2W7NA

Crystal structure of kora bound to operator dna: insight into repressor cooperation in rp4 gene regulation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRFB TRANSCRIPTIONAL REPRESSOR PROTEIN
publication title Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 31
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16509 KORA TrfB plasmid transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w7nA00
5CKTA 2W7NA 3M8JA
chains in the Genus database with same CATH superfamily
4I76A 2XKPA 5K7ZA 2K27A 1IUFA 4JBAA 3A01A 1APLC 4I0AA 1MMDA 2LDUA 1A6IA 3W6KB 4C2UA 4G6QA 4ON0A 2IJLA 4EJUA 3IH4A 2MD5A 3SFZA 4G6DA 3KP6A 4OIRF 1SANA 3KLNA 1UCRA 1OLTA 3FX3A 3KFWX 4IEJA 3WG9A 4QSHA 4S05A 1N78A 3MEXA 2CUZA 2KRCA 3BOQA 5J8CA 1RIOH 1X4PA 1D0XA 2O8KA 4EGZA 2K5CA 3CCMI 5LFAA 1R49A 5IP9J 1GVDA 4N4OB 4AM3A 3D5LA 5B5EC 5KAIC 1A35A 3K6GA 4FX4A 1P7JA 3RKYA 4EJWA 4S0HB 4MFEA 4ZH4F 3CJRB 2LVSA 4EMSA 2XPWA 3IHUA 5M3FJ 1T0FA 2LR8A 3IH3A 1LNWA 2ZXWH 4XL9A 3Q0VA 5DD8A 2OQRA 4F55A 1OR7A 3OYCA 1XN7A 2DYRH 5HNHA 2CUEA 2DA1A 1LFPA 5HNFA 3OSFA 3U9GA 2X6YA 2WTEA 4AYBN 2OTJI 1R1VA 1YE9A 2QQAA 1I3QJ 1MGTA 3O3KA 1XG1A 2MGQA 2BHZA 4XKWA 3TL4X 3GTGJ 2YR2A 2E7WA 3HSEA 1QRYA 3JRAA 1ZRDA 3LFUA 5ILVA 2D5VA 3FMSA 2R7WA 4ZZDA 4F7ZA 2KJCA 5IT9K 3EQLF 4XRMA 1XDUA 4RGSA 1IUYA 1CF7B 4GXOA 4CHUA 1K78B 3DWLE 1OYIA 4BAYA 4A3JJ 3PJRA 1USSA 2MYSA 2O03A 3DPLC 2VQGA 2XVCA 3VB2A 1HW5A 3ASOH 2M8GX 3S2DJ 3M4OJ 3LQQA 3I53A 2IS6A 3K4MA 3PM1A 2KIUA 5HLIA 2DXIA 5JI6A 1TNSA 5E1XA 3W2WA 3WTZA 2V1XA 3FMQA 1Y39A 1S29A 1UB9A 3PNVA 2Q8KA 1W36C 1KGSA 3LSRA 2QSGX 3HSFA 3LL7A 3F23A 1ZRCA 3JAMZ 3P9CA 4N9IA 4HPQA 1WJ5A 4I2OA 2LKSA 4BQAA 1W36D 4EEFG 1TC3C 1TWCJ 4G7OF 5D4RA 5M3MJ 1YITI 3KLOA 2Y75A 1H88C 1IXRC 1QPMA 3EETA 4IRGA 4KN7X 1WJDA 4HG2A 3EYYA 4GRIA 5E8IA 3X2QH 3ZMUA 3PO3J 5KAFC 1ETQA 2LLKA 2EV6A 2A07F 3OYKA 2AXTC 2DT5A 2IP2A 2IGNA 2X51A 3HGGA 2MD0A 3QODA 4M3BA 5J8FA 4YIRX 1W0TA 5AIPA 3CLQA 1BL0A 1FJLA 4OIPF 3V8JA 1FTTA 4LFUA 5JR3A 1QNTA 3OYGA 3CMYA 3S3NA 2OBPA 2EJRA 3RKWA 2NYXA 4XNFA 3BG9A 5HVQC 4I7HA 4EV0A 2XUBA 1ZLKA 2DW4A 5IYCJ 5LRSA 1FYKA 5HODA 3GUDA 3OY9A 1WGXA 2MH9A 5TJJA 5EEHA 5HDNA 4XKVA 3L7WA 3V7CA 3VFZA 5DEQA 4HOBA 3AG2H 1BIAA 2VKVA 2VLAA 1K79A 1QZEA 4XLHA 4QTRA 2HQAA 5F1RA 3S17J 3FISA 2Y9YA 1O7LA 1QVTA 2RAEA 2V79A 3S3OA 1SEUA 5GAHJ 2E36A 1Z3YA 5KVRA 1D0YA 2OZ6A 3DKYA 2MA3A 4JYKA 1KQ9A 3TDUC 1YJWI 1R5ID 1YW7A 1C0WA 1VQKI 2XPVA 3OYDA 1XX5A 3E5XA 2OF7A 3LSIA 3GX4X 2JRTA 2FNAA 1W4MA 4XICA 2XRLA 2F5VA 2VE9A 2LFBA 2EQRA 1V5EA 5CPRB 3CMAI 1F4KA 3K4NA 2M3AA 4ZYDA 2A61A 1X1AA 1R9TJ 3UR3C 3L2UA 2DTRA 1IC8A 4PDKA 4UV8A 2PBIA 3H9QA 2YU9J 4U7BA 4N9HA 1BC8C 1XSVA 2NXNB 3M9AA 3WE3A 1JT6A 1UHWA 2Y30A 3IL2A 2HDWA 2HPMA 1OCPA 3HC7A 1WFXA 3HYIA 3I59A 3A2KA 2Y9ZA 5FLXZ 3V4GA 1HDDC 1EKEA 5TISC 3BR0A 4UHTA 3HOXJ 4NHJA 4S04A 2R5ZA 2DFEA 2LOOA 2W25A 3L9FA 5CLSA 3DBRB 3OV8A 1A6QA 3SDBA 5FFZA 2FE3A 2M7BA 4JP0A 5HLHA 1G8XA 3NEUA 4CYCB 1VQOI 1FX7A 2RN7A 2Z5UA 3DLLF 1ETKA 2IGKA 2KIMA 1SFKA 3GZ6A 2N8GA 2WAEA 1FY7A 2XF6A 2QM3A 3BG3A 3DCFA 4B09A 1DPRA 1I1SA 1DGRM 4AVPA 1X4OA 1JJ8C 1YTYA 2CS3A 2NOGA 2ICWG 1D8KA 3QOPA 4PK4A 4PZJA 1ZH5A 5C4JJ 1HOMA 2P8TA 1BR1A 3HOUJ 4BNCA 1BM9A 4BE0A 3G6EI 3BP8A 4A6DA 5LGUA 2YU3A 4RBOA 2K4JA 3G71I 2K9QA 3G3ZA 3B6AA 5JHFA 2IW5A 1K4SA 4NC8A 2ZCWA 2P4WA 5ED4A 4RS8A 1I3AA 1Z7LA 3L2WA 1D1CA 2KZVA 2PQ8A 1XGOA 2DLLA 2HS5A 2P5VA 3KEQA 4HSTA 2L9NA 4WF2A 4IF4A 5EG0B 2JPBA 2XASA 5ILSA 2FQ4A 4HQEA 2ESNA 3WTWC 4HYEA 3C3WA 3O8HA 1GXQA 3SDGA 3U1DA 4B4CA 4AUXA 1FYLA 2JA5J 1K61A 2KKOA 4IHVA 4L5EA 5ERIA 1PUEE 2D2WA 4IHYA 1HBXG 3IP4B 2X1DA 2LP0A 4MTDA 1LE8B 4DNCA 2J5PA 1FP1D 2F5EA 2CV0A 3GTLJ 5LEJA 1XTAA 2VKDA 5FGMA 4XOTA 2O61A 2P5KA 1ON2A 4UB6C 3FXMA 3R61A 3F3XA 4UVCA 4F52A 2Z1DA 4PCQA 3GTKJ 5ICCA 4M71A 3JAMK 4E7HA 4CCLA 2R5YA 4XSZF 4JX5A 2ZBKA 3RYRA 2R93J 2HOAA 3LQRA 4M6VA 3OMYA 2NS0A 5C4XJ 2XKOA 1MMAA 2DDBA 2JWTA 5EZHA 5GTIC 4A5NA 2VOOA 2P6SA 3A01B 3RQIA 3GFJA 1MW7A 1KU2A 3D5SC 1I27A 3C2GA 1DP7P 1S9HA 2WADA 2JRMA 2QSFX 1DPUA 4MO7A 4MTEA 4C3JJ 2GZWA 1CF7A 2LK2A 3NWTA 1F43A 2EH3A 3EUHA 1K78A 3CC4I 3IV5A 3IAS2 3ZMVA 1IRFA 3BTIA 2AS5F 1P4AA 2DFFA 3K9TA 1ZR4A 1HSJA 3JR9A 3JREA 3MD2A 2ELKA 3NRVA 4KFCA 1BJZA 4PFPA 1MJBA 3I56I 3CUQC 3OIPA 3HJEA 4XBFA 3TGNA 2RNGA 4HZFA 3CF5F 1OCZH 4UVAA 3CC2I 3MKWB 3DQVC 1LDJA 4E7IA 2K4BA 3FXLA 1P2FA 4XRSG 3GZ5A 5M5XJ 2VJJA 2UZKA 2BY3A 4NB5A 3TO9A 1REPC 2A5WA 1WHUA 3P5JA 4II3A 1YIJI 1WRJA 3BQYA 1FOKA 1SMTA 2WBMA 3ZQFA 3H9JA 5LGNA 1R4MB 4PFOA 4FASD 3LSMA 5JLXA 1GHCA 4YEJA 3DEWA 3EPZA 4XM3A 4IRHA 2R7ZJ 4XONA 2ZFWA 2OCCH 2DK8A 3E6DA 1E2XA 1XD7A 1FWZA 5DS9A 1BW6A 1O3QA 1WPKA 3RJPA 2EZIA 3PUFA 4U87A 1HSTA 3T0YA 2PI0A 3I64A 3E7LA 3R0JA 4BY7J 3WTUC 1IF1A 3TW7A 3ZQGA 2M34A 3FDYA 1IV8A 5E8GA 3TW6A 5J1RA 2P0WA 3F9KA 3HTSB 1R36A 4MNUA 4YELA 3HOVJ 2K9MA 5L3BA 5FLXK 1ZQ3P 1IXSB 2RNJA 4U0VA 2J5OA 4DYQA 2JSPA 1DGWY 2W1OA 3CCRI 1JTXA 2WAFA 2YPRA 3HRTA 5H6RA 3S15J 2DQRA 3BT9A 2KT0A 5CVIA 3BJ6A 3I58A 2WY8Q 2LD5A 1IO2A 2FD5A 3SZPA 3ZMZA 3OYBA 5IOZA 5IYDJ 3FXKA 4YIIA 2M45A 2PN6A 4DGWB 1TZLA 2FBHA 3QRFF 2HYJA 3M1CA 4L0YB 3KZYA 4A93J 2L9SA 3QYFA 4U0YA 3CLOA 1CGPA 3R0AA 4A5MA 4M3DA 4LIUA 2DJIA 1U2WA 3RZDJ 3EDPA 3HPHA 2IA2A 4P5OA 1VQ4I 3T8TA 2QYOA 3KP3A 4WXDA 5LHGA 1T38A 2Y0MA 2PJPA 4KA4A 4RAGA 2VXDA 4FTHA 1IV6A 1MJ9A 3C18A 2E7XA 3WE2A 1MNEA 3K1PA 2VJIA 3H5NA 3ZN1A 1GV2A 1FYMA 3G2BA 3W6VA 2DT6A 1HW2A 4M3EA 5J40A 3SEQA 5CQGA 3E0JB 2WWYA 2FUG2 2BZTA 2HNHA 3KYCB 1KU7A 4AD9A 5TGTA 3PFYA 2CU7A 1WJAA 1T33A 2FMLA 3E6BA 3CJQB 3AKZA 4PSXA 1AOYA 3ZQQA 3I71A 2DA7A 3ECOA 1MNMC 5BPDA 3Q0WA 3ZP5A 2EBIA 4UUTA 1SAUA 5JHUA 1OCCH 1Y8RB 1TTYA 4JX4A 3I54A 3LNQA 2KZGA 4A3MJ 3K1NA 1LPQA 4KNYA 3VYTB 4KUMA 4KIBA 5F27A 4Q4ZF 4G8XA 2RQQA 3RDIA 3CCQI 1J0RA 5E1WA 3S2WA 3AG3H 3GTQJ 2BXYA 2EFQA 4E7SA 1ZRFA 2E34A 2Y31A 2HDCA 5K5OA 4O3MA 3FHNA 1FP2A 2FMYA 3KCCA 3I5UA 2KFDA 3QOEA 1FMWA 1O3SA 2CQQA 3GTOJ 1MMNA 3WTVC 2XHKA 2DMQA 4L5IA 2FRHA 2FJ1A 3IAM2 1N77A 1UG0A 1D1AA 2W00A 4HF0A 4AIHA 3MFKA 4LB5A 1BC7C 2OU2A 1JKPC 5HDGA 2M30A 4RAFA 2V1UA 2X48A 3OYNA 1OYYA 1Y56A 3QU3A 2COMA 5J4YA 4U7DA 4L9TA 2EFOA 3BQZA 4EVIA 1UELB 3RZOJ 1RPWA 3RKQA 1IAWA 4OMYA 3OL4A 3C2HA 2LNBA 1LUJB 3E1SA 3ERMA 1BN5A 1W7PA 4E7ZA 3L2CA 3NWSA 3E3VA 4ZJZA 3RSNA 2AHQA 3I59B 4RGXA 5ICGA 2EV5A 5EG0A 5GAEJ 4MEYF 5GTHC 4IZZA 4BUPA 1VQ8I 2OTLI 2VT2A 3UNGC 3KEYA 1OKRA 3GZNB 2HGCA 3CCSI 4OAYA 2R5ZB 2M8EA 4QLCU 2VT3A 1L0OC 4DQ2A 4E70A 2LC2A 1ON1A 4MQ9F 4MQVA 5HS8A 4B43A 1YHQI 5GPCA 2K3PA 4LK1F 1DUXC 4M72A 4I98B 2EV0A 2H1KA 2GWRA 4E6KG 2EK5A 2ZMEC 2CGPA 4B47A 3FIWA 4BXUA 2X1CA 3OS1A 2Y69H 4G94A 1MBKA 1G3SA 1MSFC 5JVGF 1Z6RA 4IHXA 2DBBA 1WH7A 4GYGA 4LJZF 2LBFA 2V9KA 1BBYA 3EUAA 1X3WB 2XAUA 4HV6A 3FWEA 1V54H 3SFIA 4IO9F 4HX7A 1RESA 1WJBA 3KP7A 4M74A 3DPTA 2IVMA 1JUPA 2VIXA 2X4HA 2Z16A 1R5HA 2IS4A 3ZR8X 3HKZA 1J9IA 3GLXA 3EYIA 2LF7A 2XAJA 3MQ0A 4QPOA 5AONA 5ILUA 1YYVA 1F36A 4I0BA 4DW6A 1J2XA 3E5QA 2NVUB 4L0ZB 1ETYA 1CQTA 2PJRB 2NS7A 2R4GA 3F21A 1FOYA 2CRGA 1O3TA 5E17F 3J81Z 1IRZA 2A6HF 2LY1A 3N05A 2XGCA 5DCMB 1WQ2A 1XSXA 3RYPA 1GLNA 3BZKA 3JRCA 1OJLA 1LEBA 1VZ0A 5CVRA 3DU5A 4CCJA 1Z9CA 2BVMA 2JK3A 1LB2A 2RV8A 2ESHA 2H6BA 1IN4A 3HEFA 4IQJA 4TV7A 3A0BC 2OUMA 4F91B 1H9TA 1KZHA 4RLQA 4Y7NJ 2RKHA 4BDZA 3GFMA 4DBRA 3AL0B 4A3LJ 1ITYA 2CSOA 1D3YA 3HOYJ 2W85A 2AO9A 1OCOH 3TBIA 2R5YB 3TDZC 1Z7UA 2DQLA 1ONVA 4L9JA 4J00A 4NC6A 1R4NB 