2W85A

Structure of pex14 in complex with pex19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE ANCHOR PROTEIN PEX14
publication title Structural Basis for Competitive Interactions of Pex14 with the Import Receptors Pex5 and Pex19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w85A00
3PFIA 4MQ9F 2Y0MA 4ZZDA 2DFIA 3CUOA 4OU0A 1FP2A 4DQ2A 4UV8A 2LSOA 3ZMUA 1PP7U 1O7FA 1R36A 3WG9A 3F22A 3F8NA 4GGGA 5J8CA 5JI6A 2Q0OA 3RIRA 1TQPA 2L54A 2M5WA 4G7HF 1EH6A 1V3FA 2GWRA 3FMQA 3QP5A 3TO6A 4Q5SF 4L5IA 2OBPA 2W84A 3KP4A 2ZNZA 3LWFA 3V8JA 1XMAA 2LDUA 3RTRA 1F4KA 3V8LA 4K2EA 1MD0A 4XBFA 4CXFA 1G4DA 1ZARA 3FMSA 4HOBA 4EGZA 4LG0B 1FBQA 4JK1X 3DPLC 2ZNYA 1TNSA 4I0BA 4M9ZA 1L0OC 2K02A 1MZBA 1J5YA 1AOYA 2H6BA 2VXZA 2ZO4A 4IJAA 3V8KA 3G73A 2CW0F 2STTA 4KIBA 2ZJ2A 1IXRC 2EB7A 2EV5A 3D5LA 1EH8A 3TQNA 4HDVA 5JHUA 3NRVA 1P6RA 4AWXB 2EV6A 4L9NA 5IT3A 4G6DA 2QVOA 4BAYA 1XDUA 1HSJA 3HRTA 1QBJA 3F8FA 2NYXA 4YIIA 3ELKA 1J75A 2QZ8A 4UV9A 3CJNA 3GFLA 3HSFA 3BP8A 3MQ0A 2L01A 3WE2A 3MZHA 1Z91A 3M8FA 2A69F 3L00A 1Z05A 5EEGA 2DT5A 5ICFA 4G94A 3HUGA 1MDMB 3RKYA 3L2CA 2RDPA 3WTYC 3C18A 3JSPA 1BI0A 1XDSA 4RGXA 4L9TA 2VN2A 1TTYA 2MH9A 3E5XA 1J0RA 4RGUA 4Z2YA 4A0ZA 1T39A 4R8HA 1UHMA 5FB2A 3C1DA 4HX4A 3U1DA 4AIKA 5E8GA 2XGXA 4IXAA 1YYVA 3DF8A 4IVNA 2BE5F 4ESJA 3LAJA 2WTEA 3JSOA 2JT1A 3MEXA 1UHWA 4L5JA 1S7OA 2YX7A 2BV6A 1K78A 3VFZA 1W7PB 2FQ3A 2XHKA 1R23A 2L3DA 2GXBA 2V9VA 5LGTA 3R6SA 3KETA 1WSUA 4ZZLA 4KICA 2JPBA 1FX7A 2HQNA 3BPVA 4UHTA 4Q4ZF 4CO8A 1ZRDA 3ABUA 1KYZA 5HDGA 4KN7X 1R1TA 5HS7A 3CUQB 1LJ9A 2OU2A 2PBIA 3TDZC 2RN7A 3U2RA 1D8JA 4RB0A 2DQRA 2GQQA 1U8RA 4EJTA 3SHFA 1SMTA 2D2WA 2M8EA 2A3SA 4HV5A 3BWGA 3TOBA 3ULQB 2E1NA 1PP8F 4YIFA 1D5VA 1SFUA 4Y13A 3I0TA 1Y0UA 3RPQA 2VOOA 3L09A 3W6KB 4ON0A 1T98A 2KRFA 4G6QA 1DPUA 2MH2A 1YIOA 2E7XA 3QU3A 1C0WA 2DU9A 2V1XA 3SQNA 2DI3A 3B02A 2P5KA 2UXNA 1K7AA 2PJPA 4R1HA 5H6QA 2CWEA 2L02A 5L3EA 1HW5A 1UB9A 4HV6A 4L0YB 2F5CA 2FOKA 2L4AA 3FXUA 4WXDA 3QAHA 2FMYA 1G3YA 4WX9A 2OQGA 1PUEE 1GXPA 1R1UA 3ML6A 1FBSA 3IC7A 1R7JA 4CDGA 3ZQ7A 1OR7A 2ETHA 3FXRA 3EDPA 3KFWX 1ZGJA 2JSCA 4F7ZA 3DPTA 1FOKA 3SFZA 1KQ8A 1IW7F 2Z9OA 2A6HF 6PAXA 3W6JB 1VTNC 1SMYF 4GCVA 2H94A 3MCZA 4ENKA 1KU3A 1B4AA 3VEPA 1Z9CA 1W4MA 1P92A 1H0MA 5HLHA 1USSA 2RKHA 1S6LA 2XROA 4MHGA 1IUYA 4H0EA 2QBYB 1R22A 3T8RA 2P6TA 3T5XA 2IW5A 3FZVA 4YFNF 3ECHA 1UFMA 4BNCA 1IN6A 1CF7A 2HDCA 1W7PD 4A12A 3WTUC 4HZFA 4KMFA 2R7FA 2ZKZA 1USTA 4LD5A 5AIPA 4PGGA 4G8XA 3WODF 3QRFF 2RGVA 2XV4S 2F5EA 3K0LA 3O2PE 4O5VA 1P4WA 3ROUA 5D8KB 2M87A 4M72A 4HBLA 5TJJA 4RGSA 1BIAA 2EFOA 2J5PA 5DD4A 1WI9A 1EH7A 1XGMA 5HS8A 5FFZA 2QQBA 2EV0A 4LFUA 1ZREA 2PQ8A 4HAMA 2EA4A 3GUDA 2P7VB 2IA1A 3H3ZA 5CVIA 1WRJA 3DV8A 2G9WA 1LEBA 1B9NA 4O6JA 2PG4A 3TO9A 3K2ZA 2ZCWA 5HLIA 2FXAA 2GIVA 3KLNA 5LEKA 1E17A 3H3UA 5ILVA 3RDIA 4QLCU 5CVVA 2D45A 3F8CA 1HQCA 3S2WA 1FYKA 4A6EA 2HS5A 2COMA 2HTSA 3H92A 2W24A 5LHGA 2MD5A 1BI1A 3F72A 1STZA 3I71A 1YS7A 4LB6B 1I27A 1H9TA 2PMUA 4EJUA 1HBXG 1ZH5A 4BQAA 1S3JA 3F8MA 4ZYEA 3WE3A 3ZPLA 1Z7UA 1MJBA 2HQRA 2QBYA 2BEOA 2NNYA 3EYIA 1GHCA 4CHUA 3HOSA 1B1BA 1FSHA 2RQPA 1O57A 2ZMEB 3K1PA 2JTVA 2XKPA 3ZN1A 4LLNA 2DAOA 4AIHA 5ICGA 1IN4A 4JBAA 3RJPA 2O6GE 4WXCA 2HKXA 1FYLA 1XGSA 1RUNA 4HQMA 4HQEA 2HEOA 4D0PA 1S29A 5L3GA 3WTZA 2FBHA 2J5OA 3E5QA 2EWNA 1IN7A 3WTSC 5JFRA 5E1ZB 3HHGA 4ENJA 3Q9VA 1I6XA 4RB3C 2D1HA 5FD6A 5HLGA 5JR3A 2YR2A 2XAQA 3O6BB 1K6OA 1U2WA 4MTDA 4L9VA 2LKPA 4RGRA 1YS6A 1XGNA 1YLFA 4ESBA 1YW9A 2IVMA 2Z99A 3P9IA 2K7LA 3BZ6A 5BPIA 3GZ5A 3G3ZA 5IT9Z 1S8NA 1B6AA 2BYVE 4Q48A 2OA4A 3I64A 2BGCA 2NS0A 2F5FA 3VOEA 2WV0A 4KDPA 3JW4A 3COAC 1O3RA 1RZ4A 1E2XA 2RVCA 3DKWA 4N9HA 4WCGA 1KU7A 5D5WB 1R5HA 4HF1A 1RI7A 4Y15A 5D4RA 1JHHA 2F5DA 1DUXC 2HGCA 2QENA 4UUVA 4WWCA 2EFQA 3V4GA 1FP1D 2YX4A 4A5NA 4ESFA 2A61A 5E17F 1BJAA 1YW7A 5DCFA 1SD5A 3IRQA 3KP2A 4U88A 1Z6RA 3HHHA 1FT9A 1I1SA 3GX4X 1SFEA 1JXSA 1Q1HA 3DEUA 2QYOA 1IXSB 2W57A 3M9AA 2VBZA 2ZXJA 3HOTA 1QNTA 4PDKA 4PZJA 5KK1A 2DO7A 1ON2A 3WGIA 3E6DA 4BXUA 3IKVA 2LNBA 1J2XA 1ODDA 5D5UB 4BHCA 1ZRCA 4HF2A 4M6XA 4UVBA 1D8KA 3HSRA 4XRFA 3CO7C 4A0XA 5IT9K 4UXNA 1RNLA 2NRAC 4ZYGA 1ZG1A 2M1BA 4EGYA 2H27A 4EV0A 1ZYRF 1OYWA 2DQLA 5LBQA 4ENMA 3RPUA 2DW4A 3ZP5A 5K5OA 2IT0A 4L0ZB 2E7WA 2VC0A 2D1VA 3P9KA 4IHSA 1J7KA 4I7HA 3MFKA 3L9FA 4UNOA 4FHTA 1EV7A 2XAFA 2STWA 4EM0B 3E6MA 4BHBA 3T0YA 2FMLA 1RIOH 3F23A 3M1EA 3J7AO 3J80Z 2K27A 1OPCA 1P2FA 4LG0A 2HKOA 3NEUA 5LEJA 3DFGA 3PQJA 3JTHA 2Y75A 4P9FA 3GFIA 4FT8A 3C3WA 5A2QZ 4KYWA 1XSVA 2FRHA 3FF5A 2HYGD 4A2UA 5F6FA 1FWZA 4CGZA 1OKRA 2KIUA 3KLOA 4MEXF 3WGGA 2CGPA 1BIBA 3I58A 1ZG3A 3I59B 3TO7A 3GFMA 3GZ6A 4CICA 1IAWA 4YFKF 4HF0A 4UVCA 3F6VA 5ICCA 3REOA 3GLXA 2VONA 1HKQA 4FX0A 4RS8A 3PQKA 2K4JA 1BI3A 1ULYA 3F3XA 2PI0A 5D6FA 2VODA 3I4PA 4XLNF 2PFBA 1FLIA 3HSEA 2YPRA 3V7RA 2PMHA 1MDMA 1KQ0A 2OQRA 1ZLJA 4EVIA 3WU0A 1R1VA 4B8XA 3QOPA 1GXQA 5LHHA 4LK1F 2EA2A 4G7ZF 1BBYA 3GF2A 2V79A 2TDXA 1MJAA 5D8LB 3LA7A 2P8TA 1BI2A 5DV5A 1LDJA 1LDDA 3BJOA 5HOOA 4EM2A 3IHUA 5LRSA 3ZN0A 5D4SA 1ONVA 3J80K 5K5RA 2A07F 4GO1A 2GZWA 4I0AA 1TQIA 2P4WA 1SAXA 2O8XA 1WQ2A 3GVAA 5F64A 4HYEA 4XSZF 1KQ9A 5D5VB 3KP6A 1K79A 3LA3A 1UCRA 1SD6A 1W7PA 1ZGAA 1Z6TA 2CYYA 1FPQA 2NAZA 2GXGA 3LQQA 3IL2A 4M74A 5A2QK 4O3MA 3ZMZA 1A04A 3SZTA 2VOPA 3EETA 1KGSA 4E70A 4CYDA 3E6BA 2RC4A 3KEQA 3J81K 4LGWA 5J8FA 2QQ9A 2RV8A 2OZUA 2BBYA 3SZPA 2VE9A 2XAHA 1QGPA 5E1XA 2P6SA 2Z3YA 3V7SA 3VB2A 1HSTA 3EYYA 3CUQA 2QQAA 5E8IA 4ASNA 1YQAA 3CLOA 2XIGA 1OYIA 2O3FA 3N97A 2JZYA 3QU6A 3WGHA 4I09A 3BJAA 1FSEA 2Y48A 2PN6A 1ZN2A 4ZYDA 2UZKA 2KIFA 4HX7A 1KA8A 3I59A 5D5XB 5D6EA 3KCCA 4KNYA 1CGPA 2OAZA 2MLGA 2OD5A 4L18B 2FNAA 3RKWA 2MLKA 3LSTA 1U3EM 1MJ9A 4HA8A 5DCMB 2CSOA 4M6YA 1I5ZA 3SXYA 4A0YA 4OIOF 3R60A 2G7UA 3BY6A 5FD5A 4MQVA 3LAPA 1V4RA 1LNWA 1YTYA 4P96A 5CVUA 5BS6A 3OOPA 2R7DA 1O3TA 4EJWA 5E20A 3M8EA 2DK5A 2IRFG 3MZYA 3GXOA 5HDKA 1T6SA 3O3KA 3ISPA 1B9MA 2A5YB 1O3SA 1ZAOA 2GAUA 2LF7A 1OYYA 4MNUA 4EM1A 2EFNA 1HKTA 4U7DA 3B73A 3OV8A 4I2OA 4HDUA 5E18F 4OMYA 1IN8A 2L4MA 1G3SA 5BMZA 4IRGA 3I5UA 4IHTA 2QM3A 5HDNA 5K1YA 3JTGA 2M30A 4I02A 2NNNA 4PGHA 5LHIA 2FU4A 1R5GA 5EEHA 2CQKA 1U78A 1U5TB 2O0YA 2VT3A 3ZMSA 3RI4A 2DLLA 4JQFA 2KIMA 4ZH4F 1YW8A 4DNCA 1T2KA 2DTRA 2HZTA 1O7LA 3KE2A 1MGTA 1BN5A 1FZPB 1DDNA 4YG2F 4S04A 4FX4A 3HRSA 4BYYA 2FE3A 1B59A 1ZRFA 3BJ6A 2KKOA 5TRDA 2HYFA 5L3FA 4KMUX 4HLYA 3U9GA 2ZBKA 3K1NA 1NHAA 1TBXA 4NQWA 4GXOA 3I53A 3R0AA 5LRRA 1DP7P 1G3WA 4P55A 2H09A 3LFKA 1WKMA 3V7CA 3JAMZ 2Z5UA 5DCMA 3KEOA 2XRNA 2E1CA 5AONA 4KIGA 4EQQA 1XN7A 2UXXA 2DPUA 3EQLF 3K1MA 3DQVC 5BQTA 1J9IA 3QP6A 4N9IA 1G6NA 1P4AA 2WC2A 5FLXK 2XAGA 2FBIA 3GEZA 2QWWA 2IJLA 4ZYHA 3WTWC 2PEXA 4LLLA 1TQMA 1LVAA 1K78B 3EUHA 3CUQC 3Q9SA 3FX3A 5H6RA 4U0YA 1MKMA 1AWCA 2XAJA 2PLYA 3K9TA 3DXJF 