2W81C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 242
sequence length 242
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w81C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w81C01
4O3XB 3VE2A 1YS5A 4O4UA 4AYDC 4O4XA 4U9CA 2W81C 3V8UA 3PQUA 4AYID 3HOLA 3UAQA 2KC0A 5EE2A 3VE1A 3PQSA 4O3ZA 4O49A 4AYEC 2Y7SA 3HOEA 4AYMC 4O3YA 2LFUA 4Z3TA 2YPVA 3KVDD 4O3WA 5T5FA 4AYNA 2KDYA 2W80C 4QQ1A
chains in the Genus database with same CATH superfamily
3JV4B 2X41A 4RMRA 4I0PB 5KBLA 1I1RA 2EDNA 3Q8EA 2E47A 4G9FE 4KRMB 5DR5L 4JE4B 4RESB 3OJDB 1X9RA 1W6LA 5HYQA 1U92B 3KPOB 3V8UA 2IMNA 2YKLL 5FB8B 1N10A 1SEQH 3QUYB 3FQRA 1ZS8B 2FLRT 4LSPH 1F00I 1I3GH 2Y1YA 4CAGA 4APQA 4ZQKB 2YBRA 4F15B 4R7XA 2V2TA 3V4PL 2CIIB 4K8RL 1I1CA 4QOKB 5LHDA 1KXQA 3KLHC 1IAII 2HKAA 1YMMA 5KTEL 2F54B 1F3JB 3C12A 3K8LA 3NJGA 3FB5B 1N8OE 3IDIB 2NY5C 3LQZB 3BKCH 4FADA 4QRQB 4P23B 4RMQA 2X89A 2XV6B 1AHWA 2XG5A 3ARDB 2QHRL 3HW7A 3MODH 4FDWA 1AXSB 4P23C 4FG0A 4QHLB 1JNLL 4XNZB 3V8CA 3D4CA 4PRIB 4I3RL 2F8OA 1QX1A 4PJ8C 3L3JB 3SDXB 3V4PB 3IE4A 4H8WC 1D2PA 4MA7H 4GW1B 2AVGA 1ZE3H 2Z31A 4K4KA 3BCDA 5EUOF 1HL5A 4PJGE 1UCTA 1KLFA 1CDBA 1VB9A 5KW9H 1Z2KA 4N9OB 4ADJA 4MS8C 1YEJH 3K6SA 1ZVSA 2EO9A 4TL4A 4WW2F 5HI3C 1CFSA 5FM8A 4MA3B 3W9DA 3MRFA 1NGPL 3QUMB 4YC2B 1QZNA 4WWOA 5GZOD 2I9LB 2Q7YA 3ARTA 1JGUL 3AREB 5D4IA 3RA7H 5F72S 1F0LA 3S37H 5F3HA 3SGEI 5BUAA 3JQOB 1TQWA 3HNVL 2GI0A 2XWTA 1HWWA 3BKMH 4UQ3B 4ZSOB 3BPOC 2KZBA 2IWVA 4K9EC 1EFXA 2NLJA 3W5NA 4MB3A 1F58L 5DJ6B 2NTSP 4NNPH 5MEQA 2ICWA 1PJWA 3QK0A 3LHPH 1XF3B 4W9LC 2VIRB 4OF7A 5HI5C 3MSPA 4XNMA 3WKYA 4RZCB 3MLXH 2OXGA 4LCCC 3L5XH 2X5PA 1TTRA 1S7QA 4PP2A 5DEZA 3WUWB 2EIZB 3QDJD 1PY0A 3LDBB 1EJ6A 4KDTC 4U7MA 4JRYE 2OJEB 4G6ML 3PPSA 1VENA 4DUVA 4RFEA 3S34H 4Z8FL 4ICWA 3I50H 1MN4A 2EIBA 4Z7UF 1B0RB 2EDJA 3TEZA 1NL0H 3IJSA 5CZKA 1CURA 2WN3A 2BZDA 3QRFM 2B5IB 4Y16C 3QUKB 4PS4L 1RCYA 5BVJB 3ZZQA 5KSVB 2ZKHH 2JIXD 4XC3H 4G7VL 1SYSB 1MLBB 4FRXA 4QRUA 3S4SA 2PTTB 5J0BA 5AFAA 4PCSA 1RZGA 4OLYL 1E6JH 3HAEH 2WYHA 1SMDA 3IJHA 4BZYA 1BPVA 2K9UA 1FFPA 4E9VA 2QR0A 3TURA 2PWHA 5C0AB 5E5UB 4LSVL 5KOVC 2AJZB 3EJZC 4CC4C 4PGZA 2FJSA 5E8DH 3HE6A 2KMWA 5EULV 4YDNA 3LH8A 3RGVC 3F6LA 1FA4A 4ZG1A 3WEMA 4HVBA 4P5TB 1Y6NR 4L3EA 3G04A 4ZSOE 3O3EB 1SXSA 1AKJB 2WV3A 2IFFH 5DS8B 1FBIH 3MLZH 3HE6B 5AOJA 3OX8A 4H7VA 4YHLH 3L6FB 4X5LA 1TOXA 1JZJA 5EUKB 5LBSH 1CYWA 4FESA 4ANXA 4PJ9C 3UABA 3X11B 4EN3B 2H3KA 3SGKA 1A47A 4HX1A 3TZVB 4OT1L 3OPZL 1G6VK 4ONFL 5C09B 1R17A 5D7JB 4M61B 1FNGB 1ZD6A 3FCTA 4XPGH 4YBHA 1TNNA 5JHLH 3U4AA 3FU0A 4IMLB 4F80A 1J0JA 3QUKA 5I24A 3FW6A 2WP3O 4JO4L 1X4YA 5AW0B 5E24E 5F6HI 4QRAA 1SOSA 1HXKA 2Q0ZX 3HPJA 4Q89A 1ORSA 2VN7A 5IB5B 3CIQA 4Y5XB 3WFCH 2ITEA 2D3NA 2K6ZA 4A7UA 3IPBA 1IGTA 1UZGA 2J6WA 2BIIA 1A6ZB 2DL2A 3WUWA 1XL6A 2HJKB 4MD0B 3ZPDA 4XNZC 3D39B 4LU5H 2GBUA 4F3FA 4P2RA 4FHBD 1E7VA 5FYLL 4KV5E 5L0QC 1FLTX 3M88A 4WUUE 1FCGA 3EJSA 1VDGA 4BZ1H 3QXDB 4P5MA 4QTFA 3OR6A 5CAYB 2XN1A 1BPLB 3H3PL 1E67A 2ZOTA 1RZPA 1T3FB 4IRSA 4PRHB 2QBWA 5MP6L 4DPAX 3D25A 4DGIH 5B38A 4QRRB 5T3XL 1GGCH 1QABA 3CPLB 5DVOA 2PTUA 1NBZA 1S5IH 4RIRA 4TQEL 4C4KO 4NKMA 2I5YL 3DMMC 3FSWA 3GDCA 5KBKA 2V33A 3HWBA 2ENJA 4LBEB 4KRPB 3MRFB 3QUMA 3UOAB 1UEYA 5DDHA 3TA3A 5SX5H 4KRPC 3BEWB 1DZ0A 4A2GA 3V0WL 3NJLA 3K6SB 2NX5B 1PCXA 2BNQE 2QSTA 5D1QE 4RIRB 4FNQA 4ZW7A 4P3CL 4K23L 1MG2C 5L6YH 1UM4L 2WXNA 3GMLA 1F58H 3D25B 2X27X 1IKOP 1V5JA 1DEEB 1IQWH 3C75A 4NO2B 3QUXC 2FO4A 4NQSB 5JTWA 2NSMA 4JG1H 2ADFL 1S46A 4DQOL 1LQBC 3DXAD 1D6EA 1QSEE 3CVHH 2N01B 3IMVA 4NM4H 1GYVA 4D9LL 4AV4A 1NCGA 2XMXA 1MI5E 4GF4A 4QHLA 5AZUA 5IFHH 1GGUA 3UTSA 2C3VA 2XICA 4LSTH 3INUH 4P23A 3C60D 4NNXA 1AHWC 5F1NB 4P5TD 4M3KB 4Z0BL 1QASA 4G1MA 5JIIA 4HLZH 4KKAD 2J8OA 2ZWYA 3CFBB 1UQSB 4PREB 4PWJA 4E42B 1PY4A 4Y9BA 1VA9A 4XH2A 2X6AA 4R4NC 5I1HH 1ZXKA 3DX2A 3D7PA 2WZ0A 4YHOH 2BHZA 4FS0A 3ARBD 3QIUB 4NQCE 5DVNA 1DVTA 3Q6GL 4I48B 4YBQD 2F53B 3HHSB 1C5DA 3D85D 1G9MH 2DQFA 4MCNA 3IVKA 3KYMB 3DO4A 4HBQA 1EHLH 1A3RL 5BMFL 4ZW3A 4PM1A 3ZZ1A 4OZIF 4HKBB 3IGAB 5HVGB 4LSSH 2KT6A 4J7RA 4HX1B 1EAPB 3CFJA 4J4PD 4M43H 3IJ9A 2JELH 1DQMH 2J1WA 4Q0XL 1FYTE 4UAOB 2FX9H 2WLHA 3DJSA 1V10A 2ERVA 1T0MA 2ZWZA 3LZNA 4QTIH 1JE6A 4HQQH 3KAAA 4K9EL 3MV7B 4JRLA 1M53A 1TVHB 1QI5A 4R7DB 2PPAA 1QWNA 3QDJB 5IKCA 1JWUA 5JOPD 3UAAA 1K5WA 2FIKB 4S1SL 3CG8A 1U4EA 3IU4L 3VWJB 2Z64C 5HHNB 3FUMA 5KYUB 5LXVA 3PL6C 1BA9A 4Q9QL 3UMNA 1QUNB 5F7YC 4M1CC 1DHKA 4AYNA 4XN4A 3FT2A 3HG1A 3CZUB 1AP2A 3APDA 4R8WL 5HDWA 1VFAB 4YHPA 5F1IA 2HKFH 2ETWA 2C1PB 5IWLC 1ZHNA 5DVMA 1T1YA 1BJMA 4LHQB 3TFKC 1I8LA 1XAKA 2K4TA 5DUPH 5E5MA 4BH7B 4FQCL 1X5AA 4WI0B 3AUVA 3GM8A 4NYLB 1AYOA 2HFEA 2VDNB 4GLRI 4UBDD 1B2WL 4L8SA 3QDMB 3QFGA 3MKKA 3W39B 1T2QH 2CHNA 3HRZB 3O45A 3SYQA 4MXWL 4JO8A 3RFZA 1UXWA 5TD4A 4EI5A 4N2FA 2AC0A 1T16A 1R33A 1PYWB 3HMXH 4LCYB 4YHMH 1OPGH 1U8HA 4G80A 4LT7A 4LU5L 1AR2A 4X7TB 4MAYA 4ELME 2HT4C 1N64H 2FHFA 2K45A 2HTLD 2F5BH 5I66B 4ISVA 2P8PA 2ICWB 3ARDD 1AQDA 3HCVB 1CBVH 2HX7A 3QQ3A 4GB9A 3W2DH 