2W80C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 56
structure length 243
sequence length 243
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w80C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w80C01
2W80C 3KVDD 4QQ1A 3HOLA 4O4XA 4AYDC 5T5FA 1YS5A 3PQUA 2YPVA 3HOEA 2KDYA 3VE2A 4O3ZA 4O3XB 4O3YA 3V8UA 4Z3TA 2W81C 3PQSA 5EE2A 3VE1A 4AYNA 2KC0A 4U9CA 2Y7SA 3UAQA 4O3WA 2LFUA 4AYMC 4AYID 4AYEC 4O49A 4O4UA
chains in the Genus database with same CATH superfamily
1J05A 1WFUA 2HFFB 3QG6A 4RL9A 1ZA3B 4NRYB 2VN5A 3GSNH 4GLRI 5G5DB 5I17A 1Q9WA 1FGVL 4X6DB 1JN6B 1U8LA 2JXMB 4M1DH 3VSUA 1YEKL 1T0NB 4YHIA 3D5OF 1LILA 4JG9A 4NRZA 3RKPA 2R2BA 3V8UA 1QI3A 3GM8A 3WSQH 1SYSB 2ZWKA 4ZI8A 4XP1L 4ZX4A 1LP9A 1M6OB 3D25A 5FEBA 4G6FD 4H0HB 1BVZA 4YSCA 4RMWA 4E0RB 3E7JA 1W91A 4M7ZC 3EFFA 1SEBA 1T66C 1U3JA 3B9KD 4ZMAT 1NINA 4C59B 1INQB 4A7GF 5CEYB 3PGCB 4X98A 3WD5L 4DP2X 4XXDB 2C9SA 2J6WA 3KPRB 4G42A 5D9SB 3I9IA 4NUGL 5ITFB 3IMSA 4GRLC 4S2SA 1NEUA 1CYXA 3B2MA 4K7PY 4BQBA 4OD1H 4YFEA 2ZONA 4M7KH 3EO9H 4ATWA 1OAUL 4YK4C 1EIBA 1DZ0A 1M71B 1OPGL 2CKBL 2EINB 2DQHL 2BZDA 2E4FA 2NY2D 4BSWB 4X5LA 3EXJA 3HG1A 4LCCB 4N6RB 1FQ9C 2JI2A 3PJSB 2VSKB 2MEJB 3NFPA 1XSJA 2F74A 2VYRE 3QQ4B 4Y4HC 3GSVA 2F5BH 1DJWA 2IGLA 2MCG1 4LDOB 4FADA 1BZDA 5B1JC 4M5ZL 1YEFH 2XWTB 4OZHF 4NP4H 4ADGA 4GMSH 5IQ9B 1IX2A 4FQLL 1AGFB 2JJSC 5AAMA 3IMBA 4QHKI 4GW1B 3NSCA 1F3DJ 4RAUB 3B1UA 4CU6A 4LDLB 3WUWG 4LSVH 5HYSG 3DOSB 1J9CT 4JQXC 3MV9A 3EJSA 1CQYA 1CL7I 4WHCA 5JIDA 5F8RC 5E2VL 4FMFA 1GGCH 4YK4B 2YSSA 4WAFA 3LDBB 4QY8A 4Y2DA 2JKJA 4DGYH 3DRTA 5IVXA 3CH1A 5IMMB 2FECL 4U1NB 4U1KB 4Z7NF 2AKRA 3O3DA 1UXSB 3L4YA 4AW4A 4XAWL 3O0RL 5C0GB 3KLQA 3LNFA 2XYCA 4LE8A 2ZUTA 2VUYA 3P0VH 1LQSR 4NOBA 7PRNA 3KXFB 1HH9B 2BY2A 4OCXH 5ICXA 2CWRA 2G60L 1WAPA 2WBWB 5GISL 3H4FA 3FQXB 5CWSB 1MZZA 1JXKA 2CM5A 2NY2B 3ZK0A 1B0GA 1FYHB 3MV8B 4FSOA 2VXUL 5GJTL 1RZPA 1UTDA 2FR4A 4JANB 1YMMA 3DV4B 2BH0A 5D96B 2AXHA 4ACTA 1EQWA 2XCMC 4Z7QB 2EUVA 1CDIA 2DQFB 2DTMH 2NX5E 4P3CH 5IZ7A 2APFA 3FU8A 1TJMA 1FFOA 3PREA 1A1MA 2ZAIA 3DWOX 2FZ3A 5DEFB 2F2HA 2DOCA 2YD7A 2AS5M 5INCA 3GMOB 3WDHA 1EBAA 1HILB 1MREL 4HK3N 2CRMA 1YNKL 3KPLB 4I88A 3AS1A 3IS1X 4WCYH 4ODHL 1J5OH 3P77A 3T20A 3TASA 3BZ4A 5EO9A 4I0PA 2IDQA 5ID0A 3T6QC 5IW6B 2CPCA 2PCFA 3TF4A 2X3BA 3MBEC 4LB8A 1S9WA 4XCYA 4B9GA 3CN0A 1AMYA 4PGJA 2IOMA 5E6IA 3W9DB 4CU8A 4EKXA 3ULUE 3IBEA 3FRPG 5TPWH 2R8SH 1O7DE 4PIBA 4I77H 1UZ6F 1TFHA 3V5DA 1RLBA 2G75A 4PV1C 4F33B 2WLKA 3P4MB 5HDQL 5I71B 1L3WA 3ABLB 4UM8B 4H88H 5D71L 4IDJL 1BD2A 3IJSB 1LDPL 4LLMA 4PJ8C 4LQFL 1V7NH 2FJGA 4G1MB 4A7TA 5F6HI 3HS8A 5JHDE 2P48B 4F1ZA 2AV1B 4HBCL 4PW9A 4V33A 1WWAX 4CNIB 4NT6B 1K4CB 3V5HB 3OB0K 3G5ZA 2VRAA 1S2EA 5LNEA 1WIOA 2EYSB 3FFDA 4OLUL 1NOLA 5ADXK 1Y18A 2AERT 5EU3A 1M9SA 3CHXA 1OO2A 3V6OC 1IFHH 3KVDD 1N8ZB 5TDOB 2A6IA 3FF7A 3PJLA 5DL7A 2Y1YA 5I1AA 1KPRB 4JR9H 2IWEA 4ZXBD 3MR9B 4K94H 3VDBA 3PHQB 2MQ3A 3ETTA 1ET5A 4L4TB 2CJTA 4TSCL 2C3WA 1CDJA 4EDWH 3HTLX 2XRAH 4B9PA 3KWWB 1UZ8B 4P59L 5EORL 1VKXB 2YKLH 2WKLA 4K7FB 5IBLC 4HH8A 4UNTA 5D55A 1RL1A 3PDOA 1KJVA 5DTFA 8PRNA 3RUGA 4PG9B 3QARA 4GBXB 1EUTA 5F7AA 2W92A 5DC2A 4ZOEA 1P2CB 4DKFL 5F6HJ 3AA7A 5HHVH 5B21A 2M83A 3SGKC 1ZY9A 4N3TA 3FQRA 1KIPB 4CDGC 1BQLL 1WWWX 3EYVA 5IREA 1JGDB 3OD3A 2O61B 2GTWA 4BXSV 2R4PA 2R29H 3QFJB 4DAGL 5A1AA 3DXAD 1RK1A 5EEVA 4G5ZH 2E47A 1F42A 2IVFC 3H9ZA 4QXTA 1F4YL 3A4AA 4KO6A 1TQCC 1UB6B 3G5VB 2Y1AA 2ITDA 2XV0A 5CKAA 3W11C 1P4LA 5EIVA 3RVUD 4XNYL 2G75B 4LMQE 2V4LA 4QHUB 6TAAA 4RDQF 4B61A 1MAMH 4X6BA 4TVPD 4QHKJ 5JZ7C 2O5XL 2XBZA 4ZPTB 1KACB 5I30L 3UH8A 2XZQL 4MNGB 2CBQA 3U0WL 4H13C 2DV6A 2DICA 3HAEG 2X4UA 4MQ7A 1EO8H 1ZHNA 1HEZA 3FO1A 4MJ6A 3NIFE 5DZPA 3ZTEA 5CP7A 4A2EA 1QUNA 2OQJB 3VWJD 1P7QA 3GMNB 4FZ8L 1ZMYA 2ID5A 2FECI 2VLME 4U3CA 3EO1B 3QFDA 1ZHNB 2VH5H 1UT2A 3RGVC 2EH8H 4ZMYA 2O4EA 3P77B 3V6OE 1CD8A 4Y5XC 3U2IA 3O8XB 2OAAA 3RIAF 4XOEA 3MNZA 1OP5H 3M07A 2AW2A 3NIGE 1BF2A 3U36A 1XH0A 4KKQA 5B7MA 3D12B 5ABZA 1M05B 3RL1A 1A1NB 5TE7H 4EQ3A 5ILTH 4P2OA 8CGTA 4RGND 4L4VE 4KO9A 3D07A 3KYKH 1JV2A 2B1HH 2DQFA 4UDUA 2QSCH 2KLRA 1MCNA 3T4AA 3KW8A 4A39A 2N56A 5HHOA 1EHLL 2BSBA 2HZHA 5SX5H 2X05A 2QADD 4O51B 2GJZA 1MEXH 3EDFA 1XF5B 3D52A 3K2IA 5IV2B 1E28A 4GBXA 5I1HH 3H2QA 3FSZA 2GHZA 3S35X 2UVFA 4XO8A 3HS0B 3VNZA 1AANA 4D5UA 4N2BA 1VKXA 1KY6A 2XMXA 3PPEA 4GY4A 4XMKL 2F7RA 1KPUB 4G3YL 2DL2A 4QHLA 2JB6B 1I1AB 4WEEA 3RWGA 3T08A 1LE5B 5C3LD 3T09A 5IUCA 3NPSB 5L8KB 5E4OA 2BNRD 1VJSA 4QYOA 5C07B 1SOQA 5EWIH 3VGFA 5JLZB 1FYTE 2YQ2A 2UZYB 4G1EA 4PJ9A 4LGSB 1IQDB 3MRIA 2AI0L 3U2SA 1N64H 1QOKA 2ZKHH 4HUXA 2NYYD 3VXNA 3H53A 2W94A 3NZ8A 3KNBA 4U1SA 2NYKA 3V5HA 3Q2NA 1I8KB 3L2NA 2IALA 3EHBC 4ZUTB 4D9LL 4N2IA 5EC2B 5C9JA 2FHFA 1CICD 5E79O 2VLJB 4QGYA 3LYRA 1XTMA 2JKNA 4CNIA 4KKAD 3E9TA 5T1LD 1OTSD 2LLLA 3IN0A 5E99H 3WE6B 3GUFA 4M5YH 4NKQB 3L9YA 3BVVA 4NUPA 3M1BB 3SPJA 2WNWA 5KVGH 2J1ZA 3TN0B 4RGNB 4JY5H 3H2WA 1E30A 4X0KB 2FEDD 4JDTL 2PW1B 2KQNA 2VXQH 4NQTA 4RZCA 5DJAB 2A7BA 3G04A 4HZAA 4KNQA 