4RB1A 3R4KA 1OMIA 1TLHB 5FGMA 4P5OA 4GYIA 2IA2A 2DBBA 2O61A 4IPAA 5JVTA 5CJ9A 4M9SA 4I98B 4AVPA 2P5LC 1U5TA 2F2EA 3ERED 4WK8F 1KU2A 2HWVA 2ZMEA 4UVAA 1YO5C 2K86A 4NHJA 4RAZA 4M73A 3FMRA 2O03A 1IXCA 5K5QA 4NB5A 3R0JA 4AD9A 5DEQA 4MEYF 3IWZA 1S7AA 2AXLA 2MA3A 1YG2A 4LB5A 2R3SA 4U7BA 1PDNC 3JAMK 1W5SA 4KUMA 5BPDA 1Z1DA 5DUKA 1QZYA 1FBUA 3K69A 4BH9A 2ISZA 2FSWA 1FNNA 4A5MA 3FXQA 4LJZF 4LK0F 4Q47A 3KP7A 5ILUA 2VBWA 4BHPA 4OIQF 4GYGA 1QZZA 3FM5A 3TGNA 4AIJA 1FYMA 1REPC 4RB2C 2IA0A 2EFWA 5DUIA 2RNJA 4CZZA 3FWEA 1XB4A 2FBKA 3ECOA 3BPXA 3F8BA 5HS9A 2LF8A 4M71A 3QPHA 3P9CA 4R79A 1QPMA 1XCBA 2QUFA 3E3VA 3CDHA 4EJOA 3BOQA 3D0SA 4I01A 3RKXA 1ON1A 2MBFA 4U0WA 1U6GA 3WTTC 1R58A 4RAYA 1IF1A 1YFHA 2V1UA 4OINF 1H9GA 3M7GA 1BC8C 3BROA 2VBXA 1F5TA 2HOEA 4L9JA 3DP7A 1HW1A 1X3UA 4U0VA 1QQIA 3P7NA 5L3DA 3IRRA 3J81Z 2KJBA 2CG4A 1CF7B 3E97A 5DDGA 1BOAA 2KJCA 1SD4A 4S05A 2IPQX 5ICEA 3HRUA 3HYIA 4EJVA 3HTUA 5ED4A 1IZ1A 3E5UA 3E6CC 4WF2A 3GYHX 3LQRA 4KFCA 4IRIA 2WWYA 1TW3A 2ADUA 2B0LA 4N0BA 2VE8A 2H6CA 2V1DA 1O3QA 2FF4A 4P9UA 1IRGA 4XLPF 1D3YA 4ENNA 5LGNA 3CTAA 1JHFA 1W5TA 2JRTA 1HKSA 3AAFA 1XD7A 3KP5A 3WU1B 3ZMTA 5LGUA 1F1ZA 3Q5FA 1T38A 4G9YA 2W85A 4KN4X 5E1WA 2HTJA 3MWMA 4KIFA 2HR3A 1U5TC 2FNPA 3GO5A 2P5VA 1DPRA 5J6XA 3IWFA 2QLZA 4XSXF 3F21A 1T0FA 2ELHA 1LEAA 2IP2A 2YU3A 2DPDA 1KYWA 1TW2A 5H20A 2GA2A 4HW0A 3HRMA 2Q2EA 3CO6C 1FY7A 1ZLKA 3KZZA 4M9XA 3C7JA 1R00A 2FA5A 4IRHA 2EFPA 3FM3A 2EJRA 3WTXC 3TDUC 2ESNA 3IKTA 4KT5C 4PCQA 5FO5A 5ERIA 4OIRF 4OIPF 2VT2A 1JGSA 3GFJA 4Y17A 5CYVA 3RYRA 1HW2A 1WWXA 4MTEA 2VC1A 1LDKB 2W25A 4QWQA 3HIFA 2X0LA 2HFHA 4HX8A 5AIQA 3VODA 4OOIA 1P4XA 1XSXA 3T1BA 5ILSA 2A6EF 1XGOA 1SFXA 1QO0D 1TNTA 1FC3A 4MGRA 3TOAA 2OZ6A 3GW2A 2ISYA 1RUOA 5FFXA 5L3CA 2AS5F 3ZMDA 3QPTA 3T8TA 2EK5A 5LLQA 1SD7A 1JE8A 4LLGF 1KU9A 2DK8A 3L7WA 3BDDA 3R61A 1LQ1A 4G7OF 3F6OA 1HXDA 3RYPA 1L3LA 1BC7C 1LB2A 5KVRA 4A6DA 2Z33A 5DD8A 2UWMA 4EMSA 1G3TA 4HLXA 4OMZA 2MC3A 2ZFWA 2CO5A 2VBYA 5BOXA 5CVRA 3ZMVA 2XUBA 4ETSA 1J59A 5FLXZ 3FHZA 5L3BA 2A68F 3I54A 3HTSB 1ZHFA 3GWZA 3ABTA 4B09A 5HVQC 1IRFA 2JPCA 2M45A 4TV7A 2YSRA 2Q8KA 1F9NA 5CVJA 1XSDA 5CLSA 3N4MA 4IF4A 2P7CB 3TKYA 2XKOA 2FEZA 3NQOA 4KA4A 3KZYA 3KP3A 2CFXA 3WTVC 2V6CA 1GVJA 5DYMA 3LA2A 4YFXF 3MAJA 2G7HA 1I1GA 2ACJA 2C6YA 2XASA 2XVCA 4WXHA 4LMYA 5F1RA 2ESHA 1BM9A 1XCVA 2GA1A 2K4BA 2X4HA 1ZG5A 1XMKA 1IN5A
chains in the Genus database with same CATH superfamily
3PFIA 2IS1A 4MQ9F 2Y0MA 4ZZDA 1W5CC 2DFIA 3CUOA 4OU0A 1FP2A 4DQ2A 2VQLA 1UMQA 4UV8A 2LSOA 3ZMUA 1AA7A 3ZRGA 2JVHA 1PP7U 3ABLH 1O7FA 1R36A 3WG9A 1CQTA 3F22A 1JJ6C 3F8NA 4GGGA 2VPRA 2HOTA 1P9QC 3CCQI 5J8CA 3OYEA 4V2GA 5JI6A 1YHQI 2Q0OA 3RIRA 1TQPA 2R0QC 2L54A 1T0FC 2M5WA 1TT0A 4HG2A 4G7HF 1EH6A 1V3FA 2GWRA 3HPHA 2DA6A 3FMQA 1S5LC 1LFPA 1D5YA 3QP5A 3TO6A 1B72B 1SVMA 3CQZJ 4FQGA 4Q5SF 4L5IA 2OBPA 2W84A 3KP4A 2XF6A 2ZNZA 3ONQA 3LWFA 4XLAA 1XMAA 3V8JA 5EJCA 3OL3A 2LDUA 2DFFA 3RTRA 4BDYA 3CMYA 4C2UA 1F4KA 3V8LA 2L5QA 4K2EA 1MD0A 1SAUA 4XBFA 2L2OA 4IOCF 3HOZJ 1DP3A 4CXFA 3G1LA 4RAGA 3J7YJ 1G4DA 1ZARA 4M3BA 3FMSA 3OYJA 4HOBA 4EGZA 4LG0B 1FBQA 4JK1X 4RAFA 3FKJA 4XR6A 1R49A 4LITA 3DPLC 2ZNYA 1TNSA 1TWAJ 4I0BA 4M9ZA 1L0OC 2K02A 1MZBA 1J5YA 3J7AY 2M3AA 3JRIA 2HDWA 1AOYA 2H6BA 2XF5A 4W1UA 2VXZA 4ABZA 2CQ7A 4F92B 2ZO4A 4IJAA 3V8KA 3ZCOA 2BY2A 3G73A 2CW0F 2STTA 5KAIC 4KIBA 3ZXSA 2LRDA 1IXRC 2EB7A 2ZJ2A 1TWCJ 2EV5A 3D5LA 3FBNB 5IOZA 1EH8A 3TQNA 4LIUA 2MC4A 4HDVA 2IAIA 5JHUA 3NRVA 1P6RA 1EF4A 4AWXB 2EV6A 2ZXIA 3G2BA 4MIMA 3NWSA 4L9NA 2GXAA 1Z21A 4UUSB 1V5FA 5IT3A 1W1WE 2DN0A 1FOYA 2FJ1A 5EGOA 4G6DA 3I56I 2EZIA 1X1CA 2QVOA 4BAYA 1ZK8A 1VQ6I 4JOMA 2JA6J 3IP4B 1XDUA 1HSJA 4ZJZA 1MH3A 3HRTA 1QBJA 3F8FA 2NYXA 4YIIA 3ELKA 3PSIA 1W36C 3BR1A 1J75A 1E0EA 3BG7A 3FXKA 2X1CA 2QZ8A 4UV9A 3TMOA 2OV7A 3S32A 3TP3A 3CJNA 4E4HA 3GFLA 1K83J 3HSFA 3TEDA 3BP8A 3MQ0A 2L01A 1JKRC 3WE2A 3NAUA 3MZHA 1Z91A 3M8FA 2A69F 3L00A 2ELKA 1Z05A 2EQRA 5EEGA 2DT5A 5ICFA 1WCMJ 1WJEA 4G94A 3HUGA 2Y31A 4B3AA 1MDMB 3RKYA 2WA0A 2R93J 3L2CA 2GBYA 1OCOH 5EEAA 2RDPA 3WTYC 3C18A 3JSPA 1BI0A 4DZPA 1XDSA 1MNDA 1D0XA 4RGXA 3W2WA 4RMNA 1WJDA 4L9TA 1UELB 4DBRA 2VN2A 1TTYA 1OLTA 5EG0A 2MH9A 1MSFC 3E5XA 5GPCA 1J0RA 4N4NB 3EUKL 4RGUA 5GPAA 2CH0A 4BQNA 4Z2YA 4A0ZA 1T39A 4R8HA 4F91B 1UHMA 3AKZA 5FB2A 3C1DA 2OC6A 4HX4A 3FXJA 2EH3A 3K70C 3U1DA 1X2MA 5E8GA 4AIKA 2BVMA 2XGXA 1HCRA 2WAQA 4IXAA 1IC8A 1YYVA 2CW8A 3DF8A 3KYDB 4IVNA 2BE5F 3BCBA 4NC7A 4ESJA 3LAJA 4QTRA 4II3A 1OCTC 2WTEA 3JSOA 4NNJA 3BR5A 3I3LA 4D5CA 3SJMA 2JT1A 3O8HA 4UB8C 5E3LA 2KP6A 1UHWA 3MEXA 3HEFA 1ERDA 1MBKA 5TISC 1PUFA 4BU2A 4L5JA 1S7OA 2YX7A 2PMZA 2BV6A 2VJIA 3L2WA 1BW6A 4XOTA 3ZGKA 2BXYA 1K78A 3VFZA 2MGQA 2CV1A 2GLOA 1JJ8C 1KZHA 1W7PB 2WB1A 2F5VA 2FQ3A 2XHKA 1R23A 2L3DA 2GXBA 3HXLA 2V9VA 5LGTA 3R6SA 3RPUD 3S17J 3KETA 1WSUA 4ZZLA 4RM2A 2NOGA 5FKMA 2A5WA 4KICA 2JPBA 1FX7A 2MW8A 4Y52J 2HQNA 2I10A 2IGNA 2DA4A 4E7LA 3BPVA 1EJ9A 3DTEA 2XDVA 4UHTA 3H36A 3L2UA 1VQMI 3AFHA 4Q4ZF 4XN3A 3F9KA 3DLAA 2HQAA 4CO8A 4C2TA 2HOAA 1ZRDA 3ABUA 1KYZA 5HDGA 1AHDP 1XG1A 2VQGA 1OCCH 4KN7X 1R1TA 3CCLI 1GT0C 5HS7A 1EA3A 3JCUC 3CUQB 1LJ9A 2OU2A 2PBIA 3TDZC 2NVTJ 2YU9J 4J19A 2RN7A 2F6CA 3U2RA 2V1NA 1D8JA 4RB0A 3CP8A 2DQRA 2GQQA 1YI2I 1U8RA 4EJTA 3SHFA 1LVKA 5FROA 3G6EI 1SMTA 2D2WA 2M8EA 4OAZA 3A01B 2A3SA 4HV5A 3BWGA 3TOBA 3ULQB 1D0YA 3MN2A 3ASOH 3OY9A 2E1NA 4BJTA 1PP8F 4YIFA 1TC3C 3C2BA 3OIPA 2RNGA 1D5VA 2HVRA 3FBIB 3D1NI 1SFUA 2JJ7A 4Y13A 3I0TA 1W0TA 1Y0UA 3RPQA 3SEZA 2DA2A 1MMAA 2VOOA 3L09A 2HXOA 3W6KB 4ON0A 2VJ5A 1T98A 2KRFA 2XAUA 4G6QA 1MMSA 2MH2A 1YIOA 4C3JJ 1DPUA 2E7XA 3QU3A 1C0WA 2DU9A 4XM3A 2V1XA 3SQNA 2DI3A 5B3SH 3B02A 2UXNA 2P5KA 5E79C 1X1PA 1R4MB 1ETKA 2E1OA 1RR7A 1K7AA 3V42A 2XC7A 2PJPA 4R1HA 5H6QA 2CWEA 2L02A 5L3EA 1HW5A 1UB9A 4HV6A 2CJJA 4L0YB 2F5CA 2FOKA 2L4AA 3FXUA 4WXDA 3WHBA 3PIPF 1VQ9I 3QAHA 2FMYA 1G3YA 3L2QA 4B43A 4WX9A 2OQGA 1PUEE 1GXPA 1R1UA 2I5UA 4IX7A 3ML6A 3VSLA 2OTJI 1FBSA 3PL8A 3IC7A 4M3FA 2KDZA 2Z1DA 4P1WA 1R7JA 4CDGA 3ZQ7A 4QPQA 1OR7A 2ETHA 3FXRA 4HRIA 4A3CJ 3VYUB 3EDPA 2R7ZJ 3KFWX 1ZGJA 1QU3A 2JSCA 3DWLE 2ZB9A 3FHNA 1R9TJ 4BQQA 4F7ZA 1MH4A 4A3JJ 2VI6A 2Y9ZA 4DIQA 1DGWY 3DPTA 4IKFA 2R7TA 1FOKA 3SFZA 1ZELA 1KQ8A 1IW7F 2Z9OA 1RESA 2A6HF 4UB6C 6PAXA 3W6JB 1VTNC 1SMYF 4GCVA 2H94A 2EIJH 3MCZA 4ENKA 1KU3A 1B4AA 1GV2A 1YRNB 2WADA 1RPWA 3VEPA 1Z9CA 1W4MA 3PO2J 5EF6A 2E36A 1R4NB 3VWBA 1GUUA 4KJZA 1P92A 1H0MA 5HLHA 2B63J 3M4OJ 1XX5A 2X6WA 2KLOA 1USSA 2RKHA 4S0HB 4Y7NJ 1I3QJ 1S6LA 2LMDA 1YE9A 3OMYA 2XROA 3Q3SA 4MHGA 2E19A 5GP9A 1MW7A 2VL8A 4H0EA 1IUYA 5IYDJ 4F93B 2QBYB 1A6QA 2LKXA 1BR1A 2E5NA 1R22A 2FQ4A 5F0HA 1VI0A 3T8RA 2P6TA 3T5XA 2IW5A 2AQEA 3SDBA 3H5AA 1JUMA 2BZTA 4BEHB 1JT0A 1GDTA 3FZVA 4X0GA 3VYTB 2WAFA 2QKMB 4YFNF 3ECHA 1UFMA 2UV1A 1U9NA 1RKWA 5IY5H 