2W80C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 243
sequence length 243
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w80C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w80C01
3HOLA 2W80C 4AYNA 1YS5A 3PQSA 4AYEC 4O49A 3VE2A 3PQUA 4O3YA 5T5FA 4AYMC 2Y7SA 4U9CA 4O3XB 5EE2A 4O3WA 4Z3TA 4QQ1A 3KVDD 2KDYA 2KC0A 3HOEA 3UAQA 2LFUA 3VE1A 4O4UA 4AYID 4O3ZA 4O4XA 2YPVA 2W81C 3V8UA 4AYDC
chains in the Genus database with same CATH superfamily
3BWAA 2QQKH 4UTBL 1MPAH 2OMVA 4BKLA 4Y19E 3X13A 2BY3A 2ZXDA 4WFGE 1UYWH 4D0DA 1YCSA 1QI5A 1SDYA 4JN1L 3RHWF 4BV1A 3TVMB 5C7XH 1JPGB 4TVUA 3EJYD 2W0PA 1PFCA 1I7ZA 5CJQL 3ZK0A 2Y06L 2Y7QB 3ISRA 5EWIL 1N10A 1PF3A 4ACTA 3VXUB 4M61B 2WWNA 1P4LB 3BPOB 2GIXA 4JHZA 4R7VA 1B3IA 1F4HA 3VXSB 5KYXA 3I9AA 4PGJA 1GGBL 2BMKB 3R0MA 4OM1H 4BIKA 3SDDD 5EZOL 2ERJB 3DUSA 2P47B 3CUPA 1AZVA 2BSEA 3IDMB 3VI3B 1TYEB 1KLUB 4Z78A 4HU2A 3ZL4L 3QQ4B 1JZ5A 4PY8J 2X4QB 3EJUA 1JGDB 1VFAA 3LKNB 5DQJA 4TRPH 1U58A 3V0EA 5A2CA 5DC4B 4XO9A 4JFDB 2FB4H 1A2YA 2CO7B 3NP3A 4GXUN 1TQVA 2VXTL 3BSZA 4HQQL 3L3DB 4B0MB 1ZHZA 3QYMA 1KZYA 2P5WB 3HOGA 3VFRA 5CJBA 5I66A 4G3YH 1HWHB 1XO8A 3BLBA 5KVGL 2VDKB 3OB0H 5C0FA 4MJHA 3QDJE 5B4MD 4ISVA 4YAQB 5CZVH 1LO3L 3BH4A 4UT9L 1KEML 4MMXC 2F61A 4PRHE 4JFEE 4X9IA 2X9YA 3BO8A 3CLFL 4HWUA 5FFLA 3S4SB 4GSRA 4IRSB 4FKEA 4P2RD 3QRCA 3V5HA 1ZHWA 1EFXD 2YWZA 5H4ZA 2Z7YA 2CJTA 2OTWB 3LPOA 4JKWA 4OFIA 4PG2C 4DFHA 1FG2A 1LE9B 1BH3A 1XGRB 2F54B 1OAKL 5DLMH 3U6RB 1I1AB 3AITA 4RZKA 1KENH 2VAJA 4NRXA 3VD1A 4YXKL 2OW6A 2G75B 1YEJL 1JGEB 1GYCA 4QRPB 3CFQA 5AYUL 2A73A 5D6DC 5CN3A 4YXLH 3HAEA 3ZQWA 1U95A 4KVPA 3Q6GH 3F7LA 3K8KA 2ZKHL 4N5EC 5HY9A 4ZMQA 1R34A 2VXSH 2YEZB 3MA9H 4L4TA 4LLYA 4O00A 5HGAA 5K93A 2ZTBA 2WQWA 4HH9A 4PG9A 3MV8A 1CI3M 3ZMEA 2XSKA 1Z66A 2FZ3A 3SDCB 3VFUA 4IDLA 1ZANH 4M29A 4WEEA 3W0WD 3QUZC 1BZ8A 4KZEH 4IU2A 1KV7A 3SQOH 2R9HC 3GGWA 3SEPA 2ZXCA 2QMJA 4UQ2A 3OG4B 5IFAL 4PJ0O 2DS4A 4PJ9C 3SKNB 4JRXE 3G6DL 2Y0HA 2DQEL 1LK2B 2R23B 1AS6A 2X70B 1DBBH 2XYBA 2HTLC 1AI1L 3GB7B 2PTTB 3DWNA 5EC2B 4Z3FA 2ICWI 2OMTB 5FYLD 3T2OA 4AIOA 1TMQA 4GRMA 4GP4B 4BSVB 1XXDC 5B8CB 1MFCL 1LWRA 5CEZH 4JFHE 4R8WH 1N12A 1SHWA 4NIYE 1LO0L 5HJDA 5MENB 4NO3B 1IBDA 5CCGE 4G6JH 2VDRL 4HZLB 3LHAA 1BVKA 7FABL 1YA5A 1A14H 1TOXA 1HEZA 3H42L 4IIQA 4XVUC 1ASQA 1T6BX 2AJZA 1S7UB 3PDDA 2ATKB 3WCYA 1AGFB 4FZ8H 4JR9H 3TZGA 3VXME 4UDUA 4DEPC 1XSKA 1MQKL 1YYCA 2YBGA 3VDCA 4MAZA 1AFVH 5KSAC 1BFOA 1F3DH 1TEGA 3GJEB 3N43B 5GS1C 3KBHE 3VGHA 1S9YA 2J8OA 5E1AB 2OA9A 2WZAA 1N68A 3GS0A 5IQNA 3QI9C 5CKAA 2P1YA 1RVFL 1NCJA 2EABA 4DCQA 4YFEA 2BNUA 5D5MF 4APQC 3HNSH 4A7QA 4CMMA 4E9YA 4GIOA 2IDQA 3BAEH 2BP0B 4EN2A 1EXGA 1PLCA 3NFNA 3LEVH 2QHRL 5D5ME 5I1EH 2XIIA 3S6CA 5C0DA 5C0AE 4EAEA 3S9DB 3ZZ1A 4C59B 3KLSA 1U21A 3VCLB 4ANVA 1ZD6A 1HNFA 4XP1H 4BYHA 1X4YA 5D1QE 3NJKA 2LHFA 4WHDA 4OZIE 3GSVA 1OSZA 4AJYV 3U4AA 4RA0C 3QXWA 2ENQA 3ROLB 2K3HA 2HH0H 1XH1A 4ABUA 5HGGS 3CSTA 2AKRA 3QPKA 4ZO9A 3HB3B 5FX3A 1U8HA 3S5LB 4G9FB 3D2UA 1YAZA 4Q4IA 1MG3C 1WFMA 2EYSB 5CZRA 2Y7SA 4FQLH 4PD4K 3V0WH 2YR3A 2OULB 3PU7A 4PU2A 3SO5A 3NIDF 4AYFA 2A4CA 1BQRA 2VGLM 3F7QA 3W0WA 3NIDE 1OO2A 1D6EA 1Q94A 1RZKC 3DBSA 1QASA 5EIVA 2EUWA 3H4HA 4RGOH 1YEHH 3VWKB 3U2IA 2XTJE 4PD4J 1GS7A 2E27H 4R3SA 3TFKD 3HUJF 2R0ZH 2WJ7A 3FAXA 3QFDA 2GHZA 2H32B 5HDBB 3WFEL 8PRNA 2C3GA 3FUKA 5T3XH 2UYLA 3TZVC 1OCWL 2F53B 3HUJE 1T4KA 4F57L 5KJRH 3MXVL 3CVCA 3MLRL 4NNXA 5LNEA 2AJ3B 2DYRB 2VDKL 4MS8C 1R3LA 2D3LA 5BJTA 2FO1A 1T80A 1HWGB 1CFTB 4NZRH 4RFNB 1RIHH 2K7PA 3NFSL 4L8DA 4KZ0A 5GS2D 1OGSA 3SPIA 1S7VA 4PS4L 4S1DC 3GQFA 3S3PA 2AQ1A 1FLRH 2R1WB 1SQMA 3FUHA 2WM0A 2AK4D 3B9KB 4Z7QF 4XP6L 3O0RL 2CUHA 3D0VB 1DJIA 2NTFA 3DC0A 4NP9A 4RGMC 2QKIC 4WW2B 3MX0A 3WIIH 4UTAL 4AYMC 2W80C 2BY1A 4M7ZC 4Z7QE 1BVNP 5JIKA 1K4CB 4L8BB 2FX7L 1P7KA 5FAAA 4PI0A 1OGAE 3QUHA 3GXFA 3DX0A 1EJ6A 5IBTL 1FL3B 4KGJA 2IOMA 4NN7C 1ADWA 1Z9MA 4X4XB 4XN1A 2WPGA 5K39B 1S6NA 3L6FA 5L0QB 3IGFA 3N44B 3NEOA 1KC5H 2IAAC 2EH8L 1KPVA 2CHWA 3EJRA 4HUMB 3UTTB 4CVXB 4OSUH 5C0RL 3O41B 1KCSH 1KB5L 1HC1A 3C75A 5EUOE 5JW4R 3O6KL 4OIBA 4QXUL 1OD7A 4XBEH 4C83B 5L2JA 1QTPA 4ZNEA 3QHZL 3RVWC 1L0QA 4JFFB 3ZE2F 2APFA 1RIVH 1HKFA 4KQ0A 4PJ8C 4N8UA 4RMTA 4Y1AE 3QZOA 1VRSA 2VRAA 3ZE2E 3FFDA 2LVCA 3AQZA 1F3JA 3QEUA 3KLHD 3ULAB 3L3OB 4H8UA 2MEJB 5DFTA 1S46A 1V3KA 2GT9B 2K9UA 1MVFA 1IGCL 2ZXEB 4E42A 5FYJH 3BZDA 4OZ4B 2JKJA 1PLAA 4X6DF 1GA2A 5AVWB 2VNCA 3FU7A 4I3SH 4A55A 1T0MA 2BO0A 1J10A 4EI5D 2OMNA 2BIQA 1UCTA 3PL6B 4N6RB 4G8IA 4UIMB 4X6DE 4JZNA 5FGBC 3WS6A 1WYJA 2XPYA 5T1MB 4GXVL 3TT1L 3TH3T 5CFAA 3GHPA 3QAZB 1J1PH 1FYTB 1UZ8A 3A22A 3N9GL 1ZLSL 3VE1A 2Q76B 4JO1L 4LPTA 1B3JA 1R9FA 1DLFL 4RSYA 1YNKL 4U1SB 4BJLA 4YSRA 1N67A 5TE7L 2VIRB 3D39E 1IBZA 1E6OH 4YSPA 4RWYL 4WWNA 3D4YA 5I5RA 1Y7VA 2XRAH 3DHMA 4OVUA 5EBLA 4F8PA 4N5ED 2R27A 3GK8H 3Q5TA 1PJ9A 3FQWA 5E94B 2KQNA 2X40A 1KTDA 3B6SA 1QUNA 4L2LA 4ZUUA 4X42A 1PU0A 2JH2A 2QGBA 3S36L 4MMZA 1T0NB 4XCFL 5DR5H 1KV3A 4U49A 1CT8A 5A2JH 1UZ6E 1WFIA 4CN6A 5ANHA 3OWRA 1A5FH 