2W80C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
b'GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 243
sequence length 243
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w80C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w80C01
4QQ1A 4O4UA 4O3YA 4Z3TA 4AYEC 4O4XA 1YS5A 4AYNA 4O3ZA 3PQUA 2W81C 2W80C 4O3WA 2KC0A 4O3XB 3PQSA 2YPVA 2LFUA 2Y7SA 3UAQA 4AYMC 4O49A 3VE2A 3KVDD 5T5FA 4AYDC 3V8UA 4AYID 3VE1A 2KDYA 5EE2A 3HOLA 3HOEA 4U9CA
chains in the Genus database with same CATH superfamily
3BGFB 1O7DE 3HE6A 2X2IA 1AKJA 2XQYA 4M3HA 3WSQH 2IAMD 2J55A 3OXRB 4GINA 3ES6B 1HNGA 4A7UA 2GABA 4KAQL 4P4RA 3SYPA 3MRGB 4O2FB 2BO0A 5J3HD 4PRHA 3UBXB 2APFA 1YEKH 2LFUA 1J5CA 1IUZA 3FMGH 4LCWA 2BSSB 2UXFA 5HHXH 5E8OB 1IMHC 3WIHL 3G5ZA 1AGFA 1IC4H 1NCTA 5HGBA 4GMTL 1AOZA 1UWGH 1ET8A 5I0YA 1TTRA 1EXUB 4KGJA 4I3RL 2GFBA 4OLXL 1YEFL 2VW4A 1J05A 3OHXA 4R26L 5C08D 2YQGA 2YSSB 4QCIA 1BDYA 3CFMA 1JGUH 4TVPD 4GP8B 2BY1A 4ORGB 4L3CA 1B2YA 2A9BA 4W1TA 1MFMA 5E2WL 3IMVA 1FL6A 5SWSA 5EZLA 4LSSL 4GAAA 1GGCL 2H3XC 1TJGL 4UT9H 8CGTA 1CDYA 1FO0L 2JB6A 4X5QA 4WHTB 3V8UA 4HWBL 4JPSA 4ONHA 3UPRA 4HLZH 4XNQA 4NJAL 3RURA 1A22B 4IK7A 1YEIL 3WKNA 4K3CA 4PJBB 5IR1B 1IC7L 4FXGC 1DZBA 1ED3B 1S8DB 4HH9A 4PCKA 2DEWX 2I7SA 1N18A 4AWJC 4QYOA 1KULA 3GJEB 1UA6L 5IW1A 4RDQG 3QXVA 3GMLB 1A7PL 1O6VA 4QRRA 4QRTB 1DQLH 1PAZA 2VDQB 5DJYB 5JMRA 3FTYA 4PJCB 2OMFA 4FYSA 3II1A 2QADD 2Y3NA 1V3KA 1L9RA 4YXHL 4MB5A 5JOFB 1TVBA 1C16B 2AEPL 4GQ9L 3RPIA 5MHSE 4JKLA 5E8EA 4JZJB 3NBNA 5HYSA 1C1EL 8PAZA 4WI9A 5C09B 1CZ8L 4PJGF 5C6WH 3M1BA 3OKKB 3UZVB 4B50A 5DDHB 4PWJA 5E6UB 4HPHA 2J3SA 3FUKA 2KLRA 2QHRH 4WTZA 1N8OE 1OF2A 3ULVF 3FT9A 1XCQA 3I02A 4DQAA 4Y4KA 1CDHA 2ZCZA 3HS0B 4ODVH 4X4MA 2GT9A 4GRWE 4AMWA 4W6XB 2WD0A 1IEBA 2V3FA 2VABA 5JHLL 1E3ZA 4NFDA 1N5AB 4PS4L 5BXFB 1LL1A 1RHFA 3LSOA 3MCYA 5DC0A 1A6WH 3WAKA 2FX8L 3FFCA 4L9LC 3T3MB 4Z7NE 5I74B 4F7EB 3DRTA 3O0RL 2KI6A 3CPLB 1D9KC 2F18A 4ZMVA 1HH6A 3Q48A 3PP4L 3F7KA 3FU7B 2YGQA 3V5DB 2QVTA 4LLYB 3PXHA 4K8RD 1D7CA 1YYLH 3EZJB 1WFOA 4X4XA 5JIDA 1LDPH 1G7PB 1KJMA 3E6FB 3NABH 5I5MA 2M07A 2B7DT 2QMKA 4GW5B 4DN4L 1P5UC 1PS3A 3ZQWA 5IFHL 1FCGA 1L0XA 3N1QC 1NZRA 3VXUD 4LDOB 5I1GH 1JFQH 3GUTA 1VEMA 5DRNA 1JP5A 2C7FA 2DWEB 4XOBA 3RBSA 4C56E 1JN6A 1KBPA 1UWEH 1X5AA 3GRWH 3ZE0E 1SEQL 2ESVB 2LGNA 1KCVL 4F93B 4QJ4B 5I1AA 3CN2A 4O4YH 4AV4A 3G5XB 2FGWH 3TZGA 1S9YB 4ZXBC 1NEPA 4HGWB 2Q6WB 1W8OA 2XI9A 3H42L 3OJVC 4GW1A 1SLWA 1ZGLM 1DUYB 1PNCA 4NUGL 4P5RA 2HT3C 5LCVL 5A2FA 4QHLA 3WEMA 8FABB 3CFIC 3JWOC 5E4EC 3T2NL 2E7LC 4WJ5A 3MRQA 1I1FA 2AEQH 3BP5A 3HE6D 5C0DA 4M6ML 3ZDXF 5LB1A 2CXGA 5F9OL 3IDNA 3B7RL 3JWOL 4PCYA 3DO3A 1WAAA 5HVFB 5D70H 5FYLD 2XKSA 4P49A 1FFQA 3WNOA 2D8KA 1H3TA 4QLRA 3KYOA 5D1XD 3WHE0 1I1AD 4PRHD 4WRLA 4Z7VE 4CBZA 4QLWA 5J56B 3CVHH 1OE2A 1F58L 1AHWA 3ZRFC 3F2LA 4JJ5A 1WTLA 2OAAA 2RGSA 2OP4H 4AEHH 1LO2H 1X5JA 4ZSOB 3A6CH 3ECBB 3ROOA 3BRYA 5K9JH 2B5IC 4Q9QH 1LGVA 2D2CC 5CJOL 3NCYS 4KY1L 2XCMC 4C69X 1C9SA 3FNKA 3Q5TA 2F1AA 1IM9B 2WLLB 1FFOA 4OZGF 3SCMC 1R5WB 4WNJA 3C5SB 1NCDH 5LGYA 5ACLA 3GBMH 2IAAC 2ZUUA 2FNBA 1CG9B 4YEEA 1QHOA 3NUKA 4Q6YA 2ZYIA 1UVQA 1Z1WA 4WWOA 2K70A 2NY1D 2HFFA 4MYPA 1NFDB 4ODTL 4TSBH 5JYLA 1KGXA 1MFBH 4AZLA 4P8QA 5EOTB 2QBWA 2EDHA 1JDDA 5TPWL 5CFHA 2RAMA 1OSMA 3KS0J 4MWFB 4XCFH 5B4MD 2DWXA 3WMPA 4EI5C 4GG6F 3RWIA 2JI1A 3VGAC 5CU9A 2B0SL 3TT3L 4DESA 5HHMB 4AH2A 3FRUA 4C83A 4JN2A 1FFPA 2BFVH 2Y0LA 4KTDL 2GITA 3GRBA 4FP8L 4TULH 1ROWA 1ZDQA 4PJHB 1NAKL 3ZHFA 3VFOA 4Z76B 1Z6JT 1Y1UA 2WZ5A 4ODSH 3I6LD 4YZFF 1LO4L 3ZKMC 4QRRD 1AZRA 3N91A 3WY4A 2Z93A 2K3TA 2FBRA 3LRMA 4NFCA 3IM1A 3WIIL 3OZ9H 1FSKB 3ZLQC 2BNRD 2XV2A 4LRIC 5F7UA 1ORSA 3FO1A 3O6KH 4EZJA 5FCUL 4ZRGA 3FB6A 4BKTC 4S1DD 2CDGA 3BRFA 4OH2A 1OKEA 4GBXC 5AOIA 3GSXA 1CFTA 5FM5M 1EHLL 5I18H 1D5RA 4IW4C 1J1XH 3SZ6A 4LOFA 2YXWA 4ODHH 3FOLA 4G1EB 5HVHB 4C58B 3S8GB 1EANA 2E8YA 5GRJL 1L7TH 4JAMB 4XN9A 3AY2A 4LP8A 2N7AA 4WFGD 5MEOB 4G7VL 2WQXA 2X4TB 3T20A 1MVUA 1V10A 4KROD 3WTUA 3KPNA 1RMFL 3FFCD 4OLZL 4PJ9B 5E5MB 1KTLA 1JF6A 4R7VA 2QQKL 5D55A 3X3GL 2BCKB 3UZEA 5FOBA 1N3NB 2A0LC 2K45A 3QQDB 4NUMA 4RLDA 3VFTA 2BRQA 3U36B 4P5TD 5EWIH 5ABDE 5G55A 3UBXI 3VO0A 1LP9F 3NGBC 2O4VA 3GT6A 1MHEA 1T5XB 2FWLB 6FABH 4PLJC 3ATBA 4XBPB 3EGDA 4WFFD 1SXSA 1XB8A 3BKCH 3QJXA 4IBSA 4PJEE 2B9AA 1OOAA 1DLHA 5D7EA 4FMVA 4UOW1 3P1VA 1GCFA 2Z31B 5FFGA 2WQAA 3WUWG 3US0A 3GSWA 5E8DH 1A47A 5FYKL 1TR7A 4S1QL 3E38A 1GHFL 5LBSH 3RKDC 5GRVL 1YS5A 3SN6N 2KXPB 1C7TA 1VFAA 3SE4C 5L8JB 3PHOB 3CZNA 4CL7A 5F71A 3T24A 1DJZA 5GIRA 1XAKA 3A4DA 3DX8B 3GMPB 1MLCB 1AQDA 2D9CA 1NSNH 4XVOA 2X0WA 3WNLA 5A6IA 3I3BA 1HOEA 4C4VB 1CFMA 3SBWA 3HC3L 4ZFZA 3VE2A 4AL8H 3A5VA 1MUJB 3WGVB 3NJHA 1HCYA 1LK2B 4EIGB 5BW7C 2Y0HA 1NCWL 2R27A 3HUJA 5SX5H 3LN9A 2ARWA 3U6RA 3KPSB 4B41A 2EIZA 3FH5A 2CBMA 2DIAA 1AD0B 1FZKA 4AY0A 3RZWA 4KUZL 1N7ML 5F8QC 1FVDA 2FJHA 4W4NA 1B2WH 1LEKA 4DP2X 3CFKB 4AMKH 4IJ3C 1EVTC 4JM2D 4Z7OF 2OPCA 1A9BA 3GBNH 1IU1A 4AV0A 2WLIA 3EJRA 2ZX7A 5A16A 2QPSA 1J1PL 4PHZA 