2W81C

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 242
sequence length 242
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2w81C02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w81C01
5EE2A 4O3WA 4U9CA 3KVDD 4O3YA 4QQ1A 4O4XA 4O49A 3VE2A 2W81C 2YPVA 3PQUA 3HOLA 5T5FA 2LFUA 3PQSA 4AYDC 1YS5A 2Y7SA 4AYEC 4Z3TA 4AYMC 3VE1A 4AYNA 4O3XB 4O4UA 3V8UA 3HOEA 2W80C 4AYID 4O3ZA 2KDYA 2KC0A 3UAQA
chains in the Genus database with same CATH superfamily
1EJ6A 2XA8L 5GRWA 3T6ZA 1EEYA 1XIWC 2CHWA 4NZUH 4Z7WF 4K8RH 3C9NA 4LLMA 1SVBA 2Z8SA 1F2XK 1VEOA 2YWZA 4U1LA 3SQOL 2JKXA 4KNTA 2HJLB 2E74C 1JFHA 4G42A 4I0PD 1PEWA 4QDGA 4UIMA 5C0RL 5LWYH 4NP4H 4HF5L 4OCRH 2EO9A 2YD9A 4U6YA 3WFHB 3IGLA 1XFPA 2IBZX 2OMXB 4LRNH 5IT2L 2JCCE 1X5JA 2X41A 2V37A 3OVUB 3T3PF 4IIQC 4XC1H 3IMVA 3LK2A 2C3XA 4WHCA 5KVMC 2CUIA 1CICB 3GMOB 4JHZA 1U3ZA 4Z7IA 1EUUA 5IMMB 2IQAA 4KKCD 4Y2OB 1NOLA 5K1NA 5JHDD 4DGYL 5E5RB 3X1EA 1VAHA 1P7QD 2ZP8A 2TRYA 4UF7C 2YQ3A 2C1OB 2M26A 4LSPH 2VNCA 4F57H 1TTRA 2X1OA 3VTMA 4N2LA 4EUPB 2V7HA 1ZLUH 5DYOB 1R5VA 4PBVC 4Y19D 1PG7X 4N0YL 1K85A 4UNIA 3APDA 2B1AH 2F1TA 3QQ9C 3GHEL 3MI6A 2CK2A 1H8NA 3FPXA 4WFFD 4NQDD 4F7EB 1VGKA 1F8TH 4NRZA 3UAJC 4HJGA 2L3BA 2WP3O 2ITEA 4IIZA 1CR9H 3F04A 3O2DH 3QYNA 5K69A 1TCMA 4MXWL 1FORH 1MNUH 5CUSH 1CUOA 3JVFC 4G11A 2CM6A 3VU1A 4PGBB 3ZSTA 3KYOB 4NXKA 3VFRB 4NIKB 1NLBL 4QRPE 3Q2WA 1XMWA 1ZANH 3A6BL 3QIUB 1JBJA 2QKIB 3GNML 5HVGB 4FNLL 2WUCH 2ERJC 1KB3A 3LPWA 3PABA 2DQHL 1F3DJ 3HZYB 2O5YL 5SWZE 1ORSB 5C08A 1PZSA 4DKDC 4E41B 4U6XB 5CN2A 1W0WA 4LOUD 1RIUL 2IF7A 4PGDB 1TZHA 2CIIA 4AUJA 1BVLA 3DUUB 3V2AR 3V5KB 4Z3GA 1JUFA 1QASA 4XMUA 4J3WA 2FEEL 2HLFC 4MS8C 1N26A 5IYUA 2JWYA 3WDJA 5CKAA 2R7EB 4JJHA 4TXVB 2XJKA 4ONGL 5CSZA 4GOSA 5KUKA 2O93L 1J1OH 1QRNE 4NQCD 3ZKMC 5I8OL 2VIRB 3QDAA 1D9KA 2WXRA 3ZY7A 4V1DB 2F7RA 5KSVB 1RUAH 3D50A 1A6VH 1JPGA 1ETJA 3VI4A 2F8VA 4A7SA 4CKVX 1DVXA 1KYDA 5C09D 4FG0A 5AKTA 3U4EB 1TQBC 4WI7A 2GE4A 1F1AA 3RVTD 4ZUVA 4J28A 2UYLB 3B9EA 4JJOA 4OGYL 4C83B 4HZLA 3WY3A 3UJIH 2H9GA 2MPAL 4G6MH 4L1HA 4XMTA 3GMRA 5I18H 4WEEA 4ZO7A 4K5MA 1CGVA 3SBRA 4L1TA 4N8VA 4GW4A 2DTML 3G08A 5DJ2B 2J1ZA 4GBXA 1L9OA 2WQRA 4BUHA 4KTDL 1YEIL 2VDOB 3WFDL 3GSWB 2G5RA 4XC3L 1ZJBA 3FCTB 3HHSA 3D69B 4JO4H 4TLSA 5LCVA 2O6DA 5ENWA 4LBAA 4CMHB 5I66A 1PLGH 4WKXA 4POYA 2YRPA 4F24A 5DEZA 3U79A 2XY2A 2AMGA 5DJAB 1CZ8H 1N6VA 3T0VA 1T04A 1IGFH 2Z7WA 1KTDB 1P4LB 1MJUH 4P2RE 3P02A 2OSLA 2V7NA 3BIKA 1D5XA 3HE7D 2ED7A 1Q9OA 4FLRA 4A7TA 4L8SC 1CLOL 3DYOA 4KKQA 2XWTB 2PRNA 1FO0H 3P77A 1U8OB 4QXWA 3NZ8B 4ZMPA 5DQJB 4PGEA 2Y5QA 4LQFH 3AU1A 3C6EA 2ILLA 3E6FB 4X6DF 3MRCA 4CL7A 2UXFA 1T1XA 1VZIA 3ARFA 4HOMA 3KLHC 2PO6C 4A2HA 2Z31C 2H26A 3DUHA 3LAFA 4HHWA 3FSAA 3CDYA 1F97A 5B3NA 3PDOB 5IV2B 5DJXB 2XWXA 4HS6A 4EE2A 1FZJA 1DJHA 2NY4C 3ZE1B 3UYPB 4XAWH 3C5SB 2UZYB 5E2TL 5JNYB 2COQA 1DEEB 4X7FC 4U3SB 2IWGA 3QJHA 4XBGB 1YZZA 5C0DA 1Z9OA 4O4XA 1GGUA 5HYQA 1F4YH 2FO4A 4ZS6D 5GGQH 4H0HB 1E5ZA 3ZL1A 3X11A 5MEOA 4FNPA 3KPSD 1NC4B 2WQXA 2ZYRA 4HUKB 1BYNA 2WTPA 4CADB 2ZCLH 3JV4A 3RWIA 2GCYB 3APNA 1RAMA 1FLRH 4EIBA 4EAEA 2IXQB 5FYLD 4HZ1A 4YSRA 1MFAH 5HVHC 4HJJH 3QGVA 4ADGA 3MKKA 3GLEA 3QUXB 3IWUA 4G1EA 5F70A 3MBXL 3T0EA 2ZOWA 2QQKH 3RILA 1H8LA 3J07A 1AO7E 2CLRA 3H56A 1CL7H 4LVEA 4QY8B 1FYTE 3MLUL 4CNIA 2UUDK 4ZS7H 3QI9C 4Y16D 1A0QL 5F9JB 1TZIA 1U4FA 5H37G 5BJTA 1D5MB 1B9ZA 2IDQA 2JB5H 3JWNG 1PVHA 5DK0A 1F00I 4EUPG 4YK4C 1MLBB 1TG8A 4FFVD 5DT1L 2VN3A 4L4TA 4KKAD 4M62L 4RIRB 5ICZB 2C26A 3TBYA 4E9RA 4A67A 5EE2A 4NUGL 4UM8A 1H6FA 1U3HA 3FU8A 1E42A 4MDJB 2VERA 1CLYH 5EG6C 1DJSA 2DWTA 2YPLA 3QEQB 3D09A 1J88A 4NZDA 3ZVVA 2IAMC 5ADPH 2GW5A 3T8XA 4RWHA 5K59E 1UT2A 3V0GA 2BP0B 2PCFA 1LP9B 3WFBH 2QQNH 4XXDA 4OAWA 1TOXA 1NTDA 2YS4A 4I8DA 3UTSA 1HU8A 1GS7A 1U8KA 2Y1AA 2P1YA 1U41A 4UV7L 2CKBH 4B9JA 3KLKA 1SN2A 3EG9A 3PHAA 5T1KA 3P4NB 3GMPA 4PGJA 2WLZA 1FVEA 2D7TL 2R27A 1M42A 4KUZL 4MJ6A 4PEEA 1HWHB 2CSPA 4L9LC 4QCIB 5IMOB 2CKBA 3D0LB 4JZJC 3U7YH 1VIWA 3VFSA 3QHFH 1XZ0A 5ERWB 4M43H 4K94C 3W1ZA 2E5EA 4KRMB 5C0GA 3UBXB 1KJ3H 1ES0A 1X5GA 2W0LA 3CDGA 4KTEH 3OPUA 4PSPA 4RISH 4NNXB 3ULVF 2OCJA 4HIPA 2ICWA 5JIKA 1ECYA 1TJHL 2VDMH 4Q58C 1QLEH 2IPUG 3BMWA 1IBGL 2H6PA 4X6DA 3M1BB 2F5BH 3KWXA 4TQIA 2E8YA 4FLSA 4D9RE 4PBWD 2Q2LA 3H7BA 4MX7B 3VMOA 2BVYA 1ZEAL 1T21B 3IM1A 4DETA 5AAMA 3N5AA 2X40A 4KITB 4B9KC 2Z34A 4DQOH 3MLTB 4G3YH 3IPFA 1JGEB 3DSNA 5I16B 3WUWA 4FQHA 4UT9L 1FSKB 3VGAC 1Q9WA 3FOMA 3RAJL 5JDPA 1G6VK 4XX1E 2IALA 1JTPA 5IM7A 4W1TA 5BO1H 2OTWA 3TYGL 4PJ5E 3LB6D 3FO0H 1QKZL 4R97C 3CGTA 5E4IA 1YPZF 5D1XB 5E9NA 1BM7A 4HHAA 5DZVA 5EOCJ 2PWGA 3Q8FA 1HH9A 2XXMB 2M83A 4B3VA 3QUYA 3T24A 1KACB 4WI4A 5SV4A 1AGEB 2OYPA 4CUCA 4GG6B 2HVKA 3DVFA 1MFNA 5AL8A 4KKBC 3FQRB 3MGAA 1MCBA 2PPFA 1OE3A 4IGBD 5HJ3B 1JN6A 5GV0A 1CFNB 2BPBA 5FDYA 2BK8A 3K7UA 4ADJA 4IJ3B 1WBZA 4XOAA 4MJ5B 4PJXF 5BMFL 5C70A 3NYKA 1QFUL 4JR9H 2WLLA 3KR3L 4DW2L 5C0CD 1S46A 4JBSA 3B9KB 5JOPE 3HS8A 1G1KA 3QWOA 4LVHC 5I8KH 3MVSA 1XTMA 2AK1L 1HOCB 5FHAH 1TZGL 3TURA 