2W80A

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
TLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 123
sequence length 123
chains with identical sequence B, E, G
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2w80A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2w80A01
2RLQA 4AYIA 1H2PP 2MCYA 5JPMG 4J38B 3IX0A 5HZPB 2RKYA 4K12A 3T5OA 2BZMA 1TPMA 2JGWA 2KMSA 3CALA 4B2SA 2RKZA 4PZ5A 3M7PA 1HFIA 1TPGA 1CKLA 2YRAA 4JHSA 3TVJA 2XWJI 5I0QB 3EJHA 1UOTP 4MUCA 4ZH1D 3OEDC 3RJ3D 1LY2A 1HCCA 1VVCA 1U5MA 1Q3XA 3ERBA 3KXVA 2JGXA 3GOVA 2XQWC 4YNXA 2A55A 3GXEA 2CG7A 1PPQA 2RL0A 1GHQB 4B2RA 1OK2A 2UWNA 2WIIC 1Z92B 1GPZA 1OJWA 1QUBA 1OK3A 2B5ID 1E8BA 1FBRA 2CG6A 1GKNA 4AYMA 5HYUB 1ELVA 3INBC 4F4OC 2MCZA 1QGBA 1NWVA 4ONTD 2KRIA 2EC3A 1E88A 1SS2A 1O9AA 4KKDA 5HYPA 4LOSA 2V8EA 1QO6A 1GKGA 3ZRZA 2YBYA 3KZJA 3IU3I 2O39C 1OJVA 4LOTA 4IGDA 3L89M 2LOJA 3OXUD 2G7IA 1SRZA 2IZ3A 1ZJKA 1G4GA 1VVDA 1HFHA 2W81A 1MD8A 2XWBF 4DJZA 2W80A 2JRAA 4A5WB 5FO8C 4AYDA 5HYTB 1E5GA 3OP8A 4C16A 2XRBA 1OK9A 1C1ZA 1H2QP 2EHFA 2XRDA 4AYEA 2IZ4A 3ZD2A 3SW0X 3MQLA 1OJYA 3NFPI 1OK1A 1H03P 1TPNA 4CSYA 2RLPA 4WJG2 1H04P 4FXGG 1G4FA 2CKUA 3O8EB 3R62A 2QY0A 3ZD1A 1MD7A 2ERJA
chains in the Genus database with same CATH superfamily
2RLQA 4AYIA 1H2PP 3K3TA 2MCYA 3ZLEA 5JPMG 4J38B 3VWOA 3IX0A 5HZPB 2RKYA 4K12A 3T5OA 3F6KA 2BZMA 3NJAA 1TPMA 4PO7A 2JGWA 2KMSA 3CALA 4B2SA 2RKZA 5DN4A 4PZ5A 3M7PA 1HFIA 1TPGA 1CKLA 2YRAA 4JHSA 3TVJA 2XWJI 5I0QB 3EJHA 1UOTP 4MUCA 4ZH1D 3OEDC 3RJ3D 1LY2A 1HCCA 1VVCA 1U5MA 1Q3XA 3ERBA 3KXVA 2JGXA 3GOVA 2XQWC 4YNXA 2A55A 4MSLA 3GXEA 2CG7A 1PPQA 2RL0A 1GHQB 4B2RA 2X2ZA 4N7EA 1OK2A 2UWNA 2WIIC 1Z92B 1GPZA 2Y8SA 1OJWA 1QUBA 1OK3A 2B5ID 1E8BA 1FBRA 2CG6A 1GKNA 4AYMA 5HYUB 1ELVA 3INBC 4F4OC 2MCZA 1QGBA 1NWVA 4ONTD 2KRIA 2EC3A 1E88A 1SS2A 1O9AA 4KKDA 4APLA 5HYPA 4LOSA 2V8EA 4YIZA 1QO6A 1GKGA 3ZRZA 2YBYA 3KZJA 3IU3I 2I2LA 2O39C 1OJVA 4LOTA 4IGDA 3L89M 1RLHA 2LOJA 