1JFHA 1A1NB 5MERA 5HPOA 2E9JA 3K71A 3ZE2E 4L5FL 3MUGA 2VL5A 4MZIA 4CAGA 1MRDH 4KKCC 2R1YB 1K3ZA 2ARJA 5DHVA 2BS8A 1RVFL 4WFHD 5CJQH 4Z95H 4OCSL 5DUPL 5AYUL 4JQVA 1LXMA 4DO5A 1XDTT 5IHZA 1AXSA 4UQIM 1WD9A 2NW2A 5F21B 1U2HA 4U31A 1ZANH 4JFBA 2VDQL 2AGJL 5DL5A 2DEXX 2QFPA 3DIFA 5EN2B 5A40E 4HT1H 2EC8A 3GMMB 4I13B 1QEWA 1JF1B 3UBXG 5D71L 3MJ8B 3TT1L 1EBPA 4XXCC 1H0DA 4BUHA 5D2NB 4GAFB 1NCUA 4JM4L 4P3CH 3RIFK 3WTTA 1AQKH 5SWZB 3TF4A 2W0LA 3R06B 5F72S 4MNGE 3L5WB 2OMVA 5C0AB 3HS0C 3MLUL 1BQLH 1JDAA 3L4YA 2UUDH 4ZUUA 1FZJA 4F8NA 4HCIA 4QRUA 1QBLH 1FFNA 2BIHA 3QDME 1VAHA 5I6LA 2X88A 5K69A 2IDUA 4TSCL 1FLRL 2BVPA 5SWQB 1UD6A 3QNYA 3C5OA 4Z78B 1FFRA 5DJZB 1ACCA 1BQHB 1PMYA 2CPUA 1YHPA 2AQNA 1T7VA 3WXWL 4TF4A 4KZCA 4ANKA 4A67A 3MUY1 3IXTB 2AK4A 2VAAA 3CFQA 3RVWD 2ZXAA 2AZUA 1T3FB 3L7EB 1Q72H 3T3PB 1RZFH 1DQJA 3VFVA 3NYKA 2CAKA 1CFQA 2QL1A 2QPDB 4I77L 5CGYC 3WLBA 3B2VL 5AVUB 1XSKA 3E9UA 4EUPA 1FZMA 3OB0H 2Y6TE 4YGAB 3HHSA 4Y4FB 2YPLB 1VB9A 4L05A 2G3MA 2R0LL 3RAJH 1A6ZA 3GO1H 4XMWA 1GTFA 3V5HA 2ED8A 4N2DA 3MBWB 3L5IA 4MA8H 5FV1L 2Y1ZA 3LHPL 2WJQA 1HEZB 2X0UA 3BYTA 1DJWA 5GGQL 3K0WA 4UCFA 4GI6A 2PTVA 4OCMC 1JVLA 3QHZL 2LVEA 3QNXA 2ZXWB 3MACH 2C9VA 4GJTB 2JCWA 1WLHA 1ZSDB 2AAVA 2J2ZA 1MHCA 3CQQA 3PGCA 4BH8B 4GXUN 1NGPL 1Z9SB 3V9FA 2P80A 2XY1A 1MWOA 4Z7QF 2FJFA 4EOWH 1UWFA 1P7QB 2FB4H 4GPVA 4Y1AE 1A6VH 3OHMB 4FFWD 3PABA 2AXTO 3HG1A 3QP3A 3TA3C 4XHQA 3A3YB 1AACA 1F18A 4FFYH 2EH7L 2NY2D 4N8UA 5CJ8A 1NPUA 4K3JH 3C6SB 4HJ1A 3POHA 5HHQB 3NCWA 3QIBB 4N2NA 1RUMH 4QT5B 5IB5B 5FYKE 3B1TA 4GW4A 4OSUL 4BZ2H 4YXKH 5LAXA 4XAKD 3ETSA 5I76A 5JR1L 4ZOAA 3DHMA 1T1ZA 2FWSA 4G42B 3F12A 5I6NA 3UL4A 3O6FA 1CT8A 1D5XA 3N1GC 3VXNB 1CB4A 3UROR 1RZ7H 3MJ7A 3GLEA 1TQSA 4QHKI 1HHKB 1PDKA 1I7RA 3G5YA 2VH5H 2V9TA 1F4AA 4MB3A 3L9RB 1XHHA 4NQCA 1XGTA 4D9QE 4GIAA 1I9JL 2ZAGA 1IGFH 1C08B 5LGKA 2Q8AH 5B38B 1UD8A 3VXRB 3S36X 3TN0D 4AKPA 2WLYA 1BMGA 2WXPA 3VJ6A 5C7ZA 2CDEB 1DVUA 4PGBB 2AJYL 4U1HA 1N5YL 2CM5A 1SNRA 1CLZL 1WH0A 3D1MC 4OUOA 1HEHC 6PCYA 3VXSB 1JPGB 2VZ1A 4PP2B 4LDEB 1S5LO 1S4IA 4WLCA 5CM1A 3HZMA 5I1HL 1O9VA 4AYDC 4AIZB 1YY9D 2ZX6A 5GGRY 1JTOA 2EXYC 4JO4H 5IBTH 3MLPA 5BOJA 4UTBH 1VF5C 1HSBA 3FF7A 3RGVA 4KVNL 3ATDA 5D6DA 1FSKC 1WA2X 1FN4B 4N90D 4ZTOL 2MCPH 1TPXC 1M56B 4TLSA 2X4SB 4N1EA 2EDEA 1PLGL 4XMKL 2NZ9D 4PJCE 5T5FL 3VXPA 5KSVA 5DFVD 4DGWC 3BISA 3UYOD 1BIIA 2VQ4A 4LKXA 1RFDL 1WZLA 3F64A 1OGPA 5CN3A 1T03L 3ULUE 4HUVA 3QQ3B 4TSAL 4XO4A 1BA9A 2C3XA 1GY2A 4RFNB 3HG0A 1NMBL 1ETZA 4MQXC 3IMWA 1U8HA 4OFVA 1OGSA 4UIKH 2E74C 4GO9A 4OM1L 5IQNA 3H3BC 4QRFA 2EVGA 2IQAB 4FRXA 3QJHB 2GBAA 4PJ9C 5E6IB 4NZTL 4P2OC 5BQ7A 1N6QH 3AQXA 4GH7B 5JHDE 5G26A 2AK4D 2ZUQC 2L3BA 3Q6GH 5E6SB 2XQ0A 3POXA 3T3ME 3UXFA 3WFHB 2W9EL 2WBWB 2CO6A 3U0PB 1NGZB 1ID5I 1Z32X 3QCTL 4ZYKB 4HJIA 5IJVA 5IMKB 3NJTA 3C2AH 3NCJH 4WI6A 4ZG1A 1E6OL 1NGQL 2DYPB 2EACA 2QLVB 5C0IA 2VDMB 5DJDA 2IFFL 3KPPB 2R69A 5I1JH 2HTLD 4GQPH 1QRNB 1TMCB 4R97B 2VERA 4OCYL 2R1WA 2Z31C 3Q6FA 4P9ML 4PBWD 4ONFL 3W3BA 2HLAB 3EYSH 4ZO7A 4UDUB 4N74A 1M71A 1R19A 1X5HA 4W70A 4L18A 2X4OA 4L1LA 2VITA 4RJWA 1FBIH 4WIQA 1BAFL 1JGEB 4ABVA 3TJHC 2Q8BL 5KYYB 5TK2A 2VMJA 3IN2A 4P48A 4Y89A 2P4AB 1IBGL 4PHXA 1G0XA 3PS6A 2P80D 5EU7C 1I1CA 2PR4H 2YMTA 1DN0B 5AB2A 3CMOL 2VZVA 3D51A 2YHGA 3L3OC 4BD4A 1TNNA 4ETYA 3MLZH 3HG1D 5C2BH 2XG4B 1QD0A 2QR0B 1C8PA 2FIRT 1HI6A 4MNHA 3QA3A 1GTNA 4K94H 1KBWA 3REWA 2ZICA 5C0GA 3RWGB 1S7TA 1IAIH 4Z0BH 1ASQA 4GSQA 4XMPH 4RWHA 3BFOA 2Z6FA 3PREA 3M8OH 2CIIA 2B08A 3MAWA 5ADOL 4KZDH 1U6AH 2BWDA 5L7XH 5IHUL 2BSRB 5JHAA 1MSPA 3LKSA 4K9EL 5DURB 2COVD 1F90H 3CSBA 3IVKA 3O6FD 3P4NA 2MEJB 1SOSA 4WW1A 3MOAH 1MCNA 2R1XA 4LVNB 1JNNH 1TYEB 5KSBF 3GI8H 1AFVL 2ZKXA 4IOIA 5DD1H 4Q8BA 5DMIL 2FWOA 5CIPH 4HKXA 4JANA 4UV7L 2IH8A 4I9WD 4PG2A 5EOCL 4A2DA 4Y9BA 2WYTA 4LSIA 1HHJA 2R8AA 3CFBB 5IB4A 5JDSA 4NP4H 1U93B 4C56A 3BAIA 4G72B 3D12B 4FABH 3F7VA 3MROB 1U4EA 1ZEAH 4N5EC 4Y0GA 2E7MA 5CEXA 3DUHA 3WD5H 3RL1B 2OJZH 3IRZA 4HDIA 4OQTL 4KQ3L 2YD7A 4M5TA 3D33A 1U30A 3LKPB 3NFPB 4E2OA 4YAQA 5MENE 1RQ5A 2JVUA 2ZT9C 3L95A 2BIPA 4J4PC 2IBGA 2NPLX 4GAYB 4HCGA 4HIPA 3GEFA 5HHME 4CSPA 3HR5B 1VZIA 1MW0A 3LK3A 2CBQA 1K2DB 2ZAHA 4J3VA 4PGDA 1G1KA 1RU9H 3QUYA 3UJTL 1BMZA 1BWMA 4DP1X 2Y9RT 3P73B 3F05A 2JKSA 3VMPA 2ICWJ 1X9RA 3J7HA 4EVNA 4MMXC 4KKNA 1NDTA 3AM8A 3U6XA 5EG6C 3T1FB 4DK3A 1GW6A 4ELKB 1KNOB 1FIGL 1TVHB 3I6KA 3M45A 4LMQI 5F9DC 4BH7A 4Z7VA 1XR9B 2VLLA 3WI5A 5I1KL 1CBVL 3ARDB 3GB7A 2EUWA 1RUKL 3MREB 2QEJA 3HLAB 4NT6A 4UT6L 2C4FT 2JIXA 3RPKA 1TO5A 3S37L 1P53A 3CUPA 5FO8A 1IAOB 1CGYA 4OIAA 2DDQL 1SEBA 3U2SA 2HFTA 3L81A 1KCBA 3BUYA 4Y4FC 3G5VB 4KVCH 4PJDE 1G84A 2CNYA 4O3ZA 5C0EB 3VFRA 3FH8A 1IAIM 3DYOA 2ENPA 4FLOA 1ZLVK 4G8FA 4E9YA 5F7DA 4POUB 2PCYA 2YN5A 4E9XA 3EO1A 4H40A 2FE0A 2RALA 2M26A 4JFQA 2ADJA 2I5YH 4KJWC 3BEVB 1KGCE 3UEQA 1E2VA 4GXVH 3AA0B 5ECGA 3FSOA 4ONGH 3WY1A 4G7SB 1CFSB 1FO0A 5LAPA 3GSNH 4HWBA 1FGNH 1J0KA 1FDLH 5IMMB 5JIKA 2YOCA 5EB9A 4GRLB 2FYYA 3MV7E 2YUZA 1U95B 3JWDL 1AYOA 2FATH 4N0YL 4DKEL 4EDXB 3G9VA 