3C60D 1AHWB 5DJYB 1T22B 3JVGC 3MKGA 4O2FA 4NN7C 5HGGS 3CIQA 3AXHA 1E6OH 3LZFL 5AOIA 5HHXL 4PP1C 3WNNA 4GCQA 2IADA 1ZK5A 5C6WH 2ICWJ 2Z6FA 1I8IB 4EI0A 3N0PB 5H2BB 5F1KC 2RGSA 1BREA 2V8MA 5IW1A 3VXUA 4W4OA 3HAEB 5JPNC 2P49B 5HYSA 5MEQB 4E5XA 3P9MA 4PV9A 5IGXL 2DEWX 7CGTA 4P3WA 3GSVA 4K5LA 3KLSA 4NKDB 4F80A 4AJWA 2K6WA 3Q05A 5AWNL 3BSGA 3TBTA 5KSAC 4BHUA 5HDOA 3H85A 4XMXA 1MWAA 3VSTA 3R1GH 3FU9A 3K0YA 1UWYA 4YX2H 2WWKT 5CCKL 3I9GL 5FUOH 4DZ8A 1HK6A 4UB6O 3SD5A 4RQQA 5BCAA 1J48A 3REWB 1YC7A 1P1ZB 2CJUH 1RP8A 3EO1B 1UJ3C 1MZYA 1F86A 5M95B 1HNGA 4FNUA 1MCNA 5FAAA 1U30A 3FZUC 4U1NA 4ZMYA 5F7DA 4Q52A 2IOMA 2L7EA 5TFSL 4TMPA 5AZ2L 2O26U 4JY5L 4S2SA 4P59L 2AMUA 3WL9B 3KH3A 5GXBB 3U6RB 1QHOA 5F96L 1MPAL 1LO3L 4HEPG 5HYJA 1KGJA 3K46A 4HSCX 3VWKD 2BNRA 4UZSA 3KWWB 2XRAH 1MCWW 1KYFA 2Y7QA 4UT7H 1K6QH 2P5EE 5FECB 2D0HA 2X4TB 1JF5A 5HHPB 3K5RA 3QQ9D 3VDBA 1T16A 2UXTA 3ECQA 3L17A 3K8MA 5DQDL 4QEGA 4ERSH 3P4MB 3U2IA 3E3QC 3PPEA 3PGCA 2Q2EB 4UOW1 4B7IA 3F6LA 4X7SL 4H26B 3RDTC 1BQKA 4AE0A 4B9ZA 5L0QC 2HKFL 5GZNA 5D2LF 3RFZC 1L9QA 1RIHH 2Y07L 3IJHA 3M86A 2XN9D 2WNXA 1FAIH 1G6RL 2X4UA 4JRFA 4PJHB 4IBQA 1L0QA 2NMSA 4LCCC 5EOQL 3AB0C 3RNQA 5E1HB 2CPCA 1XSIA 3VAEA 1R3IL 3EHBB 4NXSA 1MRFH 1O9ZA 1T3FB 1KYAA 4NJ9L 1UENA 1E65A 2CO6B 4OLUL 4LCWD 1DVQA 3DX6B 4HC1H 5D9SB 1WHPA 3RPIA 3V4LA 5D7SH 3RIFK 4I9XA 1MM4A 4M02A 4W9GC 2EXWD 4ZODA 2E76C 2M1KA 3BKML 4HC1A 4DPAX 5DMJB 1MG3C 1NBYB 2J5LB 3UBXG 2QR0A 1MCSA 3OMAB 4NRXB 2VLJA 5IIEB 3FQNB 3N04A 1P1VA 1DQJA 4KY1H 4PJXA 3SPCA 3MUUA 3GXDA 1KT2B 3AAZA 3ZR5A 2ZOLB 3BXNB 5J1TC 1QPPA 2Z7UA 1A7RL 4Q8BA 1JGDB 2FX7L 2B8OT 2CDEA 5FO9A 3S48A 4XPAL 1AXSB 2W9EL 1A47A 3TN0B 3VXTB 1WAAE 1B0WA 2VQTA 3QUZD 4F8NA 4A68A 3PJNA 3QXAB 1HHHA 2WJRA 2QEJA 2ZKYA 4OLZL 1FFQA 2XWZA 5AFUK 3LS5L 4O51A 4PU2A 3U0TA 4X7EC 5CO1A 3ARDB 4FQ2L 1FV1B 5DUBB 1JHLL 5IOKA 3KPRB 1YN6B 4ZTPH 4D65A 3FU5A 5CJXA 1OAJA 1XB8A 1AXIB 2NY3C 2PR4H 2OL3A 2R69H 4D9LH 1BCIA 4GKZB 3HNSL 3ZE2F 4RMQA 5AD0B 3B34A 1WIPA 4PR5A 1BZQK 4G80A 3I3BA 5DD1H 1QOKA 5F93C 4JVPA 2P8LA 3F7KA 5EF1A 3MCKB 2R69A 2MOVA 3E8UL 3W56A 2XIIA 2LAAA 3DX7B 3WO3B 1WWCA 2EABA 2HFFB 4Z95L 3ZL4L 3C9NB 5T1LA 3EJCA 3HA0A 1QSZA 3S5ZA 1RHHA 1A8ZA 4U1LB 5E4EB 1V27A 4J27A 2Y2WA 4Z5RA 4YOKA 1HN1A 2DLGA 3S35H 1ZV5A 3ARBD 2V5SA 3EZJB 5KVGL 1ZTXH 3Q06A 1MHPL 1CYGA 1DBJL 2ARJQ 2KQNA 4FS0A 4PI0A 1F1DA 3ZHDA 3IJ7A 2ENYA 1OPFA 2PYFB 3LKPB 3LSOA 4Y2DD 4CGTA 2ODIA 4CU8A 1PQZA 2A4CA 3SDDD 4F7MB 1LO2L 3LH8A 2QSQA 2MKWA 3F3HA 4H20L 5E79O 2OX5B 2YUZA 5HTSA 1FL6A 2J8HA 2IQAB 2C9VA 2V17L 2XX0A 2ZXDA 4Q9QH 1HCVA 1EGJH 2E7HA 4ODWB 3A0BO 4ZTOH 3L4YA 2E46A 2EDRA 3SDAA 3HAEG 5G39A 5FO2A 1SXCA 2DQEL 3J7HA 4JG1H 4M4RB 4Z7QE 1MCRA 1DN0A 1MDAA 1R5VB 2BFGA 2H3XC 2AANA 1EGJA 2YD5A 1UACL 3BPNC 4FQCL 3QWNA 4NUQA 4PJFE 5F7FA 5IEKB 2FUQA 3X14B 2O6PA 4N8CL 1E4KC 1HXUA 3R18A 3GFUA 1KXTA 1O75A 1P5VA 5D2LA 5DO8A 3VD9A 1PG7L 3BSZL 4K3GA 2EDTA 1HXMA 3SCMA 1VGKB 4OZGE 5AVUB 1PFOA 5CMAA 4UOW0 5T3ZH 2GUYA 5D6CA 1T66C 1KXVA 2NXZD 3FO2B 4Q4EA 1G9NC 1IUZA 3FUJA 1CE1L 1LLAA 5CZVH 2YD2A 3JWOC 3V0VA 5C86A 2CDFA 5HGAB 3DIVA 4AIXA 4JFVA 3MX0A 3WS6C 3DRQA 1SXNA 2NY2B 3RWEB 1SLXA 1A7BA 5INDA 3OKEA 2WINA 2BNQA 2AI0L 4ZOBA 2VKXA 3CPLA 3MNWA 3KYMA 3VWJC 1A21A 3VI3E 8CGTA 4B60A 2JCCF 4GAAA 1D5RA 4OB5L 3SYAA 4JHAL 5EIIA 32C2A 4HV8B 3VXRE 3SZDA 3K71A 4MNGE 4UB0L 4BV1A 1BVLB 1G7HB 3DVIA 1A9EA 3ETBJ 1GZHC 3TA3A 1JUFB 1OW0A 2FJGA 3D85A 3JUZA 2WAQA 2X0VA 1RPKA 1E4HA 1KIPB 3SDCD 3HPLA 3D87B 5D7LB 5I6PA 3DIFA 1MXGA 2BCKA 5IW6A 2I9TB 3MFFA 3WN5C 1AH1A 7FABH 1QATA 4OLXH 1NUGA 5IUCA 1FIEA 3CFDB 3O6LL 1FLTX 4XT1C 4AENB 4NO3B 1I9IH 5LHDA 1I8AA 1KJVB 3NH7L 1Z1WA 2IWFA 3V8OA 2EIKB 4TPRH 4P3CL 1JNHA 1QUPA 2K0RA 5GS0C 4C56E 1YEHL 2DYSB 4DTGH 3SOTA 4QO1B 3ULSA 2APFA 1G9HA 4R3SB 2OSXA 1ADWA 4FLQA 4JFDA 1BZDA 4JGNA 1VB9A 4HZLB 5B38A 3WNKA 3DMMC 4UI2A 1MIEH 1PJWA 1EHXA 1IARB 2ICWI 2X6AA 2WBWB 1JNJA 3HFFA 2ITDA 4R7XA 4HPOH 5G4OA 4N8VB 2IO5A 1IFGA 2XWDA 2RFXB 4Z7WB 4GBXB 3MGOB 3DYPA 4GLRH 4AQAA 5K9KA 4DNLA 3I9PA 1HILB 4UTBH 4N2EA 3WLBA 4LCYB 1PYWA 4KKRA 2CIKA 2VLKE 2XPZA 1G4MA 2BXYA 5CBAA 5KYWB 4M5ZL 4CTDA 1OSEA 1T04B 2QMKA 1BFOB 4YDJA 1NLDL 3T3PB 2P44B 2ZNXA 3LIUA 1A7NH 3BIKB 5TGBB 3IKKA 1L6PA 4ELME 1EH9A 3FT1A 1GC1C 4XO8A 4IRJC 4AT6A 3BAEL 4QXTA 2B3IA 3C5ZB 3WKPA 5ESQB 3PNWA 1J8RA 4GMSL 1G4RA 4E9SA 1YECL 1QACA 3NGBC 2CO4A 1THQA 1NH6A 5LBSA 2L7QA 3MRCB 1T1XB 4WTZG 1OP3H 1Z5HA 2I07B 2J4WL 3B6SB 2AJVH 3EFFB 2H6OA 4RMRA 3ARYA 2H26B 4KROC 1U2HA 2GFBA 4WUUB 4A6YH 1KLFA 4AK2A 4L8CA 4KUCF 1FNLA 2Q5BA 4HS6B 1NCDL 3C2AL 1FG9C 5IB4B 2N59A 4ZNEE 5AVRB 1XV8A 4FG6C 5B1CA 1Q94A 4RGMC 4TM9A 4P07A 2ADJA 3INUH 1A22B 1NBCA 2J5WA 2WZ6A 3KS0H 4FFWC 3MV11 4NGHH 2NY0D 3QJHB 3MBWB 5C0DB 4KKBD 4N75A 3DK2A 3JXAA 1N5YH 3LZPA 3FHQA 3US9A 1BLNA 2X4PA 3ZDYE 2R8SL 3X11B 5MEOB 2N2LA 1WDAA 4I18C 2A6DB 1DBAH 2CZNA 1P9MC 4JEGB 5L2KB 5KOMC 3HN5A 3HG1B 1EZVY 3JV4B 1H3GA 4LSVH 5DZOA 3RWIB 3VGEA 2ESVD 4G8IB 2ZUXA 1XIWB 2EUVA 1B3IA 1U93B 5GGVH 3RKPA 2ED9A 2DJSA 3SJVB 1UEYA 4WHTA 