1JKQC 1YX3A 3T1BA 4E7KA 2ZSHB 3LSKA 3FXOA 4YRVA 2R7XA 2VBYA 2TDXA 3FXUA 4EM1A 2ID3A 2ZXHA 3O8GA 3H5RA 2O9LA 4IOCF 2JUGA 4Y52J 1NTCA 1IGNA 2M4GA 2R92J 3ZQLA 1X1DA 3CD6I 3QAHA 1T0FC 5D8LB 2JA6J 5DYMA 4GDFA 1D8JA 5J1YA 2X6OA 2L9VA 3LSPA 4IL6C 2CH0A 1BR4A 2CQNA 2DDAA 2QQ9A 4BHBA 4DJAA 3TQNA 1IG7A 2W82A 1T98A 5IOYA 1BIBA 3K2ZA 4Z2YA 5LRRA 1QHGA 2VE8A 2LF8A 2EIJH 1Z91A 2ACJA 3RPUD 1ZKGA 3I3LA 4LLLA 3FXRA 1XC5A 5CVVA 1SMYF 2ME0A 1G2HA 3HKZN 4EQQA 1X3ZB 1ZK8A 4OIOF 2VJ5A 4LG0A 4QWQA 1IJWC 1HKQA 3TEDA 3OYLA 1MMGA 3K70C 1GT0C 3BY6A 2X0LA 5DDGA 1B59A 2VODA 4A0ZA 3CESA 1Q1VA 2EWNA 2IRFG 4G9YA 5EYRA 3BPVA 5D4SA 4J01A 1SC7A 5EF6A 1VQNI 3HSRA 1U0JA 3K70D 1JI8A 4BGDA 3JRGA 2LSOA 4AIJA 4BY1J 5K7FA 2CV1A 3ZCOA 2OD5A 1XCVA 2DTZA 4G6TB 2V1DA 3GCMA 3M8EA 1X1PA 4BS9A 1BI0A 2AXLA 2M4KA 1HDPA 3K4JA 4EGYA 1XGMA 2L54A 4PGGA 2ISZA 3PNYA 3L1PA 1LDDA 5J47A 1XPXA 3KIOA 2HPIA 4IVNA 2DOFA 2I5UA 1HLVA 2STTA 2KHMA 2BBYA 1EH8A 2VC0A 4ETSA 4F92B 3P9KA 2GXBA 3OOUA 4AWXB 2XDVA 2STWA 2AQEA 2K9SA 5LHIA 1I1GA 4ITVA 1YQAA 3GO5A 3DBLB 1S3JA 2Q2EA 4W97A 2E19A 2I8DA 1BJAA 1YW8A 1JHHA 3GMEA 2QBYA 5M5YJ 1SFOJ 4L5JA 4BE1A 3F8MA 2QCOA 3WHCA 3GFIA 4LK0F 2BY1A 2NVTJ 1OCRH 3O6BB 4LITA 2LMDA 3P9IA 2A6TA 2EINH 2HOEA 2L4AA 4RGUA 4HSRA 2IA1A 5GAGJ 2P7VB 1XMXA 3CMEI 2EPFA 4BEHA 1IN8A 3VEPA 1YRNA 4RAYA 4HNUA 4NC7A 1T6SA 1VQ6I 3S1NJ 2CQ7A 2CUFA 2FF4A 2V6CA 3QPHA 1WJCA 4NNJA 3CQZJ 1LFBA 3I0TA 3ABUA 1QVUA 1DQUA 3VWBA 4L18B 1FEXA 1Y1VJ 1RR7A 2XB5A 5D6FA 2GLOA 3FBIB 3DTEA 1ZELA 2R7SA 1G6NA 3JRIA 1R6RA 2MG4A 4LMYA 3L2VA 2ZC2A 5K5RA 4MFDA 2DA4A 1NG6A 3B73A 5J6XA 2V1NA 2KRHA 1Z77A 4B1RA 2OJED 3D1NI 3CUOA 4X6AJ 2CW8A 1HCRA 4Q47A 4CZCA 2OCEA 1WI3A 3NARA 4NBQA 2ADUA 4HA8A 5HS7A 1O4XA 3AG1H 3F22A 1XMAA 3U2RA 2LY9A 1S7OA 2FEZA 3MWMA 3TO7A 4CH7A 1MKMA 4BJ6C 3DXJF 1EH7A 1MH4A 1UMQA 4DYCA 2K3FA 2CYYA 1S72I 2WAQA 3J81K 4BHCA 1BR2A 2E35A 3HB9A 2O6GE 5BPIA 2XSJC 3FXQA 5FKMA 1P9QC 2K40A 5FD5A 2YUSA 2PMUA 3W3CA 4C30A 5J4VA 4B8XA 3WU0A 4DYRA 4G7ZF 2JZYA 1R7JA 2FA5A 2BY0A 2ZJ2A 1K4TA 2KP6A 3H9GA 5C3EJ 4ZDPA 2GAUA 4A6EA 3Q5FA 2QWWA 1MZBA 2ELHA 2EIMH 3G4SI 1PJRA 3S14J 1XSDA 2R7RA 4BJTA 2EFPA 3J7YJ 2JA8J 1U6GA 1J75A 2GOXB 3GLLA 2QUFA 4FETA 4M73A 5EJCA 3OSGA 1U3EM 1FSEA 4IXAA 3V7SA 3LA7A 2BHYA 2E1MB 2GXGA 2LH9A 4O5VA 2DODA 4ZTFA 3HZJA 3KP5A 2F6CA 4D5CA 4GFBA 2F2EA 1A04A 2NS8A 4Q48A 2P5LC 3K4KA 1A36A 4A3GJ 3W6JB 3F6VA 1Z0XA 4HDVA 2LY2A 1H8AC 3F72A 1JGGA 2WB1A 2BGCA 1JKRC 3VOEA 1R1UA 3PFIA 4I99C 1E3PA 1TQMA 3PQJA 3K2AA 5EZGA 1YS6A 1T95A 3QP6A 1U5TC 1W7PB 2H27A 2HXIA 2UUZA 4LIVA 2HZTA 3FM5A 2VI6A 1YJ9I 1UJ8A 5B66C 4MGRA 5F08A 2XV4S 2PJRA 4KYWA 2ZB9A 2QLZA 1WSUA 2L4MA 2MC3A 5DCMA 2A69F 3FHZA 5B1AH 1FIAA 1JUMA 2A05A 2NNNA 1SD4A 2A3SA 1Z05A 2R0QC 3BLYA 3OR2C 2L01A 1D1BA 5FO5A 1XS9A 2H8RA 3E97A 2F5FA 1B72A 4XSXF 4MLOA 3OWTA 1I6HJ 3COAC 1LVAA 2ISYA 2BV6A 1ZG3A 3P7NA 2LBFB 4DBQA 4R1HA 1RZ4A 2XAHA 3BPXA 2L9RA 4XN3A 5DD4A 3F8NA 2DCEA 2QSHX 1XB4A 1MMSA 3C2BA 4A3EJ 2HQRA 1VQLI 3G1OA 1QZZA 1QA6A 3N97A 3SQNA 5F6FA 4CSWA 5LGTA 5AIQA 2GQQA 3ROUA 3BROA 3OS2A 3MKLA 2YX4A 1Q1HA 3GW2A 4A2UA 5FLVA 3PNTA 2M9HA 2EZHA 2AQFA 2VUMJ 2ZNZA 3QQAA 3K4LA 3S1QJ 2DN0A 4RA2A 2WB1N 2O7OA 2G0EA 2HTJA 3A4CA 3BTCA 3H35A 1PUFB 2PX9A 2KJBA 3LA2A 3S16J 4OOIA 3MZYA 3KYDB 2QF7A 5FRMA 3DU6A 4G12A 2Q0OA 4FT8A 4Y17A 3H5AA 2JQ7A 2IAIA 2KPMA 1ZARA 3NAUA 1X19A 3FKJA 4CA0A 3CUQA 2D1VA 3KETA 1MIJA 2CWEA 2VPRA 3MCZA 2TRTA 4HX4A 4LGWA 3KYLA 1P6RA 2LKPA 3GXOA 4PJ0C 4XLAA 4BH9A 3I4MJ 3FMRA 4K2EA 4MIMA 5D5XB 3JRHA 2Q1ZB 2QZ8A 4ZYGA 5ICFA 3IWZA 4UNOA 2CG4A 3WGGA 1FBSA 3WTSC 1T39A 2DPDA 2LTPA 4FX0A 2DOAA 3IRQA 3L2RA 3VSLA 3PL8A 3QWLA 1ZG1A 2DYSH 4H4KC 5EEGA 4XN0A 3RQ4A 5E18F 1ZGAA 3OIQA 3OYMA 5GPAA 2E1OA 2PEXA 2Y2ZA 3CJNA 3DKWA 4Q5SF 2F4MB 3GEZA 3ZQHA 1MD0A 1W5CC 1UZCA 2DMPA 3HBLA 4CUGA 1S7EA 1RKWA 3BZ6A 2FSWA 5BMZA 3F8CA 3K4CA 2FBKA 1TL8A 4HRIA 1W5TA 2JTVA 3K69A 1HKSA 1IW7F 2MSYA 5K1YA 1QO0D 1KYWA 3DTIA 1GVJA 3V8LA 1W0UA 1V5GA 4I02A 4F93B 1USTA 4LG0B 1QU3A 3LAPA 3S2HJ 2ECCA 2HYFA 3HPGA 4HAMA 1QBJA 1ODDA 1J7KA 4XLNF 4A12A 1E0EA 3JCUC 4AU7A 1G3TA 4PJJA 3L00A 3S32A 5K5QA 3LMMA 1FT9A 3BR1A 4YFKF 3J80Z 1E17A 1LDKB 4HLXA 3ISPA 2HWVA 4IHWA 4XLCA 2ELJA 4Y4RA 4I09A 4D9JA 5IP6A 1LKXA 5D5VB 1KU3A 1AU7A 4B48A 5LLQA 4ANJA 1TT5B 2CFXA 2GOMA 3MAJA 2JUCA 2JSCA 3ZQIA 3EUKL 3PO2J 1VNDA 1R22A 2RREA 1WVRA 5F64A 2WC2A 5GP9A 1VQMI 1GDTA 2NVYJ 5CKTA 2Z3YA 4FISA 3H0DA 1SAXA 2G7UA 2IGMA 1HC8A 3BG5A 2EB7A 1TWAJ 4NDLA 4U0WA 1TT0A 3A0HC 1SD7A 5L3CA 2Q2EB 2VKHA 3ZMSA 2H8WA 2QBYB 3S93A 2PFBA 4HF2A 1NK3P 4IOAF 2JN6A 3G73A 3OR1C 2PLYA 2E71A 2BE5F 3C7JA 3FZVA 4UVBA 2YS9A 1WCMJ 1FTZA 3WU2C 4I6ZA 4D0PA 3DPUA 3B6CA 2VQLA 4BQNA 1TWGJ 3CDIA 3M8FA 4BEHB 1X3UA 4A3FJ 2K7LA 3MZHA 2O0YA 1YRNB 5BS6A 5EGOA 1YG2A 3KPHA 2VB6A 1TW2A 2G7HA 4RMNA 3A1YA 5HLGA 2E2IJ 1EA3A 1ZYRF 4BHPA 1T2KA 1YIOA 2HOSA 1UG2A 4KIGA 5CQEA 1G4DA 2IS1A 1MBJA 4KMUX 2V9PA 3Q9VA 2WA0A 2VBWA 1RI7A 4HNVA 3U1KA 2TCTA 2B9SA 5E3OA 4A3DJ 2ZFUA 3J7AY 4ZTJA 4RB0A 2R7DA 2GIVA 4NQWB 3SEZA 2LKXA 2XF7A 3I9V2 3TO6A 3M3YJ 4EJTA 2KMUA 5J1UA 2FOWA 2FQ3A 4UUSA 1N75A 2WV1A 3HUGB 2VASA 5GADJ 4EATA 4IPAA 3H3UA 1PVEA 4F3QA 1MDMA 4A0XA 3DFGA 4HW0A 1Y8QB 5LEKA 5FKLA 3VYUB 3OOPA 1ZAOA 2EA2A 3JSOA 2H09A 2ZNYA 4EJVA 1E3HA 4OU0A 1EH6A 4XRFA 2RQPA 2VONA 1J5YA 2JVGA 1ZTRA 1LFUP 2MC4A 2YX7A 1V5FA 3FXJA 2H6CA 3D0SA 1MNDA 2V7FA 4ZDLA 1FZPB 1D5YA 3VDXA 1RUNA 3MZ8A 4KDPA 4XIDA 2F4IA 1MBEA 4HQMA 3SZGA 5JVTA 4P96A 3RPQA 4AIDA 1IDZA 2IS2A 1P4XA 3K7AJ 4RM3A 3BZCA 1ENHA 3KEOA 4ENKA 3CO7C 3RIRA 2EZLA 2E5NA 2EFNA 5F0FA 2DA2A 5L3FA 3R6SA 1B9NA 4HNTA 1U78A 1ZN2A 3BCBA 1RC9A 3DKXA 2F5CA 2NOJB 2BW3A 1R1TA 3FK7A 1SFXA 4ESJA 3HRMA 3DEEA 2E1NA 3S1MJ 1OISA 3M8JA 3BCAA 3PQKA 2L7KA 4PGHA 2JA2A 1STZA 4CCMA 2O5RA 1A31A 4NUBA 1KYZA 4ESBA 1YJNI 3WGIA 4MEXF 3CCEI 1SVMA 3KP4A 3CF2A 1SVLA 5FKKA 4BDYA 1B1BA 3M1EA 1HA8A 3G1MA 1AWCA 1UFMA 5E3MA 3MKZA 4PJLA 2EIKH 1SD6A 4CO8A 1PUFA 2L7MP 1X2MA 5F0HA 3ABTA 4KN4X 5CJ9A 1B72B 4XK4A 3WODF 2F5DA 3MMYB 2MABA 5FKNA 5ICEA 2EZKA 3ZN0A 1YS7A 2DA3A 2XGXA 5JFRA 3ZGKA 2DA6A 2LG4A 1RETA 3J80K 5E79C 2IBDA 3BDDA 2XSDC 3CCYA 3VPRA 1GUUA 1OCTC 3IUOA 1W1WE 1HQCA 3F8BA 3QP5A 5HOOA 4ENJA 5L3DA 3OYAA 4ZYHA 2ZJRF 3ML6A 2K9NA 2IXSA 1KA8A 1JTYA 1H89C 4C2MJ 1WJEA 3L2QA 4A3IJ 2IEKA 1OMIA 1FMVA 3DF8A 2GIZA 2OC6A 1H9GA 3GTMJ 4LB6B 2W84A 3HTUA 5M5WJ 3ABLH 1O3RA 4KISA 3GTPJ 4E7LA 2L7ZA 3HIFA 2HOTA 1AKHB 2FNPA 3MN2A 4CCNA 1ZHFA 3SYTA 1OR7C 2VBXA 1HXDA 2Z2SB 3VYRB 4XORA 1I39A 1KQ0A 2KIQA 3CP2A 2ZKZA 4GYIA 2MH2A 3RPUA 3VODA 4B44A 1FSHA 1MH3A 1WI9A 4X1EA 2E5ZA 2FBIA 2OV7A 1XGNA 2QGUA 4ENMA 2PMZA 2JMWA 4BU2A 1VI0A 2I10A 1Z6TA 5D8KB 1JKOC 3CUQB 4R8HA 3CCVI 3CJTB 3S1RJ 4M3GA 3HL2A 2KRFA 2O8XA 2XC7A 2B63J 3PUBA 4AC0A 2CO5A 3TP0A 4IRIA 4JK1X 1B6AA 1J09A 2WY7Q 2RVCA 2BOLA 2B0LA 4M9ZA 1G59A 4HLYA 2RC4A 2R7QA 2CW7A 3G1LA 1OFCX 1TWFJ 1ZR2A 3GVAA 4D7NA 2MFZA 3B02A 3H3ZA 2NVQJ 1I6XA 3BJOA 1IN5A 1OQYA 4N0BA 5E1ZB 1RRJA 3GF2A 4V19K 3CCUI 1D0ZA 3T5XA 3OS0A 4C2TA 2DA5A 2NRAC 1ULYA 2HXOA 2VKEA 5FRNA 5KHDA 4E4HA 3PSFA 1NG7A 2WV0A 1B9MA 5LD2C 3CDHA 1F5TA 3JRBA 1NK2P 3R60A 2V9VA 2L7FP 2OAZA 4BQOA 6PAXA 2CFOA 3BR6A 4BJ5C 3GTJJ 1VF9A 4GGGA 1RNLA 2MBFA 3LSTA 3JSPA 5L3EA 3HOTA 1XDSA 2QQBA 4ZYAA 4KT6A 2DI3A 2MLKA 1R71A 4RAZA 1V3FA 1S5LC 1Y6IA 2X9DA 4KJZA 1XCBA 3SZTA 4BL0B 5IP7J 2PMHA 4OWRB 3E6MA 3KE2A 2XGEA 4OIQF 1OPCA 4OAZA 4CICA 1YI2I 2V26A 3ABKH 1ZG5A 2ID6A 1E3OC 