2W81C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 242
sequence length 242
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w81C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w81C01
2KDYA 2KC0A 4O4UA 4QQ1A 4AYNA 2W80C 3UAQA 4O49A 4U9CA 4O3ZA 3PQUA 2LFUA 4O3WA 4O4XA 4AYEC 2W81C 3HOLA 4AYDC 4O3XB 4O3YA 5T5FA 3VE2A 5EE2A 1YS5A 2YPVA 3PQSA 4Z3TA 4AYMC 3KVDD 3V8UA 3HOEA 3VE1A 2Y7SA 4AYID
chains in the Genus database with same CATH superfamily
4PG9B 3FC8A 2D3LA 4NN5B 3KJ4C 3MXVL 3TF4A 2YZ8A 5EEZA 4P9HL 5CSZA 3M1CA 1JWUA 4FA8A 3CFDB 2DYRB 1OCWH 4UV7H 3MNVA 5GIRA 3FTYA 4A2LA 1KCUH 2O5XL 2X12A 3P11L 4J3TA 2CGZA 2W1NA 3DV4A 1JDDA 4AEHH 4BH8A 4KZDH 3LNEA 1AHWA 1QI5A 1T66D 4NZRH 5KJRH 3RTQD 1HCVA 2YSSB 5E24E 2W94A 2FX7H 1MCCA 1Y0LA 3BKYL 3RIKA 5JOFB 1H15B 4JQIL 2GITB 4BUGA 5JW4Q 25C8L 3MV9B 3THML 2NZ9D 3OX8B 1KELL 3WSQL 4I18A 4HAKA 4MJJA 2A4CA 4HIHA 5A2AA 4G43B 3SE8L 2WANA 4OFPA 3F64A 4HLJA 3H42L 3Q48A 4R83A 4X7TA 1ACZA 5DI8A 1AS7A 3ETTA 4LRIC 2EE6A 5FCUH 1NJ9A 3B2PA 3RAJL 5D55A 2GBTA 5IQ9A 3FUMA 1AGFA 1N3NB 1ZANH 5C0BD 3BIAX 3RIFK 1VFOA 4O02A 1AAJA 3KL5A 2ADGB 3W56A 1X9QA 1XH3A 4DCQA 4RGOL 5IHWA 2DYSB 2X9ZA 2R0ZH 1RZKH 4LKXA 2X27X 1SUJA 5D1XD 3S98A 3FF7A 5KOMC 4R97C 2DL2A 3MV8E 2AGJH 1MHHA 1IFRA 3ZL4L 1F41A 1XL6A 3C8DA 1JUFB 1ROCA 32C2A 4H0HB 2DQDL 1PLAA 2AK4E 1TT6A 5KSVA 1PZAA 1WSST 4MD5B 3CFMA 3QWRD 1WISA 4W9LC 4JM2A 4XNXL 1XF1A 5D7LB 3SDYH 4MZ2A 3WXWH 1PZBA 2WXGA 1FJ1B 4U7MA 3OAWA 1T0MB 4LLYB 1HZHL 2PYEE 4X6CE 5FHAH 1IM9B 3P54A 3QZMA 1NGZA 4I1PA 3S34L 1N7MH 1W0VB 4P5TD 3UTSB 3IJEB 1CE6B 4I0PB 2HZHA 1RUKH 5TDNA 3T4AC 1ADWA 3RI5K 1J10A 3KPNB 1KG0B 2N59A 1ZPUA 2W0KA 3UBGA 4L2YA 4Z8FH 3ZHKA 4Z7NF 4B9FA 3POQA 4MCMA 5EF0A 2Q2EB 2D7TL 2VLRE 3BWUC 4HS8H 1DN0B 1MWOA 1RERA 1YNLH 2ZP8A 5T1LA 3WN6A 1V3MA 1AQKH 4LLUA 1I9RL 4F9LC 1JZ6A 3KLHC 2CLVA 2LAAA 3PGFH 4MQ7A 3RVVD 1ETZB 1XT5A 3QEQB 1XCQA 4NKMB 5JIHA 1I8MB 4EQ3A 4BFEA 1DQMH 1BXWA 4O49A 1G7QB 3EBHA 3GI9L 3QHZL 4XOAA 5EOQH 2HLEB 5FM5M 1BQKA 5EU6D 4P5TC 2VR9A 3UYPB 3MBWB 4DF9A 3GXPA 2QDVA 5FA4B 3GMLA 2L7UA 4YLQT 1YQVH 4O3XB 2VM9A 1E4HA 2A6IB 3OHMB 1SHMA 1ASPA 1MIMH 1JV5A 3RFRA 1UWFA 2N1TE 3TWYA 3POCA 2R0KL 3ZKMC 1NOLA 4NQXB 4DP4X 1TYJA 4UTAA 4X9HA 2R56L 2BSRB 4HEPG 2E6PA 4G7YH 1FG2A 2XHNA 3QEGH 4KJWD 2AJYH 2R7EA 1AGDA 2UXTA 2QV2A 3D4GA 4ZMTA 2DKMA 2HMIC 4QT5B 4XXWC 3QJZA 1HSBA 3O3AB 2WZ0A 3DX9B 4ICXA 4NT6B 4LARH 1QSFA 4KUCD 2R4NA 2MCG1 4XMUA 5DL6A 1NTDA 1O7DE 5JW4R 5KWYC 3GXDA 4YBHA 1JPSH 4DOHE 2C3VA 3NIDB 2VC2L 3ZW3A 4U1LB 2AVFA 3WN5B 5E94A 3GTNA 2SEBA 1A6AA 1G9MC 2H4EA 4R4FL 3D3VE 1TLMA 3SPVB 4OZGA 4V2CB 4NWTL 1PIFA 1LVEA 3DRQA 4YDZA 4LLQA 1YMHA 3U36A 2BY0A 4M4RA 1I1AC 3SJVB 1UD8A 3T20A 1RUPH 4G7YL 1FV1A 4EI6A 4WZ9A 2UXFA 4I1RA 1J1XH 1DQDH 1TZHA 2XG5B 3EO1B 3NFNB 2JCWA 3B9VA 4Z7AA 5SWSB 3RA7H 3ARFD 3VGDA 5LNEA 3CSTA 4IIQA 1OZUA 1AIFA 2VSMB 2EADA 3VI3F 1LLAA 3KYMB 1F6AB 3POUA 2EXSA 2YXMA 1JGDA 3TCTA 2HRPH 4HMCA 1JZ2A 3TBTA 2EDWA 2EAEA 4L4TE 2WYZA 1WA1X 4JFFE 3A67L 1XDTT 1F3DH 2XCMC 2ZONA 5J3HD 2Y69B 4HD9A 5CSGA 1UYWH 1DVSA 4J2XA 4F7PB 3CIAA 3MJ8A 1IC5L 2W0PA 4LQFL 5DVKA 3S37L 2ZCHH 2C1PB 3GIZH 4CW1B 3BDBA 4JZJA 4PAZA 4HZLA 2O93L 3QNYA 2XWXA 4HGWA 4L3CB 4AWJC 5ITBL 1CDGA 4L3EE 4BRVA 4L8CB 1HYRC 1OK8A 2QADB 4BSVB 3T9WA 4NB7A 4WHTA 3WFBL 1EXUB 3CH1A 2ERVA 1BH3A 1HHJA 3QA3B 2R29H 4PJIB 2NY1C 1GGIH 2X09A 3VX1A 4MFHA 1DDTA 3IFNL 2JJUA 4GG6F 5C71A 1F58H 2IV8A 5D2LE 4Q4IA 4JUTA 4AW7A 1BD2B 3B8SA 4XMPH 3T0WA 2BZDA 1ZLSL 5LQBH 4LIQE 4Z18A 4U6TA 4DAGL 5D1XA 4BFGA 3HG1D 2LV4A 1UXMA 3SDXA 1MJJB 4XP5L 2DQFB 4OZ4B 2NY2D 4RAUB 5AW8B 4K15A 4POYA 3C60A 3E7JA 3QFDA 4AUYA 4MJIA 4L0ZA 3QDMD 4EXPX 1CG9A 1IKNA 2F1EA 2VW7A 3BAEH 3MJ6A 2MEJB 1OLLA 2LFUA 2K45A 3FTWA 5INCB 2DM2A 2P49B 3L2NA 2R29L 3HE6B 4YSRA 5KN5A 3ILDA 2AV1A 2PF6A 3FTGA 3MO1B 3SDCC 3F12B 4P2OC 3CD4A 4NHUA 3DOHA 3O11B 4YHOH 4N2HA 4LF3A 3OGCA 5I8EB 5I73B 1FAKT 4L1TA 3U0TB 3CG8A 3LRSA 4HYTB 1TQWA 2HLAB 1AJ7H 1SVBA 4DGVL 2DW5A 2EZ0C 1ND0A 3DHUA 2B4CL 4UTAL 3TPUB 4KMTH 4BK4A 2BCKB 3U1SH 1NCOA 3BSZA 3QIBD 5EU3A 3UOAB 5JO5B 1NMCC 1IILE 4YC2B 3OQ3B 4FXKB 1XXDC 1YYLH 2VOTA 3Q2WA 3VY8X 3V0GA 3ARXA 4IBTA 1RJYB 3BZ4A 2Q10A 4UT7H 3UBXA 5EEUA 4HS6B 1M71A 4AQ1A 3KDMB 3QI9C 5C6PB 4MKTA 4N25A 1DDHA 3UTTE 5IFAH 2W88A 5D93B 4YFLF 2NY1B 5LCVL 5HHOE 1P5VB 1JZGA 1WAPA 5LGYA 1T22B 4JJOA 4LBEB 1ZHWA 4J39A 4CAGA 1IFHL 2FDBP 5D7JC 5ICYA 5HY9A 2QPFA 4FP8L 5DZPA 5FM5O 1UXWA 1MFBH 1NCTA 3RKPA 3QYNA 5EA0L 3VXPB 1A7OL 2XYBA 3ZO0A 3W1ZA 3T65B 1HILB 4WFGE 1HH6B 4DEPC 4WWKD 3SYPA 4PLKD 3C60D 1JPFB 5I6NA 1QUNB 4LVNC 4EIBA 1VAHA 3GQFA 5KVFH 1ERNA 2NMSA 4PJBE 5DL7A 3V6BR 2R1WB 3OTTA 3QUMH 4OZ4A 3H4HA 5CCGE 5JPNC 1U42A 1A4AA 3ATAA 2W9EH 2Y1YA 2BNQB 1L6PA 4OM0H 1ZT7B 3HHSA 3HTLX 2X3BA 4HIQA 2D0GA 5I1EH 3HFFA 1DVFC 1GHFH 1RMFH 3R4DA 1FAIL 4OD2A 3UH8A 1X6NA 3CFDA 2VXSL 5TPWH 4JNXA 1ANUA 1KENH 4LU5L 4JFDE 4NOFA 2A9MH 2NYKA 3O9WB 4OB5H 1XR9A 1R5VB 1T0NA 4GO8A 1YEJH 5DJCA 1NCNA 4KQ4L 4JK0D 3B43A 5EEXA 2Q76B 1HL9A 5EIIG 3TNNA 2C9AA 3IJSB 