2X4NA 2ZXGA 5IMMA 1NGYA 3ESNA 4PJBB 1EFXB 5JIKA 1OF2A 3K74B 3OQRA 1GSKA 3ROLB 2IDCA 4BFIA 1JRHH 5K39A 4XCYB 2XN9E 4W9HC 1CR9L 3UFIA 2Y6SD 3T0DA 3QYNA 1JCVA 4GSDH 4FNLH 4O4UA 3SE3C 2GJJA 1P6WA 5L2JA 3VFGH 1EO8H 1GFOA 1Z3RA 3MNZB 1LE5A 2X9XA 5JW4Q 4TLUA 3UTTE 5T5NF 1BLIA 2DKMA 3WIAA 2ITDA 5D93B 5J89A 5JLZB 1UACH 1JZ2A 4ZAKB 5DJAB 3ILQC 4FNPA 5TJWK 3L3OB 1F1DA 3T8XB 3WGUB 1WHOA 5IIEA 4BINA 1SXCA 4P5RA 3JWNE 1W0VB 1YDPA 2DIBA 3C6SA 4K8RD 4AYFA 2P5WD 4PRIA 1GC1H 4FCHA 1ONQB 4FG6C 1C5BL 3II1A 4KDWA 3TO4B 3V6FB 3LAFA 3V0GA 1MFVA 2A73A 3KYOB 3N41B 1AHWB 1D5MA 1KZQA 1P4IH 2XG5B 3X3FL 1GGIH 4NNPL 1NMBH 4JNXA 4DCQA 3T65B 2APTA 1NKGA 5DTFA 1TJGL 3AC0A 5BQ7A 3UJIL 3VFTA 4WTZA 2XN2A 3V7AE 4IRZL 1AZZC 2D31B 4E2OA 2VR8A 1IC7H 4HIXH 4AVHA 1R75A 1F45A 1R5VB 3UC0H 1V3MA 4XR8C 1UOWA 4ZQKA 4IIQB 1WAAF 1ZSDA 2JNZA 3S48A 2DQTH 2RAMA 4Z7VA 2IAND 4UTAH 2VDPB 4NJ9H 2ZOWA 1CDCA 3T3PE 1I3RB 1UA6H 1F3DJ 4E1TA 5GGVH 2B1HH 3ZLQC 5CD5D 2VERN 1NQBA 1LK2B 4JFHE 4NUPA 3V4LA 4GG6F 2VR9A 1RZJL 1MCOL 1T03H 4MD4A 1G5GA 3SBQA 1NCNA 2QHRH 3BE1L 1IGJA 1AO7B 1WICA 1SDYA 5BPPA 4GRMB 5IF0B 1QLEH 4LHUG 3TCTA 4FQXC 3QIWB 4FNSA 4IQHA 1T80A 1M7XA 2FBJL 4BGDA 4JM2F 5HJ3A 1P2CA 1FL6B 1SY6A 3WS6C 4ZYKB 2Z1PA 1ZLWK 1NDMA 4C4KT 5EHFA 4J3OC 4R26H 3G7GA 4YLBA 3ZE2F 1SYVB 2OTWB 1SFHA 2VDLB 3MA7B 1OP9A 4XGZA 5FM4A 4F8LA 5JXEC 1OGAD 2WIIB 4PJAE 2FH6A 2P5PA 4LOUD 3NCYS 4UMSA 3NH7L 1T1XA 2BSTA 5DD6B 5CSZB 1ZV5A 5DZAA 1NMAL 1HU8A 5T3ZE 4K3JH 43C9A 1B0WA 5T3XE 1JTOA 1XH0A 3S35H 4G70B 2BMKA 1ASQA 3FCBA 4JN1H 3F5WA 1HYRC 3KYNB 3OXRB 2HJLB 4U1IB 2BMKB 4N2IA 4R6UA 3UEQA 3LNGA 4ZTPL 3MNWB 1HDMB 4HZ1A 2AHIA 1TKWA 2K3HA 3GXFA 4O4XA 4MNQB 1UC6A 4JO5A 5DRNA 2P45B 5KS9E 2GAZA 2IPKB 1MIMH 3IK2A 4P5KB 1TMQA 3CCHB 3SD5A 6FABH 5JORB 4XNYH 4MJJA 4YHML 2FGQX 5A2KH 1Y7VA 1I1YA 1S7XA 3MRNB 5EO0A 4P2YA 5IOKA 1JTPA 3AU0A 4HLJA 4A6YA 1PIFA 1O7SA 4U1HB 3Q6GH 4PRHE 4GQPH 1HC1A 1BVKA 3G5VB 4PVLA 2UZPA 2QADD 2A9MH 3BDXA 3VI4F 4FJYA 4ZYKA 4MMYB 3S0PA 3EDKA 3AY4C 4MJHA 1YEDB 2XOTA 2BWIA 4V2CB 5IF0A 5C6TH 1QTPA 1PHOA 3ORJA 1IGFH 4GIOA 5L4IA 1CXIA 4OCSL 1OTUC 1EZSA 3DZMA 2QDVA 1MHEB 3P2DA 2QSVA 7PRNA 4N2CA 2ALAA 1OCRB 4PJ5D 2ZJSH 3BMWA 1HQRA 5JMRA 4KTEH 4LKCA 1MY7A 2OL3B 2PR9A 3MXVL 2VLJE 1I3RA 2YAPA 3S5ZA 4U6XA 2L7EA 2H6OA 5HGAB 1KLUB 2JKJA 3N06B 1CS6A 1FIEA 4LDOB 4FQIL 4FA8A 1BQ5A 3GEFA 5DC2A 4FERA 4J8RB 5E1QA 4P46B 3TCLB 3WHXA 2EE6A 1J5HA 1YYMH 2A3TA 4DH2A 5LGKA 2HSIA 2IQAB 4GKNB 4OF0A 4XMWA 4Z7OB 4TPRL 4KJPD 5F71A 2MKLC 3A22A 4GI8A 5EC1A 2W9DH 2XWXA 4MJ5B 1RUPH 1JFQH 2DWYA 1SN0A 1ONQA 1J5OH 1CFNB 1IKNC 3D0VB 3S96B 4MDIB 4Z9KB 4Y2OB 2JJSC 1QSFA 3J07A 4Z7QE 4JO1H 4P46A 3TCLA 3WHXB 5T1MB 4DGYH 3NGBB 1ZHLB 2BW4A 4PGBA 2NNAB 3QG6A 4K8RC 1PZ3A 1YLBB 3BXNB 5G2NA 5IGXH 2F9BT 3RX7A 4N0YH 2MHAB 3CSGA 4NGHL 2A4CA 4J2QA 1JVOA 1L9MA 3SO3B 4F2ME 4LPVA 3UJJL 1H8OA 4KVCL 3NIFB 2DWDA 3L3DB 2P8LA 3K6DA 4N1HB 2W80C 4UOQA 4YDKH 1SJHB 1P7HL 3WY2A 4XCYA 3F84A 5A2AA 2P5EE 2ED6A 3HNSL 1F97A 1AC0A 2VC2B 4JQXA 2O5ZH 4UB0H 3U4KA 2X09A 3HCVA 3RVUD 4QKXB 3ZBMA 3P3YA 1H6UA 2VW6A 3WIFB 1O7DE 5DUBA 4KJPC 2ZXBA 5K1NA 1HL8A 1T6VN 3CZJA 3EJRA 5GGTH 4H1LB 4C47A 1LWRA 4DERA 4D9RE 3QDGD 2BINA 3WE6A 3DX8A 5A2IH 1QW8A 2WPGA 5FGBA 3FAXA 2BM3A 4CVXA 2DD8H 3V2AR 2J20A 3FC8A 2ICES 3ZYZA 1L9PA 4M3JA 4L8SB 3EYUH 1WVZA 4F4BA 4Y4FB 4V1DD 2WVVA 4OD2B 2Q10A 4U1IA 2O5NA 3BN9C 1MELA 3FO0L 4IRJA 5F7AA 1XCTA 5DA0B 5TE4H 3T3PB 3QC5X 1HHJA 2X1OA 5I1EL 3GLZA 2DJ4A 1FN4A 2LAAA 3VD0A 1RZFH 1FVCA 2UZIL 3QISA 1TDQA 4HGWB 2WSKA 3E38A 3FOLB 5I75C 2OJ1A 3IDYC 1Y18A 3TN0A 3LEVH 4M1CD 4XBGA 5AW1B 1EDHA 4WO4A 2R0WH 1KN2L 2EQDA 3GBLA 3NRQA 2A2QT 5I1HL 3W9EA 2AK4A 3VD9A 2QQLL 3ES6B 1VHPA 3HI5L 3MRKA 1RZKH 1Q1PA 2X42A 3C09B 4GRMA 1CG9B 1XSIA 1XH2A 2WP3T 5I1KL 3Q8FA 4FRTA 4A37A 1KXHA 3HKFA 3A4FA 2GFBB 4BSWA 3OZLA 2ATPB 2H5UA 3DRQA 1IT9H 4LCWA 4WUKH 5I1IL 2DYPD 3K72A 2VLLB 4HD5A 4XVUC 1HYSC 1Q9OA 2EXWD 2WJ5A 3N2JA 4FTVB 2N0KA 2F53A 3HHSA 4KI5F 3LXAA 3TOPA 2BO0A 4Z7NF 1BM3L 1TZIA 4NQDE 3THMH 1H3TA 4JB9H 1NIFA 1AG6A 4EIGB 4PRAB 4OIIL 5E8NB 1J0KA 3EOTL 4DPBX 4MZ3A 3HI6H 4S0TD 5HI3D 5E9DB 5TDPB 2OTUB 3CFEA 4OJEH 1PSKL 5C0JB 1H3VA 2VN3A 1BVNP 2FD6H 4JN2B 4NPKA 2KXPB 3QH3A 4Z3IA 2KPWA 4HEPA 2IPTH 2XIBA 5BV7B 2IBBA 5FO9A 2X10A 3HC3L 4Q9RL 1E4JA 5EWIH 3ZL2A 5IT2L 1NIAA 2V5MA 1U93B 5E4EC 4UZGA 5FKAB 4DAGL 4NZ8A 1WBXB 3UYOD 3ULVH 3GI9H 4QOKE 2ARJB 3GKWH 3OJMB 5EZIL 3MLPA 1Z9PA 2AV1A 2G2RB 3GMMA 3D3VD 3UIYA 1MJ7H 2YJLA 2R0ZL 5C0BB 3MI6A 3CIAA 1FJ1B 1XGYH 4XVOA 3DTXA 1JK9B 2GW5A 4G7YL 4NBXB 1YC7A 2I7OA 4WLCA 4HUVB 2OCJA 1NFDA 2GITA 1OE2A 4WHCA 4E36A 3GI8H 1IC7L 2NX5A 3EJCA 1CF8L 3OB8A 4JDTH 3FYEB 3CLFH 4LCWE 1MCJA 1CDJA 4L9LA 4M48H 3O0EA 5H8DA 1N7MH 4ZAKD 4O02B 3MJ7B 3JTSA 5DFWH 1WRFA 1BYOA 2AJVL 3RWCA 4LBEA 3UGUA 3GPSA 4AGLA 4XVUD 4Y1AB 1DBKH 3QI9D 5GGVL 3AG4B 4OJAA 4YWGL 1KCSL 3SKMB 4N75A 2I07A 4L3EE 1CTOA 1AAJA 1KJMA 3VFOB 3N42B 1N6QL 4IBWA 2ZLDA 1W6WA 2V3DA 3L3OC 1TEGA 1G84A 3ULVD 1EGJH 3IDGB 1OT4A 1A1NA 3E8UH 3ALPA 3QXDA 2BS71 2ENQA 1DO6A 4N1CA 