1T7WA 4LVEA 4X8XA 4BZ2A 1FNSL 3A24A 2A9DA 1N26A 4NCDA 4PJIB 5TQ2H 3T1FA 1AS7A 1BPVA 2GCYB 2X87A 4M00A 4NHUA 2OJ1A 1TLMA 3BESR 1GPOH 4W4OA 4WU5B 1WZ1H 4N2FA 4QNPF 4QHMB 2CZNA 3FB8B 2LFEA 3DVFA 6FABH 2R1XB 2CJUH 2JKIS 4OVUA 4X8GA 1KMGA 4NQCD 2X0UA 4DP7X 5C71A 1MUJA 2WLZA 3L3IB 1R17A 3EZJB 4YHZH 3BZ4B 5EO9B 5KOVC 2DQIH 4PRNA 3KHOA 3HZYB 3VWKB 3HG2A 1MY7A 5FGBC 5E8OA 3GS7A 2ESVB 4JM4L 3NGBB 3JV4B 4JM4H 3POUA 1TKWB 4LCUB 3UERA 4KDTA 5FIEA 5T1DL 2X4RB 4Q74A 1RUAL 5CCKL 4NI6A 1D7FA 1I85A 3C6LA 4OGQC 3RB5A 2O26U 2BP0A 3BD5A 2JE8A 2J56A 3VXUA 1L0XA 1RUKL 2C7UA 2K4TA 2KH2B 2CSPA 2ZP8A 3HC2A 1MF2L 2Y1VA 3B9KA 1CGSH 4B0MB 4BSVA 1E6OH 1CLYH 3MLSH 4APQD 2FR4B 1H3GA 1YY9D 4FLQA 2AJVH 4KZDH 2IGTA 3DX7B 4G6AC 3DPBB 4PUXA 1LO3L 2ZPKL 3LOWA 3QZNA 4ZFFA 5JIIA 4GXVH 5D72H 3IDUA 4H20L 4JPWL 4CVUA 4PJXE 1C8PA 4UOW1 4ZFFB 3X11A 4GRMA 1T1XA 3QJUB 1KGCE 3FT4B 1PZ5B 4WEMB 1DQML 4JHAH 1N5YH 1Y07A 1EZUA 4KX8A 1QWHA 2PXYA 5ALCL 4OUUB 5D7LD 2I9LA 1NDGA 5TD4A 2ZG3A 1F2QA 4U1KA 3RVTC 2DS4A 5DD6A 3RGBA 2WKOA 4OB5L 3N41F 3I9GL 3QDMD 4KJPD 4EI5B 2XG5A 4G3YH 5KSBB 5C09E 3UTSB 5DQ9A 2X1QA 2IH9A 3CIAA 3AA1A 3DO3A 2DWTA 4GW1A 5JTWA 1KXQE 2NNXA 1FZMA 1GGYA 1MI5D 1MJJA 4F9LA 4ZXBA 4HK3J 5JOEA 3ZBMA 1XSKA 4A2MA 3S96B 5DD1L 4P4RB 1F90H 1QFUL 1L9RA 2ZG1A 5IBUB 1EJOH 4XNAA 4FFWC 4H26B 3SE8H 3HG1B 4LCCA 1TZIB 5D6CB 3TESA 2WBJA 4RGMC 3FPYA 2NMSA 2W65A 2F74B 4FEMA 4OLVH 4R4NC 1IBFA 1YRKA 4ETYA 2D0GA 1NBVL 2QPDB 2W9EL 2Y06L 3BMWA 5AOMA 4NP4L 5T1KA 5FYJL 4Y4HD 4DF9A 3TWYA 5LNGA 4H25B 1KUMA 3UTOA 5T3ZD 4IGBA 3V5KA 2XKNA 4N20A 1ES0B 2CHXA 3CBKB 4R90H 4S1DD 1GAFH 4L5FL 5HGAB 3JVGC 4M6NL 5EU5A 1PFOA 3SKNB 4M6NH 5C6TL 4MCNA 4PJAE 4EXKA 3CN4A 3C60A 4MD0B 1SRDA 4NP9A 4QRPE 3ZGHA 3FN0H 5I0DA 3RPIA 1NTDA 1D7CA 3ARRA 1F6AB 2M2DA 4EN3B 1UB5A 1N10A 4OFYD 3U1SH 2Y0KA 3CBJB 4LIQH 4PP1C 4NPKA 1GW0A 4FE9A 5HD8D 1IVTA 5CN3A 4ZUVA 2E3VA 3QJXA 2AVGA 3A4FA 2OSLA 2XPYA 3E80A 3K74B 1EFXB 3DX0A 3QAQA 4WI7A 3UMNA 4FTDA 1IEHA 2E59A 1G7HA 4WKXA 4M1CC 1EV2E 1HSAA 1DCEA 3O41B 4JHZA 4K4KA 4MX7B 4CADB 3FBQA 5D4HA 4Z77B 1DO6A 1A21A 5FFLA 4HIEA 3WE1A 1Z0MA 1CGTA 4TOYH 3FUEA 4APQB 3P73B 5BPPA 2Q3ZA 2AJVL 5CN1A 1S7RB 2AMUA 5HYJD 1SMOA 1ZK5A 2ZOTA 4HWBA 3T6ZA 4NKIL 1OARL 3QZBA 1CZ8H 2CHWA 3KPSA 1HNGA 4HOMA 2Y0LA 2DTSA 1AQMA 5CFHA 1HEHC 4OZIA 4XPBH 3ZZQA 5KANG 1MCBA 1YECL 4Z78A 2SEBA 1ES0A 5IB4A 4LKXB 4QWWC 1YECH 3TTSA 3POQA 2R0LL 1FRGH 1MY5A 1CTOA 3VACA 3ZDXF 1MQ8A 3U4EB 3QUYB 5B38G 3VXSD 2F15A 5K69A 1UM6L 3LS4L 4ELME 2P5WD 4CGUB 2EH7L 3MRDB 1R5VA 1TVBA 3QZWG 1V7NL 1MEXL 4IYKA 1G5GA 3C5JB 3AAZB 4CSPA 4O2FA 2F1VA 1VADB 4FMVA 4DW2L 4Z3IA 4PJCF 3RIFF 5E1IA 2CCWA 2X4OA 1HHIB 5KG9A 2ED6A 2R0WL 4MB5A 2B4CC 2FJFA 5F0PB 5LBVA 2NR6A 4K23L 3CZKA 1J48A 4DTGL 4LLMB 3GSWA 5ID1A 3MUHL 4ZXBB 3U9UB 4NDMA 2YQGA 5KSAC 4KK9C 4XXWA 4QCIA 3QEQB 1RLWA 1A7NL 4KH9A 3OKDA 3UTZB 1ZIBA 2UZXB 1GR7A 2XIBA 3U6RB 3U7YH 4XO9A 5E0QA 1WPCA 4JE4B 5K33A 1IBHA 1NJ9B 1INDH 4GAFB 1T1YB 2NSXA 5CJQH 1MG3C 4MBOA 5KYNA 2QDVA 2B15A 1NBVH 2W9EH 2GUOA 4QRFA 2ZOKA 2DM7A 4OCSH 1EXUB 1X4ZA 2ZT9C 3BIKA 3H4HA 1HT6A 2A0LC 1NCWL 1T1XB 3CXHJ 3FH5A 3QIUC 3L5WA 4O2EA 1O7VA 4O9HL 5F7EL 3BDYL 4NO0B 4JREB 4WWOA 2PWDA 4NERA 4A6YA 1KDIA 3BZEA 2BFVH 3QUYD 3PHQA 1OM9A 4CJ0A 3MR9A 1HIMH 3K6FA 5HGAA 1XH3B 4LPWA 5FGBA 3SO5A 1XCTA 3VD2A 1D3CA 1MFCH 4XPFL 2CDFA 5EH1A 4IIZA 5IEKA 5IM7A 3UGXA 2EDQA 1L6ZA 2CGZA 4H1LA 4MJIA 2JVUA 1QFWH 3DPBA 5HHXL 2HTKD 2E86A 1HSBB 3WY1A 1H6TA 3W5MA 2F18A 3TJPA 1UHVA 3OZ9L 2J5LC 1V27A 4HDIB 5AL0A 2FK9A 3PPSA 4PJHB 2Q8BH 5AZEH 1G7MA 3RHWF 2FJGB 4FQ1L 4G1MA 4CRPA 1WCBA 1YPZF 4Z7WA 2G5BB 4P2RB 2DIBA 2GEEA 2KDYA 5DMGD 4J3TA 2DLIA 2VUKA 2ZXGA 4LSUL 1FL5A 2X10A 3KXFA 4QWWD 2OP4L 1RK0A 4BFIB 1FN4B 2GG1A 4BUHA 4FYTA 3BI9X 1T0PB 2XX0A 4M02A 2E7CA 1U2HA 1FLTX 3HFML 4OCYL 1NWOA 5KYUB 1D5BB 2RMNA 3HZYA 1QNZH 3JVGA 5E6IB 3FQNB 3STLB 3W9DA 1BZOA 3OAZK 1TTAA 2YRBA 4LLYA 1RV6X 4N2GA 3EUUA 4DP1X 3JBG7 4NKIH 5MEOA 1E5CA 4UBDC 1QSEB 3QRBA 1K8IB 2EKSA 4UBDD 4F92B 3VG0H 1ID5I 2DAVA 4TLUA 5GGRB 1U8JA 3ZMNA 1NC4A 5CCHE 3S3SA 1HQRB 3Q48A 2GJPA 2BMKA 3O2DA 2P43B 3LV3B 1L9TA 1FH5H 2NY5L 3UTZA 3D6GA 5D2NA 5I5MA 1MHCB 1DVYA 4RRPM 4Z3HA 4FJ6A 2HKHL 2VW7A 5DJXA 4MASA 2PTTA 3VY8X 4QO1A 4O02A 4R0LB 2EDYA 2H6PA 2NNRA 3PNWA 4FERA 3UG3A 4RMUA 4JVWA 4NXKA 3MJ6A 2VDMB 2IAMD 3QDGD 5EFIA 4FZ8H 5T33H 4WFGD 1BX2A 1XSOA 4JFZL 2V37A 2ZCHH 2WY3B 3IFNH 4W9LC 5IVXE 2O4VA 3N41B 4NAQA 5B3NA 1PKQA 1Z1WA 4NKOA 5E8EA 1U3YA 2BVYA 3K1DA 2GJRA 3OV6A 4WRLA 2UXTA 1GC1L 2DLTA 3D4ZA 3CPLA 3PWJB 4KBPA 4OZHE 1F11B 1SLUA 3ASNB 4LAQL 1PHOA 4R5XA 4YHOL 5E03A 3U4AA 4FCHA 3GINA 1CBVH 3EOBB 4AYMC 3CFBA 1QKZL 2A6KB 3WNKA 3MRFA 2BIQA 3CHSA 4X6FB 1L9OA 1MRDH 4XHQA 2OBGA 3JVFC 4Y4KC 4EVNB 1L0QA 3PWPA 5DUBA 1VA9A 5A2FA 3KCPA 1T16A 4XZUA 4E0RA 4H5SA 3RILA 3RKDC 2R9HC 4LP5A 3P73A 1T1YA 1C5BH 3LKSA 4KVNH 5HI5C 3B8SA 1TUPA 2NY2C 4H8WH 5T5NF 1IQWL 5IMKA 2UZXA 3BHBB 5DD3L 3T2LA 3BDXA 3P0VL 1A8JH 1UVQB 1T0NA 4YHIB 3SKUD 4MDJB 3MAWA 4FI8A 2EVJA 2Q3AA 2ZOLA 3MJGX 2NSQA 3MJ8B 3S4SB 4ANVA 