2W7VA

Periplasmic domain of epsl from vibrio parahaemolyticus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
82
Chain Sequence
STDVAMLSWLAALPATLGQVKDLEITSFKYDGQRGEVRIHARSSDFQPFEQARVKLAEKFNVEQGQLNRSNVVMGSFVLKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Dimer Formed by the Periplasmic Domain of Epsl from the Type 2 Secretion System of Vibrio Parahaemolyticus.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
total genus 17
structure length 82
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.100 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 General secretion pathway protein M, EpsM 2w7vA00
1UV7A 2W7VA 5HL8A
chains in the Genus database with same CATH superfamily
5C4XC 3GEHA 4QJVB 3RZDK 3PO2K 5IOTA 3N0BA 3GTPA 4OIPA 2NVTC 4G7ZA 1BGWA 4GTBA 4LK1A 3K7AC 4C2MK 5IYBC 1Y1VA 2ZUFA 2JA6K 1INNA 4A3CC 1AB4A 1DCHA 3GTQC 5M3MK 2E2JK 2W7VA 4GTLA 4X6AK 4A3LK 3T00A 4YG2A 1TWFC 2JA6A 2NVQC 4AH6A 2RGRA 3LAJA 2JA5K 2B63A 3MMLB 1I3QC 2JA7C 3OPFA 2FQOA 1IQ0A 4BY7C 2A68A 3HXAA 1VGXA 2BE5A 1KQ4A 2NVYC 1IE0A 3GTKK 1XPPA 4P5BA 3A8IA 1WSRA 2B63K 3NUHA 2JA5A 4KM8A 2V6SA 4MEXA 2NVXA 2O5IA 4XCHA 2ZFZA 5IORA 2XCQA 4A3FK 4XSZA 3GTMK 1PJ7A 2JA8K 1HQMA 1TWCK 5FLMK 1WCMA 1HI9A 2PA8L 3HKZL 4G0UA 3I4MC 2PPBA 1IW7A 4BBSC 3GTLC 4A3KC 1V5VA 1TWAA 1I50K 3BP8C 1K83K 1WOOA 4A3EK 1WOSA 3M3YK 4C3JK 1SMYA 5IP7K 3N0CA 5IYCC 1UV7A 4KN4A 3OEPA 4A3LC 4GT9A 1Y1WC 2VUMC 3AQOA 3HOUC 1F9NA 4ZH4A 2CFAA 2PA8D 2JA8C 2GSNA 1WQGA 4BY1C 1TWHA 3GIRA 3TFJA 1R9TK 1I3QK 2JA7K 4OIQA 3S1MC 3ADAC 3M4OC 3GTLK 1DD5A 1I50C 1PJ5A 1XXCA 3GTKC 4Q5SA 3RZOC 3ERED 4A93K 1TWGC 3FHZA 3GTPK 2P8TA 2R92C 4LQYA 3A8JA 3HOVC 4BXXK 3GTMC 5D4DA 3L4KA 5M5WK 4KAWX 3G4AA 1J6XA 1IL2A 1WSVA 1VRQC 1I6VA 1VH2A 1O2BA 2NVXC 3IPJA 4A3GK 4BBSK 1ZQ1C 1ZYRA 1L0WA 3CQZK 3S2DC 3HOXC 1O2FB 3M4OK 4GTAA 4PABA 4A3EC 2R92A 4KARA 3PO2C 5TMFA 3I4NK 3GTPC 5IYCK 1IS1A 2R92K 1TWAC 4LOWA 2E2IK 4WJ4A 4BXXC 4KMUA 3T02A 