2AK4A 2FO4A 3T0WA 1G7LB 3L9RB 1M4KA 3EGXB 1S9VB 3ARYA 3WLWC 3WIFB 5LWYL 2CK2A 3WGUB 2Q0ZX 3NACL 4F3FB 1BMZA 5EOTA 1H5BB 1KN4L 2H2PC 1KGXA 3QFJB 5IB1B 4DO4A 2CDGA 1XF4B 3T0XA 4OZFG 5J0BA 2BRRH 2X4RA 4K3DH 5JORA 1E5CA 2VLRB 1KPRB 3IE9A 1DN2A 1GMEA 3TN0A 2GJ6D 4DK5A 4HX1B 3RWFB 4B9ZA 2R88A 3OKKB 3KYAA 5I0ZA 1X5LA 4WRLA 1AXIB 2G9KA 4ELKB 1MFMA 1FZOA 5DD1H 1SM3H 3VGGA 3NJXA 4JO8A 5LAXB 1XBRA 2Y5EA 3BJ91 5C7ZA 3QUXC 5AWNL 1S9KC 1NUNB 3BX7C 3A4EA 4QRRB 5E6SB 1ZWIA 2D7TL 3IDYC 1K2DA 3L5IA 4GS7B 4UOQA 4KDTC 1JIBA 1WAAF 1CFMA 1ZHYA 3UO1H 3GS4A 5FS5A 2PO6B 1I9RH 1WAAE 5DI8B 1N18A 4HUXA 1GIGH 3IAGC 1XGPA 4R0LC 3O2DH 3SPHA 1YPZF 3KJ6H 4MMXA 1GPOL 5D7HA 3D12B 2F8VA 4M02A 1U8LB 1KCUH 1OHZA 1TJIL 2A9NH 2VMEA 3CU1A 3MNVA 1YPZE 4W9GC 1RLBA 1WZLA 4BH8A 3AGVA 3D0LB 1UWXK 4R4FL 3W57A 1IL1A 5DFWH 1LQBC 4YK4C 1CGUA 3EDDA 1F8TL 3FQUA 3KJ4B 2B77A 1KIUA 4PG2A 4XC1H 4UINL 5IMOA 2WN2A 2P48B 4XWGL 2IDSA 3V5DA 3ISWA 2DMKA 5D1XE 2MWCA 2B3IA 4DZBB 3NZUA 4Z5RA 1IBYA 4A2HA 5FB8B 5D6DA 4F15B 1QSFE 2DIAA 2D31B 4YQXH 1T7WA 4AYSA 2FGRA 2ERVA 3WY1A 3SDXA 3V8UA 4HF5L 3L7EA 5DHVA 3IFNH 5EIQA 4H8QA 1E9PA 2C4XA 4FFVD 3FU6A 4KKBC 4UAOB 1HH6B 3SDAB 2VJ8A 3V0IA 1MLBB 5GXBB 2AK1L 4F93B 1AANA 4EO5A 3QUZA 4L9DA 1KJ3H 1VKXA 5DGRA 4ZW6A 3NEXA 4Q14A 5FKPA 1ULVA 4WNSA 4WSKA 4UILH 4OLWL 2YPLE 4KV5F 5FO7A 1QUPA 4KJYB 5HJ3B 4D0BB 4DGWC 5I18L 1P7QD 3NJNA 4C56D 1IX2A 4ZMZA 2OR9L 4KV5E 1CZ8H 1U8KA 4OFDA 4PJ9A 2WYTA 2CK0L 3TONA 2E0PA 2O30A 3KNBB 3W9EA 2YN5A 1RXLA 2D8KA 3TZVD 4LRIC 5FPIA 4ZMYA 2DOCA 3WN5B 4JFXA 1F86A 2WVUA 2IANB 2FR4A 4WFEE 3K8LA 2VTFA 1QFWH 1SVCP 1AKPA 3DXAE 4UIKL 2R15A 3GXPA 2DN7A 1U91A 4XPHH 4FQ1L 1BPVA 2QSCL 4YHML 1YLBB 1NC2D 1SY6H 2J2ZB 3HLKA 4IEFA 4HXBL 5GZOC 3BWAB 4JQIL 5EORH 3KYKL 2OMVB 4BKLB 1KCKA 1U8QA 3X13B 5D7JD 5DQDL 4P46C 4PJAE 4QPEA 1TJXA 4D0DB 4XGZA 1I8LC 3TBSA 5IW6A 4ZTOH 3B7YA 4KHTL 3AXHA 4FQ2H 4X9GA 3IS0X 3DHJA 4V1DD 1INDH 5J1SC 4I77H 1I7ZB 3QC6X 2AJXL 1FUNA 2NY1C 5KSAA 3QXUA 1UD8A 5GS1A 3US9A 5KYXB 4P5TD 2GK2A 4KRLB 1N8OE 1D5BA 3KBEA 3QI9A 5CLWA 3DUSB 3A6CH 2NCEA 3CUPB 3RUGA 4XVSL 4CUCA 5BVPH 1YMME 5ID0A 5H4YA 4APQA 4Z78B 2CDEA 1LP9F 3KPOA 3DA3A 3S3DB 3MZTA 1VFAB 1LP9E 4U1NA 5DQJB 1U58B 3GDCA 1GGIH 2UY6A 3RWIA 5JXEC 3ULUD 4YIQA 2BP3A 1A2YB 1TVBA 4IK7A 3RVWD 3VMNA 4O2EA 5ANME 3H9SE 1CD1A 2ALWA 1GKOA 5B7EA 3VFRB 4BD4A 5I66B 1RJZA 4OFVA 2DQ6A 3MACL 1DP0A 1FNHA 5EZPA 5C0FB 3IDXH 5DVPA 4ISVB 3MJ8A 4HCGA 2CA4A 1U4FA 2DMGA 3EYSH 1VESA 5I5MA 4Y4FD 1P6AB 2IGLA 4W4OC 5DS1A 2YMTA 3BO8B 3POHA 2EKJA 4XMKH 3FTZA 1RIUL 1BFSA 2IBBA 4GAFB 3BESR 4LCVA 3V5HB 1UXLA 2DH2A 3OZ9H 1JGUH 2V8MA 3BAJA 4N0YH 5C3IA 3V7AG 1KCBA 3TBVA 1FG2B 2FYVA 3H6AA 4N2IA 3VXUE 5J11B 5ADXK 2FLMA 1P7QA 2X09A 4NRXB 3BDYL 4B3EA 1ZT4A 1T6WA 1D5IH 2COVD 3EYFA 3Q2WA 1ND0A 2A73B 1NIBA 5D8JL 4LXFA 3AGWA 4WV1C 3TZVA 3HAEB 5CLTA 5F6HJ 3NJJA 3QNXA 4ELMA 1U95B 5H2FO 3CFEA 5HY9B 2F5BH 5CP3H 5D96B 4NQQA 4LLYB 5HGAB 4L4TB 5A43C 4HH9B 4PG9B 1OTTD 2Q1EA 3MV8B 4G6KL 2GJZA 1HIML 1JUFA 2FZ3B 2NY0D 1E54A 4JFDE 4X5QA 3RGVD 3VFUB 4JNXA 2VDLH 5I9QB 1NC2A 3GEFA 4IU2B 3EHBC 4D9RE 2AJUL 3GGWB 4URKA 2MPAH 2P5WE 4WWOA 3UAJD 2FEDD 1T4WA 1TQBB 4UQ2B 2QKIA 4FQXA 3MJ6A 5JW3L 3QARA 4Z9KB 1V3LA 4QWWC 1AR2A 3PG2A 1JNLH 4W9HC 5GISL 4PVNA 1E9OA 2QPFA 4K3CA 1CLOH 5AVZB 3HHSA 4WTQA 5E08H 2F7OA 2OL3L 4GRMB 3NABL 1F6AA 5CIPH 1IFGA 5I28A 1DVUA 3MUZ1 4DGYL 3IKCA 4B9JA 2PP8A 4O2FA 4EN3D 3A6BL 2XN0A 4FFYA 2CMRL 2JKLA 5CM1A 1BVKB 2XDHA 3I3EA 2F54E 4YDMA 1IEHA 1HEZB 1UEYA 4IIQB 1ZDSA 3GS7A 1T83C 2D7MA 3NA9H 2AJZB 1TO4A 3CFCL 4H7VA 2XVBA 1I8MA 4QRPE 5F7KC 2KHAA 4UDUB 1R3KA 3ECQA 5DZAA 1GHFL 4PJ8A 3EJCA 3KPQA 1BFOB 2I24N 4NQSA 4AM0A 1A1NA 1KJ2H 1KLFA 1S9YB 1XSOA 1ACYL 2D7QA 2XFGB 2Y24A 4HEPG 4HLJA 4UM9A 4IGBC 4AMXA 4YHKH 3U30B 5A2IH 3RKDD 1FN4A 2CGYA 4QOKD 4DCQB 2BNUB 3SE9L 3VA2C 5HYIA 2YAPA 4CMMB 5I6MA 2KZBA 1FLTX 1NCUA 2JNZA 5E5MA 3HE7D 3NFNB 1JMXA 4XP5H 4M62L 4PVBA 2XTRA 2LTQB 4JM2C 4ZAKC 2V6HA 5C0DB 4CAGA 4MRCA 3VY9X 4YL9A 3ULVD 3QIWD 4DKFL 1OCCB 1W9XA 4E41A 1CF8L 1H3TA 3MRGA 1A7OL 5FGBA 3WG7B 1AR1B 4J3OH 4PBWD 1EO8L 3PABA 3TNNA 2XQYA 3ZHDA 2PW1B 4MNQA 4G7YH 1JPTH 2D03H 3GSVB 1OSZB 2IG2L 2X9ZA 5GJSL 4KRPD 3T2LA 4X7CC 3NAAH 3CPLA 2N7SA 2PTVA 4ZOEA 4IDJH 3MV9D 2AKRB 3GIZH 4FCHA 3FH7A 2VQUA 5IQ7H 5IUCA 1U8HB 1EHLH 5FGCB 1URIA 3SJVA 1KFGA 1KGUA 1LO2L 3D2UB 3MV7D 5DF0A 1NLDL 2VDNB 1IBGH 3QNZA 2MKLC 3OKDA 4LLWA 2NSMA 4KK5D 4AYFB 1CFVL 1GMIA 4DN3H 3BYTA 1QKZL 3WSQL 4P5MA 1QSEA 4Q9RL 1DLHA 4QRQB 3W0WB 2XE1A 2X4OA 1UQSA 3N43F 4JE4B 3CH8A 2B2XL 4WHYH 1D6EB 4XN4A 1Q94B 4PCTA 3PGSA 1EDYA 1ID2A 1KYUA 1ZTXH 4FGMA 5EE2A 3OPZL 4HBQA 4GFXA 4R3SB 3I9GH 3IYLW 2NXZD 4AQEA 1JWMA 2I26N 3SZKC 3QFDB 5DZNA 4B41A 2BS71 4LDOB 1DVYA 2UYLB 1T4KB 4I9WE 5I71C 2HJKA 4NNXB 4NUGL 5FCUH 1R3LB 2ZYSA 4Z77A 4LSQL 4N9OB 5IB3A 3MRKA 2MKWA 5D71H 1Q4NX 5BJTB 1RPKA 1YEIL 1E8WA 4JKMA 2HKHL 1JHLL 2XTLA 3B4NA 4L8DB 1J0YA 1S7VB 1DVFD 3PAZA 2GSGA 3O6ML 4UV4H 4CW1A 3TF7C 1FAIL 2FECI 3SE8H 1SN5A 3H2WA 5G4MA 2UZIL 2NTFB 3KL5A 1OWRM 2BNQA 2V0AA 