2W80C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 56
structure length 243
sequence length 243
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w80C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w80C01
4O4UA 2YPVA 4AYMC 4O49A 4AYDC 2LFUA 2Y7SA 4AYID 4Z3TA 3V8UA 3HOEA 2W80C 5T5FA 3VE2A 3PQUA 4AYNA 3HOLA 4AYEC 2W81C 3PQSA 3UAQA 4O3ZA 4O4XA 3VE1A 4U9CA 1YS5A 4O3WA 4QQ1A 2KC0A 4O3XB 2KDYA 3KVDD 5EE2A 4O3YA
chains in the Genus database with same CATH superfamily
2D9CA 4O02B 4ODSH 2NXYB 1BZDA 5IGXH 2CQVA 5IROA 4HCGA 3IGUA 1U95A 3QPQD 1XIWB 3NA9L 4G6JH 1A0QH 3TO4A 1QUNA 2LQRA 3T2OA 3WJMA 5C1MB 1B4JH 3MHZA 3P69A 2O6CA 4J6IA 4DQOL 3NJFA 1NPJA 5DA0B 4HWNA 1DBML 1KEGH 2BSDA 2PNDA 5DSCA 4DEPB 1GYAA 3CFDB 4JVPA 1YPZE 2XZCH 5EU4B 5D2LE 3TBYB 1IBFA 5DGQA 4LPXA 2JELH 1O6SB 2IQAB 2FB4H 2GITA 3H2WA 4JPIB 1M7IA 5EEVA 1XVSA 3ZIYA 1BAGA 1JS4A 4LEOB 2NY0D 1UKTA 1LO2H 2Y07H 3BGMB 1T5XB 4HIEA 5JDPA 4M00A 2ARJA 1KPVA 3GI8L 5AW5B 3LMJH 4KK6D 3ZTEA 3QAQA 2XE5A 4K23L 1LO0H 3WHXB 3TN0C 2OCJA 3D2UA 3GXDA 1JJUA 5MEND 1TLKA 2JWYA 3B37A 1F1GA 5I0DA 2BNUA 3FFCB 3QULA 1IAOA 4I0PD 4LBEA 5DHEA 3SD5A 5KVEH 4OV6F 5ALBL 3TPUA 1MHPH 3T1FA 4G80A 3GLDA 1DVFB 2E76C 2MPVA 1ODAA 2VSMB 5AL0A 1QLRA 1R3HB 3DBSA 1X44A 2DTML 3PGFH 1QSFD 1QLRB 1R3HA 2CHDA 1E50A 2XTSA 3FUIA 2VTFA 1NPUA 1Y1DA 15C8H 3MR9B 3HI6L 1VRSA 3VXRE 4AVJA 5KN5B 4OZFG 2QQLL 4JM2D 4YK4C 5EBWA 3UG4A 4IEFA 2PYED 3GEWB 5BQ7B 4GUQA 3B4NA 3DVNA 4LCWA 4LLWB 4J5VA 1Z9MA 1BD2E 2OV0A 1WYJA 3K72B 3L2MA 4X5PA 1K8IA 1BAFL 1T21B 4OKVB 2VLRE 4EZJA 3AG4B 1T1ZA 3AXLB 4NP9A 5TH2A 2P42B 1H15B 4MGXA 2YS4A 1LTXA 1Z9PA 2AQ2A 3HFFA 2WWNA 1QSEB 4ABWA 1U8PB 3EYQC 2R2EB 2I25N 3KYKH 4Y2OA 2WZPA 4Y5YB 3M8OH 1N18A 4P2RE 4ZFFB 1E27B 1DQTA 5DA4A 1UWXK 3KE0A 1MFEH 1DQLH 3HE7A 4XBEH 3FPXA 4C4KT 5F7NC 4D8OA 2DTSA 4CNIB 4JFYA 2WC7A 2R7EA 4H26A 3DBXB 5EUOA 3VFVB 2BP0B 1XF5A 4G72B 5IEKA 3BGMA 3PG2A 3AWFA 1L9MA 1NC4A 4XAWL 2DLIA 2P5PA 4KNSA 1RZFH 5E51A 2EEFA 3QZMA 4V33A 1JXKA 1BQHG 4JZNB 1RZJH 4O58L 5DD5L 5FHAH 2NR6A 4AYMC 3OKLA 3PNWB 4LEXH 4FRTA 5E6ZA 3EJCA 5DK2B 1TQTA 2R83A 4Z18A 4MD0A 4M7JH 1PZ5A 2DQCL 5C09B 4M48L 1UASA 5A2FA 3FQTB 3DJRA 4N1EA 1E54A 1AZCA 1LE9B 2AQQA 2D9QB 1E2VA 1ZXQA 4O02A 4YHNB 2P7TA 1T7ZA 3C5JB 2FGRA 5KSUA 4BFBD 3D4ZA 1X6LA 3VXOA 4EKXA 1CYGA 2GJPA 1VKXA 2J20A 4LSQH 3W9DB 5EDSA 1JGLL 4PJFA 4B9PA 5BPPA 4MA1B 1KYOK 1L6PA 3PWPB 3MLWH 4EEEA 2JIXA 4QRBA 1MFDH 1U8IA 1JG9A 5CD3A 1NCDH 4KXAA 2XV0A 4LVOC 2FD6L 1HJCA 2C8NA 3CH1A 5E70A 5HYIA 2J3SA 4X8CA 3U4KA 4BZ1A 1CFVH 1AD0A 1RIUH 3LV3A 4NRXB 2EDLA 2FWSA 3ORJA 3FOLA 4HHWA 4OIIL 1TEYA 3SE3C 2I32A 3K0WA 4NIKB 3LQZA 5E2UL 1CFMA 2ALWA 1LMKA 3IMUA 3O6MH 1MVFA 4CC4C 1E4XI 3ZQWA 1CJYA 1E90A 5I8CB 2X3BA 1GS6X 1QFWH 2OMXB 3SO5A 3WEXA 3QEUB 3GHPA 3M7OA 2HVJA 2C34A 5CN3A 5AW2B 3B1UA 4BSWB 2VWEC 3CFCH 3DYPA 3MACL 3CLWA 1MAML 4JRXE 3S3SA 3CN3A 2YKLL 1BOYA 3DI3B 3TU6A 3E0GA 1FVEA 5FYJH 3ARBA 2OXHA 5ISZD 4OUUB 5A2CA 1UCTA 3NZUA 3FK3A 3MR9A 1EERB 3WELA 4NQSB 3GSOA 3EAKA 4G7VL 1AKJD 4JFDB 3SBRA 1RJYB 4XPAH 5DJDA 3E3QC 5J11B 3SY0A 3QFJB 5JXAL 2R0KH 1XXFC 3V9FA 3PDOB 4K7FB 5C0NC 5DD0L 3AU1B 1XSIA 3B9AA 3V4VL 2ADFH 3BKJH 1JZFA 3IJ8A 3IDUA 2G5BA 3U7AA 3M17A 3RWFB 2ICCA 2CWRA 4ZOAA 1U30A 2PETA 3WHXA 4E9RA 1GS8A 1JTOA 2WP3O 1KEML 3Q13A 4MXWL 3TA3C 5K9KB 2Y1AA 3QDJA 4IDLA 4WV1C 3KW8A 2F7IA 3DHJA 5HTSA 4APQD 2AXJA 3VD2A 2QGCA 3OMZA 3QIUB 1A5FL 2XTQA 4XAWH 3SPIA 4BZ2A 3BPOC 2BVEA 1LE9A 5BZZA 2X7LB 3MLUL 1JZ4A 4F2EA 1JP5A 2YLKA 5T8IA 2E5EA 4U1JB 2AJZB 3D2TA 5E79O 4HKZB 3DOSA 4LVNC 2A74C 1SFHA 3HAEG 2J72A 5TF1L 1JYWA 4MA8L 5C07A 2EUXA 1XIWA 5JOEA 2OYMA 4AEHL 1OW0C 4N0YL 1C5BH 3E6FB 2YPKA 5A6MA 5IESH 4J4PD 2A77L 3VSVA 3WNJA 2V9TA 2IXQB 1T04A 2J44A 2OYKA 1OL0A 1DQML 2JJTC 1DL7H 1NINA 5E2VL 3BZDA 3HPJA 4UB0H 2E59A 4G1EA 3SGKC 5DMKA 4KKPA 1QNIA 1SXSA 2VSKB 1TIUA 4L8CA 5IP4A 1MPAH 3I02A 4LLAA 3ARSA 4GKZB 2YAHA 3SY6A 3VXQA 1BMGA 4AGNA 1JNLL 1S3KH 3OF6A 3E9UA 4HQQH 4LSPL 3U1SL 4ZAKD 3B9KB 5AYQA 4JRWA 1E6OL 2VZVA 4HXAL 3QZLA 4LLDA 1KMGA 1XAKA 1ECYA 2OMTA 3VFRB 2WBXA 5GZOA 3IJSB 3H2PA 2F53E 5D7JD 3U46A 2L3BA 4D7BA 4NB7A 3JVFC 1QQDB 4JY4B 4XNYL 1OOWA 5F7WC 4OUUA 2EVFA 3QQNA 4GFTB 4L9LA 2WKOF 4GQQA 5E5MA 3ZE0B 4KR8A 1R75A 4UB0L 4CDGC 4KROC 3ASWA 5ERWB 5DJDB 2B39A 2AXGB 3IDXL 1I75A 3BXNB 3Q06A 3FXIC 2DB8A 1SQ2N 2JJSC 1PX4A 2BMKB 4KRNA 4L8DB 4PSRA 4YSCA 1X7SA 4UQBA 1GCYA 4KFZC 1AGCA 2CIIA 1MQ8A 1NDMA 3ARBB 4U49A 1FN4A 3AWGA 3TFBA 4N2HA 4DP0X 5KSVB 1DBMH 3VWJA 1S7TA 5JYLA 1CD9B 3RY6C 3X1GA 4WU7B 4X6DA 4DQAA 3HRZB 1NC2D 3TIEA 3MRGA 4QTIH 5JHMA 4AEFA 1KACB 4NNYA 1FSKC 4FNUA 1KWGA 4KXDA 4FTVE 5HY9A 4HKBA 1A8JH 1F4AA 4AL8L 4NHCL 4OQTL 1LD9B 3CXHJ 3MRJB 2Y9RT 4RGNE 5I76B 2XX0A 2WQVA 2YXVA 4LCUB 4X9FA 1N2RA 2ATKB 4KUZL 5F0PB 2KXPB 4XWGL 3VFSB 1EMTH 2YSTA 2BNRE 4U1GB 1X7QA 3AABA 4GMTH 3ZRFC 5C09D 4DFHA 4ZOCA 4HFUH 5EORH 2JMMA 4UQCA 2DL2A 4P2QD 4E9WA 3PQUA 5CHNA 5C0EA 2WZ6A 2X4SA 3VXSD 1QSZA 2BIMA 5GZOC 1KTKE 3B43A 5D4HA 1IU1A 1ZIAA 4R26H 4JFWA 2DMKA 4Y7MA 1J8HB 1JDAA 3V4PA 