4M A;  5CQG A;  4DJA A;  5HLT A;  4BE1 A;  4C2T A;  2Z2S B;  2R7Q A;  2R7S A;  2Q1Z B;  3DPU A;  3KEY A;  1FMW A;  4P5O A;  4JOM A;  3IAS 2;  1WJ5 A;  4Y33 A;  2DT6 A;  4ZYA A;  2M3A A;  1QHH D;  2VLA A;  4D1Q A;  1J09 A;  2V4J C;  3DEE A;  1VZ0 A;  4ZJZ A;  4E7L A;  2MFZ A;  1N75 A;  2R7O A;  4II2 A;  2XAU A;  2FUG 2;  2M7A A;  2Z1D A;  2ELJ A;  1X1C A;  5HOO A;  2XF6 A;  4BDY A;  3E1S A;  2WBM A;  3L2U A;  4AU7 A;  2GOM A;  2HU9 A;  3EPZ A;  2IS6 A;  2Q2E B;  3MKY B;  2KZV A;  4LIV A;  3K70 D;  3LSM A;  1WJE A;  2K3P A;  3DQV C;  3CJR B;  3CES A;  3HC7 A;  3DPT A;  3PL8 A;  2ZSI B;  2BW3 B;  2KP6 A;  3BG6 A;  2VIX A;  2MD0 A;  4PSX A;  5FRN A;  2JVG A;  4H4K C;  2R4G A;  4YEJ A;  1V5E A;  3KX2 A;  2HVQ A;  3VYR B;  4CCO A;  2WAQ A;  1ERD A;  3BLY A;  3D5L A;  1DQU A;  4HPQ A;  3QYB A;  3ZXS A;  2CUJ A;  3M8J A;  3H0D A;  3VDX A;  3PNT A;  3OR1 C;  3PJR A;  4BQQ A;  2A5W A;  2HNH A;  2X6X A;  4XN0 A;  1BR1 A;  4RLQ A;  4BGD A;  2I8D A;  2R7T A;  4CCK A;  4XLC A;  3OIQ A;  3CF2 A;  3IUO A;  4LIT A;  2VJ5 A;  2KPM A;  3W2V A;  2IGK A;  2ZFU A;  2V6E A;  4LIU A;  1OLT A;  1UG0 A;  1X19 A;  2UUZ A;  3FDY A;  1X4O A;  4BXF A;  2CUZ A;  4X0G A;  3OYC A;  3HL2 A;  2E1M C;  4IQJ A;  2IS2 A;  4CA0 A;  4E7K A;  3OY9 A;  1WJC A;  2XF5 A;  4F52 A;  1BR4 A;  4BEH B;  3A4C A;  4IKF A;  4G6T B;  4E7S A;  1UAA A;  4HST A;  4KT6 A;  3V42 A;  2X1D A;  3S8P A;  2DT7 B;  2KL4 A;  3RSN A;  4F3Q A;  2WA0 A;  2A6T A;  4CSW A;  3ZCO A;  2P0W A;  2V7F A;  2VJI A;  4XLH A;  4HNU A;  3VSK A;  4BAC A;  3DTK A;  4CCL A;  4IX7 A;  1V5G A;  3MD2 A;  4BEH A;  4C9Y A;  3LSK A;  1LKX A;  1SAU A;  2HQA A;  1WJB A;  2CH0 A;  2F5V A;  4IQ4 A;  4PK4 A;  4BJ5 C;  4GRI A;  3OMY A;  4BJT A;  2X1C A;  1T95 A;  3ZQQ A;  3HKZ A;  3LMM A;  1QHG A;  2KDO A;  3QOD A;  3OYA A;  2Z16 A;  1D1B A;  3A1Y A;  2V1N A;  4NC8 A;  4HRI A;  4PJM A;  3K70 C;  2F6C A;  1X1B A;  3FBI B;  3HPH A;  3CJQ B;  4PFP A;  2E5N A;  4HSR A;  2X51 A;  2QKL B;  4ZDP A;  1N77 A;  3MMY B;  3S3N A;  4KJZ A;  4C30 A;  4XKW A;  2LYC A;  4J01 A;  1MNE A;  2LBF B;  2BVL A;  2PJR B;  4Y4R A;  3OYK A;  3QOE A;  2L7K A;  2KRH A;  3FHN A;  1YE9 A;  2W7N A;  1WJF A;  2VJJ A;  3A2K A;  2LY2 A;  1D1A A;  4XLA A;  4XKB A;  2CV0 A;  3BCB A;  3PSI A;  2WAF A;  1QU3 A;  2BVM A;  4BS9 A;  2AQF A;  2K5C A;  3ZRG A;  3I3L A;  3K6G A;  3BC8 A;  4U7B A;  1DP3 A;  2LH9 A;  4BU2 A;  2QKM B;  4N4N B;  2W1O A;  2R7W A;  4BDZ A;  1TZL A;  4XKC A;  5JHF A;  4CCM A;  3CP2 A;  3OYE A;  2L2O A;  2M7B A;  3SDB A;  3LSH A;  4B43 A;  1MMD A;  3VSL A;  3MKZ A;  4Y3O A;  4ZC3 A;  2VL8 A;  3W2A A;  4OAZ A;  3DTI A;  1X4P A;  2LBF A;  3PNV A;  2DXI A;  4E4H A;  4XQF A;  1K6Y A;  4ZDO A;  1W36 D;  4XOP A;  4E7Z A;  3OYB A;  3G2B A;  2CW8 A;  3H5R A;  1MW7 A;  1BR2 A;  4RM3 A;  2R7U A;  3DKX A;  4QPQ A;  4ITV A;  2DCE A;  4ZTJ A;  2AQE A;  2W4S A;  3DWL E;  4E7I A;  4XL9 A;  3PUB A;  4RMN A;  3ONQ A;  3DLA A;  1TT0 A;  2HZD A;  2OC6 A;  3S93 A;  2KHM A;  2ZXH A;  2Y0S A;  2CV1 A;  3UNG C;  2KMU A;  2L5Q A;  2ZSH B;  3SEQ A;  3EUH C;  3FKJ A;  2O5R A;  4BJ6 C;  2WY7 Q;  4CUG A;  1MMA A;  2HVR A;  1DGW Y;  3KYL A;  2BOL A;  3K10 A;  3S32 A;  4YRV A;  2DJI A;  2WAE A;  3EUK L;  1LDK B;  3TL4 X;  3LFU A;  3CP8 A;  4XR6 A;  3OYM A;  3OYI A;  1W36 C;  1JI8 A;  3OYJ A;  4R79 A;  3OYL A;  3PSF A;  1R6R A;  2GOX B;  4U87 A;  3LL7 A;  3OS1 A;  2XDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...