2BXZA 1BI1A 3RI4A 4GCVA 4ZYEA 1EF4A 1MJAA 2PMZN 1BA5A 4ENNA 3RTRA 3U21A 1QPIA 5D6EA 3SXYA 2ZO4A 4PSWA 3HHHA 3JRDA 4P9UA 3LOCA 2DMUA 3SHFA 1YOVB 1H0MA 3CDLA 1ZGJA 2X6WA 3IH2A 1POGA 2FU4A 2OA4A 2JT1A 4NQWA 4P9FA 4WXCA 5H2FC 4O6JA 4IHTA 2V4JC 3CCLI 4B3AA 1Z3XA 1R00A 4M9XA 2W48A 1L3LA 2VJ4A 3HUGA 3F6OA 1JGSA 1QQIA 3DP7A 2XROA 1TNTA 3IC7A 4LOCA 4HF1A 1OYWA 1Y0UA 2ZXJA 4A3CJ 2K02A 5E20A 1TQPA 2Y0SA 4CGZA 2Z99A 5HS9A 1T8IA 3TOAA 4LLNA 5LHHA 5EGOB 3ERED 2R7UA 4L9VA 2A68F 1YLFA 2KDOA 4UY8I 2IGOA 3BTJA 2L5QA 2E2HJ 2JJ7A 4IQ4A 4CCOA 5C44J 3QYEA 1BI3A 4N4NB 1P92A 4J19A 3ZRGA 4BKXA 2CQKA 3I4PA 4XKCA 3N4MA 3JW4A 1J59A 1WWXA 5IY5H 3HOZJ 1LEAA 2HEOA 2M1BA 4D5FA 5E3LA 4RGRA 3TOBA 1IRGA 3Q3SA 2JVHA 3HGYA 1MBGA 4D1QA 2X1EA 2QQ8A 2DMTA 4UUSB 5FKOA 2EILH 5FB2A 1K6YA 1IZ1A 1QGPA 1YX5A 3FM3A 3VYSB 1SFEA 1B8IA 2OZUA 2R7TA 3K0LA 4UXNA 3TMOA 1FOWA 1HW1A 5KK1A 3TKYA 3W2AA 3KZZA 1MDMB 2K85A 3DLAA 4D7MA 1O7FA 1GV5A 2P81A 4AVZA 1U5TA 1F9NA 1JE8A 2MLGA 5CVUA 2UXXA 1WJFA 1JUSA 1ETVA 1JHFA 4IHSA 1V4RA 2GBYA 4UUVA 2W7NA 4PUSA 4YIFA 1U8RA 1HF0A 4WX9A 1WKMA 1T56A 4HBLA 4IJAA 1MSEC 4KICA 4ZDOA 4XLEA 5TRDA 1Y0NA 1I50J 3L09A 4I01A 2HKXA 2W24A 1VQPI 2R3SA 5F0CA 3RKXA 4G7HF 3WGHA 2HQ5A 4XRSA 2WAQN 4Y13A 3OYJA 3ZXSA 4CZZA 2GM4A 1W5SA 2Y0SN 2ZMEB 1R58A 2CUJA 4RLFA 3QU6A 4CXFA 3CMMA 1VTNC 2CJJA 4BE2A 1A5JA 1NH3A 3K10A 2ECBA 1UHSA 5BQTA 2F4OB 3LSGA 2KDZA 1JJ6C 2E2JJ 1IXCA 4A69C 2L2OA 3QPLA 3WU1B 1DU0A 2HVRA 2KIFA 2KL4A 3IKVA 3UKGA 2BW3B 1ZREA 4BBSJ 2P6TA 4L9NA 5FJ8J 3CTAA 3AL0C 2K9LA 2Z9OA 2DOEA 3K1MA 3CO6C 4M6YA 3ECHA 2ZSIB 4II2A 3HM5A 2VL8A 1JXSA 2VBZA 2B7EA 1AKHA 3OYHA 2H1LA 3HOWJ 3ESWB 3H36A 3QPTA 3K4BA 2HFHA 1DDNA 1F1ZA 3LSHA 4BXXJ 2GA2A 2KISA 4DZPA 4B3XA 1DP3A 1BI2A 3D5RC 4P55A 4GO1A 1MBHA 4PJMA 1V55H 5DUKA 4LG3A 4YFNF 5DM6F 3WTXC 2F48A 2M0CA 3ZMTA 2HYGD 4HV5A 2FX0A 2XB0X 2X85A 3BG7A 4W1UA 3A02A 4OMZA 1Z1DA 1PP7U 2IT0A 5J3LA 2DMNA 3WG7H 4QPQA 2UXNA 3C1DA 4KIFA 5FD6A 3I4NJ 1P7IA 4HX8A 3J7ZI 4FQGA 1QZYA 3EUHC 1RR8C 3KP2A 2VC1A 5A2QZ 2E1CA 2BYVE 3PSIA 3OIOA 2NAZA 2M7AA 2CV2A 3A03A 2C6YA 2LREA 2LYCA 2XAGA 3T8RA 1XGSA 4RDUA 3WTTC 3ONQA 3ZPLA 1UHMA 2CMPA 2W4SA 1JT0A 2FXAA 5HLTA 3PIPF 3LAJA 4ZC3A 2XGDA 3CCJI 4RM2A 3SJMA 1UAAA 5B1BH 5HDKA 3WTYC 4XKBA 1TBXA 5DCFA 1R5GA 4X0GA 4WXHA 1K83J 2HQNA 3ABMH 1Z67A 3BTLA 2JA7J 4EJOA 2DU9A 4HDUA 3W2VA 1PDNC 4M3FA 3ASNH 2ZJPF 2H94A 4YFXF 2HR3A 2EA4A 1SFUA 4V2GA 3HRUA 4RB2C 2QA4I 1VQ9I 2A6EF 1SD5A 2D1HA 1O57A 5FROA 4A3BJ 2L0KA 5D5WB 3GYHX 1FLIA 1MBFA 1FIPA 4OINF 2BEOA 4XR6A 3PIOF 1FC3A 4FCYA 3LFKA 4JQFA 4KT5C 4Y3OA 3OYFA 5LBQA 3BR3A 5K7HA 2M5WA 3REOA 1FBUA 3S8PA 5EDNA 1P4WA 5EEAA 1VQ5I 3ZQCA 1Y1WJ 5DM7F 3CZ6A 1ZLJA 2HI3A 3LA3A 1ETXA 1FNNA 1HKTA 4ZZLA 5KNLA 2XRNA 3BR5A 2XPUA 2P7CB 3KZIC 4CCKA 2KQRA 4PJNA 4U88A 4Y33A 3DV8A 2VQCA 2QEXI 2K86A 2DFHA 2R7FA 3JRFA 3V42A 2EFWA 2RGVA 2GXAA 5CYVA 2M0MA 5H20A 2V6EA 4FE4A 4DOZA 1BOAA 1T08B 5IYBJ 2OPTA 4M6XA 2VPLA 4AIKA 1EV7A 3H0GJ 4BYYA 3O2PE 3TP3A 1X2NA 1ETOA 5IPAA 4RB1A 3LSJA 2LRDA 2XF5A 2A5YB 4CYDA 4IX7A 3DTKA 2FOKA 1TLHB 4XLPF 5BNGA 4HEA2 2ETHA 4WCGA 3IKTA 4A3KJ 3KX2A 3M07A 2DFIA 2VQHA 3AAFA 4R79A 2BY2A 2UV1A 5D5UB 3OYIA 1ORKA 4BACA 1IRXA 2HZDA 2HKOA 2JPCA 4JOMA 4XLFA 1GXPA 4C3HJ 4H0EA 1S8NA 2VXZA 4BQQA 5IT9Z 2XAQA 4MHGA 1BW5A 4CDGA 2PG4A 5B3SH 5JLWA 2BVLA 3R4KA 2QENA 1YO5C 4XQFA 5DUIA 3ZMDA 1S7AA 2ZJQF 2OQGA 5L3GA 3NQOA 3RCOA 4QIWN 3GFLA 3M7GA 2ZXIA 1LJ9A 2Z33A 1D5VA 4IKFA 1K6OA 2COBA 4A0YA 3HRSA 2YSRA 3AFHA 3BR2A 3HHGA 1EJ9A 3CC7I 2CW0F 3HG9A 1TWHJ 3QPSA 1Z21A 3IRRA 3HOSA 1G3YA 4Z6YA 2R7OA 1ETWA 1AHDP 4RB3C 1KU9A 2UWMA 3GWZA 1R23A 2DJNA 1K7AA 2HDDA 5F04A 5FFXA 2GA1A 1YW9A 1VFCA 4FHTA 3F8FA 1KONA 1I5ZA 3VSKA 1RUOA 1IN7A 1TW3A 3E5UA 1G3WA 1TQIA 3H92A 1VQ7I 3BWGA 3FBNB 4EM2A 4CYCA 1NHAA 2DAOA 3WHBA 2HU9A 4LD5A 2E1MC 4YG2F 1SVOA 1X1CA 5BOXA 3OYEA 2Y48A 1PYVA 1U8BA 1FPQA 1ZGWA 2DT7B 2RDPA 3JTHA 2DPUA 3V7RA 4BBRJ 5E3NA 2G9WA 2DK5A 4XMYA 4DIQA 2QVOA 3CP8A 1PP8F 1N25A 1TP4A 2HVSA 3Q9SA 1WZ2A 4M9SA 1B4AA 3FKIJ 1WH5A 3JTGA 2R7VA 3S3MA 1LVKA 1XMKA 2D45A 4ASNA 2NVXJ 1ERDA 9ANTA 3DBHB 3OL3A 4P1WA 1U9NA 1M1EB 5CVJA 3V8KA 2MW8A 3FF5A 1X1BA 2DO7A 2QKMB 2QKLB 1ACIA 2XIGA 2X6XA 5A2QK 1QHHD 2L02A 3H1CA 1W7PD 3HXLA 1LQ1A 3F0CA 3I55I 2IA0A 2CQXA 2ZMEA 5IT3A 4ESFA 2M2EA 2VOPA 4JX6A 1RKTA 3BC8A 4UB8C 4WK8F 2O3FA 3MVPA 5DV5A 5FLMJ 2M87A 3MKYB 2NNYA 1U9OA 2E60A 2HVQA 3AG4H 3BG6A 4LLGF 1KQ8A 4C9YA 4DZJA 4AYBA 4E7JA 1LE8A 1B8IB 4KMFA 3J7AO 3FK6A 2HTSA 1FBQA 5H6QA 2W57A 3ULQB 4C3IJ 1S6LA 4EM0B 2KLOA 2IPQX 3QYBA 4UV9A 2XAFA 3Q0UA 5KCMA 5F1JA 3H3VK 3ELKA 3E6CC 2VN2A 3GBGA 3HDDA 1U5TB 2L3DA 4V2FA 1IN6A 1FOXA 2ME6A 4ABZA 1DU6A 3IWFA 3BJAA 4BXFA 1BOBA 3ZOBA 3ZQ7A 1AA7A 1YFHA 4KITB 1IDYA 1X58A 5DTDA 4WWCA 4FE7A 3DEUA 4Y15A 4XOPA 3LWFA
chains in the Genus database with same CATH topology
2V26A 4LIUA 2DJIA 2LBFB 4DBQA 3HPHA 4P5OA 1MMDA 4C2UA 4XN3A 3RTRA 3U21A 2DCEA 2VXDA 4PSWA 1MNEA 1OLTA 2VJIA 3H5NA 1N78A 2CUZA 2KRCA 1X4PA 3G2BA 1D0XA 2X6WA 4CSWA 2DT6A 3OS2A 3SEQA 5CQGA 3E0JB 2FUG2 2HNHA 2K5CA 5LFAA 5TGTA 3PFYA 2V4JC 1WJAA 4N4OB 3PNTA 3D5LA 3CJQB 1Z3XA 4PSXA 3AKZA 2AQFA 3K6GA 3ZQQA 3K4LA 2VJ4A 3A4CA 3CJRB 3H35A 1SAUA 5FRMA 4XL9A 3DU6A 3VYTB 4F55A 3OYCA 5HNHA 3H5AA 2KPMA 2RQQA 2Y0SA 3FKJA 1X19A 4CA0A 1LFPA 5HNFA 4E7SA 2X6YA 1YE9A 4XKWA 3TL4X 2R7UA 3FHNA 3KYLA 4XLAA 2KDOA 3QOEA 1FMWA 3LFUA 2IGOA 2Q1ZB 2L5QA 1MMNA 2R7WA 4IQ4A 4CCOA 3QYEA 4N4NB 1N77A 3IAM2 1UG0A 3ZRGA 1D1AA 2DOAA 2W00A 3L2RA 3DWLE 4XKCA 3VSLA 3PL8A 4H4KC 3RQ4A 4XN0A 3OYMA 3PJRA 2MYSA 3OIQA 3OYNA 3DPLC 1Y56A 2VQGA 4CUGA 1UELB 2JVHA 4D1QA 2X1EA 3OL4A 3C2HA 3E1SA 4E7ZA 3K4CA 4HRIA 3NWSA 2IS6A 1K6YA 3K4MA 3RSNA 4ZJZA 1YX5A 3VYSB 2DXIA 4IZZA 4BUPA 3DTIA 2R7TA 3UNGC 3KEYA 3W2WA 3TMOA 1V5GA 3W2AA 4F93B 3PNVA 4OAYA 1W36C 3DLAA 1QU3A 3LL7A 3HPGA 2LC2A 4AVZA 4HPQA 4B43A 1WJ5A 1E0EA 2K3PA 1WJFA 1W36D 4AU7A 4PJJA 4E6KG 2W7NA 4PUSA 3S32A 3LMMA 4B47A 2X1CA 3OS1A 1LDKB 4ZDOA 4XLEA 2LBFA 2V9KA 3EUAA 4XLCA 2XAUA 1WJDA 2ELJA 4HG2A 1WJBA 4GRIA 4Y4RA 4D9JA 3DPTA 1LKXA 2VIXA 4B48A 2Z16A 3ZXSA 3OYJA 4ANJA 3OYKA 2X51A 2GOMA 2IGNA 2CUJA 2MD0A 3QODA 4RLFA 3ZR8X 3HKZA 2IS4A 3CMMA 4BE2A 3EUKL 3OYGA 3K10A 3S3NA 2RREA 4QPOA 4XNFA 3LSGA 5HVQC 5CKTA 3H0DA 2L2OA 2HVRA 2IGMA 2KL4A 2BW3B 2PJRB 2R4GA 3AL0C 1TT0A 2K9LA 2LY1A 3N05A 3OY9A 2Q2EB 2VKHA 1GLNA 2ZSIB 1VZ0A 4XKVA 3S93A 3DU5A 4II2A 2VL8A 4CCJA 2BVMA 3OYHA 3K4BA 2VLAA 3LSHA 4IQJA 3OR1C 4XLHA 4B3XA 2HQAA 2OUMA 1DP3A 4F91B 4RLQA 3D5RC 4BDZA 4PJMA 4LG3A 4DBRA 3DPUA 3S3OA 3AL0B 2VQLA 4BQNA 1Z3YA 2X85A 4BEHB 3BG7A 1D0YA 3DKYA 4QPQA 2VB6A 4RMNA 3TBIA 3A1YA 1EA3A 4J00A 3OYDA 1YX3A 4E7KA 2ZSHB 3LSIA 3LSKA 4YRVA 2R7XA 3EUHC 2ZXHA 5CQEA 2IS1A 3H5RA 2F5VA 2JUGA 2M4GA 1V5EA 3PSIA 5CPRB 1X1DA 2WA0A 2M7AA 2CV2A 2LREA 1T0FC 2LYCA 2M3AA 3K4NA 1X1AA 2ZFUA 3ONQA 3UR3C 3L2UA 4ZTJA 3J7AY 3H9QA 4NQWB 3SEZA 2CMPA 2W4SA 4U7BA 2CH0A 2XF7A 3I9V2 1BR4A 5HLTA 4DJAA 4ZC3A 2KMUA 4RM2A 2W82A 2HPMA 2HDWA 1UAAA 1QHGA 3HC7A 1WFXA 1N75A 4XKBA 3HUGB 3RPUD 3I3LA 3A2KA 4X0GA 2VASA 4EATA 4F3QA 3W2VA 2LOOA 2VJ5A 3VYUB 3OYLA 1MMGA 3K70C 3SDBA 2M7BA 1G8XA 3CESA 5FROA 2IGKA 2JVGA 1SFKA 2MC4A 4J01A 2WAEA 2XF6A 1U0JA 1V5FA 3K70D 1JI8A 4XR6A 1DGRM 1MNDA 2V7FA 4ZDLA 1X4OA 4BGDA 2CS3A 4JQFA 3VDXA 4Y3OA 3OYFA 2F4IA 4PK4A 2CV1A 3SZGA 3S8PA 3ZCOA 1BR1A 4G6TB 2IS2A 4BS9A 4BE0A 2M4KA 3K4JA 3PNYA 4RM3A 3CZ6A 2E5NA 5JHFA 2HPIA 5KNLA 4NC8A 1Z7LA 2KHMA 