5F7DA 3R19A 2HZHA 3WNPA 1HZKA 2CUHA 4YK4B 3VRIB 2JCCB 1TT6A 4YHZH 4MB1A 2OSWA 3VX1A 5KYXB 3VFNB 2ENSA 2C4FU 4PBWD 4XHQA 1A6TB 4WTZG 3VFTA 3JV4A 4MDJA 5DRZA 4ANVA 2VDPB 3D1MC 4E41E 1HQ4A 3MACH 4XP4L 3KL3A 3NJHA 1P7KA 4PY7B 3U9PH 2Q0ZX 1A7RH 3HMXL 3PJSB 1HXKA 3G9VA 3SDYH 4CNIA 4IRSA 4QRTA 5JA9A 4P48A 5K1JA 2CIKA 5D2LF 4E41D 2YZ1A 1ZK5A 1E27A 3OG6B 2WWMD 3OSVA 1HWHB 2R8SL 3IK2A 3B5HA 1RIHH 5E6RB 2DLFH 5I17B 2WNGA 1HH9A 1PLBA 4WWKB 4DN3H 4YDMA 3H6AA 4U3CA 1QBAA 4PJ5B 3VGAB 3X1NA 2Z1PA 4ZDHA 2WYHA 5E6IA 4Q89A 3ME0B 2VERN 5JHBA 4LPVA 5T33H 2ATPA 4ZFZA 1ASOA 2EDTA 4C58B 1PTZA 2ZX9A 5D7KD 2H0EA 4XNQA 3QUYC 3KDMB 4XMPH 3DVNB 4LCWB 3C5SA 2WWOA 3ZO9A 1JZIA 5G39A 2A9ML 1T2QH 1FV1A 3EH5B 3RGBA 4Z5RA 3TGXA 1L4IA 2X1OA 1DBJL 4WFGE 1ONQB 1IC5H 3HB3B 4ODTL 2N4IA 3MRLA 4OF5A 3SGJC 3Q8EA 3X13A 4KKCC 1JHLL 5JW3L 3I6GA 2Q20A 4AUUA 1E9QA 4PP1C 4X80L 3SE3A 1N4XH 3IU3B 5CZXC 4UB6O 2GJ6D 2DYSB 1R19A 5C2BH 3ZQXA 12E8H 1CVRA 3OKMA 4QHNB 1ZHXA 1PRNA 5E8OB 3WTTA 1Z2KA 2XQYK 4XMKH 3C5ZC 2R51A 1CLOH 3OG4B 3UAEA 3L95A 3TEZA 4WWOA 4LRNL 2H26B 3LNFA 1SPDA 3JTTB 2EKJA 5CS7A 3EBIA 3SQOL 5BJTA 5H4ZA 1U8MA 2F7PA 1RU9L 4F7EA 5EU7E 3VZUX 1GW0A 1P4LA 2RGSA 2VR3A 3QORB 4IJTA 5DJ0B 4IS6A 4XN7A 1HXXA 2OQJA 5C0EB 4MHHI 2WUBL 5GGRB 5KSAA 1NGXA 2FO1A 5D1QC 3W0WD 1G9NL 2VIRB 4I4WB 4OFIA 4JFFD 3DMMA 2H8PA 4PJ0O 3KS0J 4AIXA 1JZHA 4KI5F 1Q94B 4PJAE 5FXCH 2FX9L 5FYJD 5JO5B 1N2RB 3JZYA 4AENB 4P05A 1W0VB 4BE6A 1M1XB 4J3OG 4C4KO 4ZMLA 2ZWZA 4AYGA 3B5GA 1M1XA 1T89A 2RHEA 3CQQA 1A9BA 4FXTA 4HKBB 2GBAA 3W56A 2QTVA 2BCKB 4XCEB 1UD2A 1BG9A 3HMWL 4MMYA 5IHHA 1T7YA 4JR9H 1Z5HA 5IB3B 4AYBA 4AQOA 5ICXB 4K7PY 1AANA 3X11A 2BOBB 1MFCH 4PAZA 4GP5B 1DQJA 4DTGH 3FB5A 3MBEC 5HHME 1BEXA 2RBLA 3OHXB 2XX1A 2ZAGA 3WKML 4AGLA 4R3SA 1NUFA 5E5UB 4HHAB 3VNYA 5BZDA 5D93C 4ABVA 3PWVA 4MQ7A 4FXGC 4UV7L 5DRWA 4YSOA 4JREC 3BKCH 5GGUA 3KWTA 4LSHA 2CCWA 1IILE 4RAHA 2YGOA 3CDZB 1C12B 1SOSA 2DQUL 3AW5A 1G9MH 4XMTA 3EH2A 1F4WH 1X5GA 4UM9B 3ZE0F 3QO1B 4ZSOA 5BV7B 2X4OB 3BWZA 3FT4A 2OK0L 3NRQA 3QQDB 3U2SA 2LR4A 3GI8H 3GBLA 1KN2L 5EOTA 4A66A 4PGCB 3UDWA 1SRDA 5I73B 1XEDA 4ANWA 5BZWA 1JWMA 4G9FB 1L9SA 4JFHE 2R4LA 3STBA 3ZN6A 3MRIA 1I9RL 3F00A 3G6JF 1JYXA 3GPEA 2DQUH 2X88A 1U8OB 4HU2A 3GSNA 4MMZA 3BPNB 1NAML 2EINB 1TTUA 3K3QA 3OC5A 4MNHA 3MNWB 1KIPB 4K3JL 2GSIB 2VDLB 4X7EC 4DQOH 1WZLA 3EBAA 4KJQD 1O7DE 4PRAA 1I1YA 2ZFGA 1KJMB 4V2BA 5E6IB 3MXWL 2BWQA 2GSMB 3AAAA 4JE0A 4Y1AD 43C9A 1IBYA 2ZTBA 5I15L 1T04B 4XNLA 3FRPA 2V0AA 4ONOA 1I1AA 1GCFA 3PYCA 4KITB 1DBBL 2BP5M 2CM5A 1D5MA 3HPLA 3FU7B 3VXMB 1AZVA 4YNYA 4B3EA 1C7TA 2X40A 3LCYA 1ZA6B 4NAJA 4C59B 3MRFB 5EOQH 5AAMC 4JE4B 1BLNB 3HFMH 2I5YH 4G9FD 1S7RA 1KT2A 4JM4H 4O5LL 5HDBB 2X4SB 1NAKL 4ZUTB 3FH8A 3UC2A 5ISZE 1WFJA 2ZX8A 4HJIA 3ISYA 1XGTA 1OT4A 3ARGB 3QA3B 3QFGA 4Q58C 4QTFA 4XXWC 4ANXA 4Q4IA 2VDKL 1JYNA 1MIMH 2FBOJ 3BAWA 3JYCA 1KC5L 3BZEB 2DKMA 3FU3A 3DX3A 5FB8A 4KJPD 3OJVC 3UTTB 3P1VA 3DVIA 4R0LB 1OE2A 3F5WA 4X6CB 2JB6A 4ALAC 1INEL 2EIKB 5EBMB 3A2SX 3FB7B 1SXAA 3EUUA 2A0LC 3SGKA 1S9XA 4PJHE 1JCVA 1ZVNA 4NO2B 5GS1B 5EF1A 2EVIA 1AJ7L 1YUHA 2R4SH 2ED6A 2IG2H 3LH9A 4PRPB 1AACA 2J56A 2P28B 4Y19E 3DGGA 2HRPH 2R56H 1PCXA 1JD7A 2P5EA 4NSKA 5I76A 4LSEA 3F05A 2DYRB 2Z8WC 4YZFF 4KHTH 2Y1VA 1JF1B 3OGCA 4BM7A 3MROB 4N2BA 2APXA 3MROA 5AG8A 1BVOA 2WO2B 5C3TA 5EOCJ 3P11L 4HJGB 3LXBA 3IRPX 4WEMB 3EJYD 4A63A 5KSVA 2CE6A 3GSQB 3L3OC 1UENA 3MDJA 2CD0A 4LARL 3FU5A 4AKRB 4M4RB 1BQRA 3CC5A 3IMWA 3UGXA 2XWRA 4P9ML 4X0KB 3D0VA 3ZKMC 3PIQA 3RVUD 4UIMA 1T03L 3BXNA 3S3JA 4DZBA 3TT3L 4KQ0A 1KN4H 2YARA 3D39E 5DUMH 2RCSL 4GAYB 4LLDB 1RP9A 4BFFA 3CZSA 5JPMA 3CN2A 1SN5A 1S7VB 3DTUB 3C5XA 1JNNL 1S46A 1MCLA 1S8DA 3H0TB 3M7FB 3MLZL 3N42F 4LCIL 5C0AB 4ZJ9A 4MA1C 1A6AA 1WFIA 4LCCB 4MCZA 3HS0C 2XVBA 4PS8A 1U8IB 4X8JB 5EO0B 4JDEA 4JFDE 5I82A 3RJOA 2WBKA 3CN0A 3PWPA 4MJHA 3BD5A 1OPGH 2A38A 3TL5A 1IAIL 1FFTB 5AB1A 3DHPA 5ADOH 1T1WA 3GTTA 5HHVL 3RIAF 2Q7NA 3DZMA 1NCHA 3OWRA 4HHAA 4JM2A 4X83A 4KHXH 2HX7A 3QHZH 3CN1A 4L48A 1FNGB 4N26A 4U05A 1LP9B 3F2LA 3H3PL 1T22A 1OAXL 3FRPB 2E7DA 1FYHB 2ZUTA 1Q9WB 3V2AR 2DEXX 4DZ8B 4EBQL 4YSDA 3KZIO 2Z1KA 2Q8BH 4D9LL 5EEXA 1X5XA 2CO1A 1JDCA 1KJMA 2BINA 2AABL 2WJ5A 4N28A 2XYBA 2AXFA 4YSRA 4RLCA 5HHVH 3US9A 3QI9A 3VXRD 3D25A 2D2OA 1C08A 2XN9B 5DZPA 5CLTA 1XCWA 2WCPA 2OTUA 4WK0B 3ZU8A 4OQTH 1AFVL 1J87A 4AT6A 3FTGB 2Q7AA 3FQNB 2CDGA 1GOFA 4DGVH 3QXDB 3MRMA 1QATA 5B3SB 4XBPA 5F3BB 3QWOB 2P8MA 1B4LA 1HE7A 3OAUL 2MPAH 2JV6A 5D4QA 1AC0A 1WFTA 2AEPH 1HT6A 1TJXA 1XWVA 3DRTB 3I74A 1A14L 2VAJA 3Q8CA 4DCQB 3TBWB 1UCBH 5ITBH 2OL3L 3DVGB 3SBWA 2ZXWB 2SEBA 4X6BA 5HVHC 1BFVL 4N68A 1RJCA 3DV6B 1XBDA 3KPMB 3I9GL 3CHQA 4NN6B 3E80A 3AMKA 1GR7A 4AQ8A 1FVDA 5CLYA 1YEDB 1NCAL 4WI9A 1NOAA 2Q86A 3J27A 1K5NA 5AENA 4ONFH 1IEBA 1NKRA 2F1BA 4N6RB 3ULVF 4R97B 1P5UA 1NFIB 1QUPA 2H6PA 1QR4A 3VACA 3L4WA 4AQZA 4HWZB 2VLRD 4IBSA 1FPTH 1NEZB 3KL5A 1A9EA 5AZEH 2R27A 1EGJA 3D69A 4O4YH 5J6HA 3EO9H 1O6SA 3S0PA 5L4JA 5E8EA 5CZXD 5AZ2L 1LK3H 4KZ0A 4IKIA 2VE6A 4AENA 4DUXA 5HVGB 3ZE1F 