3OXUD 2G7IA 3WSYA 1SRZA 2IZ3A 1ZJKA 4BWCA 1G4GA 2ZYCA 1VVDA 3CI0J 1HFHA 2W81A 1MD8A 2XWBF 4DJZA 2W80A 2JRAA 4A5WB 5FO8C 4AYDA 2Y8TA 5HYTB 1E5GA 3OP8A 4C16A 3WSXA 2XRBA 1OK9A 1C1ZA 1H2QP 2EHFA 3ZLDA 2XRDA 4AYEA 2IZ4A 3ZD2A 3SW0X 3MQLA 5DN5A 1OJYA 3NFPI 1OK1A 3FGRA 1H03P 1TPNA 2Y8RA 4CSYA 2RLPA 4WJG2 1H04P 4FXGG 1G4FA 2CKUA 3O8EB 3R62A 2QY0A 3ZD1A 3FGTA 1MD7A 2ERJA
chains in the Genus database with same CATH topology
2RLQA 4AYIA 1H2PP 2MCYA 5JPMG 4J38B 3IX0A 5HZPB 2RKYA 4K12A 3T5OA 2BZMA 1TPMA 2JGWA 2KMSA 3CALA 4B2SA 2RKZA 4PZ5A 3M7PA 1HFIA 1TPGA 1CKLA 2YRAA 4JHSA 3TVJA 2XWJI 5I0QB 3EJHA 1UOTP 4MUCA 4ZH1D 3OEDC 3RJ3D 1LY2A 1HCCA 1VVCA 1U5MA 1Q3XA 3ERBA 3KXVA 2JGXA 3GOVA 2XQWC 4YNXA 2A55A 3GXEA 2CG7A 1PPQA 2RL0A 1GHQB 4B2RA 1OK2A 2UWNA 2WIIC 1Z92B 1GPZA 1OJWA 1QUBA 1OK3A 2B5ID 1E8BA 1FBRA 2CG6A 1GKNA 4AYMA 5HYUB 1ELVA 3INBC 4F4OC 2MCZA 1QGBA 1NWVA 4ONTD 2KRIA 2EC3A 1E88A 1SS2A 1O9AA 4KKDA 5HYPA 4LOSA 2V8EA 1QO6A 1GKGA 3ZRZA 2YBYA 3KZJA 3IU3I 2O39C 1OJVA 4LOTA 4IGDA 3L89M 2LOJA 3OXUD 2G7IA 1SRZA 2IZ3A 1ZJKA 1G4GA 1VVDA 1HFHA 2W81A 1MD8A 2XWBF 4DJZA 2W80A 2JRAA 4A5WB 5FO8C 4AYDA 5HYTB 1E5GA 3OP8A 4C16A 2XRBA 1OK9A 1C1ZA 1H2QP 2EHFA 2XRDA 4AYEA 2IZ4A 3ZD2A 3SW0X 3MQLA 1OJYA 3NFPI 1OK1A 1H03P 1TPNA 4CSYA 2RLPA 4WJG2 1H04P 4FXGG 1G4FA 2CKUA 3O8EB 3R62A 2QY0A 3ZD1A 1MD7A 2ERJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RLQ A;  4AYI A;  1H2P P;  2MCY A;  5JPM G;  4J38 B;  3IX0 A;  5HZP B;  2RKY A;  4K12 A;  3T5O A;  2BZM A;  1TPM A;  2JGW A;  2KMS A;  3CAL A;  4B2S A;  2RKZ A;  4PZ5 A;  3M7P A;  1HFI A;  1TPG A;  1CKL A;  2YRA A;  4JHS A;  3TVJ A;  2XWJ I;  5I0Q B;  3EJH A;  1UOT P;  4MUC A;  4ZH1 D;  3OED C;  3RJ3 D;  1LY2 A;  1HCC A;  1VVC A;  1U5M A;  1Q3X A;  3ERB A;  3KXV A;  2JGX A;  3GOV A;  2XQW C;  4YNX A;  2A55 A;  3GXE A;  2CG7 A;  1PPQ A;  2RL0 A;  1GHQ B;  4B2R A;  1OK2 A;  2UWN A;  2WII C;  1Z92 B;  1GPZ A;  1OJW A;  1QUB A;  1OK3 A;  2B5I