4BNCA 1LFBA 1IN6A 1CF7A 2HDCA 1W7PD 4A12A 3WTUC 4HZFA 2BY1A 2ID6A 4AVZA 2VASA 1YITI 4KMFA 2WAEA 3LSHA 2R7FA 2ZKZA 1USTA 4LD5A 5F0CA 3OYGA 2Y2ZA 5AIPA 2IGOA 3A01A 2D5VA 4PGGA 4G8XA 1SFKA 3M07A 3N05A 3WODF 3QRFF 1RRJA 2RGVA 3S14J 1ETVA 2XV4S 4GRIA 3S93A 5FRNA 4JP0A 1N78A 4NBQA 2F5EA 2O5RA 3K0LA 1YOVB 3O2PE 1MNMC 4O5VA 4AC0A 5JHFA 1P4WA 4NQWB 3ROUA 3AG2H 5D8KB 2M87A 4M72A 2DFEA 2LBFB 2KRHA 2HPMA 4JYKA 4HBLA 2DTZA 3DEEA 1WJBA 2VLAA 2BHYA 2GIZA 5TJJA 3KX2A 4RGSA 4E7SA 1BIAA 2DDBA 2EFOA 2J5PA 1IUFA 5DD4A 1WI9A 1EH7A 3PNYA 2E35A 1XGMA 5F04A 5HS8A 5FFZA 2QQBA 3A02A 5HNFA 2EV0A 4LFUA 1ZREA 2PQ8A 2X1DA 4HAMA 3HKZA 2EA4A 4XMYA 3GUDA 3DTKA 2L9VA 3VPRA 2JA8J 4ZDOA 1SC7A 2P7VB 3RZOJ 3ZQQA 4BJ6C 2IA1A 3H3ZA 5CVIA 2WY8Q 2HU9A 1WRJA 1JGGA 3DV8A 4Y3OA 2G9WA 2H8WA 1OCRH 5B5EC 1HC8A 4F52A 3MKWB 1B9NA 1LEBA 4O6JA 2VQHA 3BG3A 2PG4A 3TO9A 3K2ZA 2ZCWA 4KITB 3TBIA 1E3OC 1IV8A 5HLIA 2FXAA 2GIVA 1WJAA 1Y8RB 3KLNA 5LEKA 2CV0A 1E17A 2KT0A 3H3UA 3PM1A 5ILVA 3RDIA 4QLCU 2R5ZB 1PJRA 1OJLA 5CVVA 1SANA 2D45A 2LG4A 2M8GX 3F8CA 1HQCA 1UG2A 3S2WA 3UR3C 1FYKA 4GFBA 3ZQLA 4A6EA 1VNDA 2HS5A 1N75A 2COMA 4A3KJ 4V2FA 1LUJB 2HTSA 2KZVA 3H5RA 3H92A 4IEJA 2CS3A 3H3VK 2LYCA 2W24A 5LHGA 5M3FJ 2MD5A 3NWTA 2K9MA 1BI1A 3F72A 3L2VA 4A3FJ 1STZA 3I71A 1YS7A 4BJ5C 4AUXA 4LB6B 1I27A 1LPQA 4E7IA 3H35A 1H9TA 2PMUA 4EJUA 1QVTA 1HBXG 1ZH5A 4BQAA 1S3JA 3CZ6A 3F8MA 1ITYA 4ZYEA 1VQLI 3WE3A 4X1EA 2L9NA 2M4GA 1Z7UA 5K7ZA 1O4XA 3ZPLA 1MJBA 4JX6A 2HQRA 2QBYA 1JKQC 2KIQA 2P0WA 2BEOA 2NNYA 3EYIA 1GHCA 2DA5A 5F08A 4CHUA 4A3BJ 2K9SA 3H0GJ 3HOSA 2VXDA 1B1BA 1FSHA 5CPRB 4HNTA 2RQPA 1O57A 2ZMEB 1N77A 3K1PA 3K4MA 2JTVA 2XKPA 3ZN1A 4LLNA 1ETYA 2TCTA 2V4JC 2YUSA 3QYFA 4HPQA 3OOUA 1SVLA 2DAOA 4AIHA 2ECCA 5ICGA 1IN4A 4JBAA 4E7HA 3RJPA 3A0HC 3HC7A 2O6GE 3BQYA 4WXCA 1Q1VA 2HKXA 3VYRB 1FIAA 1ZGWA 2JMWA 1FYLA 1D1AA 1XGSA 1RUNA 1E3PA 1QHHD 4HQMA 5KNLA 4A3MJ 1F36A 1RETA 2NVXJ 3QPSA 3S3NA 3QODA 2R7XA 4HQEA 2HEOA 4D0PA 3IV5A 5F1JA 1X58A 1S29A 4A3IJ 2LK2A 2RQQA 2ZFUA 5L3GA 3OL4A 3WTZA 3PIOF 2FBHA 2J5OA 4PJJA 4XOPA 3FDYA 1OR7C 4PFOA 3E5QA 2EWNA 1IN7A 3WTSC 5IP9J 2ID3A 3CMAI 5JFRA 3ZQCA 2M34A 5E1ZB 3HHGA 4ENJA 3Q9VA 1I6XA 5TGTA 4PJNA 4RB3C 1DQUA 2D1HA 5FD6A 1MNEA 5HLGA 1NTCA 1A6IA 2E1MB 2LBFA 5JR3A 2LTPA 2YR2A 2XAQA 1EKEA 2KRCA 3TL4X 2M2EA 3O6BB 1K6OA 1U2WA 3GTQJ 4MTDA 4ITVA 1JUSA 1FTTA 5KAFC 4L9VA 1DGRM 2LKPA 3LNQA 3OSFA 5M5WJ 4RGRA 1XGNA 1YLFA 1YS6A 4ESBA 3G4SI 1YW9A 4DYRA 2DA3A 2IVMA 2Z99A 3P9IA 2K7LA 4M3GA 4PSWA 1K4SA 2X51A 3BZ6A 5BPIA 2V7FA 3GZ5A 3G3ZA 3GBGA 4XKCA 5IT9Z 5IP6A 1S8NA 3DKYA 1B6AA 2BYVE 4Q48A 1WZ2A 4AIDA 2OA4A 2QSFX 3K2AA 3U1KA 3I64A 2H1KA 2BGCA 3DCFA 3DBHB 2JA7J 2K3PA 2NOJB 4E7KA 2KZGA 2NS0A 2FOWA 2F5FA 3VOEA 2WV0A 5M5YJ 2IGKA 3E0JB 4KDPA 3ABMH 3JW4A 3COAC 5HNHA 4OAYA 1XTAA 3CCJI 1O3RA 3BT9A 4EEFG 1RZ4A 1E2XA 3PSFA 2RVCA 2ZXHA 3DKWA 4N9HA 4WCGA 1KU7A 5M5XJ 4IQ4A 5D5WB 1R5HA 4KISA 2BW3B 3G1OA 4HF1A 2LY1A 4QIWN 2QQ8A 1RI7A 3RZDJ 4Y15A 3DPUA 5D4RA 1JHHA 3HDDA 2F5DA 3OYKA 2DMNA 4PFPA 1DUXC 2X6OA 2HGCA 2QENA 2PJRB 3BR2A 1FMWA 2W82A 4XKBA 4UUVA 4WWCA 3BQZA 5F27A 2ZJRF 2EFQA 3V4GA 1FP1D 2YX4A 5E3NA 4A5NA 2DJIA 4ESFA 2NS7A 3GTJJ 2A61A 4NDLA 4YELA 1LE8B 4G6TB 1Y1VJ 3S1NJ 5E17F 1BJAA 1YW7A 3S1RJ 5DCFA 2E2HJ 3QQAA 2HVQA 2OUMA 1SD5A 3LSGA 3IRQA 3KP2A 4U88A 3A4CA 1Z6RA 4OWRB 3HHHA 3JRFA 4XL9A 1BR2A 1FT9A 3GX4X 1I1SA 1SFEA 1Z7LA 4HNUA 2DYSH 3JRGA 1JXSA 1Q1HA 3DEUA 2QYOA 1IXSB 2W57A 3M9AA 1D1BA 2XSDC 2VBZA 2ZXJA 3HOTA 1QNTA 2HPIA 2XGDA 1NG6A 2JUCA 4PDKA 4CA0A 1UHSA 5M3MJ 4ZTFA 4PZJA 5KK1A 2WAQN 4XQFA 4CCLA 3CDLA 4D7NA 2DO7A 1ON2A 3WGIA 1WJCA 2IEKA 2FD5A 1HF0A 3HG9A 3E6DA 4BXUA 2FUG2 3IKVA 2LNBA 3OYDA 3LSRA 1J2XA 2CU7A 2H1LA 1ODDA 2PMZN 2W1OA 3Q0WA 5D5UB 4BHCA 1ZRCA 4HF2A 1YX3A 4M6XA 4UVBA 2DMQA 1D8KA 1Y6IA 3CC7I 2LFBA 2M7AA 2WB1N 1VQ4I 2EIKH 1WI3A 3IH4A 4ZC3A 3HSRA 2IS6A 3DEWA 4XRFA 1VQNI 3CO7C 3S8PA 4A0XA 4DJAA 3OYAA 5IT9K 4B44A 4UXNA 2Y9YA 1FMVA 5J40A 1BJZA 1RNLA 2NRAC 4ZYGA 3AG3H 1ZG1A 1X2NA 5GAGJ 1JTYA 5E3OA 2M1BA 4EGYA 4D1QA 5EYRA 2H27A 2R5YB 4EV0A 1S7EA 1ZYRF 3OYLA 1GLNA 1OYWA 2DQLA 5LBQA 4DW6A 3OS0A 4ENMA 3BZKA 3RQIA 1XMXA 3RPUA 2DW4A 4RLFA 1QVUA 3RKQA 3ZP5A 3OIOA 3FKIJ 3ZQIA 5K5OA 2IT0A 4L0ZB 2E7WA 2VC0A 5KCMA 3OYHA 2D1VA 3P9KA 4IHSA 1J7KA 1WGXA 4I7HA 3MFKA 3UKGA 3AG4H 3L9FA 4BQOA 4UNOA 2QEXI 4XLCA 2E34A 1EV7A 4FHTA 1IJWC 2F4OB 2OJED 3DU6A 2XAFA 4DYQA 3OYIA 1MMGA 2STWA 4EM0B 3DBRB 1XC5A 3LSMA 3E6MA 3I4MJ 4XRSG 4BHBA 2O8KA 3T0YA 3ZR8X 2FMLA 1Z3XA 2EBIA 3W3CA 1RIOH 1X4PA 3F23A 2E71A 2OTLI 3GLLA 3LSIA 3K4KA 5DS9A 3M1EA 1X1BA 4ANJA 3J7AO 3J80Z 2K27A 1IG7A 1OPCA 3HM5A 1G2HA 1V5GA 3QYBA 2KHMA 1P2FA 4LG0A 1VQ5I 1U8BA 2HKOA 3NEUA 5LEJA 3DFGA 3PQJA 3JTHA 3A1YA 4XLFA 5J1RA 4DGWB 1Z0XA 2BOLA 1YIJI 2Y75A 3CMMA 4P9FA 3GFIA 4FT8A 3PFYA 3ERMA 4QPOA 3C3WA 5A2QZ 4KYWA 1VQ8I 1XSVA 1LE8A 3PNTA 3K4NA 1AKHB 2DFHA 2FRHA 3FF5A 5DM7F 2HYGD 4A2UA 5FLVA 2LOOA 5F6FA 4AYBN 1FWZA 3H1CA 5LD2C 4CGZA 2R7RA 1OKRA 1G59A 1TWGJ 2KIUA 3KLOA 4MEXF 3SEQA 2HDDA 3WGGA 4ZDLA 2CGPA 4UUSA 1BIBA 1HDDC 3K4CA 3I58A 1ZG3A 4IHWA 3I59B 3TO7A 1X19A 4XLEA 1POGA 2R7WA 3GFMA 3GZ6A 4CICA 1IAWA 4YFKF 4HF0A 5IP7J 2P81A 3K4LA 4MO7A 4UVCA 3F6VA 2LY9A 3REOA 5ICCA 2CV2A 3GLXA 2MABA 2VONA 1HKQA 4FX0A 4RS8A 3PQKA 2LREA 2M7BA 3QYEA 2XF7A 2K4JA 1BI3A 1ULYA 3F3XA 1WH5A 2W4SA 3DKXA 2PI0A 4FE4A 3A03A 3BC8A 2W7NA 5D6FA 2VIXA 5JLXA 2LLKA 2VODA 3I4PA 3CCVI 4XLNF 2PFBA 5J4YA 3CCUI 2LR8A 4BBRJ 1FLIA 3HSEA 4HSRA 2YPRA 3RQ4A 3V7RA 2PMHA 1MDMA 4A3GJ 1KQ0A 1QHGA 2OQRA 1ZLJA 3CF5F 4EVIA 1Z67A 2NVUB 1R1VA 3WU0A 4XIDA 2LY2A 3QOPA 4B8XA 1GXQA 3AL0B 2K5CA 3PUFA 5LHHA 2XGCA 3CC4I 4LK1F 3UNGC 3BCAA 4PJMA 5FKLA 2EA2A 4MFEA 1T08B 1BBYA 4G7ZF 2QSGX 3GF2A 2V79A 3JRDA 2TDXA 1MJAA 5D8LB 2F48A 1KONA 3LA7A 3H0DA 2P8TA 1BI2A 3I4NJ 2ZJPF 2ICWG 5DV5A 1LDJA 1MMDA 1LDDA 3BJOA 5HOOA 2L7FP 3BTIA 1J09A 4EM2A 3IHUA 1F43A 5LRSA 3ZN0A 3SFIA 5D4SA 1ONVA 1XS9A 1LKXA 5GTHC 3J80K 1R71A 3C2GA 5K5RA 2A07F 3IAM2 4GO1A 2GZWA 4I0AA 1TQIA 2P4WA 1SAXA 2DT7B 3HGGA 2O8XA 1WQ2A 1TT5B 3GVAA 5F64A 4HYEA 4XSZF 4PUSA 2Y69H 1WPKA 2E5ZA 1KQ9A 1BW5A 5D5VB 4ZDPA 3KP6A 3GCMA 1ETXA 5C3EJ 1K79A 3LA3A 1UCRA 1SD6A 1W7PA 3CDIA 1ZGAA 1Z6TA 5HLTA 2CYYA 1FPQA 2NAZA 3BR0A 2GXGA 3LQQA 3IL2A 2ZMEC 4M74A 5A2QK 4O3MA 3O8GA 3ZMZA 2K9LA 5CKTA 2LH9A 1K4TA 1ACIA 1A04A 4MLOA 3SZTA 2VOPA 3EETA 1KGSA 4E70A 4CYDA 2HYJA 2DYRH 3GTKJ 4CZCA 3E6BA 2WV1A 4XK4A 4MFDA 2RC4A 2EZKA 3KEQA 3J81K 4LGWA 5J8FA 2WY7Q 2QQ9A 2RV8A 2OZUA 2DOEA 2BXZA 2IBDA 2XPUA 2BBYA 2X48A 3SZPA 3SYTA 2XAHA 2VE9A 4BBSJ 1QGPA 5E1XA 4G12A 2IS4A 2R7VA 2P6SA 2Z3YA 4XLHA 3V7SA 3VB2A 1HSTA 3EYYA 3CUQA 1WHUA 4C9YA 1A36A 3MVPA 2QQAA 4B4CA 2Y30A 1W0UA 5E8IA 1IGNA 3HKZN 3K7AJ 3OR2C 3HOUJ 2JSPA 3BTLA 1YQAA 4I99C 4ASNA 2L0KA 3CLOA 2XIGA 1AKHA 3TW6A 1OYIA 2O3FA 4Z6YA 2JZYA 