3IDGA 3L1FA 3MX0B 1H6TA 1RFDH 1TQCB 3O45A 3QUXA 4G8AC 4KVNL 1OP5K 3MRHA 2AXWA 1P7KB 1M42A 3CVBA 4CKQA 1QW9A 2AANA 1W0VA 4G9FE 4KDTA 1IEBA 3LRMA 1BPLB 7PCYA 4KOBA 3L6FB 4MJJA 4J3XA 4FP8H 4RH4A 3GI8L 3GLZA 5EIIA 3VD9A 2GUYA 4BA8A 4QOKA 3L3IA 4R0LA 4K5MA 1KPVB 2F8OA 2GJRA 4WGKA 1BG1A 1C16A 3K72A 1FZKA 2EKSA 3AA7A 1WG3A 5J57B 1BYPA 5HDBF 3APFA 5ESVA 3WFDL 4X7FC 1H3VA 4JG0H 5L2JB 5IREA 5EDXA 1R3JA 5HDBE 1BAFL 5J1AA 4ANKA 5HDLA 2F53E 2X4UA 1L9OA 3PV7A 5FF6A 3FFDB 3QIUC 1AO7E 1OPGH 5E0QA 1F3JB 3QEUB 3GLEA 5AG9A 1SYVA 3S3SA 1J8HD 1MCRA 4E68A 5IKCA 3E9TA 5DT1L 3BFOA 1K9TA 4E42B 4WW2F 4LVHC 1A4AA 3RIFF 1UWFA 3AG4B 3JTSA 4M1GL 1K5NA 3FU7B 1F13A 1T0MB 1X5MA 2J71A 4WW1A 1WEJH 4G8IB 1EMTH 3MUY1 2APVA 4JZNB 3QJXA 1V8HA 1OP9A 4NKIL 3HG2A 4PJGA 4YVUA 4FQCH 3BJLA 4J1UA 4ZD3H 4Y4KC 1UZ8B 2NQ3A 3N44F 3WE6A 4DVRL 1DVQA 5DO2C 1P1ZA 3K6SB 4P4KC 4WFFD 5KANI 1WSST 3HS8A 1PG7H 5IIEA 1RLWA 1I3VA 3EH1A 3TNMA 3WTSA 2WZ6A 4LRIA 5EBLB 1CE1H 2B7DT 4MKTA 1PCXA 4V11A 5A2AA 5DC0A 4JG1H 3JWNE 3FQWB 3MCKA 2CH8A 4GY4A 4KNSA 5G3AA 1KTDB 1QUNB 3B6SB 4MD5A 4U1HA 5DVKA 4ZUUB 1E9QA 1HE7A 2YKLH 3PP4L 5B1KA 4MMZB 1COBA 3G04A 1CT8B 1WIPA 2F1BA 1TJGL 2P8LA 5FYKD 3PGUA 5B1JC 4YXHH 3VFMA 2M26A 3VXRD 2AK4B 2FO4B 4CILA 5GZOA 3HI6H 3ZDWA 5TE4L 4XOBA 2PR4L 4EOWL 1A65A 1UD2A 4P46A 3HG1D 2R2BA 1I8LA 2DLFH 1XD1A 3RP1A 4Y9BA 5EOTB 2PWHA 4M1CC 4OGQC 2NDFA 1ZLDA 3KH4A 1MJ8L 3U25A 1XGTA 2CDGB 4G8GE 2VERA 3KR3L 2E7LC 4MA8H 2X4RB 5JORB 1J8SA 2NZ9C 1KG0A 4L3CA 3TN0B 4J27A 4O58H 1BGXL 2DQUL 4KTDH 3VI4A 3VXOA 1E5AA 5LCVH 5DMYA 4L3EE 1FG9C 1KIPA 4MFHA 5FYJU 2VXUH 4LOVA 5IHUL 1FYTE 5HI3D 1FZOB 5FYKU 3B8YA 5BOZG 2ZJSL 2K6ZA 4R26H 3Q8BA 3QQDA 1MHHA 5JXEA 1ZWIB 1K2DB 4GKNA 2C3VA 3E8UL 5DL8A 3N41B 4FQQA 3ZYZA 3RBHA 4Z7AA 4OFYD 2JELL 4AE0A 1MIML 4HUXB 4AWJC 3KLLA 1XGPB 2JTYA 1U6AL 3D3VD 2Y36H 3CFIC 3FONA 1AG0A 2Z0BA 5EEXA 5CSGA 4MMXB 4YPGA 5HYEA 5F72S 2DQDL 4W4OA 1XF2A 3QJOA 3MNVB 4MJ6A 4BH8B 4AY0A 3BMVA 1ODAA 3QP3A 1WAEA 1IL1B 3UERA 4AVKA 3BUTA 3DSFL 3FQUB 1KXQE 1QBLL 1KIUB 3FHAA 3QFJE 3IGLA 3O81A 5F93C 4KMTH 5IMOB 4U31A 3DWOX 2ID5A 2ZXBA 3EF7A 3V95A 2VLRE 3IBOA 3NH7L 1TZGH 1UXWA 2CJUH 3T20A 3V5DB 1DBAL 2DWXA 1QX1A 1TZ8A 3O2VL 5G2NA 4Z5RB 5CU5A 3T04D 3IMBA 3G6JB 3GSRA 1DJHA 2N4IA 4WV1A 5HYJD 1TTBA 3SDXB 4A2DA 3L7EB 5DHVB 4OV5A 2WLZA 5C0BA 2K4TA 1E9PB 4Y2OA 5E4IA 2WXJA 3IWVA 3PWLA 1JG9A 4QRRE 5L6YL 3MJ7A 4P9ML 3QUZB 3NPZB 4XMLL 1VKXB 4NENA 3AWEA 4N86A 1W15A 4V33A 4KPHL 3ARBC 1AJ7H 4XPGH 5FKPB 4D8PA 1E2WA 3Q5YA 5FO7B 4J3OC 3F01A 1NCDL 5HSFA 2J6WA 4GRWH 4PJ9B 1U8KB 1MCKA 2Y22A 5J3HC 3QNFA 1EEUA 4C47A 5I1KL 1JYVA 3TASA 3W9EB 4XTRC 1CLYH 4UOJA 2VM9A 3BEWA 3TEXA 5C0CD 1TZOA 1CYWA 4JFXB 4DQOH 5BMFH 2FR4B 1UGKA 1ZT7A 2I32A 2EACA 3GINA 3B9VA 3VH8A 3S48A 1U91B 5HVFB 4BEIA 1OWWA 1RAMA 4GJTB 1OSPL 4IEFB 4LK4A 3RY4A 3ZLQC 4BUGA 4XOAA 4L48A 3IJ7A 4XCEA 3B7RL 4O9HH 1T83A 2D9CA 4XGZB 4AL8L 4P59H 3TBSB 5IW6B 2SEBA 2VN7A 2XZAH 1KB9K 3G3LA 4FMKA 1N6QL 1OVZA 1Q1JH 4QRAA 3U7YH 3SGDI 4DEPB 1UWGL 5ICZA 3LS5H 4M43H 3UGUA 3S3BB 5KSAB 3UBXI 3PP3K 3QHFH 4NZTL 3IVKA 5GS1B 5EO9A 3BUBA 3BZEA 3CIQA 3KS0J 1VHPA 4IGBA 4K73A 5I1HL 1E4XI 1D5BB 3QI9B 5CD5D 2YKKA 2OK0H 3GJFH 1KB9J 3RUGB 1AYOA 5ID0B 1EXUA 3CC5A 3PF1A 3JVFC 4APQB 1NQBA 4H0GA 2CDEB 4X8XA 4GYBA 3KPOB 5D4HA 4OLXL 3VTAA 4FZEL 1F4WL 4JM2A 4ZAKA 4OGXH 4U1NB 1ZLVH 4QHKI 5DS2A 4K5NA 3RWIB 5AW6B 4LCYA 4YIQB 4DP1X 1TVBB 4CSTA 2BK8A 4O2EB 1KTJA 1WFUA 1CD1B 4GFTB 3ABZA 3SQBA 1IVLA 2IANE 3AU1A 1HZLA 2V2WA 5AVXB 3D4ZA 1RJZB 1P6WA 3O8XC 3KPPA 1G6RL 3LXCA 3ESNA 1ZLUH 5FA3A 3R19A 4Y1TA 3MDJA 3MJ8B 5JHBA 3ZYJA 1BFTA 5L88H 3AADB 4XCYA 3UXFA 2K8MA 5EG6C 1OT1A 2JTDA 1FE8L 3O2DA 3QRLA 2Y2YA 1GFMA 3BUPA 1HOEA 5DS8A 1BAGA 3CC1A 1XSJA 1NWPA 3TBVB 3WUZA 3BRFA 1WHPA 1AS7A 1Q9GA 4BRVA 3D7PA 5IBUG 2RR3A 3P3TA 3P30H 1YYMH 5DZJA 1P7QB 5GGRA 2YO3A 4XAWL 3MXWH 4DHLA 4EZMA 1QRNA 3V4PL 4WSJA 1A8ZA 2WUCH 1PIFA 1U2CA 1ZT4B 4PR5A 3EYFB 1ND0B 4S2SA 1BXAA 1CB4A 3TZVB 4ELMB 4OCYH 3QNXB 4ADJA 4UOW0 3VQ1C 1PCSA 3CFEB 5D1ZC 2HMIC 5KZCD 1S7WA 2GJZB 1JUFB 3NJIA 3FB6A 1W80A 2Z9TA 1NC2B 4NP4L 4TLTA 5DLLA 4WO0A 1HEHC 3LSOA 1JHKH 1RSYA 2BSTB 2HAZA 2I69A 4RGMB 2QKIB 1KCRH 4FQXB 4LP8A 4ZOCA 4RDQF 3KZ8A 4M7ZB 1TEFA 1OCZB 2XWJA 3NRQA 4TTGA 1UJ3C 2KQMA 1E9OB 3BKYH 1FGNH 1CFSA 2DYPA 5F0PB 4K7PY 3HHSB 2R4NA 2X4TA 4NN7B 4OLZH 1FL6A 2NX5A 1F6AB 4NQVA 4FX5A 4P2AA 4PHZA 2V2TA 3QR1A 1XGUA 1MHPH 5F89B 4HLZH 2HFEA 2O5YH 3CHSA 3IKCB 4FNPA 4Z76A 2EIBA 1SHSA 4ZS7L 4EBQH 4DUVA 4KHXH 4GSXA 3LMJH 2R1YA 2FWOA 2HFFA 4LPWA 2ZCZA 3RPBA 4A2LA 1HYSC 4Z7NE 3ERXA 2J4WH 4L0YA 1PNDA 1RZFL 5EA0L 4ZXBC 4JRYE 4TVPH 3SSGA 3VFTA 1I8MB 1SY6A 1W8EA 2KYIA 3P2BA 5IVXA 1NFDE 1R3KB 4BXVA 2OJZH 4PJ8B 4G70B 3CVDA 5LGJA 3KPQB 1J8RA 5G5DA 5FIEA 3QIUA 2UVEA 4NQSB 1A1NB 1EA9C 1KLFB 4L4TE 4AM0B 4UM9B 1ZA3A 3KEHA 3MV8E 3BFWA 3MROA 4GUPB 2VN6A 1MPFA 3UFIA 1FN4B 1JZFA 4MQTB 4LNVA 5DTFA 4ZZKA 2K0RA 1KBPA 1F56A 4J3VA 1NFIA 3BWUF 5E5MB 5KVEL 2LU7A 2V5MA 3POCA 2IWEA 4U2YA 3UABA 4DP2X 1G90A 3IMRA 3MVSA 4G82A 4E41B 3MRGB 3GHEH 