4FQPA 2EEDA 1M7IB 2NY6B 5CINL 4LZKA 2XQBH 4U7SA 4C4BA 3ARDD 4HKXB 1R17A 2L7EA 4Q74A 1U95B 4BA0A 4FZ8L 1XGRB 1HXYA 1KJ2L 1R5VA 2VZUA 2H2SC 4LGPB 3NAAH 4K8RD 3VE2A 2B20A 3EFOA 4JRYB 4PB9H 4DK6A 4XRCA 3LXBA 1R3KA 2VAJA 4KHXH 4D0CA 5ABAA 3SQOH 1XVSA 4PRDB 2EEBA 3DOSB 3LKNA 2P7TB 4M02A 1FO0H 2ENQA 4ZOBA 7PCYA 3E2HB 2H6UA 3FB5B 5EZLA 4ALAL 4QRSB 2HT3D 4Y1AB 2IGTA 3MC0A 1E5BA 1NANH 4ODUA 5GS0D 5KANG 2Y0LA 1CDUA 2XC8A 3D8MA 4Y19E 2XG5A 5CBEB 1F97A 2FATH 3VNYA 3KZ8A 2XG6A 4GEIA 2YPLD 4BSWB 1GS7A 2OMXB 2X5PA 3EG9B 3I9AA 4IM8A 1RUML 2EINB 4D65A 3BPOB 4KX7A 1FF5A 1W80A 3QCVL 3AG1B 5FGRA 4EQ2A 4F15B 5KG9B 3HJEA 3SKNB 1FH5L 3K0WA 2FZ3A 2XICA 4WW2F 2PYED 3QO0A 1VGKB 3RWDB 4XVTH 2X70A 4IRSD 1RU9L 4PRPB 4PBWD 3BKML 4JO1L 4Z3HA 4M93C 2DIAA 1M3IA 1G5AA 4JFHD 4OCRH 5TK4A 3CVHB 4JN2B 4ODVL 4L4VE 2YQ2A 4K55A 5E6RB 2CK0H 3K72B 5F71A 1SOKA 4JFFB 4OQTA 3QWQB 4RZCB 1ZLUH 4XNMA 4P4KC 2UZPA 4PW3A 4R90H 1UQSA 1AGDB 2VZTA 3NPSC 4DO6A 3EH1A 2C34A 3MGOB 3B6SA 4OZHB 2J5LB 5AVZB 2WNKA 1J9RA 2EDEA 4XN4A 5E2WH 4QRRE 3KLSA 2BCMA 1R5WB 1T20A 3O41A 1B4LA 4HWUA 4PRHD 4IOIA 5KAQF 2G75B 5D7IE 4AT6A 3MRNA 3TURA 3PGCA 1G7PA 1XGQB 3SPJA 3F00A 1S3KL 3GJFK 4PTTA 4ZS7L 4PYHA 3WOVA 4HP5A 2WIMA 4ES9A 2WQ8A 2ESVE 4EN2A 4E42B 1NBYA 2BRRH 2C9QA 3LN4A 2E9GA 4PJXB 3F7PC 4Q9RH 3PJSA 1NGPL 3MSPA 1O7VA 3QEQA 2CO6A 2GJRA 1ETZA 4PREA 3RDTC 4CVWA 5BMFL 4OJCA 5L7XL 1LEKA 1TZGH 3HG5A 2FSDA 5FLUA 2GUOA 4GSDH 2BOCA 2Z1PA 3T3PB 2Z31B 3FQ4A 2F5BL 1NKGA 4LLUB 3FT9A 1S9XB 4KTEL 3RWJA 2YC1A 5TE7L 1KGIA 5I19L 1Z7JA 4EN3C 2J5LC 3PWUB 2VDLB 1G43A 3BPNB 3FT4A 5DJ6B 4KQ3H 3VGBA 2WXKA 4NI6A 5CJQH 4L8DA 4NNPL 4CNIB 1BVLA 1T7WA 3EJCA 1KIUB 4E9RA 3F7QA 3NIDE 4FXLA 4K3DH 4M6ML 4U6XB 4IGBD 3MLVL 1U2YA 3EOYG 1MJUL 2ADIB 3UTSA 3TTSA 2B0SL 3PWVB 2QVIA 3DBXB 5E9NA 2JJTA 4CGUB 4MA1C 2DQCL 4XCFL 4C83A 2TRYA 1MCKA 1HVXA 2JKRM 1DYZA 1DFXA 2VLJE 1PCXA 2F53E 3P73A 4LLYA 5E6ID 5L8LB 4PJXE 1KDIA 4G3YH 4XXDB 1NCCH 2B14A 4AITA 4NO0A 2K9UA 1HOCB 3H7LA 3SYQA 1I9RH 3ZTCC 1TQTA 4X9YA 3LKOB 3ARDC 5DU7A 2H5UA 5B3NA 1A4JB 1I1AA 2WLIB 5DEFB 4HKJA 4B0MB 1R3IL 4KO7A 5LNDA 4K7PL 1AHKA 3WE6A 5CP7B 3HHMA 1A1NB 4LKXB 1E3FA 3MGTB 4WW2B 4FHBD 2JWYA 3VACA 3MYZA 4IIQC 1CYWA 2XWJB 3L9RA 4K5OA 4Q8BA 5TF0A 3SOBH 1URZA 2B1OA 4HWZB 3DROA 1ZIBA 3CN4A 3E9TA 5FYJU 4DKAA 2CD0A 4Z9KB 5HHOD 1S5IL 3C5OA 2B2XH 3C6LB 4KKCD 3UTOA 1Z2KA 5E1HB 3KPMA 4NXKA 4WQOA 4FUVA 5GGRA 4CBZA 4NQVB 4JL1A 4J1UA 2HVBA 4FQLH 3DI2B 4X6CF 2NRDA 3ECBB 2WLYA 3VZTX 1QA9B 4L3ED 5L4IA 7TAAA 3EJJX 4NYLB 4YN3A 1U8QB 1Z3RA 2PWGA 2Y2YA 3QFJE 5F9OH 4FT6A 1Z5LB 5A3IC 3GO1H 4JW3A 3TN0A 2GAZA 1T5WB 3HAEH 2GITA 1T2XA 4GCQA 3CHRA 3DIFA 3SJVA 1E6OL 4MAYA 3QQ9C 5E2UL 1JHTA 2EDTA 1NGXA 4Y4HD 5C9KA 2H0JA 2EXWC 2FX7L 1THQA 2PP7A 4IRZL 1F4XL 1GC1C 1KJMA 1UACH 1VFAA 4Y1AD 2OTPA 3GSOB 4NZUH 5FKAA 1YS5A 5EA0H 3SZVA 1JFHA 2A9CA 4QXTB 4E1TA 2AK4B 4M8QB 4KTEH 1CB4A 4K0OA 2V4LA 3MXWL 5C0JB 2KI6A 2VUOA 5C97A 3P2TA 4JFPA 3FQ1A 2Y1AA 3DO3A 4HG4J 3SIKA 2CLRA 5K39B 2J4WL 3FSVA 1CD9B 1ESOA 3RVTD 4R26L 4OI7A 2JELH 5HPOA 1DBAH 5K5YA 1AGBB 1Q1JH 1Z5YD 4PGZA 1TETH 1IM3B 4IMKC 1F3RB 3ZKND 4YX2H 5M7QA 4AC4A 5FOBA 4Z3GA 1HHKA 1FNGA 1PZCA 4HCRL 4X9IA 1G7IB 2WBJD 2Z65C 5L6YH 2ED8A 2VDLL 2DTMH 3BP7B 3K71A 5BUPA 1L6XA 2ODJA 1I1CA 1ILUA 5LBGA 1H9DA 1ECYA 2HJKB 1SEQL 2AFNA 5CZXD 1D5RA 5DC9B 3FFCB 3GM8A 3OAYH 5KSAB 2FHBA 1OGTA 1ORQA 1P6FA 2WTOA 3BWSA 3UEZA 1EBAA 2WKOF 1Q94B 3BT2H 2VC2B 3IXAB 4XPHH 4PRIB 4UNVA 4WHCA 3I85A 1U8MA 4V1DE 3ZDXB 4GKSA 5AOKA 2F8IA 1KJ2H 4KI5C 4XMKL 3EOAA 3GLDA 3VVVA 1F4WH 2WMPA 3QUMA 3HN5A 5C0FA 1FLRL 4PJDB 4EJ1C 3CFQA 1A14H 1TJMA 2HFEA 4HIEB 2NY1D 3T2NH 2BIHA 4XMPL 1JGIA 4KVPA 3FBKA 3VA2C 2Z3FA 3U2JA 5CEYB 4DIXA 3Q1SL 4U49A 5HI5D 4L1BA 3SYCA 4UDTB 1ZHXA 3SHSA 2IH8A 3AA7B 1SHSA 2AJXH 2ICES 5AALA 4P2QE 4NDMB 4FQJL 2VXQH 5CJXC 2P52A 4HWBH 2VDNL 4AMWA 4L48A 4FQEA 1PPIA 3HBPA 4LSTH 3H6JA 1P2CB 3VFVA 1S5HA 1X5MA 2E9IA 1H3VA 1WTLA 4K3EL 4ZSOB 1VFAB 5EU4A 4IOIB 4FRWA 1LP9A 3F85A 4KAQL 4X9GA 3FHAA 2FJUB 2VLRA 3SCMA 4QKTA 3N44B 4G70B 4Y7OC 3RG1C 3VRJB 4HS3A 2DLFH 4X83A 4DCQB 1JZ5A 4QHNB 4IHBA 3LRLA 4Q2ZA 4ELKA 5I8CB 1HJCA 2X6UA 1KLFA 1M42A 1HH9A 1PEWA 2KZ1B 3BJLA 1XTMA 5DJZA 3ARWA 4ORZC 5IMKB 4U3SA 1MRFH 2APFA 1NIAA 3ULVC 4J1UB 2XV6B 1MCJA 3TXAA 4WU5A 5DDHB 5LGKA 5F6HJ 1VKXB 1U58A 1EFXA 4MBRA 2IO5A 5C0CB 5HDQH 1F4HA 4MQXC 1MH5B 3QYCA 4FLRA 4XCEB 4OVUA 3CHPA 3QNZB 3PNWA 1A6VH 2PW2A 4QPEA 4JE4B 5I9QB 3C6LD 4AI7A 3KVDD 4LRIA 3K8MA 1UOLA 1PU0A 3IJ8A 1DCEA 43CAA 2ITCB 4PCTA 1AXIB 4HUVA 5AKTA 1KF9B 4QRSA 2ODHA 4G80B 4NBYB 5CIPB 5DFVC 3HZ3A 4H1LA 4OLVL 4PIRF 4QYOA 4N5EC 1OTSC 1WIOA 2B1AH 4CKQA 1BJ1J 1YEHH 3BPOC 5FAAA 3N55A 2X1XR 3HZYB 4BUQA 1IT9H 1KGCD 4HCIA 3KPRA 1EAOA 3H7BB 4NKIH 4F27A 1B2WL 2Q7NA 1DO6A 3ETBF 3DGDA 3ESPA 1KLGA 3OJMB 1NGYA 1X4ZA 4KKAC 4YPGA 5J6GA 3MRJA 3TYGL 4CC0A 3G5YA 3GB7A 4G6ML 4L1DA 4LK4A 3VXQB 1SYVB 3B7TA 4S2SA 5INDB 5JZ7C 4UIMA 4IRSB 4Y4KA 3ZY7A 4DKDC 3ZTEA 4NS0A 2RCSH 1MREH 4BFFA 2V9UA 1A25A 4XAWL 3FN3A 1RZ8B 4WUKH 1TTRA 2XVGA 4N87A 4HALA 