4WJ5A 1XL6A 3T3PB 4LSUH 4OZGA 1X4ZA 2V4LA 3CZKA 4YE4L 4XPHH 5E9DB 1KPVB 5F7YC 2D7MA 4KI5E 3JWNE 4I3SH 5IW1B 3VYPA 4AKMA 1FFPB 3QSKB 4G11A 5CJ8A 3S36X 5H35A 1UUNA 3VGAC 3P4MA 4I1RA 2AMUA 1N59B 1RK0A 4H88H 1CXFA 1MHCA 1RP8A 3TBYA 3UGUA 3V52L 2W91A 5I1JL 4DVBA 1CGWA 4HUXB 1UJTA 3ABLB 3FSOA 1LILA 2JXMB 1W16A 3NRFA 1TJGL 3BWUC 4GKNA 3BAYA 1SMDA 4JFED 1G6RB 1KIUA 1XB3A 2ICEC 2YN5A 1DJXA 1MCOL 3V0VB 1ZPLA 1D7BA 2WINA 1D9KB 4JZJB 2IWVA 2AW2A 5AG9A 1A6AB 5F96H 3K4AA 2W59A 4Y1SA 3FO0H 4ZMXA 1RD6A 1JGUL 5F72S 1ZV9A 3O6KL 1Z1WA 5E2WL 4PJIF 5KANG 2WQAA 2RA1A 2DWTA 1X5AA 1HXTA 2ARJQ 4N6QA 1AIFB 4QHUB 1FBIL 1E9QB 3DX9B 1H3XA 2KHAA 4RRPA 5CEZD 1IL1B 4BZ1H 1KXQA 3MJ8A 1AZZC 1OANA 3ILDA 4Z7OB 4NYLA 3MODL 2IANB 3T2NL 2Q7YA 3ZDYB 3K6NA 3MV7B 1BX2A 5CCGE 3NVQA 3IFNH 1TITA 4K55A 4FG0A 3EOYG 4ALAH 2OW6A 2AQ1A 4I18B 1BQHB 2ADJA 4K3JH 5INDA 4JGMA 1UM5L 1XEUA 4BFIA 4PUBH 4YXLH 4K7PL 5JMRA 5AFUL 4RDBA 4NCC1 5E8EB 3PWLB 4XCNB 1FO0L 1M71B 3HE6C 4KOCA 4DGUA 4HOXA 4N74A 25C8H 5EWIH 3CC5B 1C1EH 3G04A 2FGZA 2XIIA 2OMUB 1BCIA 1D9KD 1GFMA 5IW1A 1FRGH 1JAEA 5G5DA 1BFSA 1WAEA 3WO3B 2F58L 3HMXA 2DJUA 1P5UB 3EDJA 2K78A 3DA3A 2KQMA 1E8WA 3K5RA 3O6FD 3OX8A 4MHHG 3RWHB 1KIQB 3UAAA 4TUKH 4KH2A 1KBKA 4U31A 2IAAC 5IBLC 5DLML 1F4WL 1GYWA 3FFDB 5DFWH 4FYRA 3UXFA 4U2ZA 3FCBA 5IB2B 3Q0HA 3VXSA 4ZXBC 4ZMPA 5GJTH 1FL6B 1T6BX 3WNIA 5JR1H 1GYUA 2IH1B 1HI6A 4A38A 1CICB 1I4FB 3TBSB 4YAQA 2DM7A 1J0ZA 2GAZB 1LWRA 3VI4B 1RUAH 2BNQA 1DE4A 3WUWB 2NW3A 1IEBB 3H9SD 4H8PA 5JPNB 3UCQA 4Z3EA 5BVJA 1IJ9A 1QI4A 4OM1H 3QULB 3FB7A 2NYZA 4NZTL 1WWBX 2WLKA 4XOAA 1DN0A 2QDWA 1KJVA 4Z0BL 4JR9L 4A67A 2GW5A 5LQBH 4MAZA 1ZS8B 4TUUA 4O3ZA 3VFMB 4M61A 1U3HD 3ZE2B 4LOEA 5FVNA 3QEHB 2L0DA 4I88A 4GG6B 1DJWA 4J8RA 3RGVA 3MUGA 4ISVB 1BXUA 1MCHA 1HEZB 3GZKA 4WW1A 3RIKA 3SOTA 5ESVA 4H8HA 3D09A 3M1OA 3CLFL 1XBRA 4HC1L 4AEIH 2ADGB 2YMTA 1SXCA 4CC4A 4EOWH 2B08A 5CEZH 1K3ZA 1S5LO 4XN5A 4K3BA 3KLAA 3S36H 3IJHB 4UIKH 1D2OA 2Y24A 3WFBH 4ZX3A 1HL4A 1UWGL 2Y2YA 4E9SA 3NOIA 4OZFH 2JVUA 1U95B 2AJ3B 2EE6A 2E4FA 3LNGA 4U4IA 1A6WL 2ADIB 3SEPA 3ZW3A 1YAZA 1SXZA 3AVEA 3SZKC 4WFFD 2RB8A 5HJDA 1MCPH 5DHYB 2NY4C 1QEWA 5J1AA 5T5NG 5C0BD 2R29A 4XP1L 2CHZA 1S6NA 3HZYA 1T4KA 1A6WH 3O4LD 2V3DA 4E9YA 3GLEA 2AV7A 2H1LM 3OAYK 3AITA 2XVGA 3X3GH 4P9HH 1UWGH 1F02I 1QKZH 2V2TA 1TMQA 3C8KA 4GG6F 5ELIA 3V7AE 1VIWA 4U0QB 1BD2B 4KV5E 4PSPA 1H3TA 1FIEA 1DQLL 3I3EA 4J6RH 3CU7A 1NMCC 2RIKA 1BBDH 2A6JB 4RX4A 5AW9B 3QCUL 1DBJH 4BINA 2YLHA 4E9XA 4JN2A 4JB9H 5E95B 3FTVA 2APVA 4KO5A 4JZOA 4A37A 4X8JA 3WYRA 1OGPA 4DW2L 2VC2B 4CADB 1FORL 3JT2A 2H6OA 1WD9A 2YGVA 2YMXH 3L1GA 3EYVA 3MA7A 5KTEL 1Q9LA 2XXMB 1OCRB 5E1AB 2G2RB 1S7VA 1A47A 1H8OA 4PJEE 1TTCA 1CXHA 2DYPD 2I9LA 2W60A 3L4VA 1QW9A 3WNLA 5JW4M 3L81A 3RL2B 5JA8B 3SDDA 1MFVA 3QAZC 4JFFA 3KAAA 2Q8AH 3VM5A 1N5AA 2XTLA 3T6WA 4ZFOA 5EU3A 1DQQA 3MMEB 4QQ1A 2C3GA 1EJOH 1Z0MA 3ATBA 3QEGL 2FJGA 5F9DC 2IJ0C 1EX0A 1I3UA 1IGIL 1OT2A 1SDAB 3WTVA 4M7LT 3LZQA 4FI7A 4HU8A 5I16A 3VVWA 3PGCB 4MXQD 2VDOL 3NCCB 2BIIA 4CGUB 2JB5H 4KJWD 5BXFB 1Z3RA 4X7TB 2BY0A 1TR7A 1AOZA 5D7LA 5DJYB 1JXDA 1IE4A 4PG9B 4ZFOL 2NUTA 5F7EL 3ZL4H 3GB7B 3ZHNA 1TCRB 3NPSB 4M5TA 1TF4A 2D2CC 2QKIB 4KRLB 3VFUA 3ULUD 5E6SB 3AGVA 3BAJA 5T5FL 3WNKA 2Y7LA 3DRQB 4QT5B 2MTPA 3V4VB 3VGFA 2NY6B 1VPOL 4MNQA 5ANMA 1J9QA 2BNRA 1LWHA 1XIWC 5JDSA 4PJCE 4QRUA 4PRPA 2LABA 2XZCL 4PRHB 3HG0A 4K3CA 4IKJA 4MD5B 3QZPA 2RAMA 4FNLH 2AFNA 5E8OA 4CSSA 3KPPA 1ZT1B 1YC7A 1XGRB 2FWOA 2GY5A 3VDBA 2CU9A 2WB7A 3VH8G 3T2NH 1RHFA 5TE6L 4IHOB 1ZDSA 2EDFA 1DDHA 1X5HA 3LH2L 4BK8A 5DZLA 5JTWA 2PCXA 3S4SB 1EWHA 4RGNB 3ARDC 1U3JA 3RWCB 4BGDA 4E1TA 2HT3C 4AIZB 4B9IA 4UOW1 4XCYA 2PRNA 5CEXB 1DCEA 1L0PA 4FQPA 2X4RB 5F96L 2G0KA 4XXDA 5DK3A 1JZ5A 2VXUH 1FVCB 1T2XA 2HFFB 1DLFH 4Z7WF 1EIBA 3V95A 4FI8A 4XO3A 1A1MA 4XBGA 3BAKA 4Q9QL 2J1ZA 2ZXGA 4PLKC 4JDTH 4MJJA 2NY3D 4EIGB 4YZWA 4AJYV 1QRKA 2JKLA 4FJYA 3S7GA 1DQIA 4ODVH 1PKQA 2AAAA 2VM9A 1MWAB 3ZE1B 2L4OA 4FQEA 1VFBB 3IWUA 2AK4E 3K7UA 4HZLB 3GMRB 5ABZA 2UY6A 3C5OA 4LLMA 3AADB 4N1HB 5AVYB 2NY6D 3LN5B 4AGMA 6PAZA 1MN4A 2W0FA 4JX0A 3NYKA 5I5RA 2PW2B 4LIQH 2WJRA 1IKNC 3CVIH 4XC3L 2W8CA 1Q8MA 2VMJA 1I85A 1G7QA 3CFMA 3T5WA 5KYXA 2QQKH 1T0NB 5F44A 1UOLA 5GGQH 1FPTL 1AO7B 3OXRB 1ZHBB 3UTTE 2ED9A 1Q9OA 4OD1H 3EO0B 5HPMB 3QEQD 5F7DB 5EZJB 1KG0B 4R4FH 4WHYG 1BXXA 3TZVA 2L7UA 4AMXA 4G6AC 4PBDA 1Y18B 2VM4A 3UJIL 3NZ8A 1F4HA 3EYOB 1DQMH 5AOJA 3UTOA 2AXWA 5HVHB 5KJ7E 4UCFA 4NIYE 3VRIA 1UGNA 1IGCH 5IESL 1BIIB 4QEGA 2J8UE 2ISDA 1TDQA 3WIHL 4KDVA 4RNRA 1DBAH 2DIEA 3QZWB 1GHFH 2H6UA 3GUTB 2Y7QB 4WEBH 2ZAHA 4GHBA 2ITDB 4H25B 2WNXA 4MA8H 3MUHL 3SZVA 4PJ7A 4QMEA 2CLRA 1H6EA 4QRSB 2AJXL 1R3JB 3IFOA 3LVEA 3NEOA 1IM9B 5LG6A 4FP8L 3SE4A 5KYUB 3ZMRA 1DQDH 5B7FA 4F8TA 3CSTA 2OZ4A 2JKJA 4JUTA 4OFQA 3X3GL 3LRSA 4XMZA 5EO1B 5EC2B 3RZCC 1ETB1 2A7BA 4PJ5D 5KAFO 2YWYA 3MBWA 5KSBF 3MLTA 2PW1A 5GSVB 4GXUM 5AD0B 2CIIB 2FSDA 3VQ2C 2XV6B 5BS0B 1R17A 5GSVA 1MCPL 4LF3B 5B3NA 4Y5VA 1G7PB 3U36B 3EHBB 5IMOB 5DSCB 4H0LC 4WNQA 2Z92A 4KWUA 3HRZA 4GIAA 