1AKJA 5A7EA 1DSFL 2A6JA 1PFCA 3T0EB 4YNYA 2B0SL 1RULH 1UH3A 2CLRB 2EH8H 4WZ9A 1CU4L 2ZUYA 4Q9RH 5D1QE 3OR7A 1CLZH 2BVQB 4MA1C 4BHUI 4NT6A 5CLWA 2PETA 3GZOA 2ZCZA 5LG6A 1NCWH 3D1MC 4IIQB 3VSVA 5CN3A 2YSSA 4O02H 5BJTB 4JZOA 4CSSA 5JHLA 2FO1A 2NTFA 1XF5A 4OZFH 5DUPL 3TH3T 5DK0B 4AUUA 4FI7A 1JTOA 3MHZA 4Y2NA 3BKYH 5IB2B 1FPTH 5ETUA 1UXSB 5F1NB 5MEND 4O02A 4BFFA 4IEFA 3QG7L 1YG9A 5IUSA 1CDBA 4L4TB 1E7UA 4ZMLA 5IBLD 1OSPH 1CG9B 5GTHO 2XFXA 5PCYA 3NCJH 1A7OH 4XCNA 2Y9RT 4PVNA 5E00A 5FYLL 4MYWB 4UM8B 1U3HB 3WFZA 2DQUH 1GMEA 3KW7A 2NY1D 1DVSA 1RZKL 4M00A 4YLBA 5INCA 1ZLWK 3AS2A 4OF0A 4QJ4B 1SHXA 3EGSB 4TOYH 1B4TA 3T8XB 5JR1L 1DVTA 5CIPB 5DEFB 5ANME 3A21A 3TOPA 4Y0GA 5J9PB 1BOYA 1TT6A 3EGDA 3BH8A 3S7GA 2J56A 3DX2A 1A1OA 4PH8A 4H8WH 4OAWB 3CVDA 5JDJA 4G5AA 1CPUA 2L4OA 4ZTEA 1I3GL 5FEBA 4MA7H 1WFIA 1CGWA 3KXFD 3G6JE 3SIKA 1E50A 2ERVA 4MHHI 4AL8C 4N3TA 3RWHA 4DT2A 4PLNC 1UQSA 1OARL 5T1KB 2ITCA 4YDVA 2XU9A 1K5WA 5I0WA 3MBEC 3IDUA 3REVA 1KGCD 4QOKB 1MI5D 3VFSB 4QRPA 1U8HA 4R5XA 1XZ0B 2YD1A 4F8TA 2LGNA 4F9PA 3BP6A 2AQ1A 2RCSL 5SWZA 2LTQC 1XGPA 5MP6L 5IQ9A 1IE5A 3DX1A 1HFUA 2PP7A 4MB5A 4HKXB 2WSPA 1MHHB 1MCPH 4UM9B 2VXQL 3OJVC 2F18A 1P7BA 1U9KA 2ERJB 3K80A 5GS1C 1OAQH 4XP4H 2AEOA 1ZAGA 1I9EA 2H6PB 3RDTD 4U6HB 4X6DB 2ADFH 3TT3H 1QRNA 5EPMA 1FIGL 2XKNB 5DEGA 5IK3A 1ZJAA 1DVFC 3MV9A 4Y9EA 4BUQA 3MLZH 1UZGA 4YXLL 4UQIM 5E95B 1NMCB 4XP9L 3U9PL 4CDHA 3DSNB 3QDGD 3D48R 3U46A 5D55A 5HDQL 2HZHA 2Y23A 4UWQB 3D39E 3DV4A 4UB8O 2DD8L 4UOQA 4N8VG 1G9MH 1HHJA 2DTSA 1TETH 2IALB 5IM7B 1F1GA 5K59F 1YY8A 3N0AA 5B21A 1TQBB 43C9B 1HHGB 4ONFL 3NJJA 3N43F 5E9DB 1J9SA 3UGXA 5FOBB 3BAXA 1KFAL 1KB5L 4HHAB 4LSQL 1IMHC 4JFPA 3SY9A 3WI4A 4A37A 2WJ5A 1CIDA 2QVFB 2ATKA 4TNWK 4DCQB 1B9KA 4D94A 1KPVA 1VZGA 3MCLH 4LPYA 4PJBE 4FGMA 4NQEA 1OP4A 4LLYB 4RZCA 5E2UL 5CHNB 3QXTA 1DZ0A 4UTAL 4L5FH 1MFCH 3LXUX 5HSFA 1WBZB 3V6OE 4M5YH 3VXOA 4DVRL 4OCLC 2N3JA 3KGRA 5BZZA 4E41D 5FB8A 4TQHA 3OWEA 3LEYL 2WMPA 3ULUE 1VJSA 3ZL2A 3QWOB 1I1CA 3AREA 3HE6C 4I2XE 4KJQD 4RGOH 5MHSE 4FFZH 3T6WA 4G6FB 3C87A 1EEZA 1OHQA 4UINH 5C07A 3ZOAA 5EF3A 1N10A 2ROYA 2J8UE 4L8SB 3QR2A 3VXPA 4DHLA 1OSZB 3CU7A 3I85A 5F7BA 4KRPD 2IADB 5TDPA 2HKHL 4FFZA 1W16A 5D7JA 4BWWA 3P73B 4M1GL 4CC0A 3C08L 2NY5C 5J56B 1KSRA 5IW1B 3GJEA 5SWQA 3PORA 1AXTH 1HHIB 2ZNWA 3VXUB 3WJJA 3O3EA 1WBYA 3U7WL 3P9MB 2PO6B 3CLFH 2Z31B 1HZLA 2R0LL 2DKSA 3O2VH 1S78D 4N0CC 4E9QA 4F58L 3VGDA 1KN4H 1AR2A 3DSFL 1S7UA 2D7OA 3ESNA 3NSFA 4GUPB 3TBTB 1NIEA 2FHCA 5AYUH 4NLHA 5GGUA 4FMFA 2NY4B 1EV2E 1MWAB 1S7QA 3ISRA 4FZEL 1Z66A 3AC0A 1CD0A 4FQJL 4Y4KC 2YLKA 5A43C 3O4LE 2CHZA 5BRZE 4GUQA 4DZ8B 5FS5A 1E3XA 4KZCA 3FPYA 1IM3D 2ADGA 4TNWF 2YRZA 1SY6L 2GSGA 3VDAA 2YD0A 2D7MA 3LQAH 1JF1B 1SBSH 3APMA 3WXVL 2IANB 3GGWB 1H5BC 1L4IA 5DF0A 4IK6A 1OANA 5L7XL 5E8DL 4UQCA 5IW3A 3VVVA 2NT1A 4KZDL 1NAMA 4MBOA 4K8RC 4N20A 1AO7A 1EZUA 2GAZA 5HVHB 2F9BT 1FYTA 1UVQA 4MNHB 2ORBL 5CLZA 4XVSH 1JXJA 3QC5X 5HDWA 4AV5A 1T0NB 4P2OA 1ODUA 5JHAA 4FNRA 1JFQL 4WO4D 5D8JL 2MCAA 4F7TA 3AG4B 1GGCH 1E2VA 3QULA 1QUNA 2I5YH 2R29A 3L3KB 1KLGA 2R2BA 3K0WA 4PRIB 2XBTA 5HGDA 5J1SC 1J1PH 1NFKA 3QI9B 1BYOA 1MCDA 4X8CA 2XE3A 4L29B 1CD1B 2EXYC 2QGCA 1PG7W 1WC7B 4Z6AT 1W15A 1ZLWH 1SXZA 1IEAA 3TNNB 4YK4B 1QBLL 4OQTH 2OR9H 1FFRA 3QYCA 2AXHA 5CD5C 1Q0XL 5J3HD 5C3TA 2J8OA 1EEQA 4PP2A 4ZMAT 2X4UB 1RVFH 1PX3A 5FGSA 1I75A 1UURA 4V11A 3ERXA 4Y5YA 1RUQL 1S9VA 3DTXB 5JA8B 4EQ2A 1TVBA 1RZFL 2KS0A 2CUHA 2NCMA 3MN8A 4HJ0C 2IAMB 4HWBL 5HD8C 5EU6D 5EOTA 2BSTA 4G7YL 1YPZB 4JRLA 5ESAA 1FC1A 3LQMA 3WKNA 3LK42 1SJHA 4R2GC 3NJFA 4X7CC 1EHLL 3KHQA 3VYPA 4L1DA 2HJFA 4UDUB 3ATBA 1HAWA 2H2PD 4KI5D 4U1HA 5AVYB 4EN3C 4X0KA 1ZMYA 4OCYL 4TTGA 4ZUWA 3TO2B 3UACA 2NOYA 4I3SL 5T1MA 1BXXA 5ESVA 4IKLA 2BFVL 3EYOA 1BG1A 1DQJB 4PJXB 5C2BH 4XN7A 3TWYA 5HI3D 2VN7A 3OAUL 4BCXA 5IFAH 3AAZB 1SFHA 3FCBA 4ZMZA 4HXBH 5TE7L 1ZA3A 1OLLA 1YMMD 1KFGA 1LO5B 2IG2L 4WUKL 1F58L 1I82A 2ZWSA 4AYMC 2XA8H 2AQTA 3SBWA 1DQKA 2WBJD 4YXHL 2EUWA 4WCYL 3CFKA 1BGXL 4XPTL 3P0GB 4L4VD 3L9EA 1CGYA 4PFEA 3SQOH 4LSTH 1IX2A 4RAVA 3VGFA 5C0RH 1Y18A 3AAEA 5JO5A 5D71H 3U0TB 2VDLH 4HF5H 2R4LA 3J27A 3DMMD 1T7VA 3B2XA 3CZFB 3TNMA 4FYQA 4B7LA 2Y5EA 1DUZA 3OKNA 1T1YB 3GMQB 3ZIYA 5TH2A 3B3IB 1TCRA 4NQVB 3RIKA 2J88L 4FMKA 4YWGL 3DHMA 4MMZA 3K2IA 5K93A 3VXSE 4WHYH 4BFJA 3SPGA 1ZTMA 1W6LA 1Z5YD 3N1FC 4NAJA 3ZYOA 5C7XL 3QPQD 2P8LB 3LKRA 4JFXB 2CPUA 2KPWA 4XZUA 4GEJA 3MZTA 1BD2D 3WDHA 1I9JH 4ZSOE 2X4OA 3VGAB 4DGYH 2KC0A 4RMVA 4J39A 1WRFA 1XDTT 3SE4A 5A2LH 3HLAB 5T1LB 1FNEA 1I85C 5E03A 1E5YA 3LVEA 4JJ5A 4ZZFA 4K71C 5DTFB 5IESL 4R97B 5IHWA 3TWCL 1JYXA 4N0YH 5IFJA 2VDPH 4Y5VC 4PD4K 3NAAH 2ZX9A 4QRQA 4PB9L 5E99L 2JJSA 1DQIA 3PL6C 3KM1A 4KK5C 3NJNA 5DK2A 3DETC 1D5IL 2MSPA 4KMLB 3D3VB 4JRXB 3BP7A 3N6YA 4GFTB 1QG3A 1BAFL 2EDJA 4LLVA 2GUOB 5D7IE 1PD1A 4MCYA 1FL6B 5FYKD 4NCC2 1WAAF 4MXWH 1S7XA 4JFYB 4LVHB 1EDQA 1OF2A 3MRBA 3ILPB 1NEZB 1SLWA 1ZSHA 3SDAB 4C4KO 3QNZB 2FD6L 3U1QA 4M93C 4E5XG 4FFWD 5HYSG 1NLBH 2BLFA 4LSUH 4NN7B 3A6BH 1NCHA 4Z7UA 2YR3A 