1DVXA 2WTRA 1CURA 3L54A 2YGOA 3O9WA 1J8KA 5CHNB 3QUZC 4LCWB 5IB4B 5BUAA 1CYGA 1CLOL 1X7TA 1OT2A 1WC7A 1LM8V 1VERA 2A73B 3UTPD 4F15C 3GSWA 4CMMA 3WLBB 2ADFL 1PG7X 5BOZG 2VT0A 3D6GA 5GZOA 5ID0A 1J7VR 1WBYA 1UT1A 1TCRB 5IF0B 3I2CH 4UAOB 3K19A 4NQUA 1P9MA 2J2ZA 1KTCA 1NCWL 2VDNB 2VJ0A 1TF4A 2H32B 3O8XD 4JDVB 3Q8CA 5MP6L 3KBFA 3MLYL 1DL7H 1RIVL 3RRQA 3T2PA 1E9QA 2A83A 1M56B 3MBXH 1G7PB 4HJ0D 3L3OB 1QUNA 1G6RH 3FFCD 5KSAD 3SZ6A 4XR8C 2M83A 1BQSA 1MCSA 4WGKA 1J9QA 1DBBH 15C8H 4R8WH 1TTCA 4B7IA 4EI5C 2OTUB 4URKA 2DWEA 1TTGA 2B1HH 5F0JB 1S8DA 4A7TA 3P4MB 4Q58C 3EHBB 1NWOA 1VPOH 2HH0L 1EHAA 3OKOA 3ROLA 1CLYH 1IIKA 3O3DB 3HR6A 4MAUH 1OL0A 5F1KC 3VXME 5J8OA 5HXMA 4QHMA 4FJYA 1ET5A 4L1HA 5FYLH 4TNVF 5JLZB 4OQTH 2DQGH 4N5ED 5L8JB 2R0ZL 4XN9A 1KIPB 3P4MA 1J12A 5DMKB 5I1LA 4GBXB 1J5OH 1IJ9A 3GFUA 4L4VA 2WYHA 2VTFA 1IGIL 3DV6B 4NJ9H 5E5MB 4A6YH 2XVLA 4E5XB 3LHAA 1MHEA 4ZFFB 4AKMA 1AHWC 1ADQL 1BQUA 1PX3A 1FA4A 1AD9B 2NXZB 2VDKL 4I8DA 4PJCB 3ZSTA 5ALBH 2WLNA 3DDGA 1OEZW 5BVJA 4D0DA 1BZ8A 1G7HB 2WUBH 2FQFA 2RIKA 3BPNC 3QW9A 4GAFB 4I77H 4PJDF 4D9LH 2H32H 1DBAL 3MZTA 4MJ6B 4BQCA 3Q05A 2DKUA 4N2AA 4XOEA 4KX9A 3D85A 5AKVA 3M8OL 4HPHA 1JYVA 4J3VA 3ULSA 1OTUD 1T7VA 3FPXA 2ZKHL 3GSWB 4A7GF 4CMMB 4YNYB 3HE6A 1OD9A 1QTYT 2KH2B 3FN9A 3GMMA 1HNGA 3NUKA 3QR0A 4XODA 2Q3ZA 1DJIA 4TOYH 1B0GA 1Z9SB 2I9LA 4PJFB 4F4BA 3ARUA 4FZEL 1XZ0A 3HOGA 3P9MA 4NQDE 1NBCA 2J8OA 3V9FA 3WIIL 4G6FB 3QWOB 5IBLC 4WNQB 1WFNA 2FGRA 1DN2A 2FQGA 3W0WB 1UD3A 6PAZA 3EXLA 1T1XB 3HPLA 3LRGA 1B4JH 3RVUC 3UFIA 1NC4A 1PD0A 3H3KA 1PD1A 1HL8A 1IGFH 2OJEA 2GT9A 5D5MF 1IGMH 4J3OC 1MWAA 4U05A 5DA0B 1R47A 1A6ZA 2IANE 4GQZA 4FE9A 4CN4A 5GXBB 3EO9H 3O6FC 4ZXBA 3KPRB 4AK1A 2W9EL 3KLLA 1YEKL 3HZYA 4XPAH 2JJWA 4JHZA 1LP9F 1FIGL 1XH2A 1JHLL 4YK4C 5FYKD 1SXSA 2AXGB 4PQXA 4HC1L 3QRFM 2I60H 3TH2T 3KH3A 5EMYA 4ODHL 3VVWA 1G5GA 1TTUA 4HXBL 1UENA 3LS4L 4FQJH 3KPSA 4TN9A 1LHZA 1N68A 1ZLUK 3BZEA 3MV8B 1UFGA 4G9DB 1UXSA 4TVUA 5MENB 1WD9A 3QZBA 3QZLA 1T2QL 1GZQA 1P4LB 4TULL 1TSHA 5I0WA 1AG0A 1CLCA 4PS3A 5CINH 4AIZA 3I3EA 5ICYB 4KDVA 1FVEA 2DLIA 5LG1A 5L9DL 1TTAA 3NIFF 1MI5A 3ZBMA 5HPMB 3SKMB 1OIOA 3L3DB 2BSCA 3MJ7B 4FG2A 4HPYL 4NQDA 4OZGF 5SV4A 3V4LA 5HYFA 4Z77B 3NZHL 4N2CA 3HRZB 4LL1A 1HJBC 4LP4A 1FN4B 3L3KA 5F1OB 4MHHG 5C0DA 4ELKB 2IALA 1KBBA 2GSIB 2EVJA 3VGFA 1I1YB 4PTUA 1H8SA 1QSEB 3POHA 4QWWD 4D9QE 3OQRA 5D4IA 4LAQH 3ZSSA 4XPFH 2GSMB 3IMTA 1BA9A 2XWBA 2HLAA 4H13C 5LGHH 3DURB 3QSKB 4OCWH 5H35B 2F1CX 1ACYH 3BOVA 1ZWIA 1Q4NX 2EDLA 4KPHL 4ZNCD 3G9VA 3GLZA 4A7GA 5G5DA 3PL6A 4ODVH 1AZNA 3VZWX 3DX9A 5C6WH 2L0DA 3RVWD 1BF8A 1DLHB 1UA6L 2A9NL 2PTTB 3MCKA 1E30A 5A7BA 1A1MA 2YKLH 3FRPG 4JFOB 1IAIM 1ZA3B 4FI8A 4APXB 3F7LA 1W6LA 5EO9B 4GOSA 1JK9B 2CKBB 3EYVB 4NCDA 2WJRA 3FCSA 3O6MH 1OHQA 3ENEA 4BE6A 4FQIH 4BZ1L 4LAQL 1C16A 1RIUL 2QQQA 3IRPX 3NOIA 4F7EA 1AR1C 3O2DL 5B1KA 5FA4A 5EU5B 4P46A 2YAQA 2A6DA 4EI5A 1KPVB 4UI2A 2VLRD 2BP3A 3WD5H 3KWWB 4AG4L 3EYSL 2V2TA 4B9JA 4YQXH 3Q9PA 1I4FB 3NFPA 4QR7A 1HDMA 1PAZA 2NUTB 1ZHBA 3TC9A 2RTTA 2LTQB 1AVAA 2AANA 5EF1A 7FABL 3GKZA 3JVGA 3NMEA 1Q0YL 3LRKA 5IHZB 2J4UP 3H4FA 3QA3A 3L9EA 4N85A 1DN0A 1R19A 2XN2A 1SY6A 4LGRB 4LPYA 3GD1C 3FTZA 3DJ9A 3O6ML 4CVUA 4W1TA 4F7TB 4JFOA 3BHBB 5J3HC 4XNUL 1KG0A 2KXPA 4KUCF 4M6NL 4LOFA 2N01B 1P4BL 1XBDA 4G7RB 4P5MB 2HJFB 3R19A 3UG5A 4GAYA 4FABH 1CVRA 2X7LA 3E9UA 3J7HA 4HKBA 4JB9L 4ONFL 3V52H 4P9ML 4PRBA 3WL9A 5L0QB 1TMCB 2HPOA 3HI5H 5J6GB 1ULVA 1MCPL 3OKYA 2O61B 1BGXH 2JKLA 1E8YA 2WVPA 2ATPA 4H26B 1LGVA 4AG4H 4HPYH 3DO7A 5IOPA 3NPSB 4HJEA 1Y7VA 4ZFQA 3T6XA 4Y2NA 5DK0B 1E5AA 1WCBA 4Y9BA 5HP5A 3FONB 5HHNA 4L8BA 2ALWA 2NSMA 5DQDL 4A66A 3ZQWA 1ID2A 2FWOA 2ZOOA 4PGBA 3O4LE 4F92B 4IDJL 3APFA 1A4CA 2CBPA 2EO1A 2CIIA 2CWRA 4G5AA 3ESUF 4NN7B 2HH0H 4EN3D 4LXFA 3MUGA 3OSKA 3NBNA 3N2JA 3QNZA 4ZQTA 4XP4H 3K2KA 3DYPA 1T5WA 3LEYH 4DJMA 2YARA 1ZY9A 4G9FA 2GUYA 4YFDB 3VMOA 5SWSE 4GP4B 2JKNA 5JW5B 2AC0A 3ECBA 1KGJA 1JWMA 2VZ1A 3OGOE 3U7WH 1JVOA 3DVIA 3MV8A 3H9HB 5CLXA 2AABH 5JR1H 1MAJA 1QD0A 4KFZC 4LRNL 3H0TB 1R6VA 3SDCA 1CD1A 3EJZD 3KPQA 5I0ZA 3GS4A 1XV8A 2VISA 3MA7B 3MV8D 4R5VA 2MCPH 3TO4B 3VI3A 4K7FB 2X6AA 3O2DH 4LHQB 3DJZA 4HJ0C 4PJ9D 4W81A 4BKLB 2R2BA 1K2DA 5HYQA 2WUBL 4OLWL 2APXA 4BV1A 4KGJA 4HS3B 1AOHA 1J0KA 1FSKB 5BVPL 3FRUA 3P3RA 1NIEA 2IFFL 3QRGL 4AGLA 3MUZ1 4CBPA 5I75C 2Q3AA 2VLLA 2WZAA 4KKRA 5F1IA 1CFQA 4JFEA 2CIKA 1DVYA 2EDJA 4DW2L 2F18A 3RUGF 4IRSC 1AYRA 4NN6C 4HBCL 1D5ZB 5CU5A 2YXFA 2R2EA 3U6RB 4QGTA 3OB0H 2UY6A 5E70A 2A9ML 2BY2A 5A2JH 3D52A 2C3HA 3DX6A 1QSED 3HE7C 2VIRB 4ZUWA 2F1AA 1EEZA 2R1XB 2V7NA 4P4RA 5GRVL 3BAXA 2DMCA 2NY3C 4P2RD 5CU9A 2QSVA 3CFJB 5AZUA 2J21A 3OXRA 1BREA 4DFIA 1ZTXE 2X0WA 5CJ8A 5B5EO 3UPCA 4BFKA 4U6XA 5JXEC 2JCCA 3O6LL 5IBLD 5E1GA 1MELA 3G3LA 4HUUA 2ENPA 2GK0B 4JZOB 4X4ME 1T16A 5EPMB 2DY2A 1S9XA 1A3ZA 1NAKH 3L3OC 4G11A 4JEGB 2MHLA 2QGCA 2BHZA 4NZ8A 3UGXA 2HG5B 3VO0A 2B39A 3Q43A 3HHRB 2EILB 4U1IB 5F2FA 2VGLM 4D0BA 5J9PA 4ZPVB 4LSTL 3LZPA 3PQYE 3RQ3A 1ZKAA 1U8PB 2D7TH 2XN9E 4G6AD 5DJDA 5IREA 3P2BA 