1LE9B 3PQUA 4GNKB 1B9ZA 1FORL 1P2CB 3EF4A 4RIRB 4EJ1C 4BGDA 3QIBC 3LN5A 4IRJA 1FV1B 4GKNB 2IV8A 3VFSB 4D7PA 2ZJSL 2X1XR 5TFSL 1XGZA 1PZCA 3WAJA 4HZAA 1BQHG 4FSPA 1OHQA 4HFWB 1WIPA 3THMH 2E6PA 3X3FL 3TFKD 1IKFL 5IJKC 1MRFL 3U46A 1UB6A 2FBJL 4RETB 4GCSA 3DIDA 2XYCA 2B14A 1HWGB 4U6XB 2R9HD 2Z4QA 2QMJA 3KGUA 1PG7H 2H6UA 4M02A 4O2EB 4XBGA 3L6FA 1AZZC 2JKTM 3WFDH 1G7IA 2D7NA 1U0QA 1ZJAA 2NTSP 3LQZB 4M7KH 4AGQA 1NCCL 3NJXA 1G7LA 4KKBC 2XFGB 3PAVA 3WMQA 1OY3B 3FUDA 4R5XA 4GP5B 3EYVA 4M5YH 3W2DL 1BM7A 5DZVA 4BDVB 5FGBC 2FNWA 5I6OA 3ILPA 1RURH 3CFEA 4FLQA 1TQTA 2GTZA 5CLZA 4J8QA 4MA1C 3KPSE 4YLQT 2EO9A 3N3EA 5DI8A 4MJ5A 2JKLA 1G94A 4N24A 4QNPF 3IJ8A 3DZMA 1KN2H 3FF8A 2DYSB 3GJFK 3PUCA 1HXMB 4IEFB 3MLRH 4XVUC 5J89A 4Q0XH 2E4FA 3N04A 4FG6C 4Z0XA 4GLRI 2PUQT 2RH0A 4CW1A 4ZX3A 1A4KA 1NBYA 3VQLA 3D87B 4RA3A 4EXPX 1BQUA 1AGCB 4F2MB 3V79C 3ZZ1A 2XV0A 1HS6A 1KIPB 2GSGB 3MNWA 4ISVA 1JRHI 4M7LL 4MVBD 3UAJC 4LSTH 4PJEA 3BEWA 4R0LB 4EIZC 3LNFA 4YL9A 3LY6A 5DS1A 2ZLDA 4LLDA 4AQ1A 4C56D 2CHNA 1P7KB 2XE2A 3OMAB 4JDEA 2OSLB 3SYOA 1SVCP 3DA3A 2QZQA 4WDIB 1WBXA 4TNEA 3S97C 3A23A 2MQCA 3QWOA 1DQDH 4HIIA 4LCIH 3MZTA 1IKNA 4WNQA 4NO0D 4AYMC 1IV8A 4B9YA 1QW9A 5B1JC 2DLGA 3V0WH 1MW1A 3KXFB 4HXBL 5LCVA 2OL3H 1LWRA 3MBEB 4NYLB 4XX5A 4QI3A 5F7HA 3KG5A 5D2NE 4L8BA 1R0AL 4JG1L 2BDNH 4EZLA 5SWZE 5AYTA 3C8HA 3EGXA 1JRHL 3IDXL 4GCQA 2YLHA 4X9HA 1GJUA 5D6CA 1H5BA 3QUYD 3SKMA 2AEIT 4I3GA 5B38G 1YECH 2APVA 3MRKA 3RX8A 4HIEB 1I4FB 1KXQE 5ICXB 5L2KB 2E7LA 2FT8A 1VGKA 1UM5H 2EIMB 1OXYA 3JT2A 3L4VA 5EZPA 3VDBA 3LD8B 1MM5A 3DTXB 3MN8A 4KNQA 1UACH 2FO4A 3LEYL 4LEBA 4Y8DC 2CHWA 2DLTA 2QVKA 3WIFA 1T89C 3ZYJA 4PG9B 3P0VH 3U7WL 1QBBA 3A0OA 3IU3B 4OGQC 5IVXF 5LNEA 1JHTA 2Y2WA 3SDXB 2JIXD 2V5RA 2XXGA 3BESR 3T3PE 2WLNA 2ZUWA 2NYYC 4MQSB 2QLYA 5TE4H 5K5YA 2YN3A 3SE8H 5IQOA 4CGTA 4MZ2A 4NN5C 5D4JA 2HFEA 5ACMA 2F5AL 1OTSD 1SYVA 1ZT1A 2VDML 5ILTH 2AW2A 1U21A 3NZSA 2AJVL 3SCMA 2YPLE 4XOCA 1AGDA 1X6LA 4NKOA 4GY4A 5BO1H 2BNUB 5E9AA 3KL5A 4PIBA 1BW8A 2AEOA 4LMQE 4AQAA 4BJLA 1CGSL 1UZ6F 3CVDA 1BFVH 4XGZA 4YDJB 2Y1VA 2XT1B 4G6KH 4ONOA 3VE0A 3PAZA 5CBAA 1T16A 4MNGA 5D4IA 3HTLX 1GZHC 1Q94B 4R7XA 3OAZK 3B5GA 1DEEA 3QEQB 4KKLC 5J6SA 2UZIH 3MV8B 4BSWB 5K9QI 4JE0A 4H20L 3B9KB 3R4DA 4W9EC 1W0WB 4IRJD 3VXOB 2ZCLH 4AGNA 3HW7A 3PGFL 3F01A 2IFGA 2I9TA 2DMBA 4JFZL 1AIZA 3NCBB 4W4OC 3U4BH 4N22A 2ICEC 5I2IA 2B1OA 4BQ9A 2GCYA 1AQMA 1KCLA 3WUWA 3TZVC 5T3ZE 4G7YH 2JI3A 2YD1A 1XH2A 5SV3A 3CVHB 4M7LT 4OD1L 2DW5A 1KJ3L 2R2HA 1DLFH 3CSYA 2FEDC 4HIHA 4LAQH 3T6ZA 4P23C 4EZKA 4RAVB 3ZHNA 5EU4B 1XFPA 3BO8B 4RMTA 1GGBL 1QNZH 3SDAD 3D05A 1UHVA 4RZCA 1I7TB 3S48A 3JTYA 1NMCC 3UPAA 2OYLA 1KFAL 1NAMH 4PUBH 3LRKA 4L1SA 1J86A 4ZX5A 3BP6A 3BDXA 4J3TA 4G3YH 4X0NA 4YIQA 3JYCA 4G6ML 1QACA 1TENA 1AZBA 4L4JA 5FOJA 5A43C 1H15A 3MA9L 3VXRE 5IF0A 3OJ2C 4PWFA 3NCCB 4DP5X 4XCCL 3T09A 4AYEC 3NPZB 2XWDA 4WO0A 3CK0H 2V0AA 5FAAA 2FLRT 5GRUL 4J3OH 2WBXA 3CH1A 1A7RH 3RG1C 1WAAF 3JTTA 5KEZA 3C2SA 4CMMB 5I8KL 1XZ0B 1A02N 4UNTA 1X5YA 5KS9B 2BNQB 4BFRA 3VXSE 2G60L 1HOCB 4Y1AA 2AQ3A 2JK5B 4POZD 3VXQA 4JM2F 5JIHA 2YS4A 3WDHA 2DF3A 3MRPB 4F91B 2AXFB 2EKSA 4K3EH 3Q1EA 1ZA3A 2CGZA 3ZT6A 2F58H 3I9IA 1IO4C 2FAUA 2FTAA 1QWHA 4BK8A 1X5ZA 1PX8A 5D7SH 1XB6A 2H32H 4C8XA 3GKZA 3AY4A 3EH4B 3OXRA 4GI9A 5GZOC 3U9UA 3AROA 1W6WA 2JB5L 3ARDC 4F8OA 2Q9OA 2XQBH 3V0FA 3APCA 3MRGA 1DQVA 1TSHA 4O2FA 4HKJA 1YPZF 4JVPA 4OLUL 4WTXA 4IYKA 3HN5A 2R29L 1BD2E 2EDYA 1VJSA 2CJSA 5E8OA 1OW0C 4QJ3B 5GXBB 3RTQC 2YXFA 1DE4A 5DMKB 1TZHB 3U7AA 2LLGA 1XMWA 1HZHL 4D9LL 1DFBL 3KBEA 3SGKC 1TZOA 2H1LM 5DHMC 1YJDC 2YSSA 1L3NA 1G9NC 1Q1JL 4W6YB 4WI5A 4ORGA 4WO4D 5GZNC 1JGLH 1GIGL 1MW2A 4M61A 5CUSL 2G4GA 1MAKA 4B96A 5EO9B 1KPVB 3OKNB 2BP0B 3K0YA 4GRLC 2OK0L 4F57H 3H7LA 1WGVA 1T5WB 4WHTA 4DO4A 1HKLH 2X89D 4BBWA 4CRPA 2QSCL 5IW6B 3QUMH 1E27B 4IKNA 4TYUA 4KU1A 4AQ8A 1ZXQA 5AENA 4ZPTA 5HGDB 2WIMA 3KMDA 4PGCB 2H6PB 4EF3A 1S8DA 3DXAB 3DYPA 5AYQA 4XP1H 3GJEA 3KPQA 1QRNE 1OALA 2PN5A 3GNMH 4ECNA 4TVPH 4NRZA 4ZMLA 5JQIB 4QRTA 3WSQL 4HK0B 1XSJA 1MFEL 4NRXB 4PJCA 2XTSA 3I9GL 1YYMH 5EFIB 3LIUA 2D4DA 2MWCA 4HUXA 5ACZB 4WI3A 4ZUVB 4JFFB 4EQ3A 2WN3A 4JFUA 1S7WB 4H7VA 4KX7A 5CEZH 5JOFA 2H41A 3E3QC 4JZJA 3QWNA 3DMMB 1QW8A 3FQXB 1Y6NR 3UZVA 4FE9A 5T1MB 1CL7I 3L1OH 1SOKA 5KBMA 3M07A 4DP4X 3BRDA 1MPFA 5DVNA 1SXNA 4X6FA 4RJXA 2YMXH 1S3KL 3C6LB 4YHOH 1THCA 2D7QA 2VL4A 4N8VB 4EN2A 4JBSA 4YR6A 3ZR5A 2CJUL 4AVJA 3PLYA 4H1LB 3AWGA 5JHDA 32C2B 1N5AA 2WTRB 4OAWA 3D2TA 4MAUH 3T2PA 1KGIA 4NQQA 4G6AC 1HT6A 1GZQB 5BRZB 3TO2B 1ZGLP 3T6WA 3UC0H 3V4VA 2FUTA 5BRPA 5D9SB 3BKJL 2PWDA 5IGXL 1Z0NA 3CPLA 4L2YA 3ARBD 1BLNB 3AT9A 4GKZB 5CJXA 5JORB 1KUMA 2DQUH 3FU7A 2PCPB 1ET5A 1HQ4A 4JO2L 4XN5A 4LLYA 3BT2L 2P24A 3K5SA 1A0QH 1CL7L 4R0LC 3DLQR 2XA8H 1V3LA 4HIXL 2OMWA 3U9PL 5KJRH 3E6FA 4XZUA 3WJLA 3VW3H 1RPKA 2AI0H 3OV6A 2PPAA 4X7SH 2OZ4A 4ERSH 5FB8A 3FU0A 3WTSA 5E79O 5EZJB 3TX4A 5CCHE 3STLB 5B8CA 3NEEA 3UAFA 5E9DB 4JHWL 3BIKB 5J13B 5DS8B 3L3JB 5E08H 3AXLB 2DWEA 2BY0A 2MOVA 3ESNA 4RAHA 3NSGA 1CD1B 