3L2WA 1D1CA 2KZVA 4HNTA 4CCKA 2KQRA 4PJNA 4F92B 4HSTA 2L9NA 3BCBA 4Y33A 3DKXA 3OOUA 2VQCA 2XDVA 2AQEA 2NOJB 2BW3A 4ITVA 3DEEA 3V42A 3M8JA 3BCAA 2L7KA 2JA2A 2M0MA 2I8DA 4CCMA 2V6EA 2O5RA 4DOZA 4NUBA 4BE1A 2VPLA 3IP4B 2X1DA 3CF2A 2CV0A 4BDYA 2LRDA 4LITA 2XF5A 2VKDA 2A6TA 4XOTA 1HA8A 4IX7A 3DTKA 3MKZA 4HSRA 4PJLA 4HEA2 4F52A 2Z1DA 3KX2A 4BEHA 2VQHA 4R79A 3OYIA 2UV1A 4BACA 4E7HA 1IRXA 2HZDA 4CCLA 3MMYB 4JOMA 2MABA 4XLFA 4HNUA 4NC7A 2VXZA 4BQQA 3OMYA 3ZGKA 1MMAA 2LG4A 1WJCA 4NNJA 2BVLA 1DQUA 3VWBA 4XQFA 1MW7A 3IUOA 3FBIB 3DTEA 1ZELA 3D5SC 2R7SA 1R6RA 5HOOA 3RCOA 3L2VA 3OYAA 2ZXIA 3C2GA 4IKFA 1S9HA 1NG6A 2WADA 2IXSA 2V1NA 2KRHA 1WJEA 3L2QA 3NWTA 2CW8A 1FMVA 3AFHA 2OC6A 4CZCA 3IAS2 4KISA 3HG9A 1Z21A 4E7LA 3HOSA 4CCNA 2R7OA 3SYTA 2UWMA 1OR7C 4CH7A 4BJ6C 3MD2A 2Z2SB 3VYRB 4PFPA 4XORA 3OIPA 2WAQA 1BR2A 1KONA 2RNGA 3CP2A 3VSKA 4B44A 2XSJC 3FBNB 1P9QC 3W3CA 3DQVC 3MKWB 4C30A 2E5ZA 4E7IA 2HU9A 2E1MC 2VJJA 2OV7A 1X1CA 3OYEA 2KP6A 3H9GA 2PMZA 1PYVA 4ZDPA 2A5WA 4BU2A 4II3A 1PJRA 2DT7B 2R7RA 4BJTA 2GOXB 2WBMA 4FETA 4XMYA 4DIQA 3H9JA 3CP8A 2HVSA 3HL2A 4PFOA 4FASD 3LSMA 2XC7A 2E1MB 3PUBA 2LH9A 4YEJA 2R7VA 3S3MA 1LVKA 3EPZA 4XM3A 1ERDA 4ZTFA 2F6CA 1J09A 2WY7Q 3OL3A 2BOLA 4P1WA 4XONA 1G59A 3K4KA 1X1BA 2QKMB 2QKLB 2R7QA 2CW7A 2X6XA 1QHHD 2LY2A 4U87A 2WB1A 2MFZA 3HXLA 3FDYA 1D0ZA 3OS0A 1T95A 4C2TA 3BC8A 5FRNA 3MKYB 2P0WA 2UUZA 3F9KA 2E60A 2HVQA 4LIVA 5KHDA 4E4HA 3BG6A 3PSFA 1NG7A 4YELA 4C9YA 4AYBA 4E7JA 2K9MA 2PJRA 5LD2C 2KLOA 3QYBA 2JSPA 1DGWY 5KCMA 2W1OA 2WAFA 4BQOA 2CFOA 3BLYA 3OR2C 3GBGA 1D1BA 4BJ5C 2WY8Q 3HOTA 3OYBA 4ZYAA 4KT6A 4MLOA 4DGWB 4BXFA 1BOBA 1TZLA 3OWTA 1Y6IA 3M1CA 1AA7A 4KJZA 4BL0B 2L9SA 3QYFA 4OWRB 4KITB 4OAZA 4XOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKT A;  2W7N A;  3M8J A; 
#chains in the Genus database with same CATH topology
 4I76 A;  2XKP A;  5K7Z A;  2K27 A;  1IUF A;  4JBA A;  3A01 A;  1APL C;  4I0A A;  1MMD A;  2LDU A;  1A6I A;  3W6K B;  4C2U A;  4G6Q A;  4ON0 A;  2IJL A;  4EJU A;  3IH4 A;  2MD5 A;  3SFZ A;  4G6D A;  3KP6 A;  4OIR F;  1SAN A;  3KLN A;  1UCR A;  1OLT A;  3FX3 A;  3KFW X;  4IEJ A;  3WG9 A;  4QSH A;  4S05 A;  1N78 A;  3MEX A;  2CUZ A;  2KRC A;  3BOQ A;  5J8C A;  1RIO H;  1X4P A;  1D0X A;  2O8K A;  4EGZ A;  2K5C A;  3CCM I;  5LFA A;  1R49 A;  5IP9 J;  1GVD A;  4N4O B;  4AM3 A;  3D5L A;  5B5E C;  5KAI C;  1A35 A;  3K6G A;  4FX4 A;  1P7J A;  3RKY A;  4EJW A;  4S0H B;  4MFE A;  4ZH4 F;  3CJR B;  2LVS A;  4EMS A;  2XPW A;  3IHU A;  5M3F J;  1T0F A;  2LR8 A;  3IH3 A;  1LNW A;  2ZXW H;  4XL9 A;  3Q0V A;  5DD8 A;  2OQR A;  4F55 A;  1OR7 A;  3OYC A;  1XN7 A;  2DYR H;  5HNH A;  2CUE A;  2DA1 A;  1LFP A;  5HNF A;  3OSF A;  3U9G A;  2X6Y A;  2WTE A;  4AYB N;  2OTJ I;  1R1V A;  1YE9 A;  2QQA A;  1I3Q J;  1MGT A;  3O3K A;  1XG1 A;  2MGQ A;  2BHZ A;  4XKW A;  3TL4 X;  3GTG J;  2YR2 A;  2E7W A;  3HSE A;  1QRY A;  3JRA A;  1ZRD A;  3LFU A;  5ILV A;  2D5V A;  3FMS A;  2R7W A;  4ZZD A;  4F7Z A;  2KJC A;  5IT9 K;  3EQL F;  4XRM A;  1XDU A;  4RGS A;  1IUY A;  1CF7 B;  4GXO A;  4CHU A;  1K78 B;  3DWL E;  1OYI A;  4BAY A;  4A3J J;  3PJR A;  1USS A;  2MYS A;  2O03 A;  3DPL C;  2VQG A;  2XVC A;  3VB2 A;  1HW5 A;  3ASO H;  2M8G X;  3S2D J;  3M4O J;  3LQQ A;  3I53 A;  2IS6 A;  3K4M A;  3PM1 A;  2KIU A;  5HLI A;  2DXI A;  5JI6 A;  1TNS A;  5E1X A;  3W2W A;  3WTZ A;  2V1X A;  3FMQ A;  1Y39 A;  1S29 A;  1UB9 A;  3PNV A;  2Q8K A;  1W36 C;  1KGS A;  3LSR A;  2QSG X;  3HSF A;  3LL7 A;  3F23 A;  1ZRC A;  3JAM Z;  3P9C A;  4N9I A;  4HPQ A;  1WJ5 A;  4I2O A;  2LKS A;  4BQA A;  1W36 D;  4EEF G;  1TC3 C;  1TWC J;  4G7O F;  5D4R A;  5M3M J;  1YIT I;  3KLO A;  2Y75 A;  1H88 C;  1IXR C;  1QPM A;  3EET A;  4IRG A;  4KN7 X;  1WJD A;  4HG2 A;  3EYY A;  4GRI A;  5E8I A;  3X2Q H;  3ZMU A;  3PO3 J;  5KAF C;  1ETQ A;  2LLK A;  2EV6 A;  2A07 F;  3OYK A;  2AXT C;  2DT5 A;  2IP2 A;  2IGN A;  2X51 A;  3HGG A;  2MD0 A;  3QOD A;  4M3B A;  5J8F A;  4YIR X;  1W0T A;  5AIP A;  3CLQ A;  1BL0 A;  1FJL A;  4OIP F;  3V8J A;  1FTT A;  4LFU A;  5JR3 A;  1QNT A;  3OYG A;  3CMY A;  3S3N A;  2OBP A;  2EJR A;  3RKW A;  2NYX A;  4XNF A;  3BG9 A;  5HVQ C;  4I7H A;  4EV0 A;  2XUB A;  1ZLK A;  2DW4 A;  5IYC J;  5LRS A;  1FYK A;  5HOD A;  3GUD A;  3OY9 A;  1WGX A;  2MH9 A;  5TJJ A;  5EEH A;  5HDN A;  4XKV A;  3L7W A;  3V7C A;  3VFZ A;  5DEQ A;  4HOB A;  3AG2 H;  1BIA A;  2VKV A;  2VLA A;  1K79 A;  1QZE A;  4XLH A;  4QTR A;  2HQA A;  5F1R A;  3S17 J;  3FIS A;  2Y9Y A;  1O7L A;  1QVT A;  2RAE A;  2V79 A;  3S3O A;  1SEU A;  5GAH J;  2E36 A;  1Z3Y A;  5KVR A;  1D0Y A;  2OZ6 A;  3DKY A;  2MA3 A;  4JYK A;  1KQ9 A;  3TDU C;  1YJW I;  1R5I D;  1YW7 A;  1C0W A;  1VQK I;  2XPV A;  3OYD A;  1XX5 A;  3E5X A;  2OF7 A;  3LSI A;  3GX4 X;  2JRT A;  2FNA A;  1W4M A;  4XIC A;  2XRL A;  2F5V A;  2VE9 A;  2LFB A;  2EQR A;  1V5E A;  5CPR B;  3CMA I;  1F4K A;  3K4N A;  2M3A A;  4ZYD A;  2A61 A;  1X1A A;  1R9T J;  3UR3 C;  3L2U A;  2DTR A;  1IC8 A;  4PDK A;  4UV8 A;  2PBI A;  3H9Q A;  2YU9 J;  4U7B A;  4N9H A;  1BC8 C;  1XSV A;  2NXN B;  3M9A A;  3WE3 A;  1JT6 A;  1UHW A;  2Y30 A;  3IL2 A;  2HDW A;  2HPM A;  1OCP A;  3HC7 A;  1WFX A;  3HYI A;  3I59 A;  3A2K A;  2Y9Z A;  5FLX Z;  3V4G A;  1HDD C;  1EKE A;  5TIS C;  3BR0 A;  4UHT A;  3HOX J;  4NHJ A;  4S04 A;  2R5Z A;  2DFE A;  2LOO A;  2W25 A;  3L9F A;  5CLS A;  3DBR B;  3OV8 A;  1A6Q A;  3SDB A;  5FFZ A;  2FE3 A;  2M7B A;  4JP0 A;  5HLH A;  1G8X A;  3NEU A;  4CYC B;  1VQO I;  1FX7 A;  2RN7 A;  2Z5U A;  3DLL F;  1ETK A;  2IGK A;  2KIM A;  1SFK A;  3GZ6 A;  2N8G A;  2WAE A;  1FY7 A;  2XF6 A;  2QM3 A;  3BG3 A;  3DCF A;  4B09 A;  1DPR A;  1I1S A;  1DGR M;  4AVP A;  1X4O A;  1JJ8 C;  1YTY A;  2CS3 A;  2NOG A;  2ICW G;  1D8K A;  3QOP A;  4PK4 A;  4PZJ A;  1ZH5 A;  5C4J J;  1HOM A;  2P8T A;  1BR1 A;  3HOU J;  4BNC A;  1BM9 A;  4BE0 A;  3G6E I;  3BP8 A;  4A6D A;  5LGU A;  2YU3 A;  4RBO A;  2K4J A;  3G71 I;  2K9Q A;  3G3Z A;  3B6A A;  5JHF A;  2IW5 A;  1K4S A;  4NC8 A;  2ZCW A;  2P4W A;  5ED4 A;  4RS8 A;  1I3A A;  1Z7L A;  3L2W A;  1D1C A;  2KZV A;  2PQ8 A;  1XGO A;  2DLL A;  2HS5 A;  2P5V A;  3KEQ A;  4HST A;  2L9N A;  4WF2 A;  4IF4 A;  5EG0 B;  2JPB A;  2XAS A;  5ILS A;  2FQ4 A;  4HQE A;  2ESN A;  3WTW C;  4HYE A;  3C3W A;  3O8H A;  1GXQ A;  3SDG A;  3U1D A;  4B4C A;  4AUX A;  1FYL A;  2JA5 J;  1K61 A;  2KKO A;  4IHV A;  4L5E A;  5ERI A;  1PUE E;  2D2W A;  4IHY A;  1HBX G;  3IP4 B;  2X1D A;  2LP0 A;  4MTD A;  1LE8 B;  4DNC A;  2J5P A;  1FP1 D;  2F5E A;  2CV0 A;  3GTL J;  5LEJ A;  1XTA A;  2VKD A;  5FGM A;  4XOT A;  2O61 A;  2P5K A;  1ON2 A;  4UB6 C;  3FXM A;  3R61 A;  3F3X A;  4UVC A;  4F52 A;  2Z1D A;  4PCQ A;  3GTK J;  5ICC A;  4M71 A;  3JAM K;  4E7H A;  4CCL A;  2R5Y A;  4XSZ F;  4JX5 A;  2ZBK A;  3RYR A;  2R93 J;  2HOA A;  3LQR A;  4M6V A;  3OMY A;  2NS0 A;  5C4X J;  2XKO A;  1MMA A;  2DDB A;  2JWT A;  5EZH A;  5GTI C;  4A5N A;  2VOO A;  2P6S A;  3A01 B;  3RQI A;  3GFJ A;  1MW7 A;  1KU2 A;  3D5S C;  1I27 A;  3C2G A;  1DP7 P;  1S9H A;  2WAD A;  2JRM A;  2QSF X;  1DPU A;  4MO7 A;  4MTE A;  4C3J J;  2GZW A;  1CF7 A;  2LK2 A;  3NWT A;  1F43 A;  2EH3 A;  3EUH A;  1K78 A;  3CC4 I;  3IV5 A;  3IAS 2;  3ZMV A;  1IRF A;  3BTI A;  2AS5 F;  1P4A A;  2DFF A;  3K9T A;  1ZR4 A;  1HSJ A;  3JR9 A;  3JRE A;  3MD2 A;  