2W7VA

Periplasmic domain of epsl from vibrio parahaemolyticus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
82
Chain Sequence
STDVAMLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRSNVVMGSFVLKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
publication title The Dimer Formed by the Periplasmic Domain of Epsl from the Type 2 Secretion System of Vibrio Parahaemolyticus.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Transport protein
total genus 17
structure length 82
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 2w7vA00
2W7VA 1UV7A 5HL8A
chains in the Genus database with same CATH superfamily
1I3QC 4WJ4A 2R92K 5M3FK 3T02A 4MEXA 1Y1WK 3TTGA 1TWCK 1WCMK 1SFOC 2A6EA 5C44K 2PA8L 4KATA 4QIWD 4C3HK 1IBAA 4Y7NK 4G7HA 3GTJK 3S1RC 1EK8A 3TFHA 5JVOA 5HL8A 2NVYK 4XLPA 3HOZK 3CQZA 3H0GK 4A3JK 1XXAA 1TWCC 3GSIA 5C44C 3GIRA 4PAAA 3AD7C 2V6UA 4QJVB 3VA7A 5FLMK 3H3VL 3N3YA 4C3HC 2R92A 1IS1A 3EQLA 3S16C 4P5AA 4WILA 4OIOA 3N0BA 1Y1WA 1B4BA 5D4DA 1WCMA 3FOEA 1WQHA 1USOA 2RGRA 3M4OK 3S1QK 3NUHA 1L0WA 3GTJA 5FLMC 3RZOK 1JVIA 1R9TC 2NVYA 4P5BA 4JK1A 1ISEA 1WOPA 4C45A 3H0GA 5C3EC 1I6HK 4GT9A 4GFQA 3ERED 1TWGK 2B63K 3S1QC 1AB4A 1INNA 1X31C 5IORA 3IPJA 3GTQK 1XPPA 3LPXA 3S14C 4A3DC 2WAQL 2JH3A 4A3CK 1J6XA 3TFJA 1TWFC 3GTOA 4BBRC 3HKZD 1TWGC 1J6VA 3A8IA 2ZFZA 1TWAK 1JQWA 3GTKK 4A3GK 4C2MC 4BY1C 5L46A 1XXBA 1F7VA 1SMYA 1PJ7A 2JA7K 4A3CC 4KM8A 2Y0SD 1HI9A 2B63A 1ZVUA 3HOXK 3GTLA 2PMZD 1WIHA 2JA8K 2R93C 5M5WK 3GTQA 1EFWA 4OINA 2JA7C 4KMHA 2BE5A 2E2IK 3GEHA 2NVTK 4PABA 2XCOA 2CFAB 3HOXC 1BGWA 4OIQA 1IE0A 4C3IK 1TWAA 3GTKA 3S0XA 3FOFA 2JA8C 2O5IA 4BY7K 2P5MA 4KASA 3GTPC 4KMDA 2FQTA 3CAGA 1BDFA 2NVTC 2V6SA 2JA5K 4KN7A 4C3IC 1I3QK 1BJTA 1B4AA 4A3FK 4BBSC 5C4XC 1XZPA 3GEIA 4AYBD 1ZYRA 2GSUA 4QIWL 5JFEA 4BY7C 2A6HA 3LAJA 2E2IA 1RU0A 1SFOK 2A69A 5IOQA 2JA5C 2R7ZK 3G4AA 4LR2A 5IYDC 3S1MK 3QX3A 4A3FC 3S1RK 2P8TA 1JOEA 5C4JK 4KMAA 4NOIA 1J6WA 4XCHA 2JA5A 1VGXA 2R7ZC 1I3QA 1WSVA 3S1MC 4Q5SA 3FKIC 3S16K 2GAGC 3BP8C 3K7AC 2YU9K 5C4JC 1XZQA 1SFOA 5CHPA 1Y1VC 2GSNA 3I4NK 1ZXOA 2NVXC 3A8KA 2E2HC 3HOVC 3OPFA 1TWHC 3TFIA 1R9TK 4G7ZA 1XXCA 2YU9C 5C3EK 1TWCA 3AH5A 1IW7A 2WB1D 3I4NC 1KQ4A 5IYBC 4A3IC 4KB2A 1O29A 1WOOA 3SZZA 3JSTA 3HOWC 3L4KA 3HKZL 4WJ3M 1VH2A 1O28A 3S14K 4A3DK 3A8JA 4A3EK 1IQ0A 5IYCC 1TWFK 4BBRK 3S17C 1R9TA 2Y0SL 1G51A 1GE9A 2XCRB 3LAPA 4C2MK 4BY1K 5CJ9A 3FHZA 4A3EC 4A3BK 1WQFA 3H3VD 