1AP2B 3VVVA 2Y0KA 5T3ZH 3HZMA 2ZJSL 1YMME 1M05B 1CLVA 1UACL 5CEZE 1GZHC 3A3YB 2MOGA 1HXMA 4YMPA 4N90E 1FLRH 3GNMH 4XPAL 4F93B 4XMVA 4HWZA 2UX7A 1JMZA 2MEJB 1XX9C 1AVAA 4G7VH 2FX7L 5E9AA 5FKPA 4PJIA 2JKSA 5E8DL 3HR5A 2YD1A 2D3NA 3OJ2C 4R9HA 4GEIA 2H26A 3CLEL 3CSYA 3NJVA 3RRQA 4DKFH 4HULB 4M8QA 4EMZA 3QFJD 4DPRA 1U8CB 2WXPA 5JW4N 1YY9D 4G6AD 5DZOA 4UTAH 3O9WB 2XXGA 4WI0B 4JKPH 1FG9C 4NUQA 2MCAA 5F0JB 1XSJA 3MV9E 3P2DA 2CDFB 4UT9A 4OVUA 4TULL 3U0TA 1FIGL 3ARFC 2KZ7A 4RAUA 4QRPA 5FUCC 1L9NA 4N0UA 5T1JA 3GMLA 3KPSA 2BSED 4JUSA 2YO3A 5HGDB 1QO3A 1KB5L 2ZXEB 4X99B 3A67H 2QVIA 1ESOA 2WQXA 3TV3H 3CVBA 4JFZH 1WWAX 3E6FA 1ZT4A 4P9MH 3VY8X 1OIOA 3W11C 1NCTA 1YC8A 2AQSA 2AXFB 4OD2A 4GW5A 3IJYA 1CLZL 3AA6A 4E1SA 3BH9A 4MXVF 4XCYB 3TF7C 4KPHH 3APFA 3L13A 1FRGL 4ZZKA 4LKCB 2FZ3B 2R39A 2VDQB 3JWOH 4DFIA 3UBXG 1A6PA 1TVBA 3MJ8B 4OCWL 1J8SA 3BDXA 4XBGB 2CO6B 1OZTG 4I48A 4X4XB 5IVOA 4YBLB 2XRAH 4XTRD 1DDHB 4RSYA 4ENEC 1ZEAH 3D6GA 1HWWA 3PJSA 4GAGL 1YEKH 3N85H 4HOZA 5D71L 2EXYD 4WY7H 2WINB 2AQTA 1MFBH 3CHSA 4WU5A 4BK5A 3QUGA 1NCCH 2EXSA 1IGYB 2CA4A 4ONGH 4PRHA 4EDXA 2KPNA 3KYAA 1BSIA 5SWZB 4OTXH 3NDZE 4HCRL 4NXSA 5DQJB 5TDPB 1SY6L 1T1WB 2PN5A 3FDWA 2V3EA 3DUHA 3MLYL 4KXBA 2XZQL 2V5MA 5DFTA 2VLRA 3H4FA 3VO0A 1A7OL 3JTYA 1F90L 2Z8RA 3HG4A 3L3KB 4ZUVB 2VDLL 4JRYE 3N1QC 3PDGA 2ILLA 2YWZA 4HAKA 1AGBB 3M6DA 4HWUA 2R9HC 5CD5C 3VG9C 4Q4EA 3WY3A 3ZDZE 3DK2A 4TOYL 5AQ0A 4V1DA 1TJGH 3GBNL 3VA6A 1A65A 2JK5A 3QORD 1F11B 2P8PA 5L7XL 1AGFB 3KD4A 4YAQB 3AC0A 4HDIA 2P80D 4OIAA 5EOQL 1FHGA 5F2FA 4I0CC 1GY1A 3OKOB 5EUOE 3GI9H 3PWUA 4N9OB 2ZSWA 4UYQA 1F45A 2IAMA 1DQQB 3MMEA 4H1LH 1J0IA 3UO8B 2KMWA 5LB1A 4QYAA 4WSJA 2VZ3A 3ZTNL 4OV5A 2QTEA 2BNQE 4JKWA 3RWJA 3QCTH 4MXQC 3SDXE 1GTFA 1IGFL 2G9KA 4JFUA 3QI9D 1SY6A 5D1QD 5AZ2H 1NJ9B 2G60H 3FSVA 3KEDA 2CK0H 4P46B 3BDYH 3BVTA 1JK8A 3ZE2E 1SQMA 2LVCA 2UWEF 2FK9A 3AS3A 3S37H 3TP4A 5CCKH 3BUYB 4AMKH 1HXUA 2V37A 3E8VA 1A6ZA 4X6BB 4N8CL 3W9DA 1SJXA 2NY7L 4E9QA 4M8VA 4TUJB 3S34H 2FJFB 4ZK8A 1I9RH 3ZDZB 3QORC 2LFUA 2EVHA 1N7MH 2Y7MA 3RKPA 3BRZA 4RZCA 1ADQA 2WLHA 3IGAA 4OFYD 3DGDA 3IDYC 3KPRE 4K5OA 4PRNA 3MTRA 1PZ5B 4Q9BA 2OK0H 3O0RL 3FSWA 1A6VH 5I1EL 5GPRA 2R69A 3RJDA 3VZTX 2V2XA 3NT0A 4PLOB 2X1QA 3UTZA 1NMAH 1XDTT 4HEMA 3NJMA 1QBLL 4NGHH 3ZHFA 3BVNB 2AKRA 2K8MA 3RTQC 2XN9A 3FTZA 1CYXA 2OP4H 5TJWK 4AMWA 2WLMA 1A14H 1ASQA 1FH2A 1D5MB 3HPLB 1PEWA 3O2WH 2X89A 5DJAB 4OJDH 4NOFA 4NO5B 4YL4A 4WHCA 1U9KA 4G6ML 4MX7A 4Y16D 2FIKB 3V5HA 1DVYA 4QHLA 1FE8H 1K85A 3KXFE 1G7LA 5LGHL 3LXAA 2Z35B 3ZDXB 3V9CA 4DTGL 1G7LB 4LQ1A 5D7JB 3AA6B 2EYRB 2A4EA 1JZJA 2ORBL 2DBLL 3SDAB 5MEOA 1X5YA 3US0A 5KS9A 4TQPA 3O81A 2K9FB 1BWMA 4KKLD 1KIPA 3N41F 1NIBA 1U93B 3P4MB 1UB6B 1VAHA 4FLQA 2PXYA 4LDOB 3VMPA 4KVNH 3AU0A 4PJAB 1KBGL 7PAZA 1Z9SA 4HK0A 1UA3A 4X8GA 1AMYA 5E24E 2OMVA 1E0OB 1HVXA 1JWMB 4LFHD 4IDJL 1T21A 4OKVA 1R3KB 4LSSH 3V7AG 2M26A 3IS1X 4FFZL 4DN4L 1S7SA 4NUPA 5KYYA 2BFVH 2B2XH 3AY2A 4JO2H 4WI0A 1Z7JA 3CX5J 4G42A 1G9NH 1BP3B 1NKOA 4MA3B 2GSGA 1NFKA 2CGYA 2VQTA 4Z9KB 3E3QE 1GOHA 2WUBH 3BH4A 3K0YA 4PV1C 3TCXA 4YHOH 1QX1A 2PYFA 4H0HB 5HGBB 5IQLA 3UROR 3Q6GL 4OFKA 4BXVA 5BVPL 2IH8A 2ZYRA 3KPNB 3MZTA 5D1XA 4ZS6D 5GZND 3VFMA 1ED3B 4M4PA 4BCYA 1GGBL 1OPGL 5TE7H 3S8WA 2EYSA 2X2HA 2WSPA 2XYCA 2BY3A 4FQ2H 5C0CE 1KDJA 3IBOA 5EBWB 3TBVA 3AG2B 3BT0A 1U8CA 4UM9A 2XNAA 4FXKA 4L29B 5ILTL 5I2IB 2NNFA 3D9AL 2EKSA 4IU3A 4X98B 1NFDF 2UUDK 3GO1H 2A9CA 4IGBA 3I6SA 4MJIB 2NTSP 4FL4B 2W0LA 1MCQA 4MJ6A 3RA7H 2H4EA 1D5ZA 2ZCHH 3D3VE 5BZDB 1OTSD 1JV2B 3B8SA 1R47A 4ODTH 3PUUA 4NHUB 1U92A 4JDZB 3ULVL 1AD0B 4RESB 4JBSA 3AJ7A 5IB4A 5T3XH 4YGAB 2C1PA 5DU7A 4B0MM 2AQPA 5DHVB 5FYJU 5I1KH 3N6YA 2CR6A 3MRPB 4ZPVA 4HKJB 4DEUA 2X9XA 1GGTA 5IR1B 5DLLA 3F5WB 3UAFA 2Z34A 4I0PA 5LJYH 3BUPA 2CMRL 3BCDA 2D7TL 4E9LA 3LKPA 4FXKC 1XTLA 5GISL 3WJJC 5DHMC 3ESUF 1BZOA 1KUMA 6FABH 3F83A 4TRPH 4UOQA 1MCRA 2DD8H 4XXWA 4E2OA 5IHWA 1QFWI 1J12A 4ZD3L 3RFZA 1DEEA 3QA3A 5C3LD 2VISB 1TKWA 4F8QA 4TQIA 4J3OC 3AQYA 1E43A 4Q0XL 3DIFA 2ZG2A 4FQJH 4NLAA 5LN8A 2XN1A 1KGCE 4YHPB 1VZGA 5FWQA 3AM8A 1E6JL 4BFRA 4J4PA 4Z78A 1JXJA 3AQDA 1A6UH 3T0EC 4CILA 5EO9A 1KCSH 1KGCD 3S98A 2XG5B 5B66O 3O9WC 4PWJA 3KGRA 4U1KB 5C0FA 3L3IA 1JPEA 3OAZK 4NC1E 3NMEA 3RUGF 3SE8L 4KX8A 4YDVB 2VR8A 5SWSA 5TGBA 1M7DB 5MP6H 1MZZA 5DRXB 3FO2A 4XXCC 1EDQA 2PW2A 1TZ8A 3GZPA 4HPYH 1QR1B 2QADB 3NACH 1NEPA 1KSRA 1WISA 2F1VA 1NAKH 1JGEB 4RSVA 5I0WA 4O5LH 4HFUL 3SYQA 3WMSA 4B60A 1ZHLB 1YDPB 2NY1D 4KQ4L 2ESVA 3IPBA 4XI5C 3V4UL 2WWKO 3LNHA 4AGOA 2NSQA 1BXVA 4FX5A 1IM9D 1EXUA 5TK2A 3EZJB 4TNEA 3FO9B 4A2FA 1ORQB 4NRZB 1CL7L 2CH8A 3L4CA 3ILEA 4FTVB 1WBXB 3D33A 4W9LC 3GMLB 4EPSA 3L6FB 4P2CG 4WI4A 5HGAB 5J8OA 2Q2LA 4N2IA 2GTZA 3G5WA 2DWEB 4LLMB 5CP7A 2NY6C 5FFGA 3KHQA 1ZD6A 4FG2A 1G9HA 1ZT7A 3FN0L 1X4XA 4YC2C 1CF1A 2QR0A 3P2TA 1FVDB 1MNUL 3T3MF 4UTBH 1LO4H 4PV8A 2K7PA 1DJSA 1XF2B 5H8DA 2K6WA 4PLKD 3CMOL 2P5EB 4NSKB 1AO7D 3OBAA 4IBLT 4OFYA 2NNRA 2Y5EA 1TPXB 3C60C 2XNAB 5IFJB 4JO3H 1AXTH 3GMPA 3NFSL 1IGTA 2A9BA 4Z7QF 