1QLRB 3DV6A 4MD5A 4WWOA 5LCVA 4AEFA 4OCLC 1DTUA 3IMVA 2CKBL 3NCXA 1BLIA 4OJYA 2NXZD 5HVGB 5LGJB 3IF1B 5D1ZD 5E99L 5I1HH 5DMKA 4HIJB 3X12B 3MBED 4Q14A 4F20A 4MHHI 3BVNB 1LQSR 2K3TA 5FO9B 3HB3B 4IGBA 4N0FA 2N7SA 1N0XH 3B2UC 4MVBD 3RWIA 5F7EH 2VDPH 3RURA 1JYNA 1Y18A 4JO3H 3D69B 4RWHA 4B9CA 1MFCL 5H37G 4F5CA 5D1XE 2G9HB 5J6SA 1N8OE 4E9WA 4J3OG 5MEQA 2D7QA 2BSED 5E8NB 2ORBH 3EOTL 4U2ZA 1ZLWH 3ZMEA 1SDDB 2CGYA 4BKTC 3PABB 1CFSB 1EFXD 2R0KH 3AREB 4M5SA 4N6RA 3SD5A 3SO3C 3ZMNA 2F7IA 5CCKH 3BVWA 1E27B 4IOFC 1H3GA 3L4YA 3T0ED 5J6HB 2XTRA 2J8UA 2D9QB 5IGXH 2YPVH 4L4JA 1SJEA 5JPMA 2RALA 3W9EB 1KZYA 1Q9OB 3RU8H 5I8OH 1E9QB 2HMID 2YNKA 3MJGX 2XWRA 2DEYX 3DJTA 1F6LL 1JHKH 4OV6F 3CFCH 2DN7A 3DTUB 1HWWA 2NLJA 3MRBB 3DIFB 5DLMH 5GISH 4MS6A 3ZXAC 4H2AA 3A2SX 5B66O 1UVQA 4E9QA 2XTJB 3QJVB 4GUOA 2OCFD 3N85H 2VH5L 4JANA 4DO4A 3PF1A 1EIBA 2BSSA 3OC5A 3UX9B 3QORB 2ORBL 3EOTH 4KRPD 3TH4T 4G1MA 2YLHA 4R3SA 3NCEB 2ZF9A 1BSIA 1KELH 4MAYC 4ZS6C 1OD7A 4U1MB 4CJ0A 4LPXA 3PV6B 3TBYB 4YDJB 4EN3B 3PWPD 1HXXA 5DK0A 1WLHA 3FF8A 2BVOB 1NCUA 4K5NA 1OE3A 3BESR 1RZJC 4KZ0A 5FO2A 1S3RA 2BVUA 1FQ9C 1PD6A 5I1JL 4S0SD 3QPQC 2VW4A 3BAIA 1IZNA 2X7LB 3WL9B 2N3JA 5EDXA 1NBVL 2WJQA 2WTPA 3G04B 1KLGB 3MV01 4NC2B 2P43B 4AQEB 5JMOC 1F4XH 2FJSA 2QQKH 4XMLH 3CDZB 1YEIH 3GSNH 2VM3A 4UB0H 7FABH 2FR4B 1N2RA 1XX9C 4MDIA 4FYRA 4U1MA 1DQLL 1IC1A 1PFCA 2DQMA 3NCCB 5AWNH 2ERJC 4MXQD 5EU6A 3VRIB 4P2AA 4ZUUA 5ICXA 1RLWA 1A4KA 4XT1C 5DMGD 1SPDA 2YMOA 3NFPB 1B2WH 4FKEA 1E6JL 3D30A 2ZIDA 4AH2B 1Q8MA 4IQHA 4LSUL 3TS8A 2UVFA 1FUNA 5K1VA 1N26A 4K7PY 2P46B 1RZJL 2HG0A 4OUUA 1WT5A 3UTQA 3V8UA 2GG1A 3VE1A 5DL8A 2OR7A 5IIEA 4MXWH 3D3VD 4GKNB 3X3FH 5IV2A 3I6GA 3F7YA 5IQNA 2HRHA 4B60A 5J6HA 2A9AA 5F8QC 4PWEA 3B7UX 3CSBA 3L4CA 2HKFH 1GMEA 3HMXL 1U2CA 3REVA 1ED3B 4G1EA 5F72S 1ZLWK 2EH7H 5DQDH 2AJ3A 1SMDA 3KBPA 4GRLD 9PCYA 4OKVA 3TBWB 4X6DE 4A55A 2PTTA 4XAWH 3LRHA 1AQDB 2UXGA 4K94C 5MHSD 4G7SB 4AMKH 4CL7A 4MNHA 1YHPA 4HJJH 4RFNC 1PEZA 3CVHL 2X1OA 2DJSA 4NZTH 3SY7A 3REWA 1P7BA 4LASH 4E1SA 4Z1PA 1V27A 2GIMA 3GLAA 5EU4B 1E3XA 2BVPB 3K46A 3B2DC 3GHBH 4UBDD 4AIOA 4WEMB 3AU1A 5DGQA 1VIWA 3T6WA 5B1AB 1OTUC 3WY2A 2WXHA 2YAHA 3DNKA 2VDOL 3B2XA 1ND0B 3FQUB 2NOYA 5IJDC 1UA7A 3O3BA 2G0KA 3IDXL 1X6LA 4PLOB 1XIWB 4RRPG 2EH7L 3KM1A 3IJYB 4IOFD 5KVEH 2AJYL 3IMSA 2I07A 4NRZB 3TBWA 2MCPL 1DZBA 5ES4B 2UZYB 2IPUG 1MW2A 1WH0A 1AJ7L 1BFOA 3BUTA 5E00A 4ZFZA 1ED3A 4G1EB 1A1OA 4MYPA 5I71C 1QPKA 3D4CA 5HPMA 2H7WA 2N0MA 2D7OA 3B2VL 4NO5A 5EPMA 3V0HA 5B4MC 5D2LB 2FX8H 5E4OA 2GSGA 3VFWB 3OJ2C 1FHGA 1Z9NA 5AAMA 3FQTB 2B8OT 2WBXA 3LKPA 5DK2B 4G7VH 3KH4A 3FU5A 4WV1B 3U6XA 3DGGB 4V11A 1F4AA 2P5ED 1OGAB 3V4VB 4DUWA 3AUVA 4DSYA 2RBLA 5IHUL 1CE1L 4Y5XC 4JFDD 5DHXB 2ZSWA 4M7KL 3R0NA 5B21A 4O3ZA 4WY7L 2FE0A 4XBGA 3UC2A 1IGIH 3JV6B 5K33A 2ENYA 1UWXH 4BYHA 2VN3A 4NEHB 4PY7B 4UT9H 1D5ZA 5H8DA 1HU8A 4ZW5A 1B0WA 1G7IA 5FUCC 1RQ5A 5KUMA 5FCUL 3JBG7 1KUMA 4YEEA 4RMVA 3IRZA 1FG9C 4HKXA 3V4PA 3EYSH 2W60A 3HPLB 1KB5B 4I2XE 3MPCA 4P8QA 4LIQL 3BIKA 3LSOB 4KZEL 3MRDA 1FC2D 2EDDA 2V9RA 2P8MA 4OZIA 3RPBA 3IN2A 5FWRA 2B1AL 4AQOA 1JK8A 5GGVH 2IDUA 3LZNA 5IW1A 4C4VB 4N2BA 4FMSA 4P05A 3LMJL 4FQCL 3GDCA 1UUSA 4JPWH 1MF2L 3D85D 3ARBD 2VCOA 1YA5A 2W91A 4LLWB 3RZCB 5IW3A 1XCWA 5DRNA 1V3KA 3TU6A 3DMMB 3MRCB 2BNQA 4AOFA 1MFDL 3U48A 1G9ML 4NQEA 2KLSA 1F18A 3WJJA 3CNKA 3Q8EA 2X0VA 4ZX5A 3GNMH 1RZFH 4AQZA 1MHCB 2WBWB 5KS9B 4KZEH 1IGCH 4MA8H 4PRPE 2NY3B 4ZMXA 3P3TA 5E51A 1D6EB 4BFBD 2XFXA 4WFGD 2N2MA 4F8QA 3QJUB 5CEXA 4QY8B 4GSQA 4PRAB 2EYTB 1F86A 1NDTA 2PKDA 4LSEA 3PF2A 2EC9U 1E8ZA 4V1DA 3CPLA 2KPWA 3LQMA 4Y1AE 2ZYIA 3LS5L 1MW1A 2AZUA 3MROB 4TVPH 2LU7A 5DD6A 3QXVA 1D5BB 2WXMA 5TFSL 2WQUA 3IFLL 1FZJA 4ONHA 1M71B 3WLWD 5E08L 1KBGL 2D2CC 4LSSL 4RIRA 2WCPA 3BZ4B 4X6BB 1R34A 4P4KD 3X12A 5J4MA 1OAKH 1E4JA 1BWWA 2K70A 3LEXA 1IBBA 3QJFB 2HFGH 1HYSD 2DQIH 2WSPA 3A6CL 3TT1H 1AE6L 3FQRB 4HX1B 1P53A 3PQYD 4NJAL 4F3FB 1TFHA 5ERWA 2DEWX 5B3JF 4QRQA 5DA4A 4PCSA 2Y36L 2NX5B 5JW4M 2JQYA 3AADB 5EH1A 2J8UB 1R3JA 2AV1B 3FTGB 4CA4A 2UX7A 4ZOCA 3AA6B 1BAWA 3MQIA 4LIQH 2GJ6D 3HB3D 4B50A 2FLRT 2IH1B 2R23A 3RTQB 3FT4B 5DJ6A 4DK3A 2KC0A 4PJ5A 3ZDZF 4XN1A 2AQRA 2E46A 1RK1B 2V0AA 1AFVH 1FLTX 3LQAC 4GPVA 1MUJB 1TO5A 1CO1A 1T66C 3KJ6L 5C0EA 3QXTA 3N04A 4F2MB 2H9GB 4Y9GA 1XR8A 3CXFA 3LK41 2PPFA 1CYXA 1OT4A 3DTDA 2A9NH 3QG6B 3FW6A 1GZPB 3ZTNL 1BBDL 3R18A 4UOZA 4B7LA 4BXSV 2FEDD 1CE6A 5TDNB 5KVGL 3DX6B 2H2SD 4I2XA 1KTDA 5AOZA 5HTSA 5FX3A 2A74B 5JNYA 5C0RH 4POZC 3BEWA 2BRQA 4HMEA 4UINL 3RJDA 3OXSA 1Z6JT 5CXPA 5D5MB 3BLBA 1F5WA 4FNRA 1R0AH 3PGCB 3APDA 3LH2H 2FT8A 3MHZA 4UYQA 5K9KB 1FVDB 4PPTA 1OGAD 3QH3B 4NNPH 5ISZE 5FK9B 3RFZA 4R96A 3LCYA 4O00A 1KENL 2R0WL 3X1NA 4Z7QB 2EUZA 3OV6A 2HX8A 3NK3A 2HG5A 2NY5H 1E5ZA 2P5EA 1MHHB 2R69L 5HYQB 3HMWH 5IVXB 1DEDA 1FL5B 1D7CA 2FUQA 3E38A 4Y5VA 3ETBJ 3NK4A 2X38A 3QG7L 3ZTNH 1Z9OA 2XNAB 1SDAB 4XB3A 2Y9RT 4XAKE 2AGJL 4ODSH 4ADIA 4F33A 2NTFB 5B4MD 2Y1VA 2X4SB 1OAYH 3H53A 4QHUA 3PWPB 3ZX1A 3CFBA 1QFWL 3VI4F 1XZWA 2IPTL 2XPZA 