2XWCA 1AQDB 1LK3H 4NQCB 4MNGB 2YK1H 1SHXA 3L5HA 2BW5A 1WIPA 3H7LA 3QRLA 4LCCB 2PPCA 1AIFB 5DSCB 3QUML 4Y7MA 2ZWSA 3UBXI 4MD0A 4AWJC 5C9JB 1MJ8H 4ZBJA 1OARH 1OQXA 4LCYA 4NKOB 4DPRA 2CG9X 1RIUL 2I85A 4KBPA 4YHKH 3L1GA 2AQSA 2JB6A 3LS5H 1TFPA 3O0LA 5J5EA 2LHFA 1OD7A 1LMKA 3BJLA 2YGOA 3OGCB 3LN4B 2B5IC 3MHZA 2DIAA 3ARZA 5KBMA 1FHNA 2YOAA 1IEBA 1RSFA 2MOQA 4MQ7B 4RMSA 4Z7QF 2DDQL 4L8DB 2Z91A 5HPMA 4HIJB 1MM4A 4HQQL 4K9EH 5GZOA 3MXWH 2VXQL 1DO5A 3VRIB 1T1YB 4M62H 1RPUA 4DKFL 4ZUSB 4M61A 2ZUYA 4YXHH 4Q2ZA 2MIZA 4GKSA 2OSLA 3QCTL 4JFED 1CE6A 3OC5A 3PQYA 2EADA 5C7XH 4F7TB 2A83A 3ZKMC 1QFOA 1K6QH 2AV7A 1QR4A 2B4CH 3ARQA 4XMKH 2WNKA 3WNJA 4XPAH 5D7IA 5HHNA 2FSEA 5DK2B 5LN8A 4LQ1A 4ZMQA 3SQOH 4HOXA 1KY7A 5I18H 2BP0A 3MV9E 2UY7A 5K33A 4E41D 5BOPA 5EZJB 1SLUA 5D5DA 2ADFH 5LO7A 3TVMB 3ETBF 1J18A 1Q72H 4AGOA 5DURB 2MSPA 3AA7B 2WHVA 1D5ZB 5HDRA 5HHOE 4UDUA 4Y4KB 4D65A 4I3GA 1T2QL 3VM5A 4ZMPA 4WSKA 2J6EH 3W0WB 5IBTH 5IEKA 3NFSL 5IJDC 2ENSA 3IGAA 3UBFA 3LXCA 4EEEA 4JO4H 1QEWA 1VPOH 4IKKA 3UAEA 4NO3B 5IOPB 12E8H 5ETUB 3D06A 2R27A 5ACMA 3UIZA 2R0KH 1GZPA 1OWWA 4JDVB 4S1RL 4WFGE 2Z91B 3IMTA 4MYPA 3LN9A 5HGBB 4LE8A 1XD1A 2NQ3A 4EN2A 2BSCA 3CZFA 1FO0H 2APSA 3TBYB 5IMKB 2EDHA 3QUGA 2EAEA 3K8KA 4RFEB 3IETB 3N0PB 1AKPA 5CSBA 4R97B 2Y06H 2CJSA 2XWJB 1DVQA 2O6FA 4G1MB 5FYLH 1VFOA 1FRGH 1G7HA 2WWNA 3ARUA 3HZYA 4FL4C 1R5WA 3QNZA 5F1NA 4B95C 1N59B 1AY1H 4GNKB 3UTSB 5I76A 3EGDA 3UGEA 2XPZA 1XF3A 4NQCA 2EYRA 5EIVA 5D2LA 4JDEA 4S0SD 4Y2DA 5I26A 1EFQA 1A1NB 4JY5L 1KELL 2G3NA 3SPHA 2BCKB 2V5TA 3QEQD 2KLTA 3MV9D 4HP5A 3ZZLA 3NIDB 4N0RA 5F9JB 3NEEA 1D2OA 1OCWL 3O8XB 4RISL 1OAUH 5TK4A 1VZIA 1NCHA 3R8BB 3HG0A 1NSNH 4U1MA 1RUKL 4OCWH 2UVFA 1RPQA 2G5BB 2CCLA 1QPPA 2UXFA 4BK8A 3VRLF 2AQNA 3HFFA 1RHHB 2NYZA 3KDMA 3OLDA 2Y3AA 3HBGA 1JSYA 3POXA 4AW7A 3IMBA 3BZFB 3SZ6A 4OFKA 4PRHA 4Z7OF 4N5UA 4J8QA 1CTNA 1JHKH 2EKSA 3V5DA 4D9QD 4HIIB 1WAEA 5D2LB 2P28B 4Y4HA 1AQKH 1JZ8A 2Y24A 1BZ7A 4FSPA 5DT1H 2H3XC 4JLRB 4M6AA 3AT9A 2W88A 3FUKA 3VWKB 2JKSA 3BH8B 4LL4A 5AFUL 1MCEA 2AJXH 4NZJA 5DD1H 1IC4L 1PAMA 3C6LC 3QXTA 4W9CC 3D50A 4FI6A 1CFTA 1KCUH 4ZD3L 1CFMA 2AEQH 1BIIA 5HHPB 1KENH 2MCPH 5FHBH 2G4EA 1JHLL 5HGBA 1J1OH 4XN2A 4TSCL 2VLRD 4MMXC 2F7QA 3AB0C 4FMFA 1SQMA 2VQTA 5G4OA 3ZTJH 2DWEA 1U21A 4KK6C 5IOPA 3KZIO 4YC2C 4CMHC 4X4YA 4H8QA 2AXFA 3LS4H 32C2B 2CO7A 3GF8A 2EEAA 1H6EA 5TE4L 3I3EA 1GA2A 2CDGB 1FG2A 4HS6B 4IDJL 5F97E 1HT6A 5A43C 4M93C 4M03A 2HRHA 3HZMB 1YEEL 2V3FA 5GXBB 2XSKA 1ZLVH 1KPVB 1RZIA 5T1LD 3N1MC 3O3EA 3RY6A 3Q48A 4KKBC 4KVNH 4AUIA 4TSBH 1T6BX 2VISA 4P5TA 1A1OB 3IKCA 4KITB 4JQIA 3TO2B 1XGRB 4KZDL 4AIEA 3FS9A 2Y7OA 2NY4C 4MQTB 1WEJL 1P4UA 1ZDQA 3GO1H 3G6JF 3S36H 5EF0A 3N91A 3V9FA 3DUHA 4X80L 1K4DB 2N7AA 2JQAA 2IBZY 2DTSA 1MHPL 2HKFL 2P49B 1F4YH 3JUZA 3UPGA 4M5YH 5DJ8B 4EI5C 5HHOA 3OHXC 5ABAA 1QJ8A 4P59L 1QFUH 2B7DT 2G60L 4KPHH 3TEWA 4XCCH 1I7ZA 1U8CB 3D85A 1ERNA 4JZJB 3NIGB 4OSUH 4ZUVB 1HHJB 1XF2A 4UT6L 4Y4FC 4MB1A 4IRJB 5HI4D 3ZTEA 3LB6C 4YSPA 3T0VA 1SXZA 2ICEC 4IRJC 4JO2H 1THQA 5EUOE 1HJBC 5KYNA 1ZGLA 2DQHH 5EPMA 1S9KC 3CHQA 3QJRB 2OKMA 1UM6H 4B9ZA 2JB6B 4GCSA 2JLPA 1E2VA 3GTVA 3QIBA 5LN4A 1EHKB 4ZX3A 4R90L 5E2WH 1KCKA 5C9JA 1MOEA 3OVUB 2A0LC 2LVCA 3PL6A 2KH2B 5TPWH 3U1SH 3C2SA 2ZQKA 2UXGA 5IMOB 1EXUB 4ZO7A 2N7SA 4KVPA 2I69A 3TBSA 1EHLL 1ZEAL 3QS2A 2OULB 4ODWB 5J4MA 1YEIL 3UZVB 3L1OH 3DJRA 1C16B 2IVFC 4JRXE 4XMLL 3ULUD 3C5JA 4ODVH 3FONA 4LO9A 3GLEA 3MQIA 4JFXA 2LOEA 4JQXC 4X4KA 2W65A 4EDWH 4OCXH 4A6YL 3AWEA 4X9IA 2MHLA 3T2LA 2BSRA 3VFOA 1CICB 4EBQH 1T22B 3ROOB 2CKBH 3TH3T 1CICC 3V0EA 2DMKA 3FPXA 2ZUXA 4JHWH 3OHMB 5C07D 1TZGH 2N59A 1AE6L 4HCRH 4GPVA 3OXSB 4Z0XA 1FVDB 4AC2A 1GOHA 2BNUA 4H26A 1S7TB 4HUXB 5T3XD 1PZ5A 3OF6A 5FYJD 2G9KA 1ORQA 2VR5A 2YD3A 1CFQB 4HFWB 1FJ1A 2ESVA 3V4PA 4AEIL 2PRNA 3DV4B 2G2RA 2YRZA 4LPTA 2XIIA 1VF5C 3RTQA 4NWTL 2BSDA 3IKKA 1A22B 1OTSC 2AABH 4KMTH 4WI7A 4HC1L 4IJTA 4XMPL 1XF5B 5DEFB 1A7NH 1JGLL 2B08A 3S36X 3IJYA 4P23D 5G55A 1KYOJ 1XR8B 3HG4A 5IHZB 1FO0L 1WA2X 1YMMB 2V5SA 3HC2A 4OM0L 5D2NC 3CLWA 4Z76B 1E2ZA 4YDKL 1IM9B 1PD0A 1SLWA 2X2UA 4U6HA 3LH2H 3BYTA 4PRAA 4J6IA 5SWSB 3L3KA 1RU9H 4K3HA 4U6XB 4K0OA 4MMXB 3DLQR 4ETQB 3QUYA 3TBWA 4LRNL 3KJ4B 3FQWB 2Y5TA 3ZDYB 2XDHA 2PKDA 3SBWC 4APXA 2IANE 4LOEA 4WWKC 5C9KA 3DV6B 1MVUB 4X98B 2BP8B 4E1SA 1B0IA 1HSBA 2CPCA 2WXFA 3GSWA 4NWUL 4TUJB 1M57B 4WVRA 5JW4N 3WFBL 2BRRL 3HB3C 4S2SA 2RTTA 4EZLA 4FQXB 2WWKO 2OMUA 2X0UA 5EV7A 3CSYB 2R69L 1BVLB 4ZO8A 4X9YA 3RP1A 2VDOB 4CDHA 3QAZB 1TU2B 3F7KA 3KHOA 5I16B 2AQTA 1DBAH 5E8OA 4XPBL 5HGDA 3CFCH 3MJ8B 5GGQL 3SPVB 3VXRD 4ZPTB 1CYXA 2K3TA 1TVBA 2OK0L 4B9JA 3L7FB 4ZX5A 1I1YB 5AENA 2WVTA 1BQHB 2R9HD 3BC9A 3PNWA 4EOWL 3DPBB 3DSFL 4HUWB 1N70A 3FB8B 3HG1D 4MNQA 1KEML 1HVXA 4ZRGA 1I1FB 3MLSL 3O6KH 5E2UH 1F8TH 5BS0B 3ZGHA 4NKIL 4Y16B 3SDYH 1SM3H 2NUPA 5IGXL 1KB5A 2HT2D 4WJ5A 1AS8A 5DMKB 4PS8A 2AI0H 2KBGA 4YL9A 3JSSA 2GSIB 5ITBL 1RLWA 3B8YA 1OSZA 5DD1L 2XN9D 4JUTA 5FW8A 4KH9A 1ZJBA 3MRGB 4PJ9A 2YZ1A 5DD6A 4L9DA 1NUFA 1U30A 4XNUL 5KANI 1KJ2L 