1XEUA 5IJVA 4YSPA 3M1BA 2VL5B 3BWAA 3P9WB 4E2OA 5KS9F 5BZWB 1W8EA 4IKLA 2JCCE 3EO1A 4MB3A 1LO0L 3ZE0B 4YC2B 4BZ2L 1OCZB 3WOVA 5DL8A 1JZ6A 5C0AD 4HWEL 3LZFL 4C4BA 4N6RA 5I6XC 4PJ0O 4D9LH 1HL8A 5MENA 3OZ9H 5AUMA 5E5LA 4XP4L 3B7SA 3TA3C 3QXDB 3UPCA 2HRHA 1K2DA 4EIZC 1HAWA 3BSGA 3NZHH 4OF3A 1MN4A 1DYZA 2ITFA 1U6AL 2P5EB 2H2PC 5GGQH 3RURA 4L4VA 4RMBA 2FEEL 3L1GA 2CIIA 2ZYRA 4LSUH 3JTBA 4JHBA 3FUJA 5D1ZC 5T5FA 4OCWH 4D0CB 2NZIA 4P04A 2I60L 1DP0A 4ZXBC 3SQOH 4S0SD 4WFEE 3TBWA 3QWOA 4ELKB 1XCWA 3EMNX 4QHUA 4XPHH 5IMOB 5GGSA 4TL4A 4LLQB 5LXGL 3CDYA 1RFDH 1QLFB 3UEQA 4G70B 3O3UN 5AWNH 4C4VA 1T83C 4YR6B 2OK0L 1DQQA 5GRUH 3H0TB 4BKLB 5IMKB 3C2SA 4QJ3B 3PU7A 3VCLA 4KXAA 4XVUC 3VFGL 1RZFH 1WC7A 3SYAA 1KCRH 5C6PB 4N0FA 4CN4A 5IHWA 1A7RH 4G7VH 3HCVA 2FGWH 3MLXH 4UQDA 5ISZD 3HE6C 4X9YA 3VQLA 3CV5A 4O3ZA 1J8KA 3QXUA 3GMQB 3OKEB 4M8RA 4L29A 1MI5B 3EJQA 5T8IA 1AQDB 1T20A 1PMYA 1AZRA 3EO9L 3LRHA 4OM1H 4XX5A 3B5GA 4LSRH 2WCGA 4AUJA 4DPCX 3C6SB 4D3CH 5C0FA 4RA0C 5C0CB 3PWJA 1ZA6A 4WUUD 5I6OA 1AFVL 1A0QL 3DXAB 2ERJB 4JFEA 2Z4QA 5DD0L 2MIZA 2GIYA 2NRDA 4ZUVB 2WAHA 3BIAX 2QTEA 1N19A 3O6MH 2EEAA 4R97B 1K2DB 2FO4A 2NPLX 3HKFA 1OAZH 1LO5A 2DMCA 3J27A 4WK4B 3WYRA 5L2KA 3ARFC 5FCUL 1HZKA 2QGDA 4M03A 5K59E 5IVZB 5JORB 5EE2A 2CO7A 2BX5A 2L7JA 3I84A 4X6BB 2YPLB 1SJMA 2QHLA 5DHVA 2VLJE 3LNHA 3P3SA 2VABB 2K0LA 1ETJA 4FXGC 3SDYL 3SGEI 5F3BB 1T1WA 4K8RC 3X17A 3RJQB 5AFUK 4M7JL 4YDMA 4YLCA 2RCSH 1KTLB 3HG5A 1CQKA 2KLSA 3UABA 4AMXA 1IKFL 4J3OC 4OB5H 2OSWA 3CN3A 4U6YB 3SKMA 3HAEH 2BINA 1IVLA 5T1KB 1KZQA 2OMBA 2AJSL 4P57A 3AXLB 2WBJB 2XZCH 1QPXA 2NZ1A 3D0LA 4ALAH 1TJHL 3HRZA 1BQ5A 4JGUA 2JIXB 4QRRB 4URKA 2MOVA 4HETA 3PWPB 1YEEH 2ATKB 4B9KC 1EZVX 4YLBA 1AXTL 3VXRB 2CNZA 1J10A 3OR7B 4KMTL 2AXWA 2CKBH 1SVZA 3FCTA 4P5MB 4WNQA 5HBBA 1PW3A 5EPMA 4HUVA 4YMPA 5DVKA 3S3CB 4XAKE 4M5ZH 4D2NA 1A1MB 2ZXWB 5I23A 2F53E 2AQPA 5AKVA 4O58H 5BVPH 1PEWA 1PD0A 2LVEA 3TYFA 4OLYH 5D6DC 1S7TA 1BZ9A 4N9OB 4WY7H 4R96A 4DZBB 5KSBA 5HDBB 3SYCA 1FZOA 4DP5X 1IGJA 4QTHA 4OBSA 4F7PA 4MNQA 1NCDH 15C8H 3NJFA 4LOFA 3ZYIA 3CFKA 7FABL 3ULUH 2PXYB 1MQKL 4AIZB 1QLEH 3LNDA 4C58B 3AWGA 3VH8A 1ZWIB 1S7QA 5DO2D 4XPAH 4ANXA 5ICXB 3B3BA 2V3FA 5HDWA 1JPST 3IDGA 4IOSA 1BJ8A 2R29L 3VFMA 3ZTNL 3ZHFA 4JPVH 4AYGA 5J6HB 3PXHA 1BECA 1R24A 4PRBB 4JFDA 3STZA 1AS6A 3KJ6H 4R7XA 3VFVA 2P52A 4HQQH 4YX2H 1G84A 4KAQH 2EIBA 3D2UA 3MMEA 4YX2L 5C9JB 3BRGC 3QRGH 5FXCH 4FLSA 4NGHL 4MA3B 3QORC 3CVHH 5IK3A 4K5MA 2BSRA 4BSVB 1N2RB 4NZDA 3O11A 1GGTA 1UXLA 1H8OA 1JHTA 3NP3A 4U1MB 2C1OB 2D3JA 1K5WA 4BKTC 2BC4A 5EIQA 2Q76A 4HKBA 5ISZE 4R8WH 3TYGL 3U6RA 3MLTB 4KRNA 3GIZH 2W0FA 3SDAC 4AT6B 1JZGA 2FZ3B 4ZZFA 1RZQA 5E70A 3DSFL 4FN0A 1Z2KA 4MVBD 4F57H 1CXLA 1OE3A 2YLHA 3C9NB 4OQ1A 2O5ZH 4D9QD 3B5TA 4IKKA 1IM9D 4JUSA 2OJEA 2V6HA 3UC0H 5IB1B 1LNUB 2X28A 4S1RL 5F72S 4XVTL 4E42A 1TOXA 1FSKC 1AQKL 1T66D 1D9KC 3ARXA 4F5CE 3PF1A 3SY0B 5E6YA 1XCQB 1EHLH 2WWMC 2D3LA 4BQ9A 3KVPA 3LN4B 1YYLL 1JJUA 4MKMA 1N68A 3BP6B 4WWPA 2AP2A 4FQJH 5J1AA 4FTVA 1KWGA 1P6WA 5B39G 2EVFA 4JQIH 2VABA 4A2DA 4AGMA 2OR8A 3I9GH 3ARYA 1O5DT 2XTLA 3EDJA 8FABA 1B4JL 3QZMA 5C0BD 4NQDA 3WKPA 2F5AH 4X98B 2K78A 2CO7B 4L3EA 4DGYL 1P7KB 1SEBB 2OA9A 3LKRB 3PCYA 5CIPH 1NSNL 3FO9B 4YBLB 1MCPH 1ZAGA 4MA3A 1P6AB 4HLZG 2XWCA 3CMGA 5GRZA 2QVKA 3PGDB 2NQCA 4X4XA 4P06A 3N43B 3S5LG 5IOPA 1GJIA 1F1GA 4I2XB 3UZVA 5AFAA 3KZIO 1UD8A 2E7BA 2YD3A 3HAEB 1FL3B 3CX5K 1DBJH 1ET7A 3FFCA 4KKAC 1U8LB 2CK0L 2CALA 2Y69B 4KX9A 3ULSA 1JVOA 3RHWK 1AQDA 3TT3H 3G6JE 5IQNA 4MXVE 3H6JA 2FJSA 2FLBT 4PJDE 5LAXA 1Q94A 4A2FA 1ZVSB 4FNSA 1MCJA 5L4MA 4L5FE 2RD0A 1NGPH 4XCEA 2QVFB 5DVOA 4OF0A 2YD5A 1VAHA 4HGWA 4YVNA 3PGFL 3FSAA 3HE7C 2J72A 1PAMA 3BISA 3AA7B 3FSOA 3O2WH 4K2UH 3GTTA 5G4NA 4AVKA 4K3DL 3HNVH 15C8L 1OXYA 4XO4A 1NAMH 3HNVL 5D2LB 1OGSA 1F0LA 2QKIC 4PS4L 5A6LA 4GH7B 2D31A 3DX3A 3DURB 4WJ5A 2XX1A 1DQQB 4PHZA 4XWGH 1NCHA 1R5VB 4Q9CA 4LASL 3FTUA 4RMRA 3ULVC 2NLJA 4QT5B 4KO7A 3FQUB 4JZOA 1SEQL 1TPXC 4MNQD 1URLA 4ES9A 4ODUA 3A67L 3K2MC 1GFQA 3SJVA 5EOCJ 3FUMA 3FO2A 1MHEB 1J5IA 4PJEE 3EADA 4XPTL 5K1JA 3JV6B 1TO4A 2ZSWA 2GT9A 4Y9CA 4HCRA 1PCSA 1RZIA 2EDHA 5C7XH 2APTA 5IQ7H 4MMYA 2OK0H 2VDRH 4LCWD 1KCLA 1JIBA 3QFJD 4TVPH 2NCMA 4GG6A 2VXVH 4BGLA 3FQYA 2EYSA 2NT0A 3AXLA 3F05A 4FOMA 3B5HA 3QDGB 3LRKA 2LAGB 2NY5H 4Z7UB 4FHKA 1YEDA 2DQDL 3VD0A 1NCUA 3CLFH 5T5FL 4BA8A 2PPAA 1IEAB 4MBRA 1G6VK 3NIFB 3L17A 4JMXA 5D1QD 5A2LH 3UTQA 4M1DL 4J1UA 5IJVB 4JKMA 4Y7MA 1DLHA 4XP9L 3U7WH 4EUPA 2BM3A 1V3MA 1RZJL 3EFOB 2BOCB 3GEWB 3K2KA 1FL6A 3MGTB 5AB9A 3AY2A 2YIHA 1WV7T 1MF2H 1IC4H 2XTSA 5DSCB 3WJLA 2WLJA 1PQZA 1AO7B 3AS0A 1MRDL 3H7BB 3IU4H 3BRFA 3AY4A 4M4RB 5MHSD 4GCPA 1U8CA 3L08A 3SYSA 2RH0A 2BNQE 4NFBA 3RGHA 4JPWH 1YMMD 1U2YA 3X14A 5HYJB 1CDBA 5C08B 2IGFH 4NUJB 4DQOL 4X9BA 4FQXB 4JPKL 3ZKXC 4HPYH 2WOBA 1DQJA 1KLGA 2IADA 2YGPA 4AGNA 3TJHC 2YRZA 4MS6A 3S5LB 4XMPL 5DXWA 5G26A 4J6RL 2G2RA 3MRFB 4JO2L 3RUGE 5HYFA 3QWRA 4W9GC 3T0BA 4U3HA 3AVEA 1CF8L 1FO0B 3IRZA 4JFSA 3S35L 1ZTXE 2IEPA 3MOBL 1CFVH 2VDNB 3FRUB 