3QU6A 3WGHA 4I09A 5J1YA 3BJAA 3N97A 1FSEA 2Y48A 2PN6A 4IHYA 3GTPJ 5DTDA 1ZN2A 3HOVJ 4ZYDA 2E1MC 2UZKA 3HOWJ 2KIFA 3SDGA 4HX7A 4A69C 4D7MA 1KA8A 4AM3A 5C4XJ 3Q0VA 2HNHA 3I59A 5IPAA 2G0EA 1D1CA 3I9V2 5D5XB 5D6EA 3KCCA 4KNYA 1CGPA 2OAZA 2CMPA 2XPWA 2BY3A 1V54H 2MLGA 2OD5A 3PO3J 4L18B 2FNAA 3RKWA 2VKHA 3S16J 3K4JA 2MLKA 3LSTA 1U3EM 5GADJ 5FKNA 1BR4A 1MJ9A 4HA8A 2E60A 9ANTA 5DCMB 2NXNB 1FTZA 2CSOA 2M0CA 4DBQA 4M6YA 4D5FA 1I5ZA 3SXYA 4A0YA 3OIQA 4OIOF 3R60A 2G7UA 3BY6A 2NS8A 5FD5A 4MQVA 3LAPA 3MKYB 1V4RA 2KL4A 3CD6I 1LNWA 3GTLJ 1YTYA 4P96A 3CJQB 1HLVA 1ZR2A 4BGDA 1FOXA 5CVUA 5BS6A 1LFUP 5EZHA 3OOPA 4FASD 4E7ZA 2R7DA 1O3TA 4EJWA 3L2RA 5E20A 4IL6C 2HQ5A 2JWTA 3M8EA 3CLQA 2DK5A 1UAAA 2V9KA 2IRFG 3MZYA 4ZYAA 1YJWI 5B1AH 3GXOA 5HDKA 1T6SA 4D9JA 1TL8A 3KYCB 1X1AA 3O3KA 3KIOA 3ISPA 3L1PA 2DJNA 3OSGA 4IZZA 2CQQA 2X6YA 2VUMJ 2COBA 1B9MA 1Z77A 2A5YB 3MZ8A 5H2FC 5JLWA 5C44J 1O3SA 1ZAOA 2GAUA 2LF7A 3KPHA 1OYYA 3CP2A 4MNUA 4EM1A 2EFNA 1HKTA 4U7DA 4BY7J 1K6YA 1YRNA 3B73A 3OV8A 2XSJC 1DU6A 4I2OA 4XICA 1QPIA 4HDUA 1GVDA 5E18F 5HODA 4Y33A 3FISA 2CQXA 4OMYA 3G1MA 3RSNA 1IN8A 1MBGA 2L4MA 1G3SA 5BMZA 1W36D 4IRGA 3I5UA 1MMNA 4IHTA 2QM3A 5HDNA 1A5JA 5K1YA 2CUFA 3JTGA 1A35A 1OCZH 2Y0SA 1NK2P 5K7HA 2M30A 4I02A 2NNNA 2L7MP 4PGHA 5LHIA 2FU4A 1R5GA 4LOCA 5EEHA 2CQKA 1U78A 1U5TB 2OPTA 1MBFA 2KMUA 1HDPA 4BKXA 2O0YA 2VT3A 3E7LA 3ZMSA 4F55A 2DLLA 4JQFA 3WG7H 3FXLA 3RI4A 2KIMA 4BEHA 4FTHA 3ASNH 1WJ5A 2JN6A 2XRLA 4ZH4F 1UZCA 1YW8A 3OYBA 4DNCA 2QSHX 1T2KA 2DTRA 2HZTA 1O7LA 3KE2A 4C3HJ 1MGTA 3OYFA 1BN5A 1FZPB 1DDNA 2Q1ZB 4YG2F 4S04A 4FX4A 3FIWA 3HRSA 2L9RA 4BYYA 2FE3A 1B59A 2CUJA 3SZGA 1ZRFA 3BJ6A 2KKOA 5TRDA 2HYFA 5L3FA 5EGOB 4UY8I 4PSXA 3CCRI 4KMUX 5IYCJ 1T95A 1T56A 3HZJA 4HLYA 3U9GA 2ZBKA 2LVSA 3K1NA 1ZQ3P 5E3MA 4CCKA 3ZQFA 1NHAA 5J4VA 1TBXA 4NQWA 4GXOA 3I53A 3R0AA 5LRRA 1NK3P 2KISA 1DP7P 1G3WA 4P55A 2H09A 4IO9F 3IUOA 4M3DA 1S9HA 2N8GA 3LFKA 1WKMA 4XKWA 3V7CA 4N4OB 3HUGB 3JAMZ 2F4MB 3I55I 2B9SA 2Z5UA 5DCMA 3KEOA 3DBLB 2XRNA 2DCEA 2E1CA 3LFUA 5AONA 1T8IA 2VJJA 2R7UA 2K9QA 4XKVA 4KIGA 4EQQA 2M9HA 3BG9A 1U9OA 5EG0B 3CCEI 1XN7A 2UXXA 4JX4A 4BE1A 3PUBA 4XONA 1NH3A 5FRMA 4Y4RA 3HB9A 1QRYA 2GOXB 2DPUA 3EQLF 4F3QA 3K1MA 2LKSA 1P7JA 3MD2A 3DQVC 2QF7A 5BQTA 2YS9A 2XGEA 1J9IA 3D5SC 2E2JJ 3QP6A 4N9IA 5IOYA 3CF2A 1G6NA 1P4AA 3S15J 3A2KA 2WC2A 5FLXK 2XAGA 3FK7A 5LFAA 2FBIA 3GEZA 1FEXA 3VDXA 2HI3A 2R5ZA 2QWWA 2IJLA 4AU7A 3FK6A 4ZYHA 3LSKA 3JRCA 1PUFB 1IRXA 2K9NA 3WTWC 2PEXA 4LLLA 1TQMA 1LVAA 1K78B 2DMUA 3OS1A 3EUHA 3CUQC 3Q9SA 5KHDA 3FX3A 5H6RA 4U0YA 2NVYJ 1MKMA 1AWCA 2JK3A 3S3MA 2ELJA 1FJLA 2XAJA 2PLYA 3K9TA 3DXJF 1VQPI 4RB1A 3R4KA 1OMIA 1TLHB 2A6TA 5EZGA 5FGMA 4P5OA 4PK4A 4HNVA 4GYIA 3FXOA 2IA2A 3GTMJ 1RC9A 4B47A 3BR6A 2OCCH 1ETOA 2DBBA 3BTCA 2O61A 1TWHJ 1R6RA 4IPAA 5K7FA 1ETWA 5JVTA 2DT6A 5CJ9A 4A93J 4M9SA 4E7JA 3S2HJ 4I98B 1X4OA 2BHZA 3KZIC 4AVPA 4DOZA 2P5LC 2JVGA 1U5TA 4XN0A 2F2EA 3E1SA 3ERED 1WVRA 1VQ7I 4WK8F 1QA6A 1KU2A 3M3YJ 3EUAA 2HWVA 2KQRA 2ZMEA 4BACA 4UVAA 2CFOA 2RREA 1YO5C 4KT6A 4DYCA 2K86A 3LSJA 2JA2A 4NHJA 4RAZA 4M73A 3FMRA 2O03A 1MBJA 1IXCA 2LC2A 5K5QA 4NB5A 4J00A 3R0JA 4AD9A 5DEQA 4MEYF 3IH3A 1RR8C 3IWZA 1S7AA 3JRHA 2AXLA 3WHCA 4BS9A 2MA3A 1YG2A 4XNFA 4C30A 2VKDA 2FX0A 3OYNA 4LB5A 4NUBA 3OS2A 3TP0A 4PJLA 2R3SA 1D0ZA 5J47A 1VQOI 3A0BC 1ZKGA 3CJRB 1Y0NA 4U7BA 1PDNC 3JAMK 2V9PA 1W5SA 3PNVA 4KUMA 3AL0C 3K6GA 3FXMA 5BPDA 3HL2A 4W97A 1Z1DA 2ZXWH 2XB5A 5DUKA 1QZYA 1H8AC 1VQKI 1FBUA 4PJ0C 3GZNB 3K69A 2B7EA 4BH9A 2LD5A 3OYMA 5DM6F 2ISZA 2FSWA 2TRTA 2OCEA 1FNNA 4A5MA 1MBEA 3FXQA 1T33A 4YRVA 1MBHA 2XPVA 1PYVA 4LJZF 4LK0F 4BXFA 4Q47A 1OISA 3KP7A 5ILUA 2VBWA 3H5NA 4BHPA 4V19K 4OIQF 2O7OA 3HGYA 3CJTB 2DOAA 3P5JA 4GYGA 1QZZA 3FM5A 3K4BA 3TGNA 5GAHJ 1G8XA 1JTXA 1NG7A 4AIJA 1Y39A 1FYMA 4B1RA 3BLYA 2AXTC 1OQYA 1I3AA 1REPC 4RB2C 2IA0A 3OR1C 4CYCB 2EFWA 5DUIA 2RNJA 4CZZA 1Y56A 3FWEA 1VFCA 2DXIA 1XB4A 2FBKA 3WU2C 3ECOA 2VJ4A 3BPXA 3F8BA 5FJ8J 4U87A 2ZSIB 5HS9A 5CQEA 2LF8A 2L7ZA 3IH2A 3H9QA 4M71A 1GV5A 3QPHA 3LMMA 3P9CA 3G71I 4NC8A 4R79A 2CUZA 1QPMA 1XCBA 2QUFA 3E3VA 3CDHA 4EJOA 3ZQHA 2H8RA 3BOQA 2EZHA 2JA5J 3D0SA 3M1CA 4I01A 1HA8A 4LIVA 3RKXA 2CUEA 1ON1A 2MBFA 4U0WA 1U6GA 3WTTC 1R58A 4RAYA 1IF1A 2BW3A 2EPFA 1YFHA 1U0JA 2V1UA 4OINF 1H9GA 3LSPA 3M7GA 2VKEA 1IDZA 1BC8C 3BROA 4A3EJ 2OF7A 4A3DJ 2Q2EB 2VBXA 5J3LA 4BY1J 2VKVA 1ENHA 3NARA 2PJRA 3H9JA 2AO9A 2EZLA 1UJ8A 2CQNA 1TP4A 2L7KA 1A31A 3DLLF 1F5TA 2HOEA 3S1MJ 4L9JA 2K85A 3C2HA 3DP7A 3Q0UA 2KFDA 5FKKA 3IAS2 1HW1A 1IO2A 1X3UA 4U0VA 3HPGA 1WJFA 1QQIA 3P7NA 1XPXA 3MKZA 1B8IB 5L3DA 2ME6A 3IRRA 2Z16A 4FE7A 3J81Z 1TZLA 2KJBA 2CG4A 2M4KA 1CF7B 2QKLB 3J7ZI 3E97A 3LOCA 5DDGA 1BOAA 2W48A 2KJCA 1SD4A 4S05A 1Y1WJ 1V55H 1P7IA 2IPQX 5ICEA 5FLMJ 3HRUA 1H89C 3HYIA 4EJVA 1FOWA 3HTUA 3BR3A 3GTOJ 2L9SA 2CRGA 5ED4A 1JT6A 2GM4A 1IZ1A 1WH7A 3E5UA 3E6CC 2MYSA 4WF2A 3BZCA 1I50J 4XRSA 2PX9A 3CESA 4CH7A 2ME0A 1M1EB 3GYHX 4FCYA 2GOMA 2MSYA 3LQRA 5BNGA 5C4JJ 4KFCA 4IRIA 2VPLA 1VF9A 5B66C 3CC2I 2QGUA 3OYCA 4C2MJ 2WWYA 1TW3A 1QZEA 3BG5A 2ADUA 3QPLA 2R4GA 2B0LA 2HXIA 3B6AA 4N0BA 4BE0A 2VE8A 2E2IJ 2H6CA 1X1DA 2V1DA 1O3QA 2FF4A 1PVEA 4P9UA 4XORA 1IRGA 1K61A 4XLPF 1D3YA 4ENNA 3EPZA 5LGNA 3CTAA 2R7SA 3EUHC 1JHFA 1ZTRA 3GMEA 2R5YA 1W5TA 2JRTA 1HKSA 2K3FA 5EDNA 3AAFA 3S1QJ 1JI8A 1XD7A 3KP5A 4AYBA 1H88C 3WU1B 2DA7A 4YIRX 1SFOJ 3ZMTA 5LGUA 2HOSA 1F1ZA 3Q5FA 1T38A 4G9YA 4RLQA 4CYCA 4RM3A 4BL0B 2W85A 4KN4X 3RCOA 4CUGA 1ORKA 5E1WA 2HTJA 1YJ9I 3MWMA 3HBLA 4KIFA 2X85A 3B6CA 1JKOC 4RBOA 2HR3A 1U5TC 1I39A 2FNPA 3GO5A 2ZSHB 2P5VA 3HOXJ 1DPRA 2LP0A 5J6XA 1SEUA 3IWFA 2BVLA 4IHXA 2QLZA 4XSXF 3F21A 1T0FA 1Y8QB 2ELHA 4L5EA 1LEAA 3S2DJ 2IP2A 2XB0X 2YU3A 4M3EA 2DPDA 1KYWA 1TW2A 5H20A 4IOAF 3VYSB 3ABKH 2GA2A 3TW7A 2NVQJ 1R5ID 4HW0A 3HRMA 2Q2EA 3CO6C 3U21A 1FY7A 1ZLKA 4EATA 4IHVA 3KZZA 5IYBJ 2DMTA 3CCYA 3DU5A 3M8JA 4IQJA 4M9XA 3CCMI 3C7JA 1R00A 2FA5A 4A3LJ 2HVSA 4IRHA 3HOYJ 2EFPA 3FM3A 4CCOA 2EJRA 1X3WB 3WTXC 1MSEC 3TDUC 2ESNA 2A05A 2AQFA 3IKTA 5B1BH 4KT5C 2MG4A 4PCQA 5FO5A 4CCMA 1B8IA 5GTIC 5ERIA 4OIRF 4OIPF 2VT2A 1JGSA 1X3ZB 3GFJA 4Y17A 5CYVA 3RYRA 1APLC 1HW2A 1WWXA 2HZDA 3JREA 4MTEA 2BY0A 2VC1A 2X6XA 1LDKB 3X2QH 3W2VA 4E6KG 2RAEA 2W25A 4ZTJA 4QWQA 3HIFA 4BE2A 2X0LA 3OWTA 3D5RC 4CCJA 2HFHA 3PJRA 2DA1A 4HX8A 3W2AA 5AIQA 3VODA 1ZR4A 4OOIA 1P4XA 1XSXA 4M6VA 3T1BA 4HSTA 4I6ZA 5ILSA 4X6AJ 2A6EF 1MIJA 1XGOA 1SFXA 3JRBA 1QO0D 1I6HJ 1TNTA 2DOFA 1FC3A 4H4KC 2DMPA 3VSKA 3CMEI 4MGRA 3TOAA 4C3IJ 2OZ6A 1ETQA 3GW2A 2ISYA 1BA5A 2JRMA 1RUOA 5FFXA 3DTIA 5L3CA 2AS5F 4HEA2 2MFZA 3ZMDA 2Y0SN 2F4IA 2JQ7A 3QPTA 3T8TA 3ZOBA 2EK5A 3GTGJ 1WFXA 5FKOA 5CQGA 5LLQA 2CW7A 1TWFJ 4J01A 4CSWA 2R7OA 1IDYA 3KEYA 4UUTA 1SD7A 1JE8A 2X1EA 4LLGF 3KYLA 1KU9A 1Z3YA 2DK8A 3L7WA 4BUPA 2EILH 3BDDA 3R61A 1LQ1A 3W6VA 