3CVDA 3CE1A 4GRWF 1KCBA 2MFNA 4YHLH 1U91B 4M5ZL 1INDL 4EVNB 3GUTA 4HH9B 3QUZA 1NFDF 1GZQB 1P4LA 5DD3H 2QJDA 4I0PD 5FYLE 4BQ6A 4E9VA 5DEGA 2JE8A 1LK2B 3PWLA 5F21B 3N1QC 5IK3A 4ZMLA 2X4PA 4BFIB 2JKJA 5F6HI 3OB8A 1ZA6A 3U46B 4NN6B 3CFBB 5DYOB 1IV8A 4KVNL 2K0RA 4CRPA 1B0RA 1ZXKA 2W07A 4KY1L 5EB9A 4DP9X 1UKQA 3ZE2F 2B3RA 2Y06L 3GMOB 1NFDB 3IWVA 2R2EB 5DWUH 3NRFA 3EO1A 3PNRB 4HC1H 2YZ1A 1TQCC 4TLSA 1Y0LB 1RJZB 3BH9A 2DQJL 4FNLL 1MXDA 2ZT9C 3FNKA 4M4RB 5GZND 3KR3L 3MRQA 4F91B 2EIDA 4L8SB 4OCSL 2WVTA 1J5CA 2QADC 1A9BA 3M1OA 2VDKB 1ODAA 3ZJAA 4YFLI 3BUDA 3O4LB 3TV3H 4XPHL 3Q2NA 2BOBA 2J88H 5GISL 4FNPA 4OJEH 4PRBB 3CUPB 5GSVA 4GF4A 3QQ9D 4GAYB 3ZE1F 2YBRA 4ZX6A 1JRHL 5DVOA 1G87A 1YMMB 2DQ6A 4PP2A 4DN3L 3WEAA 3WIIH 1JFQL 4KJYB 2YR3A 4IS6B 5DJCB 1F2QA 3K4AA 5DFWH 1ZV9A 3B3IB 3EF7A 3T2NL 2XT1B 4PGJA 1YDPA 2ZXQA 5IB2A 4AE0A 5L4MA 1MNNA 2VXUL 3U6XS 1XCTB 3EYOA 3SQBB 1JVLA 1RHFA 2UYLA 3MRKA 4WWNA 3KPRE 3QIUA 3SPGA 4NHCL 1MFEL 4NQCB 5EN2B 3K6IA 1Y6MR 4PJBB 2NUTA 4DP1X 3KL3A 2LHAA 4YHPA 3UYPA 4RMBA 4GRWH 1EEYB 3O0LA 3KWWA 1WBXA 1UOWA 5DT1H 5HHNB 4PJFE 1NUDA 4ISVB 1DUZA 3NABH 4DGWC 2FWLB 4R96B 4Q6YA 4ATTA 1LO3L 5LB1A 3UTPE 3VQLA 4ZJ9A 2J72A 2CLVB 1PKQB 2OK0L 4NKDB 4B95C 2JJVA 3VD4A 1EBPA 2Q8BH 1A64A 4P48A 4FSPA 3RWGB 4CMHC 3AQDA 4FKHA 2GE4A 1A66A 5T1LD 2VXUH 3EOBB 5FECA 4PUBL 5T3XE 4HK3J 3VI4A 4KK6C 3RX9A 3VFTA 4PYGA 4C56A 3PL6B 2X4NA 4MTMA 1K3IA 5LBSA 1M9WA 1NGZB 5T1DL 4FFYH 4F8PA 4A63A 1D9KD 5DUBB 5BS0A 3BSZH 4V1DB 2Y7QA 5D2NB 3V0VA 5IMLA 2XFGB 2Y06H 3F58H 1QP1A 4S1RL 5GGQL 2FLMA 5D7LA 5GRJH 6CGTA 3FRPA 3BPLC 2OMNA 5AZ2L 3NIGF 4N8CH 1XB8A 2OK0H 4DFHA 2BCKA 2G5BB 4G6KL 5FB8B 3TPUA 3K5SA 3LPPA 3HKFA 4OB5L 1D6EA 4NNYA 2YSTA 4FQHB 4ABVA 4ZMOA 8FABA 4MAYD 2CUAA 4HT1L 2A6DB 2VYRE 1S46A 1MQKL 4B96A 4WSJA 5EU5A 2HKHL 1C12A 3KXFD 3IDGA 1EA9C 3NA9L 4NQDB 5H2BB 3MLWH 2FGWL 1ZTXL 2KERA 1HFUA 2Q8AL 4C56E 2XX0A 3ARGC 3L48A 3S3CB 5HHME 5HGDA 2XVKA 1YEHL 2EIZB 3CHXA 3AFLA 5IFHH 1G9HA 3VD0A 1L0XA 4JFSA 2VE6A 1YJDL 3BVUA 4FKKA 1KLUA 3MOBH 2ZOTA 4ODTH 5ESQB 4CJ1A 4P2CG 4JFUA 1K8DA 4F8LA 3A21A 1S7XB 4L29A 4WEBH 1YECL 2DQIL 4G6MH 3AS0A 4N0CD 5E6UB 5TTRA 1YQ2A 3MROA 2ZUQB 3KYOA 4ELMF 2F8VA 5JTWA 1RURH 2VXVL 3MV9A 3OPUA 3HLKA 1QBLL 1H0DB 4YDMA 4WO4D 5D1XB 5KVMC 4KV5F 3FSOA 2Z91A 2MKWA 3V4PB 4O5LH 3RHWK 4JG1L 2XIBA 2Y7SA 2F5AL 4G8IA 4QY8A 4OV5B 2WBJC 4ICWA 1WZ1L 3LIUA 1IC4H 4PV9A 1SRDA 4NX0A 3IDMA 1XGUA 1UH4A 3DMMD 3FO2A 5HVHC 4AQAB 1XGTB 4CVXA 4AYEC 5JIDA 4I4WB 4Y2OA 4PY7A 1TU2B 3QDGB 4X6DF 1L9NA 4HJIA 4O3YA 1SZNA 3UTSE 1BEYH 4HGKC 2NX5E 2JJSC 5CGBA 4OFQA 5CLWA 2G60H 2J3SA 1CXEA 1AZZC 3QWOA 2O1AA 3P77B 3QAQA 1UWEH 3KYNA 4WRLA 4HH9A 4OLWH 4DGIL 3QFGA 1TEYA 4JB9H 1WHPA 5JZ7D 3VSQA 2W0FB 4WWPA 4XB8A 4ZW8A 1N0LB 1LILA 3WO4B 3GPEA 4N9GB 1JMZA 2PRNA 5EUOE 4XPBL 3W57A 3ZDYF 5GGQH 3UCQA 3V0WL 4XO9A 1T2JA 1AXTL 1KGYE 2GJPA 4QRRB 1KC5L 4YPJA 4JAMA 4N2NA 2X3CA 5E8OA 1V8HA 4Z78A 3MACH 3SDAA 2EC8A 1Q1PA 4IIQB 3FYIB 2H6OA 1DQLH 1KB5A 1TETL 1QBML 3MODH 3ZKSD 4K71C 4KH2A 1UD5A 4I3GA 2RJMA 4J12A 2BDNH 1FL3B 1FSKC 4PJCA 1TZHB 2QGEA 2K7QA 2QQKL 1H6EA 4YR6B 3ZZSA 1BPVA 1PSKH 5MEPA 4S1SL 4LOUC 4F7KA 1XIWA 5IESL 5AEAA 2ZWNA 3PQUA 3O3BB 2OW6A 1EGJL 1PJ9A 4RDQG 2YQGA 4GSXA 4LMQE 4X7SL 5J7CC 2CXGA 1MXGA 1XGQA 2VLKD 1ETJA 3K80A 1N8ZB 4QKXB 3WN5A 4F93B 4G2AA 1RKRA 2K8MA 3IU4H 3PORA 3PAVA 1TSRA 5E79O 3K5RA 1LTXA 3FL7A 3WHXA 1BYOA 4TS6A 3BW9A 1QAWA 5F96L 3KW8A 2CPCA 1S7XA 4L29B 3DSNA 2COQA 2UWEA 3FQTA 3P4OA 1DEEA 3GMMB 3OKKA 4J6IA 5BV7L 1PNDA 2O4EA 4C4UA 2ZKYA 3B9EA 1AR1D 4LU5H 2AXHA 1R3HA 2AQPA 4A68A 3S37H 3PL6D 5IJBC 3CAFA 3AAZA 3AWEA 4HZ1A 4N2DA 3HS9A 2E75C 3IPEA 3Q5YA 4UOJA 3D48R 4J8RA 5IZ7A 1WEJL 4UBDC 4GAGL 5BVJB 3NJLA 1I1RA 4QHKJ 1N4XH 2I07B 5I17B 4YDIH 1U2HA 4QXUL 2PWFA 3KPRD 2BIPA 3I9IA 4AH2A 5JPMC 3SQRA 4CVZA 3FQRA 4NAJA 1KBGH 5D1QC 1ZMYA 4Z7NE 1U8OA 3K8LA 1QHOA 5DWPA 3WLBA 2IOIA 2L4OA 3AQZA 5AW5B 1FNSL 4CSSA 3LEXB 1J5OL 2Z8VC 4XPGL 3OAZK 2AI0L 3ES6B 3UAJC 5CGTA 1YNTF 4WI9A 1IEAA 5KZCD 2EO9A 1LEGA 3QIUD 5CEZD 1V55B 4M1GH 4N6QA 2OTWA 1K4DA 4D0CB 1DZ0A 1EMTL 4M1CD 4MNHB 4G5ZH 2ZPKL 3UJIH 2X4NB 5L2KB 4ANWA 3EUDA 4FEIA 4F57H 2F54E 2Y6SD 3ZYJA 1SXBA 2UXVA 3NVQA 5LNGA 1S7TB 1BECA 1U8LB 3PGDB 1JNJA 3GSXB 4PRPD 3SE6A 2FT6A 2FHFA 4ZK8A 4XMTA 1ZHTA 4P2QD 4E0RB 1QBMH 2CHNA 3MVSA 1ZHLB 4LP8A 5AAWA 3MJWA 3QUXC 1EZVX 5GZOC 4HEME 1FNSH 1IAOB 3F05A 3FFCE 2ZWKA 2VL5B 1ZLVH 5IW6A 1JNNH 1KCKA 3RBGA 1E9OB 1FRGH 5AFUL 5IVOA 3KJ6H 4BHUA 5D2NE 3Q1EA 5F97E 1B3JA 2R56H 3TFBA 2XX1A 3LPOA 4JGMA 1G6RB 4YZWA 5GS0H 1TJIL 2GABA 1MRDL 2Y2WA 3BN9C 2FYYA 1QEWA 1BBDH 2FO8A 2BSSB 4LEXH 1H19A 2AQ2A 2A4EA 4R90L 3HG1B 2NYYD 3R1GL 1A4KB 4KUZL 4QMEA 3F7VB 4UV4L 1J0HA 1LNUB 4NQCA 4PRNA 4U4IA 3RX7A 3QRAA 5JHMA 3LJ3A 3ZKNC 2Y5TB 2QV4A 3D07A 4O02H 5GGTA 4D94A 4PJHF 1FL6A 2DEXX 3VRLE 3WTXA 1NANI 3GXIA 4FYTA 1EXGA 1CZ8H 5ACZA 4QQ1A 3F04A 2ETWA 2H45A 2ICEB 1EAPB 2TSBA 1HE8A 2PCPA 4KPHH 4BDVA 4UB0L 2LW3A 2Y4SA 3T65A 5LAXB 4U3SB 5GSVB 5IHBA 2DJ4A 2D73A 5HYSG 4MQXD 4JFTA 2L04A 1J1XL 1DQDL 3FU9A 