3FT2B 4G8GE 4JPSA 1E7UA 3MCLH 3EOBA 1JPEA 2DWDB 4WDIA 4KRLB 4X9IA 1JP5A 1KJMA 2D9QB 3FYXA 2K70A 3MV9D 1XSIA 3BAWA 4OY9A 4YPJA 4PJ5E 1BG9A 4V1DE 1QLRA 4JFXB 1GVIA 1MVUA 1RURH 3GBDA 2YNKA 5GRYA 1K4CA 3BCFA 4JO4H 1FNEB 1IKNA 2C9UA 3GZQA 4EEEA 1WA1X 2LR4A 4GI8A 2FCBA 1MHCA 1CFNB 3ASOB 1QUPA 4HPHA 2WZPD 3ZHNA 3SKJL 2YAEA 3C60C 3QNYA 1X5MA 4UTBH 5H35B 5E1GA 2V9TA 4OV6F 4YFLF 2UX6A 1BYOA 3T6WA 2IBZY 2C34A 2AKRB 1A14L 2N1KA 3MJ9A 3CZSA 1H19A 1TEGA 2WANA 5E9AA 2P5EA 4DEUA 3Q1SL 4J3UA 3N1GC 5I9QB 5IFHH 5IOKA 4XGZA 5DUPL 4MJ5A 3Q3GA 4TNVF 3GHEH 5DHDA 2QV4A 1GGIL 1JERA 2R1XA 4R2GC 2MTAA 5F9DC 3QIUD 4KQ4L 4G8AC 4PV8B 5A2CA 1BF8A 1B0IA 5F89B 2G60H 1UM5L 3MVSA 1FNSH 1N3NB 4WI2A 1NCCH 5AL8A 5F7LB 1IZNA 4JZJA 2P24A 3W0WD 1XF3A 1Y6NR 3VGHA 4F8LA 2VISB 3DJTA 4CW1B 2A9NL 5A16A 3V0AC 4AEHL 4AZUA 2R2EB 1ZWIA 5J5EA 3TNMB 4JFDD 1I8UA 3BAYA 2HTKC 1MW0A 3LRSA 4JCLA 1Q72H 5FR3A 4YBQD 3MQIA 3VQ2C 1XL4A 3TBVB 4RQQB 2KT6A 2FH8A 3QISA 3UOAB 2YZ8A 1JMZA 2C7UB 5L2KD 4UM9B 4ZUTA 4O3WA 3QIWC 3MRNB 3JWOH 4WHYG 5IJDC 4RQQA 4GAYA 1ZHLA 3CXDL 4YHLL 4BD4A 3CFCL 2YBRA 5JNYA 4KXCA 3FT2A 3IGAB 1YAZA 3LRGA 3MNVA 3WIHL 2A99A 1S7SB 4NZ8A 1KXTA 4OZHB 4MJIE 2HLFD 3CSYA 1IM9A 2CHNA 2CUIA 2J88L 2FT6A 4DN4L 5J9PB 4PTUB 1DQJB 1FNFA 1KLGB 4FFZL 1KEMH 4P3WA 1VCBC 4PJGB 2OZ4H 4BH7A 3RPBA 5IJKC 3PQYA 2ZUXA 1MIEL 2JIXA 2VC2H 3GI8H 5GRVL 4ODWB 4EBQH 1VSCA 2AXGB 1EEZA 1G87A 3ALXA 3CHQA 1IJ9A 5FYLD 1W2KT 3FB8A 5AW2B 2VERN 5KW9H 5CJXA 4LEOB 4BZ1A 1T89A 1JPFB 4XCCL 4LPTA 4CBZA 1KTDB 2DQ6A 3P2DA 2WOYA 5I8EA 4ZTOL 1YMHA 3KWTA 2R2EA 4JFUA 5C09B 2O6CA 1SN2A 1Z5YD 5C9KA 4LSRL 2X9KA 2VISA 1W8NA 1KLFB 3VYNA 5IJCC 1TQTA 2FNBA 2Z0BA 4HJ0C 1AGCB 3L9RB 1OF2B 4AQ1C 2Q5BA 3Q06A 5DHEA 4K7PX 4YE0A 2AQ3A 4RA3A 3P2TA 1WA0X 2L04A 4MJJA 4FXKA 2OXHB 1H6EA 3FO0L 3LK2B 1UCBL 2NY6C 3X3GH 1HN1A 3JT2A 1A7NH 1ORSA 3WTWA 4JG1L 2H8PB 3VE2A 4QTIL 5AAWA 3JWNG 5GHWL 1LP9E 4UQ2A 3E8UL 3WKNA 1CF1A 2CLZA 4BSJA 4HK0B 1YPZB 5JOFB 1FFPA 3NZSA 4PJ9B 4HJEA 3RE0A 4TLTA 4ELMA 4GSQA 1SJHA 1YY8B 3FUNA 1JHLL 3JWOC 4MRBA 3AT8A 3IXAA 1AIFA 2E46A 1PU0A 3RWFB 1TCRB 3SZVA 3L4XA 2SEBB 3G5VA 1HHKB 1R75A 1JPSL 3GXPA 1H3VA 1I75A 4KY1L 4ODUB 3NABH 5FDYA 4YHYC 7PAZA 3T3ME 4B9FA 2BIMA 4PJHA 3QQ9C 3SJVE 1T2QH 3L6FB 2MCAA 1RU9H 1EGJA 4HJUA 3F83A 3MV8D 2DYPA 2ZWLT 4IIQC 4XZ4A 1OSZA 3VSQA 1L7TL 3K4DA 2KYIA 3NJVA 5I2IB 5I1DB 3PL6C 5HSFA 2E6PA 1MI5E 3BVXA 3G6DH 3TEZA 2OKMA 1OAKL 3LRMA 1XCTB 1ZGLM 4PG2C 4BM7A 1ZVNA 3GBNL 4BHUA 5J6GB 4KK5D 3EJUA 4NNXB 4R4FH 3RX7A 1YO4A 1F18A 1WFTA 4EN2A 4GG8B 4Z3EA 2C4XA 1AP2A 3ARPA 1TSRA 4X7CC 4HP5A 3NEXA 1CFSA 1YSOA 1AR1C 3C5ZC 4FF9A 4PJEA 4ZMXA 2I5YH 4LHUA 4LSVL 5TTRA 4G83A 2YAHA 4WJKB 3DIVA 3VB9A 5C0DB 2NY6B 4TQIA 3RWJA 2KZ1B 1ZHWA 2YFOA 3AGWA 4Z7NE 3WENA 4LAQH 2ZPKH 1TTRA 2X4UB 3IYLW 6PRNA 2ORBH 2YPLE 3LHPH 4OFDA 1ZLUH 4UTAL 2B4CL 5DJDB 5GS1B 5AW5B 3BT2H 3MRLA 4AQ1B 1OPFA 4NZRH 3FNKA 3BWAB 2HVBA 5FM4A 5HPMB 1AS8A 1IM3D 1I3GH 2QGEA 2WV3A 4KUCF 2X4QB 2J3SA 1NGZB 4I87A 4EUPG 1CK0L 1RVFL 2AQNA 3MKGA 1LE9B 1F41A 3SQRA 3ZZLA 4AMKH 2ZXCA 1ZHKA 4FS0A 4TS6A 1KCRL 1JXFA 4ZG1A 4Y19A 2QVTA 2CNYA 1IGTA 3MPCA 3D85D 3CQFA 4JX0A 3RTQA 1XD0A 3SY0A 1JZ8A 1C5DA 2X4OB 5BQ7A 1RK7A 1OGAB 3MV7D 1J0IA 1R34A 2WWMD 4JO2H 2PP7A 3JZ7A 2MHAA 4OI9A 4OZ4B 5E2JA 2BDNH 2XN9D 2NNAB 5T3XH 1KLUB 4OBRA 2VR5A 1GGBH 1Q94B 4XXWC 3V0HA 1E4XH 1PDKA 4HJ1A 5DJ6A 1ZGLB 2O5NA 2NNFA 5DLMH 1B4JH 3ARDC 2ARJQ 3EUDA 3TT1H 3SKOA 4AQ8C 3NA9H 2UZIH 1M2OA 3QQDB 1U3HD 3PFQA 4G8EA 3W9EB 3GJFA 2R69H 4G7SB 4LVHC 2K45A 3NZHL 3Q8FA 4P5TC 5EO0B 5HDBE 3SODB 4HSAC 5BUAA 2WKOF 2B5IC 1PZ2A 1BQHG 3U1PA 5E9DB 3EF7A 3W0WE 5CHNB 4L1TA 1KXQA 1DUYB 1QASA 5F9WC 5DHMC 3EDDA 2PP9A 3IMVA 3P69A 4N2AA 3U30C 1KXVA 1EDHA 5CGBA 4Z76A 4I18C 3ZR5A 2B59B 4G6KL 5GGTA 4LLUB 4YHYB 2O5YL 2R88A 3CX2A 4G8FB 5JW5A 2D4DA 4XX1E 1Y1DA 3B4NA 3HFMH 3ZRFC 2JJSA 2IPTH 3MREA 4XAWH 4TSBL 4XBPB 5AAMC 4LP4A 2WCSA 2A6DA 4MXQC 1FG2A 1UWEL 1RU9L 3FFOA 4LAJH 3VQMA 43C9A 3Q05A 5HDRA 2EE3A 1AZNA 5DZLA 4CSZA 4PAZA 3U4KA 5IFHL 2DQTL 3SDDC 3WLBA 1LWJA 3MUJA 2FB4L 1NCNA 1M4KA 4E41E 1DQDH 4BKSC 2H45A 4CKQA 3IDJA 1NL0H 3GKWL 3MJWA 5CMAB 4C83A 2G5UA 3PUCA 2I69A 3ARVA 1T22A 3UZEC 3K72B 3FQNA 3EAKA 3KM1A 4JKPH 1DJXA 1SDYA 2DWXA 4YE4L 4FQLH 3QQDA 2H0FA 1SBSH 4OLZH 4FTVB 3OXSB 1ZJBA 1LVEA 1OOWA 1GY1A 4KJYB 3ZT5A 4WI3A 4KC3B 4XBEH 3ZL1A 3CQPA 1OP3K 3V79C 5SWZB 1P69B 1RMFH 5FPIA 3P3TA 5IHHA 3ALPA 4AKQA 5HI3D 5D7JC 1MM5A 3AG2B 5IK3B 2VDRB 4P5SA 5EZLA 2NY7L 3AWFA 1AGDB 1WZ1L 2V2WB 2YMXL 4U33A 4AVIA 5J12B 5KUKA 1E9OA 1N4XH 4JPVL 3OXRA 1DDTA 4ZMTA 4DETA 5E00A 1PZBA 2I7SA 3SPVB 3UCQA 3UYOD 1FZJA 2VSDA 1XIWB 2B8OT 3Q9PA 2VL4A 5JIPA 2H1XA 5BV7L 1MCEA 5GS2H 3KG5A 4LQ1A 5G38A 3SOTA 5GJTH 1DEEB 2QPFA 3AA1B 1JS4A 2F68X 1D2OA 3EJYD 4ONHB 2OX5A 1ECZA 4B7LA 3KYOA 2ZF8A 4CGTA 5DRWA 4XB3A 3BP4A 2A77H 3NJTA 1C08A 1BLNB 1QRKA 3N40F 4U6VL 5EA0L 5JIHA 5HYJA 2HX7A 1NDGB 3MV9B 3ZE1B 4OCNC 1M7IA 1U8QB 4IU2A 2ZKHL 4N0UB 1HXMB 5HI4D 3W9EA 4LU5H 4ABQA 5BW7C 3TBSB 3IWVA 5JW4R 2XN9E 2E8ZA 3MLSL 1LO4L 1VEMA 3LVTA 