D;  1E8B A;  1FBR A;  2CG6 A;  1GKN A;  4AYM A;  5HYU B;  1ELV A;  3INB C;  4F4O C;  2MCZ A;  1QGB A;  1NWV A;  4ONT D;  2KRI A;  2EC3 A;  1E88 A;  1SS2 A;  1O9A A;  4KKD A;  5HYP A;  4LOS A;  2V8E A;  1QO6 A;  1GKG A;  3ZRZ A;  2YBY A;  3KZJ A;  3IU3 I;  2O39 C;  1OJV A;  4LOT A;  4IGD A;  3L89 M;  2LOJ A;  3OXU D;  2G7I A;  1SRZ A;  2IZ3 A;  1ZJK A;  1G4G A;  1VVD A;  1HFH A;  2W81 A;  1MD8 A;  2XWB F;  4DJZ A;  2W80 A;  2JRA A;  4A5W B;  5FO8 C;  4AYD A;  5HYT B;  1E5G A;  3OP8 A;  4C16 A;  2XRB A;  1OK9 A;  1C1Z A;  1H2Q P;  2EHF A;  2XRD A;  4AYE A;  2IZ4 A;  3ZD2 A;  3SW0 X;  3MQL A;  1OJY A;  3NFP I;  1OK1 A;  1H03 P;  1TPN A;  4CSY A;  2RLP A;  4WJG 2;  1H04 P;  4FXG G;  1G4F A;  2CKU A;  3O8E B;  3R62 A;  2QY0 A;  3ZD1 A;  1MD7 A;  2ERJ A; 
#chains in the Genus database with same CATH topology
 2RLQ A;  4AYI A;  1H2P P;  3K3T A;  2MCY A;  3ZLE A;  5JPM G;  4J38 B;  3VWO A;  3IX0 A;  5HZP B;  2RKY A;  4K12 A;  3T5O A;  3F6K A;  2BZM A;  3NJA A;  1TPM A;  4PO7 A;  2JGW A;  2KMS A;  3CAL A;  4B2S A;  2RKZ A;  5DN4 A;  4PZ5 A;  3M7P A;  1HFI A;  1TPG A;  1CKL A;  2YRA A;  4JHS A;  3TVJ A;  2XWJ I;  5I0Q B;  3EJH A;  1UOT P;  4MUC A;  4ZH1 D;  3OED C;  3RJ3 D;  1LY2 A;  1HCC A;  1VVC A;  1U5M A;  1Q3X A;  3ERB A;  3KXV A;  2JGX A;  3GOV A;  2XQW C;  4YNX A;  2A55 A;  4MSL A;  3GXE A;  2CG7 A;  1PPQ A;  2RL0 A;  1GHQ B;  4B2R A;  2X2Z A;  4N7E A;  1OK2 A;  2UWN A;  2WII C;  1Z92 B;  1GPZ A;  2Y8S A;  1OJW A;  1QUB A;  1OK3 A;  2B5I D;  1E8B A;  1FBR A;  2CG6 A;  1GKN A;  4AYM A;  5HYU B;  1ELV A;  3INB C;  4F4O C;  2MCZ A;  1QGB A;  1NWV A;  4ONT D;  2KRI A;  2EC3 A;  1E88 A;  1SS2 A;  1O9A A;  4KKD A;  4APL A;  5HYP A;  4LOS A;  2V8E A;  4YIZ A;  1QO6 A;  1GKG A;  3ZRZ A;  2YBY A;  3KZJ A;  3IU3 I;  2I2L A;  2O39 C;  1OJV A;  4LOT A;  4IGD A;  3L89 M;  1RLH A;  2LOJ A;  3OXU D;  2G7I A;  3WSY A;  1SRZ A;  2IZ3 A;  1ZJK A;  4BWC A;  1G4G A;  2ZYC