2AHQA 2QCOA 2M0MA 2VQCA 4G7OF 3F6OA 1HXDA 3LL7A 4YEJA 3RYPA 1L3LA 1BC7C 1HOMA 2ECBA 1LB2A 4BXXJ 5KVRA 4A6DA 2Z33A 1OFCX 5DD8A 3ZQGA 4GDFA 2UWMA 2Z2SB 4B3XA 1FIPA 1VZ0A 1E3HA 4EMSA 2IGMA 1B72A 1G3TA 4HLXA 3S3OA 5F0FA 4OMZA 2MC3A 2ZFWA 2CO5A 2VBYA 2R7QA 4I76A 1YX5A 5BOXA 5CVRA 3HJEA 3ZMVA 2XUBA 2JUGA 2I8DA 4ETSA 4CCNA 3K10A 1YJNI 1J59A 4QSHA 5FLXZ 3FHZA 5L3BA 1JKPC 2WBMA 2A68F 3QWLA 3I54A 2R92J 3HTSB 1ZHFA 2X9DA 2UUZA 3GWZA 3ABTA 4B09A 2V26A 5HVQC 2K40A 1IRZA 4JX5A 1IRFA 2KPMA 2MD0A 1UG0A 2JPCA 4LG3A 2IXSA 2M45A 4TV7A 1N25A 2YSRA 4BDZA 2Q8KA 1F9NA 1IV6A 3BG6A 5GAEJ 3JR9A 1RKTA 1JUPA 5CVJA 1XSDA 5CLSA 2W00A 4NC6A 2ZJQF 3QOEA 3N4MA 1OCPA 4IF4A 3MMYB 3JRAA 3MKLA 2P7CB 3TKYA 2XKOA 2FEZA 1SVOA 3NQOA 2DODA 3CCSI 4KA4A 5JVGF 3KZYA 3KP3A 2QA4I 2CFXA 5J1UA 4XRMA 2ZC2A 3ESWB 3WTVC 1DU0A 2KDOA 2V6CA 1BL0A 4B48A 2O9LA 1GVJA 4FETA 4II2A 5DYMA 3K70D 2DDAA 1V5EA 4RDUA 1S72I 3LA2A 4YFXF 1AU7A 3MAJA 2G7HA 1I1GA 4RA2A 3AG1H 2ACJA 2C6YA 2XASA 2IS2A 2XVCA 2V6EA 4WXHA 4FISA 2EIMH 4LMYA 5F1RA 2ESHA 3F0CA 2VB6A 3H9GA 1BM9A 1XCVA 2GA1A 2EINH 2K4BA 3BTJA 2X4HA 4DZJA 1ZG5A 1XMKA 1BOBA 1IN5A
chains in the Genus database with same CATH topology
3PFIA 4MQ9F 2Y0MA 4ZZDA 2DFIA 3CUOA 4OU0A 1FP2A 4DQ2A 4UV8A 2LSOA 3ZMUA 1PP7U 1O7FA 1R36A 3WG9A 3F22A 3F8NA 4GGGA 5J8CA 5JI6A 2Q0OA 3RIRA 1TQPA 2L54A 2M5WA 4G7HF 1EH6A 1V3FA 2GWRA 3FMQA 3QP5A 3TO6A 4Q5SF 4L5IA 2OBPA 2W84A 3KP4A 2ZNZA 3LWFA 3V8JA 1XMAA 2LDUA 3RTRA 1F4KA 3V8LA 4K2EA 1MD0A 4XBFA 4CXFA 1G4DA 1ZARA 3FMSA 4HOBA 4EGZA 4LG0B 1FBQA 4JK1X 3DPLC 2ZNYA 1TNSA 4I0BA 4M9ZA 1L0OC 2K02A 1MZBA 1J5YA 1AOYA 2H6BA 2VXZA 2ZO4A 4IJAA 3V8KA 3G73A 2CW0F 2STTA 4KIBA 2ZJ2A 1IXRC 2EB7A 2EV5A 3D5LA 1EH8A 3TQNA 4HDVA 5JHUA 3NRVA 1P6RA 4AWXB 2EV6A 4L9NA 5IT3A 4G6DA 2QVOA 4BAYA 1XDUA 1HSJA 3HRTA 1QBJA 3F8FA 2NYXA 4YIIA 3ELKA 1J75A 2QZ8A 4UV9A 3CJNA 3GFLA 3HSFA 3BP8A 3MQ0A 2L01A 3WE2A 3MZHA 1Z91A 3M8FA 2A69F 3L00A 1Z05A 5EEGA 2DT5A 5ICFA 4G94A 3HUGA 1MDMB 3RKYA 3L2CA 2RDPA 3WTYC 3C18A 3JSPA 1BI0A 1XDSA 4RGXA 4L9TA 2VN2A 1TTYA 2MH9A 3E5XA 1J0RA 4RGUA 4Z2YA 4A0ZA 1T39A 4R8HA 1UHMA 5FB2A 3C1DA 4HX4A 3U1DA 4AIKA 5E8GA 2XGXA 4IXAA 1YYVA 3DF8A 4IVNA 2BE5F 4ESJA 3LAJA 2WTEA 3JSOA 2JT1A 3MEXA 1UHWA 4L5JA 1S7OA 2YX7A 2BV6A 1K78A 3VFZA 1W7PB 2FQ3A 2XHKA 1R23A 2L3DA 2GXBA 2V9VA 5LGTA 3R6SA 3KETA 1WSUA 4ZZLA 4KICA 2JPBA 1FX7A 2HQNA 3BPVA 4UHTA 4Q4ZF 4CO8A 1ZRDA 3ABUA 1KYZA 5HDGA 4KN7X 1R1TA 5HS7A 3CUQB 1LJ9A 2OU2A 2PBIA 3TDZC 2RN7A 3U2RA 1D8JA 4RB0A 2DQRA 2GQQA 1U8RA 4EJTA 3SHFA 1SMTA 2D2WA 2M8EA 2A3SA 4HV5A 3BWGA 3TOBA 3ULQB 2E1NA 1PP8F 4YIFA 1D5VA 1SFUA 4Y13A 3I0TA 1Y0UA 3RPQA 2VOOA 3L09A 3W6KB 4ON0A 1T98A 2KRFA 4G6QA 1DPUA 2MH2A 1YIOA 2E7XA 3QU3A 1C0WA 2DU9A 2V1XA 3SQNA 2DI3A 3B02A 2P5KA 2UXNA 1K7AA 2PJPA 4R1HA 5H6QA 2CWEA 2L02A 5L3EA 1HW5A 1UB9A 4HV6A 4L0YB 2F5CA 2FOKA 2L4AA 3FXUA 4WXDA 3QAHA 2FMYA 1G3YA 4WX9A 2OQGA 1PUEE 1GXPA 1R1UA 3ML6A 1FBSA 3IC7A 1R7JA 4CDGA 3ZQ7A 1OR7A 2ETHA 3FXRA 3EDPA 3KFWX 1ZGJA 2JSCA 4F7ZA 3DPTA 1FOKA 3SFZA 1KQ8A 1IW7F 2Z9OA 2A6HF 6PAXA 3W6JB 1VTNC 1SMYF 4GCVA 2H94A 3MCZA 4ENKA 1KU3A 1B4AA 3VEPA 1Z9CA 1W4MA 1P92A 1H0MA 5HLHA 1USSA 2RKHA 1S6LA 2XROA 4MHGA 1IUYA 4H0EA 2QBYB 1R22A 3T8RA 2P6TA 3T5XA 2IW5A 3FZVA 4YFNF 3ECHA 1UFMA 4BNCA 1IN6A 1CF7A 2HDCA 1W7PD 4A12A 3WTUC 4HZFA 4KMFA 2R7FA 2ZKZA 1USTA 4LD5A 5AIPA 4PGGA 4G8XA 3WODF 3QRFF 2RGVA 2XV4S 2F5EA 3K0LA 3O2PE 4O5VA 1P4WA 3ROUA 5D8KB 2M87A 4M72A 4HBLA 5TJJA 4RGSA 1BIAA 2EFOA 2J5PA 5DD4A 1WI9A 1EH7A 1XGMA 5HS8A 5FFZA 2QQBA 2EV0A 4LFUA 1ZREA 2PQ8A 4HAMA 2EA4A 3GUDA 2P7VB 2IA1A 3H3ZA 5CVIA 1WRJA 3DV8A 2G9WA 1LEBA 1B9NA 4O6JA 2PG4A 3TO9A 3K2ZA 2ZCWA 5HLIA 2FXAA 2GIVA 3KLNA 5LEKA 1E17A 3H3UA 5ILVA 3RDIA 4QLCU 5CVVA 2D45A 3F8CA 1HQCA 3S2WA 1FYKA 4A6EA 2HS5A 2COMA 2HTSA 3H92A 2W24A 5LHGA 2MD5A 1BI1A 3F72A 1STZA 3I71A 1YS7A 4LB6B 1I27A 1H9TA 2PMUA 4EJUA 1HBXG 1ZH5A 4BQAA 1S3JA 3F8MA 4ZYEA 3WE3A 3ZPLA 1Z7UA 1MJBA 2HQRA 2QBYA 2BEOA 2NNYA 3EYIA 1GHCA 4CHUA 3HOSA 1B1BA 1FSHA 2RQPA 1O57A 2ZMEB 3K1PA 2JTVA 2XKPA 3ZN1A 4LLNA 2DAOA 4AIHA 5ICGA 1IN4A 4JBAA 3RJPA 2O6GE 4WXCA 2HKXA 1FYLA 1XGSA 1RUNA 4HQMA 4HQEA 2HEOA 4D0PA 1S29A 5L3GA 3WTZA 2FBHA 2J5OA 3E5QA 2EWNA 1IN7A 3WTSC 5JFRA 5E1ZB 3HHGA 4ENJA 3Q9VA 1I6XA 4RB3C 2D1HA 5FD6A 5HLGA 5JR3A 2YR2A 2XAQA 3O6BB 1K6OA 1U2WA 4MTDA 4L9VA 2LKPA 4RGRA 1YS6A 1XGNA 1YLFA 4ESBA 1YW9A 2IVMA 2Z99A 3P9IA 2K7LA 3BZ6A 5BPIA 3GZ5A 3G3ZA 5IT9Z 1S8NA 1B6AA 2BYVE 4Q48A 2OA4A 3I64A 2BGCA 2NS0A 2F5FA 3VOEA 2WV0A 4KDPA 3JW4A 3COAC 1O3RA 1RZ4A 1E2XA 2RVCA 3DKWA 4N9HA 4WCGA 1KU7A 5D5WB 1R5HA 4HF1A 1RI7A 4Y15A 5D4RA 1JHHA 2F5DA 1DUXC 2HGCA 2QENA 4UUVA 4WWCA 2EFQA 3V4GA 1FP1D 2YX4A 4A5NA 4ESFA 2A61A 5E17F 1BJAA 1YW7A 5DCFA 1SD5A 3IRQA 3KP2A 4U88A 1Z6RA 3HHHA 1FT9A 1I1SA 3GX4X 1SFEA 1JXSA 1Q1HA 3DEUA 2QYOA 1IXSB 2W57A 3M9AA 2VBZA 2ZXJA 3HOTA 1QNTA 4PDKA 4PZJA 5KK1A 2DO7A 1ON2A 3WGIA 3E6DA 4BXUA 3IKVA 2LNBA 1J2XA 1ODDA 5D5UB 4BHCA 1ZRCA 4HF2A 4M6XA 4UVBA 1D8KA 3HSRA 4XRFA 3CO7C 4A0XA 5IT9K 4UXNA 1RNLA 2NRAC 4ZYGA 1ZG1A 2M1BA 4EGYA 2H27A 4EV0A 1ZYRF 1OYWA 2DQLA 5LBQA 4ENMA 3RPUA 2DW4A 3ZP5A 5K5OA 2IT0A 4L0ZB 2E7WA 2VC0A 2D1VA 3P9KA 4IHSA 1J7KA 4I7HA 3MFKA 3L9FA 4UNOA 4FHTA 1EV7A 2XAFA 2STWA 4EM0B 3E6MA 4BHBA 3T0YA 2FMLA 1RIOH 3F23A 3M1EA 3J7AO 3J80Z 2K27A 1OPCA 1P2FA 4LG0A 2HKOA 3NEUA 5LEJA 3DFGA 3PQJA 3JTHA 2Y75A 4P9FA 3GFIA 4FT8A 3C3WA 5A2QZ 4KYWA 1XSVA 2FRHA 3FF5A 2HYGD 4A2UA 5F6FA 1FWZA 4CGZA 1OKRA 2KIUA 3KLOA 4MEXF 3WGGA 2CGPA 1BIBA 3I58A 1ZG3A 3I59B 3TO7A 3GFMA 3GZ6A 4CICA 1IAWA 4YFKF 4HF0A 4UVCA 3F6VA 5ICCA 3REOA 3GLXA 2VONA 1HKQA 4FX0A 4RS8A 3PQKA 2K4JA 1BI3A 1ULYA 3F3XA 2PI0A 5D6FA 2VODA 3I4PA 4XLNF 2PFBA 1FLIA 3HSEA 2YPRA 3V7RA 2PMHA 1MDMA 1KQ0A 2OQRA 1ZLJA 4EVIA 3WU0A 1R1VA 4B8XA 3QOPA 1GXQA 5LHHA 4LK1F 2EA2A 4G7ZF 1BBYA 3GF2A 2V79A 2TDXA 1MJAA 5D8LB 3LA7A 2P8TA 1BI2A 5DV5A 1LDJA 1LDDA 3BJOA 5HOOA 4EM2A 3IHUA 5LRSA 3ZN0A 5D4SA 1ONVA 3J80K 5K5RA 2A07F 4GO1A 2GZWA 4I0AA 1TQIA 2P4WA 1SAXA 2O8XA 1WQ2A 3GVAA 5F64A 4HYEA 4XSZF 1KQ9A 5D5VB 3KP6A 1K79A 3LA3A 1UCRA 1SD6A 1W7PA 1ZGAA 1Z6TA 2CYYA 1FPQA 2NAZA 2GXGA 3LQQA 3IL2A 4M74A 5A2QK 4O3MA 3ZMZA 1A04A 3SZTA 2VOPA 3EETA 1KGSA 4E70A 4CYDA 3E6BA 2RC4A 3KEQA 3J81K 4LGWA 5J8FA 2QQ9A 2RV8A 2OZUA 2BBYA 3SZPA 2VE9A 2XAHA 1QGPA 5E1XA 2P6SA 2Z3YA 3V7SA 3VB2A 1HSTA 3EYYA 3CUQA 2QQAA 5E8IA 4ASNA 1YQAA 3CLOA 2XIGA 1OYIA 2O3FA 3N97A 2JZYA 3QU6A 3WGHA 4I09A 3BJAA 1FSEA 2Y48A 2PN6A 1ZN2A 4ZYDA 2UZKA 2KIFA 4HX7A 1KA8A 3I59A 5D5XB 5D6EA 3KCCA 4KNYA 1CGPA 2OAZA 2MLGA 2OD5A 4L18B 2FNAA 3RKWA 2MLKA 3LSTA 1U3EM 1MJ9A 4HA8A 5DCMB 2CSOA 4M6YA 1I5ZA 3SXYA 4A0YA 4OIOF 3R60A 2G7UA 3BY6A 5FD5A 4MQVA 3LAPA 1V4RA 1LNWA 1YTYA 4P96A 5CVUA 5BS6A 3OOPA 2R7DA 1O3TA 4EJWA 5E20A 3M8EA 2DK5A 2IRFG 3MZYA 3GXOA 5HDKA 1T6SA 3O3KA 