3VMOA 2NXZD 5FYJE 3SDAD 2ZE0A 5ADPL 5L6YL 3FTSA 1B6UA 3AUVA 3QDHA 4YDNA 3RL2A 3B9DA 5TISO 2EVHA 3HCVB 3MRMA 3UTQB 3O6FD 3ARGA 3HEIB 2IIJA 3D0AA 5AVRB 5GS0C 4JO5A 3D0LB 3QDGA 1TTCA 1D5IH 1SJXA 4OLWL 1GS8A 4L8DA 1Z3GL 5GHWH 2XT1B 1D9KD 3QUML 3RJDA 3GFUA 5BS0B 4Z7OB 2OI9B 3GJFB 4YL9A 5DI8A 5JW4Q 2BIOA 4S1DC 3A2SX 2IMNA 2L4OA 4JFFD 3BKCL 1TU2A 4JGJA 1UD5A 4XMKH 2RBLA 3LEYL 3TN0C 1U9KA 2WTRB 2Y24A 3AADB 1IC5H 2CJUL 4XMLL 1UD3A 2WZAA 5FO2A 3NRQA 1T5XA 3O4LA 1NLBH 4LF3B 3SQBB 3T8XB 3C8HA 4AY0A 3DTDA 5D7IE 1IGFL 4UV7L 2H0PA 3L3OA 1AGEB 2O6DA 1OAXL 2WP3O 4XH2B 3VFUB 2MNWA 3BKYH 1X3DA 2A6JB 4FFTA 4FGMA 4PJIF 5IB5A 1WD9A 5IG7B 3QXDA 2JCCB 4AYFB 5LDUA 2RJMA 1OM3L 3BQUA 1VEOA 2CGRH 4HPOL 2WLIB 2OSXA 4JFEB 2A2QT 1MJ8H 3ZE2B 43C9B 4LIQL 5DZOA 1FG2B 3UYPA 1KTRL 2BOLA 3L7FA 5ENWA 2HT3D 4Y19B 5HHNB 4KZEH 2YPKB 1L9MA 1PNDA 2OMUB 2XBDA 2P5WB 4JLRA 4Z7UE 3UCRA 5I30H 4H0IA 2KHAA 4IEFB 2K8QA 1MH5B 4BDVB 1AO7E 3RFZA 2EXYD 3A6BL 2R27A 4JZNA 1NQBA 4S11A 2APXA 3P4OB 3HHMA 2YPLA 1TZ8A 1BZ7B 5FUCC 4MAUL 4P48A 4L5FH 4KGLA 1KFAH 3QIBB 3PGRA 3NJJA 3MLRH 3LPPA 1CIDA 1U58A 3D39E 1JZ7A 5E08H 3I6GB 3EGDA 5CXPA 1EEQA 4F7KA 5KJ7E 2XN2A 1BVNT 1MDTA 1AJ7L 4P2AA 2KC0A 1ORQB 5SWSB 2A0LD 4Y4FC 3TJHD 5LXGH 3P4LA 5HI4C 4JRYB 5D1XA 1H15B 3CXFA 1I8IA 1TCRA 4M6AA 5JHAA 1Y1UA 4IRSB 5E24E 1XXDC 3HOGA 1MI5A 4GIOA 3O8XC 1ILSA 3MNVB 3MX0A 2IC2A 3MC0A 4KDTC 2A5UA 4TVPE 5G2NA 3CLFL 5IT2H 1D9KB 1EANA 3QCTL 2P1YA 3ELAT 5EB9A 5F7WC 4ZD3L 4FQXC 3AA0B 5F7UA 3QNFA 3ZSSA 3ZDWA 2GJZB 5CLWA 1A9BB 2H6PB 2GSIA 1KGUA 4PB0H 1FVDB 4Q97A 3EBAA 1KGCD 4QTIH 3II1A 4DGIH 3NMEA 1YAIA 4WSJA 1A6ZB 4P9HC 3BLKA 1IFHL 5I16B 1CDYA 4JZJC 2CO4A 1BSIA 2ZICA 4TUOA 2K3TA 2R69L 4UV4L 1YNKH 5ANME 4K8RL 1X9QA 4K5OA 4YSEA 2EABA 2Q1EA 1JGVL 1TZGL 4KVNL 3VI4E 5MENE 5B3JE 4ZS6C 2HJLA 4N2LA 2DWYA 2Z92A 4NZUL 5D7JB 1NC4B 5DZJA 1KIQB 1WQVT 4M7KL 2XVLA 3IFLL 4JO1H 4XNZC 4IM8A 1N8OE 3QCVH 2DMHA 2F1EA 4AMWA 1AAJA 4J3VA 1CFTB 1DSWA 5MEOB 5LGHL 5JYLA 1MWOA 1NAKH 4PJHF 4FI6A 3F64A 1SHMA 4GG8A 1YEJL 3CZFA 3BVUA 4PREB 2VL5A 1GMEA 5ECJE 4R90L 4MCMA 2V9QA 4ZK8A 4UDTA 4HUUB 1K5NB 1XF4B 2WWKO 1ZHBB 4F15B 4AL8H 1J1PH 1P53A 1UM4L 2H3NA 2XSKA 1QTYT 1ZV2A 3WJJC 1D6VH 3IRCA 5F9WB 4D0DB 1MCLA 4YHZL 1TNNA 3V8CA 1WBYA 1U8OA 4Y4FD 3HMXL 4DZBA 4D65A 5DO8A 4BV1A 2WQWA 1C5CL 2E4TA 5CEZD 1IAKB 3MKKA 3N50A 4HIXL 1E8WA 2CDFB 4IRJD 5C8JB 2XZAL 1QI4A 4JR9L 3F5WB 4H1LB 3P0GB 4MJIB 4XCFL 2IQ9H 4CC4C 3JV4A 2YD8A 4CW1A 4HWZB 1J1XH 1ZLDA 1KIUB 2PORA 1OIOA 2WYIA 4I18B 2JKRM 1TXKA 3MV11 5DJ0B 2WB1A 3FXIC 5CJOL 4DEPC 4FABH 3U82B 4CC1A 3AG3B 4LRNH 4PRPA 1KPRA 1FE8L 4YSDA 2EE6A 1G5AA 4FNPA 1JZ4A 4AI7A 2YD2A 1A2YB 4CMMB 1HZLA 4HS3B 3V8OA 1CFTA 3BPNB 4RESB 1WZMA 5GISH 4DT2A 3FT9A 3LY6A 1FFNB 1FSKB 2X5PA 5EFIB 1XZWA 2MNHA 3UAFA 3BKJH 1V5JA 4QRAA 5E94A 1WG3A 2OCCB 2GJJA 1I3VA 3WHE0 3BAEH 5DMYA 3UZQA 4PEEA 5D1QA 3TZVC 1DVXA 4ZO6A 1Q9GA 1BIIB 3TVMB 1W72A 5CJ8A 4UT7L 3L5XH 5F1NB 4UDTB 2YAMA 4RSYA 1AG6A 4L8CA 5G3AA 1NFAA 1ESOA 3GMMA 1BIIA 1USQA 1G43A 1OT1A 2FYYA 3KR3H 3O45B 1A3LH 2BMKB 3IE9A 4P2OC 1DQVA 3WY2A 2XG4B 3W1ZA 3A6OA 3RZCC 4NI3A 1J9SA 3QUZB 4JK0D 1W80A 5J12C 1JD9A 3UC0L 1S9WB 2APSA 3QIWD 1EAJA 3CFQA 5IUSA 2H26B 4H8PA 2NX5D 3SGKA 4J3WA 3UPRB 4PRHE 2GKIA 1QATA 2GTZA 4Y5YA 2VH5L 3B3IB 4MA8L 4UQBA 2V2XB 3D3VE 1RAMA 5JHLA 5IB2A 3OHXB 5IFAH 3VGAC 2Q86A 4UV4H 1KBBA 3D18B 3SO3B 5IR1B 5HHME 4QYOB 3BKMH 5GZOA 2VLKB 4O3XB 1S5IL 4HWUA 5EV7A 3O9WB 1T0MB 1URZA 2NY0C 1BQKA 4F2FA 5KW9L 3SJVB 3VRLF 1P7HL 2FJUB 4DGVL 3BGFB 4M5YL 2N2MA 3LN5A 4K3BA 4J27A 1WBXA 4X7EC 3LDBC 1IAKA 1YZZA 4DESA 3PG2A 4HKXA 4IRZL 1QLRB 3PNRB 4GQ9L 4EI5D 1IGCL 3WL9B 1Q9LA 3T0SA 1CL7L 1N59A 1YG9A 5IF0A 3H0TA 4PY8I 2FB4H 3X3FH 4XPAL 4TNEA 2QVMA 4Y8AA 3DGDA 9PCYA 3HS9A 5CN2A 1C12A 1JZHA 1TJIH 2HUHA 2QLYA 2WLNA 1J05B 3KBFA 4GLRH 4OGAC 5DD1H 2P42B 1NBQA 3EGSB 3CHOA 5G5DA 4HWBL 3Q5TA 5F7FA 1ZA3A 4NRYA 2BOCA 1A8ZA 3SYBA 4WGKA 3UTTE 1DJYA 5BJTB 4PCTA 2YA2A 2CIIB 1RPKA 1RHHA 3NIGF 3WAJA 4NQDD 4D7PA 2CR6A 2WNGA 2Z1KA 3BUQA 3KPQB 1VFMA 3PABB 4WHTA 5EZOL 5HHPA 3X1GA 3ZE2F 1R3JB 2BS9A 5IW1A 1UGKA 5IB5B 1S8DA 4K3EH 1CDGA 4G9FE 3IT8D 1ACYH 5FKAA 4XP9H 3OMZA 4Z7NB 1RXLA 3QNYB 4KY1H 4ZO8A 2OYLA 1NEZB 1MLBA 2KPWA 2CDGA 4QCIB 3O9WD 3SKOB 4AJWA 4BFNA 1YHPA 4S1RH 5KS9A 3WIIL 4JFYA 1Z66A 5DLLA 2F58H 3LQAL 1MRFL 3H3PH 1THCA 3KDMB 5DQJB 3VD5A 2FSEA 1IEAA 2AZUA 4G9DB 4WHDA 1MW1A 1A6WH 2M26A 3X1NA 1Q90A 5H4YA 2BK8A 4MJ2A 1JPGB 1LHZA 3GXUB 4ZTOH 4NB7A 5LG6A 3RVWD 4ODTL 3F8UB 3LZPA 2YD6A 4PW3A 5EUKB 4DGWC 4PGBB 1L6PA 1EHKB 3W2DL 2VOTA 4L37B 3K80A 1ZLVH 3SE4A 3BRZA 2VDOL 1FZKA 3K8MA 4NGHH 5L7XH 4HHAB 1M42A 1VERA 1Y0LB 3G3LA 4R83A 3T1WA 4RBPH 4XRCA 2XV2A 1MAML 1A4CA 5E4EC 1NGZA 2QZQA 1HHJA 5T5NG 5AVVB 1H15A 3BLPX 5TQ0H 2ZX9A 1Q9KA 1IGML 1GYUA 1S5HB 4MXWH 4ODVH 4PJBE 4Y2NA 4Z7VE 3E2HB 4DPBX 2IWVA 3W0WB 1A7OL 3H55A 4WCYL 3HZVB 4HA1A 3QIWB 2CBPA 4DH2A 1E6JL 1P1ZB 4NYLB 4RSVA 4NZRL 1XT5A 7PCYA 1INEL 2ZUWA 1BX2B 3ZZ1A 4B97A 1GA2A 5BRZE 2NSMA 4QXGH 4R97C 3UG5A 4J4PA 2Y7SA 1P7QD 1RUQL 2R2BB 1U3ZA 