5M5YK 3GEEA 1PJ6A 3S1QC 2E2IA 1R9TC 1TWFK 3FOEA 2NVQK 3FKIC 1GE9A 1XXBA 1TWGA 2R7ZK 3S1MK 3CAGA 4KM9A 4KATA 4A93C 2NVYK 3AD7C 2R93C 5M5XK 4KB4A 3GTGK 4JK1A 2NVYA 2GSUA 1G51A 3GDZA 3TFHA 1TWCA 3LPXA 4DDQA 3TTGA 2JH3A 3GTOK 3H0GC 5TMCA 3VA7A 3S1QK 3A8KA 5CHPA 2Y0SD 4G7OA 3N3YA 5L46A 1DCOA 3S14K 4KC6A 4ILDA 2VUMA 2EBBA 1Y1WA 1WOPA 1EI6A 5JVOA 2PHCB 5C4JK 3AQPA 2R7ZC 1WQHA 4BBRC 4A3KK 4LK0A 1WQFA 3S0XA 3GTLA 3FOFA 3RZDC 1I50A 1TWHK 3GTJA 1B4BA 3CQZA 5HL8A 1R9TA 3K7AK 4C2MC 5IYBK 2D6FC 2JA6C 4A3CK 1O29A 2E2HK 5C3EK 4P5AA 3S1NC 2V6TA 3HOZC 3GTOC 4MQ9A 1F93A 1X31C 4X6AC 4A3JC 2XCOA 5E68A 4LR2A 1RU0A 4BKWA 3AH5A 3HOYC 2E2HA 4XLNA 1I6HC 5C4JC 1YX2A 3TFIA 4KB2A 4AYBL 2WB1L 4C3HC 5C44C 2KWAA 4J3NA 3GTGC 2YU9A 1TWGK 4WJ3M 4A3MC 1EH1A 3HOVK 1TWFA 1B4AA 2JA7A 4KMHA 1SFOA 2GAGC 1ZXOA 2Y3PA 3HOZK 4A3FC 4YFKA 2P5MA 3GTMA 3H3VD 4OIRA 1XXAA 3S2HK 2Y0SL 4O2DA 3QX3A 4AYBD 3EQLA 1SFOK 1I6HK 3CQZC 3S2DK 3SZZA 4KDDA 3BP3A 3GTKA 1Y1VK 4Y7NK 4G7HA 2YU9C 1F7UA 1O26A 1K83C 3I4NC 2B63C 1O27A 4XLPA 1EQRA 2WB1D 4M1XA 3V4GA 1K83A 3PO3C 3GEIA 4OINA 5C3EC 3M3YC 5IOSA 5IP7C 4GZYA 3BUEA 4A3JK 4KASA 3HOUK 4G0WA 5FLMC 1WCMK 1USMA 2A6EA 4QIWD 5IYDC 3S2HC 3GTGA 4OIOA 1J98A 3H3VL 1BDFA 4A3BK 1DCPA 5M3FK 4GTEA 4C3IK 4KN7A 2XCRB 4MEYA 5JFEA 4P9SA 3S1RK 1Y1WK 2VUMK 3GTQK 2E2JC 3OREA 4Y52C 4BLBA 3DXJA 1XZPA 3H0GK 3G4CA 4BY1K 3GTOA 1J6WA 3FKIA 4Q4ZA 4A3IC 2ZUEA 5IYDK 2PMZD 1SFOC 4GTFA 1O25A 1YCLA 4A3GC 4QIWL 3HOWC 1ZVUA 1Y1VC 2FQTA 4A3BC 4Y7NC 2YU9K 2R93A 4LLGA 5EGEA 3HOXK 4BY7K 3S17K 1VJEA 3GTJK 1XZPB 3L4JA 3PO3K 1BJTA 1JVIA 1TWHC 3GSIA 1JQWA 3S16C 3S1RC 1EFWA 4QJVA 3AD9C 1WIHA 3S1NK 5IOQA 3S15K 4KMAA 3H0GA 1WCMC 3T01A 1ZBSA 4Y52K 4KMDA 1ISEA 4NOIA 2NVXK 2WAQD 1C0AA 1JOEA 2WAQL 4A3IK 4FM9A 3HOYK 2V6UA 3I4MK 4A3DK 1YNJA 4C3IC 4C3HK 5C44K 4BLAA 4RMFA 3GTJC 1O28A 1WORA 1BS2A 4GFQA 4A3MK 2R93K 1TWAK 2E2IC 4C3JC 3SZYA 2A69A 4C45A 1EK8A 1XZQA 2CW0A 5TJ3A 2R7ZA 5IP9C 5FJ8K 1USOA 4PAAA 4YFNA 