1TMQA 2FCBA 4ESKA 2F74B 5SWZB 2ZUXA 2NZIA 1JD7A 4POUB 1A6WL 3UU2A 2OTWB 3AG3B 2MHAB 3RDJA 1A3LH 4IGBB 1EO8L 4PJAE 2H1XA 3LK3B 4KWUA 3ZDXE 1U0QA 3NEEA 5AOLA 1NINA 4APQB 3LKOA 3RTQC 4IK6A 4P23D 4TL4A 4XP6H 3ZDYE 5GRWA 3MRIB 1MJUH 2KZ7A 4P46D 4G8FB 3UTTD 1OWWA 3BJ91 1MRCH 5D4HA 1P7QD 4Z5RA 3WJLC 4BWTA 3NN8B 4KK6D 1YEDB 3TO2B 3ZTJH 2EO7A 2NLJB 3KCPA 3GIZL 3OF6A 3PJNA 3IBOA 4G5ZL 1CXFA 2CRMA 4FFVC 4TPRL 5IK3B 3V9CA 5C09A 4PJFF 2V5RA 1JSYA 4WAFA 3O11A 3W9EA 1MVFA 4K7PX 1F3JB 2CUMA 4YHKL 2UZIL 2XZQH 2F61A 2IDTA 1KMGA 3AA1B 3QE5A 4CNIA 3VUAA 1A3LL 1R3HB 2F8OA 1MVYA 3IB4A 3U79A 1I3RA 1WHOA 2EDFA 2VRAA 1DBKL 1KXQE 1XWVA 2VDMB 3BPLB 4MCZB 4Y0GA 1P4BH 4PW9A 2OFQA 4H0LC 4R7VA 3DETD 3H54A 5IVXA 5T5FH 1CK0L 3KLAB 3EYQD 1AR1B 4OGAD 4Y1SA 2ZYSA 3P4LA 4FL4C 4A2DA 1U6AH 4GJTB 3B1TA 4KRMB 3G5VA 4PJDE 3H3PL 2OMUB 1LP9B 2AXWA 4K8RH 5DMYA 1MFBL 3Q3GA 4KJPD 1WO2A 4L3EB 4LT7A 5EC2B 2GJZB 4OFYD 4ORGA 4DEPB 5J1TC 4GI6A 2BJML 5ADOL 2IH9A 3UO1H 3VFVB 1PZUB 4JY5H 4IMLB 4PS7A 5I8KL 2NR6A 4OLEA 3BLKA 2B3IA 3M1BA 4FERA 4AIEA 5D71L 4OSUH 3PHSA 2X89D 4NDMA 5ADPH 2Z4QA 2E47A 4JO2L 3RNKB 2CLZA 2XTJE 4ZPVA 1HNFA 4IKKA 4LO9A 1CK0H 3OD3A 4KZCA 5C07B 4H8PA 1QOKA 2CRIA 1MSPA 1MUJA 4YHOL 4JDTL 3MNMA 1U3NA 2GTZB 5DC2A 4XH2A 3ABGA 4YE0A 2CDEB 4ZSOE 5K39A 3VI3B 4AKOA 3IJ9A 5ISZB 4JKWA 4KK9C 4RGMC 1W16A 3QR1A 3FUIA 2Q6WA 3TO4D 4PWHA 1EVUA 3FZUD 4DTGH 3UTQB 3CVHH 4NZTL 2IFGA 2W0FA 4KMTL 2DJMA 4HCGA 4NM8L 4WENB 1IKNC 3W39A 4JM4H 1VGKA 4MSWB 4OF5A 2KZWA 3KYAA 5E0QA 3RWDA 2YD1A 2I7OA 2IWKA 5HVHB 2E56A 4N2IA 3NZUA 3EO0A 3FU6A 2AXJA 4J3SA 1NGXB 4YXKL 5HYJB 1T6WA 3TJEH 1AO7B 2B08A 1YEDA 2WUCL 3JV5A 3SDDD 1UGKA 3FTSA 5PAZA 3MUGB 2VMCA 2NCEA 1VZHA 4O3WA 1CL7I 2AEIT 5D4QA 1YN6A 1Y6KR 2R69H 2XXGA 4YDKL 1WP6A 3OLEA 1OCOB 3BP7A 4IOSA 4JFQA 3K71B 3MYJB 3QPKA 3DIVA 2BY1A 2EABA 4KKZA 1UZ6E 4AKQA 2VDLH 1XGUB 1ZLDA 4MBOA 1GFPA 2Y7NA 3MN8A 4JKNA 4AQEA 5IQ7L 5G38A 4TNWF 3SQOL 1U3YA 2QTKA 3C12A 5EWIH 2ESVA 1DQKA 1ZLEA 2V2XB 4G8IB 5E1AB 1D5BA 2IADB 1BV8A 4B9KC 4YIQA 1R3KB 3X1BA 4MD0A 5H94B 5KVFL 3QUKA 3KJ4B 5IG7A 4KK8D 4I48A 4PV8B 3WKYA 4N1HB 2PORA 2L7QA 1VGEH 4YSOA 3CVIL 1RCYA 3V10A 3HFML 2F54D 4FTDA 3BSGA 1CTNA 4QXTA 4PGDA 5LWYH 3Q5TA 2XA8L 2KXPB 1HCZA 4QRRD 5LN8A 4TLTA 5ESQA 3HUJF 4JFXA 4BCZA 1WITA 2EACA 1FHNA 1KJMB 4F7TA 1HS6A 4YO0A 1YY9D 2AABL 4PMFA 5K9OB 3ASNB 5JR1L 1FORL 3PXLA 2BSRA 2XPGA 3QQDB 2DH3A 3JYCA 2J25A 5IBUG 2YA1A 5E5RB 1HHHA 1RSYA 1EX0A 5T5NG 5F0LB 4WTQA 2F19L 3EIFA 4GO6B 4KQ4H 4P2RE 1UB6A 5DRNB 2AITA 3NCYS 3ULVD 5D1ZC 1C5BL 2Y6TE 4JFZL 3DSFL 4LLWA 4C83B 1PX8A 3G6JE 5FYKE 2V9QA 1BZ7B 4FNUA 4NYLA 3ZT6A 2NY4D 4ZDHA 2IBBA 2ADIA 2XE3A 4LVNB 4FQHA 1G7QA 2WQRA 1J18A 5JYMA 4ZUTA 4P46B 5LWYL 5FB8A 3UTTB 4J27A 2QPSA 5EF3A 2OL3H 3CC5A 4HISA 4LLAA 1OO2A 2YRZA 4A37A 2ZOUA 3CK0L 4S0HA 3RWJB 4JRXD 4WI3A 2E7DA 2WY3B 3JV0A 4RMSA 3VXPA 7PAZA 1F11B 3BVTA 4FMKA 4QLRA 4C56D 5EO9A 1BQHB 1RI8A 3HPJA 3Q13A 4JCMA 3JWDC 4WCYL 4JKPH 2O6FA 1J8SA 4PB0L 3U0PA 1EERB 5ALBL 4ZD3L 1QLEH 1TPXB 4Q6IA 3LN4B 4PGCB 3WG7B 1T80A 4KNUA 1WWBX 3U30C 4O51B 3QIWA 1XB6A 3JV4B 5GS2D 2AK1L 2Y3NA 4WW2C 4M6OH 1FYHB 1R33A 3T4AB 4I3SH 5A6MA 4OGXH 3RX8A 4Y9CA 1MJ8L 5A1AA 2R29A 1QR1A 2CA4A 3IU3B 4FS0A 2VSDA 4RA3A 1Q0YH 5DLLA 1HCFX 4LDOB 3IDJA 3MMEA 3MRFA 4HHGA 1IQWH 5JW3H 2DMHA 3PP4H 3POXA 1KIUA 5DZAA 5DFVD 1R5IA 5BV7B 5EEWA 3EH5B 2BY3A 3LQAH 5DMGC 4OZHF 5D2LA 1CDCA 3F7RA 3QIUB 3ZHNA 3BD5A 3WBDA 4FHKA 3PWUA 3VXUA 5HHOB 4PJEB 3FSAA 5AW3B 4L9LA 5IEHB 2R0LH 1NMBH 4G59C 1S9WB 3UC0L 3DETC 4RH4A 3CFJA 2GYSA 5F3HB 3NTCH 1OGSA 3GHEH 4HPOH 3APNA 3UAFA 1JXFA 5IB3B 2E7CA 3SKNA 1P4IL 4X4XB 3X2QB 2DI8A 4ZUWB 1N19A 2XUWA 2XWZA 1CG9B 4KJQD 4UQDA 5E56A 5C0BB 3FT3A 1KBKA 3OF6D 1PZ2A 1QSEE 3N5AA 5GJTH 3ZRCC 4C59B 4QF1B 1FO0L 3MRIA 3H3BC 2CKNA 1UT9A 4AGQA 5FXCH 1GYCA 5A2BA 2I60L 4PTTB 3OB0K 4Z7OF 5BV7H 1FFTB 4W4OA 4NCC2 4U0RB 2BVPA 1AQMA 4YWGH 1OV8A 5EBLA 4LNRA 5I6XB 1INQA 4Q4EA 4KHTL 4L05A 3NCMA 2ZUSA 3EYUL 4DP7X 1MCNA 2JVUA 4TSBH 5DUML 3BFWA 1TPXC 1A21A 3D87B 2FECI 3OZLA 4FQ2H 4EKJA 1RUQL 4YDLC 4JDEA 3RL1A 2QT6A 3H55A 2PCFA 3U30B 2FGWH 5MENE 2GIXA 3BMWA 1G0DA 3C8KB 1H6TA 3TOPA 2W07B 4TRPL 4ZOAA 4JDZB 4I9WE 5KW9L 2LFGA 2XBZA 3NZHH 2IQ9H 1IRAY 5FGSA 1SXNA 12E8H 1AIZA 5KAFO 4MA1B 4WCYH 4KXCA 4UQAA 1TZIA 1KULA 4QJ5B 2FVNA 1C08A 4FA6A 1JRHI 4G9FB 3EHBD 3D3VA 3M7OA 3S88H 1UXSB 1CL7H 1B3IA 1YC8A 5SX5H 1GFOA 5CFHA 3SGKA 5DHVH 5T1MB 3FO0H 3U2IA 3G7TA 3HOEA 3IETA 3F7VA 4UILH 3FQXA 3SGDI 4HGMA 4PV1C 3DA4A 5J12C 1NA8A 2EH8L 3QC5X 3N1PC 1ASOA 3KYMA 5AKSA 3L1FA 2R0WH 5L88H 2DMKA 2CM6A 4XZ4A 5AB1A 1A2YB 5IBTL 5LJYH 1IX2A 1ORMA 1AGEB 3T3MB 1OLZA 3IGAA 1S7SA 2GK2A 1MFVA 3QZOA 4FP8H 2OBGA 1NOAA 4TUJA 5D8JH 3MNZB 1KV7A 1UURA 2DOCA 2K0LA 1HILA 1JGLH 3OXSB 3HUJE 2HB0A 1NICA 4E0RA 4H40A 2EE2A 4J8QA 1QJPA 5H2FO 5GS0L 4YK4B 2AJVH 3LZQA 2F68X 4P3CL 4XVJL 1KTDB 3BWZA 3DLQR 1AMXA 3OC8A 3SB3A 1EJ8A 1ET7A 3SKJH 3ULAB 3WJLA 5I0YA 3HN8A 1EANA 3HBGA 3THMH 3ARDA 1EQWA 2IBZX 3TVMC 2VR8A 3IJSA 3OMZA 2GC7C 4AVJA 3QG6A 3P30H 4WUUA 1XZ0B 