4YHPA 4CN1A 3WNOA 5DRZB 4ZMYA 1CCZA 2IAMC 5A16A 4AIZA 1AXTL 4L37A 1DZBA 3BVUA 2GI7A 1SVZA 3BP5B 3NIDF 4MS6A 3EF7A 1VCAA 5ACMA 3RL1A 4CSZA 5HYJE 3WTWA 5F1SA 4FYQA 1OARL 3HR5B 4ZOEA 1UM6L 2A4ZA 4R96A 3CDGB 1BVKB 4P5KA 5I1IH 4KTEL 5ALCH 5D7KE 2IQAA 3EJZC 1SMAA 1U2YA 5I6XB 1ZIBA 1Q9FA 2R23B 4YDLC 3LEYL 3EFDL 2Z31A 3FJTA 4Y2NA 1E8XA 3IB4A 3ZL1A 4POZD 4NBZB 4WTXA 1OB0A 2B16A 1A4CA 5CZKA 3QCTL 5GGSB 3VI3B 3WV0A 4M1CC 4FGMA 1MFCL 3D30A 5INCA 4K8RD 1IZNB 1YYML 4EI6A 2HUHA 3AUVA 4QD2E 3BCFA 4L4JA 1RSFA 1WCQA 4JFOB 4BH7B 2NT1A 3MOQA 2YJLA 3RHWF 1N10A 5BS0A 4QT5A 5I30H 5EIIG 3CZGA 1NUGA 1CVSC 3UZQA 3QUKB 5ESQA 3SYSA 4NM8L 3KXFD 2IGFH 5F0LB 1CDYA 4RL9A 3RAJH 1JN6B 1ZGLB 2IH3B 4L3AA 2V7NA 4OAWA 3QDGA 3VXNA 1UM4L 3V6OC 5CJ5A 2C9VA 4LNRA 4XPTL 1TZGH 2CJTA 2H1XA 3GC3A 3MCLL 2WVPA 2DQJH 6CGTA 4MYPA 2OLDA 43CAB 3UEQA 1ZWIB 2FO4A 2VSCA 1ACZA 2I9TB 5AUMA 5FLVA 1CC3A 4OUOA 1LEKA 4DERA 2RTTA 3X13B 3BI9X 2ALAA 5HGBA 3IDYB 4N0UE 1QFUH 4LLYB 4HBCL 1DN2A 3LKQA 5GSRB 1M3IA 1AD9B 3MQIA 3V8UA 3DJZA 4TUOB 2ROYA 2HPOA 4Q6YA 1N70A 3WNMA 4RWYL 2PWHA 4JCLA 3K6DA 2ATPB 3OAWA 4MB5A 4ZFZB 3V4VH 2YFNA 2IV8A 4TRPL 4KRPB 5HJ3A 1OWRM 3NJNA 2DMGA 4KTDH 4PY8I 2AK4B 2F53A 5JW4Q 4QUOA 3D4YA 3T65A 3HZYB 3FQUA 5IQ7L 1XMWA 4F2MB 2CGRL 4OCSL 4KZDL 3BZ4B 2VZ1A 4DNLA 5F9OL 2BC4A 5C08B 2WQUA 4NQVA 1DJZA 4DO6A 4QCIA 3HBGA 4M5YL 4XP6L 3D07A 4JL1A 4KPHL 2JF1A 4D5UA 4JFOA 2PYEB 3CCHA 3ZY7A 1HU8A 5AFAA 1NEUA 1VZIA 2UY6B 3R0MA 4AZUA 1I3GL 4IRSB 4QRTB 3X11B 3DARA 3EOBA 5EN2B 5DL7A 4FQCH 1DVXA 4F1ZA 5IW6B 1JDDA 1CGSL 1JHKL 2IPTH 4EVNB 5JLZB 5A2JH 2CLVB 1BECA 3ECUA 2VLKA 5LN4A 2DLFL 1IO4C 3BP4B 5J57B 4K8RL 2CXKA 2JJUA 5E7FA 1XH3A 5DO8A 2F19H 4X4ME 5E7BA 4AYFA 2NXYC 2QHRH 4UNUA 4PB9L 3FH7A 1SJMA 2YD6A 3B9VA 2LLNA 1AMXA 5FA4A 4XP4H 2W0KA 1G84A 4OZHE 3QDGE 4JREB 3DX6B 5C08D 4NC0B 3ZHKA 3U7YL 5EC1A 3FUDA 4NT6B 5DJXA 4WUKL 1XB8A 3KLLA 4Y7OC 2GFBA 1ZGLP 1BPVA 2WXKA 4ZUWA 1F3DH 1HK6A 2NW3B 1AR1C 2BNRB 4NUMA 5BVPH 1P4UA 2EH8H 1V10A 1KGUA 4ZUWB 3APNA 4LOFA 2W9EH 3JTTA 2AJUH 5BJTB 1UA6L 4KZEH 5D6DC 3H9SA 5LVEA 4DP5X 2LU4A 3BUIA 4B9ZA 2C9PA 1P4BL 3ARGA 1OSEA 3CV5A 3JV0A 2BHFA 4BSVB 1ZT1A 2VL4A 4IGBC 2X9YA 4FFZH 3LDBC 2ZJSH 5FCSH 3RX9A 3RY6A 1ZSHA 3FC8A 2JTYA 4GMTL 5JUEL 3F6LA 3VD9A 4QKXB 4MNQB 4S0SD 4GIOA 4Z3IA 2HH0L 1CS6A 2WLIB 1ZVHA 2NY0C 1H9DA 4P4RA 2G3ZA 4KOBA 5C08E 4O02L 3ATEA 4DGIL 3I2CL 3CWGA 4CDHA 1M71A 3VRJA 3MBXL 4L18A 2GPZA 1O9ZA 3UC0L 1Z5YD 5HJGA 3WXWH 4L4TE 5D1QA 2WLLB 4YO0A 2Y4SA 1FE8L 3UTQA 4MKTA 3SJVD 1CXLA 5KAIO 1KTRL 3QQDA 1A1NB 4FFYA 3ZIMA 1DTUA 3RNKA 3LTVA 5IYUA 5IT2H 3I84A 3G3LA 4GRLB 3FMGL 2Q5BA 5F7MC 4ODWA 3IMTA 3DTXB 2WV3A 3RNQA 5B8CB 3CMGA 4G8GD 1H0DB 2ENJA 4WWPA 3JYBA 1NLBH 1V27A 4K07A 1ERNA 5D70H 2K6YA 1IGCL 1P7BA 2O72A 3KJ6L 5DQJA 1HSAB 2C26A 3F7VA 3QNYB 4FA7B 4N86A 4MCMA 3EO1A 4Y5YC 4AQ1A 3WI5A 4N0CD 1BD2A 1RUMH 2ZPKL 4RA3A 4IMKA 1ZA3A 4PB0H 2A9DA 5C0RL 1A6TA 3UCRA 4N5EC 2DQHL 2AANA 3VFTB 5L2KD 3CUPB 3DX8B 3GTNA 2IANA 4OZ4B 3T0EB 2YSSA 3UL4A 5I1LA 3GBEA 3II2A 4FNQA 3RWEA 4U1KA 3FRPG 5GGTA 1HEHC 4QHMB 4W4OA 3VGEA 2VDOB 4FLOA 3BQVA 2B4CH 3VXOB 4RCAA 4F8PA 4OZIE 1V7ML 5GGQL 3KCPB 4LPWA 1EZVX 1QHPA 1ADWA 2QQKL 3BDYL 5E03A 1W80A 3PORA 3OKNB 5I1HL 2WSDA 2E3VA 3OKEA 2W38A 4RH4A 1EFQA 3V6ZA 2G60L 2COQA 3CVIL 3RILA 4YQXL 3TJEL 1OVZA 3C9NA 2ICEB 2X6BA 2XE2A 4U3HA 4L8SB 3LHAA 4Y89A 4EI6B 2FTAA 4CSTA 2F5AH 2UWEA 3VG0H 4POZC 5KVDE 4BA0A 4I85A 1AS6A 4N9GB 3UJTH 1PHOA 3BMVA 3VW3H 2DQIH 5CR1A 3GJFB 4ADJA 4J28A 2A77H 1ODUA 4HKJA 4BH7A 1YNTB 4B3VA 1QJPA 2G4GA 3D18A 4NC2B 2R1WB 4LSFA 1YN7A 2YUVA 3DBXA 5EUOB 3VFVA 4D0DA 2ATAA 3ZTJG 1UATA 1KXTA 2DY2A 3LJ3A 4UT9L 5FO9B 5IB4B 4GW4B 5TF1H 4FLHA 3QQ4B 3P3UA 4PRDB 4WI8A 3M17B 3RWFA 2X4NA 1OTUC 2JLLA 2CDFA 4IBWA 1PLGH 5CJQH 4LLWA 4KDTA 4BQBA 1JTPA 5GHWH 1WK0A 4FQHA 3FCSB 3C60D 1HE8A 3IJEB 4P49A 4NOBA 1KGXA 2IBZX 5ECJE 5F93C 3QFJE 3AXLA 2YPVH 5E99L 3FUMA 4ZAKA 3ET9F 3HS0B 3SKNA 4ONGL 4Y4FD 4PRHE 4E9TA 1F3JB 3G08A 1FYTB 3P4OA 1INQA 3VD3A 5IM7A 3R06B 1MAJA 5FUOL 3TF4A 1FVEB 2OCFD 4PJ9B 1NM4A 3NFNB 5F21B 4ZXBB 1OTUD 4GAGH 4HJ1A 1TXKA 3KPMA 4ZUSA 1TVHB 1TNMA 4KKCD 2HVJB 3VE1A 3S88H 1PZDA 4WNQB 2QKIC 1OZUA 5GGTL 1RJZA 4ZSOE 1QFWM 5MEPA 1Y7VA 3N9GL 4NN7B 3POUA 3HHRB 1A8ZA 2BS9A 2HFEA 2DM2A 4V1DE 4XCCL 2XG6A 4XNUH 4Y9BA 1K5WA 1ILSA 5C0AD 4F15B 1N6QH 3U0PA 3KCWA 2COVD 3NUKA 1T7VA 1MW2A 2E7MA 3NCBB 5HSFA 2F7OA 3CDYA 3CFCL 3HKFA 1X5JA 4JJ5A 2VDOH 1U8KB 1X5MA 4MNGE 1A1OA 5LBSL 4GNKB 4E9VA 5C0FB 3NCYP 3O9WD 1E5CA 1H3VA 3H54A 4OD3L 1EEYB 4U1LA 3WD5H 4GKSB 3C6LB 2YUWA 5G26A 2AEQH 3C12A 4J3UA 3PE9A 2X2YA 5GIRA 3UBXB 5JQHC 3DPDA 3TTSA 3L7FA 4NQDA 2VDPH 1G4RA 4YHNA 1H3WM 3EJTA 2BOCA 4KI5C 5DTFA 4PRID 2FD6H 2BOCB 5SV3A 4N5ED 3QDJE 2EIMB 3AAEA 2MH4A 4MD0B 4L2YA 2ZXCA 2A74B 2O5YH 4UM9D 3KWWA 4JM2B 5HP5A 1G0XA 3ZX1A 3CD4A 4GUPB 4R7DA 2PPCA 1KY6A 4JB9L 4AQAA 3D4GA 2HT2D 4U6XA 2FX7H 3QRGL 4P0DA 1A6ZB 3KWUA 2BS8A 1ORSA 1ZLWH 3VSQA 4P5TA 1VADA 4PJGE 4M6ML 1ZOXA 4WUUE 1AY1H 2WN3A 2XKSA 3U7WH 3QHFH 4TNVF 1PZAA 2MOQA 3E2HC 1A7NH 4WO0A 