3HKZD 5EGHA 3FKIK 4FZBA 2A6HA 3LAPA 3HOWK 1J6VA 3S14C 4GTCA 4LJZA 2O5JA 4WILA 2JA5C 4A3DC 5C4XK 3S17C 1XZQB 2RH6A 4BBRK 4G0VA 3RZOK 2NVTK 3S16K 2PMZL 1O24A 3Q3QA 1I3QA 2GSOA 2GAHC 1YNNA 3S15C 3AD8C 2E2HC 3WODA 1IBAA 4GTDA 3GTQA 5IP9K 3JSTA 1O2AA 1F7VA 4XSXA 1TWCC 2CFAB 4YFXA 5CJ9A 1VLOA
chains in the Genus database with same CATH topology
1UV7A 2W7VA 5HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UV7 A;  2W7V A;  5HL8 A; 
#chains in the Genus database with same CATH topology
 5C4X C;  3GEH A;  4QJV B;  3RZD K;  3PO2 K;  5IOT A;  3N0B A;  3GTP A;  4OIP A;  2NVT C;  4G7Z A;  1BGW A;  4GTB A;  4LK1 A;  3K7A C;  4C2M K;  5IYB C;  1Y1V A;  2ZUF A;  2JA6 K;  1INN A;  4A3C C;  1AB4 A;  1DCH A;  3GTQ C;  5M3M K;  2E2J K;  2W7V A;  4GTL A;  4X6A K;  4A3L K;  3T00 A;  4YG2 A;  1TWF C;  2JA6 A;  2NVQ C;  4AH6 A;  2RGR A;  3LAJ A;  2JA5 K;  2B63 A;  3MML B;  1I3Q C;  2JA7 C;  3OPF A;  2FQO A;  1IQ0 A;  4BY7 C;  2A68 A;  3HXA A;  1VGX A;  2BE5 A;  1KQ4 A;  2NVY C;  1IE0 A;  3GTK K;  1XPP A;  4P5B A;  3A8I A;  1WSR A;  2B63 K;  3NUH A;  2JA5 A;  4KM8 A;  2V6S A;  4MEX A;  2NVX A;  2O5I A;  4XCH A;  2ZFZ A;  5IOR A;  2XCQ A;  4A3F K;  4XSZ A;  3GTM K;  1PJ7 A;  2JA8 K;  1HQM A;  1TWC K;  5FLM K;  1WCM A;  1HI9 A;  2PA8 L;  3HKZ L;  4G0U A;  3I4M C;  2PPB A;  1IW7 A;  4BBS C;  3GTL C;  4A3K C;  1V5V A;  1TWA A;  1I50 K;  3BP8 C;  1K83 K;  1WOO A;  4A3E K;  1WOS A;  3M3Y K;  4C3J K;  1SMY A;  5IP7 K;  3N0C A;  5IYC C;  1UV7 A;  4KN4 A;  3OEP A;  4A3L C;  4GT9 A;  1Y1W C;  2VUM C;  3AQO A;  3HOU C;  1F9N A;  4ZH4 A;  2CFA A;  2PA8 D;  2JA8 C;  2GSN A;  1WQG A;  4BY1 C;  1TWH A;  3GIR A;  3TFJ A;  1R9T K;  1I3Q K;  2JA7 K;  4OIQ A;  3S1M C;  3ADA C;  3M4O C;  3GTL K;  1DD5 A;  1I50 C;  1PJ5 A;  1XXC A;  3GTK C;  4Q5S A;  3RZO C;  3ERE D;  4A93 K;  1TWG C;  3FHZ A;  3GTP K;  2P8T A;  2R92 C;  4LQY A;  3A8J A;  3HOV C;  4BXX K;  3GTM C;  5D4D A;  3L4K