3KPMA 3GNMH 4JN2A 1H0DA 4FNLH 4X9BA 2C9UA 1KXTB 5D2LB 1UA6L 4OZHE 4YHOL 3LN5A 4MQXD 3RVWC 4IHOB 1HXMB 4CW1B 2QSTA 5JPNB 2VKWA 3MRFB 1EAOA 5CMAB 2DEYX 4H40A 4GO6B 4ONGH 4R0LA 5HHME 4QTHA 4EIGB 1XH3B 2BOLA 5IKCB 5I8OH 4N0UB 4O5LL 1KYOK 2E27L 3V0VB 2CDFB 4Y88A 4HIIB 3EMNX 1N7ML 5C3LD 5KSAB 3VFGL 1FC2D 1ZGLA 3UTPD 4LESA 4J4PA 3IU4L 3S36X 3BT0A 4JLRA 4JN1L 3GBNH 5FHBL 2IGFH 3OKEB 4IBYA 2C9QA 2WINB 2BNQB 2APVA 2O5XH 3L08A 3PFUA 3BEWA 3CPLB 4ACPA 1QVOA 1S3RA 4PRAB 4PJ0O 2P9RA 2XXGA 3IJYB 1UGNA 1JXGA 4DF9A 4KX7A 4NJAL 5E2WL 1UJ3B 2HLAB 3G5VA 4FUVA 4OGYH 3KJ6L 3R0MA 4XXCC 4E0RA 2MPAH 1FDLH 5D5ME 3K71B 1S9KC 3HVDA 4X8JA 4W9EC 5IB5A 4N6RA 1A7QH 1KBPA 4X4MA 4DZBA 3FULA 4MHHG 1KIQA 4A2MA 2DTMH 4KVPA 4UNVA 4RESB 1NCBH 1ZHKA 2QPFA 2R9HD 2BCKB 4NCDA 1GIGL 5DHEA 3MFFB 4MCZB 2NX5D 5IW6B 1S7TB 1SYSB 2F7QA 3SGDH 1TJXA 2P45B 1CLCA 1AD9A 2AJYL 4FQEA 2F1CX 1QBML 1NEUA 4Z7QF 3O8XA 1BIIA 2JELL 3CSGA 1JZ7A 2ZUQC 1NIAA 4DFIA 3Q5TA 1BXWA 4PJFF 1W72L 3RHWF 5TD4A 4NIYE 4XNXL 2G4EA 3CN0A 4U1JA 4YDNA 5IROA 4YR6A 2YD4A 3B7RL 3LNFA 3DLQR 4JFDB 2X9YA 3ZE2B 1V05A 5EHFA 4OZGF 1UCBL 3D5OF 4MJ2A 4OF6A 1T20A 4TNVK 3RFZB 5ADXL 2H41A 1E8WA 2K4WA 1CGSH 2MNHA 1T1ZB 3IDJA 3B2UC 2PTUA 4PG2C 3AB0B 4AQAB 3HI1A 1QFWL 4POUB 2Y0KA 2F1BA 4G9FE 3P2TA 5BNXD 4RFNC 7TAAA 1OXYA 3WLBB 5LN8A 4DGVL 4KV5E 2JKWA 1PYWB 4JG9A 4RL9A 2W07B 3RUGA 4JRYD 5IWLC 3VI3F 5MEPA 1IEBA 2A74A 1N64H 4PSRA 1VFAB 5GS2H 5JORA 4POZD 4ODVL 4OKDA 1KIUB 4WFEE 5E2TH 4XCCH 4XO5A 1B2WH 1KELH 2R4NA 1IC4L 4JM2C 2ZG2A 4XVJL 4QXTB 1DVFD 1B0IA 1C08A 2VZTA 1BZ9B 2VE6A 2JMRA 2YK1L 5LQBL 4P46C 2QPUA 2XWBA 3T8MA 4YHIB 4PAZA 4TSBH 3QORA 4HUXA 1Q9GA 1A6TB 5HXMA 3EYSL 1HKFA 2UWEF 4YMPA 3K81A 1KLFB 1UC6A 4DJMA 1QWNA 2VRQA 1G5GA 2I69A 2WIIA 3OLDA 1B88A 1MHCB 4HH9B 1INQB 3LNDA 3MBXH 4P2QD 2L7JA 3NZSA 1YY9C 3LKQB 5LAXB 5DDHB 4QRFA 3MLUH 2X4RA 3FCSA 5EZIH 1A0QH 1CD8A 2NY3B 4TNVF 2G75B 1CDGA 3D0VB 3IGAA 3VXQB 3TZVA 3RI5F 1BLNB 4U7KA 5I15L 1D5BB 5DL8A 4FCAA 2C9AA 4K7FB 1SXAA 3NSJA 1YEDA 2AQPA 2ICES 2V0AA 3QIBA 4WWPA 1E9OB 2ENPA 3DGGA 1UHVA 1VGEH 3KPOB 1ZLEA 3HBZA 3MLSL 4NC2B 1MFDL 5I1CH 3POQA 4CVZB 4NUGH 2C3VB 4S10A 1ZE3H 3TTSA 3HE6D 5KYYA 1WV7T 4P4KC 3PWPB 3LPFA 2JCCB 4WHTB 2EIJB 1ZHWA 3BEVB 4F2FA 3KCPA 1OTUC 5E8PB 2E9IA 1NPJA 2VW6A 4TLUA 2OTPA 5EBGA 3VD2A 4XO9A 4DEWA 3IPEA 5HHOD 4J6RL 3OR7B 4NRYA 3GMNA 4MXQC 1ASQA 2FNWA 3PL6A 5MERA 2APTA 4NC0B 1WA1X 1NEZG 3CHRA 2A9CA 4UV7H 1FVDA 4JM2F 2AV7B 3ALXA 1DJXA 1L6ZA 1RJCA 2KT6A 3HG5A 3KPNA 3ZDWA 4GRLA 1A64A 4EZKA 2NLJA 4KUZH 2UZPA 1AQMA 1AIFA 4G59C 1J7VR 3ASWA 5E00B 3D07A 2OR8A 5E56A 1DL7H 3NJTA 3V7AE 1CFVL 1U8JA 3JTTB 3BP4B 3F84A 1R24B 4YBLC 5KZCB 2FBJL 1RZGA 2Q86A 4YSOA 1TU2A 4U1IA 2PCPA 2X27X 3STZA 3WBDA 1NICA 4TKWA 2FJHB 5JPMC 4YDIL 4F37F 2VDKB 5AUMB 4OZGA 3BH8B 3QDME 1C1EH 2H1LM 5CN1A 3PXHA 4NPYA 4L48A 2QTKA 2HP4A 2QLYA 1IBGH 2XMXA 4PRHA 5E6YA 4AG4L 3ZDYF 3IYLW 4XNKA 2APWA 2HVJA 4YSSA 4Z0XB 3ZBMA 4JM4H 2K0LA 1ED3A 4FHKA 1ZEAH 5AL0A 4NHUB 3LZQA 1NBZB 3CU1A 3LH2L 2ADIB 4RZKA 1T4KA 1YNKL 2F8IA 2ETWA 3FONA 1MG2C 3VI3A 4PLKD 1BSIA 3UTZA 4NQXB 2XV2A 3C6LC 3BP6B 3WAKA 2HTKC 2DQIL 4K3JL 4YXKL 4I87A 5SWZB 4MDRA 4RGND 4U2ZA 5B3SB 4ELKB 1HZKA 4ZX6A 3ZQXA 5J13C 3VWJB 3DX9A 2EXYD 3TYGH 2Z0BA 2VSCA 2BVPB 4PD4J 3O45B 4H5SB 4M48H 5HGBA 2GHWB 5B4MD 1KCSL 4HOXA 2BWDA 3CH1B 1UD8A 2AK4E 5GHWL 3L4XA 2H0PA 2F7IA 4NSKA 4X6CB 5JZ7C 3PWVB 4APQA 2GTQA 4NS0A 3BJLA 1SVCP 4QRRE 3SZ6A 1ZS2A 1PIGA 1SZNA 3DNKA 5I5RA 3WN5B 3NK3A 4HJ0D 5HD8D 3F64A 1FFPA 3FAXA 3UAEA 4RRPG 4CSPA 2VSMB 1URLA 3CXDH 5B38G 1DQDL 4C56A 3T0AA 1QFUH 1Q72L 2J12B 3LTVA 4FRWA 4OUUB 1PPIA 1I1AC 2F08A 3HB3C 2ZP0T 3MLWH 4LRIC 4Q2ZB 4K3EH 3L4ZA 2PPCA 4U2YA 2O6CA 1FWXA 1JRHL 5F89B 1TZGH 1VENA 1YY8B 4WFGD 5IJCC 1JV2A 1Q0YH 4GJTB 2WKOA 3CSYA 4D5UA 4ANUA 1OTSC 3OAZK 3QXVA 3CBJB 3M6DA 4DOHE 2WYIA 3G6JF 3LZFH 1R19A 2R0KL 1C5DB 3GSNH 4PYHA 4X8GA 2FJUB 2BHZA 4WI5A 5DWUL 1WVZA 3IAQA 2P5WE 4RZCB 3GSNA 4EZLA 1KYOJ 1M1SA 1LEGA 3WJMB 2AAVA 2QLVB 3EJUA 3VXOB 4HX1B 1RQ5A 1CE6A 2ARJA 2WC7A 3FUMA 3IRCA 4P2RB 5C08D 3SOBL 1G87A 4JKWA 3GM8A 4ELMA 4EVNB 5FB8B 5LGHL 3DI2B 5EU4B 5AWNH 2IDUA 3WY4A 1DCLA 1OE1A 2VXTL 1KULA 2IGLA 1T0MA 3T65A 5I1EH 4WF7A 2LVEA 3KPPA 4NWTL 1S2EA 5TQ2H 1ML0A 1EEZB 2X09A 4O58L 2XNAA 1D9KD 5EBWB 4IRJB 3WHE1 2E4FA 2QELA 1JVLA 1CGTA 3GSOA 5D7JB 4KMTH 3NGBB 4DVBA 5F3BB 1EO5A 3OBAA 1MZZA 2DJMA 3LN4B 5KVDE 2CO2A 4QGYA 4NZTL 3WE1A 4L1LA 2I60H 1PS3A 3LCYA 5BO0D 2Y0HA 1WBYB 4UNTA 1I8UA 2EE9A 1W91A 4C57C 4LPCA 4U6TA 4KROB 2RB8A 3L3OA 3IFPB 1YLBB 5KEZA 3H6AA 1MPAH 1LO3H 3OC8A 3OAWA 3CVBA 4KJPD 4GAJH 1QW9A 1S7UB 4LDOB 4AGPA 2LOEA 1A6WL 1SF5A 3QCVH 4C55A 4CMMB 5LXVA 3CQQA 3BVVA 3ZTCC 4GBXD 1NKGA 4Y1AA 4X6FA 1FL5A 3RL2A 5HDBE 2X89A 4H8VA 1U3JA 2MNUA 2YUVA 3DVGA 3G5ZB 2GSGB 5FUCC 1H3WM 4PJBF 5I8CA 2DWXA 5CBEB 3MLPA 4UQ3B 1H3UA 4M7ZC 4I18B 2H5UA 2YA2A 1TXKA 1RZIB 2HKFH 2ZAIA 2F74A 2Y07H 1V7NH 2DQJH 1G6RH 2WVVA 3KEHA 2F8XC 3RBHA 3HMXA 1AO7B 1NFIA 3FXIC 3H3BC 4ZMTA 3ULUF 3UC0L 2B4CH 5D1QA 1R3IH 4AUYA 4TTDC 4P99A 4NJ9H 4XNMB 