4BWWA 2OTUA 2BSTB 3P4OA 2PCPB 3C5SA 2P3YA 5MP6H 4QPEA 4PMFA 2GY5A 3WN5A 3WJLC 3BKCH 2ODHA 2XRAL 1EXHA 4H0GA 1FH2A 5B8CB 2AJSH 2VR8A 1ZHTA 2Y25A 4LCWE 1KN2H 4GT7A 1JE6A 4DOHB 3IJ9A 2WN2A 2JWYA 4KMLB 3CIQA 1U8JB 5F0JB 5GGRA 1C7TA 4J39A 4KMTH 1U21A 4W9JC 4FZEL 5ADOH 3C8KA 4ZYKA 3NSJA 5KYWB 3W82A 4PRHA 2W88A 2H32B 5D1ZD 1BZ9B 2C3XA 4KO5A 3M17B 1WBXB 3LN5B 2XZCL 1DEEA 4K7PH 4Q52A 1DLFH 4YSSA 1J9RA 3BAKA 3T8XA 1NEZG 3BIBX 1PX4A 2R1YB 4F80A 1WHPA 3FQ1A 1HH6B 4K94L 2E7DA 3RDTB 3ESUF 4Q6IA 3X13B 3QPKA 5HGHA 4FRXA 2FHCA 3DVIA 3GXIA 1F3DH 1QHOA 2BP8B 5F96H 2IAAC 2FATL 2GTZB 4FL4C 4PRPD 5FFGA 1QSFA 2X2IA 5I9QC 1GOHA 4Z0XA 3VXQB 3SGDH 1ZLWH 1HE7A 5GS2D 5F8QC 1SLXA 1J1OH 1T03L 4AITA 5EF3A 1T4WA 3FUIA 2G5RA 1A4KA 1RUKH 5DZAA 2X27X 1WWBX 2J2ZA 2AJYL 4TMPA 5DK3A 3TX4A 4YAQA 2WPGA 1U93A 4YXLH 2LE9A 2FWUA 2R0KH 4IS6B 3VX1A 4OT1L 3WNNA 3A3YB 1A1OA 5F3BA 2J6EA 3BVWA 3EG9B 3DI2B 5C09A 2VITB 1GSMA 3HHSA 4X4ZA 1AOHA 1B0WA 4MMXB 4QHNB 1ZS8A 4QAWA 5AWNL 1XR9B 1YCSA 1OQXA 3MV9E 1ZLUK 4P46C 3OGCB 1W9XA 4HOWA 5JIMA 1GZPB 4OLXL 4MQSB 3NIFF 2L3BA 1X5IA 3QJFA 2A74B 3QIUA 2HFGL 4YGAB 2CHZA 4MSWA 4JFDB 2XPZA 3HMWL 3V0JA 4DWHA 1WFJA 1MNUL 4FNUA 3X11B 1U8IA 5E1AB 4TYUA 3WDJA 4Y4KB 4Y9GA 4W81A 5FYLL 1S7SA 5EIIG 4HUNB 2CIKB 1I3RA 1M1SA 4L23A 1E6JH 2X1OA 4NQXA 1CO1A 4YOKA 3N5AA 1OTUD 1Z9PA 2Z8VC 4UIMB 4ZAKA 4NXSA 1BQHB 3LH2L 3J8F7 4O2CB 4RETB 4RZKA 5DMIH 3BWUC 3PJNA 3QPQD 3L4CA 4Z7OE 2AXFA 3CC5A 3PAZA 2JJTA 3LKPA 3F85A 5D7JD 1KPVA 4TQPA 3DX2A 2C9VA 1P4TA 3LS5H 1M71A 1QA9B 2I85A 5KZCB 3MROB 3HUJB 1ZANL 2VXTH 2WC7A 1K8DB 2XV3A 5ITBH 5MEQA 3IXTB 4CU7A 2RAMA 3OR6A 4LLQA 2P49B 5DS2A 5SWZD 4LLDB 5E5UB 3MRRA 3GRGA 1C5BL 2DLFL 2NY3D 2IFFL 3BEWB 4BFKA 5KBKA 4NM8L 4OCLC 4E9QA 4APXB 5I1LA 5FYKD 4NBYB 4FD0A 2DJSA 2EIMB 2PKDA 2WQUA 1HEZB 3M7FB 5CU9A 1WFOA 1Y6KR 1KIQA 3H9SD 3QS3A 5EOCL 2PNDA 1HFUA 4OJFH 5E6SB 2QKSA 1SGKA 4ZPTA 4UT6H 3K1KC 3VM5A 3B7UX 3ZTCC 4Z77A 4YHOH 4XI5D 3KPMB 5KWYC 2ZAGA 1X5GA 4JFEE 1ZEAH 1CR9H 3S8GB 3TZVA 2HXAA 4LKCB 3H9SE 3X3GL 2HFFA 4AL8C 4U7KA 4OFPA 1ETZB 1SHSA 1CYGA 3GSRB 2XXFA 4IMKA 3NIGB 1QACA 4QXUH 4ES8A 3ULVH 1C9SA 1CE6A 2NYZA 5DEJA 5J6SA 3EOAB 5KAQG 4YSAA 2AEOA 3QCVL 1DUYA 2NY7H 5M7QA 4IJ3C 1GFOA 3DX8A 4P2YA 3STBA 4MA7H 4TLSA 5FGSA 4J7RA 3T6VA 3PGFH 2WVVB 2GJ6B 5IBTH 2NXYB 4YXLL 5HHOB 2BO0A 5DWPA 5EN3A 3CZNA 1JRHL 1X5YA 4FQHB 1TSHA 2X6AA 3N2JA 4ONGL 2BSCA 3O9WA 3D7PA 2Y5TB 5FHBH 4AIOA 5GGSB 2NY3B 3FK3A 2OYMA 3IAQA 4YFDB 2N0KA 2EDKA 5CBAA 4HKJB 1KLUA 1MZYA 4GSXA 3GI8L 4EBQL 3F7PC 3TZGA 3C6EA 3LSOB 5TDPA 4FQHA 2XKNB 2DWSA 1MELA 2XN1A 1Y0LA 1UEYA 1OTUC 1DE4B 3EJYC 1EHNA 3UPRA 1ACXA 2IF7A 1WC7B 1ZOXA 4YBQC 5I73C 4YDIH 2YRLA 4FQQA 2I5YL 4F1SA 4ISVB 1KXVC 1KCVH 4PJEF 3BPCA 4J4PC 3GIVA 4WFFE 4UDUB 4OZFG 4M9OA 5JOPE 3B9EA 3LKOA 4MD4A 4FQIL 5KYXA 2R7EA 2ARWA 3GSRA 1RPQA 5INDB 2JLPA 4X6EB 1KB5A 4BFFA 2J1NA 4YN3A 5ICZA 1SJHB 1OSYA 1LE9A 3M8OL 3B7YA 3SB3A 4MD4B 3EFOA 4GRLB 1XD1A 4OGXH 1SY6A 4WLCA 5KVFH 1IC4L 3P02A 4HJJL 4XHJC 2W91A 3MZTA 4PLJD 3ML9A 1U42A 4KPHL 5I1HL 3TBBA 5D8JH 4XNMB 2IXQA 3LNGA 2V5MA 1G6RB 1UACH 4ZPVA 5LG1A 5DD6B 3L3DB 2LHFA 1E50A 1F2XK 1ZA6B 3PGSA 3KS0H 3BAEL 5MENB 3OLDA 4HUCA 4NCC1 32C2B 4AYSA 4PJGA 4D9QE 3BLBA 2ICWJ 1BJ1H 2APWA 1U8NB 3HPLB 4MCYA 2FYVA 3TPUB 2J12B 4A2LA 2D8KA 1E4KC 2WXJA 3AREC 4NNXA 3HG4A 1KIUA 3OTTA 3QUXB 1P9MC 5DYFA 4PD4J 5GSRA 3H6AA 4LQFH 1UD2A 2DMGA 3CMOH 7TAAA 4IDJH 1XGZA 1O7SA 2G3ZA 3HNSL 4NLAA 5FWQA 5DD0H 3WU2O 1N8ZA 5J8OA 1G9HA 2E56A 4OLUH 1JK8A 2EDLA 1E9PA 3NYKA 4HKXB 1LMIA 4X8JB 4YR6A 2ADIB 2AK4A 2VM4A 2XICA 3KLAB 4YHKL 1H6S1 3FMGH 2RFXB 5JHLL 5DTFB 1LGVA 3CSPA 4JFQA 1CE6B 4JDZA 5HGDA 2CKBB 3CLWA 2FBJH 3KPPA 3PWNA 2BSSA 3IJ7A 1NIAA 3IXAB 3QA3A 1H6UA 1S5IH 2YUWA 3RL2B 3CSYB 4PJFA 3VFPB 1HHKA 3MLVH 3H3KA 3QC5X 4HAFA 2NY3C 5BO0D 2JFCA 4JFOA 3RWEA 5C0JA 1Z3RA 5EUOB 3IGAA 1OAQH 1OP5K 4WU7A 4F8QA 1AHWC 4PLJC 2LQRA 4UQ2B 4CJ1A 3KYMB 3GSXB 2NXYC 1MUJB 1U8QA 4IU2B 4GG6F 3MDJA 1HYSC 2BVQA 3ETBJ 1I7TB 3RAJL 3VJ6B 1RUPL 1PYWA 4QRRD 4RVBA 5DL6A 2H26A 4Z7WE 1JRHH 4H8QA 3GK8H 3WNOA 1ZSDB 1LDSA 2BLFA 3FBKA 4J4PD 2IDSA 3ZHLA 4WV1B 1T1ZA 3DOSA 4YHML 1I9JH 3FJTA 4DO4A 5EEXA 2BXYA 3L5XL 4LLDA 4X80H 5KSAD 1FN4A 3VVVA 5CD5C 2VMCA 4F15C 4F33A 5AOIA 2Q7AA 3D48R 3D4CA 1TCMA 5EU6D 5BOJA 1PGRB 4WNJA 5IB3B 4KJWD 2Y2WA 4FEIA 2LVCA 4CAGA 3Q8BA 3PFUA 1U33A 3ZMRA 3IKKA 4HS8L 3B83A 1QLEB 3NFPB 4EXPX 1DO5A 2W07B 1YMMB 3CZEA 3EOTL 5SWZE 5D4JA 1XR8B 3UX9B 2RHEA 4I3SH 5CEXB 1JDAA 1C16A 1KGXA 3BYYA 3CFDB 2BWIA 1X5KA 4X5WA 4BINA 1P4IL 4LHQB 3VD9A 1KG0B 1V05A 5ERWA 1AXSB 1P4UA 5KVFL 3VYPA 1F1AA 3LN9A 5DFTA 3CFJA 3LK41 3DV6B 5JHBA 3HLKA 1W15A 4PVBA 1WAAA 1XF2B 1RJLB 3RWEB 1WTGT 5IWLC 1YN6A 1KG0A 4QXWA 5ERWB 4AW7A 2FGRA 1CS6A 3ARFB 2NNCA 4XXDA 3O2VH 4DIXA 3VXMB 3KPNB 4OD2A 3S48A 2ADIA 2AK4B 4OJYA 1CD1A 4HS6B 4XE0A 4K9EH 3OF6D 4QY8B 1G7QB 5MEND 2ERJC 3T65A 3C6LC 4CN1A 4IBWA 5MP6L 5ICYB 1LEIB 4O51A 4U6XB 3U4BL 2XHNA 1ZLSH 1A7RL 4G7VL 4Z7UF 4L4JA 3KXFE 1WBYB 3MRGB 3ES6B 4O9HH 2DB8A 4EDXB 4TKWA 3K6SA 4WF7A 3OC5A 2TRHA 