2Z7WA 1FH5L 1JNNH 3NCXA 4GKOA 3OMNB 5AQ0A 3ZE0E 1XQ4A 5IB3B 1ZVNA 1G4RA 4OVUA 5JXAL 4AYGA 1KIQB 5IQ9A 3B2UD 3CXHK 3DTUB 4FNRA 1YEIH 5HGDB 2WB7A 3PL6D 2KI6A 5C0CB 4KK9D 4FF9A 3NIDE 1OCZB 4G8GB 5H2BA 4HWEH 1SXNA 2BNQA 4Y5VA 2Y07L 3RGVA 2LW3A 4AIZB 3D33A 1T5XA 2CM6A 3F7VA 1F13A 2DQDH 1MFDH 4LB8A 4NUMA 5GHWH 4WU7A 1INQB 1YNKL 1ZHBB 4L1HA 4LP8A 1E9OB 3K2KA 4MMZB 4RBPH 2LTQB 5EU5B 2R1YA 1DBBL 1SJHA 3CBRA 4E9YA 2WBJD 2XQYG 3CC1A 1E65A 1S9VB 1G90A 2KLSA 3E1F1 4C56A 3MJ9A 2VMCA 5HHME 4B0MB 2ILLA 5FO7A 2F8VA 2QSCL 4FYRA 1OCWH 4JJHA 2V3EA 1M2VB 3H85A 4Z3EA 5C08B 3EJJX 4Z7VB 1U3HA 4X6BB 4PGJA 1HSAB 3MRQB 5AVRB 2OW6A 3WL9A 1L9SA 2R69A 2IDFA 2IXQA 1O7VA 3U48A 3H9YA 3REVB 1X6NA 1Z32X 1W8OA 1R19A 2PYFA 4WFFE 2AJ3B 5TDOA 3IT8D 2R2BA 1Q72L 2NW2A 5BZZA 5T8IA 4PGEA 4MDIA 1RFDH 4C55A 4JG0L 2R4RH 1CUOA 4JDTL 5A2JH 1E30A 2OFQA 2R7EA 1XIWD 5GGUB 3ZTJG 4P3DB 3J7HA 3QYCA 1LP9F 5HVFB 4ONGL 4PG9B 1NCBH 4NCC1 1LE9A 2Y3NA 4J8RA 5LBVA 2JJTC 4HFWA 3VXSD 2Y6TE 4FQHB 4B41A 5DGQA 4QHNA 4Z7UE 5EZLA 2ZG2A 1P69B 5GJSL 1ZLWH 3UJJH 5I1GH 4Z0XB 5TPWL 1OAYH 3DMMB 4G11A 2VO5A 1INEH 5KVDL 1MJUL 1J1OL 1DE4A 4NBZB 1OM9A 2Y06L 5HDBF 3SJVD 5HHVH 1WA1X 1Z1WA 1W0WA 2G5UA 5DO2C 7CGTA 3OV6A 2X4OA 4LPYA 2DZEA 2UZYB 1UJTA 4LPUA 1ZMYA 4KDVA 4MJ6A 5AKSA 3PV7A 5DJ0A 1IJ9A 4WW1B 2XPGB 3FONB 2IOIA 4NRZA 2HTLC 3VI3F 3US0A 4K94H 5DJDA 1MCLA 5F21B 1AI1L 3QUXB 4QWWD 3UZVA 3N41F 1DSWA 4ABQA 2H8PB 3AG2B 2P8PB 4B0MM 1ZLEA 1TQCC 4MQXC 1RH8A 4W9FC 2ORBH 1OAQH 1YEEH 3V5HA 4G42B 1B3IA 3KW7A 4JPIA 3WU2O 3VM7A 3IM1A 4KVNL 4FJ6A 2VXTL 3PABB 1AZCA 3MRIA 2KDYA 2GCYB 3CFNA 1NUNB 5JHBA 4S1DD 4Y9EA 1RMFL 2MNUA 4HH9A 2B3IA 4G9FA 4B9IA 1SY6H 1AMYA 4CDGC 4PWGA 5D8JH 3F58H 2DS4A 4F8OA 5LGJB 5D7LE 4CBZA 2BZCA 2ZFGA 3T09A 3K2IA 1A7NL 1JGLH 2RD0A 3ILEA 3I3BA 5FWRA 1I8LC 3MDJA 2YQ2A 3CH1A 3DX1A 2EXYD 3CVHA 5IWLA 1MPAL 3KVDD 1EEYB 1HYSD 2K1MA 1G9ML 3EYFA 4WV1B 3HG1B 1R3KB 5IW1A 3QZLA 2UY6B 3FU8A 4ADIA 3R06B 4NM8L 2H0PA 4GSRA 3TJHD 2Y23A 1JN6B 1P5VA 5IB2B 4JHBA 3HZKB 4LOFA 2UWEA 2GTZB 5DHVB 2WIIA 4RAUB 1J0YA 1NAMB 2GQHA 4LASL 3CHPA 4BZ1L 5B8CC 4PV9A 1W8EA 1UT9A 3FFOA 4FULA 5HVWA 3L16A 3RGHA 4EXPX 3TBTB 1EHNA 1FL6A 1Z9NA 4HIEA 2XYCA 4S1RH 5B8CA 3HZMA 1FZOB 4E5XG 4HAGA 2HKHH 2ALWA 3L81A 3P02A 3RIAK 3VQMA 4BQ9A 2VUKA 5IJVB 1I8MA 1D5BA 4PJCF 2I26N 4JVPA 2K8QA 1ML0A 3J8F7 1KTBA 2DBLL 3B2VH 4FXGA 4D0CB 2Y7NA 2VN4A 5CD5C 32C2A 1HJCA 4L3AA 3CN2A 5CHNB 3KH4A 5E8PB 1ECZA 2JKWA 1UWEL 4R5VA 2W0PA 1AXTH 1VGEL 1DQJA 2FK9A 5AOMA 5FXCH 4Z3JA 4FQ2H 4AL8L 3R7RA 4RNRA 3HS8A 1JF6A 5EFIB 5K9KA 4GLRH 4LHUA 3C5SB 4D0DA 3QORC 2XWEA 4ODSH 3BWAA 3X2QB 1HK6A 2ICEB 1CK0H 3CZNA 3DA3A 3QORB 3BAWA 3QFJA 4XH2B 4PRBA 4JPQA 4S11A 3TH4T 4ZXBC 4J3OD 2IIJA 3WO4C 1I8IA 5CM1A 1YMMD 4ECNA 3T65A 3HC0A 1HHIA 4N2GA 2YWYA 3MUUA 1GIGL 4R83A 1BZEA 2GK0B 3KYOA 4DO4A 5SWZE 2GVYA 1QFHA 5E99L 1EH9A 5DMGD 4K94C 1X4ZA 1P84J 3S3BB 1B90A 5B3NA 4IGBC 5C0NC 3NIFF 5JOPE 2J4WL 4K5NA 4S10A 5JIQA 2H26A 1NOFA 2N56A 2YXVA 3CZGA 4DP0X 2L7QA 4TF4A 2E7MA 3CNKA 4TUOB 4ZMZA 2J1XA 3BUPA 4U1MB 4TNVF 5JHDE 1MKFA 3KXFE 3RPIA 2EILB 3TA3B 4XP9H 4ZMYA 5JNYA 2YS4A 4L29A 3VFVA 3TA3C 4BWUA 3LK42 4B7LA 1YZZA 2MKWA 2ZKHL 2XPYA 4LGRB 3SJVA 2IGFH 5E94A 2BOCA 3LKOA 2B0SL 2BVOA 1CIDA 2R0KL 1NLDH 4Q8BA 3IN0A 4PHZA 3MJGX 4BFIB 5LGHL 4MJIA 2BCKA 3QWNA 2WQRA 1CXKA 1T1WB 2HPOA 3QYMA 3QO1A 2OBGA 1EBAA 1YA5A 2APXA 4Z95H 5FLVA 3VFNB 3QCUL 4H0GA 1OARL 3NMEA 2LU5A 2YLHA 3D39A 2XJKA 1X5FA 3QAQA 5I76B 1VIWA 2M83A 5AW6B 2DY2A 3K4ZA 4Z77A 3QNZB 1BCIA 1WZMA 5AVUB 1HS6A 4I77H 1GPOL 1VZHA 4MJ2A 2QFRA 2AK1H 2VXVH 2N0MA 3NQIA 4FUVA 1WFMA 2Z8VC 3AA1B 4MCZA 3RFZB 3IETA 2A9BA 3PWJA 5IBLD 3JT0A 4AYEC 1I1AD 1IGIH 3FH5A 4QRFA 5AVXB 5B1JA 1QSED 3NABL 2O61B 1EJOH 3RVWC 2HFEB 1JGDB 4FEIA 5DRXB 4ZNEE 4TNWK 4BSJA 4XPTH 1JUFA 1XCWA 2CR6A 4OM1H 3DK2A 2HTKC 4DKAA 4DKTA 4IRJD 2NOYA 2VDMB 3EH1A 4FQPA 3BH9B 5F8RC 1VFAA 4OLEA 1OVZA 1YC8A 4FQ1L 3FN9A 5EBLB 1KIPA 1G0XA 5I1LA 5HHMD 5KG9A 1C08A 3SGKC 1TZHB 2HRGA 5BW7A 3RTLA 3DPDA 2FEJA 5IV2B 4PBWD 4HAKA 4JJ5B 3OPUA 3TBVA 4PJ7F 3UERA 1AKJA 3K81A 4B61A 4PGDA 2RALA 3PDDA 3L4VA 3TN0D 2X2YA 2X28A 3FRPG 3ZKSD 4ZW5A 5CLZA 1U6AL 4JFYB 1QLEL 1JHKL 2CNYA 3F3HA 3OLGA 1GSMA 3EIFA 5D7IB 3PLYA 3VZUX 1FIGL 4RGNC 4GG6A 4P5SA 1IAMA 2LABA 4O5LH 4JFFB 4OJCA 4H4NA 4CC4A 5BOZG 5C0CE 5KANG 3AT8A 3E1ZA 1EAPA 3LYRA 3VGFA 3PP3H 5D1QB 3BN9D 2V6HA 3OHXB 3U25A 5CP3H 1P4BH 1E6OL 3LH9A 3NJXA 1XH1A 3KYMA 4DK3A 1DCEA 2EVFA 2WLIB 2PN5A 2DQFB 2RJMA 3NESA 4PLOB 5DQDL 3WSQL 1G0DA 4R7NB 4PYGA 1QWHA 4WHTB 4AM0A 3QIUA 1JXFA 4OAWB 2C3XA 1JVKA 3P0VH 3UO1H 1C12B 2WXKA 4KQ3H 4QNPF 4G6AC 3BZ4A 2HXAA 2LLGA 3KL0A 3K4DA 3QZPA 1V3LA 1USQA 3V0VB 5DRWA 5K9OB 4NKOA 2NYYD 5IK3A 5IREA 4PJEE 3A23A 2DKUA 1MH5A 4UQDA 4LVOC 4NNXB 4RZCA 3RIFF 2M2DA 4LCCA 2IFFL 1RFDL 4Y9CA 3LZOA 1I3VA 4AQ1C 2BRQA 1E9QA 1DVYA 1QYGL 4AX3A 5JPNA 4F37K 1HZHL 5CUSH 4HUCA 1D6EB 3SZDA 5I82A 1ETZA 1NEZB 3IB4A 4G5AA 4BZ1A 5E2UL 2VZ3A 5C7XL 3TT1H 1ZLUH 4NOBA 5JHDA 2NY6B 4NC1E 3N40P 5FYJU 3KPSA 2TRHA 1JV2B 1J1XL 2NY6C 2I07B 