4ZMTA 2XWTA 1NBQA 4F9PC 4WSGA 4K71C 3PREA 3P9WB 2DQCH 1WBZB 2V8MA 3SHSA 1HYSD 3D39B 3B2UC 3BPCA 2YEVB 3P2BA 4U7KA 1FZJA 3RDTD 3JXAA 4RLBA 4K9EC 1KBVA 2DLGA 3CXHK 4YBQD 1ZV2A 4AKOA 4AWJC 4UT6H 3DUSB 1QSEE 2QSQA 4GO9A 2VXSL 3QQ3A 4XC1H 1JUFA 2EQDA 5LG1A 2FBJH 3PDDA 2VDRH 2UZXA 3K71B 1TVHA 5ACZB 1R24B 4ETQB 1J5CA 5ACZA 4M62H 2MCG1 1B9KA 5B1JC 3TIDB 4APXA 1LEGA 1R0AH 5JIKA 1Z5LA 4AEIL 1UT1A 5KSBA 4MZ3A 4M6MH 2B15A 3QISA 4IGBD 5DO2C 1OAUL 1QQDA 1ES0B 4JY4A 3M8OL 5TF0A 4UWQB 2EDNA 4TMPA 4OJCA 4RVBA 1DBAL 3ZZLA 1BOGA 1HZHL 3K8MA 3MNZA 2HKHH 3QWQB 3S3DB 4U6HA 2F5BH 1T20A 4IK7A 3QGVA 4BHUI 5ABAA 5HHOB 2B14A 1AHWC 2ITCB 3IBEA 1R9FA 4PIBA 4LQFH 1J8HE 4M6NH 3EYVB 4Z6AT 3B6SB 1NQBA 2ODHA 5C70A 5EBMA 3WU1A 2EDMA 5ENWB 3OKKB 2YA1A 2Y1ZA 5K9OB 2X3CA 1EZUA 2F74A 2WSKA 4NX0A 5T1MA 5FB8B 2YAOA 5IVNA 1RUAL 1NGZA 1F6AA 3K74B 3PGFL 3EFOA 2H2SC 2WJ7A 3RG1C 1RZJC 3ARRA 3QZOA 4UU9A 3TXAA 2P47B 5KS9F 1N5YL 1QZNA 4BDVA 3FT0A 3GYRA 4TSAL 1BZ7A 2K4WA 2YHGA 4NM4H 1M6UA 4JFEA 1A2YA 3SDAA 5JORA 3LVTA 3FHEA 4JFHD 5D8JL 4CAGA 2OS7A 4N85A 4XP5L 3GS7A 2NUTB 1TSHA 1I8UA 3QUYA 4U1JA 4OB5L 4J4PC 2NQ3A 2TAAA 3LKSB 3T4YB 4WNSA 4MQSB 1I8KB 5GGTH 3LKSA 3SJVB 3BAEH 4LLVB 5DUJA 4EVNA 5JLZA 4Q9QH 3L9RA 2O61A 1KENL 5IJVA 1M9WA 2NY5H 2DLHA 4JW3A 5H94B 4JFQB 4PJ8C 3O4LB 1AKJA 1QEXA 1B0GB 4AY0A 1OM9A 3CNKA 4W4NA 4PJBB 1L6XA 3GLZA 4OLVL 2V9UA 5AYUH 4OLXH 2F0CA 3HR6A 2P24B 3FT4B 3IGAB 3QO1A 4ZSOB 2XZAL 4F7MB 5L4MA 1JZ6A 1NFDA 1MHEA 3AG1B 2DIBA 3EDEA 5IOPB 3F04A 2B7DT 3N1FC 3WFCL 5K9KA 1CFQA 1HWGB 3DTXA 5GHWL 2FX8H 3GJEB 1XV8A 2UZIL 2Y06L 5IQMA 2N0MA 4AH2A 1WGVA 2QPSA 1ZHNB 4HLEA 1Q9KA 4G75A 4PTUB 2XTJC 3HNVL 5DQDL 3OLDA 2V5TA 3MUZ1 3NZSA 4C56A 4OIBA 4GT7A 1AS8A 4OV5B 5T1KD 5LNGA 1IEHA 2AV7B 2UZYA 4H4NA 1SM3L 1I9JL 5SWSE 1D2PA 4Z7VB 1PZ2A 1H8NA 1BVNP 4Z7IA 4P5TD 1KYUA 4KTGA 4BELD 4R5XA 1WAPA 3FB6A 5F8QC 1NSNL 5DC2A 2YBGA 1BJ8A 4AQ8C 3TS8A 4YDNA 5L0QB 5DS1A 2ARWA 3ZKQD 1JOIA 5C97A 1U8HB 1MCBA 1KXTB 5FO9A 3K71A 2CUAA 2HLAB 2VW7A 2WYTA 3PGDA 1LJMA 3RVVD 3LQAL 4AYNA 2Z92B 2N1TE 1WWWX 2XWTB 1NBVH 1YNTA 5I1HH 4ORZC 3QUZD 5DRNB 4LAJH 2Y36H 1EJOL 4PLJD 3D5OF 1RULL 2JH2A 4LESA 4W9DC 1BJ1J 4Y4KA 4LDLB 3W81A 2P9RA 4P5MB 3U1PA 3QEHA 3R7QA 5CLZA 1JPSL 1MELA 2EEDA 3S5LB 4PGEA 4GS7B 5ANME 5C0DB 1X5LA 4O49A 3BEWA 4I4WA 2H1PL 2IMMA 3RYMA 2ZPKH 4PGJA 1HIML 3NZ8B 2FJSA 5CD3B 1OAKL 2B20A 3GMOB 4J3XA 4LSRL 5DJ0A 5HDBE 2DYPA 2RFXA 5DD6A 3RP1A 5AAMA 5A2LH 2ZSVA 1LXMA 2A6IA 4HV8B 4S1QH 5AVZB 2YQBA 4Y2DC 5HDOA 3GHEL 2XN2A 3V4LA 4UV4L 3VQLA 1XZWA 5LWYH 2OL3H 3W39B 4OCMC 1QABA 1LO3L 1QJ8A 1FL3B 2MNJB 4QTHA 4AKQA 2F8XC 3U9UA 4OFVA 4C55A 2OKMA 3BIKB 3DIVA 5AALA 1XGPA 4FXGA 2WQ8A 1QVOA 1ZA3B 3FONB 4F24A 1RPKA 5TDNA 3VSUA 3W82A 1HZLA 4WSKA 1TQSA 2IADA 5DD3L 3V6OA 4QOKB 3TC9A 3CFEB 5LGYA 5ICYA 3TFKC 4NN7C 1L0QA 2ZXAA 1RFDL 1KXQE 1CDHA 1H0DA 5FYKE 5HGAA 4YNYB 3CBRA 4ZNCD 2DQGL 4EUPH 2NY3B 1A1OB 1RUKH 3HB3C 4XNDA 1NC4D 4XVJL 4M43L 1QFOA 3FTSA 4UQ2B 5BMFH 4X5LA 3L1EA 1CN4A 1P1ZA 2A1WL 1TQUA 4GSDH 5FIEA 4BE5A 1U58B 2C9RA 3SDAD 4QRQB 4ACTA 2G5RA 2DPKA 1GXEA 3NCEB 4O2FB 3QJVB 5LXGL 3H53A 3ARFB 3FCUB 5CF3A 5EOTB 4HFWB 5FC9A 3U6RA 1KXVA 2R2BB 1R5VB 4FE9A 2E8YA 3C6SB 1OW0A 3KR3H 1FAIH 3PGRA 2BIPA 2NY2B 2WKOA 3C5ZB 4FZEH 2XTRA 4D8PA 2KYIA 1JPGA 2EC9U 3ZMNA 3O4OC 3MV8B 1H6TA 5AUMB 2AAVA 3VGBA 4L0YA 2FGWH 3NP3A 1O7DC 4WUKH 4DH2A 2VXTH 3PV7A 3VWJD 4AITA 5LQBL 1PG7W 2PUQT 3MFGB 2Y7SA 4DP7X 3KBHE 2P49B 2AV1B 5L8JB 1CYWA 4JM2C 5GRVL 1IBGH 2ICWJ 2LAAA 2VDMH 2APWA 2EH7L 1J9RA 2QHRL 4XP9H 4LSVH 3RVXC 3ZVVA 3WD5L 3O3BA 4UANA 2R8AA 4YFDB 2XG5A 3FU8A 4UZUA 1SXNA 4Q6IC 2GHZA 4JRFA 1EHLL 4ECNA 3EXJA 3PLYA 4CU7A 3UZQB 1KELL 2Z7UA 1KBPA 2ZXQA 4DESA 5DO2D 2OBGA 2YD5A 1UZGA 2EIJB 4X9BA 4PJ7E 3H1ZA 3NABH 2X4NB 1BF2A 3RVTD 1PG7L 3MO1B 1ZVSB 3B2DC 1ND0B 3FCTA 3X3FL 3FTGA 3DSNA 3PABB 5K1NA 1P0SE 1ND0A 1FAKT 2DI9A 1CQKA 2H7WA 4J23A 3OL2A 4LCUA 4BKSC 3HC0B 4PREB 3WTSA 4OLUL 3TLRA 2KT6A 2JI2A 3QJUB 25C8L 1X4YA 1FO0H 4ZI8A 2BO0A 3MREB 1G7IA 1Q1JH 3BN3B 3FBKA 1UM5H 1RJLB 1BFOA 2E56A 2EEBA 2R15A 3O2DA 4TVSa 1NC2A 1EEZA 4F27A 2RQEA 3FT2B 4M7ZB 5CJXC 4F9LA 2W60B 1SDYA 2IG2L 4D9RD 4OJFL 1H3PH 4LCYA 3UPCA 3P02A 4UINL 5DL6A 2XWZA 1DP0A 2GUOA 2FJGB 4OVVA 4RRPM 3QNYA 4MA7L 1JI2A 2E7CA 3FF8A 4NNPH 3A6CH 4XPTH 1DFBH 5CJOL 4JO1H 2YSSB 5FUZL 3GXNA 4LASL 3WY1A 5KYNA 1CR9H 3QCVL 4ORGB 2G2RA 5L6YH 5IJKA 4IRJB 3L16A 3ZT5A 3E6HA 1IGJB 1KG0A 2X4TA 2OMWA 3D39D 3T20A 3TEUA 1KJ2A 2I26N 1O6TA 2WTRB 2QSVA 2XETA 3QUMH 5D93B 1EDYA 4FRWA 5FDWB 1GZPB 1TZOA 2QMJA 2E0PA 1SEQL 4JO1L 4DPCX 2BIQA 4LB8A 1NOLA 3GINA 4F7TB 5KEZA 2VB5A 2VN6A 5IK3B 2HX8A 3UJTL 5F7UA 4HIJB 1HHHB 4L8BB 4X5XA 1PMYA 5IHUL 4PCKA 1WA1X 3SCMA 1FZMB 2DQTH 5B39G 2JKRM 2E27H 1T5WB 4BK4A 4EXKA 3PWNB 3PAYA 1GVIA 1VFBA 4ZDHB 4H8WH 4M5ZL 3EFDH 1CDJA 4EI5A 4EI5C 3UTTD 5HGHA 4TXVB 2OL3A 4WAFA 3M1BB 2YK1H 1ZLUH 5DHYA 1S3RA 3ARDD 4CN6A 2HN7A 4PGZA 5AZEL 3EGSB 4LGSB 5FGCE 5GRUH 2JCCE 4O3XB 4Z8FL 1DSFL 1KBWA 4DHLA 3FYXA 1CUOA 2LU7A 5DHXB 1JNJA 4F7CB 3FCGA 4X4MA 1CLYL 2Z7WA 3MJ9A 