1L7IH 3OKDB 5MHSE 2QV2A 5EUOF 5FYKU 1KN2L 2ESVD 4Q4EA 1HH9A 1N0XH 2J5WA 4NN7B 3KD4A 5A16B 2X3AA 5JHDD 5GSRB 4IEFA 2WZPA 3TL5A 2V17L 5ESVB 5CO1A 4Z7AA 2JI3A 1J87A 2BJML 1B0RA 1EXUA 1TO5A 3GMNA 4G9FB 4OZIE 4NHCL 6CGTA 1BBJB 5JQ6H 4X83A 2NX5B 5LNDA 1EDYA 1JDCA 2A9AA 3DETC 5JHLH 3JCUO 1MIEH 2VC2L 2GITB 4D9RE 1LK2B 1MCRA 2HJFB 4K2UL 3ZQXA 5EO0A 1JGUH 2VDML 3W0WA 3REVB 1F6AA 3WEOA 4WW2C 4XR8C 3WO3B 2XQYA 3K6NA 1TYJA 1H8LA 2VRQA 3FB7A 1G9EA 2H7WA 4ODXB 2IBGA 5EPMB 4HUVB 3OKLB 2R1YA 1KJ2H 4GP5B 4LKXA 4UZSA 1WIUA 3DSNA 4C57C 4PJ5D 3KPSB 5IROD 1OGTA 2OMYA 3H54A 3BE1H 3LKOB 2J7LA 1PX3A 3M45A 4DCQA 2V5TA 5GQBA 4BELD 4KK6C 4TSBH 4LSIA 4OF8A 4XBGB 5KSUA 1P2CA 2YEZA 4DUVA 2WBJC 4LLVA 1USZA 4DCQB 3F7KA 1JF5A 2WWNA 3DDFA 5I76B 1LK3L 4F3FA 4MX7A 1EMTH 3TO4D 3FRUA 1OV8A 3OKKA 5FYKH 3ZN6A 4EI0A 3ZE2E 4G6JL 2DF3A 5EU6B 4Y89A 5I0WA 1KCSL 4Y19E 2PABA 1F8TH 2F5BL 3AS2A 4M61B 4TULH 5EEUA 4N8VA 4RGNC 2Y0HA 2ZZUT 3PGCA 1T5WA 4C4KT 2AHIA 4NWUL 5E1HB 3GLDA 3NTCH 5DJDA 4CKVX 1F6FB 3L4UA 5GS1A 2K0RA 4R26L 3QORA 1BAFH 2GITA 3FQWA 3SDDA 1R33A 1DN0A 4P3DB 3IDNB 1UWGL 3IWUA 4Y2DC 1M3IA 3P9MB 1Z5LB 2WD0A 3IRPX 4L4TE 4X5XB 1E6OL 3HRPA 4JN2B 4MAUH 1ETZA 1CLCA 1SQ2N 4FQ2H 3TBTB 1E3ZA 3O3AA 5ILTL 3O81A 1T20B 4BWTA 1V8HA 3W38A 5L8JB 1FI8C 1QKZH 4YSUA 2E5EA 1DLHB 3HAEA 3OKEA 3PXJA 3V0DA 3NK4A 3N06B 1Q8MA 3ES6A 1YLBB 2ZCKH 2G0KA 3QNZB 5DJ2B 4EQ2A 4YS4A 4NIYE 5FECB 2OULB 2AK1L 3QFJE 3BUYB 4NO0D 1EEYA 1O6VA 4GMTH 5D6DA 3NBNA 3EZ8A 2HKFH 2OZ4A 2FJHA 1EERB 1G7QA 3I02B 3HC4H 2ZCHL 5DUML 3G6JA 2YEZB 1O6SA 5DK0A 3SD5A 4I0PB 1FV1B 1JDDA 2HT4D 5D6CA 3JTSB 5FA3B 2Q8AH 3RVWC 1HL9A 3C12A 3KPNA 4QRQA 8PAZA 1IRAY 5GPRA 2VQ1A 4GSDH 2N0MA 4MMXC 3TO4C 2F54D 3U9PH 2QQQA 3IXTA 2YXWA 1V3JA 2ESVA 3JT0A 3MRRB 2R8AA 3V6FB 4RMVA 4NENB 1NEPA 4OCMC 3FOMA 1G94A 2BC4B 1TQCB 1KYDA 4Y5XB 1EVTC 2V3EA 3CFNA 4N90D 3AUWB 4E9SA 4Y2OB 4KKNA 2R23A 5IFAL 1E43A 1MFEH 4LSPL 2JKTM 1QNIA 2IGFL 4UQ9A 4XNBA 2JNZA 4N0YH 5L9DH 1QQDA 3HJEA 1J1OL 4J2XA 1F3JB 4WWID 3FU9A 3HE7D 1U6AH 3GZKA 3MLPA 4LHJB 4UNIA 3MRMB 1B0GB 3MV8A 4FLHA 4NQSB 4KVCH 3LQMA 2WLYA 2A83A 1QSEE 4XNUL 3TEUA 3RY6C 3LQZA 4RFOH 1Q0YL 4YC2C 3LKQA 1PD6A 1DJHA 4F8PA 1L5GB 4OFVA 2PWEA 3S4SA 3LZOA 3WEAA 4DFHA 4YNYA 2VR6A 2XKUA 3AABA 4HUKB 5FLUA 1MFMA 1CDHA 1QFOA 3QIUB 2DQMA 4P23B 3TV3H 3SBWA 4XNDA 1ETA1 5A3ID 3TH3T 4UB0L 3KBPA 1BLNA 1GYAA 4C54A 2W1NA 4DO5A 3WHXA 3JYCA 3EHBD 3FO0H 4NJ9H 5KSBF 2EIZA 3QRAA 5E4IA 4A66A 1H3PL 4WTQA 3ZDXE 3BFWA 1JPTL 1I7RB 9CGTA 1BLIA 4N74A 1OK0A 1P7KA 2JB5L 2YAOA 4HIXH 4KKBC 5DEGB 1K4DA 3U2SB 4UUJA 3ET9F 3IDGB 1JWMB 1GY2A 5DA0B 1S9VB 4TQHA 1JYWA 1QEXA 3K2UH 2IBBA 4L1LA 4MQTB 2BRRL 4F5CA 5IB2B 4U6TA 5TE6H 4HIIB 4KKCD 3U46A 3QVAA 3OR7A 3KPOB 4RWHA 4KDWA 3RIFK 3CPLB 3N42F 1AGDA 2V2WA 3L3IA 3ZJAA 2YMXH 5AG9A 3GSQB 5DMKA 2IDUA 3RNKA 3NSGA 1IGYB 3WFDL 3KGTA 1RIUL 3BO8A 3GHEL 3BQUD 5D2NE 4NQSA 1JRHI 1LL1A 3OF6A 3SBRA 2QQLH 4JRXA 3DX6A 4KJPC 4HQQL 3VXUB 1K3ZA 1F3JA 3MV7A 4K3JL 5B7EA 1W0VA 4B9ZA 3GSOA 4L48A 5M94B 1XF5A 2DBLH 2G2NA 2LABA 3MRKB 2GI7A 2FGWL 3MLXL 1LEKA 4P4RA 3QUYC 1FVCB 5HGHB 3IU3B 2ADFH 4HV8A 4NN7C 4BRVA 4L8BA 3DECA 3E2HC 3H42H 5HYQB 5E2UH 4WK2B 2CIKA 1J8RA 2X4QA 1CDUA 2Q76B 3QE5A 1ZPUA 1U3HC 2PO6B 3CU1A 4GKSA 2EACA 2YPVH 2FO1A 1ZHZA 2EEBA 2R56L 2ZOOA 2VXQA 2WXQA 1MXGA 2P47B 2MOGA 3B6SA 3BSZA 1BG1A 3LH9A 5L2KB 3AB0C 5KVMC 1I7ZA 5FGRA 1MXDA 3S3DB 3WLBB 1NAKL 4HAGA 4DK6A 4U4BA 2DZEA 4PU2A 3LPGA 2IXQB 3BRYA 1TVHB 3MBEB 5BV7C 1UOLA 4BCYA 1I9IL 4MAYB 2AZAA 4HT1H 5EOTB 4MMZB 2IDCA 4BEIA 1F4WH 1Z9SA 2ZX5A 1YC8A 1UYWH 2DEWX 2P5EE 1F86A 3KYMA 1MFUA 3UO1L 3L3GA 1T7XA 1CN4A 4G6ML 3V4VH 3E8VA 4AIZA 4JY6A 2UZIL 1C1EH 1UB6A 1GZQB 3ZKSD 1S7VA 3MA7B 1A9BA 4ZSOA 3QFJA 4I3GA 3CLEH 2P46B 4YSRA 2ZXBA 3VCLB 4YEEA 1DFBL 1QQDB 3BPLC 4P9MH 4U2YA 4AVJA 2AJXH 4N8CH 2VR7A 4P2QB 1G1OA 2X4RA 4XTRC 1S6NA 4PJXB 3RWHA 3TEWA 1AHWB 2A77L 1FFRA 1YJDH 2NQ3A 5DHYA 2OV0A 3P0YL 4H8WL 1WISA 4PGDA 1T21A 1AIFB 1UD6A 5MERB 4KQ4H 3QWQB 5DLML 2RGSA 4L29B 4WI9A 3UROR 1OL0A 2BS8A 4P23D 3ARED 5T3XD 3FT3B 5LUMA 3DO7A 3G9VA 4AQ8A 1N67A 4FTVD 1IGIH 4O5LL 5D7SL 2X1PA 3PGUA 3IM1A 1IC7L 3FOLB 4XMWA 4HULB 3GK8L 3US0A 5JHMA 3VWJA 1SZNA 2WXRA 2CUMA 2GBTA 5F1OB 5DVPA 1YYCA 2R4RH 3EYUL 5F7DA 1QPKA 5FFOA 1PLAA 3JTTB 2C5DC 4K3GA 1KNOA 3FKUS 3FAWA 2FX8L 1QLFA 2YD9A 3LXBA 4LRIA 1DSFL 1IE4A 4E9YA 2DD8H 2YJLA 3VA6A 5DHVB 1QHPA 4HF5H 4KZ0A 4U1HB 3PRZA 3U9UA 5LCVA 4ODVL 5KS9B 4ETQA 1SEQH 4JPQA 4P4KB 1PPIA 4UZGA 4N3UA 4F2EA 5IVZA 2CAKA 4N86A 4XBEL 3TBTA 3Q01A 4EI6A 4PW4A 5CZXC 3OHXC 3H1ZA 3ZY7A 1NBCA 1U95A 1CICB 4H8HA 3O2VL 5JPMC 3VXUD 4EI5C 1TETL 1KENH 5KVDE 3ZDYB 4U31A 1ICTA 3F12A 4J28A 4DN4H 2KMWA 3VFWB 3V6BR 2ADFL 4HEPA 4UT9L 1JGLL 3GPEA 3WUWB 3O6KH 3V4VB 4NUGH 3BD3A 4MDIA 4UCFA 4GW5A 4FQ2L 2P80A 5KAIO 1F56A 3MRDA 5FOBA 4ZW7A 3F6LA 1PJ9A 5IHUH 1MFDL 5DDHA 3WGVB 5C0CA 4XBMA 4O3YA 2GPZA 3UACA 3AREB 4K5LA 2M07A 4ABWA 4EOWH 2B2XH 1KYOK 1T21B 3WAKA 2YFNA 4E5XA 3PWPE 1HHJB 1SUJA 5INCB 5AEAA 1J86A 5IB4B 1XV8A 2FWOA 3EGSA 1OAKH 4JQIL 4PJGF 4NO2A 1G1KA 