1UFUA 1E4JA 2VN4A 3INOA 1TTUA 3BH9A 3PABB 3ARWA 1FV1A 2F7IA 3TNNB 4D94A 1B2WH 2EDKA 4MJID 4MNQB 1OSYA 4Y4KA 3ZT5A 4AZ8A 3RIAF 3KWWA 2H1PH 4XNXL 2AJVH 5JQHC 4P4KA 3SPCA 2Z91A 3FQ1A 2EVIA 3CPLB 3UAFA 3NSGA 4KROC 4QRTA 1BSIA 2V9UA 5AOMA 2X53A 3FOLA 4O49A 1L9PA 1E7UA 2B0SL 3VGDA 4ADIA 3SJVB 2WJRA 2HJLA 2EDHA 3QNZB 3NJMA 1LO5A 3OKDB 4LLWB 3BPNC 1MKFA 4S1QH 1EZLA 5I8CA 3WUWG 2EEFA 1FORH 2ZUXA 1QSEB 3JSSA 3AMKA 1DLHB 1NH6A 3MNMA 4P5MB 1C5BL 3A21A 4JGMA 2YD5A 2X4OB 1UQSB 5TFSH 4UCFA 5B1JA 1SBSH 3UTZA 1X7TA 3IDNA 1MOEA 2D4FA 4KKLC 1C9SA 3ECVA 5DHYA 4QJ4B 2OCJA 1MCOL 4AQEB 1U3HD 3QEGL 4WF7A 1JWMB 3KE0A 4X9YA 3FUIA 1GVIA 2ZX5A 5I0WA 2HJKB 4XTRD 2D0FA 2E7LA 4Z77B 2OMWA 5IB3B 3MRKB 4L1SA 3NDYE 2BOBA 4MGXA 5CZXD 1E6JL 3VU1A 1X44A 2XYCA 5K33A 4TNFA 5F96L 5CP3A 4CW1B 5DJXA 3SDYH 3WUWA 1J0KA 5JYLA 4YSEA 2A77H 2CJSA 5LDSA 2Q8AL 4N8VG 3X14A 4TNGA 5BNXD 2BNQB 3IDGB 2B5IC 1YO4A 2MQ3A 3QUXB 3O45B 4L4VD 3FU5A 5DD6A 2FATL 2J1YA 4TSBH 2B15A 3MRHB 4GW1A 3MLSL 3U0TA 1RZKL 3PLYA 3NCYS 3IDYB 3BIBX 3I9IA 2Y5TA 4MJ5A 5FGCE 1RZJH 1W0VB 4NUPA 3SBQA 1IEBB 4GMSH 2G2RA 2VXQH 3VGFA 1T0OA 4Y9EA 3IDJA 3JT0A 5GZND 3VYOA 5TQ0H 4P2QA 4DAGH 5E5RB 1NCWL 2K3TA 5CJOL 5EIIB 1BAWA 3PHOA 5EBGA 3T0BA 1HI6A 4QOKB 3SPVA 3D18A 3L3IB 1G43A 1HCZA 4GHBA 4R0LB 4G1EA 1PZAA 1C16B 5CIPA 3LB6D 3K72B 5C08A 1FZKB 2NYYD 3DIVA 2QLYA 2EKSB 3AA7B 3GMQB 3PDGA 4UB0L 3V0HA 1C1EH 1DJGA 2BS8A 4KXCA 4XP9H 1ZK9A 2QQQA 5ESVB 4NRZA 2EXWC 1AD0A 3US0A 1R3JB 2GBUA 2J88L 5J1AB 3FRPA 4JM4L 4YK4B 4K3JL 4TLSA 2X4UB 1GC1L 4LLQA 5ADXL 2Y3NA 1BQUA 5E7FA 3UACA 3PAYA 4X5LA 5FF6B 4JFYA 5DVMA 3ABGA 5I15L 1IKNC 4HS8H 1UOKA 1DVSA 3TV3L 2Y3AA 1XZ0A 4NQXA 1IC5H 4QNPF 2KZ1B 1SYVB 4PRPD 3S88L 2QZQA 4JO2H 5IKCB 2WVVA 4CC1A 4RMQA 2E4FA 1KJ2A 3NIGB 2W65A 4ZFQA 2Z65C 4XWOC 2J55A 3N1PC 3FN9A 5DQ9A 1FP5A 4I3RL 1FFTB 1OF0A 3KXFA 3JTSB 1K5NB 5EOCJ 35C8H 1IM9D 1WPCA 4CVUA 4WW1B 1SBBA 1CK0H 2X2YA 1CU4L 2OMZA 2E9GA 4PJGB 1DSWA 3HBPA 4RGND 1NAKL 2EEBA 4J1UB 4TS6A 3V0FA 5AKRA 4YFDB 3ARBA 3N42B 3WE6B 3FYIB 4AV4A 3WEOA 2AXJA 1P1ZB 4JFWA 1CDBA 2K45A 2QQKL 2ZPKH 1MPAL 2PYEE 5IIEB 5CN2A 3T0EC 1UYWL 4HEME 1PPIA 1IAOA 4PJ5D 1E3FA 2JKTM 3VD4A 3QZMA 3TNMB 1KGIA 4J2QA 4DJMA 1JSYA 4OY9A 1FFQA 1IT9H 4F2ME 5F6IC 5T5FH 1SYSA 4DUXA 4UBDC 1CWVA 3MCKB 4U1HB 5CNHA 4MD5B 4GO8A 1JAEA 2ZT9C 4ZNEE 4U6YA 1LM8V 1E9QB 3MRRA 5DJDA 3RL2A 5T33H 2FGZA 3C6LD 3ENEA 1B4JH 1MZYA 3G04B 4OM1L 2QDVA 5AVQB 4NFCA 3VFMB 2JLPA 5ICXA 1QOKA 2C9RA 4M6AA 1CTNA 4FABL 3FUNA 2R2HA 4Q2ZA 1S2EA 3K8MA 3MODH 4Q4EA 4P46B 4M3KB 2R2BB 4IHOA 4XP4L 3ZQXA 2FX8L 2DQIL 4ZX6A 3LKQA 1HQRA 1AE6L 2VR6A 6TAAA 1XGTB 3RI5K 4AMKL 4G6ML 4K8RD 2NY1B 3WNMA 4JS7A 1KG0B 1MCPH 1KACB 2DQJH 3DX9A 4L3CB 3VXOB 2NY4C 3VI4B 4M6OH 3IFLL 1QFUL 4G3YL 3QDGD 4LVEA 3K46A 1HAWA 3AS1A 5I74C 1KIPB 1QSVA 3AG3B 3KYOA 2EIJB 3OJDA 4H8VA 3H3PH 3MMEA 3QJTB 2X28A 4XNYL 4ZO8A 3WKQA 3ZDZB 4MX7A 3N1QC 1OAXL 2PYFA 2YXVA 4H44C 4MAUH 1L9MA 3OMZA 3H55A 4RAVA 3QQDB 1KEGL 1MHHB 3IMTA 3NCJH 4P2OD 4UV7H 5E23A 1VERA 3FT3A 1WCBA 2WXQA 2P5PA 4GKNB 2C3VB 4N0CC 4FQQB 4B97A 1UTDA 1V54B 5A2LH 4FZLA 3NTCH 3Q06A 1JI1A 3O8XA 1NIAA 5CGYC 5DLML 1BXWA 1J0HA 1OQXA 3PGDA 1KENL 3IRPX 4P9HH 3FONB 4FLRA 4GQ9H 1N0LA 4CBPA 3I6LD 3P9LA 3FO0L 3SCMC 1I7TA 2ZLDA 2JMMA 4FL4C 4YPGB 1LDSA 1XF2B 1FI8C 4LVOC 1T6VN 3PWPD 4MJ6B 4Q89A 2VXSL 4UYQA 4MLSA 3VM5A 5BV7H 1B9ZA 3NESA 4ZTPL 3P9WB 4S1RH 3SY0A 4ZFOA 1W8NA 4WZ9A 4TOYL 1A4CA 1YMHA 3RNKA 1ZANL 3ETTA 4NNPH 3U2SA 4FHJA 4DETA 4PW9A 2FX9L 2YA1A 4FYSA 3BT2H 1RUKL 4HJJH 3GF8A 1UXWB 1WDAA 5I8KH 1WIOA 3SQOL 5FW8A 4X6BA 1JP5A 1T2XA 5DMGD 1K3IA 1RZ7L 3F58H 3D30A 4DUWA 5AFAA 2DJMA 2L0DA 3X3GH 5C1MB 3A4FA 4WV1B 3OR6A 1S4IA 1NBYA 1UA6L 4MTMA 5D1ZA 4OV5B 5KBMA 5C0BB 4NI3A 5IV2A 4Y2OB 1PNCA 3PWLB 3TBTA 3N41F 2Y07L 3QCVL 3HFFA 5E70A 1HU8A 3MJ7B 4ODVH 3TP4A 2MQCA 4D0CA 1RUAL 4NENB 2NNFA 1O7DE 3EHBB 3JYCA 4OF8A 1A6PA 4G6JL 1ZHTA 4KH2A 4D8PB 5J6HA 5CO1A 4YDIH 2EECA 2FUQA 2DICA 2PN5A 1A14L 2AXHA 5E8NA 2WQ8A 3EFDH 4F7KA 1UM5L 1GZHC 2QLVB 1TITA 2CBQA 4FZ8L 1S3RA 3C5SA 3OLIA 4JR9L 1UJ3A 3BEWB 2KS0A 2EIMB 1R24A 4LQ1A 4ODTH 1MXDA 3CXDL 1ZT7B 4YWGL 2K70A 2WAQA 3VH8B 4FULA 3BFQG 2O6FA 2SODB 5TD4A 4I8DA 3DETD 4XPAH 3UROR 2HPOA 2ZWNA 3T9WA 3G6AA 4M7JL 3HNSL 1S5HA 1JF6A 3BAEL 1Z5YD 2Y6TE 4OIIH 4M1DL 4XCEB 5DMIL 2YPVH 5FVNA 3LEVL 2ENSA 4ZXBA 1R46A 2SEBB 5IFJA 5T1LD 3SDXF 4KJQD 2BERA 3BEVA 5ICZB 4UQEA 2C26A 1O6SA 2O6CA 4ODUA 2VL4A 4GKOA 4TUUA 5KUKA 2O5ZL 4IKJA 2HFGL 3QRFM 2QEJA 3IVKB 2IGFH 4J28A 5EO9B 3O3AA 4LL9A 5C2BH 3EADA 3BZEB 2X4PA 1JYNA 4IGBB 1JF1A 3EAKA 2HH0L 1I9IH 3BP5A 4XC3L 1EXUB 1OAUL 3CC5B 1UATA 4KUCF 4MCZA 4WGVB 3S3JA 5LCVA 4JFZL 5E00A 4JM2B 4ZAKB 1YEFH 1IGIL 4XPFH 3V0WL 4LCYB 4MA7H 3DNKA 5DK0A 4JPWH 1CFQA 3W1ZA 1KNOA 3FQRA 3SQBB 1DDHA 3AU1B 4GAJL 1VAHA 2V2WB 2J8HA 3GBMH 3OC5A 4RGOL 4KK6D 5KVEE 1YEHL 5CJ5A 4XAKD 3K81A 1RZJC 3KPPB 1NFAA 5K9KA 5FA3B 4B60A 2GEEA 2O4EA 3CSYA 2R0ZL 5ABAA 5E56A 2AABH 1WZ1L 3OXSA 4XCYB 1H6S1 3VVVA 4FNRA 5T3XL 2V5RA 2VJ0A 4K9JA 4NKOA 4ES8A 5K1JA 3FCBA 4XVJH 2YXWA 4W93A 