2VMCA 5GSRB 1ILSA 1MCDA 2LU4A 5A2AA 3MRCB 1C8QA 4RZKA 3G5XA 4NKIH 1U41A 5F89B 4XCEA 1KGUA 3VRLE 4Y1AD 3MBEC 2CBPA 1EZUA 4YSOA 1II4E 4OF3A 3B7YA 2Q6WA 3BH9B 1XGQB 2H45A 3QJUB 4UQ3B 1NLBH 5CO1A 1VCAA 3B5TA 1EO5A 3SDCB 1BEXA 4RH4A 3HMWH 5DO8A 1YDPA 2ZWNA 3O2WH 1PBYA 1XL6A 4Y19B 5ALCH 1VFOA 5F7EL 5FYKD 4H4NA 3GD1C 1SHSA 1KLGB 3N2JA 5E1QA 5I66B 3IDMB 1CN4A 1ECYA 5E2VH 2LTQB 1TMQA 2X7LB 1WQVT 3WU2O 1IFGA 3EH5B 1CE1H 5I8CA 1G6RA 2YD4A 4LVHC 1WAPA 5DZNA 1HAUA 4JUTA 4UYQA 4BA0A 4IK6A 3HNSH 4PQXA 5AUMA 3FCGA 4FN0A 2VDRB 4OD2A 5BZDB 5E00B 2AQSA 2LHAA 4S10A 1DCLA 1LDPL 1HL9A 1ZS2A 5DEGB 1Q9LA 4OCWL 4IHOA 5G4NA 4HOWA 5GRXG 3HPLB 3V5KB 1IM9A 1I7UB 3BPNC 4FDWA 4U2YA 3F7YB 3OX8B 3C5SA 4HUWA 4ZOBA 4AKMA 3KWWB 2W9LA 4PTTB 4DN3L 5C0FB 1EUTA 1CG9A 1JFQL 3P54A 1UD2A 4XPGL 1KC5L 2GAZB 3EJQA 3O41B 1B4JH 5ESAB 3GRWL 5EBWB 5EOTA 3B56A 2FQEA 1G5GA 3V6BR 2ZUYA 3H85A 4F7KA 4MWFA 1PIFA 5MENA 2A9AA 1QKZH 1UJ3A 4ODXA 1BXAA 3MV9E 1CDCA 2IDFA 1BPLB 1JV2B 2WPGA 2XN2A 2ICWB 3IRCA 1MJ7L 3WFBH 3B9KC 1KJVB 1JYVA 5KVEL 2CJ3A 2WXIA 2VXVH 4XI5C 1YAZA 3P2DA 3CE1A 1FWXA 4PJGB 4LPXA 4MMZB 2WXLA 4M8VA 4NWUH 3O2DA 2WQRA 3JWNG 2Q0ZX 1MQKL 5T5FA 2H0EA 1MIEH 2LU7A 3BLBA 3QISA 2DBLL 3AVEA 4AX3A 3CZEA 4E9WA 4Z5RB 3W9DB 5IB2B 1PFCA 2DMGA 3QRBA 5ITFB 4F3FA 1DYZA 2VLKD 2P49B 1HILA 4KKZA 3ULUD 1JI2A 4RMUA 4A39A 1XF2A 1XH0A 3CVHL 5DL7A 1CYXA 4IHBA 2E59A 3EDEA 2OP4L 1I8LC 3ZL4L 5IBLD 2E56A 3A6CL 2D4FA 2ZOLB 3NRPA 4PJDA 1YUKB 3QPXL 2VLRB 2J4WH 1HDMB 3O8XC 4YQXH 1G9MC 4FHBD 3P30H 1CFNB 1AZVA 2GC7C 3FYXA 3GBML 1HCVA 2MCMA 5JHDD 5MEOA 5AOLA 2X4TA 3ARGC 1G9ML 2R23A 4LPCA 3DWOX 5DUML 4XPFL 1A6UL 3K8KA 1MFBL 3GJFB 3HZVB 3NSDA 5E5MA 3VY8X 3P4OB 2VXUH 1I9IH 3P69A 1SF5A 5IB3A 4FJ6A 4E9LA 3MV7A 4OJEH 1N3NA 5CKAA 2AVFA 4XPBH 5F1SA 4QPEA 3OWEA 1V3MA 4A1RA 3O9WA 7PCYA 4XBPA 4ACTA 1ZLDA 3TVMA 3WKYA 4LSEA 4M4RB 4H2CA 1UZ8A 1ZKAA 3ABGA 2G5BA 2Y0SA 5JDPA 1U8CA 3VFGL 5C3IA 4A04A 1H8SA 1R3HB 1VRSA 4I18B 1JV5B 1JIBA 3KYKL 1AC0A 3EOTH 1MVYA 2BWQA 2NQDA 3FRPB 1KYUA 4NZJA 4PLKC 5IJDC 2KXPA 3ZDXB 3PHOA 1DQMH 1GPOL 4FQ1L 1QZNA 2MRYA 3I2CH 4G76A 4KV5E 1MLCA 5C6TL 5TK4A 4HV8A 4AM0B 2YBRB 1T2JA 3KXFE 1OP4A 4C4VA 1H6UA 1JZFA 4L48A 4U3HA 4EI6B 1JPTH 5I18L 4PY7B 2IQ9L 1LK2A 2AQQA 4HUNB 4J2XA 2O1AA 4Z9KB 1JGIA 3KPSA 3ASWA 5EU3A 3VQ2C 3QJFB 3PL6A 3X2QB 3US9A 3LB6D 3IMTA 3FT3A 1FNSL 4R83A 5J06A 3GSRB 1WEJH 3IN0A 1IFHH 3OKDB 4UNIA 4OZGB 3CFKA 1T1YA 4PJ8C 3JWNE 4AUJA 4Q4EA 5ADPH 2CZNA 2V9RA 4OJCA 3O3AA 1NBQA 4H8QA 3LN4A 2A4CA 1CFVH 4OFDA 1TTGA 3SDXE 4WU7B 5EE2A 3RB5A 4DVBB 3FT0A 1A1NA 4FQLL 3MHZA 3WHE1 1M6UA 6FABL 4NLHA 1AP2B 1S78D 3EJPA 1IM9D 3B83A 2XTJB 2VSDA 1B4LA 2R1YA 4GG6B 4LNRA 3UYRH 4X8GA 3BGMA 3HAEB 4MA3B 4WWKB 1UKQA 1ADQL 4M5ZH 1QJPA 2XX1A 4UU9B 5MI0B 1DSWA 4PS7A 3EJUA 4HMDA 4JFXB 5F9WC 3ZQ9A 1MF2H 3E0GA 2CK2A 1JZJA 4HZLB 4OQTA 2QV2A 2NCMA 4X7EC 2EVIA 5EN2A 2GC4C 4JFPB 3DMMC 3GMMA 2IGFH 3SKOA 1W72A 5MEND 3DV4A 1JF1A 4R9HA 3MJ8A 4MJIB 1KYFA 3DRQB 4X6DF 4AL8C 1U8OB 5D2NA 3MA7B 1EMTL 3HB3C 2XKNB 1DO5A 4MFHA 5SWZA 4C47A 3VWKA 1DVSA 2D0GA 4JL1A 4G83A 3C6LC 4AVHA 5FHAL 2X9ZA 2J57A 5DT1H 3O0EA 4Q6IB 2V8LA 3RA7L 3QEQE 3CDZB 1KXQA 4R4FL 3BZ4B 3C60C 3LKQB 4NUQA 1I1RA 4QXTB 1HQRB 5L8LB 4BK4A 2VSCA 1JTPA 1NICA 1EGJA 2MKWA 2QQQA 1BLIA 2J6WA 5KVFL 4Z78A 4RGMB 5DJZA 2HAZA 1BQHA 1DDTA 4KJPC 2AQPA 1MNUL 2E9IA 5F3HA 4AMKL 1S9XB 3RVXD 4RBPK 5GGVL 3ZQXA 3RBHA 1T3FA 4MKMA 4OFKA 3KPRE 3MLXL 4IIZA 5CIPB 1PNDA 5T5NF 5IHBA 3LNEA 2HN7B 4HHAA 1JBJA 2P8MB 3IAQA 1EZSA 2VSKB 1T2QL 1TF4A 4G5ZH 4ZQTA 2B15A 4HIJB 3P2BA 1PU0A 3B8SA 4X98A 3JTSA 1MRDL 3QZPA 2CCWA 5BJTB 2YPLA 3T8VA 3TCLB 1XF3B 3CWGA 5CJQL 3MRFB 5EZOH 1RK7A 2HX9A 2W0PA 1LP9B 5JZ7D 1A1MB 1KSRA 1A3LL 4F7TA 4XTRD 4F58H 3MBWA 5JQ6H 5JIIA 2YD3A 3HNVH 1KACB 4JPKH 3IGUA 1RIVL 1HEZA 3S4SB 1I85A 4HT1L 3QORA 4R4BB 3MV7D 5IEKA 1BQ5A 1QWUA 5GHWH 4Z7NF 4AMXA 3SDDD 1CXFA 1Z9SA 3CV5A 3SE3C 5I5RA 3FCSB 4TLUA 5CZRA 2JTYA 1D5ZA 4WWPA 2RFXB 3O9WD 3SDCC 4TUJA 1P7QA 2AK1H 2BNQE 2CO3A 3TVMD 2X4QB 3DETC 3EO0B 3UPCA 5KWYC 3BPOB 1G1YA 3AREC 4NUJB 2C3WA 2ZXQA 5EV7A 4N8VG 1AJ7H 3OMZA 1QBLL 4O58L 2Z92B 4YNYB 3UDWC 1P9MA 2DOCA 4H1LG 2LTQC 3C6SA 5HHQA 3IGKA 1FE8H 5IVOA 1KENH 4KRMB 4QT5A 5IB5A 2N56A 1OLLA 4OLVH 1QR1B 5I1LB 3CN4A 2YBGA 3K2IA 1MCWM 3NQIA 5JNYB 2UY7B 3ZE0F 3NA9H 2R2EB 4J8RB 1Q72L 2YA1A 4CC0A 2BS9A 4DGYH 3KE0A 3ZYZA 2YAHA 1R33A 4FG2A 4CN4A 1CK0H 1HHKA 4X9IA 3KVDD 1PJWA 4Y2DA 1IGCL 2CCLA 3L9RA 1JK8A 4RSVA 4KXBA 2ICWI 1MFVA 4XO3A 4N6RB 2VDRL 4Z7OB 2XWCA 3T1WA 1AR1D 1C08A 3CD4A 4MZRA 3PL6D 1BOGB 5ERWA 1GC1C 5I1IH 1H6EA 2DQJH 4JKPH 5I8EB 4ZFQA 4LK4A 2HMID 2ZG1A 4LVOB 4RL9A 4G8EB 4XNYL 1AE6H 2WV3A 4LE8A 5TDNA 1GC1L 1NEUA 3PWNB 2WSDA 3HLKA 2V8MA 3F5WB 3RU8H 3WG7B 3QZLA 2Q76B 4PFEA 5KSUB 2EUVA 5CZVL 3OG6B 3VXSA 3P11H 1OSPH 3DUSA 1KPUA 4PP2A 1A6TB 3D39B 3MYJB 5C6PB 4HP5A 3MC0A 2WB1A 4OJDH 4Q52A 3PNRB 1DVQA 2B3IA 1A6VL 5T3XL 1AGBB 4U6HB 4I85A 5BPPA 3GBDA 4OLWH 4NM8H 1OQXA 4MMZC 4P59H 1DL7L 2DQHH 1RZKH 4KMTH 1K8DB 3QUZB 4H25B 2BW4A 5G39A 4K3JL 3QDJB 2O6CA 3EHBB 3C5ZA 3F00A 