4PJIE 3FU6A 4N4YB 4PJFE 3BO8A 1G0YR 1SOQA 2B77A 3GMOA 3I85A 3NSJA 2ZKYA 1WICA 1XGPB 3HG2A 4PJGB 4RAVA 4X7SH 1OHZA 1PL3A 3IFLL 2J55A 4DK3A 2HRLA 3H9SB 4PJXA 1NLBL 3ZBMA 4YDJA 3RVWD 1GYVA 1AHWB 3Q2CA 1VJSA 3B1TA 3MV9A 1OE1A 2ZUSA 3F6IA 2YPLE 5C92A 1SDDA 3FU0A 1T20B 5G2NA 5ETUA 2ZOOA 2F74B 5IOKA 1LM8V 3U6XS 4UTBL 2BSRA 4D0BB 4HJ0D 1BA9A 2K3TA 4LL9A 2Z93B 4I1NB 2D8KA 4NUGL 4ATTA 4M4RA 4XMUA 5I75C 3II3A 3MBEB 5K5YA 3OZ9L 4WI6A 4F2FA 1OK8A 1VGEL 1NKGA 5GRWA 3QI9C 4ETYA 3FO1A 3LKOA 1ZSDB 3MBXH 4PS4H 2GABA 5D7LB 1P4TA 4CN4A 4DGIH 4XNZC 5DWUH 4NHUA 1OQOA 3MV8E 1T0PB 2G3MA 5ES4B 1PDKA 2LTQC 4IOFC 5CUSL 3X1EA 1FL6A 4XMLL 4DUWA 3QG7L 3M1CA 2QQNH 1BM3H 5HGHB 3V4UH 3LK3A 3E8UL 3QG6A 1BREA 2YKKA 1ZT7B 2CKBH 3UIZA 3V79C 4FZEL 4PY8J 5C6PB 4ELMF 1CL7I 3BW9B 5IMLB 4FNSA 1OAQH 3GPSA 2IQ9H 4K9EL 5BOZG 1P4IH 5HYFA 3K8LA 5TDOA 4NO2A 5DZVA 5GS1A 2IAMB 3VX0A 1HHHA 5CD5D 1OXYA 5CZRA 2LE9A 1QLEL 5TK4A 3O8XA 2Z31C 4GS7C 1CK0H 1LMIA 4LPYA 2BSEA 5AW8B 3SDDD 2PCFB 2CKNA 3MRQB 1IL1A 2CJSA 2V2WB 3AB0C 2UZYB 3BSZA 3WXVL 1IAIH 3KVDD 2M06A 4LMQI 5CBAB 1JZGA 2WTRA 1ZLSL 1UZ8A 1ZTXE 4PGCA 3KWWB 3PL6B 5IWLA 4K5LA 1FO0B 1QAWA 4OU3A 2QQQA 5HYJD 4OH2A 4LP4A 3QIWC 4ORGA 3ZLQC 2F19L 4N59A 4AH2B 1G94A 3TYGL 2VXVH 4JRYA 1B6UA 1T1YB 1XF1A 3Q5OA 2EXYC 4PJFB 3MX0B 4U7MA 3L5JA 4JJOA 3W2DH 1JV5B 1MJJA 2DL9A 4X80H 5BV7L 5GS0D 5L2JB 3KLDA 1A3QA 3LOWA 4TNVK 1MHCB 4BKTC 2GUOB 4LCWE 1L9TA 3AUWB 2IBBA 3VTAA 2NNXA 2R2HB 4HGWB 2NT0A 3A21A 1EO5A 2GC7C 2A9MH 1FFPA 5AVRB 1I7TA 1PS3A 2HJKB 2ZP8A 3B7YA 4QNPE 5IEKB 3SPHA 3NZHL 4X6EB 3V8CA 1ET5A 3WMPA 1PYWB 1NC2B 2V5YA 1AHKA 2CO7A 3UU2A 3HC4H 4KI1A 4XH2B 4MFHA 4KAQL 5D2LA 2V6HA 2MQGA 3LZPA 4I48B 2V9QA 1QPKA 2G2NA 3W1ZA 5C0IB 4KO7A 3L3DA 2XACC 5K9QI 1FQ9C 2R69H 1OSPL 4LKCA 4FD0A 2J4WH 2N01B 1NC4B 1T1XB 1QSFE 2ERJB 4TV3A 2FWLB 4WHDA 3X1BA 3LZFH 4F2ME 1VFUA 4NFDA 3KH4A 5HHPB 1B9ZA 2OJZL 2J57A 1T5KA 3MJ6A 1KJVB 1ZVYA 3ARFD 2FE0A 1KGYE 5C9KA 1RUQH 2GJ6A 4M6AA 3E6HB 3PV6B 3NGBC 1KZQA 4W9EC 5J6HB 1YAIA 3ESVF 4MYWB 3MLVL 4R4BA 1JZ8A 3MLPA 1YN6A 1X9QA 4WFFE 1USQA 1T6WA 4N87A 4HF5L 2EACA 4NBXB 1EPFA 5JHDD 1Q0YH 5T1LB 5K9OA 1YQVH 1UD6A 2PTUA 3BUYA 3CFKA 4R2GB 5EBGA 5A2AA 4ZXBA 3NJXA 1E2WA 4HH8A 1JIBA 1UM4H 4JVWA 4LBEB 4YC2B 4CA4A 5B1JA 4B95C 1WZ1H 4CU6A 1B3IA 5DQDH 5DI8B 5JHLA 2NXYD 3FAWA 3QRAA 3KWVA 3QXDA 1II4E 1WZAA 2R4NA 1AZUA 4XMLH 1RUPH 4NQCD 4U1NA 2NYKA 1I4FA 4LE8A 1T5XA 2OMXA 2I7OA 2Y6SC 3NCXA 1MREL 1QOKA 1GL4B 4YEFA 4FTVA 2ZOLA 1VFOA 1FV1B 2E7HA 4KXCA 4NHCH 4RBPK 3WFCH 3MGTB 3A23A 3GJFA 2DBLH 3Q2WA 3QIBA 1MW0A 2VDNB 3QIBC 4H8QA 1A4KA 3VDAA 4L4TB 1W9XA 4UNIA 3W57A 1S5HB 3J7HA 2JK5B 1Q0XL 4LOUC 2GVYA 5EC2A 4BCXA 3WTXA 2EYTA 5AKVA 1B4TA 4QRQA 4QRPE 1LYQA 2CBMA 4UF7C 5EUKA 1ZVSA 2Q87A 2WQWA 5GRXG 2D0HA 5DT1H 3UYRL 1OLLA 3UEZA 1H8SA 4ZUVA 4B5ZA 4QYOA 2IF7A 1KENH 2D03L 2MQ0A 5EA0H 1YPZB 4UYPA 1R5WB 2ICES 5AFUK 3IFLH 3A4FA 2P44B 1TJHL 5INDB 5FYLD 5J6GA 4WW2B 3V55A 4LDEB 2XJKA 2F08A 3T6XA 3P0YL 4PVBA 4OB5H 1H6S1 1J0KA 4PEEA 4PV9A 4F20A 1XGYH 1W2KT 4A7UA 3F6JA 5JOPE 3NFSH 2YBRB 1IC7L 5I0ZA 5GXBB 1FC1A 4YWGL 1WTLA 1FNEA 4HGWA 4JPKL 3ARTA 4MS8C 1CI3M 1YMHB 1G1YA 2LHFA 1RZ8A 3QZWA 3ZL2A 3IGLA 1CFNA 1B0RA 2BY1A 1J8HA 1KBBA 5F70A 4CL7A 1JV5A 1MJJB 1QRND 2F54B 2Y6TE 1QTYT 4NAQA 1BMZA 4UV7H 5D6CB 4K2UL 1MNUH 1ZK9A 3NAAL 5DYFA 5CBEA 3N44F 2HUEA 2QL1A 1U0QA 4LLQB 2YMOA 4XAKD 1IRAY 3CUPA 1JNLH 1S3KL 2A6DA 2NXZC 3DX8A 3TZGA 5AW0B 4YXKL 2VAAB 3P9LB 2ZCKH 4JJ5B 4N0FB 3RU8L 2WIMA 3Q1SH 2F7QA 2RQ8A 5J06A 2B0SH 2VE6B 5E2VH 4XO5A 1EEYA 1TYEB 3QR2A 3BHBA 3G6DL 3VDCA 3O8XB 1U8KA 2K7QA 3DI2B 3ROLB 3VGHA 5HHQB 3QUML 4JPWL 5JHDE 3UPAA 3REWB 4WFED 1LNUA 3SZDA 1U8NB 1QFHA 1KCVH 1M2VB 2HG5A 3PAZA 1QZ1A 1RK7A 1DFBL 2ZE0A 3AT8A 3N91A 3LB6D 5FUZH 3MLUH 5C9JA 1P84J 1SZNA 4PVNA 4Y0GA 4IOSD 5D7SH 4BQ9A 1E30A 2AMGA 1V7NH 4MJID 1A5FH 3G5ZB 4OCLC 2VXSH 1BJ1H 4XC1L 1TUPA 1RU9H 3SQOH 3EGDA 3ECBA 2B1AL 3CZNA 1SDDB 4BYHA 1MFNA 1UXSA 1J5OH 1O5PA 2X42A 1H3PL 2LV4A 4HV8A 5IBTH 4JFBA 4Y2DB 4XMKL 4PJXB 4WY7L 2YD2A 4CVUA 12E8L 2HTLC 4U6VH 3KPPB 1I7RB 3ZTJH 1XZ0A 2WPGA 3OMNB 2ERVA 2F68X 5KOMC 2Z8SA 1OGTB 3PXLA 5GISH 4DKAA 2R0KL 3PFQA 2D0FA 3QJRB 4OT1L 4P23C 2X4QB 4NQCE 3VFSA 4QNPF 4PS7A 5PCYA 1ILUA 4P59H 4X5WB 2XC8A 4OLUH 3BUDA 3DRTA 1K8DA 1YN6B 4HP5A 3QRGH 3X14A 3AQXA 3BIAX 1EJ8A 3QI9B 2NY4B 5EBLA 1L9OA 3CSPA 4JG9A 4DJMA 3SIKA 1YNLL 5ADPL 3ILQD 2YQ3A 1I7ZB 2FR4A 2IV9A 4MD5A 4CUCA 1WEJH 8PAZA 5E6ID 4P2QA 4HLZG 4PD4K 4EF3A 5F3HA 3T9WA 1ETJA 2YR3A 4D2NA 5IROC 2WXQA 1LQBC 3L9RB 4PU2A 2DOCA 5MERB 2O61B 5FK9A 4PJ7F 3UG5A 3BP4A 2PXYB 3PGCA 4TQ8A 4A6YL 4P57A 3OAYH 1CBVL 2IWKA 3FW6A 1RIHL 5DS8B 2YXMA 4HIJA 4L8BA 1R5IA 5D2NB 4PWEA 3W9EA 1PAZA 4N2FA 4ZO6A 5E2UH 4IOSA 5AAWC 2XWDA 1INDH 2GG1A 3D3VB 3ESOA 3REVA 4UNTA 5LBSH 5I5MA 3SY9A 3MRIB 4FA6A 2VKWA 5JQIB 2YD3A 2EDOA 3SDDB 1TZHB 2LU3A 3ARDB 3GGWA 3POCA 1JWUA 4PJFF 1IEAA 1OHQA 2YA0A 4TULH 5F3FA 2Y72A 4HAFA 4IKLA 2ZWSA 3EYOA 4JAMA 2FUTA 4JQXC 5D1ZC 2H0FA 4R8WH 3QWRD 2MCPH 3L4XA 5G3AA 1Q9LB 3BLPX 5IHZB 4UU9B 4KBPA 2BLFA 