A;  5M5W K;  4KAW X;  3G4A A;  1J6X A;  1IL2 A;  1WSV A;  1VRQ C;  1I6V A;  1VH2 A;  1O2B A;  2NVX C;  3IPJ A;  4A3G K;  4BBS K;  1ZQ1 C;  1ZYR A;  1L0W A;  3CQZ K;  3S2D C;  3HOX C;  1O2F B;  3M4O K;  4GTA A;  4PAB A;  4A3E C;  2R92 A;  4KAR A;  3PO2 C;  5TMF A;  3I4N K;  3GTP C;  5IYC K;  1IS1 A;  2R92 K;  1TWA C;  4LOW A;  2E2I K;  4WJ4 A;  4BXX C;  4KMU A;  3T02 A;  5M5Y K;  3GEE A;  1PJ6 A;  3S1Q C;  2E2I A;  1R9T C;  1TWF K;  3FOE A;  2NVQ K;  3FKI C;  1GE9 A;  1XXB A;  1TWG A;  2R7Z K;  3S1M K;  3CAG A;  4KM9 A;  4KAT A;  4A93 C;  2NVY K;  3AD7 C;  2R93 C;  5M5X K;  4KB4 A;  3GTG K;  4JK1 A;  2NVY A;  2GSU A;  1G51 A;  3GDZ A;  3TFH A;  1TWC A;  3LPX A;  4DDQ A;  3TTG A;  2JH3 A;  3GTO K;  3H0G C;  5TMC A;  3VA7 A;  3S1Q K;  3A8K A;  5CHP A;  2Y0S D;  4G7O A;  3N3Y A;  5L46 A;  1DCO A;  3S14 K;  4KC6 A;  4ILD A;  2VUM A;  2EBB A;  1Y1W A;  1WOP A;  1EI6 A;  5JVO A;  2PHC B;  5C4J K;  3AQP A;  2R7Z C;  1WQH A;  4BBR C;  4A3K K;  4LK0 A;  1WQF A;  3S0X A;  3GTL A;  3FOF A;  3RZD C;  1I50 A;  1TWH K;  3GTJ A;  1B4B A;  3CQZ A;  5HL8 A;  1R9T A;  3K7A K;  4C2M C;  5IYB K;  2D6F C;  2JA6 C;  4A3C K;  1O29 A;  2E2H K;  5C3E K;  4P5A A;  3S1N C;  2V6T A;  3HOZ C;  3GTO C;  4MQ9 A;  1F93 A;  1X31 C;  4X6A C;  4A3J C;  2XCO A;  5E68 A;  4LR2 A;  1RU0 A;  4BKW A;  3AH5 A;  3HOY C;  2E2H A;  4XLN A;  1I6H C;  5C4J C;  1YX2 A;  3TFI A;  4KB2 A;  4AYB L;  2WB1 L;  4C3H C;  5C44 C;  2KWA A;  4J3N A;  3GTG C;  2YU9 A;  1TWG K;  4WJ3 M;  4A3M C;  1EH1 A;  3HOV K;  1TWF A;  1B4A A;  2JA7 A;  4KMH A;  1SFO A;  2GAG C;  1ZXO A;  2Y3P A;  3HOZ K;  4A3F C;  4YFK A;  2P5M A;  3GTM A;  3H3V D;  4OIR A;  1XXA A;  3S2H K;  2Y0S L;  4O2D A;  3QX3 A;  4AYB D;  3EQL A;  1SFO K;  1I6H K;  3CQZ C;  3S2D K;  3SZZ A;  4KDD A;  3BP3 A;  3GTK A;  1Y1V K;  4Y7N K;  4G7H A;  2YU9 C;  1F7U A;  1O26 A;  1K83 C;  3I4N C;  2B63 C;  1O27 A;  4XLP A;  1EQR A;  2WB1 D;  4M1X