3AQOA 2JA6K 2R93K 1VRQC 5M5XK 3OREA 4C3JC 1XZPB 1TWFA 3HOYK 2D6FC 4A3BC 1TWGA 3S2HC 4Y52K 3PO3K 4G0UA 1VLOA 4QJVA 2JA6C 1EH1A 4GTDA 4YFNA 3GTPK 3GTGC 2A68A 3L4JA 4AYBL 3HOYC 4X6AC 1HQMA 2CW0A 3MMLB 4Y52C 5IP9K 3PO3C 3N0CA 2R93A 5E68A 4DDQA 3BUEA 4MEYA 4GTEA 5C4XK 5M5YK 3RZDC 4BBSK 4BXXC 2JA7A 4FM9A 2ZUFA 4OIRA 2WAQD 1I50C 1VJEA 3Q3QA 1ZBSA 4KM9A 5IOSA 4KN4A 5IP9C 5IYDK 4BKWA 2PHCB 3GTPA 4GTAA 1PJ5A 3PO2C 2NVQC 1O26A 3AD8C 2VUMC 3S2DK 4GZYA 2W7VA 5EGHA 2Y3PA 4KDDA 4GTLA 1K83C 3FKIK 4A3MC 3GTMC 3K7AK 5TJ3A 3BP3A 3S1NK 1BS2A 1YNNA 3ADAC 3S15C 4ILDA 4OIPA 1Y1VK 4G0WA 1F9NA 2NVXK 3S2DC 4YFXA 2EBBA 4A93K 2E2HK 3HOVK 1ZQ1C 1TWHK 1YNJA 5FJ8K 4LK0A 3S1NC 4KAWX 3I4MC 5TMCA 1WORA 4LLGA 4LJZA 4Q4ZA 2O5JA 1C0AA 2R7ZA 3G4CA 4RMFA 5IYBK 4A3IK 4A93C 3HOWK 3FKIA 3HOUK 2CFAA 3CQZC 1Y1VA 1O27A 5M3MK 2NVXA 2GSOA 5IYCK 2R92C 1USMA 5IP7K 2E2HA 3S17K 1TWHA 1Y1WC 3HOUC 2YU9A 1WCMC 4BLBA 1EQRA 4Y7NC 4XSXA 3GTJC 1YX2A 4YG2A 3T01A 5IP7C 3DXJA 2NVYC 4KB4A 2PA8D 3HOZC 3H0GC 4A3JC 4GTCA 4A3KK 4YFKA 1UV7A 2PMZL 3GTOK 4LK1A 4C3JK 3M3YK 1IL2A 3S2HK 4XSZA 1WQGA 4A3KC 3HXAA 3AQPA 3GTOC 3M4OC 3GTGK 2GAHC 3RZOC 3V4GA 3GTLK 3M3YC 4X6AK 3AD9C 1DCPA 3WODA 1I6HC 1WOSA 4M1XA 3RZDK 4BXXK 1O25A 1I6VA 4KARA 1F7UA 2B63C 4KMUA 4MQ9A 3GTLC 4FZBA 1I50K 4XLNA 1EI6A 1O2BA 3GTQC 2PPBA 1J98A 2JA6A 3SZYA 4KC6A 3T00A 3GTGA 4ZH4A 2ZUEA 3PO2K 2NVQK 1DCHA 1TWAC 3GDZA 3GTKC 1XZQB 2VUMK 4A3GC 1WSRA 4A3LK 4AH6A 1K83K 4GTBA 4A3MK 2E2JK 3GTMK 3OEPA 3GEEA 3S15K 4BLAA 1I50A 4GTFA 1DD5A 4A3LC 2E2JC 2E2IC 2XCQA 1V5VA 3I4MK 1F93A 2VUMA 5TMFA 5EGEA 2RH6A 1YCLA 2V6TA 1K83A 2WB1L 4LOWA 4G0VA 4O2DA 1DCOA 2KWAA 4P9SA 3GTMA 1O2FB 1O2AA 1O24A 3CQZK 4G7OA 4J3NA 1PJ6A 2FQOA 5IOTA 4LQYA
chains in the Genus database with same CATH topology
2W7VA 1UV7A 5HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7V A;  1UV7 A;  5HL8 A; 
#chains in the Genus database with same CATH topology
 1I3Q C;  4WJ4 A;  2R92 K;  5M3F K;  3T02 A;  4MEX A;  1Y1W K;  3TTG A;  1TWC K;  1WCM K;  1SFO C;  2A6E A;  5C44 K;  2PA8 L;  4KAT A;  4QIW D;  4C3H K;  1IBA A;  4Y7N K;  4G7H A;  3GTJ K;  3S1R C;  1EK8 A;  3TFH A;  5JVO A;  5HL8 A;  2NVY K;  4XLP A;  3HOZ K;  3CQZ A;  3H0G K;  4A3J K;  1XXA A;  1TWC C;  3GSI A;  5C44 C;  3GIR A;  4PAA A;  3AD7 C;  2V6U A;  4QJV B;  3VA7 A;  5FLM K;  3H3V L;  3N3Y A;  4C3H C;  2R92 A;  1IS1 A;  3EQL A;  3S16 C;  4P5A A;  4WIL A;  4OIO A;  3N0B