1TUPA 4GG8A 4NT6B 2XBTA 3U9PH 4LVNB 4QRBA 4N2BA 1KTLB 1ZVHA 3F7YA 5JW3L 1G9HA 2E8ZA 2CD0A 1QRND 2ZXCA 2CU9A 1ITBB 3WU1A 2G5RA 5T5FA 4AL8C 4PS3A 1NUGA 3QUYC 3SKUD 3PDOA 4IGBD 5ANMA 3LNIA 4HUVA 4ORGB 4KTEL 2FBJH 1B2YA 5F93C 4G6MH 3MU3A 2YPLD 5GRVL 4KKAC 3PYCA 4UNTA 2IH3B 2R23A 2YA0A 4X99A 5D2NA 3MGOA 1RZKC 2O6DA 4WF7A 3SE6A 3IGLA 1IZKA 2HLEB 1HKLH 5KVGH 4GG6E 2YIHA 3RIFK 3RZCC 3AA0B 1DBBH 3DUSA 1WBZB 1OP3K 3BW9A 4I0KA 1MRDH 3VI3E 4JCHA 1DJZA 3H55A 2OSWA 3RU8L 4AQZA 1F3JA 4OZ4B 3UTTA 3UYPB 1ORSB 4IOFC 2O5YL 1I31A 3HE7C 2VMJA 2CGZA 3CFMA 4K55A 4R4BA 1GXEA 3F6IA 1BAFL 4X4MA 1KFAL 2NY5L 4U0RC 4MBOA 1NCCH 1HXYB 3DJTA 5DD3L 3VGEA 3K72B 1RK1A 3RB7A 1DJXA 4PH8A 1CDUA 2ATPA 2P42B 3Q7JA 1TG8A 4PTUB 5I5RA 2QTVA 1IEAB 3ARXA 3VXUD 2BVQA 3ATBA 3UTZB 1GHFH 5F6IB 3LIUA 5AW2B 2J88L 4JHVA 2F2HA 4WTWA 2UX6A 2WUBH 2VL5A 1A4JA 4LSFA 1ZHWA 3VFPA 1DP0A 2R8SL 3DVNB 4ONOA 4KKQA 1XBDA 2E86A 3B6SB 4NRXB 4MCMA 3WAKA 2R83A 4XBGB 1ASOA 2IAMB 3S88L 1K9TA 2CK0L 3ML9A 4N8CL 5FKPB 4ZFGL 2XZQL 3R8QA 1ZT7B 1U8LA 5GGRB 3TIEB 3VI4A 3LDBC 1YG9A 2P44B 4HGWA 4FJZA 5DQJB 1E4KC 2CO3A 1KNOA 4GP4B 4H20H 3VXTB 4G82A 3TYGL 3NACH 2VN6A 2QR0B 3VRJB 1I4FA 3ZRSA 4JZJC 2BNRB 1HE7A 4XVTH 3FCGA 4JFEB 3VU2A 2KUTA 4X9GA 1KIRB 3X1BA 4W9GC 4LCIH 2FRGP 4KHTH 1FFOB 1NGZB 2VM9A 5BZWB 5FF6B 2FB4H 3DSNB 2D9QB 2PO6A 3WIHL 3A0BO 1NEZG 4UB8O 1OKEA 3H9SE 4Y4FA 1GJIA 5DZ9A 1DJGA 4G3YL 4XAKE 4F57L 5BUPA 4MA1C 4O51A 1IC4H 5E8EB 4LIQH 4FLSA 1PEZA 2FYYB 4K3GA 2UX7A 3H3PH 1OP5K 1Q0XL 2CRZA 3C9NB 3FBKA 3GJFA 3VH8B 1OGSA 2CSPA 3DIFB 3L9RB 5EC2A 4BHUI 4DEWA 1NFDE 4OB5H 5D6CA 1B4LA 1G6RH 1ZLVK 4PRIE 4CVZB 4WKZB 4KTGA 4AQAB 2ERJB 1S7QB 1W80A 4LSVH 5TH2B 3VCLB 3FTXA 3GLDA 1AHKA 3NIDF 1T4KA 1J5OL 3LD8B 3K2UL 2CA4A 2YFNA 4Z7WA 3WIFA 3WTUA 5ERWA 1PW3A 4P5TC 4YLCA 5MEQB 1XTMA 1A14H 1A6AA 2KZKA 3P73B 2V8MA 3SDDB 1BVOA 1BFVH 5J3HD 4OZGA 4CBPA 2R0LL 1JV5A 3MRBA 2XFXB 5F70A 2XG6A 2PTVA 5B39A 3T1WA 5E6ID 4M8UA 3T0ED 2XJLA 5CIPA 4Y9GA 5JR1L 1IFGA 3BVWA 1H3UA 4FHJA 5DD0H 1R3JA 2XTSA 2QGCA 4FQCH 4PV8A 2X12A 2YXMA 1FL3A 3O2VH 3X13B 4P99A 3HE7A 3WEBA 5JW5B 3AS1A 3FUJA 2A6JB 1CFSB 3G5YB 4KO5A 1TEYA 1KGJA 1QHQA 1ZVSB 4BXSV 4NNYA 4F7CB 1NIEA 2WJQA 4E9LA 4YHNA 2ZONA 3BJ91 1F4YL 1FLRL 4IBSA 2C9AA 2VDRL 2VLRE 4LFHG 4BA8A 1MI5A 3SBRA 1KV3A 5DMGC 4J3XA 2JB5L 1MHCB 3FMGL 1MWAA 1K5NA 3C6LA 3P1VA 4Y2OA 2EDWA 1J5DA 1TF4A 1OSMA 1AO7E 3KR3L 1HXTA 4U1NA 3TCXA 1LO0H 3GTTA 3U83A 2NR6A 2ZOKB 1JS4A 3ARDA 3MA9L 3OB0H 3V6OC 5G3AA 5B7EA 3POHA 3VGGA 2OX5B 1FH5H 1IBGH 1JNNL 3W2DL 2X4SA 4RDBA 1EUTA 4XT1C 2VRAA 3P2BA 1YNLL 5I6NA 2F7IA 5KJ4A 3WMPA 3W56A 1L7IH 2O5YH 3MLYL 3UPCA 3MREA 2Q5BA 2VDOH 1KEGH 3VSQA 4GFTB 4XWOD 4WFHD 4I77L 1T7WA 3LIZH 3SO5A 2XBDA 1QKZL 1EA9C 4QEGA 4QHPA 4APQB 3GBMH 2EVHA 5CILH 2PPEA 3MV7E 4X6CA 2VQ4A 4XCNA 1LL1A 3ATDA 4I5BB 1GYAA 4LKCB 2RBLA 1PTZA 5H4ZA 1E90A 1N26A 3NJIA 3HPLB 3F04A 2G2PA 4IS6B 5HYQB 1FL5B 3B7UX 3ILPA 3HUJB 2QQKL 3NSXA 4G8EA 5EA0H 3QR0A 4AGPA 4BSVB 5I6MA 1YMHA 5JW4R 4TOYL 5HGHB 3HB3B 3JV4A 4ALAH 1O6TA 4FI7A 4PTTA 1O6SA 1OE1A 3K5SA 2J4UP 1VCBC 3DBXB 3QUZA 3FO2A 5D7IE 4H0HB 1MCKA 1U8NA 3MKGA 2H7WA 3Q2NA 2FWLB 3QEQE 3PNRB 4V11A 5CWSB 5IEHA 1K8IA 1PD6A 1YPZA 3U2SB 3TZGA 5KAFO 3CVHL 4NM4L 4Q9CA 5TDNA 5CEZE 1HH9A 1E0OB 4NC2B 2LGNA 3H42L 4TULH 1U6AH 3BIBX 3MRNA 3FTYA 4FNTA 4H2CA 3EGSB 3T24A 4FKKA 3MRJB 2CBTA 4JS7A 1V3KA 1RZQA 4MA8H 1KB9K 1LEKA 1IZJA 3E6HB 2XZAL 4M8VA 2B1HL 1XAUA 1ET7A 1HDMA 3HG5A 2WQ8A 5JHAA 3CUPB 1VLXA 1Q1JL 5E1GA 3O4LE 2EDKA 4J6RH 4MHHG 1KYDA 2CDFA 2XXGA 4JRFA 4EI6A 3PRNA 5KSBB 3MCLH 4GP5B 2FYVA 4NS0A 5I0DA 4MKTA 3FQ1A 3AQZA 1M1SA 4OM0H 4OUUB 4JHAL 4ZUWA 1UKSA 5CZVL 1A3RH 5BMFH 4FFYH 2EKJA 4DKFH 2QTKA 1AGBA 1HHHA 4HWZA 5AW3B 4LLQB 1K3ZA 4HWEL 2PW2A 1EHAA 4M93B 1CXLA 4U2ZA 1P53A 2DI7A 3QA3A 4NO0A 3ISWA 3SCMD 1YUHB 4BH8A 4LQFL 1BJ8A 5D4HA 4DWHA 1J9CT 1UWEH 4JAMB 3FU6A 4LLDA 4ZFOB 1SJMA 1CZ8H 2JCCF 3Q6FB 4GBXC 3T6WA 1ILSA 3QZMA 4HJGA 4N58A 1AO7A 5KVFE 2VABB 4AMWA 4JFSA 4PJ5A 3FCUB 4QO1B 3QEGH 1P6AB 5HDBE 4JUSA 5CP3A 4ZZFA 3ELAT 4CU6A 2W9EH 1EO5A 1C5BH 3RBGA 2BSSA 5EZOL 1UM4H 1FAKT 1C8QA 1QPXA 2LHAA 3MO1A 4OF5A 4XNAA 4HBCH 4CN4A 4ABUA 3OKMA 3ARBC 3V4VH 1FYTA 4L48A 4ZFOL 1EK3A 5FO8B 1TCMA 3WLWC 1A7BA 1LP9E 3L5JA 2F6AA 3CDCA 1WT5C 2LAGB 3ZR5A 1FAIL 3DX9A 1ZA3A 1ZLSH 2ZYRA 3AJ7A 3AITA 3HHMA 2WWMD 3MRLA 5ADXK 3FH7A 4PJAA 4ZDHB 4OR1A 3FO2B 3M17B 2BC4A 4OLWL 4Y5YA 1L7IL 1YY8A 2NR6D 1G7JA 2D7OA 2YGNA 4AKOA 4M8RA 4ZOAA 4WJKB 5HD8C 5IVZA 2VERA 3RUGE 1RJLB 3BKYH 4X42A 2X05A 2E27L 3VFUA 1B88A 5DUMH 4BSVA 2F53E 4Y0GA 3NCFB 5EF1A 4GS7B 4B5EA 1X5HA 3DVGB 4YLQT 3V4VB 3VD3A 4GS7C 1KDJA 3L3OA 3T8XA 3GBNL 3ZW3A 5C86A 1ROWA 3ETSA 3EJUA 3BYYA 3CC5B 4XCNB 4Y1TA 1TEFA 3HC3H 5CS7A 3L17A 1FPTL 2D9CA 4ONHB 4EUPB 4E9SA 3QCUH 5AD0A 3D4YA 4R3SB 5F6HJ 3AWFA 4D9QE 4DN3L 3L1EA 4XZUA 3HW9A 1CFVH 3FZUD 3OTTA 3LPPA 4G6KH 4ZODA 2DM7A 5AL8A 5L2JB 5BOJA 1BMWA 5AKVA 4TNGA 1I7RA 1D9KB 3D2UD 2XVBA 4UUJB 1RVFL 1WZAA 3O6LL 4P04A 2XKUA 5J1AA 2XNAB 3ROLA 3GXIA 2OX5A 3IGUA 4N86A 4M4RB 2ZOKA 3JWOL 5G4NA 