2WO4A 1Z9NA 2L3BA 3KCPA 5KSBE 4M5TA 3T0SA 1SLUA 5DS8B 3WJMA 4RCAA 1RIHL 4NQDD 4XNZC 2H9GA 4QQ1A 3FN3A 1CYXA 2E47A 1OQOA 3LS4H 4UT7L 3SGEH 2XVGA 1FLRL 1II4E 2DLEA 1GXEA 3DJSA 3RUGF 5BZXA 5GGRB 5LGKA 4ICXA 1JGLH 2W0LA 3GMRA 1QRNB 3MJGX 3T8MA 1N5YH 2YXFA 2C9VA 1OE1A 3NSCA 3WIIL 3AC0A 4I4WA 4PR5B 3RUGE 1IZKA 1V5JA 3QORD 4S2SB 5I71B 3B43A 3HKZA 3P2TA 4GCQA 5D5DA 1JD9A 1S7WB 3K1DA 2VZVA 2AEQL 4OF6A 3FB6B 3BP4A 4RX4D 1WLHA 3BGFC 1M3IA 4G5ZH 3U7AA 5IMKA 2AEWA 2Y1VA 4LLMA 2WO3B 3A4DA 3NVQA 2H1XA 3LSOB 3TCLB 4AV0A 1NBVH 5SX5H 2MHAA 3WNLA 2YSTA 2Z6FA 4J3TA 4YBQD 4YSUA 3KPSD 1BF8A 4E9WA 4MZIA 3BQUC 5JOEA 2XWJB 3LHPL 2JI1A 2VZ3A 2X6VA 2YD2A 1CICC 3LQZA 1CFSB 1ICTA 2DYPB 4HIIA 4JRLA 2DEWX 4N0UA 2DM4A 1RULH 5I1AB 2X4TB 3VY8X 1FL6B 2PXYC 1QW8A 2ZX7A 2NX5B 4NQVB 4X9HA 2V2TB 5MHSE 1XGUB 4HMCA 2HFEB 4Z76B 1KGCE 2YD3A 2FE0A 1BHGA 1L7IH 1JD7A 2LOEA 2R1YB 2FWOB 2HFFB 2JJVA 5GRVL 1HKLL 5ACLA 2AV7A 3U9PL 1RV6X 1WWBX 5DYFA 1JTOA 3D52A 4I3SL 4ELMF 3VFTB 5FYKL 5IVXB 3UOAB 3L4YA 4AZUA 1CLVA 2QGDA 4FQJH 3POUA 4E9RA 2YZ8A 4ELME 4Z1PA 5TF0A 2ZWLT 5LGJB 3KYNA 5G5DB 1A6WL 3LZFL 3QIUB 4KRNA 1IKNA 1ZA3B 3MROB 4Y9FA 2YD6A 1HDMA 4G11A 2EC9U 4N2FA 5DTFB 1DSFH 4WGWB 2BIIA 3QIBC 2GQHA 1QLRA 5D7LD 1THCA 5DJYA 4F7CA 4GT0A 1NFIB 3V9FA 1A9EA 4JKPL 4LVHB 4R83A 5HHXL 1E6OL 2WQXA 2X1XR 3GJFA 2BWIA 1V7MH 2XRAL 3W5MA 1KYDA 3GK8L 5DMJB 4AVHA 3L3HA 2YK1H 4K7PH 4DW2H 1VPOH 2EE0A 3QGVA 3G5ZA 2YAQA 4U7SA 1ZXQA 1OF2A 1KBWA 1FV1B 3O11A 4BUHA 3BKCL 3IEAA 3F2LA 1CLCA 4Y4KB 4AZ8B 4KITB 4TNVK 2VM3A 2YWYA 3AA0A 3KWWB 1A5FL 3D08A 4P4KB 2E8ZA 4WSGA 2Z91B 1YEGH 5IVZA 2H26A 4QRTB 2IEPA 3FOLB 4NC2B 3T0EA 5GRWA 1OALA 1DQVA 1LK3H 5AL0A 4QRFA 2HJLB 3WTXA 4P9HC 4RBPH 3VD2A 3CFUA 4E9VA 1LO5B 1H8SA 2BRRL 3L81A 4K3DL 4PWIA 5I8CB 2AQ2A 2QJDA 1BEYH 3IT8D 3U6XS 4G6AC 2E3VA 4Y2NA 4FG4A 5DYOA 1RSFA 3EYQC 5I82A 5E9NA 3WV0A 3EJJX 3UTZB 5BV7C 1OLZA 2D3NA 5KW9L 3GRWH 4NM4H 3B2XA 2I5YH 3IDNB 4WI2A 3T3PB 5DD1L 2LLGA 1MI5D 1SM3L 5DHYB 2KMWA 4X4KA 1EVTC 4JCWA 4GEIA 3RB5A 3UC2A 2R4RL 1SLWA 5H8DA 3MA7A 1NEUA 3QXAA 2OMYA 4FUVA 2OMWB 4W1TA 2UWEA 2IBZX 1JXKA 3CLEL 2BOBB 3WEAA 4C8XA 2VSKB 1I9RL 2BY2A 4N90D 3KCWA 1GIGL 4RA3A 3VXTA 5DJXB 3WUWB 3O2DL 5I0XA 2L7QA 4MNQE 4LSTH 4AK2A 5ALBH 2ISDA 3WMPA 3V4VH 4JKKA 3X14B 5FFOA 3TO4C 2VZUA 4PLNC 2VDLB 2A9NL 4AEHH 5FM5O 2N0KA 4GW1B 3U0TB 2K1MA 5T1JA 3IKKA 2BH0A 2GW5A 5F7LB 4MJ5B 3PQYD 5D72H 3SJVE 4FA6A 3P3RA 4PGEA 3FN0L 4NJAH 5C09E 2G2RB 4AX3A 2BCKA 2BHFA 3MI6A 4TQHA 4YSQA 4WENB 4WO4A 5GSRA 3IDJB 2Y7NA 4GBXD 5B38G 4P2QB 4PB9L 3V0AC 3BE1H 4EZKA 5JHDD 3PHOB 3TA3C 1HI6B 2ZF9A 4JY5L 3SPVB 3D18B 2H8PA 4G1EB 3KGRA 2DQHH 3C5OA 3OAYH 5CIPB 5C08B 3SCMA 3SOBH 4JG5A 2B20A 5HYSA 1E40A 4YQXL 3MGOA 1N59A 4WFHE 1DANU 1O0VA 3OJ2C 1TETH 3IFNL 2F18A 2HKFH 4NRZB 1AD0B 2APWA 3UG5A 3FRPB 5GGVL 4LLQB 1IGJA 1M1SA 4LIQE 2IOIA 2RALA 4GRLD 4XVTH 2OZNA 4JFYB 3FZUD 3BRZA 4HCIA 5J56B 2FNBA 1XZ0B 4HUUA 4NQXB 4UILL 2HN7A 3K2KA 1D7BA 4AVIA 2EILB 1VF5C 4Y1SA 3AJ7A 5F3HA 3P4LA 4NKMA 2WVVB 2E9WA 1CZ8L 1KJ2B 2W65B 5EFIA 2XN1A 2MQ0A 2V9RA 5HDQH 3T2QA 2KH2B 5DQ9B 4HIPA 3KXFB 4M8QA 4GKSA 1FFOA 2BNQE 4Y2DC 2NW2A 2ZIDA 2ODIA 3TJHD 3PHAA 3ZT6A 5I73C 1IIIA 2V4LA 4HK3J 4U3HA 5DUJA 3B2UD 2OMZB 4QEGA 1GFNA 5JZ7D 4XPHL 3WMSA 5KN5A 3ARBB 1OOWA 1SY6L 5AW4B 4AEEA 4N25A 4BM7A 2CAKA 3ZHFA 4FFWD 4YDKH 1L9TA 1OKEA 2KXPA 1FNGA 1OT2A 1B4RA 8PAZA 4O4UA 4S10A 2NMSA 1GZHA 1IAOB 2WXNA 3GEWB 4ZTOL 1QZNA 3B7TA 1J9QA 2DH3A 5CEZE 4I77L 2AAVA 3FQYA 1SYSB 3DOSA 1NAMH 1M56B 2X27X 3LEXA 3FU0A 2FHBA 4FFZL 2ORBL 1ZSDA 1VFUA 4U6YB 3GNMH 3MRRB 5DJDB 3RL2B 4O51A 3ZRSA 4DSYA 1XR8A 4CU8A 1L5GA 2OV0A 2VLKE 4ZO6A 5IZ7A 4GH7B 4NQUA 4PGCA 3EJPA 2F58H 4AIZA 4AV5A 1OSMA 5ICXB 5DJ8A 4OD3H 3U9UA 2CE6A 2DV6A 5DEZA 4KFMA 4MD0A 2R2HB 4Q2ZB 3WTWA 3I85A 3NIGF 1NIEA 1TQSA 1XAUA 4IHOB 1ET7A 4XH2A 2P8PA 1AKJA 5SWSA 1MG2C 1YG9A 3SYAA 1TTFA 3LKQB 5FUZH 1GGIL 1HQRB 3ARDD 4M7LH 4Y19D 1GTNA 4OGAC 4WFGD 3WE1A 3WFCH 1I3UA 3DX9B 3IGKA 4PJGF 1M7XA 3T24A 3ISYA 4BE6A 1AGDA 3FTXA 3N42F 3L54A 4PJGE 3IDXL 1EEYA 1ILSA 2MFNA 3KYOB 3MYZA 3OJDB 3EYSL 2ITFA 3PAVA 3MMEB 3W5NA 2QMKA 4PS3A 2CBMA 2X5PA 4MX7B 3UCQA 1DZ0A 2ED9A 2PYFB 3WD5H 2EDBA 5ITBH 4FESA 4XMKL 3UEZA 1AD9A 4RAVB 1RUQH 3QFGA 3DIFA 12E8H 4KR4A 3FT3B 1WCBB 3DWTA 4J3BA 5GS3A 1JGUL 4N0YL 5D7EA 1J12A 5BO1H 2F1VA 4PTTA 1J9SA 3F7RA 4MNGA 2EYTA 2VW7A 1XB8A 2DTMH 2BDNL 1MW1A 3VWJC 3O8XB 1BVOA 3X3FL 4WKZA 3PGDB 5LBSH 2NZ1A 4ONOA 2X41A 2VXQA 1N0LB 4KK8C 4I7ZC 5BXFA 2J1WA 3P9LB 4E5XG 1D5IL 1I7TB 2R0LH 2G3ZA 2PWDA 1WA0X 2CRZA 1SNRA 1FBIL 3QDJD 2QSTA 1CBVL 1QAWA 2VWEE 1BJ1J 1MREH 2G60L 2JCCE 4UTCA 2C3HA 4PRHD 1M9SA 4JFED 4Y16D 4ZFOB 3SY0B 3WO4C 4EXPX 4ZW3A 4XN7A 4LHUA 2XE3A 1MCLA 1N6VA 1YMHB 3O6FC 3IMVA 3RNKB 3U2SB 3KMDA 4QJ5B 3VI4F 2NT1A 4P05A 1ACCA 3D2TA 1XTLA 3P11H 4NN5C 4G80A 1THAA 4Z6AT 1FCGA 1HINH 2MPAL 4X6BB 3AB0C 3HC3H 4HYTB 4PWJA 4NOBA 1YJDL 2R1XA 2F7RA 4M5YH 2M06A 3TCXA 1XGZA 3ZDZF 1X6LA 1U42A 3T6XA 3OR6B 2MRYA 1NBYB 3ZTJG 1RMFH 3P69A 5E2VH 3K6FA 5D1ZB 1TJHH 4OKVA 4PRIA 1VFBA 5IV2B 