A;  1Y1W A;  1B4B A;  5D4D A;  1WCM A;  3FOE A;  1WQH A;  1USO A;  2RGR A;  3M4O K;  3S1Q K;  3NUH A;  1L0W A;  3GTJ A;  5FLM C;  3RZO K;  1JVI A;  1R9T C;  2NVY A;  4P5B A;  4JK1 A;  1ISE A;  1WOP A;  4C45 A;  3H0G A;  5C3E C;  1I6H K;  4GT9 A;  4GFQ A;  3ERE D;  1TWG K;  2B63 K;  3S1Q C;  1AB4 A;  1INN A;  1X31 C;  5IOR A;  3IPJ A;  3GTQ K;  1XPP A;  3LPX A;  3S14 C;  4A3D C;  2WAQ L;  2JH3 A;  4A3C K;  1J6X A;  3TFJ A;  1TWF C;  3GTO A;  4BBR C;  3HKZ D;  1TWG C;  1J6V A;  3A8I A;  2ZFZ A;  1TWA K;  1JQW A;  3GTK K;  4A3G K;  4C2M C;  4BY1 C;  5L46 A;  1XXB A;  1F7V A;  1SMY A;  1PJ7 A;  2JA7 K;  4A3C C;  4KM8 A;  2Y0S D;  1HI9 A;  2B63 A;  1ZVU A;  3HOX K;  3GTL A;  2PMZ D;  1WIH A;  2JA8 K;  2R93 C;  5M5W K;  3GTQ A;  1EFW A;  4OIN A;  2JA7 C;  4KMH A;  2BE5 A;  2E2I K;  3GEH A;  2NVT K;  4PAB A;  2XCO A;  2CFA B;  3HOX C;  1BGW A;  4OIQ A;  1IE0 A;  4C3I K;  1TWA A;  3GTK A;  3S0X A;  3FOF A;  2JA8 C;  2O5I A;  4BY7 K;  2P5M A;  4KAS A;  3GTP C;  4KMD A;  2FQT A;  3CAG A;  1BDF A;  2NVT C;  2V6S A;  2JA5 K;  4KN7 A;  4C3I C;  1I3Q K;  1BJT A;  1B4A A;  4A3F K;  4BBS C;  5C4X C;  1XZP A;  3GEI A;  4AYB D;  1ZYR A;  2GSU A;  4QIW L;  5JFE A;  4BY7 C;  2A6H A;  3LAJ A;  2E2I A;  1RU0 A;  1SFO K;  2A69 A;  5IOQ A;  2JA5 C;  2R7Z K;  3G4A A;  4LR2 A;  5IYD C;  3S1M K;  3QX3 A;  4A3F C;  3S1R K;  2P8T A;  1JOE A;  5C4J K;  4KMA A;  4NOI A;  1J6W A;  4XCH A;  2JA5 A;  1VGX A;  2R7Z C;  1I3Q A;  1WSV A;  3S1M C;  4Q5S A;  3FKI C;  3S16 K;  2GAG C;  3BP8 C;  3K7A C;  2YU9 K;  5C4J C;  1XZQ A;  1SFO A;  5CHP A;  1Y1V C;  2GSN A;  3I4N K;  1ZXO A;  2NVX C;  3A8K A;  2E2H C;  3HOV C;  3OPF A;  1TWH C;  3TFI A;  1R9T K;  4G7Z A;  1XXC A;  2YU9 C;  5C3E K;  1TWC A;  3AH5 A;  1IW7 A;  2WB1 D;  3I4N C;  1KQ4 A;  5IYB C;  4A3I C;  4KB2 A;  1O29 A;  1WOO A;  3SZZ A;  3JST A;  3HOW C;  3L4K A;  3HKZ L;  4WJ3 M;  1VH2 A;  1O28 A;  3S14 K;  4A3D K;  3A8J A;  4A3E K;  1IQ0 A;  5IYC C;  1TWF K;  4BBR K;  3S17 C;  1R9T A;  2Y0S L;  1G51 A;  1GE9 A;  2XCR B;  3LAP A;  4C2M K;  4BY1 K;  5CJ9 A;  3FHZ A;  4A3E C;  4A3B K;  1WQF A;  3H3V D;  3AQO A;  2JA6 K;  2R93 K;  1VRQ C;  5M5X K;  3ORE A;  4C3J C;  1XZP B;  1TWF A;  3HOY K;  2D6F C;  4A3B C;  1TWG A;  3S2H C;  4Y52 K;  3PO3 K;  4G0U A;  1VLO A;  4QJV A;  2JA6 C;  1EH1 A;  4GTD A;  4YFN A;  3GTP K;  3GTG C;  2A68 A;  3L4J A;  4AYB L;  3HOY C;  4X6A