4P2OB 4UAHA 4CBPA 2AVFA 5DJ0A 1QUNB 4S1DD 2XICA 5L2JA 1J8HA 3ARFD 4ODUA 2VDOL 2FATL 4TS6A 2J8UF 4W9KC 4JFEE 5HGDB 1BP3B 1TQWA 1XGQA 4KRAA 2EJ1A 3BKMH 4GP4B 5JDSA 3PCYA 5IQNA 3VD1A 1WITA 3L3JA 1THAA 3BW9A 1XXDC 2N0MA 3TYFA 1DFXA 1MCQA 4U7SA 3VSUA 4F9LA 4A39A 2AJUH 4XE0A 2Y7MA 1DUYA 1A7RH 3QFJA 3BT2H 3DURA 3O2WL 3L2LA 4O4YL 3QDJE 4XBEL 3FUIA 2QMJA 3FDWA 1KTCA 4XPAH 3DIDA 2W9EH 3N43B 4WI0A 5EOTB 5ESAB 1WWWX 1DVUA 1JV5A 3G04A 3GKWL 1R3JA 1CI3M 4G6KL 5K1JA 4GQ9L 2WXQA 3TFBA 1G43A 1P5UC 2VZ3A 3WIHL 4GKNB 4BRVA 4X0KB 3B2PA 3PP4H 1ILUA 2DL2A 1VFMA 4MJIE 3F7LA 4P57A 4XR8C 1ZGLP 1IAOA 1OCOB 2VDQH 3V4VA 4PRPD 3AITA 1HH6B 2E47A 5K39B 1WTGT 3RGVC 1KIRB 4X9FA 3MBEB 1JWMB 3HNSH 2VABB 3NFNB 4PJEA 2EXTA 5FF6B 4JANA 5C0IB 4XTRC 3WFEL 3IDNB 2X4SA 4AYBA 1QFHA 3U36A 4ZW5A 4EDXA 3ECBA 3FN0L 4E9TA 2IFGA 3E8UH 3O11B 5K9QG 2A77H 2LTQB 3N50A 5TISO 3G9AB 2FHFA 4YQXL 1CBVL 4Z95H 1BF5A 3CFKB 5FVNA 1KCLA 4G43B 3CZKA 1L7TL 4AKRA 1F11B 3HC4L 3RWDA 4LDCA 5LBGA 2AJXL 3IFOA 4F2EA 5GS1B 3NQIA 1Y18B 3QIWC 5JO5B 1OHZA 3JWDC 1DVYA 1WQVT 1RV6X 3UTTB 1FH2A 3W11C 1MHPH 1MCOH 2YPLD 4IHBA 2OS7A 3TNMB 3CX5K 1G90A 4PJDE 4IBLT 3FMGL 1DBKL 3E38A 5E5LA 1A4AA 5BQ7A 3QRBA 5TH2B 3RX7A 3H9SE 3K8KA 4B0MB 1QMUA 3R8BB 5AW2B 3D39A 5ANHA 2I24N 4TVPD 3HZVA 5CR1A 1RJYA 1LO2H 2MJWA 3BVWA 3GINA 3QFDB 4H20H 2WWMD 3HHRB 3W2DL 4XPBL 1OGAE 4FYTA 1M05A 1DN2A 3UTSD 4PJ5B 5LNDA 4XZUB 2X4QA 1DSWA 2VDNL 4KKZA 3AWEA 2X4OB 5DMIH 2AC0A 5I23A 1AGFA 5T1KD 1HC1A 3NK4A 5CEXA 5C0BE 4OLEA 1MJJB 3MDJA 4WKZB 1GZQA 2DQEH 4H8PA 4JJ5B 2YZ1A 3ILEA 2CXKA 4FQCH 4WFHE 4PJBA 5EZOL 1UACH 4S1RL 4BZ2H 5IFJB 1AZCA 3DDGA 3AXLB 3QJUB 4N8CH 4QRQB 4P2YA 1VFOA 2C7FA 3SE3A 2YEQA 3TT1H 4D7PA 5BVJB 3V6OA 4FEMA 1PG7H 3QVAA 2V4LA 3R06B 1R9FA 5D7EA 4P9HH 4AITA 3FQXA 1P4IH 5GRUH 1IQWL 3BP7B 2WXIA 3ZYJA 2CNZA 4ZW7A 3SYOA 1CVSC 1DQMH 3SD2A 1CE1H 3BWUF 4P49A 5C7ZA 2J8UA 2OMFA 4PV1C 2IDSA 1FA4A 3ZTNL 3UIYA 2XZQL 4U4BA 3K6SA 1BQSA 1OCWL 2OXGB 3C75A 3L6FB 1YYCA 3LPGA 3KGTA 3I02B 3QPXH 2EEFA 4JN2B 3VFTB 4LKCA 1JK8A 1UM4L 2FQFA 3I50L 4JHAH 2Y0LA 2R4RL 4LCVA 4U3XA 3TIDA 2D73A 1W8OA 1E9QB 1U95B 4UB0H 3UPGA 1BMWA 3ARPA 3QZPA 5F1IB 1P6FA 1FBIL 3QAZC 5JW4N 2A7BA 4R7NA 1I4FA 4QTHB 5FYKL 2UY6A 3O4LA 4P4KD 3QUYD 1S7WA 1CDIA 2CRIA 25C8L 3L3GB 4GSUA 3L5WA 3S88L 4QRBA 1R5IB 4FNTA 1ZGLB 1SRDA 3L7FB 1N67A 3O6LH 1YMHB 4Y4KB 1G7LA 3AUVA 4IMLA 4KFZC 3QJFA 1MCJA 4P3CH 3BEWB 5FKPB 2CR3A 2FJFB 4NKMA 1QVOB 2O30A 3I9AA 4PJGE 1ZOXA 2VLRB 4FZ8L 1JGLH 4ILDA 4UU9A 3I2CL 4GIAA 2H8PA 3ZTJH 1K8DA 1QFOA 2EIZB 1AC0A 2GQHA 3G5VB 8PAZA 3B5HA 1IIKA 3BDXA 4H0GA 1ET5A 2WOYA 1NIBA 1H5BB 4KHXH 2XZAL 3CVHL 4Q14A 4BFNA 5I0DA 3FH7A 5D7IF 3KDMB 1D7DA 4OD2A 5DD3H 1MUJA 4JQIA 1ZHKB 3QSKB 3MUJA 1AE6L 1XAUA 2XBZA 2P5EB 1GHFL 3FTZA 4JKNA 4A7UA 4YPGA 2YGOA 2YQGA 2BW5A 1BF2A 1N5AB 2V8LA 2G30A 2VQUA 3CIAA 2UXGA 3GUFA 4MA8L 3PJSA 1BJ1H 1ASPA 4O9HL 4X4XB 3JWNE 2Y36L 5AB0A 1BIIB 2ZXEB 4GINA 1M2VB 2WM0A 1WG3A 1MVUA 4M5ZH 3Q44A 4LPXA 1CJYA 2GK0B 4K5OA 5KSBA 4U1JB 2X12A 1ZPUA 4OZHF 2YJLA 3BGMA 5BRPA 4FQXC 4NO0A 4I4WB 3VM7A 3BESR 4CRPA 4GRMB 1YECH 5ID0A 5AOLA 2M07A 5KBMA 3IDJB 4D8PA 2EDDA 3T71A 3WYRA 4M1DL 1QFWM 2J4WH 4JKPL 3HI1B 1MJ8L 2ZOUA 2X2YA 4YHPB 3LIZL 4D0CB 3QCUH 4R7LA 1UT1A 2B14A 1DDHA 1AD0B 5D93C 2BM3A 4K07A 2L0DA 2VXVL 3ZYZA 3GJFK 4R2GB 1NCDH 5E8OB 5MEPB 1IEBB 3MA7B 1C5CL 4EN3B 5JORB 4WLCA 3NN8B 7PAZA 1UASA 5E24E 4R4FL 1F45A 3ULVD 5HYJD 1TFHA 2J1KA 1J5OL 5D5MF 1IL1A 2BNRD 4OFQA 5CINL 2ICCA 3TBWB 2H32A 1C08B 1FGVL 3RVXC 5DS8B 1I8LC 3FFCA 1QRKA 3UYOD 2FR4B 1S5HA 2XWBB 1T7XA 2AEWA 2C1PB 3QORB 3MUGA 1PX8A 1QSED 5EN2A 4Z3TA 3BPLC 2X9WA 3HB3D 1K5NA 4FG4A 2G60L 5AYQA 3H9HA 4PLOB 5EWIH 4V1DE 5GSRA 2FGWL 4X98A 1C8PA 1LK2A 1ZDQA 4X0NA 5DSCA 1U8CA 1XGRA 3RWFB 5GZND 3DZMA 2JQAA 4XX1G 1KG0A 2B0SH 4WWKC 1VADA 4FAAB 4UT6H 3LN9A 5KVEL 3A0HO 2JKJA 4WNQB 2VR9A 1NCGA 2YNKA 1HZHL 2FECL 3GLDA 3IDYC 3IWVA 3LQZB 4OQ1A 1I1RA 1BJ1J 3ZZSA 2FO8A 1I1FB 4M5TA 1OD7A 1CGXA 1OL0A 4U49A 1ORMA 4UT6A 4C00A 5DUPH 4ZSOA 2BHFA 2GTZB 2Q6WB 3ENEA 1TITA 3AM8A 4IOIA 3GC3A 1ACXA 2EKJA 3DGGB 3K1KC 4R26L 1ICTA 4KV5F 3MV8B 4ZFQA 1LL1A 4MDIA 3X13B 1HI6A 1G9MC 2VLJD 3VRJB 2NXYC 5DC4B 1DLFL 5C6TH 3R7RA 3TV3L 4A7VA 5IBTL 3DECA 4K71B 6CGTA 5I2IA 4HT1L 3RL1B 1CC3A 2XQBL 5DD5L 5JR1H 2ED6A 1NGQH 3O3AA 4Y5VB 4LLUB 5DJZA 1GYAA 1I31A 3CCHB 3LRGA 4P5KB 4LVNC 1ZT4A 4K9EL 3PL6B 3DHUA 5F2FA 2BC4A 3S34L 5D7IA 4RAUA 3FF7A 4P5TA 4LSFA 1BLIA 3HRZA 1IILE 2CCLA 3DDFA 2HT3C 4MAYC 1G7QA 1MW0A 2APBA 1J0HA 1IGIL 2PXYA 1KB9K 3NPSB 5CEZL 3L95A 5E1AA 1JNNL 1I3RB 4XODA 1O6SA 1AIFB 4EMZA 4Z7QB 3KPQA 1SDDA 3UJTH 3P3UA 2AKRA 3WS3A 3S97C 4Y4FC 1JYWA 3HR5B 4PJFB 3AA7B 1AZBA 4I85A 3SZKC 2OMBA 3WKQA 4AXWA 1FNHA 2FJSA 3STLA 5FK9A 1AI1H 1RZGB 3EJTA 3L5JA 2Q86B 4M93B 1TU2B 1EJ8A 2NZIA 2V5RA 3WGVB 4OZHA 3GIVB 1KOAA 2PCPB 1QR4A 5DYFA 1FO0B 2BP8B 5E51A 4OZGB 1NSNL 1K2DA 5JXAL 4D7BA 5SWSE 3CX5J 4BGDA 1NKOA 4FTVA 4MD5A 1WT5A 2WZPD 3W0WA 1HYSC 2Q10A 4ORGB 4F7CB 1NMAL 1MCLA 3KBHE 4R4BA 3EYFA 4WIQA 3BRZA 4YXLH 3H0TB 1IC5H 1R17A 