1MFAH 2Z7YA 4POZD 3GS0A 4OF6A 2QVIA 2Z7WA 4NQCB 5JXAH 4CC0A 4KKZA 4FQEA 1BMWA 1CGWA 2VWEE 2BVOA 3PWPD 3X2QB 4YWGH 4IIQA 2OFQA 1I3UA 3MODL 3QDJE 4KRMB 5AW9B 1AQKH 1ZHYA 1I1YB 1YEFL 3ZL4L 3L6FA 4X8CA 1J9TA 3LPOA 2FQDA 5FGCE 5I0ZA 1ZD6A 4RAVA 4QMEA 4LPXA 3V9CA 4UYQA 1UG9A 2F7OA 3RZWA 1OQOA 3DYOA 3GZOA 3SDYH 4AQEB 1CXKA 4GKNA 3SPHA 4BE5A 5FCSH 3GZPA 2VJ0A 4I8DA 1ZIAA 5A7BA 3I9AA 1KTCA 5L6YH 4Y5YB 1ET8A 4MTMA 1M7XA 1ZKAA 3QFDB 5K9QG 1T6WA 4YGVB 2ARJA 2OSLB 2X38A 1UT9A 1LTXA 5EUOE 3HBGA 4W6WB 3C6LD 1QR1B 4W9IC 4LCWB 1IILE 5CLZA 2F7PA 3FFDB 4AWJC 2NX5A 5HDQH 4FKHA 1IZJA 2QFPA 5B38B 3L1OL 1UB5B 4IOIB 2ZX8A 3BPNC 1SLVA 2R39A 3HB3D 3Q1EA 4XP6H 5I1KH 4GQ9H 4Q6IC 4S1SL 4GUOA 5JQHC 3FW6A 2X4TA 1A47A 3FSVA 4HWBH 3KPLA 3U0PA 1T2JA 5H35A 5HYQA 4APXA 3TS8A 2DDQL 2HSIA 1NGWB 4LOUD 4NIKB 3PY9A 4JEGB 1MJ8L 2J44A 3QULB 3UJTH 1W72B 4GI9A 5FO8B 4JFFB 1P1VA 5AVUB 2X9WA 2WUBL 4YDKH 4N58A 5EZJA 3LB6D 3HVNA 3TPKA 4UTBL 5K9JL 1BVKB 1FCCA 2DRUA 1EEZB 3WIHA 4ZMVA 1HXXA 4IRJC 3OWEA 2MRYA 1DL7L 3DWTA 4XNZB 4AQAB 4AJYV 3BO8B 1WEJH 5F1IA 4HIPA 2CGYA 3E1ZA 6PCYA 3K6OA 3MA9L 1PKOA 5TE6L 4A2HA 3FCGA 4G8IA 4CILA 2EXSA 1ACYL 4M4PA 4N9GB 4FYSA 1MJJB 4GO9A 4FYRA 4RIRB 1WYJA 1IGFH 3QJFB 1OSPH 5KANI 3MHZA 4PJXA 2A9NH 2M06A 3RWHB 3NABL 5DQ9B 4UM9A 5GGSY 3TCXA 3VFNB 1IIKA 3ALWA 3AACA 1EO7A 2F8XC 2WBJD 1ACZA 2XFXA 5F9JB 4GAYB 3CAFA 4NFCA 2YGOA 4XN9A 1NL0L 3AAAB 3BQVA 4XPBL 2Y36L 2CH8A 2IAND 1XQ4A 4ZS7L 3ZR6A 3CWGA 5T1LA 3IJ8A 2M1KA 3SOBL 5IM7B 4O4YH 4A6YL 4FXLA 4DP9X 1HYRC 3ZKMC 4IBSA 1CLVA 4YNYB 3SZKC 3UJJL 5I8OL 5DGQA 2X9YA 1PLGL 5F3FA 35C8L 4S0TD 4X6CB 1QO3A 3F3HA 4JFDE 4HAKA 2XWTA 5E00B 3OKMA 2OL3L 2VT0A 5JPNB 1JTOA 3B37A 3L5WB 4WFHD 1AR1D 3EH5B 3HR6A 4OH2A 5LN4A 3UBFA 4XCYB 3EH2A 2ESVE 2IAMC 3ZE0F 3B7RL 2A83B 2WINB 3LIZL 1ZCRA 3NJMA 5CFAA 32C2A 1DVSA 3RZCD 5HYIA 2CBTA 3RWCB 1OT2A 3VFOA 5T1KD 1ZHXA 1G7JA 1RZJH 1S7UA 5DZVA 5AVZB 4HT1L 4AJVA 2QELA 3ZUCA 3DIFB 4YGVA 3ATBA 4F24A 2QSCL 4KUZL 4MZIA 1QRND 1ZVHA 2UY6B 3HC3H 3LK42 1YUHB 2BRQA 3OMAB 4MD5B 1UXMA 4NC2B 5T3ZE 2UUDH 2B08A 1N4XL 3UXFA 3GMRB 2EEXA 4HWZA 2HT2C 4X6DF 4NNYB 3RBGA 3GSWB 2VLRB 1O6TA 3FT0A 3MCLL 1QZNA 3PHOA 1NLBL 2CJ3A 3SHSA 1R5WA 2BVPA 5I6KA 5LWYL 2GK2A 1NIDA 2CLRB 1W0VB 3NK3A 1DSYA 5EBMB 3IEAA 5E1QA 3TA3B 2HPTA 4BSWA 4QOKD 4G5ZL 1CI3M 3RWIA 1ODAA 4N26A 2F8IA 2VN6A 4N2KA 3QK0A 1BZ8A 1UM4H 3SE9L 4ENED 5C0IA 1QWNA 1NCGA 5CINH 3B7TA 1DBBL 1DBJL 1ETB1 5GRJH 4ZX6A 3KPSD 4M48H 3VXMD 3DYMA 3MX0B 2ROYA 4TNFA 1BZQK 1IC0A 4YHKH 4X0KA 3QG6B 3LCYA 3GKWH 3VMNA 4LSQH 1VFBA 5CCGE 1QI5A 2MCPH 3AGVA 3C8DA 5BMFH 5EU6E 1ITCA 1B3IA 3P11H 4AQ1A 4XN1A 5FK9B 2MKWA 1FYTD 4OFQA 5DC4B 4CN6A 4L2YA 1MCWW 5CUSL 3WUZA 1T03H 5AVTB 3NSDA 2BOBA 1X44A 3X14B 5JUEH 4NZUH 4WUUE 1CTMA 2DIJA 1M3JA 3WEBA 2KERA 3ULUF 4NUJA 2ZUQC 3BZDA 3KPQA 3FH7A 3HUJF 3H7BA 2FATH 1U95B 3N43F 2BOBB 3D87B 2HRLA 3G9AB 1B9ZA 4J8QA 4OSUL 4OCRH 4PJ8B 4AKPA 2XTQA 2UZYA 2WVPA 3QXWA 4G6KH 4XPHL 3ZLQC 2AJUH 4F58H 3US1A 1MVFA 3S8WA 1PY4A 2P5WA 4JM2F 4M61A 4QKXB 4PRDA 3N9GH 2VLJD 3WDIA 5KSVB 4QHLB 3RWGB 4L2LA 1LE5A 1TG8A 4OKDA 2Z34A 4XRCB 4Y16C 4R4FL 1E54A 4BDVA 3GNMH 3V4UL 4IRZA 1TMCB 3OPZL 1UQSA 3TA3D 5IROC 3JZYA 4B9IA 1BREA 4OCXL 4PGCB 4PJAB 4POYA 1Q1PA 1BEYH 1HTYA 1YDPB 3QI9A 4KHXL 1ZV9A 4L1DA 1QFWL 4YDVA 1E2ZA 1Z32X 4FG6D 1F3RB 1U41A 2G0LA 4NZTL 1JOIA 2LW3A 3RPIB 4GSDL 4PS8A 1DN2A 3O4LE 3TYGH 4PJ5B 4G9DA 2B2XL 1E5AA 3FU7B 5EN2A 4ZW8A 3GXNA 5D7HA 1HVXA 2R2HB 4GAAA 4B9CA 1MAKA 3CHRA 1JGEB 4QT5A 5ESAB 3REVA 5KN5A 1KELL 1ZXKA 3NT0A 1U8MA 1W72H 2ZAHA 4GG6E 3SN6N 1MJ7L 3GO1L 3L1EA 2EADA 1RZGA 5E23A 2V7HB 2Y7OA 4QRTA 1QA9A 2FJHB 3VG9C 2IV9A 1R3HB 4AV4A 1EZSA 1XX9C 4JG1H 4LHUB 4DGVH 3MNDA 4DKTA 5D7IA 3ULVD 1NLDL 3OHMB 4FMSA 4DSYA 5IYUA 2C4FU 5M95B 2CE6A 2H2SD 3VE0A 5KSVA 3MNWB 4HX1B 2Z31A 3V0GA 5CU5A 2LLNA 3ARBC 3DLQR 1FAKT 3L3GB 1WO2A 5L7XL 3QCUH 1I1FA 2E9BA 2V2TA 1BOGA 3SDAB 4QHPA 4G8GD 4HFWB 5KBPA 1HI6B 2IPTL 3VXOA 1N0LB 1EFXA 3WJJA 1Z6JT 4YZWA 4ZSOE 4KXDA 4BQCA 3IFOB 1IV8A 2XFXB 5F9JA 3BGMB 2A74A 1HOCB 4E5XG 2ITEA 3WS6A 5IF0B 5HHMD 2OL3A 3CE1A 3NJLA 4G2AA 3ME0B 4XZUB 2R4OA 1OAXH 3QORB 3SIKA 3LKRA 1F90L 2ODJA 5CBEA 5FK9A 2OMZB 1UJ3A 2J55A 1XF1A 2EXYC 4OD2B 4M8QB 3K8KA 3K4AA 2XN9A 1XGPA 3COOA 4OJFL 2BVUA 4LMQI 3ZIYA 3I6LE 4WI8A 4LESA 1MFNA 2D3NA 3DXAE 3RDTC 5ADPH 2VZ1A 4E1SA 1QFWI 5J57B 4OM0H 2VDLL 1MIMH 1U3HA 2XZAH 2J2ZB 4GMSL 2TAAA 5E7FA 2LU4A 3U25A 2DIAA 5FDWA 3CZLA 3VFOB 1ZE3C 3QJHA 3CD4A 1DCLA 2B3IA 5HVHB 3ULUC 1MCOL 5T1MA 1JHLH 3FYEB 4LFHG 2FRGP 1N12A 3C9NA 4KOBA 1CLOH 2GTQA 4O02B 2CA3A 4XTRD 5IB3A 2V5RA 3OXSA 3PRNA 1N18A 2RB8A 4YSOA 4FZNA 3P4MA 5C1MB 3F04A 4KJYA 2BW4A 2VDQB 5FUZL 3LXUX 5I1JH 2UY7B 3ARDB 1X7SA 4U1MA 4R4BA 1N3NA 2DQIL 3VW3H 5JORA 4WZ9A 1CFBA 1NDMA 3FUKA 3HMXH 4PJ7B 4MCZB 4TV3A 1ULVA 4KHTL 3S3JA 1OAYL 1ZT7B 4Z1PA 4X4YA 3HC0A 3ZPDA 5I66B 3RU8H 3B2UD 3MV01 4Y1SA 4FQIH 2D73A 3ZYZA 4ZFGL 4ZW3A 2E9IA 2ORBL 3LHPL 4UTAH 4PTUA 3T3PB 2B1AH 4UWQB 4XI5C 3ZTJG 4QHNA 1FGNH 3CK0L 1I1FB 3L5JA 4W9FC 1HILA 2BIHA 1PZ5A 3Q6FA 2DM4A