2ELK A;  3NRV A;  4KFC A;  1BJZ A;  4PFP A;  1MJB A;  3I56 I;  3CUQ C;  3OIP A;  3HJE A;  4XBF A;  3TGN A;  2RNG A;  4HZF A;  3CF5 F;  1OCZ H;  4UVA A;  3CC2 I;  3MKW B;  3DQV C;  1LDJ A;  4E7I A;  2K4B A;  3FXL A;  1P2F A;  4XRS G;  3GZ5 A;  5M5X J;  2VJJ A;  2UZK A;  2BY3 A;  4NB5 A;  3TO9 A;  1REP C;  2A5W A;  1WHU A;  3P5J A;  4II3 A;  1YIJ I;  1WRJ A;  3BQY A;  1FOK A;  1SMT A;  2WBM A;  3ZQF A;  3H9J A;  5LGN A;  1R4M B;  4PFO A;  4FAS D;  3LSM A;  5JLX A;  1GHC A;  4YEJ A;  3DEW A;  3EPZ A;  4XM3 A;  4IRH A;  2R7Z J;  4XON A;  2ZFW A;  2OCC H;  2DK8 A;  3E6D A;  1E2X A;  1XD7 A;  1FWZ A;  5DS9 A;  1BW6 A;  1O3Q A;  1WPK A;  3RJP A;  2EZI A;  3PUF A;  4U87 A;  1HST A;  3T0Y A;  2PI0 A;  3I64 A;  3E7L A;  3R0J A;  4BY7 J;  3WTU C;  1IF1 A;  3TW7 A;  3ZQG A;  2M34 A;  3FDY A;  1IV8 A;  5E8G A;  3TW6 A;  5J1R A;  2P0W A;  3F9K A;  3HTS B;  1R36 A;  4MNU A;  4YEL A;  3HOV J;  2K9M A;  5L3B A;  5FLX K;  1ZQ3 P;  1IXS B;  2RNJ A;  4U0V A;  2J5O A;  4DYQ A;  2JSP A;  1DGW Y;  2W1O A;  3CCR I;  1JTX A;  2WAF A;  2YPR A;  3HRT A;  5H6R A;  3S15 J;  2DQR A;  3BT9 A;  2KT0 A;  5CVI A;  3BJ6 A;  3I58 A;  2WY8 Q;  2LD5 A;  1IO2 A;  2FD5 A;  3SZP A;  3ZMZ A;  3OYB A;  5IOZ A;  5IYD J;  3FXK A;  4YII A;  2M45 A;  2PN6 A;  4DGW B;  1TZL A;  2FBH A;  3QRF F;  2HYJ A;  3M1C A;  4L0Y B;  3KZY A;  4A93 J;  2L9S A;  3QYF A;  4U0Y A;  3CLO A;  1CGP A;  3R0A A;  4A5M A;  4M3D A;  4LIU A;  2DJI A;  1U2W A;  3RZD J;  3EDP A;  3HPH A;  2IA2 A;  4P5O A;  1VQ4 I;  3T8T A;  2QYO A;  3KP3 A;  4WXD A;  5LHG A;  1T38 A;  2Y0M A;  2PJP A;  4KA4 A;  4RAG A;  2VXD A;  4FTH A;  1IV6 A;  1MJ9 A;  3C18 A;  2E7X A;  3WE2 A;  1MNE A;  3K1P A;  2VJI A;  3H5N A;  3ZN1 A;  1GV2 A;  1FYM A;  3G2B A;  3W6V A;  2DT6 A;  1HW2 A;  4M3E A;  5J40 A;  3SEQ A;  5CQG A;  3E0J B;  2WWY A;  2FUG 2;  2BZT A;  2HNH A;  3KYC B;  1KU7 A;  4AD9 A;  5TGT A;  3PFY A;  2CU7 A;  1WJA A;  1T33 A;  2FML A;  3E6B A;  3CJQ B;  3AKZ A;  4PSX A;  1AOY A;  3ZQQ A;  3I71 A;  2DA7 A;  3ECO A;  1MNM C;  5BPD A;  3Q0W A;  3ZP5 A;  2EBI A;  4UUT A;  1SAU A;  5JHU A;  1OCC H;  1Y8R B;  1TTY A;  4JX4 A;  3I54 A;  3LNQ A;  2KZG A;  4A3M J;  3K1N A;  1LPQ A;  4KNY A;  3VYT B;  4KUM A;  4KIB A;  5F27 A;  4Q4Z F;  4G8X A;  2RQQ A;  3RDI A;  3CCQ I;  1J0R A;  5E1W A;  3S2W A;  3AG3 H;  3GTQ J;  2BXY A;  2EFQ A;  4E7S A;  1ZRF A;  2E34 A;  2Y31 A;  2HDC A;  5K5O A;  4O3M A;  3FHN A;  1FP2 A;  2FMY A;  3KCC A;  3I5U A;  2KFD A;  3QOE A;  1FMW A;  1O3S A;  2CQQ A;  3GTO J;  1MMN A;  3WTV C;  2XHK A;  2DMQ A;  4L5I A;  2FRH A;  2FJ1 A;  3IAM 2;  1N77 A;  1UG0 A;  1D1A A;  2W00 A;  4HF0 A;  4AIH A;  3MFK A;  4LB5 A;  1BC7 C;  2OU2 A;  1JKP C;  5HDG A;  2M30 A;  4RAF A;  2V1U A;  2X48 A;  3OYN A;  1OYY A;  1Y56 A;  3QU3 A;  2COM A;  5J4Y A;  4U7D A;  4L9T A;  2EFO A;  3BQZ A;  4EVI A;  1UEL B;  3RZO J;  1RPW A;  3RKQ A;  1IAW A;  4OMY A;  3OL4 A;  3C2H A;  2LNB A;  1LUJ B;  3E1S A;  3ERM A;  1BN5 A;  1W7P A;  4E7Z A;  3L2C A;  3NWS A;  3E3V A;  4ZJZ A;  3RSN A;  2AHQ A;  3I59 B;  4RGX A;  5ICG A;  2EV5 A;  5EG0 A;  5GAE J;  4MEY F;  5GTH C;  4IZZ A;  4BUP A;  1VQ8 I;  2OTL I;  2VT2 A;  3UNG C;  3KEY A;  1OKR A;  3GZN B;  2HGC A;  3CCS I;  4OAY A;  2R5Z B;  2M8E A;  4QLC U;  2VT3 A;  1L0O C;  4DQ2 A;  4E70 A;  2LC2 A;  1ON1 A;  4MQ9 F;  4MQV A;  5HS8 A;  4B43 A;  1YHQ I;  5GPC A;  2K3P A;  4LK1 F;  1DUX C;  4M72 A;  4I98 B;  2EV0 A;  2H1K A;  2GWR A;  4E6K G;  2EK5 A;  2ZME C;  2CGP A;  4B47 A;  3FIW A;  4BXU A;  2X1C A;  3OS1 A;  2Y69 H;  4G94 A;  1MBK A;  1G3S A;  1MSF C;  5JVG F;  1Z6R A;  4IHX A;  2DBB A;  1WH7 A;  4GYG A;  4LJZ F;  2LBF A;  2V9K A;  1BBY A;  3EUA A;  1X3W B;  2XAU A;  4HV6 A;  3FWE A;  1V54 H;  3SFI A;  4IO9 F;  4HX7 A;  1RES A;  1WJB A;  3KP7 A;  4M74 A;  3DPT A;  2IVM A;  1JUP A;  2VIX A;  2X4H A;  2Z16 A;  1R5H A;  2IS4 A;  3ZR8 X;  3HKZ A;  1J9I A;  3GLX A;  3EYI A;  2LF7 A;  2XAJ A;  3MQ0 A;  4QPO A;  5AON A;  5ILU A;  1YYV A;  1F36 A;  4I0B A;  4DW6 A;  1J2X A;  3E5Q A;  2NVU B;  4L0Z B;  1ETY A;  1CQT A;  2PJR B;  2NS7 A;  2R4G A;  3F21 A;  1FOY A;  2CRG A;  1O3T A;  5E17 F;  3J81 Z;  1IRZ A;  2A6H F;  2LY1 A;  3N05 A;  2XGC A;  5DCM B;  1WQ2 A;  1XSX A;  3RYP A;  1GLN A;  3BZK A;  3JRC A;  1OJL A;  1LEB A;  1VZ0 A;  5CVR A;  3DU5 A;  4CCJ A;  1Z9C A;  2BVM A;  2JK3 A;  1LB2 A;  2RV8 A;  2ESH A;  2H6B A;  1IN4 A;  3HEF A;  4IQJ A;  4TV7 A;  3A0B C;  2OUM A;  4F91 B;  1H9T A;  1KZH A;  4RLQ A;  4Y7N J;  2RKH A;  4BDZ A;  3GFM A;  4DBR A;  3AL0 B;  4A3L J;  1ITY A;  2CSO A;  1D3Y A;  3HOY J;  2W85 A;  2AO9 A;  1OCO H;  3TBI A;  2R5Y B;  3TDZ C;  1Z7U A;  2DQL A;  1ONV A;  4L9J A;  4J00 A;  4NC6 A;  1R4N B;  1JKQ C;  1YX3 A;  3T1B A;  4E7K A;  2ZSH B;  3LSK A;  3FXO A;  4YRV A;  2R7X A;  2VBY A;  2TDX A;  3FXU A;  4EM1 A;  2ID3 A;  2ZXH A;  3O8G A;  3H5R A;  2O9L A;  4IOC F;  2JUG A;  4Y52 J;  1NTC A;  1IGN A;  2M4G A;  2R92 J;  3ZQL A;  1X1D A;  3CD6 I;  3QAH A;  1T0F C;  5D8L B;  2JA6 J;  5DYM A;  4GDF A;  1D8J A;  5J1Y A;  2X6O A;  2L9V A;  3LSP A;  4IL6 C;  2CH0 A;  1BR4 A;  2CQN A;  2DDA A;  2QQ9 A;  4BHB A;  4DJA A;  3TQN A;  1IG7 A;  2W82 A;  1T98 A;  5IOY A;  1BIB A;  3K2Z A;  4Z2Y A;  5LRR A;  1QHG A;  2VE8 A;  2LF8 A;  2EIJ H;  1Z91 A;  2ACJ A;  3RPU D;  1ZKG A;  3I3L A;  4LLL A;  3FXR A;  1XC5 A;  5CVV A;  1SMY F;  2ME0 A;  1G2H A;  3HKZ N;  4EQQ A;  1X3Z B;  1ZK8 A;  4OIO F;  2VJ5 A;  4LG0 A;  4QWQ A;  1IJW C;  1HKQ A;  3TED A;  3OYL A;  1MMG A;  3K70 C;  1GT0 C;  3BY6 A;  2X0L A;  5DDG A;  1B59 A;  2VOD A;  4A0Z A;  3CES A;  1Q1V A;  2EWN A;  2IRF G;  4G9Y A;  5EYR A;  3BPV A;  5D4S A;  4J01 A;  1SC7 A;  5EF6 A;  1VQN I;  3HSR A;  1U0J A;  3K70 D;  1JI8 A;  4BGD A;  3JRG A;  2LSO A;  4AIJ A;  4BY1 J;  5K7F A;  2CV1 A;  3ZCO A;  2OD5 A;  1XCV A;  2DTZ A;  4G6T B;  2V1D A;  3GCM A;  3M8E A;  1X1P A;  4BS9 A;  1BI0 A;  2AXL A;  2M4K A;  1HDP A;  3K4J A;  4EGY A;  1XGM A;  2L54 A;  4PGG A;  2ISZ A;  3PNY A;  3L1P A;  1LDD A;  5J47 A;  1XPX A;  3KIO A;  2HPI A;  4IVN A;  2DOF A;  2I5U A;  1HLV A;  2STT A;  2KHM A;  2BBY A;  1EH8 A;  2VC0 A;  4ETS A;  4F92 B;  3P9K A;  2GXB A;  3OOU A;  4AWX B;  2XDV A;  2STW A;  2AQE A;  2K9S A;  5LHI A;  1I1G A;  4ITV A;  1YQA A;  3GO5 A;  3DBL B;  1S3J A;  2Q2E A;  4W97 A;  2E19 A;  2I8D A;  1BJA A;  1YW8 A;  1JHH A;  3GME A;  2QBY A;  5M5Y J;  1SFO J;  4L5J A;  4BE1 A;  3F8M A;  2QCO A;  3WHC A;  3GFI A;  4LK0 F;  2BY1 A;  2NVT J;  1OCR H;  3O6B B;  4LIT A;  2LMD A;  3P9I A;  2A6T A;  2EIN H;  2HOE A;  2L4A A;  4RGU A;  4HSR A;  2IA1 A;  5GAG J;  2P7V B;  1XMX A;  3CME I;  2EPF A;  4BEH A;  1IN8 A;  3VEP A;  1YRN A;  4RAY A;  4HNU A;  4NC7 A;  1T6S A;  1VQ6 I;  3S1N J;  2CQ7 A;  2CUF A;  2FF4 A;  2V6C A;  3QPH A;  1WJC A;  4NNJ A;  3CQZ J;  1LFB A;  3I0T A;  3ABU A;  1QVU A;  1DQU A;  3VWB A;  4L18 B;  1FEX A;  1Y1V J;  1RR7 A;  2XB5 A;  5D6F A;  2GLO A;  3FBI B;  3DTE A;  1ZEL A;  2R7S A;  1G6N A;  3JRI A;  1R6R A;  2MG4 A;  4LMY A;  3L2V A;  2ZC2 A;  5K5R A;  4MFD A;  2DA4 A;  1NG6 A;  3B73 A;  5J6X A;  2V1N A;  2KRH A;  1Z77 A;  4B1R A;  2OJE D;  3D1N I;  3CUO A;  4X6A J;  2CW8 A;  1HCR A;  4Q47 A;  4CZC A;  2OCE A;  1WI3 A;  3NAR A;  4NBQ A;  2ADU A;  4HA8 A;  5HS7 A;  1O4X A;  3AG1 H;  3F22 