4JFSA 4TTDD 4PJ8A 5BUGA 1X4XA 3DXAD 4PN6A 4HIEA 1IKNA 4NEHB 2J73A 4XP9H 3VI3B 4ODXB 1UG9A 3UTZB 5D1ZA 1U8PA 2EDQA 1DJZA 3THMH 5HDQH 2DD8H 3VXRB 2FLMA 3BZ4A 1G1OA 4ISVA 3ABLB 4FQIH 5D5MA 5ILTH 4MNGB 1Z9MA 4GRWH 2EUZA 3VCLB 1CDCA 3SSGA 3CHOA 5T1DL 2Y24A 3L16A 5BQDA 2YD8A 1KB5H 4LSQH 2VLMD 3T2OA 5I6XB 3OG4B 3SDXE 1EERB 2TAAA 4AH2A 1NCNA 4WGKA 4JHVA 1BQHB 5IREA 2GK2A 4APQB 4N2BA 3BUPA 3AAAB 3IXAA 2UWEB 3RX8A 1MJ7L 3S35X 4X5XB 3D2UA 2DAVA 3DX8A 1U8LA 2XTJC 2BSRA 2WY3B 1N0XL 4WQOA 5LWYL 1PLCA 4C56B 4OCRL 4EN2A 4LRNL 1R3HB 2JLPA 3SCMD 2ZUQB 2V2XA 1FRGL 2YBRA 4GXUN 4XC1L 2O61B 4NN5C 4HMCA 1EAQA 4E2OA 4WV1C 4F2MB 2BMKA 1LP9E 4DP9X 3CSYB 1ONQB 2X3CA 5DHDA 2WQVA 5DHVB 1R1CA 4L37A 3RZCA 2VYRE 2AV1A 2HT2C 3C8HA 4X50A 3BZEA 4ZAKC 4HGWB 5I73B 1YUHA 4M1GH 5GIRA 4BKLA 2OI9B 2L7UA 3VXMA 2BERA 3EJPA 4JHWH 5C0AB 2VLKB 3GJFA 3QRGH 4LSPL 3CDZB 4F57L 3U7WH 3MREA 3FFDB 4WO0A 4KRNA 1CXHA 2WTRB 3DBSA 5AEAA 4ZXBC 4HFWB 2AQ2A 5EFIA 3FT4B 3S4SB 5I0YA 2B1AL 3TA3D 2C7UB 3D85D 3SY7A 3TX4A 3OX8A 2FWOB 4ZYKA 2VMCA 2EZ0C 1VZHA 4GS7C 5C9JB 1QLFB 4JM2B 1SLVA 1THCA 5DURD 1CR9L 5ICUA 1RK0A 3KYAA 3GSOB 5KJ4A 1SY6H 2FB4H 3DX4A 4NENA 4DVBB 1VACB 1JS4A 1QSFE 4P46B 1FORL 1MNUL 5CUSL 2A6KA 4BSVB 2GBUA 5AOJA 3WXVH 2YAPA 4J3UA 2W8CA 3HCVA 5A2CA 5L7XH 3T0DA 4FXKC 4NZRH 2APXA 4N0FB 2D9CA 1ZANL 2ENJA 3H2PA 1FVCA 1W0YT 4NERA 1JHKL 5HPOA 2EIBA 5C2UB 3UGEA 2ORBH 5F3HA 4RFEA 5GZOC 5I26A 4DH2A 2Z92B 4YL9A 4PRNB 4R6UA 4WK0B 2VDMB 2D3JA 3G6AA 2YO3A 3H3KA 4MQ7B 4FSPA 5DS2A 2W9LA 4W68A 2F6AA 1T1WA 3Q1EA 1AS6A 5KVFE 5JOFA 2JFCA 3D2TA 2Y69B 3QUMH 3FQUA 4X6FB 4BH8A 5D1XE 1NUNB 3ZDYB 1AR1D 1F13A 1FL5B 3RL2B 1BMGA 3BVUA 1MAJA 4BH7A 5KVGE 3C6SA 1V54B 3ZW3A 2G4GA 4NYLB 4EEEA 4FFTA 1QBLH 2MOQA 1RUAL 4FKEA 1KC5L 3UYRH 1A6VL 1MLCA 4RVBA 2F74B 1RCYA 3FQ2A 3SPVA 2WVVB 2CO1A 2PTTA 1JI2A 3HFMH 2DN7A 3MRLB 1RUQH 1Y1DA 2V5TA 3OKKA 4DSYA 2FBOJ 1RZFH 4HWBH 2YEZB 4ZFOB 1XF2B 1XCQB 4NNPH 2BIPA 4G7YH 4XHJC 4UMSA 1M7DA 2BVOB 4EZMA 4PVBA 5I1GH 3VFNA 5DJ0B 1T03H 5I18L 1R3LA 5L2JB 1NANI 4ODUB 4XP1H 3HC3H 4OSUH 1CT8B 3BGAA 3CBKB 4KOCA 5F7LB 1YJDL 4PJAB 4TULL 2NRDA 1QHQA 1KJMB 4JO4L 4M6NH 2C3HA 3L3JB 4JZNB 4MNQD 3V0WL 2ZJSH 3INOA 3BW9B 1PLGL 4KVNH 1QFPA 3P9LB 1JZ8A 4AQ8C 3OAUH 3TJHD 4G70B 1CZ8L 4NWUL 3QZWA 1TNMA 3O3UN 4BSWA 2Z35A 1R0AH 3OQRA 2OW7A 3PIQA 1XBRA 1T5WA 5ANMB 4P9ML 2WZ5A 3FRPB 3ML8A 1F58H 1MIMH 4PV8A 1S9XB 4HIQA 5KS9E 2QADC 3BD3A 5JHDE 3B5GA 4Z78A 1CDUA 3ARGC 3MR9A 1P84J 2APSA 1R3JB 3G6JB 5JPMB 4LQFL 3PQYD 4NLAA 5HDBF 1JK9B 2NUPA 4MYPA 5C92A 3MNMA 3TBVA 4ZOAA 4BCZA 2KXPA 3Q8EA 4PW9A 2ZG3A 2JV6A 3V4PH 1AKJD 2D0GA 2OMYA 3ZZQA 3D4CA 3HS0C 4PRBB 1DJGA 4NQDE 2J88H 4FZMA 4J8QA 4YWGH 5T8IA 1DANU 12E8L 3V4PA 3BLPX 3PAZA 5C7XH 4XAWL 3B8YA 3CN2A 5DL7A 3ECBB 3O6MH 2W5PA 3C6LB 1BQHG 4JKLA 1BJMA 2AK4A 4NO5A 5GGQL 1MH5A 4PS3A 4HVBA 3OGCA 5IESH 3RWDB 3IFOB 2PWFA 4FQXD 3TWCH 3VH8A 4QRRA 3V4UL 4MWFA 3WIIL 2EIMB 2ZCLL 1BWWA 1FLRL 1KB9J 4N85A 3RX9A 3OB0H 2NR6D 2OA9A 5EORL 4N2HA 4W9DC 3U2SA 2IOOA 3ESUF 4H1LA 4KQ4L 3IB4A 2B1HL 4LDLB 3HZVB 1RERA 3IKCA 2NZ9D 1A4KB 2JKSA 1U2YA 5DVLA 4NQCE 1I1AB 4P05A 3FW6A 4ZS7L 1L5GB 1WAEA 1GMIA 1C7TA 1AGFB 3K72A 4MQTB 1I7TA 4AEEA 1L0PA 4HUWA 2FD6H 3MTRA 5LXGH 2VXSH 4P23A 5C09E 3PDDA 3VFUB 4NO2A 4QRPD 3OPZH 1Q9KA 2P5WA 2VM9A 3S4SG 2AXFB 4GKLA 3PQSA 2GC7C 1VEMA 1YEGH 4PS4L 5DZNA 5EOCL 3DVNA 4YHOH 3HZKA 3O6KH 5JXEA 4HQQL 1I1YA 3GXPA 3TPUA 3UDWC 3QHZH 3BGFC 3OHXA 3QEHB 4TVPL 3FQXB 1JZ2A 4L8BA 4QYAA 5LDSA 3W9DB 2JI2A 3LZLA 4XCFH 1XSJA 4I2XB 4M5SA 1QR1A 1KGIA 2KMWA 1DBBH 1MFMA 3HG2A 4ZW8A 1IGCH 3FO1A 1QRND 3MV7D 2QQNL 5DMGC 1N7MH 4PJ9C 1N0LA 3MNZA 5DGQA 3MRNA 2CJSA 4BDVB 4ZG1A 5AAWA 3IU4H 5I1CL 4WWKD 2GSIA 4HZAA 4FNQA 4XH2A 3MV9D 5FHBH 3K6DA 2CKBL 3P0VH 2CO7A 1HJCA 2WWNA 3DC0A 3OQ3B 4J7RA 1JPST 2FLBT 3MJ6A 1TKWB 4Y4HA 5FKAA 4PJDF 5E2WH 4LKCB 1JK8B 2B59A 3U7YL 1WZAA 2OSYA 2DWSA 3KJ6H 3T2QA 4XHQA 4DKFL 4X80H 1TZOA 4WW2C 3WOVA 4AZ8B 5F6IB 2VN5A 4ONOA 3AGVA 2OQJB 3RFRA 2NXYD 3O4LB 5BRZB 5CR8A 4AYSA 3BN3B 3RY6A 1BQUA 1QLEL 5BOPA 2OMTA 5GSVB 4JFZH 5D2NE 2JELH 5HGHA 4NQED 3V0DA 1TSRA 2Q76A 4XI5C 3HNTH 5DRWB 1W72H 2Q3XA 3P3TA 3WE6B 3VYOA 4OCXL 4XNXH 4N8PA 3Q5OA 2XOTA 3TA4D 2WLIA 2XV3A 1EUTA 2FQDA 4UU9B 5FW7A 3NESA 2HT3D 1YEEH 3V52L 2H8PB 2BWQA 4DQOL 2QL1A 4X99A 3X1NA 3ARED 5CSBA 1UCBH 4M7ZB 3UBHA 5KSUA 5HI5D 1RI8A 1OLZA 5FA4B 4OD3H 3HI6H 1TLMA 1GZPB 2GJ6B 4L23A 4UV4H 1CCZA 4Y4FD 5C07D 3ZDXF 3PWNB 1ZE3C 1KLUA 3NEEA 2AJZA 3SKNA 3O3DA 1X44A 4MVBC 4X6BB 2FEDC 4I0CC 5FYLE 4DGVH 1XSKA 5JUEL 3TLRA 5C0EA 1CDHA 1FUNA 5CGYC 1I7UA 3ILQC 2DQDL 1MVUB 1N6QH 4ODVH 1MFUA 2A9BA 2JIXA 3QEGL 3N9GL 5TF1H 2R56L 3FRPG 5HJBA 3CK0H 4NO0B 4XVJH 1R5WA 4BM7A 2C3WA 4JG5A 4QNPF 3QDJA 4XNYL 3S37X 4FT6A 4AFKA 3HI5L 3BS0A 4TRPH 5AW4B 4NDMA 5ID0B 4KJYB 5IMLB 5LQBH 2IOIA 1T7ZA 4IRSC 1CB4A 3PJLA 4HKBB 4WW2F 3HR6A 3T4YA 3VYNA 3EYSH 1MHEA 4XWOD 4YLQT 1T89A 4XMWA 5KWYC 1DDHB 3CUPB 4QYOA 4LPTA 2YIHA 5AALA 1OO2A 1URZA 2WNWA 1AOHA 1EFXB 2CDGA 4PJGF 3NCEB 3VFVB 3MRGA 3OAYK 1P5UB 3LEVH 4JO5A 3TVMC 5EUOA 