5FKAB 4B9KC 1FN4A 1KCUH 3AMKA 2Y72A 1ROCA 2Y5EA 4C57C 3QFDA 2W07B 3ULVL 1ZK5A 1B9KA 2VJ0A 5C0CE 3EYOB 4AXWB 2G3XA 4N2AA 2YRPA 5LBGA 4FQ2H 5T33L 1BD2A 5FO9A 5SWZD 1JZ7A 3QO1A 1WS8A 3LXBA 3SQOH 3VWKD 4U1JA 4Z77B 5IUSA 1GJIA 1YA5A 3BD4A 1EEZA 3BSGA 4KR8A 1N0XL 2W5PA 3DPBB 4GG8B 5DHVH 2BSCA 5AOJA 1P4UA 3DHPA 4MDIB 2WMPB 5HY9B 5EORL 2Q8AL 1BBJA 2QDVA 5D7JB 3B1UA 4K3DL 3U0WH 4JPWH 1KCRL 2A5UA 5I73B 3TBYB 3EBGA 3QJHA 3TH3T 1GYUA 1SBSH 1E3FA 5E6IA 4L29B 5I6MA 1U8IB 2B16A 3DVGB 2EABA 4N9GB 2D2OA 1IJ9A 1GOFA 5L9DH 1U2CA 5DJ6A 5BRZE 3WFHA 3D18B 3FO9A 3U0PA 4F7PB 3LEXB 2PWEA 1XCXA 3NZHL 1N8ZB 4ZYKA 5IZ7A 2VLMD 1TJMA 2DYPA 2GHWB 4HC1L 3MPCA 5IBTL 4PWKA 2H6OA 1X5LA 2HP4A 1X5IA 3KPPA 2B59B 3DOSB 1QRNA 2ZF8A 3RWDB 2GUYA 2F19L 4AITA 4MXVF 1UFUA 4I18C 1EVUA 2GEQA 3VE1A 4Z7QB 2HLAA 3KLSA 2CDFB 4PI0A 4RCAA 4UDUA 4AT6A 4JNXA 4I0PD 1N64H 2DQIL 4NQVB 2WBJC 1BH3A 3BMWA 1PZDA 2CU9A 4Y2NA 3QORD 4QY8A 5TE6L 1JGEA 1FL3B 4N2LA 1IX2A 3TV8A 3KGSA 3MJ6A 1SVBA 1IBZA 5I0ZA 1NKOA 2OL3B 1OCWL 3LKNA 3TEWA 5I9QB 3WKQA 2CKBB 1P7QD 4HX1B 2CO2A 1TKWB 1CTOA 4UMSA 4WEBL 2XG4A 2QR0A 3BUTA 2R8SL 1EFXA 1F4WH 5AKSA 1MREL 2HG5B 1U33A 4Y19E 4XNXH 3RWGA 5T3ZD 5DO2D 5E6RB 3DUUB 2QGBA 2GK0B 3L3IB 2JV6A 4YX2H 3K74B 3PIQA 3IETA 4OGZA 1MHHB 4UTAA 3NP4A 3ILDA 1A66A 2I69A 2XYBA 3D50A 2EICA 3L5JA 5L6YH 2DICA 3QXDA 4F33A 4XOEA 2QKIB 3FU9A 1QLEH 5IG7A 5TF0A 4Y2DD 1Z5HA 1RPQA 4U1IB 2KDYA 2DWTA 5GTIO 4PWGA 1YEGH 3NJIA 3CFCH 1TYJA 4HVBA 4Z8FH 4UUJB 1KPRB 4X7FC 3EJYC 1YMME 2NY6D 3K80A 3KH3A 1U93A 1WCBB 4JY4B 2C34A 2FK9A 1P4IL 3DPDA 2KLTA 3U4EB 2ZKHL 1FBIL 1WZMA 1D5MB 2ATKB 2YXVA 4JR9H 4KJYB 4J3UA 4QXUH 3HG2A 3VXSD 2DQFA 2WXQA 3FTXA 3IPFA 4JO5A 3UMNA 5FYJU 4AEEA 5I6XB 3W37A 1QPPA 2WWMD 3LKPA 3GM0A 3NFPA 4IKIA 1T6VN 3NCFB 4TQPA 3COOA 3OMNB 4FNLH 1BJMA 2ZNXA 4IU2B 4A2HA 4K94C 3MLZL 5C2BL 5T3XE 3KPMB 2EYRB 3HR5A 3V52H 4ZO6A 2J5LC 2O61B 3KW7A 1LQSR 3T2OA 3ZE2F 4N0CC 1SOXA 4LCVA 3C5ZD 3P73A 2E46A 4TLKA 3AC0A 4XMPL 4PJGE 4RGMC 5ITBL 1QSEB 3U1SH 3M8OL 1P4BH 4HA1A 4P57A 5A1AA 5C97A 4ELKA 1WFUA 1KNOA 3ZKSD 4CJ0A 5J11B 3ULVE 5FS5A 1F90L 1AVAA 1XR9A 1OP3K 3HOEA 1BD2D 1PCSA 4X7CC 2AXHA 4AJWA 2R29A 3FUIA 1DBJH 1JNNL 4KMLB 4D65A 3EO9H 5CMAB 3BE1L 4OLYL 1IAOA 3TYGL 2HLFC 1Y18A 3M46A 4KK9C 4JRYA 2E6QA 2NNFA 5KANG 3SY9A 4ATWA 3HAEG 3DWTA 1D2OA 4YWGH 1XSIA 2DTSA 1N68A 4JFEE 2V33A 4NKQB 3QJZA 1A9EB 2DQGH 3HVDA 4JQXC 4EAEA 1GAFL 4QRQB 1BAGA 1W8EA 3WFCL 1RIUL 4Z1PA 1R3KA 3DKHA 1ASOA 4OKVA 5E94A 3IDIB 3EJZC 3G7GA 5TDPA 3PJLA 2ZXDA 3F7QA 3MXWH 3OTTA 4YBQC 5ICUA 3MV9A 3QJTB 1TQUA 1NC2B 1Q4NX 5IMMA 4FQIL 2E47A 4PY8J 1QP1A 1VADB 2XVGA 5JPNC 4BFBD 1P5VB 4B9CA 1LMIA 1T1LA 2DYPD 3MFFB 5D8JL 4RMRA 2ILLA 4L8DA 1G7JB 1KELL 3BPOC 4A55A 1MCKA 5I23A 5SX4H 4YHKH 4W9HC 4JB9L 4KK6C 4N1HB 3HHMA 1P2CA 2H32B 1RU9L 1ONQA 1G7MB 2PW2B 2CR0A 1SY6A 1ZLUK 4E36A 1VZHA 4FOMA 4GKNA 5IQMA 1OANA 2X09A 4O51B 2IH1A 5E5RB 3LQMA 4HOMA 2M06A 4N2FA 1YEWA 3GXFA 1EAPB 2ITEA 2XFXB 4QRSB 2D0FA 4PRAA 3HBGA 5E8PB 4DGIL 5I5JA 2O5ZH 3CFDA 3F65A 3R8QA 3LKRA 3MFGB 4PJ6A 1UWXH 4U6XA 3IKCB 4XP9L 2AJXH 5G5DB 1JZGA 3ZDXE 1VKXA 2VZSA 4O2EA 3CN0A 1GYWA 4XP4L 3SZKC 4RGNB 5KAQF 3LQZA 4W68A 1RP8A 4N2CA 3ZBMA 5C3TA 1EFXD 1S7VB 3VTMA 5IV2A 3CSGA 2IAMB 5JOEA 4X7TB 2WVSA 7FABH 1JL8A 4U33A 3X1NA 5MHSD 1I3GH 4MNQD 1DP0A 5KSBB 1RJLB 25C8H 4LVOC 4YDKH 5AW6B 2FH8A 3JVFC 5T1JA 2W8CA 2WNWA 2X9XA 1N70A 2R4NA 3GPEA 3S4SG 4LSVL 4FKKA 1M1SA 3PQYE 4X6CF 1GL4B 1R46A 1MCBA 1YEDA 3T0AA 4IBUA 4IEFA 1HHHB 1GS8A 2VWEC 4OZGE 1OP9A 2EC9T 4PR7A 3SGDH 4E9RA 2BVUA 1FRGH 3LIZH 4GRWH 2YEZB 4P9HL 1KIPA 2G9HA 2OTWB 2YQ2A 3NAAH 5C7XL 2NXZB 2W0KA 4WW2A 3UADA 3HS8A 3QUZC 4BKLB 5A2BA 3W5NA 1N59B 3Q8FA 3D6GA 3KYMB 2XTJE 4BFIA 4GG6E 4J2QA 4UAHA 5ECJE 5J6HB 5I30H 4RMVA 5HDQH 1OAZH 2OSLA 4WDIA 1BAWA 5JXAH 3ET9F 3VSVA 3KHOA 5M95B 1Z2KA 5TE7L 4I4WA 5D7HA 4CU8A 4PGEA 1OP5K 4JFYB 1M1XA 4UT7L 2XWJB 3C87A 3T6VA 1NEZB 2BIOA 1F0LA 4OV6F 4PB0L 4YZFE 5DR5H 3KXFA 4APQC 1CQKA 4JFHE 4MJIE 1RUPH 3MBEA 4NYLA 3WFDL 4F9LA 2IH3B 2BOCB 3K6OA 4M7KL 3S35X 3CX5J 3KHQA 4AYBA 3I84A 4EEEA 1PKQE 1D6VL 2AFNA 4R2GD 2VXTL 3X1EA 5D7JC 1TIUA 4M5YL 2WLHA 5I73C 2XG6A 1I4FA 2QADB 3G6DH 5CKGA 1RURL 4FXKB 3VSTA 4DPAX 4DZBB 5IWLA 2H0JA 1P1ZB 4JRLA 3PDOB 2F0CA 1Z66A 3CZSA 1AHMA 2J8UF 3P3UA 3KR3L 1UFGA 1L7IH 4AYID 4PG9A 3WNNA 3FSVA 1ZIAA 3FTWA 3VVVA 1UC6A 3WHXB 2BHUA 2Y22A 3ZHDA 5DD0L 2Z8VC 2WQUA 1S9WB 1YQVH 3QRCA 3MCKB 3RWFA 4CVXA 4JRYD 1OTUC 2PKDA 4XPTL 3ULUF 1LO5A 3ILQD 5LDSA 4LSTL 3SE6A 4PV1C 1A7NH 2OQJA 1KZYA 4FXTA 2PMZA 3L1FA 2HKAA 1G87A 1WRFA 4GKLA 1DJGA 5D72L 1AQHA 1AXTL 1ZV9A 3SPCA 4KAQH 1E9QA 1YYCA 3ARPA 4JVUA 1ZHKB 3L5XL 1BVOA 1LP9E 4QTFA 1FYHB 4OF8A 3C08L 4UBDD 5IFJA 2BNUA 4W9CC 4WHYG 1GVIA 1OTTD 3UJIH 3KPOB 3MV9D 2NXYB 3JV6B 4UIMB 4FQJL 4ZMQA 4QHUB 4TUOB 1J0YA 4LHQB 2QQNL 4MTMA 3TU6A 5BUPA 3S0PA 5I9QC 1OCRB 5DZOA 3CX5K 2LFGA 4GMTH 3RX7A 3SPJA 5C8JB 4YE0A 2OL3L 3Q3GB 4F2EA 1Q94A 1BZEA 2A74C 1XCWA 4I3RH 1CGXA 1BSIA 1YEFH 2CKBL 3QEQA 4IQHA 4PR5B 4G6FD 4R26H 3DGGB 4BSWA 1BQSA 2HJLB 3VXUB 1JGVL 