A;  3V4G A;  1K83 A;  3PO3 C;  3GEI A;  4OIN A;  5C3E C;  3M3Y C;  5IOS A;  5IP7 C;  4GZY A;  3BUE A;  4A3J K;  4KAS A;  3HOU K;  4G0W A;  5FLM C;  1WCM K;  1USM A;  2A6E A;  4QIW D;  5IYD C;  3S2H C;  3GTG A;  4OIO A;  1J98 A;  3H3V L;  1BDF A;  4A3B K;  1DCP A;  5M3F K;  4GTE A;  4C3I K;  4KN7 A;  2XCR B;  4MEY A;  5JFE A;  4P9S A;  3S1R K;  1Y1W K;  2VUM K;  3GTQ K;  2E2J C;  3ORE A;  4Y52 C;  4BLB A;  3DXJ A;  1XZP A;  3H0G K;  3G4C A;  4BY1 K;  3GTO A;  1J6W A;  3FKI A;  4Q4Z A;  4A3I C;  2ZUE A;  5IYD K;  2PMZ D;  1SFO C;  4GTF A;  1O25 A;  1YCL A;  4A3G C;  4QIW L;  3HOW C;  1ZVU A;  1Y1V C;  2FQT A;  4A3B C;  4Y7N C;  2YU9 K;  2R93 A;  4LLG A;  5EGE A;  3HOX K;  4BY7 K;  3S17 K;  1VJE A;  3GTJ K;  1XZP B;  3L4J A;  3PO3 K;  1BJT A;  1JVI A;  1TWH C;  3GSI A;  1JQW A;  3S16 C;  3S1R C;  1EFW A;  4QJV A;  3AD9 C;  1WIH A;  3S1N K;  5IOQ A;  3S15 K;  4KMA A;  3H0G A;  1WCM C;  3T01 A;  1ZBS A;  4Y52 K;  4KMD A;  1ISE A;  4NOI A;  2NVX K;  2WAQ D;  1C0A A;  1JOE A;  2WAQ L;  4A3I K;  4FM9 A;  3HOY K;  2V6U A;  3I4M K;  4A3D K;  1YNJ A;  4C3I C;  4C3H K;  5C44 K;  4BLA A;  4RMF A;  3GTJ C;  1O28 A;  1WOR A;  1BS2 A;  4GFQ A;  4A3M K;  2R93 K;  1TWA K;  2E2I C;  4C3J C;  3SZY A;  2A69 A;  4C45 A;  1EK8 A;  1XZQ A;  2CW0 A;  5TJ3 A;  2R7Z A;  5IP9 C;  5FJ8 K;  1USO A;  4PAA A;  4YFN A;  3HKZ D;  5EGH A;  3FKI K;  4FZB A;  2A6H A;  3LAP A;  3HOW K;  1J6V A;  3S14 C;  4GTC A;  4LJZ A;  2O5J A;  4WIL A;  2JA5 C;  4A3D C;  5C4X K;  3S17 C;  1XZQ B;  2RH6 A;  4BBR K;  4G0V A;  3RZO K;  2NVT K;  3S16 K;  2PMZ L;  1O24 A;  3Q3Q A;  1I3Q A;  2GSO A;  2GAH C;  1YNN A;  3S15 C;  3AD8 C;  2E2H C;  3WOD A;  1IBA A;  4GTD A;  3GTQ A;  5IP9 K;  3JST A;  1O2A A;  1F7V A;  4XSX A;  1TWC C;  2CFA B;  4YFX A;  5CJ9 A;  1VLO A; 
#chains in the Genus database with same CATH homology
 1UV7 A;  2W7V A;  5HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...