2VL4A 3JTSA 3NEXA 2CK0H 1FYTD 3ZT5A 5DFAA 5GGTH 5FLVA 2H32B 2BY2A 2WN3A 3D25B 3LKOA 4X5WB 3RGVB 4HBCH 2XTJD 3O6FA 1IBBA 2IH1A 1S5HB 5I15H 5KBDA 5GGTA 4EI5A 2ALAA 2G2RA 3R1GL 3RWGA 1CMOA 5IB1B 1V10A 4YX2L 1ZWIA 1CK0L 1K5NB 2VZVA 3L5IA 3FTSA 1B0GB 1A2YB 2CUAA 2P3YA 1SJEB 5E5MA 3F7VA 4A2DA 4DGUA 5LLIC 2EDLA 5DSCB 5CWSA 1T83A 1UWGL 3MOAH 4PJDA 1GS8A 5TQ0L 1F4WH 2KZ1B 2BNUA 5SX4I 4CILA 5IHZA 3D9AL 5E94B 3QIWB 4JPIA 5J4MA 2CHXA 1VADB 4PGZA 2YGVA 4K2UH 4J6RH 1SXBA 3ULVL 3K74B 3VXSB 1IM9D 1NFDE 3SGKC 43CAB 1CFBA 3VG0H 1S3KH 5DVOA 2V5MA 5E2JA 1QA9A 3FB8A 4KH9A 3HG4A 2FSEB 2OLDA 5DI8A 2XRAL 3BQUC 3VGGA 3WO4C 2IWVA 3UTQB 5C0BA 4HP5A 2XE1A 1X7QA 3DBXB 4IS6A 4AYDC 1HI6B 1TEGA 2Y5TA 1AZUA 4JGMA 4LBEB 4PRDA 4Z7OE 3KPTA 5GRXG 4PJ7F 4Y1SA 3LOWA 3VA2C 1JZHA 2B9AA 2EZ0D 2VWEC 2H6UA 4F15C 5C0FB 5I2IB 4J2XA 1JGVH 4NP9A 4M9PA 1IRAY 3NA9L 4XN1A 1PZBA 5FGBC 4YDIH 2H45A 3O3AB 3HZMA 4PI2A 2TRHA 3BJ91 5HVFB 2CBOA 1T5XA 4GT0A 4RMBA 3AA1A 2LAGB 3POXA 4I48A 4P5TB 2ZWYA 4PMFA 2ATPB 3K5SA 1DBML 4YHNA 5E6SB 2XN1A 4OFKA 2CLZB 4DO4A 4HC1L 1O6SB 4Z3HA 3LH2H 4KZEL 4XVUD 4MMYA 1X3DA 3WS3B 1KEML 2Z8VC 1V3KA 1TQCB 4G8GA 1J5CA 3VD7A 4YXKH 5C0CE 4I5BA 2KL6A 5SX5K 3MRQA 1IU1A 2F53B 3DPBA 4WTWA 1OB0A 2NDFA 3TO4C 3TESA 3DROB 1Q9LA 2VAAA 1F6AB 5EZJA 2YEVB 1YNTF 3GLZA 5HHMB 2DIBA 3FOLB 5TDOA 3ZHKA 1TYJA 2FL5B 4NI3A 1D7BA 2A0LD 2HB0A 5GHWH 5FC9A 5C0NC 1A02N 3VB9A 1AQKL 2SEBB 5E8EB 4FF9A 5F8RC 5TF0A 2V2WB 4PVLA 2WQAA 4AGLA 4A6YB 5L2KE 1U4EA 1MCCA 3HG1E 5CILL 2CD0A 2GABA 2A9NH 1XF3A 4AYID 3L9RA 5AW1B 4FADA 1JZ5A 5IJDC 3SYPA 2NNRA 1KTKE 4MLSA 4M8VA 1DQDH 2A83A 2X6CA 1Q72H 2ZUWA 1U8PB 2OL3L 3PV6B 3WFHA 2OMXA 3BAYA 2BHUA 3GBLA 5LO7A 2ZWZA 1U91B 2AQRA 2MQ3A 4HWNA 3RG1C 3WIAA 2OJZH 1BDYA 1JRHH 3BZ4B 2PR4L 2UZIL 2R69L 2WUBL 4HA1A 3B1UA 2J71A 3MRJB 3L9YA 3NCWA 1CICA 4RFOL 3AY4A 5H37H 2FSDA 3LK3B 1OVZA 4HD5A 4ALAH 4Y2OA 4DK5A 4EUPH 1CN4A 2BVTA 5H37A 3PWLA 1G0YR 2QHLA 4O3WA 3S3JA 4JGUA 4FKKA 3DX8B 2C4FT 3GXFA 1A9BB 1XB3A 2BSRB 2BWIA 1ULVA 4JUSA 4LAQH 5DYOA 3RTQC 3UADA 3SOBH 3WNIA 4MCNA 5AENA 4DN4L 5IHLB 3S35L 2VL5B 5LGHH 4Q6KA 1ZTXL 3FU7B 1QTPA 3NCCB 4JFBA 2ZIDA 3H55A 2YBRB 4E9YA 4ESKA 2IIJA 4NWTH 2VC2L 2MRYA 4Y5XA 4NFCA 4HLEA 2XIDA 4O58H 5HYFA 4GI9A 1O0VA 2A3TA 2N01B 3RZCB 2AV1B 3BZEB 5L6YH 4HG4K 4G9FB 3PGUA 1NL0H 2AEPL 3W5NA 1YEJH 4IRSA 5J57B 1EGJL 4EXPX 4JDZB 4BFOA 5KW9H 3CC5A 5DVMA 4A2LA 3GJFB 3KYOA 4AQ1C 5DC9B 4JG1L 3MREB 5IVXE 2YAFA 3RY5A 3FTUA 4QOKE 2XN9E 2Y1YA 3PXLA 3VFRA 4ABWA 3A4FA 4K3HA 4R7DB 3QIUA 2QKIA 5D93B 4AYGA 3UC2A 1NBQA 5EFIB 3CD4A 4H88L 3HZYA 5EO9B 2VN4A 1B90A 3FB6A 4U6XA 4NBYB 4PGDA 1BYPA 4LCWE 2VERN 1KY7A 2BSCA 1DQTA 2DLHA 1J87A 3R0NA 3K6FA 3SDXF 2R7EA 2JJWA 3LNEA 4GPVA 4NZJA 1ZXQA 4N58A 3MROB 2RA1A 3OTTA 3UL4A 3O8XD 2VIRA 4V1DA 2A6KB 1KCWA 4DAGL 5TE6L 2KPNA 4DK6A 4PW3A 3QYMA 4KHTH 3NCYP 3G5XA 4LIQH 3FTYA 2DLTA 5IROD 4HCRA 1BECA 4DERA 3POCA 4L2LA 3U4EA 3UC0H 3CWGA 5E7BA 1HL5A 2ARWA 5F3HB 2UYLA 2EUXA 1PZ5B 3TASA 2HG5B 1LP9F 2R89A 4GG8A 3DWNA 2VDOH 4BH8B 5E9DE 2CHNA 4OLYH 1M2OA 3IDYB 1Y6KR 2Z9TA 5DJ2A 1HSBA 3UCRA 3GSWA 3VG9B 1UKQA 2K9UA 3FCTA 4A7QA 3D69A 7FABL 5DD0H 1BIHA 2P8PA 5ITBH 3BQUA 1K4CA 2VN6A 1I9IL 5AB1A 4I77L 4MSWA 1KCUL 5DZPA 4TPRL 3SPVB 1KTDA 1PX4A 3ETSA 1P4LA 2HRPL 3O2WH 5GS2D 3HVNA 1JL8A 2UY7A 4DTGL 3OKKB 3KWUA 4J2QA 1MFEL 1SN0A 1AYOA 3SODB 4I0PC 1M7DB 1EJFA 1U8OA 3GKWH 4PHZA 1F6FB 3BWAB 3NZ8A 1LD9B 1MIEL 1R3LB 1GW6A 5DQJA 4NUJB 3U25A 3E6FA 4RDBA 1BBJB 3WIHH 4LVNB 2WP3T 7PRNA 5T5NF 1T4WA 4Q0XL 2VUYA 4P9HC 1MNNA 4MAYB 4AMXA 5SX5H 1KBBA 2FDBP 4UTBL 4BFIB 4YEEA 5J12C 1G94A 5IV2A 5DJXA 4Q9BA 5A6IA 4KKCC 1XH1A 5I5IA 3HNVL 3ARXA 3WFEH 4FQQB 2OSWA 3QQ3A 3UYPA 5IJKC 1D2OA 2UZYA 3C5SA 1EAPB 2ZYSA 5JNYA 3KMDA 5B3JE 1UOVA 3QDMB 1PKOA 3ISWA 3TZVD 2P28B 4XBGA 2Y6SD 1FHGA 5SWSA 5LBSL 1PGRB 3CZSA 3MR9B 3NZUA 4UQBA 3QIBD 4FJ6A 5DJCA 3WMQA 3HC4H 2DYRB 5AFUL 5HYEA 2WGNB 4CADA 4P04A 1QTSA 2A6IB 1OAUL 5D6DC 2AJVL 2KXPB 2IH8A 3UJJL 4CU7A 1OOAA 2IXQA 3AVEA 3FMGH 1DBKH 2OMYB 3M7OA 1AOZA 3L1FA 1M7IA 4ZQTA 4ZNCD 5BS0D 3FQWB 3QUXA 4K7PY 4MVBD 2FEDD 4G82A 3LXBA 3W2DH 3BZFB 4L3EB 4A1RA 2QGBA 3QE5A 4QY8A 3INUL 3AW5A 4NGHL 5GGRB 5F9JA 3VD0A 1NZRA 1D5MA 4GRLD 4HEPA 4OLWL 3UROR 2AK4B 4F91B 3GSUB 2ZX5A 3OGCB 4N86A 3O0LA 4PRIE 3KZ8A 2E9JA 5J0BA 1MLBA 4PHXA 4LOUC 4S1RH 1DYZA 1HQRB 3G7GA 1DBAL 1U8QB 3UTOA 1KPRA 4BK5C 2IPTL 1AS7A 3K2UH 4RIRA 5ICZA 3MLVH 4LSVL 5EF2A 2QDWA 3AQXA 1RZ7H 2JLLA 4AGMA 2GTWA 4MDJA 3UGUA 2YXWA 3QEQA 1M57B 3A24A 3L3IB 4H1LB 4J3SA 1IQWH 3U6XA 4KTGA 1QLRB 4LP4A 2EH8L 2LLLA 4WEBL 5EC2B 5KS9F 4GO9A 3LPPA 2BP0A 4KO5A 4PRHD 3MJ7B 1CLZL 1LP9A 5JHLL 4Q9RL 2GG1A 2VDRB 1E5AA 3LS4L 3VE2A 5ECJE 4DOHB 1BA9A 1YPZE 4PUBH 3SKMA 3AQDA 3TFKD 3K72B 4O02L 3VQ2C 3VM5A 1I7TB 3P40A 4NZ8A 4WV1B 3FT3A 3ZTNH 2XZQH 4HUWB 3QS3A 5LDUA 1OCWH 2MIZA 3Q1SH 5H94B 3BKYL 3P4NA 2XVKA 4NO2B 4DP0X 2YN3A 1Q9KB 2MQGA 1SMAA 4QCIA 5IMOA 1UM4H 3QWRD 1Z9SB 4ZAKB 5KAQF 5L4JA 3NCJL 1A7OL 1GGIH 5ERWA 3HZKB 1U21A 1NGYB 2VZUA 2GJZB 3D33A 5CEYB 2QGDA 3QJRB 4OGXH 5KOVC 