3NJJA 1O75A 4ZXBA 5KBNC 3E6FA 2QADC 1VACA 5E00A 4Y8AA 2FGRA 1I8KA 4U1KB 2QADB 1GC1L 3TPKA 4MAYB 3WDIA 1ZT1B 2J1KA 5FYKE 4YHNB 2ADYA 1XH3B 1KJVA 1BFOA 2AQ1A 4J3OH 4EZMA 5DHVH 3T2NH 2JKIS 2Q87A 4TN9A 4N90D 3O4LA 3LOWA 3HRZA 3SKJH 3CX5K 3OD3A 3ABMB 3DHMA 2WLKA 3HE7B 3DURA 4X5WA 1LO5A 4UOJA 2JF1A 2FEDD 4FXGC 3UJTL 5I9QB 3SDCB 3F12B 5ANME 5AAWC 4HJ0D 3RDTB 4AT6B 3GRWH 3DX3A 3U36A 4FFVC 1KENL 1IBGL 5FHBL 1ECYA 3ZDZF 4HXBH 4JR9L 3FQXA 4LEOB 4WV1C 5D1ZA 5KSBF 3D6GA 3N1FC 1KT2A 1UB5A 5F7NC 1EDYA 2GHZA 4GSQA 1FNFA 3NP4A 3OKEB 4UM9B 3VE2A 3HI6L 3WFHB 2ZX9A 3D4GA 4WO0A 3VXPB 2YHGA 5J12C 4BRJA 4L3CB 4I9WE 1S7WB 2VMEA 5J12B 1H9DA 3VWJA 4W9DC 2FIKA 3NP3A 1O7DC 4P2RE 3GMOA 3DIFA 3L9RA 5EC2B 5HYEA 1LYQA 3MXVH 5ID0B 2CALA 4XPFH 1W72B 4OV5B 5E7BA 4P9HL 2Z34A 4IHOB 1T0MB 2AZUA 4FZEL 3FFCD 1R5IA 2QVTA 4Q4IA 1IBYA 5JDSA 2O5XH 3OKKB 4XCEB 5LLIC 1AI1H 4HKBA 1GCYA 1GOFA 1FFOA 1UKQA 2ICWI 4M5SA 4L37B 3T3PF 1NAML 4E41E 5CEZH 1LTXA 4MS8D 2Z9TA 1JZ7A 4PVBA 1GZQB 5KOMC 1FGNL 1BXVA 3CQQA 2Q1EA 3UG3A 1OT2A 4OCYL 1FGVL 1NGWA 3LV3B 3MLTB 2ADGA 5CBAA 3S7GA 1XGQB 5EN2B 3HNTL 4HF5L 1TR7A 5F7LB 2J8UE 4HWBH 1THCA 4K3EH 2CDEB 3MYJB 2O93L 4KR8A 1DVXA 3D1MC 4BFGA 3QJHA 5AFUK 4N0YL 2EH7H 3X14B 4NHCH 3GSNB 4H8WL 4AZUA 1ED3A 3RI5K 5HHMB 2E27H 4R90H 3WEXB 3SJVE 1WLHA 3JVGA 2VQ1B 3SIKA 3WTVA 3TPUB 3PCYA 1XGPB 2JMRA 3CDGA 3F01A 4JHAH 1WBYA 4QJ3B 2WN2A 4KROD 4PP1C 3GNML 2RGSA 2DQIH 3QWOB 2DYPA 4I85A 4M00A 1ZGLM 1ACCA 5IMLB 3VYNA 5KJRH 3L95A 4F8TA 2XTRA 4N59A 5KYWB 5JZ7C 1K4CA 2IADB 1HINL 4UIMB 5IHBA 1HAWA 3WY4A 2J7LA 3L8QA 4N9GB 3PAZA 1DQTA 2JJTA 5EO1A 1J05A 3DX6A 4W9ZA 4B9PA 2IV9A 1XZWA 4B60A 1O6VA 3F83A 2W1NA 3QI9A 1JYXA 4FC3E 3MYZA 5DI8B 3GINA 3RYMA 5GPRA 4PLNC 3FT9A 3OKLB 5FDWB 2YRPA 4Z7WE 2TSAA 3WJJA 4XCFL 3U9UA 1UA3A 1A9BB 3CGTA 3OPZH 4W9JC 3ZSTA 4ZNEA 3B1UA 4KFZC 3NBNA 3K0WA 4IHBA 3I75A 3K6FA 1HILA 4Y1SA 3OAYH 1ZWIB 2ZSWA 4HJUA 4QT5B 1G43A 4UDTA 3GP6A 3QFJE 4MBRA 2IAAC 5ID1A 1FZKB 5FDWA 2EP6A 3RZCB 3BRZA 5ICYA 2XQYA 3RY4A 2H9GB 5FGCE 2F58H 2CBMA 1A7OH 4NOFA 5M95B 2PCPB 3JV5A 4NDMB 3ULUE 1XFPA 4JQIH 3RRQA 1IAIL 1RURH 5SV4A 4G43B 4ZTPH 4CU8A 2UVEA 4YSCA 4EO5A 1GOGA 4XHQA 2B59A 2PWDA 2WINA 3GRWL 3SODB 4JO3L 3QDMD 1WGVA 3LEVL 1VPOL 4QRSB 2CPUA 5DHDA 3GJEA 4FQEA 3IMRA 4LKXA 4BK5A 1RU9L 1J8SA 1FNGA 3K3QA 2AMUA 3N42F 1Z9SB 4QGYA 1V7NL 3CDGB 5C09A 4UV4L 3TJEL 1MCPL 4ABVA 1GMIA 3OM3B 3UO8B 1L9OA 1SVBA 3NIFE 5D1ZD 3S5LG 5F7EH 2CR0A 4AVIA 5C0ND 3DXAA 1ETB1 2APVA 3CXDL 4UMGA 5CBEB 1N0LA 3L6FA 5EBMA 1QMUA 4JHZA 4YIQB 1F6AA 2WZ6A 3GMRA 3GQFA 1UWFA 3E80A 3PUCA 4LLMB 3L4XA 2V2WB 3P11H 1VESA 2ZWKA 1HNFA 5E5RB 1S7VB 4HPOH 2A6DA 4JM2B 1OSYA 1D7CA 5HDQH 2CBPA 2R69H 2Y7MA 1T4WA 2E75C 3A67H 4G8FB 3TBBA 4PWIA 4C4BA 3IS1X 1FFNB 3RWHB 4XP6H 4HK0A 2P3YA 1BZ8A 4Y2LA 3T1FB 3MV8D 4K23H 1U36A 1OZTG 4TXVB 1R3HA 2GSGB 4Q6IC 4R7NA 1DBJL 3QJFA 2V9QA 4RAVA 3PS6A 4GIAA 2WLIA 3T9WA 4H44C 1OANA 5A6IA 3L3GB 5KN5B 2R1WB 4HJIA 2A6KB 1CWVA 1GGBH 1S2EA 5KN5A 2WUCH 4PJIA 5CGMA 1A7PH 3QJFB 4RAVB 1NZRA 4JHUA 4O2CA 2XE2A 4JQVC 1XCQB 1X9UA 1R3HB 4PVMA 3MRRB 1QO3A 3GZPA 3GUTB 3PGDA 3Q1SL 3TWCL 2BIPA 2G3MA 4IHOA 4XNBA 3RPKA 1EXGA 4P8QA 1S8DB 1PFCA 3R7QA 1EJOL 2EH7L 1S7VA 4JM2A 2BVYA 4GXVH 2SEBA 4YQXH 5IFJA 2EICA 2OXGB 1KUMA 2XACC 1BVZA 5KAQG 1F6AB 1CCZA 3DHPA 1MRCL 1E54A 2WLYA 5LWYL 4RLBA 2CO6A 3C60B 2WNGA 5L8KB 1PBYA 3MBEC 4LHJB 2MEJB 2ROXA 2YJQA 4BQCA 5DJ6A 4XN8A 2PCFA 4X0NA 5KG9B 1KBKA 3VX1A 1KT2B 2ZD0A 5MENE 3BMVA 3SDDC 3DECA 3EJQA 4KU1A 5D71L 3BH9A 3C09C 5SWSE 4X6FB 4ZFGH 1G7PB 4OLYH 4R4ND 3TF7C 3EFOA 2I7SA 2AJSL 5CMAB 2F74A 5FA4A 2P5EB 3D18A 3T4AC 2V5YA 3MLRL 4K3DL 5IM7A 4HUNB 2IV8A 3GIVA 2XZCL 5EU6A 1V54B 4KRPD 1FO0A 3AXLB 3CQFA 4UWQB 5IVXF 3NSDA 2HG5B 5D7LA 4KI5C 1GFMA 2XTQA 4O58L 4HA1A 4YDMA 1FSKC 2H9GA 2QSCH 2YMTA 3CN4A 3FN0L 4JFPA 4MLIA 4Q4EA 3ATAA 2E7CA 1SEBB 1FZKA 4U1KA 1U4FA 4M29A 5D1XD 5TFSL 1VACB 1QBMH 3QUXD 3I75B 2YD4A 1XZ0B 1NGXA 5E1HB 1A3QA 5D70L 2FJGB 1AXSA 2GJZB 1R24A 1GKOA 3POQA 5C0GA 4XVJL 1CL7H 5K1VA 1KG0A 3D52A 5EORH 4CU7A 1BG1A 2VDKH 4W4OA 1JD7A 3UO1L 3RVVD 4GRLB 2C34A 1E4WL 3GGWB 3QQ4A 4HZLB 4M1DL 4DKEH 3SDXF 3PP4H 5AD0B 1AD0B 2IDUA 2P5WE 4HBCL 4A2DA 3LNHA 1RUAH 1LNUA 4BFFA 4NQXA 2A9DA 3RY5A 1RJZB 5HVHB 4QMEA 5DYOA 3HS9A 4HHAA 2IH1B 3VXSB 2ZYIA 2H26B 1CF8H 1N6UA 4M48L 3GXTA 5GJSH 1NOAA 3VD5A 2O6CA 1KN4L 1X5MA 2NSQA 3U2IA 5BO1L 5BV7H 4U1GC 4I0PA 3K6NA 1DQVA 4P2CG 3SOBL 3PJSA 1RJLA 2Z35A 1N68A 1XIWB 4O00A 5C09D 2F5AH 2JKXA 4C4VA 3G6JB 4RRPG 3TZVD 3ERXA 1A6WH 2Q76B 2COVD 2MCG1 2XTJC 3GSNA 4ZDHA 4WFGD 1HTYA 5CEYA 2EDFA 1KYUA 3V4PH 5J11C 4AZ8B 4L5FE 2FHBA 1AKJD 3PGCB 4A39A 3PXLA 1WCBA 1L9TA 3MCKA 4ZW6A 4HDIA 4K71C 1E7UA 4MAYC 2XQBH 3GXDA 4OF8A 3WFBH 2PCYA 4K73A 3GD1C 4XO4A 2WZPA 3L45A 3B43A 3C5SA 3QZNA 4HYTB 1OV8A 1SPDA 3BIKA 5A7BA 3F05A 1MZYA 3PXHA 3GSXB 4FXKB 3Q9QA 3V0WH 2VLRA 3OR7B 4RFOH 5DFAA 2FO1A 2COQA 4Y9FA 5EU4A 1NGQL 4N0FB 4GINA 1DDHA 2BLFA 3MUGA 4U6VL 5C08E 5FFLA 2LV4A 2ZCLH 4H25A 1QSFE 3IDJB 3MCYA 4BIKA 4UZSA 5GGSA 3LS4L 3T0BA 3TYFB 5JDSB 