A;  1VVD A;  3CI0 J;  1HFH A;  2W81 A;  1MD8 A;  2XWB F;  4DJZ A;  2W80 A;  2JRA A;  4A5W B;  5FO8 C;  4AYD A;  2Y8T A;  5HYT B;  1E5G A;  3OP8 A;  4C16 A;  3WSX A;  2XRB A;  1OK9 A;  1C1Z A;  1H2Q P;  2EHF A;  3ZLD A;  2XRD A;  4AYE A;  2IZ4 A;  3ZD2 A;  3SW0 X;  3MQL A;  5DN5 A;  1OJY A;  3NFP I;  1OK1 A;  3FGR A;  1H03 P;  1TPN A;  2Y8R A;  4CSY A;  2RLP A;  4WJG 2;  1H04 P;  4FXG G;  1G4F A;  2CKU A;  3O8E B;  3R62 A;  2QY0 A;  3ZD1 A;  3FGT A;  1MD7 A;  2ERJ A; 
#chains in the Genus database with same CATH homology
 2RLQ A;  4AYI A;  1H2P P;  2MCY A;  5JPM G;  4J38 B;  3IX0 A;  5HZP B;  2RKY A;  4K12 A;  3T5O A;  2BZM A;  1TPM A;  2JGW A;  2KMS A;  3CAL A;  4B2S A;  2RKZ A;  4PZ5 A;  3M7P A;  1HFI A;  1TPG A;  1CKL A;  2YRA A;  4JHS A;  3TVJ A;  2XWJ I;  5I0Q B;  3EJH A;  1UOT P;  4MUC A;  4ZH1 D;  3OED C;  3RJ3 D;  1LY2 A;  1HCC A;  1VVC A;  1U5M A;  1Q3X A;  3ERB A;  3KXV A;  2JGX A;  3GOV A;  2XQW C;  4YNX A;  2A55 A;  3GXE A;  2CG7 A;  1PPQ A;  2RL0 A;  1GHQ B;  4B2R A;  1OK2 A;  2UWN A;  2WII C;  1Z92 B;  1GPZ A;  1OJW A;  1QUB A;  1OK3 A;  2B5I D;  1E8B A;  1FBR A;  2CG6 A;  1GKN A;  4AYM A;  5HYU B;  1ELV A;  3INB C;  4F4O C;  2MCZ A;  1QGB A;  1NWV A;  4ONT D;  2KRI A;  2EC3 A;  1E88 A;  1SS2 A;  1O9A A;  4KKD A;  5HYP A;  4LOS A;  2V8E A;  1QO6 A;  1GKG A;  3ZRZ A;  2YBY A;  3KZJ A;  3IU3 I;  2O39 C;  1OJV A;  4LOT A;  4IGD A;  3L89 M;  2LOJ A;  3OXU D;  2G7I A;  1SRZ A;  2IZ3 A;  1ZJK A;  1G4G A;  1VVD A;  1HFH A;  2W81 A;  1MD8 A;  2XWB F;  4DJZ A;  2W80 A;  2JRA A;  4A5W B;  5FO8 C;  4AYD A;  5HYT B;  1E5G A;  3OP8 A;  4C16 A;  2XRB A;  1OK9 A;  1C1Z A;  1H2Q P;  2EHF A;  2XRD A;  4AYE A;  2IZ4 A;  3ZD2 A;  3SW0 X;  3MQL A;  1OJY A;  3NFP I;  1OK1 A;  1H03 P;  1TPN A;  4CSY A;  2RLP A;  4WJG 2;  1H04 P;  4FXG G;  1G4F A;  2CKU A;  3O8E B;  3R62 A;  2QY0 A;  3ZD1 A;  1MD7 A;  2ERJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...