3RHWK 5E08L 4MKMA 2B08A 3NG5A 3TBTB 7PRNA 1WGOA 5LGHH 4E9XA 4RISH 2Q10A 1ZOXA 2WCPA 4D0CB 3NFPA 4UZSA 4YSDA 5J6HB 3HMXL 3SOTA 3O4OC 5E8NB 2MNJB 4RFEA 1E3XA 3ABMB 3BQUA 3TH4T 3WY4A 4ETQA 1N6UA 1JPFA 1YECH 3ZY7A 3TF4A 1IAII 3C5SB 1UJ3B 5IB2A 4U4BA 4NQEA 1CICA 2A9AA 1QYGH 1R24B 2ODHA 5DFVC 2OX5A 2PXYA 2LFGA 3UTSA 1Q90A 1F18A 4FQPA 1FRGH 3FB7A 1U9KA 3Q6FA 4YHKL 5T5FA 3EH2A 3VRJA 3MTXA 2FVNA 3KBPA 3X1EA 4KQ3H 3G6AB 1A6UH 1QI3A 4JFHD 4H4NA 1S5HB 5IGXH 3POXA 2WXRA 5JQ6L 4MHHI 2JCWA 1EEZA 3NK4A 4XP5L 1K85A 4ZXBB 4ATWA 1ZT1A 1Z9LA 3A0OA 5IFJB 2CKBL 3MAWA 5KJ4A 1NGXA 4NYLA 1R3IH 5FDYA 3TA4D 4EZLA 3MGTA 2K9FB 3BEVB 2GBAA 5EOCL 4DTGH 1O6SB 4JO4H 2VMFA 4ODUB 1TQUA 2QADB 5G4OA 1OP3K 1U41A 3KM1A 5C0BE 2KZ7B 3APMA 2EVJA 2DKUA 1JPTL 3A5VA 2D03L 1LD9A 3O3AB 2R51A 2CHXA 2X4PB 1SEBA 3LXUX 4O5LH 4H8WL 2A0LD 2LW3A 4GCPA 4ZBJA 5FYJE 1JF1B 5BO0D 1UB6A 3BP5B 4L37A 3QIBA 3DLQR 1QO3A 3QK0A 4IDJL 3GIZL 2B1AH 1FH5H 4MCZB 5IQ7L 2YRLA 3A24A 2A1WL 4XXCC 2ICWA 4QT5A 4UNIA 1MAJA 5T3ZE 5ILTH 4JFSA 2W9EH 3AG2B 3H7BA 5G38A 2DEYX 3E8VA 4K15A 2BW5A 3FTUA 5FK9A 2Y4SA 5DK0B 3QO0A 4DN3L 1CFQB 1WZMA 3C5ZC 2OFQA 1E90A 4YSSA 4KUZL 1KNOB 1AC0A 1OTSD 4KDWA 2YAFA 3FQRB 5C0AD 1NKOA 3L2LA 5A2BA 1DDHB 1DFBL 4OQTH 4K94H 3B83A 5E9AA 4X7DC 4WVRA 3GBNL 3LN5A 4HC1L 5K9KB 3CZJA 1FHGA 5D1QD 4KROB 3I9GL 3CSYB 4E0RA 4AQOA 5BW7C 1NANH 3OXSB 1U8JA 3QG7L 1RUML 3FUDA 5JHLH 2YGPA 4NKOB 5HHNA 2HRLA 5FCUL 3BPNB 3KCPB 2WMPA 3BHBA 2PCXA 1OZTG 1JPST 5D7KE 3BS0A 2YAMA 3WJMB 4XB8A 2H9GB 4LEEA 4M6MH 4LAQH 4UV4L 2FTAA 4OLYH 1ZRUA 4K23H 3TBCA 4Y4HC 4ODBD 2AXTO 1USQA 2DJUA 2JIXD 1WGVA 1NMAL 3F6JA 3GMRB 3HPLA 1UFGA 4NLAA 2P8MA 2VISA 4ETYA 4FJZA 4I4WB 4LEXH 4XMPH 3BAKA 5CSBA 2XTJD 3GZPA 4DIXA 4JM2F 2EIZA 2VW6A 5D4IA 2X6CA 4BK8A 1LQSR 1P0SE 2ZXAA 2G2PA 3MO1A 5I23A 4JRXA 2ZP8A 2DL2A 4FOZA 4XO3A 3UC0L 3HZKA 5E99H 1CD0A 1FO0H 4FP8L 2DM2A 3GUTA 3BP4B 2Y25A 1XH0A 5IMKB 3Q48A 4LLMB 3ZTNH 1THQA 2A9DA 3FSAA 4IKLA 1K4DA 5TDOA 3BI9X 4HZAA 2XMXA 4PLOB 2Z35A 2MHAB 3QJVB 4ZFOL 3TO4A 4FXGA 2B5IB 4LGSB 2X12A 3PHSA 1TQTA 4KU1A 3ZDYB 3O3DA 1NGPL 3K2MC 2YD0A 1TCRA 2NY6D 5IUSA 3VU2A 3LQZB 1I1CA 4HIIB 4N0UB 3DO7A 4OGAD 4JVWA 4Q9BA 3HC4H 4GRWB 1JCKA 4FNTA 1VENA 1G1KA 3VXMA 2B14A 3CIAA 1OGAD 1NEZA 3LRSA 4ILDA 3FL7A 1IM3A 4KTYA 3TA3A 2XG6A 4QXWA 4H20L 4R4NC 2O6DA 4I0KA 3MC0A 1TYRA 2B9AA 2GTQA 1NKGA 2F8XC 3DJTA 2ICCA 3GZKA 3WBDA 1XCXA 1AGCA 3T0VA 2AV7B 3II3A 1AZZC 5GSVA 1QRNE 3WNJA 3NJGA 1WEJL 4TF4A 1EMTL 4HUKB 3TJEH 3V0GA 2XT1B 1WQVT 2IJ0C 1B0WA 2PETA 2YPVA 3KYNB 2MJWA 1IEAB 4FQCL 1A3ZA 2Y6SD 3IFPA 5AKSA 4ZD3L 1J1XH 2WZ0A 4DGVL 2GI0A 3F04A 4P04A 5EZLA 4LSFA 3WNOA 2RH0A 4H8PA 4Y1AD 3VWJD 2P3YA 1HDMB 1ORSA 1P4IL 2LE9A 4OZIA 5A6IA 1QLRB 1XCQA 5DJYB 4F7CB 2E7HA 1WFOA 4F8NA 3ATEA 2BVQA 5M94B 3S34H 1A9EB 1YNTB 5LG6A 3OGCA 2DIBA 4XB3A 2ZOKA 3JWNH 3GJFB 1CE1L 2FQFA 3FQNA 4JHAL 3CN2A 4Y2DA 1HT6A 4JG1L 2VLJA 3L3HB 3UP1A 2VERN 2YRPA 5DRXA 1FDLH 4KY2A 3G5ZB 1OF2B 3NRFA 2WK2A 3O11B 4PJXA 1Z9SA 2GVYA 2F2HA 2XC8A 3L3JA 4KJPC 4YZWA 1N19A 4LARH 5HYFA 4YXHL 2WIIA 5AOLA 3AA0B 4Q9CA 2NX5E 5A7EA 3HI6L 2FJUB 2VQ1A 3SY9A 4WUUA 3GXMA 3AQDA 3LDBC 2MCAA 5IVZB 2H26B 3BSGA 4YBHA 2VKWA 2M8XA 3T0EB 2DLFL 3GFUA 5FM4A 4X7TA 3ZTEA 5IVXF 5F6IB 5BVJA 4Q97A 3D39D 4NUQA 5I16A 2DQCH 3QNYA 5F7BA 1TUPA 4X5XA 3B5HA 5IVXE 3SPJA 3DX8A 4KTDL 1WV7T 5DYOB 4F33A 4IK6A 3D4CA 4N0RA 1AMYA 5B7FA 3QCUH 4IOIA 3F7PC 2VXUL 2V5SA 2GAZA 4GSDH 4WTZG 2A83B 2NXYC 2EXYC 4TQPA 4KWUA 2QFPA 1YNLH 1IU1A 1YY9D 4R26L 4GQQA 3FJTA 1KFAH 3KL3A 5F3FA 5CF3A 3C12A 1S9WA 2HX7A 5DD3H 1KBVA 3MA7B 3QXAB 2OMYB 4NM8L 4A7SA 3VG9C 4GUOA 2UWEB 3H3KA 4BQ9A 4HIEA 3H0TA 1QLEH 2NY4B 3P2DA 4R97C 2ATAA 3L7FA 1XZWA 2BIHA 3C5XA 5I74B 3VXTB 1JVKA 4AIEA 2Y36L 4B7LA 3I6KA 3APCA 3AM8C 1DBKH 4OT1H 4DGIH 4WI6A 4CMHC 4V2CB 2Z31D 3D48R 3MRMA 1KWKA 1EZVY 4HALA 1BZQK 2WVSA 1WITA 4KKCC 2J56A 1U8CA 3V4UH 4FTVE 4NPJA 5HXMA 3FH5A 4W9CC 5EUOA 3SE3C 5EZIL 5I6XC 2BFVL 1EEQA 5DL5A 3CHRA 4PGEB 1DHKA 4TVSa 1KYOK 3CBKB 1U8IB 3NZ8A 5GSRB 1X3DA 1YEDA 4FMFA 3ME0A 3VGBA 2CJUL 2VZOA 4LSRL 5L4FA 1FC2D 3ZZLA 2H8PB 2FJFA 3L4CA 4KZCA 3T3PF 4LDCA 3SCMB 1E4XH 5HYSB 4FL4B 1QWHA 1GL4B 1KYOJ 3MGOB 4LVOB 1N59B 3ARRA 5D2LA 2D7OA 3PCYA 2HG0A 2IAMD 1IGJB 2ZD0A 3HBGA 3O6FA 1G1OA 2PCYA 4PFEA 4XPGL 4FEMA 3KGTA 5F0JB 4HUUB 3VRLF 2HN7B 1RURH 1W0YT 5AB0A 2GFBA 5F3HB 1A6ZA 4NKMB 3GLAA 3VRLE 1CBJA 5EFIB 3WKML 4OJDH 2NY5H 5D1XD 2VDPH 1ET5A 5ADPH 2FIKA 4M8QB 1YZZA 4GKSB 3RAJL 2IFFH 1FFOB 1BBJA 2IWVA 4DQOL 1WK0A 1QQDA 2NW2B 3KGUA 1QSFD 3ZKND 5AG8A 4GT7A 5ADOH 4XMVA 2R0WL 4M9PA 5K59F 4U1IA 1ZHKA 3AW5A 5KN5B 1QSZA 2Y7LA 1PSKH 3AABA 4AYBA 2MHLA 4D9LL 1JZDC 4P2QE 5JR1L 5K59E 3IGAA 1JK9A 4L1TA 3ARZA 1JJUA 2KXPB 1FNGB 3VYPA 1OV8A 4JDEA 4K94C 2YPLD 4P59L 2V7NA 5C08E 4MA3B 2OMUA 2XZAL 4AQAA 2FEEL 3U7YL 1OSEA 2ITCA 3S5ZA 3DOSB 2EDWA 3LEXB 2O93L 2F1AA 3QHFL 1OANA 2X3BA 1ZSDB 4MXQD 4O51B 4FG6C 1XR8B 5IOPA 4ZPTA 4N9GA 1L5GB 2QSVA 4WFED 3UU2A 4PGCB 4AIZB 4IJTA 4BQBA 3DXAD 5DJ8B 3U9UB 1RU9H 1T04A 1G9NL 4MD0B 4G83A 4JMNA 2J5WA 2AFNA 4JPSA 