3EG9B 2EXWC 1XR8B 4JY5L 1BHGA 4XMVA 3P2TA 1FF5A 3QDAA 5E2WH 3VXOA 3H2QA 1BZ9B 2P26A 1XGUA 4B9PA 4LSSH 1R3IH 3UX9B 5KYWB 1FO0H 3PXJA 4ADGA 4HWBH 2VR7A 3KPRA 3P0VL 4NJAH 2QKIC 4W6WB 1YEIH 3T4AC 5HGAA 1RSYA 2X4RB 4RAVA 3RFRA 1C12B 4XAWL 1IC7H 5EU4A 3BO8A 1JTTA 5EEWA 3NP3A 5I24A 2BP8B 1IKOP 1I7TA 1UA6H 2UWEF 3F8UB 3HE6B 3U0TA 3ZK0A 1LWJA 4JCHA 5IREA 2XMXA 2KQMA 5DVOA 1FI8C 1HL4A 3ISWA 4HFUL 4OGAD 4Z7OE 5ILTL 4YXHH 43C9A 3GXPA 4OZIE 4MRCA 3NSYA 2VW6A 1YNTF 4GQ9H 3I9PA 5DK0B 1OAKL 2AP2A 4EBQH 5D1XB 1I1AB 3ARFA 3I74A 1C1EH 1NWOA 1ANUA 1CZ8H 1EX0A 2QTVA 1V27A 3J2PA 1H3GA 4PJIF 3H1ZA 2ZUVA 3VGDA 1OF0A 3B2UC 1XT5A 5EZIH 1BPVA 1XZ0A 3G5ZB 4N20A 4M5SA 3ARZA 4QTIH 4HOZA 2BNQA 3CLFL 1NCIA 3E8UL 4IBTA 1H9DA 3C8DA 2JK5A 2V2XA 4UQAA 5KVGL 3PCYA 2GFBB 2ZIDA 3D39E 3OHXB 4AC4A 1KWKA 2WWKO 2RB8A 1I3VA 3QEHB 5JHLH 3FCBA 4QCIB 3LK2B 4PS4H 4FZEH 4I8DA 4L3CB 1X6NA 2NY1B 2WM0A 1IT9H 2FX8H 3CZFB 2MTPA 4NKDA 3MRIB 3VU1A 4A2MA 3MRHB 5EPMA 3O0RH 1XGYL 4HPOH 3C75A 5EZLB 4G7QB 3VD0A 3U4BL 3PP4H 2JB6B 1TZIB 3LCYA 3QDJE 1EZVY 5I8OL 4XN1A 4NNYA 2OMXB 5E2UL 3R0MA 4XNQB 4C55A 1CBJA 1LWHA 4AIXA 1VIWA 1WZ1L 2WUCH 5H37G 2Y2XA 2XN9D 3OKEA 4HH9B 5BS0D 4HBQA 4NQTA 3QIWB 2JQAA 4RLBA 1N6VA 4UZGA 1WUZA 2WJ7A 4N5UA 4FTVD 4HCRL 1XZWA 4QRRB 3QPQD 3DX4A 1EJOH 4XBMA 3QUHA 5IVXB 2ZP9A 5E7BA 2EIJB 4YPJA 1R24B 4G3YL 1W6LA 5DMKA 3NCYP 5FWRA 2WZPA 1TZHA 4FC3E 2BNRB 1SEQH 4K2UL 3KDMB 2WUBL 2EO7A 4RQQA 5E8EB 5HYSB 5HD8C 1BG9A 5ETUA 1NINA 4X5XB 3SO3B 4KI5E 5IQ7L 4NUGH 2AJUL 3D30A 3JV4B 1OF2B 5LCVH 3L1GA 1A7RL 3KGTA 3O2VL 1XCQB 2ICES 3KM2A 4HJSA 2QZ5A 7PRNA 5HGGS 3T2NH 3NJJA 3MCLL 3QT2A 2WO2B 2GT9B 4M6MH 4BFGA 1M2OA 2ROXA 5F9OH 3FQ2A 2VABB 4R8WH 3JWOH 3HMXL 3NG5A 4HQQL 4RLCA 2H6PA 4PGCA 1J11A 1ADQA 2Y25A 3LSOB 1JWUB 3FQ1A 2F58L 3FFCB 1LJMA 4DUWA 1U4FA 3HI1B 5FA3A 2R0WL 2Y7NA 3DRTB 5D7SL 3VZUX 4LXFA 2Z64C 4F80A 4LSHA 1CWVA 1F58H 4HK0A 4NRXA 2V2WB 4PH8A 4Z7QE 1G0DA 2VR4A 4PN6A 5EFIA 1L6XA 4FEIA 3IMUA 5C0CA 4P5TB 4U2ZA 5AW8B 1RSFA 4ZUVA 3Q0HA 1OGTA 1S7WA 1E8WA 1IB5A 2WN2A 4X4XB 4CSZA 3BDBA 4CN1A 3ML8A 4KY1H 3UBHA 1KJMB 3ARSA 2A6JB 3FQXA 1ETJA 3DWNA 4P5MA 2B4CC 4RGNC 2GHZA 3LZRA 5T1MA 3QEQD 3ZPDA 5IKCB 4O00A 1DQTA 2IAMC 3WJJC 2OI9B 4FZLA 5DRNB 2IO5A 2B4CL 2XN1A 3OPUA 5AW4B 4ODTH 4GQRA 2PYEE 4ZBJA 5J1AB 1MI5E 4FKHA 4EIBA 4HAKA 4X83A 5TPWH 4PJXE 2OMBA 3KEHA 5JMOC 3HE7B 5J3HC 4L3EB 1BVKB 4H1LA 1CXLA 3IE4A 4O3YA 1QUPA 2MNUA 4I2XE 2B0SH 3TT3H 4JPIB 3KPRD 1T7WA 5AW0B 2FSDA 1GZQA 2NY0D 4GW1B 4M8UA 5BRZA 3AAEB 5D9SA 4DP8X 2C4FU 4OF5A 4FP8H 4XMTA 5FPIA 4QHLB 4BYHA 5JORA 1NAKH 1L9TA 5GGSY 1HKLL 4WJ5B 4ICWA 1I1FB 4N2HA 3BP5B 3QH3A 1J5IA 4NN7C 2H3KA 3FQ4A 3GXNA 2FJGA 4D0CA 2VM9A 1TEGA 1GJWA 2X12A 1HWHB 4WCYH 5DUBA 3WIIH 4AQEA 3QWQB 3DROB 4J39A 2KZKA 1N4XH 3PAYA 3KYOB 4ZS6C 3ARFD 3TF7C 5FCUH 4TVPL 4JM2B 1AHWB 1F4YL 2ENJA 3QEUA 4UQ2A 5AW3B 4JJ5B 5DS8A 2CR6A 4KJQD 3AXLA 1QUNB 3QK0A 3N41F 3LPWA 3ROOB 3LS5H 4PSRA 1BZOA 1EHLH 1CD1A 5GSRA 5GS1B 4OV5B 3D52A 3BVTA 5AVWB 5J9PA 3JVGC 1C5CL 2HCZX 1XGQA 3BH9A 2H2SD 3OJMB 5GRJH 3RJOA 5KVGE 3U9WA 3VVWA 4KX8A 5TH2B 3IJSA 2W9DL 3WN6A 2R89A 1RMFH 4F8PA 1YPZB 4OLZH 3UYPB 1U9KA 2QADC 4Y19A 5DA4A 3RZCA 2QQKH 4JE4B 1DSFL 3X3GH 2VO8A 3BX7C 2H4EA 1L9SA 1CICD 1JPSL 1J8HA 3IDMA 4JS7A 3KLHD 5AG9A 2GW5A 1JZ6A 5DJ0A 1RZIB 3FB8B 1BQKA 1QSEE 2XXCB 4AH2B 3FRUB 1FFPB 1ASPA 3UC0L 2XZQL 2B1HH 2P5WE 4DP7X 3LXCA 3N5AA 2HUHA 3SPHA 3PJNA 1KT2B 3MVSA 2CD0A 1R1CA 2J7LA 2TSBA 3BUBA 5C71A 1RZ8B 3NFNA 3VFOB 3EF7A 4O02B 3BYYA 3R18A 3H4HA 4Z23A 1ZK9A 1L0QA 5ID1B 2ICCA 3VI4F 3V4UL 5FYKH 3QQNA 2WZPD 4ATTA 3VW3L 3V5KA 4S1QH 1I7UA 5CZXD 1YMMA 4PB9H 3U82B 6PRNA 2Y7OA 4OD3H 5C0FA 2DQTL 1I8MA 1E2WA 1T7XA 3GMQA 5IQLA 5AW1B 5GGTL 4K8RC 4PRID 4KUCD 4MRBA 5EBWA 4BCXA 1CFTB 1IZKA 1F97A 1P69B 4HJJH 2G2NA 1MZZA 1MFAL 4ZNCD 3E9TA 4K8RL 4EE2A 1SFHA 3GSVB 1NCWH 1F6FB 1CTNA 4C4UA 3BRGC 4CTDA 4JZNA 5G2NA 3V6FA 3I9AA 1UGNA 1KJVA 1QNIA 2KLSA 2YC1A 3LV3A 1N7MH 3O2WL 5AOZA 3WNJA 4AEIL 1VHPA 3EXLA 3NEOA 4PJGA 4KPHL 4NQDB 2YPKB 1A4BA 1YEHH 5AALA 1KJ2A 2BVTA 2IDTA 3NIDB 5E2VL 4KMQA 3BVVA 3VFTB 5C0CD 3OL2A 4NCDA 3TBTA 5MP6H 4Z5RA 3M1CA 4ABUA 1J1PH 1DJHA 5ITFA 1MHEB 1CE1L 1BOYA 3OZKA 2W94A 2EECA 3ZTNH 4OB5H 2XKUA 1RVFH 3HE6C 5AYUH 2ZOLA 2DL2A 2NY2B 4UF7C 2Y7SA 3UCQA 2VUOA 3BQVA 3LZQA 1U8LB 4JFEA 1L6PA 4WU5B 3BP4A 1ZXKA 1EUUA 2VDQH 2AGJH 3FB7B 5DWUL 5D1XC 4B9ZA 6PAZA 1QTYT 1VFAB 2E3VA 1WFMA 3NEXA 4NC1C 6CGTA 1T6WA 5KG9A 5D71H 5FYLL 1LK3L 2E8ZA 5KSBE 5DVKA 5BRZD 3H3PL 4JM4H 5E4OA 5FDYA 3GJFA 2CUHA 3L4TA 3HZVA 3Q7JA 2EUZA 4DAGL 2BIMA 3EAKA 4B9JA 3D34A 4WSGA 3HFML 2F8XC 3MLUH 4ICXA 1QKZL 2ZE0A 4HUCA 2BOBB 3EDKA 1JHLL 3F83A 2XE3A 4HC1A 5F44A 3OHXC 3QI9A 3U6RB 2H9GA 1WISA 2EIZB 1JPST 1MCHA 1FLRH 4TSCH 5C1MB 3TN0B 3HOLA 2NY1C 4ZMWA 4ZFOB 2OMNA 4M4RA 2QSQA 4FFZL 3GZQA 2FJHB 3NDZE 1XH1A 2IF7A 4LL4A 4WF7A 3WXWH 3B4NA 3DV6B 3PJSB 5HDLA 2FEEI 3NESA 2QDWA 2PRNA 4FMSA 1C5DB 1R3HA 2FECL 3GIZH 2BVYA 3DX7B 3MRRB 1LD9B 4HISA 2WLIB 4XRCA 2HSIA 2W59A 2X9KA 2ITFA 3EOAB 4I77H 1MW3A 2NOYA 5EIIG 5MERB 5JOPE 3B2VH 