2KLSA 4XNAA 3VY9X 1TPXC 1H5BA 1UZ8B 5D4JA 4HIPA 1SHXA 3U9WA 1YY8B 1PY9A 4WI2A 5T1MB 1FAIL 1UEYA 2UXGA 4PBVC 2K45A 4L3EA 4Z3FA 4Y4FB 3TN0B 2ZQKA 3HS8A 4BUGA 3L4ZA 2CLZA 1NJ9A 3GIVA 3LN4B 4YSQA 3LHPL 3QIUD 4I8DA 3P9MB 4M48H 2A2QT 3EJYC 4U6VL 2IFGA 3AREC 4CVXB 1AR2A 4LOUD 4MWFA 4M43H 4AV5A 3ARQA 2LAGB 2HMID 2PTTB 4HWBA 5CGTA 2DQGH 3SPJA 4YR6B 5I6XC 4Y8DC 3THML 1CIDA 1NMBH 4FFYL 1EBAA 2H32H 1LO5B 3ZPDA 2YPVL 5D2NE 4PJAF 1T80A 1S9VB 5EU6A 3BKYL 3N1GC 3PJLA 1A3LL 1AG0A 3NCJL 2YPLD 2PXYD 3NIDE 3PAUA 5FK9B 3FN3A 1VHPA 1IUZA 4XNZB 4Y4HC 1CGVA 2YRLA 2W65A 3WN5A 4Q74A 1SLXA 4X6DE 5MI0B 5AOLA 5B3JE 3VZWX 3S5LG 1PZ3A 2KLTA 3MRRB 5GGVL 1RJLA 2Y0SA 3GBDA 3EDFA 3VI3A 2YAPA 2A0LD 3MREA 1A2YB 1HOEA 3DUSA 4XCEA 4EIZC 4KXZI 2ICWI 3KYKL 1AQDB 3WIHH 4S1QL 5IB1A 4ISVA 5BCAA 4GCSA 1RK1A 4LAQL 2O5ZL 5B7MA 7CGTA 1OO2A 1RHHB 3H9ZA 4PJDB 2YN3A 4U2YA 3TX4A 3D52A 2XQBL 4A7GA 1E65A 1J05A 4JQXA 4R7XA 3I9IA 3L5XH 3A4AA 5DJ8A 3MU3A 3RB5A 5EFIA 4ZW5A 4I1PA 1OCCB 3FTWA 3FQRA 1ROWA 2Z31B 3Q1SL 2QGBA 1AGBA 5DD1L 4ZYKB 1AZNA 5IQ9A 4PJGF 4XNYH 3RKDC 3GS4A 3BN9C 3L3KA 3LIZA 2APTA 3RGVB 3U6XA 3TJEH 4P5SA 5J3HD 4YXKH 5L4IA 5IJKC 3QT2A 2J8UB 3IXAA 1DJHA 3DA0A 4F9LC 4W9KC 1HQRB 4B9YA 3UERA 3VXTB 4XC3H 4JJHA 1CICA 3DX6A 4HK3N 2YD8A 4MQXD 3PQYB 4FQXB 3TEWA 5G38A 3EHBC 1S4IA 2VN3A 4NERA 4RRPG 4W9GC 3D0AA 3QXTA 4CC1A 3MA9H 3CZFA 3P4NB 5DD1H 4Z0XA 4TNWK 3U6RB 4HG4K 3LMJL 2IALA 1Q9OB 1T5WA 1AI1L 4PJCF 3B2UD 4P9HC 3MYJB 1HYSC 1YNKL 1FZMA 4ZQKB 4NPYB 1U58A 2L7QA 3TEXA 5L88L 3S6CA 3MNWA 4A55A 1RERA 3MNVA 1E4WL 2XN9D 2O5ZH 5I8CA 3T0AA 4R4NC 2BVPA 3H6JA 1CO1A 1KYDA 1S7XA 2OI9C 2XZZA 2GE4A 5CIPA 1XF5B 5E9DE 4ZG1A 2NMSA 1I8IB 3CDFA 2HCZX 4F37K 4LVHB 2YGPA 1XF3B 4HGMA 1YMMA 2ESVE 2GHWB 3CZLA 2K4TA 1BVNT 2CCLA 4XE5B 1NBCA 2PYEA 3FSAA 5K33A 3U0TB 4PJ5E 4FFWD 4ZMNA 4JS7A 2X0UA 4GSUA 3QAZB 1RKRA 3SE6A 2EIEA 5BUAA 4FG6D 3T2LA 3BQUA 1E40A 1A02N 2BVTA 1YS5A 1YEEL 1Y6NR 4AGPA 1T7XA 1YA5A 2GUYA 2BWIA 1NMBL 4FABH 5DJ2B 1Z3GH 2WLJA 4XCFL 3ROOA 3IKKA 5IQOA 4LSIA 3WLBA 3TONA 2NZIA 4LGPB 4R7DB 3HZVA 4F15C 2EUZA 4I18A 5AVSB 4TVPD 3IMRA 4PJ9A 3NGBB 4AOFA 1HXMB 2XCMC 4K73A 1U42A 2IH9A 3P9LA 1NCGA 1M7DA 1U8LB 1OGSA 3LKQB 5AKTA 4H8WC 3GJFH 5BW7A 2X12A 2EO1A 3BE1H 4HIXH 3B3BA 1I1RA 2BOBA 2YC1B 5BO0D 4ZPTA 1LK2A 2BVQB 1TZAA 4UMSA 3V0WH 5BOJA 5ESAA 3QFDA 2OTWB 4HG4J 2WLYA 3QJFA 1T89C 3D85A 2KI6A 2VO5A 2CJUL 4R3SB 1YJDC 1HN1A 3OM3B 3VI4E 1NCJA 1U4FA 4M3KB 4OZHB 3RWIA 1H6UA 2HWZL 5IQ9B 1F6FB 1GZQA 3OWEA 1MY5A 1CLZH 2QPEB 2X38A 3BPNC 5I8KL 1UOWA 1IZNA 5LCVL 5F9JB 4PJCB 1F58H 1M53A 5IROD 3MRDB 5I1AB 3DUUB 3BUTA 2QPFA 1G7PA 4PIRF 2BCKA 3OKDB 2WVTA 3LRKA 1ZLDA 3GMMB 3O6ML 2EIZA 4HEPA 1OGAA 1CU4L 4TN9A 4RGNC 2J4WL 4UDTB 5E9DD 4KKQA 2VABA 3O8XD 2Q3ZA 1UB5B 3O3EB 2WJQA 1DFXA 2R29L 3WJLA 2H9GA 1B2WH 3FUNA 2LVEA 4GXVL 4JEGB 4B9JA 1ZS8A 1FF5A 2ZKMX 4OLEA 4IBVA 3KG5A 2FWUA 5B8CC 3KLHC 3OJMB 1OY3B 3OKEB 1BD2D 4YX2L 1WD8A 1C8PA 1ZV5A 2HKHL 4IIQA 1TJIL 1P4LB 4PJ6A 2P4AB 5E1QA 5D9SB 1UOKA 5TISO 4PWIA 4C83B 4KK8D 2Z0UA 3L1FA 2WBJA 2IANE 1OAUH 4GKLA 3QNXA 5AVXB 3UBGA 5E8NA 2O6DA 2WXLA 3HG5A 4OCSH 1JZ3A 3G5ZA 4KZDH 1SOKA 1MHEB 3CQFA 4HX1A 3L4UA 3A24A 4FQHB 3BKMH 2DJSA 4NQQA 3L9YA 1WA2X 2QR0B 3A0HO 4TNFA 1ZE3H 4XBMA 5EU5A 5LBVA 4AQ1B 2P5WE 4K4KA 2P8MB 2PWFA 4Y4FA 4L23A 5DJCB 2AXHA 2W81C 1QLFB 4O2FA 2R89A 4XTRC 1H8LA 3WU2O 3W0WB 1GGYA 4X4YB 2OMTB 3ULUH 3ZQ9A 2OX5B 5I6NA 2NXZB 1HHIA 1ONQA 4QI3A 1WT5A 1QSFB 3UDWC 1G5AA 1BQSA 1Z9NA 2LFEA 2GITB 5D7SL 3CFBB 4CMHB 3CK0L 4YBLC 2ED8A 4JAMB 2GJZB 3KJ4B 4LCVA 4RA0C 1A7NL 1SN2A 4HCRA 1TZHA 1XF3A 4NEHB 4R7VA 4A2GA 1AY1L 4XR8C 1N68A 4AJ0A 1A9VA 5C7ZA 4GLRI 4PGBA 3D08A 3KPTA 4WEBL 4HIHA 3RAJL 1ADQH 3CX2A 1FNGA 3E8UH 1DHKA 5GS0L 2DQDL 2JCCA 2ZAIA 5CBEB 2A83B 4WI5A 5IEHA 4G5ZH 2FH8A 1ZLWK 4EE2A 2G9HB 3MLRH 3D85D 3KCPA 5I30L 4DIXA 4Y19B 4IHOA 3FF7A 1S7QB 4XNXL 5D55A 3MLSL 1BAFH 3QDHA 1P7KB 3CG8A 1MH5B 1GJUA 4UUJB 2KBGA 2MSPA 2CCVA 2UVEA 5CHNB 3IGKA 5B7EA 3SDXF 4OM1L 4ZRGA 2P43B 1QBML 2ZNXA 1VGEH 1UOVA 2AEQL 2W1NA 3CHOA 2MNUA 3OZ9H 3HUJB 3L3HA 4C56D 3B5TA 3PHOA 1IQWL 3LAFA 5FYKD 4OFPA 2EAEA 1N0XH 1HFUA 4UAHA 1D6VL 4MZIA 3RWGA 3BC9A 2LOEA 3BZFA 1RK0B 4AQEB 2PMZA 3KZ8A 2E74C 3VRLE 4TPRL 3ECQA 4PRNB 4WRLA 1G7HA 2DWYA 5DHVH 2WXFA 4ENZA 5KVEL 4DGYL 2E9GA 2OR7A 1U41A 3RNKB 4F7PB 5DHVA 3SGDH 4X7SL 3S3BB 4XCCH 3B7TA 3WDHA 4OZGB 5JPNA 3RWJB 5DEZA 3QJXA 1D5BB 4TUJA 1JGVL 2L04A 1CGYA 2P5EE 1X5KA 4HXBH 3MRBB 4PJBE 1E8YA 1TJHH 5DCCA 3RVTC 4AVKA 1A4KB 3OF6D 3QG6B 2P1YA 4HETA 5I1GH 2WYIA 3WTUA 3O4LE 1A3RL 3Q5TA 5EWIL 2CLVA 1DSFH 4N2AA 5CEYA 1F3DJ 1KLUA 3CMOH 3IXTA 2EECA 3GTVA 3UYRH 4UT7H 1PQZB 2VXUL 5JIMA 1LO4L 5JNYB 3EYSH 2AF2A 2BIOA 3JWNH 5ANHA 3SKJL 2AZAA 4OCYL 4KROD 5JNYA 4U6YB 4JRXA 1J18A 4GBXD 3TYFB 3T4AC 2GT9A 1KTCA 4CRPA 4AW4A 1JUFB 2HFTA 4JLRA 4Y9EA 4XX1E 3KXFB 2OYPA 4HS8L 3GXFA 8FABB 5FW6A 3VXUE 3QUZB 3WFDL 1UFGA 4OZIF 3ABMB 2XY2A 3EJSA 4NXKA 4XE0A 5A3ID 1WPCA 4Q6IB 2D73A 4JANA 2BJMH 4OLYL 2BHZA 1CL7H 5J0BA 1JGUH 3CC1A 3D48R 3MV9B 4AKPA 2HT4D 4EJ1C 4DCQA 2ADJB