3KE0A 1LO5B 5J12B 2YHGA 1CWVA 2N7AA 3D0VA 2EE9A 5AVYB 1IEAB 1UADC 4NPJA 3TBVA 3ES6A 4XCFH 2Y2XA 4AYMC 3S5ZA 2GBUA 3D7PA 1J87A 2H8PA 2IH1A 1W8NA 4TOYL 2VMJA 3U2SA 1GL4B 4N2MA 3T04D 4QOKA 4AM0A 3QHFH 3F84A 5FF6A 2M1KA 2VAAB 3S96B 5DRZA 2XIDA 3C5ZD 5I6OA 3MXWH 1EZSA 3MFFA 4CU6A 1FO0A 4NP4H 5ESAB 1OM9A 2DYPA 2MH4A 1TVDA 3IDGB 3SDYL 5T3ZD 3MBWA 2SODB 3NEOA 3VWKA 2NNAB 4X6CA 5SX4I 4JQXC 5BQ7A 3QIWD 3ARPA 1UKSA 2OJZL 1CF8L 4OLXL 3TN0D 4JG0H 4FRTA 1OP5H 1KT2A 2A0LD 5FF6B 5ICUA 3IMWA 2J7LA 5E5MA 2Z7UA 5KW9H 4PH8A 4J4PD 4W4OC 3CDCA 2A73A 2KDYA 4R7NB 1ZA3A 3WTWA 3AT8A 3AT9A 4W93A 5DS2A 2DIJA 3P4OB 4DUXA 3OKNA 2PYFB 2G9HA 1BQLL 2P5EE 3DHMA 3NP3A 4H4NA 1GFMA 3VA6A 2XPYA 2OX5A 3L95A 5EZJA 5IROA 3O3DA 3FO9A 4WTWA 1FFPB 3QPXH 1UM6L 1ZWIB 1I9IL 1NOFA 2MIZA 4YE4L 1SLUA 2AQNA 4IDJH 3VFRB 3VFTB 5I30L 3NSCA 1Q9LB 3SBWA 4PJHE 3AAEA 2YJQA 3ARBB 4HS8L 4N90D 5D9SA 3ZK0A 5C3LD 3D2UB 4XGZA 4YGVA 4JG9A 3S3SA 1CF8H 1WA2X 3VFNB 5AB2A 4LOVA 5IB5A 4OFIA 3TWCH 1T4WA 3FB8A 1CFTB 3MNZA 1UH2A 5CIPH 3CX5J 5I0XA 2RA1A 2BS8A 5BZWA 2ZWZA 4L9LC 1ZE3H 4OFKA 4PJCE 4EBQH 4X5QA 4YBLB 3HRZA 2E7HA 3TA3A 3ALPA 4DP5X 2IEPA 1YECH 4M7LT 32C2B 2YQ3A 2OXGA 3AACA 5GS2H 2X1QA 4XC3L 1RIVH 4G6AC 2YPVA 4MAZA 1UM6H 4YHPB 4NZFA 4JM2C 4EIUA 1E3ZA 2ZKWA 1GA2A 2FIRT 4HBQA 1MHPH 3RIAK 5JHLA 2EIEA 5MENA 2HPTA 2H0EA 5INCA 3GI8L 2JIXD 2ZUYA 5HDBB 2BVQB 3OBAA 1IE5A 1E42A 3AS1A 1KXVC 3VD1A 2VZOA 4PJAA 4ENED 2ID5A 2TSAA 2DWYA 4NQQA 3VU1A 3KPSB 1T03H 1WBZA 2YAPA 1BZQK 4PSRA 3BP5A 2WZ5A 2R1XA 5K59E 2XKNB 4Q9QH 4XAKD 1DSFH 3AXHA 5F8RC 2YRLA 1XAUA 4J4PA 1E5UI 1ODUA 2CALA 4WSKA 5EU7E 1QTSA 3VNZA 1V3LA 4FADA 1SYVA 1VSCA 3S7GA 4ZI8A 4WGWB 3HS0C 5F6IC 2FAUA 3UDWA 3LIZH 4GMSH 1KNOA 3HZMA 1JGEB 5KS9F 4TV3A 4Z7UB 3BKYH 3TVMA 3D05A 3LY6A 1LK3H 3CDGA 5FYLD 4JPIA 3FO2B 4JM2D 4XNBA 2BS71 1A9BB 3ESNA 5BMFH 3IT8D 3K91A 3BRDA 3BT0A 1FYTA 2XDHA 2XPGB 3K81A 4JRLA 2VLRB 4I5BB 4N0UE 4ZMWA 3Q6GH 2HAZA 3BH8A 5TE4H 4LHJB 5E94B 2EXYC 3R1GH 4BKLA 5MI0B 4UQCA 4HZLB 3KPSE 3SDAD 1N59B 1OP4A 3VGHA 4WEBL 3EBAA 3KPQB 3EDJA 3Q2VA 3FAXA 3C09B 4RWYL 4O02L 3SDCB 3M8OH 4HFWB 3DECA 3QXWA 1JL8A 2R2HB 3Q8AA 4FL4B 3MBEC 4JN1L 5GRUH 1CZ8L 2AJXL 2R7EB 5JIIA 2Z9TA 2KYIA 3PWLB 1ZAGA 5A16B 3FO1B 4WI2A 3AWFA 4ANXA 5L8KB 2AV7B 4GBXD 1O6SB 2N4IA 5HGBA 3EZ8A 3CPUA 4MGXA 3T6VA 1XEDA 1F6AA 5LKNA 4MJ6A 2GTWA 4PJEA 4JPKL 4M7ZB 3X1EA 2A6IA 1AH1A 1XSOA 4RCAA 5HHPB 4Z7WF 3UBXG 4Y19A 1GZHC 4HWNA 4HV8B 4FQ2L 1RK7A 2IWGA 3CZUB 4KDTC 1FC1A 3ABKB 4Y5VB 5AFAA 3DK0A 5FHAL 2PXYC 4ZFFA 1IGFL 2IBZY 2HCZX 3MMEB 1Q94A 1MPFA 4AYBA 3UJJL 3ZHFA 4YVUA 4QXWA 5TQ0H 2X44D 4XP5H 4JMXA 4NRXB 3VFOB 2SEBB 5B39A 1OE2A 3WFHB 5E9DE 3V0FA 3RWCA 2DMBA 3KYKL 1LE5A 4HEPA 1AE6H 3QIWB 4RMTA 3ZDYB 2BIQA 1G1YA 3GXFA 4TNGA 3D50A 5GHWH 2H1PL 2ITDB 3HE7D 1OSZB 2AEQH 3DX1A 3ULUD 2BVYA 5HD8C 1A6TB 5LN4A 3FZUC 1ETA1 3TIEB 2X2UA 4UAOC 1FH5H 2ZXAA 4BBWA 3MDJA 1U6AL 2D3NA 3T8MA 1J05A 3LH9A 4JFBA 3QXAB 4NUJA 4KJPC 4TULH 4X8GA 5GGUA 1JV5B 3B83A 3INOA 4YGAB 2MNJB 4N86A 1DVFD 5E9AA 5D8JL 2G4EA 2Q7AA 2WHVA 3RI5F 3UGUA 5AZEL 3KPLA 4HU8A 5I16B 15C8L 3HVDA 4ORGB 4QO1A 4R8WL 1EJOH 1BVNP 1FFNA 2HJLB 3O9WC 1F4YH 5IEKA 2GI0A 2HFTA 4RNRA 3H6AA 1ZPLA 3CMOL 4YDLB 5J0BA 2P5WD 1CICD 3CSFA 1LQBC 4N8UA 3ULVL 4HX1A 3K6FA 1YC7A 5G55A 1NKRA 4DHLA 3QXDA 4KV5E 5C0AA 5IB2B 3L5XL 3L3JB 4TTDC 4FOMA 4HV8A 4OGXL 1Y6NR 1YO4A 2YA0A 5DI8B 1BVOA 3O6FD 5JQ6H 3WE1A 2GTWB 4NQVA 4PGEB 3P9LA 1BEXA 4PLJC 4PGDB 3C60C 3CTTA 3EFFA 2YBRB 4AEIH 4I18B 1JPGA 3MR9B 3VWJD 5A16A 1HESA 1GGYA 2MRYA 3A4AA 5KYUA 1IM9A 3W2DL 1R24B 3TA3C 2XZAL 3LNDA 5I1DA 4WK2B 1FNEB 1UZ8A 1J0IA 5E7FA 1E4XH 5EO0A 1M2VA 4F24A 3ARTA 2DDQH 1II4E 5TQ2L 3FOLB 1T1LA 1TG8A 4U1HA 2I25N 4MNGE 4EN3A 3AXLB 1JNLL 3MRQB 4QHLA 3G5ZB 3HLAA 2DKSA 3MBEA 1RIUH 5I1EL 1MAKA 2Y0SA 3MCLL 1RVFL 2IALB 2ZKHH 4MA8L 4N75A 3Q01A 1MZYA 4RBPK 4XWOC 3WDHA 4ZW6A 1AACA 1MCWW 4PVBA 2FBRA 3UTZA 4I0CC 2CDGA 4YQXL 4OQ1A 4Y19D 2ADGA 1TEGA 4JO8A 3T77A 3CLEL 5DHVA 3TVMD 1DFBL 1FVEB 2F7QA 3V6OC 3BP4A 1WTGT 2GAZB 3UYRL 2J1YA 3PUCA 4MDJA 4Z3JA 1TTBA 3PWVA 4H5SA 1SJEB 3WTYA 1VCAA 1JWSA 3IEAA 5TDOA 4GQRA 4B3EA 3BE1H 1NEUA 4JRFA 3K6NA 3CQFA 3K4ZA 4QHUB 3VB9A 4N6RB 3O6KH 4HUXB 4UQ2B 2CHXA 1CICC 1NUNB 1YUKB 3PHQB 5IUSA 3JWNG 2P9RA 1BM3L 1S7VA 4KC3B 1FBIL 2EC9T 5JHBA 5IY5B 4OD1L 1JNNL 1FL5A 1F58L 1XGZA 3QEUA 3MTXA 5JDSA 1U8HA 3ARED 4GSRA 1OB0A 4PJ7F 1XL4A 1X44A 1XF2A 5EOCJ 2WXPA 2HVJB 2BX5A 3E3QC 5GPRA 3LV3B 4OZHE 5DQJA 1PRNA 1D5IL 2J20A 3FN0H 3QIBA 4FQQA 4NFCA 5AZ2H 1J9SA 4FEMA 3RFZC 4EZJA 4XXCC 4FHJA 2VDQH 1BAGA 1FFNB 5IEKB 2AEOA 1QABA 2X4OB 5DEFA 4E9LA 1BAFH 3RDTB 3KXFB 2EIJB 4JCHA 1RH8A 2WO4A 4U6VH 5I74B 3FYXA 1G1KA 1FVCB 3TA3B 1I7RA 4AJ0A 3MNDA 2YAOA 3GSQB 3KGRA 1DVFA 4K9EC 4NIKB 4AZ8B 3Q3GB 2HKHH 4L3EA 5EC2A 3FB8B 3UABA 4ZFOB 3RGBA 1ZHLA 2HT4C 4IEFA 4N0RA 3VWJC 1R3LB 3QORD 3B9AA 4M1CC 5GS1A 4UDTA 5AAMC 2OMTA 4J6RL 4OAWB 4BHUI 1AKJA 2XBDA 3OHXA 3CBJB 2A3TA 3AM8C 3NSJA 4WV1A 3T3PE 4F37K 1JNHA 3VXSD 4ABQA 5ID1A 1OSZA 4U9CA 4M9OA 4M6AA 4YZFF 2YOAA 4PHXA 4MA7H 4WKZA 