A;  1XMA A;  3U2R A;  2LY9 A;  1S7O A;  2FEZ A;  3MWM A;  3TO7 A;  4CH7 A;  1MKM A;  4BJ6 C;  3DXJ F;  1EH7 A;  1MH4 A;  1UMQ A;  4DYC A;  2K3F A;  2CYY A;  1S72 I;  2WAQ A;  3J81 K;  4BHC A;  1BR2 A;  2E35 A;  3HB9 A;  2O6G E;  5BPI A;  2XSJ C;  3FXQ A;  5FKM A;  1P9Q C;  2K40 A;  5FD5 A;  2YUS A;  2PMU A;  3W3C A;  4C30 A;  5J4V A;  4B8X A;  3WU0 A;  4DYR A;  4G7Z F;  2JZY A;  1R7J A;  2FA5 A;  2BY0 A;  2ZJ2 A;  1K4T A;  2KP6 A;  3H9G A;  5C3E J;  4ZDP A;  2GAU A;  4A6E A;  3Q5F A;  2QWW A;  1MZB A;  2ELH A;  2EIM H;  3G4S I;  1PJR A;  3S14 J;  1XSD A;  2R7R A;  4BJT A;  2EFP A;  3J7Y J;  2JA8 J;  1U6G A;  1J75 A;  2GOX B;  3GLL A;  2QUF A;  4FET A;  4M73 A;  5EJC A;  3OSG A;  1U3E M;  1FSE A;  4IXA A;  3V7S A;  3LA7 A;  2BHY A;  2E1M B;  2GXG A;  2LH9 A;  4O5V A;  2DOD A;  4ZTF A;  3HZJ A;  3KP5 A;  2F6C A;  4D5C A;  4GFB A;  2F2E A;  1A04 A;  2NS8 A;  4Q48 A;  2P5L C;  3K4K A;  1A36 A;  4A3G J;  3W6J B;  3F6V A;  1Z0X A;  4HDV A;  2LY2 A;  1H8A C;  3F72 A;  1JGG A;  2WB1 A;  2BGC A;  1JKR C;  3VOE A;  1R1U A;  3PFI A;  4I99 C;  1E3P A;  1TQM A;  3PQJ A;  3K2A A;  5EZG A;  1YS6 A;  1T95 A;  3QP6 A;  1U5T C;  1W7P B;  2H27 A;  2HXI A;  2UUZ A;  4LIV A;  2HZT A;  3FM5 A;  2VI6 A;  1YJ9 I;  1UJ8 A;  5B66 C;  4MGR A;  5F08 A;  2XV4 S;  2PJR A;  4KYW A;  2ZB9 A;  2QLZ A;  1WSU A;  2L4M A;  2MC3 A;  5DCM A;  2A69 F;  3FHZ A;  5B1A H;  1FIA A;  1JUM A;  2A05 A;  2NNN A;  1SD4 A;  2A3S A;  1Z05 A;  2R0Q C;  3BLY A;  3OR2 C;  2L01 A;  1D1B A;  5FO5 A;  1XS9 A;  2H8R A;  3E97 A;  2F5F A;  1B72 A;  4XSX F;  4MLO A;  3OWT A;  1I6H J;  3COA C;  1LVA A;  2ISY A;  2BV6 A;  1ZG3 A;  3P7N A;  2LBF B;  4DBQ A;  4R1H A;  1RZ4 A;  2XAH A;  3BPX A;  2L9R A;  4XN3 A;  5DD4 A;  3F8N A;  2DCE A;  2QSH X;  1XB4 A;  1MMS A;  3C2B A;  4A3E J;  2HQR A;  1VQL I;  3G1O A;  1QZZ A;  1QA6 A;  3N97 A;  3SQN A;  5F6F A;  4CSW A;  5LGT A;  5AIQ A;  2GQQ A;  3ROU A;  3BRO A;  3OS2 A;  3MKL A;  2YX4 A;  1Q1H A;  3GW2 A;  4A2U A;  5FLV A;  3PNT A;  2M9H A;  2EZH A;  2AQF A;  2VUM J;  2ZNZ A;  3QQA A;  3K4L A;  3S1Q J;  2DN0 A;  4RA2 A;  2WB1 N;  2O7O A;  2G0E A;  2HTJ A;  3A4C A;  3BTC A;  3H35 A;  1PUF B;  2PX9 A;  2KJB A;  3LA2 A;  3S16 J;  4OOI A;  3MZY A;  3KYD B;  2QF7 A;  5FRM A;  3DU6 A;  4G12 A;  2Q0O A;  4FT8 A;  4Y17 A;  3H5A A;  2JQ7 A;  2IAI A;  2KPM A;  1ZAR A;  3NAU A;  1X19 A;  3FKJ A;  4CA0 A;  3CUQ A;  2D1V A;  3KET A;  1MIJ A;  2CWE A;  2VPR A;  3MCZ A;  2TRT A;  4HX4 A;  4LGW A;  3KYL A;  1P6R A;  2LKP A;  3GXO A;  4PJ0 C;  4XLA A;  4BH9 A;  3I4M J;  3FMR A;  4K2E A;  4MIM A;  5D5X B;  3JRH A;  2Q1Z B;  2QZ8 A;  4ZYG A;  5ICF A;  3IWZ A;  4UNO A;  2CG4 A;  3WGG A;  1FBS A;  3WTS C;  1T39 A;  2DPD A;  2LTP A;  4FX0 A;  2DOA A;  3IRQ A;  3L2R A;  3VSL A;  3PL8 A;  3QWL A;  1ZG1 A;  2DYS H;  4H4K C;  5EEG A;  4XN0 A;  3RQ4 A;  5E18 F;  1ZGA A;  3OIQ A;  3OYM A;  5GPA A;  2E1O A;  2PEX A;  2Y2Z A;  3CJN A;  3DKW A;  4Q5S F;  2F4M B;  3GEZ A;  3ZQH A;  1MD0 A;  1W5C C;  1UZC A;  2DMP A;  3HBL A;  4CUG A;  1S7E A;  1RKW A;  3BZ6 A;  2FSW A;  5BMZ A;  3F8C A;  3K4C A;  2FBK A;  1TL8 A;  4HRI A;  1W5T A;  2JTV A;  3K69 A;  1HKS A;  1IW7 F;  2MSY A;  5K1Y A;  1QO0 D;  1KYW A;  3DTI A;  1GVJ A;  3V8L A;  1W0U A;  1V5G A;  4I02 A;  4F93 B;  1UST A;  4LG0 B;  1QU3 A;  3LAP A;  3S2H J;  2ECC A;  2HYF A;  3HPG A;  4HAM A;  1QBJ A;  1ODD A;  1J7K A;  4XLN F;  4A12 A;  1E0E A;  3JCU C;  4AU7 A;  1G3T A;  4PJJ A;  3L00 A;  3S32 A;  5K5Q A;  3LMM A;  1FT9 A;  3BR1 A;  4YFK F;  3J80 Z;  1E17 A;  1LDK B;  4HLX A;  3ISP A;  2HWV A;  4IHW A;  4XLC A;  2ELJ A;  4Y4R A;  4I09 A;  4D9J A;  5IP6 A;  1LKX A;  5D5V B;  1KU3 A;  1AU7 A;  4B48 A;  5LLQ A;  4ANJ A;  1TT5 B;  2CFX A;  2GOM A;  3MAJ A;  2JUC A;  2JSC A;  3ZQI A;  3EUK L;  3PO2 J;  1VND A;  1R22 A;  2RRE A;  1WVR A;  5F64 A;  2WC2 A;  5GP9 A;  1VQM I;  1GDT A;  2NVY J;  5CKT A;  2Z3Y A;  4FIS A;  3H0D A;  1SAX A;  2G7U A;  2IGM A;  1HC8 A;  3BG5 A;  2EB7 A;  1TWA J;  4NDL A;  4U0W A;  1TT0 A;  3A0H C;  1SD7 A;  5L3C A;  2Q2E B;  2VKH A;  3ZMS A;  2H8W A;  2QBY B;  3S93 A;  2PFB A;  4HF2 A;  1NK3 P;  4IOA F;  2JN6 A;  3G73 A;  3OR1 C;  2PLY A;  2E71 A;  2BE5 F;  3C7J A;  3FZV A;  4UVB A;  2YS9 A;  1WCM J;  1FTZ A;  3WU2 C;  4I6Z A;  4D0P A;  3DPU A;  3B6C A;  2VQL A;  4BQN A;  1TWG J;  3CDI A;  3M8F A;  4BEH B;  1X3U A;  4A3F J;  2K7L A;  3MZH A;  2O0Y A;  1YRN B;  5BS6 A;  5EGO A;  1YG2 A;  3KPH A;  2VB6 A;  1TW2 A;  2G7H A;  4RMN A;  3A1Y A;  5HLG A;  2E2I J;  1EA3 A;  1ZYR F;  4BHP A;  1T2K A;  1YIO A;  2HOS A;  1UG2 A;  4KIG A;  5CQE A;  1G4D A;  2IS1 A;  1MBJ A;  4KMU X;  2V9P A;  3Q9V A;  2WA0 A;  2VBW A;  1RI7 A;  4HNV A;  3U1K A;  2TCT A;  2B9S A;  5E3O A;  4A3D J;  2ZFU A;  3J7A Y;  4ZTJ A;  4RB0 A;  2R7D A;  2GIV A;  4NQW B;  3SEZ A;  2LKX A;  2XF7 A;  3I9V 2;  3TO6 A;  3M3Y J;  4EJT A;  2KMU A;  5J1U A;  2FOW A;  2FQ3 A;  4UUS A;  1N75 A;  2WV1 A;  3HUG B;  2VAS A;  5GAD J;  4EAT A;  4IPA A;  3H3U A;  1PVE A;  4F3Q A;  1MDM A;  4A0X A;  3DFG A;  4HW0 A;  1Y8Q B;  5LEK A;  5FKL A;  3VYU B;  3OOP A;  1ZAO A;  2EA2 A;  3JSO A;  2H09 A;  2ZNY A;  4EJV A;  1E3H A;  4OU0 A;  1EH6 A;  4XRF A;  2RQP A;  2VON A;  1J5Y A;  2JVG A;  1ZTR A;  1LFU P;  2MC4 A;  2YX7 A;  1V5F A;  3FXJ A;  2H6C A;  3D0S A;  1MND A;  2V7F A;  4ZDL A;  1FZP B;  1D5Y A;  3VDX A;  1RUN A;  3MZ8 A;  4KDP A;  4XID A;  2F4I A;  1MBE A;  4HQM A;  3SZG A;  5JVT A;  4P96 A;  3RPQ A;  4AID A;  1IDZ A;  2IS2 A;  1P4X A;  3K7A J;  4RM3 A;  3BZC A;  1ENH A;  3KEO A;  4ENK A;  3CO7 C;  3RIR A;  2EZL A;  2E5N A;  2EFN A;  5F0F A;  2DA2 A;  5L3F A;  3R6S A;  1B9N A;  4HNT A;  1U78 A;  1ZN2 A;  3BCB A;  1RC9 A;  3DKX A;  2F5C A;  2NOJ B;  2BW3 A;  1R1T A;  3FK7 A;  1SFX A;  4ESJ A;  3HRM A;  3DEE A;  2E1N A;  3S1M J;  1OIS A;  3M8J A;  3BCA A;  3PQK A;  2L7K A;  4PGH A;  2JA2 A;  1STZ A;  4CCM A;  2O5R A;  1A31 A;  4NUB A;  1KYZ A;  4ESB A;  1YJN I;  3WGI A;  4MEX F;  3CCE I;  1SVM A;  3KP4 A;  3CF2 A;  1SVL A;  5FKK A;  4BDY A;  1B1B A;  3M1E A;  1HA8 A;  3G1M A;  1AWC A;  1UFM A;  5E3M A;  3MKZ A;  4PJL A;  2EIK H;  1SD6 A;  4CO8 A;  1PUF A;  2L7M P;  1X2M A;  5F0H A;  3ABT A;  4KN4 X;  5CJ9 A;  1B72 B;  4XK4 A;  3WOD F;  2F5D A;  3MMY B;  2MAB A;  5FKN A;  5ICE A;  2EZK A;  3ZN0 A;  1YS7 A;  2DA3 A;  2XGX A;  5JFR A;  3ZGK A;  2DA6 A;  2LG4 A;  1RET A;  3J80 K;  5E79 C;  2IBD A;  3BDD A;  2XSD C;  3CCY A;  3VPR A;  1GUU A;  1OCT C;  3IUO A;  1W1W E;  1HQC A;  3F8B A;  3QP5 A;  5HOO A;  4ENJ A;  5L3D A;  3OYA A;  4ZYH A;  2ZJR F;  3ML6 A;  2K9N A;  2IXS A;  1KA8 A;  1JTY A;  1H89 C;  4C2M J;  1WJE A;  3L2Q A;  4A3I J;  2IEK A;  1OMI A;  1FMV A;  3DF8 A;  2GIZ A;  2OC6 A;  1H9G A;  3GTM J;  4LB6 B;  2W84 A;  3HTU A;  5M5W J;  3ABL H;  1O3R A;  4KIS A;  3GTP J;  4E7L A;  2L7Z A;  3HIF A;  2HOT A;  1AKH B;  2FNP A;  3MN2 A;  4CCN A;  1ZHF A;  3SYT A;  1OR7 C;  2VBX A;  1HXD A;  2Z2S B;  3VYR B;  4XOR A;  1I39 A;  1KQ0 A;  2KIQ A;  3CP2 A;  2ZKZ A;  4GYI A;  2MH2 A;  3RPU A;  3VOD A;  4B44 A;  1FSH A;  1MH3 A;  1WI9 A;  4X1E A;  2E5Z A;  2FBI A;  2OV7 A;  1XGN A;  2QGU A;  4ENM A;  2PMZ A;  2JMW A;  4BU2 A;  1VI0 A;  2I10 A;  1Z6T A;  5D8K B;  1JKO C;  3CUQ B;  4R8H A;  3CCV I;  3CJT B;  3S1R J;  4M3G A;  