C;  1HQM A;  2CW0 A;  3MML B;  4Y52 C;  5IP9 K;  3PO3 C;  3N0C A;  2R93 A;  5E68 A;  4DDQ A;  3BUE A;  4MEY A;  4GTE A;  5C4X K;  5M5Y K;  3RZD C;  4BBS K;  4BXX C;  2JA7 A;  4FM9 A;  2ZUF A;  4OIR A;  2WAQ D;  1I50 C;  1VJE A;  3Q3Q A;  1ZBS A;  4KM9 A;  5IOS A;  4KN4 A;  5IP9 C;  5IYD K;  4BKW A;  2PHC B;  3GTP A;  4GTA A;  1PJ5 A;  3PO2 C;  2NVQ C;  1O26 A;  3AD8 C;  2VUM C;  3S2D K;  4GZY A;  2W7V A;  5EGH A;  2Y3P A;  4KDD A;  4GTL A;  1K83 C;  3FKI K;  4A3M C;  3GTM C;  3K7A K;  5TJ3 A;  3BP3 A;  3S1N K;  1BS2 A;  1YNN A;  3ADA C;  3S15 C;  4ILD A;  4OIP A;  1Y1V K;  4G0W A;  1F9N A;  2NVX K;  3S2D C;  4YFX A;  2EBB A;  4A93 K;  2E2H K;  3HOV K;  1ZQ1 C;  1TWH K;  1YNJ A;  5FJ8 K;  4LK0 A;  3S1N C;  4KAW X;  3I4M C;  5TMC A;  1WOR A;  4LLG A;  4LJZ A;  4Q4Z A;  2O5J A;  1C0A A;  2R7Z A;  3G4C A;  4RMF A;  5IYB K;  4A3I K;  4A93 C;  3HOW K;  3FKI A;  3HOU K;  2CFA A;  3CQZ C;  1Y1V A;  1O27 A;  5M3M K;  2NVX A;  2GSO A;  5IYC K;  2R92 C;  1USM A;  5IP7 K;  2E2H A;  3S17 K;  1TWH A;  1Y1W C;  3HOU C;  2YU9 A;  1WCM C;  4BLB A;  1EQR A;  4Y7N C;  4XSX A;  3GTJ C;  1YX2 A;  4YG2 A;  3T01 A;  5IP7 C;  3DXJ A;  2NVY C;  4KB4 A;  2PA8 D;  3HOZ C;  3H0G C;  4A3J C;  4GTC A;  4A3K K;  4YFK A;  1UV7 A;  2PMZ L;  3GTO K;  4LK1 A;  4C3J K;  3M3Y K;  1IL2 A;  3S2H K;  4XSZ A;  1WQG A;  4A3K C;  3HXA A;  3AQP A;  3GTO C;  3M4O C;  3GTG K;  2GAH C;  3RZO C;  3V4G A;  3GTL K;  3M3Y C;  4X6A K;  3AD9 C;  1DCP A;  3WOD A;  1I6H C;  1WOS A;  4M1X A;  3RZD K;  4BXX K;  1O25 A;  1I6V A;  4KAR A;  1F7U A;  2B63 C;  4KMU A;  4MQ9 A;  3GTL C;  4FZB A;  1I50 K;  4XLN A;  1EI6 A;  1O2B A;  3GTQ C;  2PPB A;  1J98 A;  2JA6 A;  3SZY A;  4KC6 A;  3T00 A;  3GTG A;  4ZH4 A;  2ZUE A;  3PO2 K;  2NVQ K;  1DCH A;  1TWA C;  3GDZ A;  3GTK C;  1XZQ B;  2VUM K;  4A3G C;  1WSR A;  4A3L K;  4AH6 A;  1K83 K;  4GTB A;  4A3M K;  2E2J K;  3GTM K;  3OEP A;  3GEE A;  3S15 K;  4BLA A;  1I50 A;  4GTF A;  1DD5 A;  4A3L C;  2E2J C;  2E2I C;  2XCQ A;  1V5V A;  3I4M K;  1F93 A;  2VUM A;  5TMF A;  5EGE A;  2RH6 A;  1YCL A;  2V6T A;  1K83 A;  2WB1 L;  4LOW A;  4G0V A;  4O2D A;  1DCO A;  2KWA A;  4P9S A;  3GTM A;  1O2F B;  1O2A A;  1O24 A;  3CQZ K;  4G7O A;  4J3N A;  1PJ6 A;  2FQO A;  5IOT A;  4LQY A; 
#chains in the Genus database with same CATH homology
 2W7V A;  1UV7 A;  5HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...