5B1CA 4PJ5E 1XB3A 2PXYA 3HNTL 4JFFA 5E8PB 5F9WC 2WW8A 2HFFB 3QDMA 3K2UL 1CLZL 1E4KA 2PCXA 5K69A 1NAML 1JGVL 2VLME 1ZHNA 4YHIB 4IBQA 3TT3H 4PW4A 1KTKE 1JNLH 2PR9A 5B38G 1HINL 2OMWA 4MXVF 3C5SB 1KJ3L 1BXXA 4PRIA 2PUQT 1MFNA 3WENA 1T4KB 1FFQA 1NIFA 2X6MA 2V7NB 3K0YA 3IE4A 4P4RB 4Z7UE 3MRPA 1XTLA 1J1PL 1MPAL 3IFNH 1P7QA 1S9VB 3G7GA 5A43C 1WF5A 2F8XC 3V0IA 3JCUO 1MCPH 2BWQA 4BSWA 3LZLA 2BERA 1PMYA 1CT8A 4TQEH 3ZQ9A 4W9FC 1IQWL 2ZOKB 3IXTA 3HCVA 3AU1B 2DYPB 3GM0A 5GRJL 4XVOA 2ZXGA 4FC3E 2LVEA 4HMDA 1AZCA 2QKIC 4PJ9C 5FO7B 4YOKA 3Q6FA 4M8RA 2JFCA 2P5WB 3KLKA 3MOAL 3LKNB 1XSKA 4KROD 5G4OA 3FU8A 3VXMA 2Y7MA 1GC1L 5F9AC 1I53A 3ULUC 4PI2A 5DRWB 5E8PA 4X50A 3NIDF 5DVPA 3ZGIA 2UWEB 3AGWA 4XNMB 1G9NC 3BQUA 4QRPD 3T6QC 4OKVB 1I7TB 1BIHA 2Z64C 2DH2A 2CK2A 1CD1B 1I1FA 5T5FL 4O9HH 3CVHA 1N59A 1UM5H 4AEEA 5CEZE 2OV0A 4QDGA 1LO4L 1CR9H 3QULA 2DL9A 3GNML 4HH8A 3IFPB 5IVXF 4ENZA 1JDAA 3MUY1 5GGRY 1FLRH 2ZLDA 4NFBA 5FPIA 5CNHA 3KCWA 1L5GA 1WJ3A 3BGAA 1G6RL 2H2PD 4MA3B 4XCNA 2YD0A 1XR9B 1WDAA 2X9WA 4O4UA 2HKFL 2Z35B 1L7TL 3HMXH 1FYTB 1PNCA 3FUEA 4FA7B 2WC7A 1T89A 2Y5TA 5T3XD 2QPDB 3CFUA 3B9KD 4HUWB 4ALAC 2VDRB 1HCYA 1ZEAH 4JR9H 4Z7UA 4CGTA 1WAAA 2X9YA 5CJXA 3UG3A 2FX9L 3EMNX 1AZUA 3C87A 4O5LL 5DZLA 1JE6A 3VRIA 4D7BA 2FWOB 4HOXA 1ACCA 2DQHL 2R39A 3HBQA 3O45A 3V52L 1P84J 3T71A 5E8EB 4MNQE 5JQHC 2VMEA 3QQ4B 4F8OA 4LSSH 1SXAA 1BBJB 2C7FA 4ZX4A 3NJGA 1B90A 1OGPA 3DUUA 3L5JA 1OXYA 4CU8A 4FOZA 5DJXB 5IJVA 1KPUA 3WMQA 5BS0D 2W8CA 5IOPB 2BSDA 4KU1A 1O5PA 3UMNA 4TRPH 3BFQG 1HAWA 1HSAB 2OS7A 4JO3L 4MJ5A 5E2TL 3ZOAA 1PCSA 3K2IA 4XC3H 2WKOA 5E0FA 1GYWA 3P77A 5F93C 2F7PA 4KK9D 4KVCL 5IB1A 2IBGA 3VQ2C 2IAMB 1T22A 2BVOA 3PIQB 1NMAL 1E2VA 2LR4A 3WSQH 3O3EA 1ET8A 1GRWA 2VR4A 3ORJA 4D7PA 1ILSA 3BXNB 3EGSA 4N2FA 2X4TA 3AABA 4GS7C 4DP8X 1GGUA 2CR0A 3TBYA 1YEFL 2YD8A 3PWJB 4HS6A 4RVBA 4R97B 4Y88A 3TL5A 1UA3A 4N2OA 5C7XH 1G7LA 3UAQA 3RUGA 3ME0A 3TYFA 3IDMB 3TONA 3VD7A 3LKQA 1AZBA 4Q6IC 1NWPA 5CCJA 2MQ0A 1EO5A 1KC5H 5EU3B 3MBEB 2A4ZA 2XQYK 1THCA 3EJZC 1VZIA 3R8BB 4PJBF 1T5KA 4FLQA 1INQB 3QXUA 4RX4D 1OCCB 2V5YA 3FMGH 1MVUA 4PG2A 4U6YA 4PU2A 4UQ3B 1LO2H 3EJPA 3WTSA 4XTRC 1KXTA 1UACL 2ATKA 1BQ5A 1BVLB 3ARZA 4EE2A 3EW3B 3GKWL 1K6QH 3S36X 1MIML 4M7ZC 5KYUB 3BZDA 1JTPA 4JFYA 1G0XA 1MLBB 2GFBA 1S5LO 3AUWB 3OAUL 5T3ZL 3VSUA 5C0CA 1NAMA 1EFXB 5F44A 4M8UA 2Y0KA 5I1AB 1YEEL 5D7SH 3ZE0B 2O30A 5F3BA 5C0BA 2CKBH 1T21B 2QR0A 1UM5L 3OKNB 3RVXC 3T0EE 5TDPA 3KLDA 4FULA 4XXCA 1A1OB 2GUOB 4F57L 4AYDC 1RP9A 4PREB 5F3HA 2E6QA 3L3JA 2V5MA 1VACB 3O8XC 4FRXA 4KHXL 4XMVA 4PJXA 4L9LB 1I8IB 3RY4A 3VY9X 2C26A 4NC0B 4RAVB 5BQ7B 4GI8A 1JJUA 4Y1TA 2BRRL 5CMAA 3X13B 4Z76B 5TGBB 4HA1A 3V8CA 1OM3L 1R5IB 4OM1L 4XNAA 2FO4B 2J1XA 2VSKB 4WFHD 4NN5C 5DD0L 1SJHA 2FUTA 4FXKA 1KBVA 5DRZB 4ZSOA 1NEZG 8FABB 3HG2A 3MLWL 4UMGA 3TN0C 2I9TB 5E5UB 1SM3H 5LGJA 3O41B 2C9VA 3IDJB 4NSKA 4FG6C 1YEEH 5D7SL 1XH1A 4OF8A 4AJWA 3FT2A 2W9DH 4FJ6A 3M6DA 3PWPE 1W0WA 3WAKA 4LEXL 4LNVA 3T4AA 4TNWK 2ZP0T 3X17A 1AQDA 3GJEB 4JHBA 4H44C 3V0VB 1RU9H 5IMLB 4M93B 1FBIH 3TIEA 3IK2A 2X4TB 1IAKA 3IN0A 1ZS2A 4P2YA 4BSJA 1NCWH 1TO4A 4NHUB 4DKTA 3WGVB 4JY6A 2OR9H 4RISH 1PL3A 3MTRA 3DRTA 3MZGB 2OLDA 3QNYB 4HF5L 3HE7A 4PJDA 4H8QA 4GKZB 5LBVA 5IMOB 1ZT1A 3CSYB 4X7FC 2FZ3B 1R1CA 4Q7DA 4YHMH 1TJGH 3IDYC 2PYEA 3TV8A 2EKSA 4EPSA 1I3VA 4G6JL 4R0LC 1Y07A 4PUXA 2OI9B 4QXGH 4QRAA 1AANA 4JQVA 5B39B 1D5XA 1KOAA 3QDAA 3KYNB 5AENA 3EGXB 3VZUX 1SDYA 2FD6L 1HC1A 1TUPA 2VXQL 4W70A 1C9SA 1WBXB 2I5YH 1CFNB 4P57B 3QQNA 5HVWA 5EC1B 1BZ7A 4R84A 5DJ0B 1JRHH 1FYTD 3O8XB 4QTHA 3FQXB 2H6PA 3WFCH 3D1MC 3PQYB 4B9ZA 2F53B 1YMME 2VLJB 2CIKB 2AKRA 2Y2TA 3BH4A 3T0VA 3ZDXF 5C0IA 1C5CH 2CZNA 3A6CH 4NQTA 1YCSA 2ZCLL 3TBCA 2OJEB 1YDPB 3A24A 3GUFA 1HXYB 1U30A 5KJRL 2WQSA 1GVIA 1ZHZA 2VXTH 3FO1A 2A1WH 4R0LB 4FFVD 3L17A 2ZJSL 4TYUA 3GRBA 3UERA 2A6JB 5FA3B 1DQIA 2C3VB 2XYCA 4QRUB 2ICWI 4NO3A 3CWGA 4CN1A 1QW9A 1IAII 2A9BA 4GYBA 5T33H 3MLVH 3T0XA 4JRXA 2EECA 4MD4A 3C9NB 2ZWLT 1M05A 3HZKA 4YMPA 3L5XH 1EFQA 3AG4B 5A2LH 1OB1A 4OT1L 3TGXA 2ED6A 4U3XA 2D03H 3GMQB 4YIQB 2NW3A 2JTDA 1UYWL 2LU4A 5EBWA 1TVHB 4PBDA 5DXWA 1UVQB 1MJ7H 2DQDH 2P5WA 4RETB 4HKZA 5I71B 4TSAH 1KYOJ 2EIZA 4GNKB 2DD8L 3GXNA 3BX7C 5TE4L 3US9A 1KY6A 3RDTD 4ERSL 2WQAA 4M6NH 1IC7H 3A0BO 3UPRA 5DL5A 1ID5I 4EI6B 1RPUA 3AROA 4JFHE 1JPFA 4YZFE 4PJIF 3B7YA 4UT9L 1S9VA 1PY9A 4UTCA 2AVGA 3TLRA 1YMHB 4MS8C 4OJFL 3U36B 1RZGB 1TJHL 5JHDA 3KPMB 3D34A 3DRQB 1ZHKA 3C6LA 4HSQA 3WNLA 4KFMA 3QAZB 2RCSL 4KX8A 3E6FA 3W39B 2IWVA 2YGPA 2BFVH 1KSRA 1S5IH 2B2XL 3A4FA 4LVHC 2XRAL 2EKSB 1TQVA 4LBEA 3RWFB 5D70L 3ULUH 1UD2A 1P5VA 3QHFL 2D2OA 3X14B 3QRLA 1S7QA 3QO1A 4I7ZC 3U4AA 4HJGA 4AYFA 2ARJQ 4AQ1B 1I85C 2YFNA 2E8ZA 1KN4H 4LPVA 3RNQA 1NSNL 5GRVK 1OAYL 3VW3H 1KEMH 3MLXH 1SY6H 3B2VH 1TNMA 3KS0J 1G7MA 5IBTH 4DPCX 4HOMA 1QI3A 3GJEA 2X05A 3MFGB 1CXIA 1MF2H 1DL7L 2FSEA 4NKDA 1PKQA 3OKLB 4UOW1 1NZRA 2AJSL 4GUPA 5E6IA 2JI2A 1AHMA 1DBJH 3QUGA 3MRLB 5C07E 3MA9H 3FT0A 4I2XB 3UZVA 3HS8A 4OW6A 4XCYA 5JW4N 4DGYL 3J2PA 5EORL 4QAMB