3HL2 A;  2KRF A;  2O8X A;  2XC7 A;  2B63 J;  3PUB A;  4AC0 A;  2CO5 A;  3TP0 A;  4IRI A;  4JK1 X;  1B6A A;  1J09 A;  2WY7 Q;  2RVC A;  2BOL A;  2B0L A;  4M9Z A;  1G59 A;  4HLY A;  2RC4 A;  2R7Q A;  2CW7 A;  3G1L A;  1OFC X;  1TWF J;  1ZR2 A;  3GVA A;  4D7N A;  2MFZ A;  3B02 A;  3H3Z A;  2NVQ J;  1I6X A;  3BJO A;  1IN5 A;  1OQY A;  4N0B A;  5E1Z B;  1RRJ A;  3GF2 A;  4V19 K;  3CCU I;  1D0Z A;  3T5X A;  3OS0 A;  4C2T A;  2DA5 A;  2NRA C;  1ULY A;  2HXO A;  2VKE A;  5FRN A;  5KHD A;  4E4H A;  3PSF A;  1NG7 A;  2WV0 A;  1B9M A;  5LD2 C;  3CDH A;  1F5T A;  3JRB A;  1NK2 P;  3R60 A;  2V9V A;  2L7F P;  2OAZ A;  4BQO A;  6PAX A;  2CFO A;  3BR6 A;  4BJ5 C;  3GTJ J;  1VF9 A;  4GGG A;  1RNL A;  2MBF A;  3LST A;  3JSP A;  5L3E A;  3HOT A;  1XDS A;  2QQB A;  4ZYA A;  4KT6 A;  2DI3 A;  2MLK A;  1R71 A;  4RAZ A;  1V3F A;  1S5L C;  1Y6I A;  2X9D A;  4KJZ A;  1XCB A;  3SZT A;  4BL0 B;  5IP7 J;  2PMH A;  4OWR B;  3E6M A;  3KE2 A;  2XGE A;  4OIQ F;  1OPC A;  4OAZ A;  4CIC A;  1YI2 I;  2V26 A;  3ABK H;  1ZG5 A;  2ID6 A;  1E3O C;  2BXZ A;  1BI1 A;  3RI4 A;  4GCV A;  4ZYE A;  1EF4 A;  1MJA A;  2PMZ N;  1BA5 A;  4ENN A;  3RTR A;  3U21 A;  1QPI A;  5D6E A;  3SXY A;  2ZO4 A;  4PSW A;  3HHH A;  3JRD A;  4P9U A;  3LOC A;  2DMU A;  3SHF A;  1YOV B;  1H0M A;  3CDL A;  1ZGJ A;  2X6W A;  3IH2 A;  1POG A;  2FU4 A;  2OA4 A;  2JT1 A;  4NQW A;  4P9F A;  4WXC A;  5H2F C;  4O6J A;  4IHT A;  2V4J C;  3CCL I;  4B3A A;  1Z3X A;  1R00 A;  4M9X A;  2W48 A;  1L3L A;  2VJ4 A;  3HUG A;  3F6O A;  1JGS A;  1QQI A;  3DP7 A;  2XRO A;  1TNT A;  3IC7 A;  4LOC A;  4HF1 A;  1OYW A;  1Y0U A;  2ZXJ A;  4A3C J;  2K02 A;  5E20 A;  1TQP A;  2Y0S A;  4CGZ A;  2Z99 A;  5HS9 A;  1T8I A;  3TOA A;  4LLN A;  5LHH A;  5EGO B;  3ERE D;  2R7U A;  4L9V A;  2A68 F;  1YLF A;  2KDO A;  4UY8 I;  2IGO A;  3BTJ A;  2L5Q A;  2E2H J;  2JJ7 A;  4IQ4 A;  4CCO A;  5C44 J;  3QYE A;  1BI3 A;  4N4N B;  1P92 A;  4J19 A;  3ZRG A;  4BKX A;  2CQK A;  3I4P A;  4XKC A;  3N4M A;  3JW4 A;  1J59 A;  1WWX A;  5IY5 H;  3HOZ J;  1LEA A;  2HEO A;  2M1B A;  4D5F A;  5E3L A;  4RGR A;  3TOB A;  1IRG A;  3Q3S A;  2JVH A;  3HGY A;  1MBG A;  4D1Q A;  2X1E A;  2QQ8 A;  2DMT A;  4UUS B;  5FKO A;  2EIL H;  5FB2 A;  1K6Y A;  1IZ1 A;  1QGP A;  1YX5 A;  3FM3 A;  3VYS B;  1SFE A;  1B8I A;  2OZU A;  2R7T A;  3K0L A;  4UXN A;  3TMO A;  1FOW A;  1HW1 A;  5KK1 A;  3TKY A;  3W2A A;  3KZZ A;  1MDM B;  2K85 A;  3DLA A;  4D7M A;  1O7F A;  1GV5 A;  2P81 A;  4AVZ A;  1U5T A;  1F9N A;  1JE8 A;  2MLG A;  5CVU A;  2UXX A;  1WJF A;  1JUS A;  1ETV A;  1JHF A;  4IHS A;  1V4R A;  2GBY A;  4UUV A;  2W7N A;  4PUS A;  4YIF A;  1U8R A;  1HF0 A;  4WX9 A;  1WKM A;  1T56 A;  4HBL A;  4IJA A;  1MSE C;  4KIC A;  4ZDO A;  4XLE A;  5TRD A;  1Y0N A;  1I50 J;  3L09 A;  4I01 A;  2HKX A;  2W24 A;  1VQP I;  2R3S A;  5F0C A;  3RKX A;  4G7H F;  3WGH A;  2HQ5 A;  4XRS A;  2WAQ N;  4Y13 A;  3OYJ A;  3ZXS A;  4CZZ A;  2GM4 A;  1W5S A;  2Y0S N;  2ZME B;  1R58 A;  2CUJ A;  4RLF A;  3QU6 A;  4CXF A;  3CMM A;  1VTN C;  2CJJ A;  4BE2 A;  1A5J A;  1NH3 A;  3K10 A;  2ECB A;  1UHS A;  5BQT A;  2F4O B;  3LSG A;  2KDZ A;  1JJ6 C;  2E2J J;  1IXC A;  4A69 C;  2L2O A;  3QPL A;  3WU1 B;  1DU0 A;  2HVR A;  2KIF A;  2KL4 A;  3IKV A;  3UKG A;  2BW3 B;  1ZRE A;  4BBS J;  2P6T A;  4L9N A;  5FJ8 J;  3CTA A;  3AL0 C;  2K9L A;  2Z9O A;  2DOE A;  3K1M A;  3CO6 C;  4M6Y A;  3ECH A;  2ZSI B;  4II2 A;  3HM5 A;  2VL8 A;  1JXS A;  2VBZ A;  2B7E A;  1AKH A;  3OYH A;  2H1L A;  3HOW J;  3ESW B;  3H36 A;  3QPT A;  3K4B A;  2HFH A;  1DDN A;  1F1Z A;  3LSH A;  4BXX J;  2GA2 A;  2KIS A;  4DZP A;  4B3X A;  1DP3 A;  1BI2 A;  3D5R C;  4P55 A;  4GO1 A;  1MBH A;  4PJM A;  1V55 H;  5DUK A;  4LG3 A;  4YFN F;  5DM6 F;  3WTX C;  2F48 A;  2M0C A;  3ZMT A;  2HYG D;  4HV5 A;  2FX0 A;  2XB0 X;  2X85 A;  3BG7 A;  4W1U A;  3A02 A;  4OMZ A;  1Z1D A;  1PP7 U;  2IT0 A;  5J3L A;  2DMN A;  3WG7 H;  4QPQ A;  2UXN A;  3C1D A;  4KIF A;  5FD6 A;  3I4N J;  1P7I A;  4HX8 A;  3J7Z I;  4FQG A;  1QZY A;  3EUH C;  1RR8 C;  3KP2 A;  2VC1 A;  5A2Q Z;  2E1C A;  2BYV E;  3PSI A;  3OIO A;  2NAZ A;  2M7A A;  2CV2 A;  3A03 A;  2C6Y A;  2LRE A;  2LYC A;  2XAG A;  3T8R A;  1XGS A;  4RDU A;  3WTT C;  3ONQ A;  3ZPL A;  1UHM A;  2CMP A;  2W4S A;  1JT0 A;  2FXA A;  5HLT A;  3PIP F;  3LAJ A;  4ZC3 A;  2XGD A;  3CCJ I;  4RM2 A;  3SJM A;  1UAA A;  5B1B H;  5HDK A;  3WTY C;  4XKB A;  1TBX A;  5DCF A;  1R5G A;  4X0G A;  4WXH A;  1K83 J;  2HQN A;  3ABM H;  1Z67 A;  3BTL A;  2JA7 J;  4EJO A;  2DU9 A;  4HDU A;  3W2V A;  1PDN C;  4M3F A;  3ASN H;  2ZJP F;  2H94 A;  4YFX F;  2HR3 A;  2EA4 A;  1SFU A;  4V2G A;  3HRU A;  4RB2 C;  2QA4 I;  1VQ9 I;  2A6E F;  1SD5 A;  2D1H A;  1O57 A;  5FRO A;  4A3B J;  2L0K A;  5D5W B;  3GYH X;  1FLI A;  1MBF A;  1FIP A;  4OIN F;  2BEO A;  4XR6 A;  3PIO F;  1FC3 A;  4FCY A;  3LFK A;  4JQF A;  4KT5 C;  4Y3O A;  3OYF A;  5LBQ A;  3BR3 A;  5K7H A;  2M5W A;  3REO A;  1FBU A;  3S8P A;  5EDN A;  1P4W A;  5EEA A;  1VQ5 I;  3ZQC A;  1Y1W J;  5DM7 F;  3CZ6 A;  1ZLJ A;  2HI3 A;  3LA3 A;  1ETX A;  1FNN A;  1HKT A;  4ZZL A;  5KNL A;  2XRN A;  3BR5 A;  2XPU A;  2P7C B;  3KZI C;  4CCK A;  2KQR A;  4PJN A;  4U88 A;  4Y33 A;  3DV8 A;  2VQC A;  2QEX I;  2K86 A;  2DFH A;  2R7F A;  3JRF A;  3V42 A;  2EFW A;  2RGV A;  2GXA A;  5CYV A;  2M0M A;  5H20 A;  2V6E A;  4FE4 A;  4DOZ A;  1BOA A;  1T08 B;  5IYB J;  2OPT A;  4M6X A;  2VPL A;  4AIK A;  1EV7 A;  3H0G J;  4BYY A;  3O2P E;  3TP3 A;  1X2N A;  1ETO A;  5IPA A;  4RB1 A;  3LSJ A;  2LRD A;  2XF5 A;  2A5Y B;  4CYD A;  4IX7 A;  3DTK A;  2FOK A;  1TLH B;  4XLP F;  5BNG A;  4HEA 2;  2ETH A;  4WCG A;  3IKT A;  4A3K J;  3KX2 A;  3M07 A;  2DFI A;  2VQH A;  3AAF A;  4R79 A;  2BY2 A;  2UV1 A;  5D5U B;  3OYI A;  1ORK A;  4BAC A;  1IRX A;  2HZD A;  2HKO A;  2JPC A;  4JOM A;  4XLF A;  1GXP A;  4C3H J;  4H0E A;  1S8N A;  2VXZ A;  4BQQ A;  5IT9 Z;  2XAQ A;  4MHG A;  1BW5 A;  4CDG A;  2PG4 A;  5B3S H;  5JLW A;  2BVL A;  3R4K A;  2QEN A;  1YO5 C;  4XQF A;  5DUI A;  3ZMD A;  1S7A A;  2ZJQ F;  2OQG A;  5L3G A;  3NQO A;  3RCO A;  4QIW N;  3GFL A;  3M7G A;  2ZXI A;  1LJ9 A;  2Z33 A;  1D5V A;  4IKF A;  1K6O A;  2COB A;  4A0Y A;  3HRS A;  2YSR A;  3AFH A;  3BR2 A;  3HHG A;  1EJ9 A;  3CC7 I;  2CW0 F;  3HG9 A;  1TWH J;  3QPS A;  1Z21 A;  3IRR A;  3HOS A;  1G3Y A;  4Z6Y A;  2R7O A;  1ETW A;  1AHD P;  4RB3 C;  1KU9 A;  2UWM A;  3GWZ A;  1R23 A;  2DJN A;  1K7A A;  2HDD A;  5F04 A;  5FFX A;  2GA1 A;  1YW9 A;  1VFC A;  4FHT A;  3F8F A;  1KON A;  1I5Z A;  3VSK A;  1RUO A;  1IN7 A;  1TW3 A;  3E5U A;  1G3W A;  1TQI A;  3H92 A;  1VQ7 I;  3BWG A;  3FBN B;  4EM2 A;  4CYC A;  1NHA A;  2DAO A;  3WHB A;  2HU9 A;  4LD5 A;  2E1M C;  4YG2 F;  1SVO A;  1X1C A;  5BOX A;  3OYE A;  2Y48 A;  1PYV A;  1U8B A;  1FPQ A;  1ZGW A;  2DT7 B;  2RDP A;  3JTH A;  2DPU A;  3V7R A;  4BBR J;  5E3N A;  2G9W A;  2DK5 A;  4XMY A;  4DIQ A;  2QVO A;  3CP8 A;  1PP8 F;  1N25 A;  1TP4 A;  2HVS A;  3Q9S A;  1WZ2 A;  4M9S A;  1B4A A;  3FKI J;  1WH5 A;  3JTG A;  2R7V A;  3S3M A;  1LVK A;  1XMK A;  2D45 A;  4ASN A;  2NVX J;  1ERD A;  9ANT A;  3DBH B;  3OL3 A;  4P1W A;  1U9N A;  1M1E B;  5CVJ A;  3V8K A;  2MW8 A;  3FF5 A;  1X1B A;  2DO7 A;  2QKM B;  2QKL B;  1ACI A;  2XIG A;  2X6X A;  5A2Q K;  1QHH D;  2L02 A;  3H1C A;  1W7P D;  3HXL A;  1LQ1 A;  3F0C A;  3I55 I;  2IA0 A;  2CQX A;  2ZME A;  5IT3 A;  4ESF A;  2M2E A;  2VOP A;  4JX6 A;  1RKT A;  3BC8 A;  4UB8 C;  4WK8 F;  2O3F A;  3MVP A;  5DV5 A;  5FLM J;  2M87 A;  3MKY B;  2NNY A;  1U9O A;  2E60 A;  2HVQ A;  3AG4 H;  3BG6 A;  4LLG F;  1KQ8 A;  4C9Y A;  4DZJ A;  4AYB A;  4E7J A;  1LE8 A;  1B8I B;  4KMF A;  3J7A O;  3FK6 A;  2HTS A;  1FBQ A;  5H6Q A;  2W57 A;  3ULQ B;  4C3I J;  1S6L A;  4EM0 B;  2KLO A;  2IPQ X;  3QYB A;  4UV9 A;  2XAF A;  3Q0U A;  5KCM A;  5F1J A;  3H3V K;  3ELK A;  3E6C C;  2VN2 A;  3GBG A;  3HDD A;  1U5T B;  2L3D A;  4V2F A;  1IN6 A;  1FOX A;  2ME6 A;  4ABZ A;  1DU6 A;  3IWF A;  3BJA A;  4BXF A;  1BOB A;  3ZOB A;  3ZQ7 A;  1AA7 A;  1YFH A;  4KIT B;  1IDY A;  1X58 A;  5DTD A;  4WWC A;  4FE7 A;  3DEU A;  4Y15 A;  4XOP A;  3LWF A; 