3L16A 1T89C 3OWEA 3QDMD 4XH2B 2AMUA 2P8PB 1AKJB 5SWSB 4GP5B 5I0VA 2MCPH 3GRWA 4Z7UA 3LNEA 5JPMC 3SBRA 5CZKA 2OJ1A 1Q9FA 5I1LA 1FSKC 1XB6A 3KXFE 4UYPA 4KKAC 2ZUTA 4RIRA 2HLAA 3LK42 3PUCA 4LSVH 5KUMA 4PY8I 4JB9H 4MQXC 4F5CA 1AGDB 3HG4A 4OCSH 5C97A 3DMMD 1BQLL 4J3OF 5GGSY 3RWDA 2DQFA 1EEYB 4XPTH 5ALCH 2DDQH 4K9EH 4YHOH 4HD9A 5FKAA 4JPIA 4IBZA 4MD4A 2UX7A 4XXCA 3GD1C 1A66A 2YEVB 4ONHA 1YMMD 2PP9A 1AD9B 3BD5A 3DIFB 3VWKC 2OQJA 2IQ9H 5IYUA 2NY2C 3BVDB 4N2OA 3WFBL 3T2PA 3C5ZA 3DTDA 1ODUA 1EDHA 1JYXA 3Q13A 3NEEA 4OLVL 4RETB 4UDTA 3QJZA 3ZX1A 5DRNA 4PTTB 5I6OA 3FTGA 3GKWH 3J07A 1EIBA 2EYTB 4MNGB 1SOQA 3EH3B 1YRKA 3H9SD 3P30L 2E5EA 4ONGH 1YYML 2EP6A 4WKZB 3Q44A 1CGVA 2CUIA 5FLUA 3MXWL 4XPBL 1N7MH 4I0PD 5BXFB 1E28A 2XZCH 2QPEB 5BW7A 1B6DA 2OTPA 3O9WD 4ZSOA 3BD4A 3D9AH 4OCYL 4M48H 5EBWA 3IFOA 2HT2C 4OFQA 5JYMA 4XHQA 5EHFA 4OD1L 1CYGA 1NC4A 4JGUA 4CVZA 1ZTXE 4NAJA 2WN3A 2CIIA 5FV1L 3MKKA 4LHUB 4XNZB 1F42A 4N26A 4P2RE 4AW7A 4GW5A 2ZOUA 5C0JA 5EU6A 3L08A 3DECA 4ZMNA 4KKQA 4Y4HA 4G80B 1JHKL 4OUUA 4YSOA 4FHKA 1WIUA 3VNYA 1NPJA 2HX9A 3VXUD 2R1XB 3TYGL 1KCRL 4QXTA 2C4FU 4HS3A 1QPPA 1X5IA 2P44B 5T8IA 3VXSD 1CXFA 3CDYA 5D6CA 3OAZH 3WEMA 5SWZA 3H1ZA 1ITBB 2VMCA 1FGNL 4OKVB 1RH8A 4PRIB 1NIFA 2XKUA 2EDMA 4OLZL 4H1LG 1LEGA 3KZIO 5CU9A 4YSTA 3BGFB 3JWNC 2RD0A 2YQ2A 3U0PA 2O5YL 3S35H 3LKOA 2I60L 3NFPB 1WS7A 4WQOA 4EBQL 1FPTH 4JFDD 2GITA 3LMJL 3S7GA 1ZKAA 2DBLH 5T5NG 3V10A 4RFEB 4D9RD 3QG6A 4B9FA 5CBAA 3BQUB 4DQAA 5IJVA 2P5WD 4TVPL 4ETQB 3CDGA 1JPFB 1MEXH 3AFLA 5F8QC 2HWZL 2NY3C 1Y18A 4PJAA 2BIOA 3FXIC 1CICB 4NQEB 5CEYA 1L3NA 5IB2B 1NCBH 5KSVA 4HT1H 2OX5B 2PXYB 4L18A 3W81A 4GQRA 4JEGB 1A4JA 3UTSB 4TL4A 4MLIA 3FB7B 3Q6FB 5FYLE 3DYMA 3SBPA 4W9KC 3VRJB 1JVOA 4IRSD 1NAMA 2ICES 4I5BA 3OPUA 4BCYA 3DSNA 4F7EA 3BCDA 3CDFA 1NSNH 1EEZB 1GGYA 1WWAX 5C07A 3DOIA 1ZT1B 1AXSA 4LOEA 1U4EA 2YPKA 2F54D 1OE2A 2CM6A 1I1AD 1NGXB 4NYLB 3MGTB 2XWXA 4F27A 4NGHL 1LP9A 4J23A 2PPEA 4QRPD 2R0KL 1B2WL 1PZBA 1LD9B 1SEBB 3IDIA 2H1PL 1CFNA 1M6OA 2AJVL 2ESVA 1UB6B 3GM0A 1CDYA 1F1GA 2ADFH 4L37B 3ETSA 3QIBB 1QO3B 3ZZSA 3GSNH 2BC4A 4H88H 3SDCD 1CD9B 1VZHA 2ICWB 1PZSA 2ITDA 3QDJB 3ES6A 4QT5B 5GS0D 5GRZA 2Y1ZA 5T1KA 3ZKXC 3H7BB 1A02N 5FK9B 4OB5H 3L4UA 1X5KA 3QO0B 4QGYA 1FORL 3MJ9H 3ALPA 3BCFA 4GPVA 1F58L 4O4YL 3GKZA 1FZJA 4FQHA 3G5VA 4MSWA 4AQ8C 4P2YA 4B0MM 4LOUC 5TFSL 1O9VA 2D0HA 1SBSL 3MLVH 4MZ2A 2ZSVA 3L9YA 3LN5B 5F1KC 1L0YA 2VABA 3AREC 4F58H 3CNKA 5IJKC 4E0RB 3KG5A 3D4GA 2CQVA 4G59C 5LBSA 5E1QA 3V55A 5HHNB 5MEND 2FH6A 3V5KA 3QWRD 5B3JF 3FMGL 3NSJA 4LPXA 6PRNA 3S4SG 3FYXA 2WMPB 4LMQE 3BHBB 1ZE3H 4LKXA 4YGAB 5K9QG 3OHMB 1TPXC 5B3JE 3FTSA 3KVQA 1WFNA 3F65A 1HZKA 3RTQC 3MRBA 3SDYL 1NUGA 2XBTA 3D50A 5BV7B 3T2NH 1P2CA 3RWCA 1EGJH 4Q0XH 1MIEH 3CBJB 3HPLB 4JUSA 4P07A 1SXZA 3APDA 2VISB 5TE6H 4L8CA 5CCHE 2NUPA 1ECYA 4JCHA 3S98A 3PORA 3QBTB 2EIZB 4NWUH 2ZKWA 3KDMA 3MLXH 3MO1B 4JRXB 1EZSA 1RZJL 2FLRT 4GMSL 3Q2LA 5F21B 3VJ6A 3KWXA 4CDHA 4BK4A 1JZHA 2VXQL 5L4MA 3HZKB 5HYQA 4NNYB 2NY5C 1W16A 3EO9H 4I9WD 4R7XA 4JZJC 3GUTB 5E24E 3MOAH 2X0WA 4AOFA 4HWBA 3AG1B 2HLFC 5TDOB 1K4DB 4LSDA 1FQ9C 1PRNA 2JJWA 2Z35B 9PCYA 5ELIA 1SXNA 3TO4B 4FXGB 4A04A 4HCRH 4LCCC 1X5YA 3SKOA 1T03H 3O3DB 3SE3A 5F8RC 1TCRB 4A7UA 3ZYIA 3DO7B 4K55A 5E8EA 4LHQB 3VXMB 3HB3D 4XN2A 1IQDA 4QY8A 3VM7A 3NJTA 4PV1C 1NEZB 4HS8L 3LRSB 5GRJH 1IM3B 2QBWA 2BFGA 3PUUA 4G9FD 2E4TA 2N1TE 4GW4A 4K7PX 4MQXD 3TA3B 3DYPA 1T5KA 1IC5L 3GT6A 3OQ3B 1OM3H 4JO2L 2VC2L 4B5EA 1JN6A 5FA4A 3TURA 4JHBA 2VDQH 1CL7L 2ZSWA 1AGCB 4HA1A 3WKYA 2XWRA 3KLDA 3OKOA 2EAEA 4HUWA 5GSVB 1FVCA 1GYWA 35C8L 4AKRB 3S97C 4U3XA 4HBCH 3VWKD 5CEXA 1RY7B 1AZRA 2IDUA 4U7KA 3L17A 3LQAL 1TFPA 3MV11 3AROA 3IFPB 4GF4A 4H0IA 2Y7MA 4FOMA 4HSCX 4JFQA 2UUDH 2ENYA 1HH9A 1IKFH 5EZLB 2F53D 2HPTA 3X1BA 4F1ZA 3JTYA 2LLNA 1ORSB 1S78D 3LZQA 4OZIB 3Q2NA 2W9DH 2HRGA 1XCQB 3HZYA 1XBDA 2BVQB 2WXGA 2X89A 1TNMA 2KUTA 43C9A 3OGCB 4IRJC 4OJAA 1IT9L 2ZOKB 3CG8A 3JXAA 4U6HA 4WEUD 3SIKA 3ZDYF 2ZWKA 3FQNB 1KGJA 1H9VA 5E6RB 1A7BA 3OC8A 4Y2DB 4HW6A 4K9EC 4HDIA 1P5UC 2VLJB 4OI8A 2W9LA 3B9KD 5I73B 4GRWF 3ZDYE 5DRXB 5EOQH 4N75A 3RZCC 4PJXB 3ESPA 3CFKA 4N0UE 1B4JL 3L3JB 2MNHA 4GRWE 1O6TA 5LAPA 4A2EA 2WIIB 4YX2H 4ZZFA 4H0LC 4HIXH 2G5BA 1EJ8A 3MV01 2RJMA 2VQ1B 4WUUB 3HG3A 4YFLI 4BGLA 1KPUA 2LAAA 5ICYA 4OQTA 3NCBB 3S2CA 2KPNA 1RI8A 3EYUH 4BWWA 3EMNX 1RJLA 3S5LG 3KWTA 4X7TB 3C8HA 2GPZA 4PJDA 4QIRA 4F8QA 4G75A 3BZ4A 3UTTD 5BVJB 4PWHA 2Y5QA 1DBJH 1XB3A 3LX9A 5I16B 3QNYB 5JUEH 3HC0A 1SLXA 2DQJL 4X5XB 3V9EA 3DX8B 4PBDA 5JHLA 2QVIA 4M6OL 4F33B 4IOSD 3P4OA 5FO8A 3ILDA 4DERA 4IOIB 2GAZB 4F7TA 2MIZA 3CN0A 3M7FB 2P43B 3FO2A 1QJ8A 3H3PL 2YAHA 3K74B 4RNRA 3OKEA 3HFML 1T89A 1LVEA 3CVIH 4MAUL 2IMMA 1A6VH 2B4CL 2VKXA 3NJVA 1DQMH 1S9WB 3EG9A 5JPMA 3NCJL 4UV7L 3P40A 1JV2A 3LZPA 4KY1H 3TLRA 1M2VA 2ZCKH 4OJFH 2AVGA 2XWBA 2ITEA 5KVDH 3FB8A 4S11A 1LL1A 1UEMA 4HIEB 3H0TB 4N2NA 5IQOA 5LLIC 3NTCL 2VLME 3ZPDA 2VJXA 1SOKA 3L7FB 5HP5A 2AV1A 3V2AR 1P84K 3IJSA 4M00A 4PS8A 5E6IC 4GQ9L 3I6KB 3RDJA 1MAMH 3QJUB 