3K71B 1F56A 4M4PA 2ERJC 2ARJB 5DHVB 5A6LA 2R0LH 1RLBA 4N0RA 1VESA 3VZTX 4LU5H 4PLJD 3QR2A 4EI6A 2OZ4H 4HHWA 3UH8A 3EFFB 2J4WL 3N44F 3NK4A 4MKTA 4Y19D 3RZCD 2HB0A 2NW2B 3LHPH 3RNKB 4QHMB 2ODHA 5LG1A 1G6VK 3DIFB 3QHZH 4M7ZB 3K8LA 1BQRA 4PVMA 3QJFA 3K19A 1J8HD 2FEEL 1FL5B 4PJ5D 4S1DC 1O7SA 1F45A 3PQYA 3SO3C 4IKLA 3L3HA 1HSAA 1NGPH 3GSRA 4CBPA 2FIKA 3QQ9D 2P42B 1JHKL 4OZGA 2K4AA 2YA0A 4Y4KC 2OMVB 2NSXA 1EIBA 4PRNA 4P2AA 4ZUUB 1ZE3H 4NBYB 3RVUD 3W11D 1V7NH 4KHXL 2FT6A 4WU7A 1ZHZA 1QSVA 4U1LB 1V5JA 2EH7H 3AWFA 3VCLB 2BPBA 1X4XA 4KROC 2BVPB 3EDJA 2FSEA 1HHGB 3P4MB 3QNYB 1YMMD 1A2YA 3S88L 4OSUH 4CMHB 4GG6A 1JXFA 1PGRB 4XMUA 1VERA 3M7OA 3HAEA 3Q2LA 1KBBA 3NZUA 4MA3A 3QUXA 4WWKA 2YSTA 2AK4B 2VAAB 4UU9A 2HG0A 3IDUA 4M1CD 4OQ1A 4MHHI 2J8OA 1CYWA 4JFXA 2OMTA 3KCPB 1E40A 4JY6A 1DQJB 1UXLA 4FFVD 1CFQB 2XVLA 4EO5A 1CLVA 4JFPA 1E4WL 1FVCA 4G8AC 3WLBB 5EBGA 1DEDA 4EUPB 3ELAT 1Z9NA 1DQML 3GM8A 1FZMB 3KBFA 1MIML 3Q8BA 4MJIA 1U8OA 1EAOA 1I9JH 5KOMC 4DEPB 1CO1A 3MA7A 1IGIH 1U8KA 2XKNA 3QYMA 1A6ZB 4WY7L 1PKQA 2OI9C 4K7FB 1DBAL 5J4MA 1JPTL 4F2FA 3CVIH 4KKCD 4Q6IA 2UXGA 2K6ZA 2O30A 2AJYH 3S3JA 1N5YH 3CDZA 4A2GA 2X70A 1CLZH 2H0FA 3LKQA 4LLQB 4YDLB 2VLJD 3QDGD 3QNXB 5DRXB 1YNKL 3F6LA 5HYSG 3CZJA 4W9KC 1YRKA 3ULVD 1MHCB 3IMSA 3PGCB 3X1BA 1WEJL 5F0PB 2WB7A 2DI9A 4WTZG 1QLEB 1TTAA 4YSAA 2NMSA 3AU0A 1RXLA 3WNIA 3PABB 3HG1B 3O0LA 1CFVL 5AL0A 3C09B 4I89A 2YKLH 3MNVA 3HC2A 3H4FA 1GSMA 3SYQA 5HI3D 2FBOJ 2P8MA 3E80A 4KVNH 3VZWX 4JFED 2OTUB 4QNPE 5DSCB 2GPZA 3Q2NA 1ZMYA 3LZPA 5EDXA 4DZ8A 4XMKH 4NBZB 1XF3A 1SMDA 3TCLA 5T5FH 3MRFA 2AMGA 4M5ZL 1AHWC 1NBCA 1LP9A 1T1ZB 2XY2A 3F12B 3PG2A 3QJSB 3O6FB 4UV4L 1D5XB 5FM5O 1RFDH 1MF2L 2DLFL 4WZ9A 3D2UA 5D1XE 3BHBB 2VDPB 3S4SA 3TURA 2JXMB 4R4BA 2IGFL 1XGTB 4KH2A 3IAPA 3QI9D 1ZLWK 2DWDB 3DECA 4ADIA 3HC4L 4MLSA 2N2LA 4OM1H 2RFXA 3P9MA 1UYWL 4KRPD 1KN4L 2X4QA 3EO0A 3VJ6B 4YDZA 4YC2B 4NUJA 3IGFA 5L8KB 4LCUB 4MHHG 3OJDA 2V5TA 4GP4B 4Z3GA 2Y7LA 4P5KB 3TESA 4J27A 2OFQA 2BHYA 4UYPA 3FTGB 3HZMB 3QCTH 4FL4B 2LAAA 5KOVC 4N2OA 4TVSa 1YLBB 4DP6X 1XEUA 2CGYA 1E6OH 1NGQH 2UY7A 3LPPA 5CN2A 4PM1A 2IFFH 2N2MA 3FKUS 4NQUA 4IOSD 2LU3A 4PRDA 5DEFB 1N2RA 4B9GA 2ODIA 4FS0A 4OCYH 5H4ZA 4N59A 4P9MH 1H9VA 4ONFH 1NGYA 3V4PA 4G5ZL 2OXGB 4O02L 2BZCA 3TA3D 3VSQA 2BZDA 2X4PB 4OZIA 2D3NA 3S3PA 3TV3L 1BAFH 1BOGA 5IVXE 1WYJA 1XF4B 5KSVB 3RVWC 5I8EA 4JPQA 4DOHB 2BNRE 3PQYD 1TU2B 2A7BA 5J1SC 1IBGH 2GBTA 2GJPA 2YRZA 3QJRB 3HNVL 2HTKD 4G8EA 1Y6MR 1TJHH 4HUVB 3PWNA 2NY3B 3F5WA 3OM3B 5IESL 3QG6B 1QHQA 4Y5VB 1XH3A 4Z6AT 4M6OH 4MQTB 5DVLA 1D5IL 5GHWL 5KSUA 5I19H 1KTRL 5E0FA 2NR6A 5G38A 3D39A 3MYJA 4O4XA 2NNXA 5AB1A 1AGBA 1BECA 4U6HA 2XTJD 2Q87A 1D3CA 2Y6SD 3NZ8B 1DFXA 5ADOH 4XCYA 4QWWD 4TV3A 3QUXD 4X6DB 4XN4A 4K9EH 2YFOA 3B43A 5IHUH 3UZEC 1K8DA 3QUZA 3QDJA 2ID5A 5FKAA 3ZIYA 3F7PC 3CXHJ 3L3GB 1A14L 2APWA 4FOZA 3FPYA 4PY8I 1AFVH 1SDYA 3EYFB 1BYNA 5DL6A 4UV7H 5D1QE 3AA6A 4JFHD 4W9GC 5EOCH 3EYOA 4AXWA 5CR1A 2NY2C 1EH9A 3MTXA 3CNKA 3O3EB 3Q1SL 5CCGE 1MN4A 2FX9L 3FYIB 3RKPA 1W0VA 4PTUA 1SOQA 4JG5A 5IFAH 1M71B 3CIQA 3NJGA 2VITB 1XF5A 4MDIA 5FM4A 3TPKA 4I7ZC 4LLWB 3PFQA 3AQZA 4M9OA 4OGYL 4JKPL 4OQTH 4KQ3H 4PBXA 3TBYA 4N25A 2J43A 4FI6A 1W72H 4L3EE 5GS0D 3QIUA 4C54A 2NSQA 2WANA 3DVGA 4HG4K 3SBWC 4UM9D 2VR6A 3NRFA 1UXWA 2XPYA 3DSFL 4BKSC 3D18A 1OSPL 4MNHB 1SRDA 4F7PA 1D7FA 4CADA 3T65B 1N8ZA 4ZJ9A 1RZKC 5TGBB 2IG2L 4F8QA 2CIIB 3WTWA 2F1EA 4Z7NB 1SLUA 4YSCA 4OVUA 3CXHK 1R5VB 3N0PB 3DOSA 4TL4A 4LGRB 1FIGH 1V8HA 3IVKB 4ZFOL 5I1KH 2ATAA 1CBVH 2YEQA 5DC4B 3P4NB 1G7HA 4Y9GA 3SJVE 1WA0X 1RUKH 2CDFA 4P2OD 2KKQA 3D2UD 2D7TL 3W0WE 2R1XB 4NQVA 1EXGA 1YY9C 2D9QB 2KBGA 5BOZG 4HKXB 4JANB 1FL3A 1TZGL 1NDMA 3X17A 2DDQH 4AIOA 4YHZL 4K07A 4FQ2L 2CGRL 4LF3B 5KUMA 3UG5A 2WVVA 3H9HA 2C3VA 2WHVA 2YD6A 4JQVC 1HHJB 4XPHL 1HXYA 4HX1A 4OFQA 1L3WA 4WKZA 5FDWA 1TKWA 5CAYB 1LYQA 3LX9A 5JDSB 4X5LA 3U7YL 3KH4A 2PYEA 4J3SA 5GISL 3ZE0B 1MI5A 1DN2A 3F7VB 3NMEA 4PJXA 4M7ZC 3G6JF 4ZI8A 3MRJA 4DSYA 5L4JA 5CEXB 2NZ9C 4ZPVA 5DFVC 1YPZE 2F54E 2HG5A 4HDIB 2FLBT 1MAML 2F1TA 4I2XA 2J1ZA 3BH4A 3EBAA 3DUUA 1F4XL 3BWZA 4GSUA 4JPWL 4MQ7B 2GK0A 4NO0B 3CXDH 3JWDH 5G3AA 3L95B 3MYZA 4N0YH 4DNLA 4DKEH 3TJHD 2CXKA 1OD7A 2JQMA 2LLNA 2PP8A 2V9UA 5K1VA 5L9DL 4OGXL 5DFTA 3MLVL 3LK3B 2M2DA 3GWJA 4PGDB 4J1UA 2E5EA 1SLXA 2P9RA 3QUYB 2R4OA 2R2BA 3GXDA 4HSQA 4G8GE 2V7HB 3S3CB 3K4ZA 4KV5F 1BVNT 1A8JH 5IHHA 2ZJSH 1OE3A 1AKPA 5CCJA 4CVZB 1IBBA 3QCUL 4JRXE 5T3ZH 3X3FH 5BV7H 1IKFH 1MRFH 4Z7VB 1TLMA 5GRYA 2FBJH 4BH7B 5AG8A 2VLLB 2N4IA 1K5NB 1Q9WA 3GB7B 3CZUB 4WWNA 3T0XA 4NT6B 2EXTA 3VQ1C 2VN5A 4JY4A 5CP3A 2ADYA 2JIXB 2BIIA 2XWBB 1IZJA 2YLKA 3ALWA 3B7TA 1AD9B 3U4EA 5BVPL 3CUPB 4M48L 4DEPC 2B9BA 1FGVH 1NCCH 1SEBB 5K59F 3EJCA 3BUYB 3ZO0A 4TNVF 2NR6D 2HTLC 3W2DH 3ZW3A 3ARVA 2MHLA 4IU2A 4NAJA 4G8FB 5F7DB 5B66O 2E86A 3KPMA 3EO1B 1IZNB 2EYRA 3ZDWA 4ELDA 4GUQA 5E99L 4JFQB 4AYSA 1WJ3A 2ADJB 4YDLC 5GJSL 1UKSA 3AFLA 1QPXA 4MXQD 4KXDA 3ZTJG 3NK3A 3QDJD 3EHBD 4AGPA 1XXDC 4XNXL 2V3EA 1IGYA 1AS8A 1QSEA 2AQRA 4NQDE 3V0DA 