3ISPA 1B9MA 2A5YB 1O3SA 1ZAOA 2GAUA 2LF7A 1OYYA 4MNUA 4EM1A 2EFNA 1HKTA 4U7DA 3B73A 3OV8A 4I2OA 4HDUA 5E18F 4OMYA 1IN8A 2L4MA 1G3SA 5BMZA 4IRGA 3I5UA 4IHTA 2QM3A 5HDNA 5K1YA 3JTGA 2M30A 4I02A 2NNNA 4PGHA 5LHIA 2FU4A 1R5GA 5EEHA 2CQKA 1U78A 1U5TB 2O0YA 2VT3A 3ZMSA 3RI4A 2DLLA 4JQFA 2KIMA 4ZH4F 1YW8A 4DNCA 1T2KA 2DTRA 2HZTA 1O7LA 3KE2A 1MGTA 1BN5A 1FZPB 1DDNA 4YG2F 4S04A 4FX4A 3HRSA 4BYYA 2FE3A 1B59A 1ZRFA 3BJ6A 2KKOA 5TRDA 2HYFA 5L3FA 4KMUX 4HLYA 3U9GA 2ZBKA 3K1NA 1NHAA 1TBXA 4NQWA 4GXOA 3I53A 3R0AA 5LRRA 1DP7P 1G3WA 4P55A 2H09A 3LFKA 1WKMA 3V7CA 3JAMZ 2Z5UA 5DCMA 3KEOA 2XRNA 2E1CA 5AONA 4KIGA 4EQQA 1XN7A 2UXXA 2DPUA 3EQLF 3K1MA 3DQVC 5BQTA 1J9IA 3QP6A 4N9IA 1G6NA 1P4AA 2WC2A 5FLXK 2XAGA 2FBIA 3GEZA 2QWWA 2IJLA 4ZYHA 3WTWC 2PEXA 4LLLA 1TQMA 1LVAA 1K78B 3EUHA 3CUQC 3Q9SA 3FX3A 5H6RA 4U0YA 1MKMA 1AWCA 2XAJA 2PLYA 3K9TA 3DXJF 4RB1A 3R4KA 1OMIA 1TLHB 5FGMA 4P5OA 4GYIA 2IA2A 2DBBA 2O61A 4IPAA 5JVTA 5CJ9A 4M9SA 4I98B 4AVPA 2P5LC 1U5TA 2F2EA 3ERED 4WK8F 1KU2A 2HWVA 2ZMEA 4UVAA 1YO5C 2K86A 4NHJA 4RAZA 4M73A 3FMRA 2O03A 1IXCA 5K5QA 4NB5A 3R0JA 4AD9A 5DEQA 4MEYF 3IWZA 1S7AA 2AXLA 2MA3A 1YG2A 4LB5A 2R3SA 4U7BA 1PDNC 3JAMK 1W5SA 4KUMA 5BPDA 1Z1DA 5DUKA 1QZYA 1FBUA 3K69A 4BH9A 2ISZA 2FSWA 1FNNA 4A5MA 3FXQA 4LJZF 4LK0F 4Q47A 3KP7A 5ILUA 2VBWA 4BHPA 4OIQF 4GYGA 1QZZA 3FM5A 3TGNA 4AIJA 1FYMA 1REPC 4RB2C 2IA0A 2EFWA 5DUIA 2RNJA 4CZZA 3FWEA 1XB4A 2FBKA 3ECOA 3BPXA 3F8BA 5HS9A 2LF8A 4M71A 3QPHA 3P9CA 4R79A 1QPMA 1XCBA 2QUFA 3E3VA 3CDHA 4EJOA 3BOQA 3D0SA 4I01A 3RKXA 1ON1A 2MBFA 4U0WA 1U6GA 3WTTC 1R58A 4RAYA 1IF1A 1YFHA 2V1UA 4OINF 1H9GA 3M7GA 1BC8C 3BROA 2VBXA 1F5TA 2HOEA 4L9JA 3DP7A 1HW1A 1X3UA 4U0VA 1QQIA 3P7NA 5L3DA 3IRRA 3J81Z 2KJBA 2CG4A 1CF7B 3E97A 5DDGA 1BOAA 2KJCA 1SD4A 4S05A 2IPQX 5ICEA 3HRUA 3HYIA 4EJVA 3HTUA 5ED4A 1IZ1A 3E5UA 3E6CC 4WF2A 3GYHX 3LQRA 4KFCA 4IRIA 2WWYA 1TW3A 2ADUA 2B0LA 4N0BA 2VE8A 2H6CA 2V1DA 1O3QA 2FF4A 4P9UA 1IRGA 4XLPF 1D3YA 4ENNA 5LGNA 3CTAA 1JHFA 1W5TA 2JRTA 1HKSA 3AAFA 1XD7A 3KP5A 3WU1B 3ZMTA 5LGUA 1F1ZA 3Q5FA 1T38A 4G9YA 2W85A 4KN4X 5E1WA 2HTJA 3MWMA 4KIFA 2HR3A 1U5TC 2FNPA 3GO5A 2P5VA 1DPRA 5J6XA 3IWFA 2QLZA 4XSXF 3F21A 1T0FA 2ELHA 1LEAA 2IP2A 2YU3A 2DPDA 1KYWA 1TW2A 5H20A 2GA2A 4HW0A 3HRMA 2Q2EA 3CO6C 1FY7A 1ZLKA 3KZZA 4M9XA 3C7JA 1R00A 2FA5A 4IRHA 2EFPA 3FM3A 2EJRA 3WTXC 3TDUC 2ESNA 3IKTA 4KT5C 4PCQA 5FO5A 5ERIA 4OIRF 4OIPF 2VT2A 1JGSA 3GFJA 4Y17A 5CYVA 3RYRA 1HW2A 1WWXA 4MTEA 2VC1A 1LDKB 2W25A 4QWQA 3HIFA 2X0LA 2HFHA 4HX8A 5AIQA 3VODA 4OOIA 1P4XA 1XSXA 3T1BA 5ILSA 2A6EF 1XGOA 1SFXA 1QO0D 1TNTA 1FC3A 4MGRA 3TOAA 2OZ6A 3GW2A 2ISYA 1RUOA 5FFXA 5L3CA 2AS5F 3ZMDA 3QPTA 3T8TA 2EK5A 5LLQA 1SD7A 1JE8A 4LLGF 1KU9A 2DK8A 3L7WA 3BDDA 3R61A 1LQ1A 4G7OF 3F6OA 1HXDA 3RYPA 1L3LA 1BC7C 1LB2A 5KVRA 4A6DA 2Z33A 5DD8A 2UWMA 4EMSA 1G3TA 4HLXA 4OMZA 2MC3A 2ZFWA 2CO5A 2VBYA 5BOXA 5CVRA 3ZMVA 2XUBA 4ETSA 1J59A 5FLXZ 3FHZA 5L3BA 2A68F 3I54A 3HTSB 1ZHFA 3GWZA 3ABTA 4B09A 5HVQC 1IRFA 2JPCA 2M45A 4TV7A 2YSRA 2Q8KA 1F9NA 5CVJA 1XSDA 5CLSA 3N4MA 4IF4A 2P7CB 3TKYA 2XKOA 2FEZA 3NQOA 4KA4A 3KZYA 3KP3A 2CFXA 3WTVC 2V6CA 1GVJA 5DYMA 3LA2A 4YFXF 3MAJA 2G7HA 1I1GA 2ACJA 2C6YA 2XASA 2XVCA 4WXHA 4LMYA 5F1RA 2ESHA 1BM9A 1XCVA 2GA1A 2K4BA 2X4HA 1ZG5A 1XMKA 1IN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFI A;  4MQ9 F;  2Y0M A;  4ZZD A;  2DFI A;  3CUO A;  4OU0 A;  1FP2 A;  4DQ2 A;  4UV8 A;  2LSO A;  3ZMU A;  1PP7 U;  1O7F A;  1R36 A;  3WG9 A;  3F22 A;  3F8N A;  4GGG A;  5J8C A;  5JI6 A;  2Q0O A;  3RIR A;  1TQP A;  2L54 A;  2M5W A;  4G7H F;  1EH6 A;  1V3F A;  2GWR A;  3FMQ A;  3QP5 A;  3TO6 A;  4Q5S F;  4L5I A;  2OBP A;  2W84 A;  3KP4 A;  2ZNZ A;  3LWF A;  3V8J A;  1XMA A;  2LDU A;  3RTR A;  1F4K A;  3V8L A;  4K2E A;  1MD0 A;  4XBF A;  4CXF A;  1G4D A;  1ZAR A;  3FMS A;  4HOB A;  4EGZ A;  4LG0 B;  1FBQ A;  4JK1 X;  3DPL C;  2ZNY A;  1TNS A;  4I0B A;  4M9Z A;  1L0O C;  2K02 A;  1MZB A;  1J5Y A;  1AOY A;  2H6B A;  2VXZ A;  2ZO4 A;  4IJA A;  3V8K A;  3G73 A;  2CW0 F;  2STT A;  4KIB A;  2ZJ2 A;  1IXR C;  2EB7 A;  2EV5 A;  3D5L A;  1EH8 A;  3TQN A;  4HDV A;  5JHU A;  3NRV A;  1P6R A;  4AWX B;  2EV6 A;  4L9N A;  5IT3 A;  4G6D A;  2QVO A;  4BAY A;  1XDU A;  1HSJ A;  3HRT A;  1QBJ A;  3F8F A;  2NYX A;  4YII A;  3ELK A;  1J75 A;  2QZ8 A;  4UV9 A;  3CJN A;  3GFL A;  3HSF A;  3BP8 A;  3MQ0 A;  2L01 A;  3WE2 A;  3MZH A;  1Z91 A;  3M8F A;  2A69 F;  3L00 A;  1Z05 A;  5EEG A;  2DT5 A;  5ICF A;  4G94 A;  3HUG A;  1MDM B;  3RKY A;  3L2C A;  2RDP A;  3WTY C;  3C18 A;  3JSP A;  1BI0 A;  1XDS A;  4RGX A;  4L9T A;  2VN2 A;  1TTY A;  2MH9 A;  3E5X A;  1J0R A;  4RGU A;  4Z2Y A;  4A0Z A;  1T39 A;  4R8H A;  1UHM A;  5FB2 A;  3C1D A;  4HX4 A;  3U1D A;  4AIK A;  5E8G A;  2XGX A;  4IXA A;  1YYV A;  3DF8 A;  4IVN A;  2BE5 F;  4ESJ A;  3LAJ A;  2WTE A;  3JSO A;  2JT1 A;  3MEX A;  1UHW A;  4L5J A;  1S7O A;  2YX7 A;  2BV6 A;  1K78 A;  3VFZ A;  1W7P B;  2FQ3 A;  2XHK A;  1R23 A;  2L3D A;  2GXB A;  2V9V A;  5LGT A;  3R6S A;  3KET A;  1WSU A;  4ZZL A;  4KIC A;  2JPB A;  1FX7 A;  2HQN A;  3BPV A;  4UHT A;  4Q4Z F;  4CO8 A;  1ZRD A;  3ABU A;  1KYZ A;  5HDG A;  4KN7 X;  1R1T A;  5HS7 A;  3CUQ B;  1LJ9 A;  2OU2 A;  2PBI A;  3TDZ C;  2RN7 A;  3U2R A;  1D8J A;  4RB0 A;  2DQR A;  2GQQ A;  1U8R A;  4EJT A;  3SHF A;  1SMT A;  2D2W A;  2M8E A;  2A3S A;  4HV5 A;  3BWG A;  3TOB A;  3ULQ B;  2E1N A;  1PP8 F;  4YIF A;  1D5V A;  1SFU A;  4Y13 A;  3I0T A;  1Y0U A;  3RPQ A;  2VOO A;  3L09 A;  3W6K B;  4ON0 A;  1T98 A;  2KRF A;  4G6Q A;  1DPU A;  2MH2 A;  1YIO A;  2E7X A;  3QU3 A;  1C0W A;  2DU9 A;  2V1X A;  3SQN A;  2DI3 A;  3B02 A;  2P5K A;  2UXN A;  1K7A A;  2PJP A;  4R1H A;  5H6Q A;  2CWE A;  2L02 A;  5L3E A;  1HW5 A;  1UB9 A;  4HV6 A;  4L0Y B;  2F5C A;  2FOK A;  2L4A A;  3FXU A;  4WXD A;  3QAH A;  2FMY A;  1G3Y A;  4WX9 A;  2OQG A;  1PUE E;  1GXP A;  1R1U A;  3ML6 A;  1FBS A;  3IC7 A;  1R7J A;  4CDG A;  3ZQ7 A;  1OR7 A;  2ETH A;  3FXR A;  3EDP A;  3KFW X;  1ZGJ A;  2JSC A;  4F7Z A;  3DPT A;  1FOK A;  3SFZ A;  1KQ8 A;  1IW7 F;  2Z9O A;  2A6H F;  6PAX A;  3W6J B;  1VTN C;  1SMY F;  4GCV A;  2H94 A;  3MCZ A;  4ENK A;  1KU3 A;  1B4A A;  3VEP A;  1Z9C A;  1W4M A;  1P92 A;  1H0M A;  5HLH A;  1USS A;  2RKH A;  1S6L A;  2XRO A;  4MHG A;  1IUY A;  4H0E A;  2QBY B;  1R22 A;  3T8R A;  2P6T A;  3T5X A;  2IW5 A;  3FZV A;  4YFN F;  3ECH A;  1UFM A;  4BNC A;  1IN6 A;  1CF7 A;  2HDC A;  1W7P D;  4A12 A;  3WTU C;  4HZF A;  4KMF A;  2R7F A;  2ZKZ A;  1UST A;  4LD5 A;  5AIP A;  4PGG A;  4G8X A;  3WOD F;  3QRF F;  2RGV A;  2XV4 S;  2F5E A;  3K0L A;  3O2P E;  4O5V A;  1P4W A;  3ROU A;  5D8K B;  2M87 A;  4M72 A;  4HBL A;  5TJJ A;  4RGS A;  1BIA A;  2EFO A;  2J5P A;  5DD4 A;  1WI9 A;  1EH7 A;  