2WK2A 2VDKL 3UBXA 3NSCA 3WTTA 4GT7A 4TOYL 4FL4B 4HUNB 1PZAA 3KLQA 5T3XH 3ATDA 4NNXA 5FYKH 1D6VL 1W0VB 4X7TA 3CBRA 1WS8A 2G0LA 5AVQB 4ZXBB 5LN4A 2R88A 3FO1B 3VD5A 4H8WL 3LKSB 1H8OA 4D3CH 3S88H 1PMYA 2LR4A 5M7QA 3QRLA 4G1MB 4PCSA 3M1BA 2GSIB 4KPHH 3HMWL 1QSFA 3O9WA 1NCTA 3L5HA 5K9OA 4GS7B 1VLXA 4MX7A 1T21A 5FKAB 3IGFA 1BZEA 1ZDSA 4Y4HB 3GRBA 3RURA 4UUJB 4PBXA 2Q87A 3MLTA 1TJIL 1XBDA 2WN2A 3LZNA 2CBQA 1LWRA 3SYBA 1OPGH 1JGEA 1I8MB 5I16A 1AY1H 1FN4B 3L2MA 3WXWH 1ZHNA 1U3NA 3WJLC 1PTZA 3UZEC 1YS5A 1JSYA 2PLTA 4XVTH 2BCMA 5D2NC 1NCUA 1AE6H 1MCPL 1PLAA 3N3EA 3F12B 1GHFH 4Y9BA 4HXAL 4MZ3A 5D1XA 2V5YA 5F9WC 2GITB 4XP4L 4BFEA 4CC4C 4DWHA 1HDMB 3L4WA 4ZX4A 4O9HH 5HDBB 1WEJL 3TT3L 3OXRB 2Y36H 5AVXB 2ADFL 1AGEA 4QHNB 2FBRA 4C47A 2D3LA 4FI8A 4KK6C 4CC1A 5CS7A 3FQRA 2LFGA 5CP7B 3B9DA 5CFHA 3IDGB 2OV0A 4ZS6C 3QUHA 1CFNA 2GBAA 4DEPC 3FB5B 1PNDA 2Z7YA 4X99B 1KF9B 3US1A 2XG4B 3D3VE 4JRXE 1A1MB 3B9KA 3I6GB 3VE1A 4WJ5B 1HOCA 3CFCH 3I6KA 1HYRC 1HWGB 2LVCA 4M1DH 1KLUB 3A23A 2AJZB 1UZ6E 5DWPA 4JKPH 1MJ8H 1AHWA 4QXGH 1RZKC 2EYSB 2YZ8A 1T22A 2WD0A 4JFEB 4XPFL 4E9XA 4LP8A 3JTBA 2J21A 4QIRA 3V7AG 2VXVH 4XBPB 2PORA 3HAEH 1EQWA 1HOEA 3TH2T 1I8IA 2NY6C 4KXAA 5H2BA 5HDRA 3ZKQD 4Y16C 1C5CH 4FQLH 3MCLL 5EZLB 2JIXB 4DP7X 2F1EA 1SNRA 3HAEA 3IJEB 4N5UA 4K3BA 4R4FH 4L5FL 1MFCL 2V9TA 1Y07A 1G7PB 4M5YL 1DJYA 4FFVC 3QDJB 1EJOL 4NKDA 5DO2D 1FL3A 4HSAC 2CKNA 3WTWA 1J0JA 4Y1AD 5JHDA 4F20A 4RGOL 5MENE 3S37L 1YN7A 2X89D 3IBEA 1UD4A 4FFZL 4UINL 1BQLL 2QADB 5DFWH 1JDCA 2BIHA 1M1XA 3QEUB 4QYOB 2PKDA 2WXLA 1P1ZA 3ARGB 3REWA 1AQHA 3EO1A 2WJQA 3P1VA 4MJIB 3IF1B 4J3OF 3CZGA 4BQBA 3CJJA 2ZLDA 4HUMB 3EYVB 2VR3A 4E42B 1MSPA 1AXTL 4NQDA 4Z8FL 3VQLA 1EPFA 1JHTB 2A9ML 4QTIH 5KANI 5KVEH 3CLFL 5D1QD 5I0VA 3O2VL 1HZHH 4RSYA 4W81A 5L8LB 3WL9A 3U6RA 1WWAX 3KXFE 3E1F1 3FYXA 2B08A 2FGQX 4RSVA 2GPZA 2J57A 1J8HD 3O6FB 4OUOA 1YQVH 2EDYA 3KWWA 5AYUL 3RTQD 2IDFA 1NWOA 3W3BA 4EI5B 2YQBA 5F7YC 1LK3L 2X4TA 3IMUA 2OTUB 5HHPA 4S1QH 1KGCE 2CJTA 2IVFC 4QHPA 3W57A 5B1JC 3SE9H 3F7VB 2XWJB 3TV3H 1DLFH 3P4MA 1A8JH 5IBTH 4JHUA 4H1LG 1HAUA 1EZVX 4RMUA 3LQAL 1ETZB 1QYGH 3BLKA 3ARTA 4PS7A 4XXWC 2BNUB 3G5WA 3UZQB 5DD5H 1NAML 3QFJD 5A7BA 2JJTC 3H9SB 3ALWA 1XCXA 3GBDA 1V55B 4Y89A 3OKLB 4E9LA 3FHAA 4K9EH 5CJBA 3ZE2E 3IMWA 1OGAB 4HK3J 5F7KC 3AA6B 3B2MA 4MMXA 5CEZH 1IGIH 1QA9B 2BZCA 3PGDA 1T3FA 4XVSL 3UIZA 1JNNH 2CO6A 1UD5A 4LASL 2LQRA 4JQXC 3DX6A 2WQ8A 2I5YL 2FWUA 5D9SA 5C0BB 4L1SA 3F83A 4XP6L 3T6XA 2RMNA 4K5PA 1F3JB 2R1XA 3QNFA 1PD6A 4XRCB 3BD4A 2RR3A 4IS6B 3A22A 2Z4QB 1UWXK 2ZQKA 4PRDB 5CZXD 3EH1A 3U9WA 3LB6C 3QDGE 2R2EA 2R4SH 3AZUA 5ALCH 2GY7B 1GL4B 2ZOKB 3U0PB 4NRXA 5IIEA 3BDYH 3F8UB 1MEXH 3FQNA 3IU3B 2OR9L 2C9XA 4ZDHA 1KT2A 5DLML 1NSNH 3BXNA 4KX8A 4WW1B 1JGDA 2ZWNA 1G7JB 3ZDXB 4I48B 3PRZA 3BGFB 3NCBB 4X4ZA 3WIFB 4KQ3H 1GSMA 4G6JL 1AXSA 3IDXH 3TN0A 3VXTA 5AQ0A 1NUDA 4ZO6A 4YHNB 1OSMA 1NMAH 3CSFA 3NTCL 5AW9B 4LSRL 3QXAA 4JY4B 2HJKB 1RZJL 4MMYB 4UAOB 2DMGA 4GAGL 3E6HB 4KMQA 5AZEL 4TYUA 1H15A 4PJ9B 4ABUA 4WTZA 1TVHB 1TZAA 2G3XA 5A16B 3C60C 2JCWA 3HE7A 1FV1A 4AY0A 2Z8RA 4XNUL 1COBA 1YN6A 4AQZA 2QGEA 1S8DA 2ZKHL 3MRQB 3D39D 4TVUA 1URIA 1OK8A 1SUJA 3ATEA 1DQLH 2CHDA 5C2BL 5E6IC 5IFAL 2ZXQA 1NFDF 1QP1A 4IMKC 3E7JA 5T1DH 3V95A 4HXBL 3TU6A 1TR7A 5AD0A 4I3RL 1PCXA 5EZJB 4KKPA 1NPNA 4XGZB 1XQ4A 5TDOB 3MCKA 1WHOA 4Z18A 2JTYA 3K4DA 3QNYB 3BRYA 4WW2B 5L4MA 1EIBA 1F3DH 2BS9A 3DX7A 4OY9A 2HFFA 5T33H 1MJ7H 1XF3B 3L9RB 4LSTL 1N0XH 3BVDB 4W9CC 4Z7OF 4J6IA 4WHYG 2IGTA 4PJGB 5D71L 2A83B 1KGUA 2VDLL 1E9PB 4YGVB 4XNZC 2KKQA 3PWPE 5I1KL 4G8EB 5DRNB 4DIXA 1IBHA 1FRGH 3ULUD 2IFFH 3LKPA 2PYFA 2OMUB 3PAYA 3W5MA 4KDVA 2XWCA 5CKGA 2CR6A 4F7MA 1GFOA 1MCHA 1J8SA 3C8KA 3MA9L 2OX5A 2Q3AA 2KZWA 4KJWD 2XT1B 3MUY1 4N9GB 1I9JL 1U8IB 2UX7A 4J3TA 3QR0A 2MKLC 3PWLB 4ODWA 1GY1A 3Q5YA 3DGCR 3OV6A 4B95C 3VFPB 5J11C 3APCA 2KERA 3VWKC 4M4RA 4IJTA 4AE1A 4ICWA 5HHQA 5IEKA 1ETA1 5EUKB 2VDPL 1BFVH 2HUEA 4AK1A 4WI2A 3NAAL 3X14A 4FABH 1AZZC 1UADC 2HFEA 2EEDA 3IT8D 4KAQH 4GY4A 4XPGH 2XDHA 2W0FB 4W6XB 4Y5XB 4JFFD 5HBBA 3ME0A 1BBDH 1EX0A 1UD3A 3FO2A 3QWQB 4ZI8A 4ZMNA 5JQHC 3NSXA 4TL5A 1FZKA 5EO0A 5HGAA 5KG9A 4OV5B 4IRSB 4TNGA 3MRMA 3BYYA 3RWEA 3CC5B 3FUDA 4XNBA 5FV1L 3CHQA 2GHZA 4LL9A 2W38A 3VZWX 3E9UA 4PJ7B 2C9PA 4LSUL 2DM4A 1PKQE 2ZXGA 3POUA 1JHKH 3SDYL 4GKSB 4LQ1A 5IB3B 4YBQC 3CMOL 2EH7L 3A47A 3FB6B 5EU6E 2PYEE 2X44D 4HV8A 2EXWC 2NW2B 3TVMB 1WFTA 1G7HA 1ZD6A 3KLDA 3EDJA 4OCWL 1KIPA 1N8ZB 4ZMWA 4KI5E 3US0A 3CMGA 5D7LA 4FXGA 4AC2A 2I9TA 2IBGA 1J9RA 3EO0B 3TV8A 1HCFX 4X6CE 5B8CA 3SY0B 5ACMA 5DZAA 5FYJH 2DBLH 3CFDA 4X5QA 1KC5H 1TQSA 3K3QA 4AENA 3G5XB 4NO3A 5A2IH 3GBNL 1O7SA 1KJVA 2IGFL 3RWCB 2O5XL 3NT0A 4DO5A 3GTNA 4HFUH 4UCFA 2Y22A 5I1HL 1YMME 2V3FA 3QUZC 4XZ4A 4QO1A 3UBXI 4UBDD 2OMVB 2ZXBA 4R3SA 2EE0A 1NFDA 4JPSA 4L9DA 3SQRA 3L4CA 4AYEC 4XXWA 1UXLA 1FDLL 5FDWB 2E7LA 4BZ1A 1YNTB 4GG8B 4L4VE 4X9HA 1A7QL 5FM8A 8PRNA 5LCVH 1E8YA 1SQMA 1YJDH 4RH4A 1WJ3A 3DGDA 1I8KB 1NCBL 2RFXA 4Z7WA 3RNKB 3MGOA 1HSBB 4TULH 2D2CC 3UAQA 2VJ8A 3CVC