3PL6D 4V2BA 4AGQA 3TWCL 1FO0A 4KX8A 3MRMB 3US1A 2X0VA 4K7FA 4MVBC 5I26A 2DKMA 4L3ED 2V5TA 1U8CB 4AYNA 3DROA 3RBSA 1FYTD 4TTDC 3T0EE 5EUOB 3CX5K 3V52H 3G7GA 1P53A 2WV3A 3RIFK 5DURB 3NZ8B 3RBGA 2QQNH 2IPTL 4FNLL 1YEDB 3BT2L 1N0XH 3FULA 5L4IA 4HJJL 3ME0B 3VWJB 3QXTA 1AO7A 2OW7A 2FJFB 4LCWA 3CX5J 3F58L 3FT9A 1CMOA 1ERNA 2HTKC 4MBOA 1FIEA 4IRZH 4C58B 3ZO9A 4BELD 3ARQA 2XQBH 1QVOA 3RY6C 1HHIA 2D3VA 5ITFA 4ZQKA 1RK7A 2WSDA 5D2LB 4DPAX 4GI6A 4FQIH 4LSPH 3V6OC 1X5HA 2WKOA 3WO4B 4XOCA 1E67A 2MNWA 2UWEF 4EZJA 4XVOA 5H37H 2LT9A 3O6FB 3T08A 2X6AA 3KVDD 2DKSA 2UWEE 3BH8A 3B1UA 4NN5B 4Z7VE 1BA9A 2HRPH 1JRHH 3HG5A 3QFJD 4YDIL 3ROOA 5J7CC 1CXKA 3AB0B 2GFBB 1IGFL 5GGUA 1A6ZB 4UB6O 2VLRD 3EFDL 1JZ6A 5AW9B 4JPQA 4JHVA 4X80H 4HD5A 1B90A 2FIKB 1BBJB 2A74C 43CAA 3B7SA 1QQDB 2XA3A 1A7QH 5J13C 1C8QA 1NICA 2YIHA 4XNMA 4HAKA 4X8GA 2EDOA 3RDTC 1DQTA 4U1IB 1ZHKB 4XPAL 1J5HA 2VITA 2ZQKA 2YUZA 4XMXA 3RTQD 4QRRD 3VSQA 3RB7A 1UH3A 3IGAB 1JK9B 1MFEH 3ARFC 3GMMA 3O4OB 3ULSA 4JQXC 4MYPA 4OIIL 2PO6D 4JDEB 1RQ5A 1QHPA 4MRBA 4IL6O 2V7NB 2AZAA 1Z0NA 2OMUB 2Z7WA 4RWHA 4AQAB 1B4TA 1UWEL 1A1MA 1XH3A 2ITCB 3JV4A 2G30A 2QVFB 5DWUL 4DKEL 2CBTA 2YMXH 5C2BL 4G8GA 1LEKA 5FWQA 5EU4A 4ZPTB 4N9GB 4YSAA 5IOPB 1F90H 4HSQA 2D73A 5J6SA 1I9IL 1D6VH 2X44D 1ZE3C 1I9JH 4ZS6C 3VFSA 4NT6A 1ZHBB 4OVVA 4K2UH 1CIDA 1T04B 2C9AA 3ILQD 4L3EA 1BW8A 4P5KA 1HCVA 2NY7L 3WJLC 1M3JA 1UURA 1MVYA 4XPFL 4Z7UB 3AUWB 4KH9A 4MA7L 5I1LB 5IT2L 1TTGA 4JPWL 1KTRL 3QO1A 4LPVA 3H2QA 1Z3GL 4C4VB 3HHRB 4RIRB 2HLAB 2J6EL 3GBML 2YQ3A 1LMIA 3FSWA 4LPUA 1MUJA 2X7LA 4DP5X 3HMWL 1C5CH 2DQFB 3SDAD 4BFOA 1ZS2A 5K69A 1WHOA 4UAHA 3C9NB 5FKAB 2HSIA 4JPIB 3DGDA 4MD4B 2AABL 3HLAA 1CGSH 2UX6A 1SDAB 3IE4A 1NDMA 4WU7A 3SO3C 3LK2A 1EUTA 3M17A 4ONHB 1B0IA 2MTPA 4RRPA 3B56A 4GIAA 4PJEA 4D3CL 4B7IA 2OQJB 5LN8A 5LXGH 3WXWH 2QL1A 1J0IA 1S8DA 1Y6KR 2E59A 3LRLA 2R69H 3C5ZB 3Q8FA 3V4VB 3UGXA 2FHFA 4UTBH 4UDTB 3SN6N 3ULUE 4AQ8A 2XN9A 5DRNB 3MQIA 3FTGB 4OF3A 4X5PA 3QPXH 3KHQA 1KSRA 1JGLL 3WDJA 2IAND 3AREA 1DDTA 2Y06H 5EWIH 2X9XA 5IJKA 1E28B 2OP4H 1TLMA 1TZIA 4DEWA 3IN0A 4ZSOB 2XBDA 1AQMA 4DNLA 2XV2A 3UBXA 3QR2A 2HCZX 5EBWB 4NO5A 3IFOB 1Z2KA 3JV0A 1NC4B 5SWSE 5A3ID 1X5JA 2CIIB 2FSEA 4HPYL 3U4BL 4CSPA 5HI5C 2GC4C 4C4KO 2FJGA 3MYJA 4P23C 3RTQA 1R17A 4GW5B 5C0JB 5EU6B 1IBFA 2CPUA 4Y4HB 4MMYA 3N91A 1YEKL 3MRDA 4OUUB 4YDLC 5EEVA 4JM0A 5AW1B 1FIGH 4QXTB 3LK3A 5EH1A 4HS3B 4PP1C 5E95B 5HTSA 5D6CB 2AJSL 5SWZB 5JMOC 1E4WH 4JW3A 3H4FA 4FEIA 5KVGH 2BSED 3BKMH 1H3XA 1RULL 4GP8B 2ADYA 3LH2L 5I1IH 3B2DC 5DHXB 5FR3A 1LEGB 4JZJA 1KEMH 2B1HL 5C3LD 4MB1A 4RLCA 3U0PB 5DK3A 3UIYA 3LKOB 3CLFH 5IHLB 1L7IL 3MBEC 2TSAA 2WQSA 2GITB 4MNGE 4MXVE 3RVVD 3VRIA 4ENZA 3ZTCC 1KBBA 4JQVC 3TV8A 4LCCA 3QG6B 5CBAB 5IJVB 5KTEH 3CDGB 1JXFA 1XGYH 2Y7OA 4PJAB 1Y18B 5CEYB 5EDSA 4I87A 4FQJL 5KSVB 5A7BA 1HESA 4I48A 4KR8A 1YEJH 3KLQA 1A4JB 4E9SA 5AYUH 1HL4A 3K2UL 2RFXA 3FDWA 1NAMB 3OMAB 4I5BB 1A9VA 4JY6A 3GLDA 3DSNB 5ISZA 2YD1A 4F7EB 4XCCH 4HOMA 2OSLA 1VACA 5I2IA 4W9ZA 4WTXA 5C07B 4UQCA 2VDMH 4N24A 1AXSB 5DO8A 4YJZL 3ZE0B 2YPKB 4IJ3C 4OQ1A 2ZUQC 5DA0B 3NK3A 3VW3H 2YK1L 4K7PL 1LP9B 3G5XA 3IGUA 1EJFA 4ICWA 4PRIE 3DDFA 4JREC 4W9LC 5ANMB 3G6DH 2ZUYA 3P4MA 2FNWA 3IDIB 1CFNB 3Q05A 2ZXGA 1M6OB 2ESVB 2P4AB 5HHOA 2FGQX 1GTFA 1DEEB 2H2SD 4L4TD 4QLRA 2BC4B 3MV8D 4LAJH 2D2CC 4G7VL 4M8UA 2AF2A 4IRJA 2ITDB 4ZJ9A 3I74A 3ES6B 6PCYA 3T0DA 2CKNA 5T1KB 1LO0H 1MY7A 1GGUA 2F15A 2YQBA 2ZUSA 4GI8A 3W11D 5DD5L 4L1BA 1JTPA 1P5UA 3TEWA 5JXAL 4MAYC 5AW3B 1WFTA 2VDRH 3D51A 3NZHH 3RZCA 3UYRH 4NQEE 3SE4C 7FABH 1FZJB 4FQHB 2CDFA 3G5VB 4MSWB 3ULVE 3P3SA 3AY2A 4FT6A 3LQMA 1I1FA 4ENED 4Y5VC 4BFGA 2ZSVB 4NM4L 3UTSE 5IBLD 2VABB 1A22B 5A1AA 3LDBB 2XX1A 1MQKH 4NHCL 1WF5A 3TN0C 4EDWL 4WK2B 4ZMXA 1TMCB 5IG7A 1RK1A 4TSAH 4RDQG 2BSSA 2WBJC 3GSWA 5AEAA 3V5KB 3BYYA 2H3NA 4PJ7E 2XWTA 5KAQF 1UXMA 4LBAA 7PAZA 4LKXB 2EDQA 1T3FA 1XXFC 1NCAH 3T09A 3QJQB 2M2DA 3AT9A 1KBGH 4IBQA 3MRBB 3FBKA 2R59A 3FF8A 2XI9A 1K72A 4KO7A 4PTUA 2VT0A 1P2CB 3RWCB 4LSTL 4X7SH 3DTUB 5ALBL 1ZJAA 1AY1H 2NXYB 1IFHH 5KAFO 1A3QA 3DX7A 3V4VL 1ZPLA 3QEHA 2M07A 1O7DC 2RA1A 4RZCA 5DUML 5AAMC 4EUPH 1JCVA 4L8CB 1T5XA 2NUPB 1QNIA 1USZA 1PZ2A 3K6IA 4JO3H 1NCOA 1ZVYA 3KDMB 4LKCA 4ODSH 4PQXA 3HAEG 4IMKC 4L29A 4NJAL 2OSYA 4TKWA 3VG9B 3VJ6B 1RJYA 3K6DA 5HYQB 1L6ZA 1LWHA 1Q0EA 1M7IA 3BE1L 4R97B 2G9HA 2OBGA 2ZX9A 3CQPA 3D0AA 1C5DA 5I1CL 1WWCA 5E6IA 1HWWA 2DQHL 4EDXA 1AR1D 2WSKA 4LO9A 1KGWA 1DUZA 5DJ6A 3SOBL 4CMHB 3E1ZA 3D85A 3CDZA 3QPQC 3HI5H 4R2GC 4YUEL 3SKOB 5MEQA 3UMTA 3WXVL 1DL7H 3CSFA 5I6XB 4LIQH 3FQ2A 4KK9D 4JRYA 2YEQA 1TT6A 2R56L 4AG4L 1GFPA 5E8EB 2Z8SA 5GRYA 4J12A 1NFDA 1IQDB 2LR4A 4QY8B 3VFGL 4NO0A 3UL4A 4IM8A 3D2UD 4GW4B 2WXPA 1JERA 3WFEH 3C08H 2G4EA 2GSMB 4GG8A 1NZRA 3MLRH 1U92A 4O02H 1JN6B 5FA4B 1E7VA 3KHOA 3CH1A 4AEFA 3RIAK 3D33A 3RY6A 2ZSWB 5HDQL 3FFCA 4HK3N 4CL7A 5I1JL 1U3ZA 1VEOA 4HUWB 3OKOB 5I8EA 1FVCB 4HOXA 4PS4H 3M8OL 2WWMD 3V6OA 4XNUH 5CEXB 1H9DA 4R7DA 1NBZA 4HUNB 3V0VA 3CFTA 3L2NA 1MCQA 1BD2A 2YGQA 2DB8A 4JFQB 1H