1XGM A;  5HS8 A;  5FFZ A;  2QQB A;  2EV0 A;  4LFU A;  1ZRE A;  2PQ8 A;  4HAM A;  2EA4 A;  3GUD A;  2P7V B;  2IA1 A;  3H3Z A;  5CVI A;  1WRJ A;  3DV8 A;  2G9W A;  1LEB A;  1B9N A;  4O6J A;  2PG4 A;  3TO9 A;  3K2Z A;  2ZCW A;  5HLI A;  2FXA A;  2GIV A;  3KLN A;  5LEK A;  1E17 A;  3H3U A;  5ILV A;  3RDI A;  4QLC U;  5CVV A;  2D45 A;  3F8C A;  1HQC A;  3S2W A;  1FYK A;  4A6E A;  2HS5 A;  2COM A;  2HTS A;  3H92 A;  2W24 A;  5LHG A;  2MD5 A;  1BI1 A;  3F72 A;  1STZ A;  3I71 A;  1YS7 A;  4LB6 B;  1I27 A;  1H9T A;  2PMU A;  4EJU A;  1HBX G;  1ZH5 A;  4BQA A;  1S3J A;  3F8M A;  4ZYE A;  3WE3 A;  3ZPL A;  1Z7U A;  1MJB A;  2HQR A;  2QBY A;  2BEO A;  2NNY A;  3EYI A;  1GHC A;  4CHU A;  3HOS A;  1B1B A;  1FSH A;  2RQP A;  1O57 A;  2ZME B;  3K1P A;  2JTV A;  2XKP A;  3ZN1 A;  4LLN A;  2DAO A;  4AIH A;  5ICG A;  1IN4 A;  4JBA A;  3RJP A;  2O6G E;  4WXC A;  2HKX A;  1FYL A;  1XGS A;  1RUN A;  4HQM A;  4HQE A;  2HEO A;  4D0P A;  1S29 A;  5L3G A;  3WTZ A;  2FBH A;  2J5O A;  3E5Q A;  2EWN A;  1IN7 A;  3WTS C;  5JFR A;  5E1Z B;  3HHG A;  4ENJ A;  3Q9V A;  1I6X A;  4RB3 C;  2D1H A;  5FD6 A;  5HLG A;  5JR3 A;  2YR2 A;  2XAQ A;  3O6B B;  1K6O A;  1U2W A;  4MTD A;  4L9V A;  2LKP A;  4RGR A;  1YS6 A;  1XGN A;  1YLF A;  4ESB A;  1YW9 A;  2IVM A;  2Z99 A;  3P9I A;  2K7L A;  3BZ6 A;  5BPI A;  3GZ5 A;  3G3Z A;  5IT9 Z;  1S8N A;  1B6A A;  2BYV E;  4Q48 A;  2OA4 A;  3I64 A;  2BGC A;  2NS0 A;  2F5F A;  3VOE A;  2WV0 A;  4KDP A;  3JW4 A;  3COA C;  1O3R A;  1RZ4 A;  1E2X A;  2RVC A;  3DKW A;  4N9H A;  4WCG A;  1KU7 A;  5D5W B;  1R5H A;  4HF1 A;  1RI7 A;  4Y15 A;  5D4R A;  1JHH A;  2F5D A;  1DUX C;  2HGC A;  2QEN A;  4UUV A;  4WWC A;  2EFQ A;  3V4G A;  1FP1 D;  2YX4 A;  4A5N A;  4ESF A;  2A61 A;  5E17 F;  1BJA A;  1YW7 A;  5DCF A;  1SD5 A;  3IRQ A;  3KP2 A;  4U88 A;  1Z6R A;  3HHH A;  1FT9 A;  1I1S A;  3GX4 X;  1SFE A;  1JXS A;  1Q1H A;  3DEU A;  2QYO A;  1IXS B;  2W57 A;  3M9A A;  2VBZ A;  2ZXJ A;  3HOT A;  1QNT A;  4PDK A;  4PZJ A;  5KK1 A;  2DO7 A;  1ON2 A;  3WGI A;  3E6D A;  4BXU A;  3IKV A;  2LNB A;  1J2X A;  1ODD A;  5D5U B;  4BHC A;  1ZRC A;  4HF2 A;  4M6X A;  4UVB A;  1D8K A;  3HSR A;  4XRF A;  3CO7 C;  4A0X A;  5IT9 K;  4UXN A;  1RNL A;  2NRA C;  4ZYG A;  1ZG1 A;  2M1B A;  4EGY A;  2H27 A;  4EV0 A;  1ZYR F;  1OYW A;  2DQL A;  5LBQ A;  4ENM A;  3RPU A;  2DW4 A;  3ZP5 A;  5K5O A;  2IT0 A;  4L0Z B;  2E7W A;  2VC0 A;  2D1V A;  3P9K A;  4IHS A;  1J7K A;  4I7H A;  3MFK A;  3L9F A;  4UNO A;  4FHT A;  1EV7 A;  2XAF A;  2STW A;  4EM0 B;  3E6M A;  4BHB A;  3T0Y A;  2FML A;  1RIO H;  3F23 A;  3M1E A;  3J7A O;  3J80 Z;  2K27 A;  1OPC A;  1P2F A;  4LG0 A;  2HKO A;  3NEU A;  5LEJ A;  3DFG A;  3PQJ A;  3JTH A;  2Y75 A;  4P9F A;  3GFI A;  4FT8 A;  3C3W A;  5A2Q Z;  4KYW A;  1XSV A;  2FRH A;  3FF5 A;  2HYG D;  4A2U A;  5F6F A;  1FWZ A;  4CGZ A;  1OKR A;  2KIU A;  3KLO A;  4MEX F;  3WGG A;  2CGP A;  1BIB A;  3I58 A;  1ZG3 A;  3I59 B;  3TO7 A;  3GFM A;  3GZ6 A;  4CIC A;  1IAW A;  4YFK F;  4HF0 A;  4UVC A;  3F6V A;  5ICC A;  3REO A;  3GLX A;  2VON A;  1HKQ A;  4FX0 A;  4RS8 A;  3PQK A;  2K4J A;  1BI3 A;  1ULY A;  3F3X A;  2PI0 A;  5D6F A;  2VOD A;  3I4P A;  4XLN F;  2PFB A;  1FLI A;  3HSE A;  2YPR A;  3V7R A;  2PMH A;  1MDM A;  1KQ0 A;  2OQR A;  1ZLJ A;  4EVI A;  3WU0 A;  1R1V A;  4B8X A;  3QOP A;  1GXQ A;  5LHH A;  4LK1 F;  2EA2 A;  4G7Z F;  1BBY A;  3GF2 A;  2V79 A;  2TDX A;  1MJA A;  5D8L B;  3LA7 A;  2P8T A;  1BI2 A;  5DV5 A;  1LDJ A;  1LDD A;  3BJO A;  5HOO A;  4EM2 A;  3IHU A;  5LRS A;  3ZN0 A;  5D4S A;  1ONV A;  3J80 K;  5K5R A;  2A07 F;  4GO1 A;  2GZW A;  4I0A A;  1TQI A;  2P4W A;  1SAX A;  2O8X A;  1WQ2 A;  3GVA A;  5F64 A;  4HYE A;  4XSZ F;  1KQ9 A;  5D5V B;  3KP6 A;  1K79 A;  3LA3 A;  1UCR A;  1SD6 A;  1W7P A;  1ZGA A;  1Z6T A;  2CYY A;  1FPQ A;  2NAZ A;  2GXG A;  3LQQ A;  3IL2 A;  4M74 A;  5A2Q K;  4O3M A;  3ZMZ A;  1A04 A;  3SZT A;  2VOP A;  3EET A;  1KGS A;  4E70 A;  4CYD A;  3E6B A;  2RC4 A;  3KEQ A;  3J81 K;  4LGW A;  5J8F A;  2QQ9 A;  2RV8 A;  2OZU A;  2BBY A;  3SZP A;  2VE9 A;  2XAH A;  1QGP A;  5E1X A;  2P6S A;  2Z3Y A;  3V7S A;  3VB2 A;  1HST A;  3EYY A;  3CUQ A;  2QQA A;  5E8I A;  4ASN A;  1YQA A;  3CLO A;  2XIG A;  1OYI A;  2O3F A;  3N97 A;  2JZY A;  3QU6 A;  3WGH A;  4I09 A;  3BJA A;  1FSE A;  2Y48 A;  2PN6 A;  1ZN2 A;  4ZYD A;  2UZK A;  2KIF A;  4HX7 A;  1KA8 A;  3I59 A;  5D5X B;  5D6E A;  3KCC A;  4KNY A;  1CGP A;  2OAZ A;  2MLG A;  2OD5 A;  4L18 B;  2FNA A;  3RKW A;  2MLK A;  3LST A;  1U3E M;  1MJ9 A;  4HA8 A;  5DCM B;  2CSO A;  4M6Y A;  1I5Z A;  3SXY A;  4A0Y A;  4OIO F;  3R60 A;  2G7U A;  3BY6 A;  5FD5 A;  4MQV A;  3LAP A;  1V4R A;  1LNW A;  1YTY A;  4P96 A;  5CVU A;  5BS6 A;  3OOP A;  2R7D A;  1O3T A;  4EJW A;  5E20 A;  3M8E A;  2DK5 A;  2IRF G;  3MZY A;  3GXO A;  5HDK A;  1T6S A;  3O3K A;  3ISP A;  1B9M A;  2A5Y B;  1O3S A;  1ZAO A;  2GAU A;  2LF7 A;  1OYY A;  4MNU A;  4EM1 A;  2EFN A;  1HKT A;  4U7D A;  3B73 A;  3OV8 A;  4I2O A;  4HDU A;  5E18 F;  4OMY A;  1IN8 A;  2L4M A;  1G3S A;  5BMZ A;  4IRG A;  3I5U A;  4IHT A;  2QM3 A;  5HDN A;  5K1Y A;  3JTG A;  2M30 A;  4I02 A;  2NNN A;  4PGH A;  5LHI A;  2FU4 A;  1R5G A;  5EEH A;  2CQK A;  1U78 A;  1U5T B;  2O0Y A;  2VT3 A;  3ZMS A;  3RI4 A;  2DLL A;  4JQF A;  2KIM A;  4ZH4 F;  1YW8 A;  4DNC A;  1T2K A;  2DTR A;  2HZT A;  1O7L A;  3KE2 A;  1MGT A;  1BN5 A;  1FZP B;  1DDN A;  4YG2 F;  4S04 A;  4FX4 A;  3HRS A;  4BYY A;  2FE3 A;  1B59 A;  1ZRF A;  3BJ6 A;  2KKO A;  5TRD A;  2HYF A;  5L3F A;  4KMU X;  4HLY A;  3U9G A;  2ZBK A;  3K1N A;  1NHA A;  1TBX A;  4NQW A;  4GXO A;  3I53 A;  3R0A A;  5LRR A;  1DP7 P;  1G3W A;  4P55 A;  2H09 A;  3LFK A;  1WKM A;  3V7C A;  3JAM Z;  2Z5U A;  5DCM A;  3KEO A;  2XRN A;  2E1C A;  5AON A;  4KIG A;  4EQQ A;  1XN7 A;  2UXX A;  2DPU A;  3EQL F;  3K1M A;  3DQV C;  5BQT A;  1J9I A;  3QP6 A;  4N9I A;  1G6N A;  1P4A A;  2WC2 A;  5FLX K;  2XAG A;  2FBI A;  3GEZ A;  2QWW A;  2IJL A;  4ZYH A;  3WTW C;  2PEX A;  4LLL A;  1TQM A;  1LVA A;  1K78 B;  3EUH A;  3CUQ C;  3Q9S A;  3FX3 A;  5H6R A;  4U0Y A;  1MKM A;  1AWC A;  2XAJ A;  2PLY A;  3K9T A;  3DXJ F;  4RB1 A;  3R4K A;  1OMI A;  1TLH B;  5FGM A;  4P5O A;  4GYI A;  2IA2 A;  2DBB A;  2O61 A;  4IPA A;  5JVT A;  5CJ9 A;  4M9S A;  4I98 B;  4AVP A;  2P5L C;  1U5T A;  2F2E A;  3ERE D;  4WK8 F;  1KU2 A;  2HWV A;  2ZME A;  4UVA A;  1YO5 C;  2K86 A;  4NHJ A;  4RAZ A;  4M73 A;  3FMR A;  2O03 A;  1IXC A;  5K5Q A;  4NB5 A;  3R0J A;  4AD9 A;  5DEQ A;  4MEY F;  3IWZ A;  1S7A A;  2AXL A;  2MA3 A;  1YG2 A;  4LB5 A;  2R3S A;  4U7B A;  1PDN C;  3JAM K;  1W5S A;  4KUM A;  5BPD A;  1Z1D A;  5DUK A;  1QZY A;  1FBU A;  3K69 A;  4BH9 