4W81A 5ISZB 1A3ZA 2DQGH 1R5IB 1KGIA 1MDTA 2EUZA 1N18A 1HWHB 3LZQA 4O9HH 2ODHA 3UAJC 2ZX8A 1DSFL 3U9WA 5EEWA 3ARFD 1L0PA 4NRYA 5T1KB 1E27A 3KWVA 1TCRB 3ULUC 3ALXA 1GY1A 4K2UH 1JF1B 3INUL 4NO0B 2Y0LA 4GUQA 1LMIA 3HR5A 4G5ZH 2Y2TA 3P9LB 3VI4E 2OV0A 5DHVA 3TV3H 5MENA 1U91B 3QSKB 5IB2A 1ES0B 1RZ8B 3MNMA 2FTAA 4JY6A 2XN9B 1CO1A 3M45A 5CF3A 2A4ZA 1IFRA 4WV1A 5D1ZC 5IW1B 3UTPD 4OUUA 2VLJA 1JZIA 1QQDB 3AGWA 4PSRA 3WNMA 3E7JA 1X7TA 1M6OA 3UADA 2VZTA 2VZ1A 35C8L 5LQBL 3PV6B 1QTSA 3HEIB 3WS3A 5KVDH 3CUPA 3QNXA 4PWHA 4OGAC 2ZKXA 3JYCA 1I3UA 3O4OC 1QR1A 4HKZB 2FQFA 2DLIA 4PRPE 3TIDA 5BJTA 3O4LB 2J73A 2WYIA 1P7QA 3Q5YA 2VM3A 1PZDA 5F89A 2GCYA 3II2A 1FSKB 3S2AA 1XH3A 3E2HC 3ATFA 1W15A 4TTDD 5IROA 3BVNA 1I9JL 4UIKH 3NA9H 4NLAA 4KJWD 3S5YA 2WQXA 1PQZB 4HUUA 4XRCB 4PWEA 1K8IB 2H41A 4XPFL 4L4VD 5EOTB 4GAAA 3ABZA 4AVJA 2Y25A 3BLBA 4LIQE 2CE6A 4FQXD 4QYOB 2JK5A 1BZ9B 3MLYH 1RP8A 1SOXA 5IW6B 4XMXA 2IBGA 3EFDL 3MMEB 4CC1A 4GRLC 3QHTC 1YMHB 3SY9A 4ZTEA 1QW9A 2X4OB 1MIML 1SY6L 3MR9A 2X4TA 1N6VA 5K9JH 2F54D 1I9IL 2XV3A 3KPNA 1I7TA 3T4AA 3LMJH 5DVLA 3VD2A 1FGNH 4QOKD 1D5IH 3MX0A 3BD3A 3RBSA 3ECUA 4GO6B 3HTLX 3A4AA 3QUYD 3E9UA 5IW3A 4MZRA 1T04B 4GI6A 1WFIA 1UG9A 2O1AA 4FCAA 5JUEH 5JHLA 3IXTB 4JANA 3FFCE 1WFJA 1A6WL 4FYQA 3PGSA 4L2YA 1JPSL 5IG7A 1BM7A 4JM4L 4Y5YC 5JHLL 2GTQA 3Q8BA 4I0PD 2F8IA 2WMPA 4XNXH 4BELD 5GGUA 3FTZA 3GSUB 2VRQA 1C5CL 3ECBA 2JK5B 3KPRE 3AG3B 1T5WB 3B9KC 3ZOAA 2Z1KA 4PW9A 4KJWC 4OTXH 3ZUCA 5JYMA 1ZA3B 1WT5A 3APNA 4PGEB 2X3AA 2F7PA 3HMWH 2VR4A 5C2BL 1T7XA 1PQZA 1URIA 2OMBA 3DIVA 1T21B 4HUUB 4XRCA 1LO4H 1TTGA 5FYJH 1LDSA 1AC6A 3UPAA 1CXFA 4XOBA 1BBJB 1DQML 2W07A 4GQ9H 4Q0XH 3DDFA 3L13A 5GIRB 1HSAA 3MRQA 3VFGL 1FYTB 4JQVA 2PXYB 1YJDL 1P7QB 4P0DA 4XBEL 3WKPA 2WTRA 2IO5A 3B7SA 1T1ZB 3HOEA 2QT6A 1MIEL 3S3JA 4XC3L 1CICD 3X13A 4X9FA 2DI9A 2NDGA 4LSRL 4Q6IA 3RVWD 3DJZA 3VX0A 4OI9A 4PVNA 4U3HA 5CIPB 5L4FA 2Z93B 2OA9A 5E7FA 3LN5A 4H88H 3RWJB 1S5IL 4TQEH 1Y6KR 3OZKA 4MVBD 5IHWA 1N3NA 3L7EA 3MRHB 4CJ0A 3ULUH 2WLJA 1KXTA 1MW1A 3EO1B 1TPXB 1E4WH 3RGVB 1A6AB 3H8NA 3P73A 5BUGA 3QUZD 3STLA 2XN9A 1RULL 3O6FD 1N2RA 1DVSA 1YEFL 5IR1A 3ABGA 3KWXA 1YUHA 3QG7H 1WIOA 3WXVL 5MENB 3FQNB 1XGTB 5TH2A 3VCLA 3ULVF 5JIMA 1OW0C 4NENB 3EH2A 3HR5B 5T1KD 3ULUF 2YGVA 3VXRA 3ARWA 2CK2A 4HWZB 4OLZH 3KMDA 4PJ9B 3AS2A 1QAWA 1IIKA 5DHYB 2CIKA 4R9HA 4YE4L 5BRZE 5IQ7L 2B8OT 2J72A 3F00A 2NY4B 2XVGA 3EYVB 5LQBH 4UOW0 5FCSH 4RGNB 2E7BA 2GT9A 1T7ZA 2WXGA 3QDGE 2YSSA 2WBJA 5EZOH 3BSZH 3EOBA 4TVPE 4PJFE 1NSNL 1FIGH 3P77B 2LE9A 1IAOB 3US1A 1R3LA 4QF1A 2PPDA 1OOWA 3NRPA 4QYAA 1AJ7L 3U0WL 4I3SL 4N3UA 2A38A 4TVUA 1LEKB 1I4FB 1MFCH 5CLTA 5DCCA 4AQ8A 3MRJA 3NDYE 1PLGH 1VJSA 2FBRA 4OZIA 3GSQB 1UH4A 3WBDA 5GIRA 3I9IA 3GZQA 2B1AH 5ALCL 4F5CE 3AS3A 2CLRA 3PJLA 3A0OA 2YQBA 2VRKA 1CGXA 2G75A 5EG6C 3SYPA 3QJOA 3FFDB 1W72H 1MCIA 3KG5A 4EUPH 4PCTA 3EHBD 1U33A 5C0IB 3QUZC 4HXAL 3VB8A 3CMOH 3HI1B 5JPMA 1NTDA 3OSVA 4JREB 4HH8A 2XKSA 1F1GA 3DYMA 4LLYA 5HYJB 3FSAA 1KB9J 4NO5B 3BHBA 3QJUB 2AKRA 4JDZB 3W11C 3BUDA 3KGSA 5DEGA 4AQ1B 4TTDC 9PCYA 4XVJH 3GSWB 3MUJA 5I0YA 5HGHA 5FV1L 1RJYB 2UZIH 3ILPB 1HOCA 4LCWD 4OZFA 2AERT 1NMCC 5D7KD 3HPLA 3L9YA 3ZRFC 1Q0YL 3KWWA 3LRSA 1JZ6A 1Q9LB 2DTMH 5I71C 3RVXC 5FOBB 1IBDA 4WK2B 2HN7A 1SMAA 5DJYB 3CBKB 2EO1A 2IGTA 1MCDA 1PNDA 2RR3A 1IM9A 3DXAE 4GRLD 1JPFB 1N8ZA 5C0AE 5JQ6H 3PUUA 4YR6B 2FT8A 4AM0Q 5CN2A 5ICZA 3BSHA 3H7BA 2X89D 5LWYH 3APFA 4AMKH 2WGXA 2DL9A 3D69B 2GJZA 1G7MA 4FABH 3QE5A 5JW4M 1F4AA 1HXXA 4LSTL 2YN5A 3VXOA 3POCA 4E5XB 2BDNH 1WQVT 5GJTL 4U7SA 1J8KA 2JWYA 5I6PA 2V9UA 4O5LL 1UXSA 4DF9A 5B7MA 2K4WA 1RUML 5IESH 1X3DA 1G9EA 5LUMA 2XVKA 1R0AL 3OGOE 5ANMB 5ITBH 1MFMA 4GO8A 1N12A 4OLXH 4EKXA 3FT4A 5EU6B 1FVDA 1GFPA 1BBDH 1P7BA 5BJTB 4AY0A 1MRDL 2F74B 2YMXH 3O8XD 4KK8C 4ZOBA 1QHOA 4APQC 1INEL 3LKSB 5DC4B 1B0GA 4PJDA 4X7DC 3MTRA 3WS3B 4NPYB 2YUWA 4A1RA 3QEQB 4G8GE 5B3JE 4NPJA 1H19A 1LGVA 3GZOA 4YDIL 1YYCA 3A67L 4PWFA 3JTTB 2BOBB 4TPRH 4XP6L 5GZNC 1TTUA 3TBSB 4JY6B 3JWDL 1IJNA 3HR6A 3RNQB 5FEBA 4X7CC 5ERWB 3E8VA 4Z7WB 3T4YB 4KV5F 4UTAA 4E41A 1FZMA 2K7QA 2DJSA 5FLUA 4QCIA 2PLTA 3POUA 4H1LG 2NW3A 7FABL 2OMYB 3FT1A 1JF1A 4FZEH 4PJGB 5IQ7H 5GRUL 5B1CA 1CD1B 4NRYB 4WI4A 4LAQL 1GW0A 1JZDC 1PZCA 3FT3B 3PAUA 3UCQA 1JZ4A 5IHHA 1J1XH 1RI8A 5KBDA 4WGVB 2CKBL 2D03L 2H1LM 2PW1A 3B37A 4XO5A 2PO6B 4N8VG 4NQDB 3WDHA 5SWQB 3RNKA 3DSNA 3RX8A 4FLHA 4NN7B 1QPKA 2PWGA 4DQOH 1AD9B 3Q8CA 4ZUVA 1EERB 3HFML 1MJJA 4HKXA 3W0WD 4UTBH 3C5ZC 1PKQE 5I1CL 2EXWC 2XWDA 5E2TH 3SKOA 3MV8B 4WFHE 1QLEB 4MAZA 3UC0L 5IVOA 4GHBA 2E9IA 3PWUA 4ONGH 1BD2A 1F41A 1MHHB 1X5JA 3IPEA 4PR7A 4JM0A 1TQBC 4JFYA 4PJBF 4LOUC 5IYUA 4L0ZA 5B4MD 2Q8BL 2AGJH 4P2OD 2F5BL 3ZIMA 5DQDH 4LSRH 2NDFA 3G5XA 4QHKJ 3PWNB 4W4NA 4Y2DD 2WVPA 2HWZL 4YO0A 2WW8A 4OZHB 3HZVB 5DLLA 5IZ7A 3LQMA 5C1MB 1P9MC 4JPSA 4DAGH 4EN3C 1S5HB 1Z9SA 1HEJC 2JELL 1ZHYA 1ZOXA 3GHEL 3OC8A 4U1SA 5D7JC 1YYLH 4LKXB 4PB9L 2X70B 3G9AB 5LBSA 1RV6X 4OIBA 5I1EH 4UQAA 3ISYA 2W92A 1MQKH 3J2PA 3KHQA 4FQ2L 4AL8H 4B7IA 4NZRL 4GCQA 