3VSUA 1PZAA 3VX1A 2WLKA 2FYYB 2K7QA 4JO3L 3SQBA 3IF1A 4JN1L 3FUHA 1KDIA 2HRHA 2UXVA 2P5WA 4HPYH 5CLWA 4M7LH 3AG2B 2D31B 1ZHBA 4L0ZA 4Q97A 5L6YL 3BQUA 3ABLB 1QLEL 1E3XA 4J4PD 4HCRA 2ZUXA 1IQWL 1IEAB 3LN5B 5EOQL 4IRJB 2XVKA 1M05B 3VD3A 1VPOL 1NGWA 1SN5A 2H26A 2EDFA 1T1XA 5EUOF 4YK4B 5C07B 2C9AA 1UB6B 3O6FC 4YFLI 2AERT 2NUTB 4IRZA 2WKGA 3QXWA 3NIGF 1A9EA 3CVCA 5F0LB 2WP3O 4KI5D 4XAKE 3QIUD 3Q2WA 4HXBH 3NFSL 4AI7A 2YNKA 3VDAA 1KTKE 3KBPA 1R0AH 3SDAB 1G7IB 4GUOA 4UAOB 3GINA 3IDIA 4JG1H 2XNAB 4EUPG 3VB9A 1G7LB 1JRHH 2DLIA 2VDPL 4UILL 3FZUD 2D0HA 1JE6A 1QWNA 3AG3B 3EYVB 4XO5A 1J0HA 3HMXA 3MFFA 3I50L 1G7JA 1EZLA 3MGOB 4MJ5B 3LEYH 3WE6B 4HALA 1TFPA 3U7WH 3FDWA 5FO7A 3ZXAC 4I48B 2WJ5A 4NQEB 3S3SA 1PQZA 4O51A 3A22A 4FL4C 4DP9X 3ZKXB 1P4BL 3O3BB 5KVDL 1EAPA 3K8MA 4BK5A 4Q7DA 3CQPA 3K2UL 2X4NA 1F8TL 3MNWB 1FHGA 1EEUA 4ISVB 5E8PA 3C6EA 3TNMA 3BEWB 3ESOA 5A2IH 1O7DC 1BZ8A 3RWCA 3RGVC 5G5DA 4GEJA 5F1IB 1DBJL 5AVSB 5D6DC 2IXQA 3EO9L 4N68A 2AJVH 2PYED 3WY3A 1MI5D 5HGHB 1OT2A 5SX4I 1JYNA 4JDEB 1T1WB 3ESUF 1OSYA 1KY6A 1TQVA 4IL6O 2E9GA 2ERVA 1FG9C 4PCTA 4YWGL 5H2BB 1RJLA 5KSBA 2BSTA 3BZFA 1CGTA 1CGSH 2AXWA 5H2FO 4HS8L 4WNQB 5DA0B 2AEWA 1MRCL 2ZKMX 1NH6A 1WBZB 3HNTH 4WI2A 2KC0A 4Y5VC 4TUUA 3ZJAA 4DTGL 2RIKA 1HHHA 3BWAA 3EGXB 5DYOB 1F3JA 1EO8L 2GY7B 3APMA 1H5BB 3EW3B 3IBOA 3SKMB 1OPGL 2M1KA 3PHAA 4H20H 2XPGB 3MRKB 3A6OA 4JHBA 3IFPA 3PGFH 5AW9B 1VGKB 2YEZA 2J1XA 4JFZH 5GRZA 2AF2A 2OTWA 2UX6A 3LKOA 3DX2A 5J0BA 2FO4B 1G4MA 1W15A 4H26A 3WS6C 3WJMA 2MNJB 2JJUA 1N59A 3HWBA 3WIFB 3RQ3A 1BBDL 4WO4B 3UMTA 4OD1H 1NUNB 3UBGA 1KJ3H 3R0NA 4UTAH 1WF5A 3N6YA 3S5YA 4WTWA 1K6QH 2CA4A 1IAKA 4M6AA 2X42A 5KN5A 1CR9L 2OJEB 3UIZA 5D7IF 3ZE2B 1BGXH 4HKBB 1KFAH 2O5ZL 3DJRA 2HFEB 3SGDI 1SMOA 1YVLA 3CSTA 4DW2L 2Z7YA 3SZDA 2R69L 3FUEA 4G6MH 3CQFA 2IH3A 3TNNA 3MA9H 1AGDB 1A7QH 5F8RC 3WNMA 4QGTA 4XCCH 2HA1A 4K15A 4NKOB 4FRWA 3UIYA 3TFKC 2EVJA 3D9AL 1BXWA 1HCFX 7FABL 5JW3H 2WXMA 1I3GL 2K3HA 5GRUH 2X38A 1FC1A 4FXKA 1P1ZA 2NLJA 1ZHNB 1CXKA 4XGZB 2R9HC 4H8VA 5I8KH 5LG6A 1CDBA 2GSIA 3CZLA 4PJ7F 3WELA 5JDJA 2G60H 2DQEL 2P5WD 3N42F 2WXFA 2ZCKL 4MNGB 5CBAB 1O7VA 3CHPA 4F1SA 1J87A 4X4YB 3BQUD 1J9SA 4XVJL 3O6ML 5T1KA 4NO2A 4AW7A 3TP4A 4HAGA 4FI7A 4RFOL 3DVNB 2TAAA 2I9TB 4X9GA 2FEJA 5IK3B 5DU7A 1AY1L 1WPCA 5CEYB 4AKRB 3RHWK 1W8NA 2HFGL 4ZFGL 2JB5H 4LARH 1GGYA 3ROLB 3UTPD 3APDA 4F7CA 1KCWA 4HIHB 3ZN6A 4DFIA 1USZA 3BZDA 5I30L 3D85B 1IARB 1OAZL 3INOA 4HWNA 4KBPA 4U1MB 3ARBB 4OLUH 1QATA 2R29H 2L7UA 4PG2C 4RZCB 3TS8A 3KPOA 4MVBC 3JV6A 4UIMA 2DN7A 5DZ9A 4TUOA 1TQCB 5DD5L 3D0VB 5AWNL 5I5IA 3ECWA 3H55A 2J6EL 2WVUA 3J07A 3B5HA 4GSRA 4DVRL 5C8JA 1DZ0A 4I9WE 4YIQB 5LN8A 5FC9A 1ZV2A 5F9JB 4D9LH 1DFBH 4QYAA 1SJHA 2G5RA 4A6YA 2FRGP 2NY5C 3DGGA 3QHTC 4CKVX 3QRFM 2HJLA 1Q1JH 3WS3A 1XR8A 5T5NG 1GIGH 5CUSH 1VSCA 3QJOA 3SPIA 3IPEA 3P02A 2NY5L 2SODB 4HCFA 1CJYA 3CH1B 3JTTB 3EOBB 3GGWB 1MCCA 1PSKH 1GGTA 2F8VA 3WUZA 3O81A 3PYCA 4Y1AB 3WTYA 4HMCA 4N3TA 3VXQB 1HZKA 5EIIA 3OD3A 3QUYC 2X4RA 2EKSB 2BHFA 2KERA 3FAWA 1ZA3B 1UH4A 3GBEA 1G43A 4W9ZA 1R3JB 1U3HA 5EU6B 2BP8A 4X6EA 4KKLD 4H8WL 4V33A 3AM8C 1XVSA 1JD9A 1BMWA 4DGUA 3AA1B 4AK1A 3BFWA 1A7NL 1MFEH 3BS0A 4K7PL 2AQ2A 2BERA 3U9UB 3I9GH 4M00A 4Q2ZA 5DK0A 3T5WA 1UUNA 3GPSA 4HKJB 5D1XA 2AMUA 1I1AA 1QMUA 1WWAX 3GZPA 4PBVC 4WI0B 5IBUG 3WOVA 4TRPL 4DOHE 3F84A 2O4EA 5DUJA 3UJIL 2FEDD 4ZW7A 3FW6A 4PPTA 3OMIB 3ZHLA 3REVB 1OTSC 4JQIL 1S3KH 4AG4L 1DE4B 4R7DB 2X2HA 4BFKA 4O9HH 2NXZD 2CJUH 4FFZA 3QEHA 2X28A 3LK2A 1GGIL 5FF6B 5AVTB 1LVEA 2CRIA 5IM7B 1SBBA 4M61B 1U3YA 3CZFA 3PHQA 3MRIA 3MO1A 3MRHA 4X6DE 3BLPX 3BKJH 2DH2A 5DC2A 1R3IL 1T0NA 3W82A 1DTUA 1CIUA 3QEGL 5IGXH 3GMRA 5FR3A 5HYEA 5JOPD 1EDQA 1TZIA 2FX7H 3H9SB 4JO2H 3BT2H 2OMXA 1OL0A 1KXHA 1CL7H 1KBVA 4UNUA 2O72A 4HIXH 3RL2B 3QVAA 4XC3H 1ZA6B 4ZPTB 4ZDHA 1DVZA 3M17B 3U9PH 1OO2A 1EV2E 4IRJC 3QIWA 3BSHA 4OT1H 1YNLL 1SUJA 3KPQB 4QXWA 1WE5A 4NRZB 2R4LA 4FAAB 2P3YA 4JHWH 2VERN 1XF1A 5HYIA 5A7EA 5IVXA 1RKRA 5J5EA 2F7OA 2L7EA 1R24A 5BCAA 4BQBA 2BNRA 4HUXB 2WGXA 5FIEA 3KDMA 3DX9B 2ZKWA 4FNRA 2VLKB 4EBQL 2HKHL 3GXUB 2C7UA 2ZF9A 3SDAC 3GSUB 4X5XA 5FXCH 2XZAL 3PPSA 1Y6KR 5I75B 5T1KD 1I75A 3JV4A 4XXDB 4X6FB 5EZIL 4ZW3A 5I15H 3IAGC 2J21A 1FNHA 4MJ6A 4QTIL 4TTGA 5F7EH 4X99A 2H2PD 1QLRB 4L4VB 4YR6B 4PJAF 3TOPA 4H2AA 5I6KA 3F85A 3UU2A 5JHDB 3LMJL 5E1AB 4OAWB 3BC9A 1T66D 4D2NA 4FZEL 1P6FA 3HZKB 3QWRA 2GJ6D 1JWUA 4P0DA 1IT9L 1JNLH 4J3XA 4E41D 3HI1A 5JXEA 3V4VB 3JWNH 4HPOL 4ZQKB 4FF9A 4BWUA 3ZKXC 3AWEA 3RIKA 2V2WA 1HQ4B 5D1QA 1Z5LA 2VKWA 4POZC 2NXYD 3ZZSA 2P24B 4P5TA 5DFWH 3RGBA 3B7SA 5C0ND 2OMWB 3GLZA 1ML0A 4ANXA 2WUCL 4XZUB 4OCWH 2A6JA 4PW9A 4FZ8L 4CC1A 4AQ1C 4JGNA 1ZTXE 3IT8D 5FB8B 3UTSE 4KQ0A 1LQBC 5IKCA 3MOBL 4DN3H 5B8CB 4I3SH 4ORZC 4RRPG 1U91A 4ZAKA 2ZUTA 4MS8D 3WE1A 1EJOL 2A6DB 2XG5A 4QEGA 4XPGH 1KC5H 4YDMA 5T1DH 5HXMA 1MVFA 3E2HC 4PD4K 5J1AA 3K1DA 4IMLA 3RVVD 1ZS8B 1IKNC 3ZSTA 3MR9B 3HE7A 2FO8A 1U92B 2UWEB 4L3EA 1BVKA 3A4EA 4XCEB 1X3DA 3P77B 4QAWA 2GJRA 3PXLA 4JPIA 1UH2A 1VFBA 4QRPB 2H1PH 5DVMA 1UT2A