#chains in the Genus database with same CATH homology
 2V26 A;  4LIU A;  2DJI A;  2LBF B;  4DBQ A;  3HPH A;  4P5O A;  1MMD A;  4C2U A;  4XN3 A;  3RTR A;  3U21 A;  2DCE A;  2VXD A;  4PSW A;  1MNE A;  1OLT A;  2VJI A;  3H5N A;  1N78 A;  2CUZ A;  2KRC A;  1X4P A;  3G2B A;  1D0X A;  2X6W A;  4CSW A;  2DT6 A;  3OS2 A;  3SEQ A;  5CQG A;  3E0J B;  2FUG 2;  2HNH A;  2K5C A;  5LFA A;  5TGT A;  3PFY A;  2V4J C;  1WJA A;  4N4O B;  3PNT A;  3D5L A;  3CJQ B;  1Z3X A;  4PSX A;  3AKZ A;  2AQF A;  3K6G A;  3ZQQ A;  3K4L A;  2VJ4 A;  3A4C A;  3CJR B;  3H35 A;  1SAU A;  5FRM A;  4XL9 A;  3DU6 A;  3VYT B;  4F55 A;  3OYC A;  5HNH A;  3H5A A;  2KPM A;  2RQQ A;  2Y0S A;  3FKJ A;  1X19 A;  4CA0 A;  1LFP A;  5HNF A;  4E7S A;  2X6Y A;  1YE9 A;  4XKW A;  3TL4 X;  2R7U A;  3FHN A;  3KYL A;  4XLA A;  2KDO A;  3QOE A;  1FMW A;  3LFU A;  2IGO A;  2Q1Z B;  2L5Q A;  1MMN A;  2R7W A;  4IQ4 A;  4CCO A;  3QYE A;  4N4N B;  1N77 A;  3IAM 2;  1UG0 A;  3ZRG A;  1D1A A;  2DOA A;  2W00 A;  3L2R A;  3DWL E;  4XKC A;  3VSL A;  3PL8 A;  4H4K C;  3RQ4 A;  4XN0 A;  3OYM A;  3PJR A;  2MYS A;  3OIQ A;  3OYN A;  3DPL C;  1Y56 A;  2VQG A;  4CUG A;  1UEL B;  2JVH A;  4D1Q A;  2X1E A;  3OL4 A;  3C2H A;  3E1S A;  4E7Z A;  3K4C A;  4HRI A;  3NWS A;  2IS6 A;  1K6Y A;  3K4M A;  3RSN A;  4ZJZ A;  1YX5 A;  3VYS B;  2DXI A;  4IZZ A;  4BUP A;  3DTI A;  2R7T A;  3UNG C;  3KEY A;  3W2W A;  3TMO A;  1V5G A;  3W2A A;  4F93 B;  3PNV A;  4OAY A;  1W36 C;  3DLA A;  1QU3 A;  3LL7 A;  3HPG A;  2LC2 A;  4AVZ A;  4HPQ A;  4B43 A;  1WJ5 A;  1E0E A;  2K3P A;  1WJF A;  1W36 D;  4AU7 A;  4PJJ A;  4E6K G;  2W7N A;  4PUS A;  3S32 A;  3LMM A;  4B47 A;  2X1C A;  3OS1 A;  1LDK B;  4ZDO A;  4XLE A;  2LBF A;  2V9K A;  3EUA A;  4XLC A;  2XAU A;  1WJD A;  2ELJ A;  4HG2 A;  1WJB A;  4GRI A;  4Y4R A;  4D9J A;  3DPT A;  1LKX A;  2VIX A;  4B48 A;  2Z16 A;  3ZXS A;  3OYJ A;  4ANJ A;  3OYK A;  2X51 A;  2GOM A;  2IGN A;  2CUJ A;  2MD0 A;  3QOD A;  4RLF A;  3ZR8 X;  3HKZ A;  2IS4 A;  3CMM A;  4BE2 A;  3EUK L;  3OYG A;  3K10 A;  3S3N A;  2RRE A;  4QPO A;  4XNF A;  3LSG A;  5HVQ C;  5CKT A;  3H0D A;  2L2O A;  2HVR A;  2IGM A;  2KL4 A;  2BW3 B;  2PJR B;  2R4G A;  3AL0 C;  1TT0 A;  2K9L A;  2LY1 A;  3N05 A;  3OY9 A;  2Q2E B;  2VKH A;  1GLN A;  2ZSI B;  1VZ0 A;  4XKV A;  3S93 A;  3DU5 A;  4II2 A;  2VL8 A;  4CCJ A;  2BVM A;  3OYH A;  3K4B A;  2VLA A;  3LSH A;  4IQJ A;  3OR1 C;  4XLH A;  4B3X A;  2HQA A;  2OUM A;  1DP3 A;  4F91 B;  4RLQ A;  3D5R C;  4BDZ A;  4PJM A;  4LG3 A;  4DBR A;  3DPU A;  3S3O A;  3AL0 B;  2VQL A;  4BQN A;  1Z3Y A;  2X85 A;  4BEH B;  3BG7 A;  1D0Y A;  3DKY A;  4QPQ A;  2VB6 A;  4RMN A;  3TBI A;  3A1Y A;  1EA3 A;  4J00 A;  3OYD A;  1YX3 A;  4E7K A;  2ZSH B;  3LSI A;  3LSK A;  4YRV A;  2R7X A;  3EUH C;  2ZXH A;  5CQE A;  2IS1 A;  3H5R A;  2F5V A;  2JUG A;  2M4G A;  1V5E A;  3PSI A;  5CPR B;  1X1D A;  2WA0 A;  2M7A A;  2CV2 A;  2LRE A;  1T0F C;  2LYC A;  2M3A A;  3K4N A;  1X1A A;  2ZFU A;  3ONQ A;  3UR3 C;  3L2U A;  4ZTJ A;  3J7A Y;  3H9Q A;  4NQW B;  3SEZ A;  2CMP A;  2W4S A;  4U7B A;  2CH0 A;  2XF7 A;  3I9V 2;  1BR4 A;  5HLT A;  4DJA A;  4ZC3 A;  2KMU A;  4RM2 A;  2W82 A;  2HPM A;  2HDW A;  1UAA A;  1QHG A;  3HC7 A;  1WFX A;  1N75 A;  4XKB A;  3HUG B;  3RPU D;  3I3L A;  3A2K A;  4X0G A;  2VAS A;  4EAT A;  4F3Q A;  3W2V A;  2LOO A;  2VJ5 A;  3VYU B;  3OYL A;  1MMG A;  3K70 C;  3SDB A;  2M7B A;  1G8X A;  3CES A;  5FRO A;  2IGK A;  2JVG A;  1SFK A;  2MC4 A;  4J01 A;  2WAE A;  2XF6 A;  1U0J A;  1V5F A;  3K70 D;  1JI8 A;  4XR6 A;  1DGR M;  1MND A;  2V7F A;  4ZDL A;  1X4O A;  4BGD A;  2CS3 A;  4JQF A;  3VDX A;  4Y3O A;  3OYF A;  2F4I A;  4PK4 A;  2CV1 A;  3SZG A;  3S8P A;  3ZCO A;  1BR1 A;  4G6T B;  2IS2 A;  4BS9 A;  4BE0 A;  2M4K A;  3K4J A;  3PNY A;  4RM3 A;  3CZ6 A;  2E5N A;  5JHF A;  2HPI A;  5KNL A;  4NC8 A;  1Z7L A;  2KHM A;  3L2W A;  1D1C A;  2KZV A;  4HNT A;  4CCK A;  2KQR A;  4PJN A;  4F92 B;  4HST A;  2L9N A;  3BCB A;  4Y33 A;  3DKX A;  3OOU A;  2VQC A;  2XDV A;  2AQE A;  2NOJ B;  2BW3 A;  4ITV A;  3DEE A;  3V42 A;  3M8J A;  3BCA A;  2L7K A;  2JA2 A;  2M0M A;  2I8D A;  4CCM A;  2V6E A;  2O5R A;  4DOZ A;  4NUB A;  4BE1 A;  2VPL A;  3IP4 B;  2X1D A;  3CF2 A;  2CV0 A;  4BDY A;  2LRD A;  4LIT A;  2XF5 A;  2VKD A;  2A6T A;  4XOT A;  1HA8 A;  4IX7 A;  3DTK A;  3MKZ A;  4HSR A;  4PJL A;  4HEA 2;  4F52 A;  2Z1D A;  3KX2 A;  4BEH A;  2VQH A;  4R79 A;  3OYI A;  2UV1 A;  4BAC A;  4E7H A;  1IRX A;  2HZD A;  4CCL A;  3MMY B;  4JOM A;  2MAB A;  4XLF A;  4HNU A;  4NC7 A;  2VXZ A;  4BQQ A;  3OMY A;  3ZGK A;  1MMA A;  2LG4 A;  1WJC A;  4NNJ A;  2BVL A;  1DQU A;  3VWB A;  4XQF A;  1MW7 A;  3IUO A;  3FBI B;  3DTE A;  1ZEL A;  3D5S C;  2R7S A;  1R6R A;  5HOO A;  3RCO A;  3L2V A;  3OYA A;  2ZXI A;  3C2G A;  4IKF A;  1S9H A;  1NG6 A;  2WAD A;  2IXS A;  2V1N A;  2KRH A;  1WJE A;  3L2Q A;  3NWT A;  2CW8 A;  1FMV A;  3AFH A;  2OC6 A;  4CZC A;  3IAS 2;  4KIS A;  3HG9 A;  1Z21 A;  4E7L A;  3HOS A;  4CCN A;  2R7O A;  3SYT A;  2UWM A;  1OR7 C;  4CH7 A;  4BJ6 C;  3MD2 A;  2Z2S B;  3VYR B;  4PFP A;  4XOR A;  3OIP A;  2WAQ A;  1BR2 A;  1KON A;  2RNG A;  3CP2 A;  3VSK A;  4B44 A;  2XSJ C;  3FBN B;  1P9Q C;  3W3C A;  3DQV C;  3MKW B;  4C30 A;  2E5Z A;  4E7I A;  2HU9 A;  2E1M C;  2VJJ A;  2OV7 A;  1X1C A;  3OYE A;  2KP6 A;  3H9G A;  2PMZ A;  1PYV A;  4ZDP A;  2A5W A;  4BU2 A;  4II3 A;  1PJR A;  2DT7 B;  2R7R A;  4BJT A;  2GOX B;  2WBM A;  4FET A;  4XMY A;  4DIQ A;  3H9J A;  3CP8 A;  2HVS A;  3HL2 A;  4PFO A;  4FAS D;  3LSM A;  2XC7 A;  2E1M B;  3PUB A;  2LH9 A;  4YEJ A;  2R7V A;  3S3M A;  1LVK A;  3EPZ A;  4XM3 A;  1ERD A;  4ZTF A;  2F6C A;  1J09 A;  2WY7 Q;  3OL3 A;  2BOL A;  4P1W A;  4XON A;  1G59 A;  3K4K A;  1X1B A;  2QKM B;  2QKL B;  2R7Q A;  2CW7 A;  2X6X A;  1QHH D;  2LY2 A;  4U87 A;  2WB1 A;  2MFZ A;  3HXL A;  3FDY A;  1D0Z A;  3OS0 A;  1T95 A;  4C2T A;  3BC8 A;  5FRN A;  3MKY B;  2P0W A;  2UUZ A;  3F9K A;  2E60 A;  2HVQ A;  4LIV A;  5KHD A;  4E4H A;  3BG6 A;  3PSF A;  1NG7 A;  4YEL A;  4C9Y A;  4AYB A;  4E7J A;  2K9M A;  2PJR A;  5LD2 C;  2KLO A;  3QYB A;  2JSP A;  1DGW Y;  5KCM A;  2W1O A;  2WAF A;  4BQO A;  2CFO A;  3BLY A;  3OR2 C;  3GBG A;  1D1B A;  4BJ5 C;  2WY8 Q;  3HOT A;  3OYB A;  4ZYA A;  4KT6 A;  4MLO A;  4DGW B;  4BXF A;  1BOB A;  1TZL A;  3OWT A;  1Y6I A;  3M1C A;  1AA7 A;  4KJZ A;  4BL0 B;  2L9S A;  3QYF A;  4OWR B;  4KIT B;  4OAZ A;  4XOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...