1G1YA 4XP4L 4PW4A 4JG9A 3LQAC 4JY4A 4AV5A 3K46A 3UYPA 4ZFQA 4CTDA 2HZHA 4UILL 2J2ZA 4PJ8D 4JFZL 1II4E 2HX8A 4F37F 3ESVF 3E2HB 4IK6A 1MAMH 1WBZA 4AYMC 1M42A 4A63A 1IKFH 1CXHA 3CK0H 2D7NA 4WCYL 3IFNL 4HFUH 3IRZA 4L8BA 2HT4D 1TITA 2EDRA 3ZXAC 2V37A 3SDAB 1TJIH 4KNTA 4L8BB 3MGOB 1LP9A 2O4VA 4AKMA 2ZAHA 2Y2YA 3GB7B 4U33A 4YN3A 5EIIB 2H6PB 4D9LH 1BYNA 4MJIB 2YPKA 2CMRL 4HPYH 5PCYA 2VW7A 5L7XH 1QFWL 4GW4B 4BCYA 1JXKA 2EUVA 3QI9B 1RHHA 3KDMB 3DVIA 3LQAH 4HT1L 4DN4L 2YD6A 1O5PA 3APMA 3MGTB 4GQ9L 5JDJA 3V79C 5T1DH 3ZHDA 4N9GA 4CW1A 4YBLC 1QRNA 4NAQA 5CJBA 3ZO9A 4PJCA 4XI5D 5C2UB 2VXSL 1T20B 4WW2C 4DGVH 2WQVA 1I9JH 3KBFA 5ESQB 2W94A 5HVHC 4KROB 1M05B 1L5GA 1JV2A 3FPYA 2H2SD 3P9WB 4OUOA 4K7PX 4PW3A 4RWYH 4XE0A 2CO4A 4ZS6D 4OU3A 3GBML 4GBXA 2GUOB 1WBYB 1KBGL 2DOCA 4I9XA 2NZ1A 4ZMAT 1XGPA 2AW2A 3HLAA 1Q90A 4N85A 2XXCB 4JDEB 2CCWA 1JZHA 1R4XA 1UCBL 3IBOA 3RURA 2ZCKH 1INDL 1GJWA 4ANVA 3GKWL 2BERA 1NLBL 4N2DA 5EEXA 3KBPA 5INDB 1HHIB 4LAQH 5LB1A 2K7PA 2DEYX 5T5NG 1N5YL 2JKLA 2ZNXA 4LDLB 4XPAL 3EKCA 3QUHA 3B9AA 1C12A 4PRBB 4LCUA 1NMAH 5IMKA 5HYSA 3EXLA 1OL0A 2XLLA 4N68A 5DGRA 3V0HA 3LK2B 1QSEA 1XEUA 3EJYD 3S98A 3MV8A 2JKTM 2IOOA 1DJHA 3BDYL 3D4ZA 4FQJH 3U30B 5HI4C 1LM8V 4U6TA 4TNWF 1XSJA 1IGCH 2MPVA 2ZUTA 4HKXB 3O9WB 4TQHA 1F42A 5IUCA 4DKEL 1VFMA 5D1QA 4PJXE 3RNKB 2FX7L 3HS0B 5J8OA 2WBXA 1N6QH 1OGAE 1UADC 3WXWL 3I02A 3LNFA 3P3RA 1BAGA 1EO7A 3RUGA 3H1ZA 3LK2A 5CJ8A 5L2KB 3T1FA 3CHXA 4IKJA 5I1KH 4IRZH 1FFNA 2R4LA 4G8FA 4F33B 3BVVA 5EZJA 4UCFA 3QUMH 5CLWA 1NKRA 2A9ML 2WY3B 4PGDB 3RX9A 2FSEB 2EVIA 1U9KA 2Y1ZA 5FGCB 5B7FA 4RQQB 4JFHD 1FRGL 4PY8I 2XN0A 2ZAIA 5LNGA 3H3KA 1CE6B 1EEYA 4AKQA 3D5OF 1BX2A 4XVSL 5JHDD 3GEWB 4NEHB 1PSKH 1Q0XH 5KWYC 5L8LB 2HFGL 1E28A 3NAAH 4A2LA 1GFQA 1HL9A 4UQCA 2GE4A 4PAZA 1C7TA 1OLLA 3CX2A 2HKHL 4HJ0C 4KO9A 5B1BB 1L5GB 5B66O 3ZU8A 3SDCA 4QI3A 3WJLA 3EJYC 3WN6A 4FMSA 4IBYA 3RDJA 3BZEA 3AGVA 3Q9PA 3QJXA 15C8L 1EMTL 3DUUA 4TVPD 2O61A 2DTML 2KL6A 4O58H 1BF8A 4Z3TA 3I9GL 4PRNB 3QQ9D 3MGTA 3AA1A 1NFAA 3TWYA 3UBXG 5C3LD 5HXMA 2YEZA 4XWOC 2HG0A 4HU8A 1YAIA 2E5EA 4HAFA 2P5WA 3QARA 4KJQD 4I1NB 2EDEA 5MEOB 1ZIBA 2FNWA 4XHJC 2ZUQB 4IU2B 1AQMA 1Q9WB 2BXYA 2HFTA 3A4DA 1A8ZA 1DQDH 5E08H 3IDNA 4I0CC 3QZWA 1KTDB 4LP4A 4F8NA 3CLEL 2G3XA 4TM9A 5EF3A 1L3NA 3UTTD 3GSOB 4PHXA 1LJMA 4I9WD 2BOCB 3LKOB 1GKEA 3KPPB 4IKIA 5H35B 4YBLB 4OQTH 3VFVB 4I18B 1Q1JH 1YPZE 2AJXL 4DGVL 5IBUB 3RPIB 1U3NA 2DMCA 2QVKA 3SE3A 1CDIA 1WGOA 1JGVL 3BEVB 1A4BA 1HI6B 2NY0B 1PVHA 4ZMWA 3LRSB 3NOIA 5EU6D 1NFDB 2JKRM 4KHXL 4WWPA 1JERA 2X70A 3A5VA 4OZGE 2OP4L 2FGWL 4IGBA 4KJYB 4TLTA 5E5LA 1Q9GA 3I6GB 4YHKL 2LFEA 2WLZA 3GT6A 3MROB 1UWYA 1HESA 4AJ0A 5E79O 2ZCKL 2QELA 4BUQA 3OZ9L 1U95B 2AV1B 3GMMB 3UPRB 2ZF8A 1LD9B 2AJYH 4IBVA 3CSTA 3O11A 4N90E 2AEIT 1ED3B 3GHBL 5FK9A 5JPMB 3TU6A 2NXYD 5FO9B 4K07A 4ZOEA 5FFOA 2QLVB 3HC0B 3QVAA 4IBZA 3QH3B 3MLRH 2ITFA 4DPCX 3SB3A 4MKMA 4J3OG 2Q9OA 1TZGL 2EIMB 3L2LA 3D0AA 1U8QB 2P26A 4L1SA 4YHLL 1KCBA 3WCYA 5EN2A 1MHHA 2FJUB 4O2EA 1H8NA 2ADGB 3QORA 5GRUH 1OAUL 3GIZL 3BWAB 1U3HB 2V2XA 3OMAB 4G8IA 5CEXA 5GS0H 1EVUA 5FHAH 5E70A 3T3MB 4YNYB 2B39A 1CD0A 4WFEE 1MAKA 1RUKH 2BSSB 4X5XB 4NZDA 3EF4A 1T1LA 4GRWE 4FFZH 4PJXB 4H8UA 1JDCA 3DRQB 4LCWB 1ZHTA 2WXPA 2Z7ZA 1C8PA 5KSAD 3EOBB 1KYFA 3VGAB 5B3SB 1ZT4A 2Y7QB 1L9NA 1MCCA 4LSQL 1D5IL 4NQDA 5E2JA 2DMHA 4ES9A 1BSIA 3EDEA 5JIPA 4QHUB 2A74B 2XZZA 3I3DA 3M6DA 5A2LH 4DGYL 2QQNL 5DUJA 3WFDH 1VRSA 3SCMB 3PHQA 4PV9B 5C0CA 2NW3B 1G6RA 1X44A 1FZMB 4P9MH 2O72A 2F1TA 5ALBH 3VG9C 4OLXL 1SFDA 3FOLA 4LEXL 5JHMA 4L18A 5GZNA 1C5CH 1QLRB 3RNQA 3GMPA 4RZKA 2UY6A 1ZPLA 5BV7L 1W0YT 1CLVA 1L6PA 1RUQL 4OTXL 4NQEB 1WSST 3JTTA 1G7LB 3O2DA 1FVCB 3HMWL 3CVHB 3L7EB 3MRHA 2JSFA 4IMKC 4WUKL 5I1IH 3QDJE 1HHKA 4PLKC 3JUYA 2VDMH 1F6FB 3KBEA 1QJ9A 3ZL1A 2D0HA 5F0PB 5IP4A 4MSWA 4O4YL 3ZGIA 1RHFA 2ZPKL 1BGXH 5KYXA 2EJ1A 3DURB 5DZPA 3T0SA 3JZYA 1C7SA 4P48A 3WEOA 2CBQA 3WKQA 2WTOA 3G6DL 2VDNH 3DRTA 4BHUA 2DICA 4IM8A 2Q86A 3LKNA 1MI5D 3H54A 1PZSA 3WOVA 3KGRA 4FXTA 4JPIB 4BKTC 1YPZB 5DUBB 2XA8H 3U2SA 5CJQL 2ICCA 4YXHL 3PU7A 1B6DA 1JRHI 3EYQD 2N1KA 2EYTB 4WFED 5DYFA 3O6FB 1URZA 3QUXA 4HHGA 4WGWB 3QUZB 1N9PA 3CSYA 3DWTA 4Y19A 4A67A 3RGVD 2DMBA 5KS9A 1KJ3H 3IDUA 1NCDH 5F9WB 3KLAA 3HOLA 3BWZA 1MDAA 3B9KD 4AYSA 1OEZW 4GUPA 3TH2T 1RUPL 2AI0L 3VJ6A 1KGWA 1G4MA 1DSFH 2BP8A 4LGPB 3SZKC 3QPQC 5CGBA 1NCUA 3M1OA 3VI3A 1JPFA 2O4EA 3PPEA 5I1CH 1DVFC 1DE4B 4AUUA 5ESVB 3UJTH 4EUPA 2AJUL 2Q7AA 4IU3B 5T33H 1NANI 5DO2D 4APQD 1YHPA 4NQUA 4OIFA 3CC5A 5DT1L 4TVPL 3ARRA 1FQ9C 2PXYD 3BXNA 4N0UE 4DGWC 3FYXA 4PGBB 3P3UA 5I8CA 1R46A 5E1IA 2QQLH 4F2MA 5D5MB 3L4YA 2WXQA 2HVJA 1EGJL 3U79A 3SEPA 5JPNC 1MFCL 4AQ1A 2DQDL 4OV6F 1MCHA 4GMTL 1E3FA 4M7ZB 5H2FO 5L8JB 5EU6E 3NZUA 2IPUG 3M17A 5EC1B 1TZAA 1G9NC 5CNHA 3WLBA 2R56H 2R2BB 4ODVL 2R4OA 5D2LF 4N0CC 2DKSA 3FU7B 1Z9MA 4W9IC 4BE6A 4JRWA 2VMDA 2W81C 3JXAA 4OD1L 1U3HC 3QIUC 3RWEB 1KGXA 2GTWB 4AQ8C 5I0XA 1YO4A 4OGZA 5AVYB 4FFZL 2E8YA 2OL3A 2WVUA 1JGUH 1KBBA 1NOLA 2F18A 5FO7B 3RA7L 5DUPL 2E4TA