A;  2ISZ A;  2FSW A;  1FNN A;  4A5M A;  3FXQ A;  4LJZ F;  4LK0 F;  4Q47 A;  3KP7 A;  5ILU A;  2VBW A;  4BHP A;  4OIQ F;  4GYG A;  1QZZ A;  3FM5 A;  3TGN A;  4AIJ A;  1FYM A;  1REP C;  4RB2 C;  2IA0 A;  2EFW A;  5DUI A;  2RNJ A;  4CZZ A;  3FWE A;  1XB4 A;  2FBK A;  3ECO A;  3BPX A;  3F8B A;  5HS9 A;  2LF8 A;  4M71 A;  3QPH A;  3P9C A;  4R79 A;  1QPM A;  1XCB A;  2QUF A;  3E3V A;  3CDH A;  4EJO A;  3BOQ A;  3D0S A;  4I01 A;  3RKX A;  1ON1 A;  2MBF A;  4U0W A;  1U6G A;  3WTT C;  1R58 A;  4RAY A;  1IF1 A;  1YFH A;  2V1U A;  4OIN F;  1H9G A;  3M7G A;  1BC8 C;  3BRO A;  2VBX A;  1F5T A;  2HOE A;  4L9J A;  3DP7 A;  1HW1 A;  1X3U A;  4U0V A;  1QQI A;  3P7N A;  5L3D A;  3IRR A;  3J81 Z;  2KJB A;  2CG4 A;  1CF7 B;  3E97 A;  5DDG A;  1BOA A;  2KJC A;  1SD4 A;  4S05 A;  2IPQ X;  5ICE A;  3HRU A;  3HYI A;  4EJV A;  3HTU A;  5ED4 A;  1IZ1 A;  3E5U A;  3E6C C;  4WF2 A;  3GYH X;  3LQR A;  4KFC A;  4IRI A;  2WWY A;  1TW3 A;  2ADU A;  2B0L A;  4N0B A;  2VE8 A;  2H6C A;  2V1D A;  1O3Q A;  2FF4 A;  4P9U A;  1IRG A;  4XLP F;  1D3Y A;  4ENN A;  5LGN A;  3CTA A;  1JHF A;  1W5T A;  2JRT A;  1HKS A;  3AAF A;  1XD7 A;  3KP5 A;  3WU1 B;  3ZMT A;  5LGU A;  1F1Z A;  3Q5F A;  1T38 A;  4G9Y A;  2W85 A;  4KN4 X;  5E1W A;  2HTJ A;  3MWM A;  4KIF A;  2HR3 A;  1U5T C;  2FNP A;  3GO5 A;  2P5V A;  1DPR A;  5J6X A;  3IWF A;  2QLZ A;  4XSX F;  3F21 A;  1T0F A;  2ELH A;  1LEA A;  2IP2 A;  2YU3 A;  2DPD A;  1KYW A;  1TW2 A;  5H20 A;  2GA2 A;  4HW0 A;  3HRM A;  2Q2E A;  3CO6 C;  1FY7 A;  1ZLK A;  3KZZ A;  4M9X A;  3C7J A;  1R00 A;  2FA5 A;  4IRH A;  2EFP A;  3FM3 A;  2EJR A;  3WTX C;  3TDU C;  2ESN A;  3IKT A;  4KT5 C;  4PCQ A;  5FO5 A;  5ERI A;  4OIR F;  4OIP F;  2VT2 A;  1JGS A;  3GFJ A;  4Y17 A;  5CYV A;  3RYR A;  1HW2 A;  1WWX A;  4MTE A;  2VC1 A;  1LDK B;  2W25 A;  4QWQ A;  3HIF A;  2X0L A;  2HFH A;  4HX8 A;  5AIQ A;  3VOD A;  4OOI A;  1P4X A;  1XSX A;  3T1B A;  5ILS A;  2A6E F;  1XGO A;  1SFX A;  1QO0 D;  1TNT A;  1FC3 A;  4MGR A;  3TOA A;  2OZ6 A;  3GW2 A;  2ISY A;  1RUO A;  5FFX A;  5L3C A;  2AS5 F;  3ZMD A;  3QPT A;  3T8T A;  2EK5 A;  5LLQ A;  1SD7 A;  1JE8 A;  4LLG F;  1KU9 A;  2DK8 A;  3L7W A;  3BDD A;  3R61 A;  1LQ1 A;  4G7O F;  3F6O A;  1HXD A;  3RYP A;  1L3L A;  1BC7 C;  1LB2 A;  5KVR A;  4A6D A;  2Z33 A;  5DD8 A;  2UWM A;  4EMS A;  1G3T A;  4HLX A;  4OMZ A;  2MC3 A;  2ZFW A;  2CO5 A;  2VBY A;  5BOX A;  5CVR A;  3ZMV A;  2XUB A;  4ETS A;  1J59 A;  5FLX Z;  3FHZ A;  5L3B A;  2A68 F;  3I54 A;  3HTS B;  1ZHF A;  3GWZ A;  3ABT A;  4B09 A;  5HVQ C;  1IRF A;  2JPC A;  2M45 A;  4TV7 A;  2YSR A;  2Q8K A;  1F9N A;  5CVJ A;  1XSD A;  5CLS A;  3N4M A;  4IF4 A;  2P7C B;  3TKY A;  2XKO A;  2FEZ A;  3NQO A;  4KA4 A;  3KZY A;  3KP3 A;  2CFX A;  3WTV C;  2V6C A;  1GVJ A;  5DYM A;  3LA2 A;  4YFX F;  3MAJ A;  2G7H A;  1I1G A;  2ACJ A;  2C6Y A;  2XAS A;  2XVC A;  4WXH A;  4LMY A;  5F1R A;  2ESH A;  1BM9 A;  1XCV A;  2GA1 A;  2K4B A;  2X4H A;  1ZG5 A;  1XMK A;  1IN5 A; 
#chains in the Genus database with same CATH topology
 3PFI A;  2IS1 A;  4MQ9 F;  2Y0M A;  4ZZD A;  1W5C C;  2DFI A;  3CUO A;  4OU0 A;  1FP2 A;  4DQ2 A;  2VQL A;  1UMQ A;  4UV8 A;  2LSO A;  3ZMU A;  1AA7 A;  3ZRG A;  2JVH A;  1PP7 U;  3ABL H;  1O7F A;  1R36 A;  3WG9 A;  1CQT A;  3F22 A;  1JJ6 C;  3F8N A;  4GGG A;  2VPR A;  2HOT A;  1P9Q C;  3CCQ I;  5J8C A;  3OYE A;  4V2G A;  5JI6 A;  1YHQ I;  2Q0O A;  3RIR A;  1TQP A;  2R0Q C;  2L54 A;  1T0F C;  2M5W A;  1TT0 A;  4HG2 A;  4G7H F;  1EH6 A;  1V3F A;  2GWR A;  3HPH A;  2DA6 A;  3FMQ A;  1S5L C;  1LFP A;  1D5Y A;  3QP5 A;  3TO6 A;  1B72 B;  1SVM A;  3CQZ J;  4FQG A;  4Q5S F;  4L5I A;  2OBP A;  2W84 A;  3KP4 A;  2XF6 A;  2ZNZ A;  3ONQ A;  3LWF A;  4XLA A;  1XMA A;  3V8J A;  5EJC A;  3OL3 A;  2LDU A;  2DFF A;  3RTR A;  4BDY A;  3CMY A;  4C2U A;  1F4K A;  3V8L A;  2L5Q A;  4K2E A;  1MD0 A;  1SAU A;  4XBF A;  2L2O A;  4IOC F;  3HOZ J;  1DP3 A;  4CXF A;  3G1L A;  4RAG A;  3J7Y J;  1G4D A;  1ZAR A;  4M3B A;  3FMS A;  3OYJ A;  4HOB A;  4EGZ A;  4LG0 B;  1FBQ A;  4JK1 X;  4RAF A;  3FKJ A;  4XR6 A;  1R49 A;  4LIT A;  3DPL C;  2ZNY A;  1TNS A;  1TWA J;  4I0B A;  4M9Z A;  1L0O C;  2K02 A;  1MZB A;  1J5Y A;  3J7A Y;  2M3A A;  3JRI A;  2HDW A;  1AOY A;  2H6B A;  2XF5 A;  4W1U A;  2VXZ A;  4ABZ A;  2CQ7 A;  4F92 B;  2ZO4 A;  4IJA A;  3V8K A;  3ZCO A;  2BY2 A;  3G73 A;  2CW0 F;  2STT A;  5KAI C;  4KIB A;  3ZXS A;  2LRD A;  1IXR C;  2EB7 A;  2ZJ2 A;  1TWC J;  2EV5 A;  3D5L A;  3FBN B;  5IOZ A;  1EH8 A;  3TQN A;  4LIU A;  2MC4 A;  4HDV A;  2IAI A;  5JHU A;  3NRV A;  1P6R A;  1EF4 A;  4AWX B;  2EV6 A;  2ZXI A;  3G2B A;  4MIM A;  3NWS A;  4L9N A;  2GXA A;  1Z21 A;  4UUS B;  1V5F A;  5IT3 A;  1W1W E;  2DN0 A;  1FOY A;  2FJ1 A;  5EGO A;  4G6D A;  3I56 I;  2EZI A;  1X1C A;  2QVO A;  4BAY A;  1ZK8 A;  1VQ6 I;  4JOM A;  2JA6 J;  3IP4 B;  1XDU A;  1HSJ A;  4ZJZ A;  1MH3 A;  3HRT A;  1QBJ A;  3F8F A;  2NYX A;  4YII A;  3ELK A;  3PSI A;  1W36 C;  3BR1 A;  1J75 A;  1E0E A;  3BG7 A;  3FXK A;  2X1C A;  2QZ8 A;  4UV9 A;  3TMO A;  2OV7 A;  3S32 A;  3TP3 A;  3CJN A;  4E4H A;  3GFL A;  1K83 J;  3HSF A;  3TED A;  3BP8 A;  3MQ0 A;  2L01 A;  1JKR C;  3WE2 A;  3NAU A;  3MZH A;  1Z91 A;  3M8F A;  2A69 F;  3L00 A;  2ELK A;  1Z05 A;  2EQR A;  5EEG A;  2DT5 A;  5ICF A;  1WCM J;  1WJE A;  4G94 A;  3HUG A;  2Y31 A;  4B3A A;  1MDM B;  3RKY A;  2WA0 A;  2R93 J;  3L2C A;  2GBY A;  1OCO H;  5EEA A;  2RDP A;  3WTY C;  3C18 A;  3JSP A;  1BI0 A;  4DZP A;  1XDS A;  1MND A;  1D0X A;  4RGX A;  3W2W A;  4RMN A;  1WJD A;  4L9T A;  1UEL B;  4DBR A;  2VN2 A;  1TTY A;  1OLT A;  5EG0 A;  2MH9 A;  1MSF C;  3E5X A;  5GPC A;  1J0R A;  4N4N B;  3EUK L;  4RGU A;  5GPA A;  2CH0 A;  4BQN A;  4Z2Y A;  4A0Z A;  1T39 A;  4R8H A;  4F91 B;  1UHM A;  3AKZ A;  5FB2 A;  3C1D A;  2OC6 A;  4HX4 A;  3FXJ A;  2EH3 A;  3K70 C;  3U1D A;  1X2M A;  5E8G A;  4AIK A;  2BVM A;  2XGX A;  1HCR A;  2WAQ A;  4IXA A;  1IC8 A;  1YYV A;  2CW8 A;  3DF8 A;  3KYD B;  4IVN A;  2BE5 F;  3BCB A;  4NC7 A;  4ESJ A;  3LAJ A;  4QTR A;  4II3 A;  1OCT C;  2WTE A;  3JSO A;  4NNJ A;  3BR5 A;  3I3L A;  4D5C A;  3SJM A;  2JT1 A;  3O8H A;  4UB8 C;  5E3L A;  2KP6 A;  1UHW A;  3MEX A;  3HEF A;  1ERD A;  1MBK A;  5TIS C;  1PUF A;  4BU2 A;  4L5J A;  1S7O A;  2YX7 A;  2PMZ A;  2BV6 A;  2VJI A;  3L2W A;  1BW6 A;  4XOT A;  3ZGK A;  2BXY A;  1K78 A;  3VFZ A;  2MGQ A;  2CV1 A;  2GLO A;  1JJ8 C;  1KZH A;  1W7P B;  2WB1 A;  2F5V A;  2FQ3 A;  2XHK A;  1R23 A;  2L3D A;  2GXB A;  3HXL A;  2V9V A;  5LGT A;  3R6S A;  3RPU D;  3S17 J;  3KET A;  1WSU A;  4ZZL A;  4RM2 A;  2NOG A;  5FKM A;  2A5W A;  4KIC A;  2JPB A;  1FX7 A;  2MW8 A;  4Y52 J;  2HQN A;  2I10 A;  2IGN A;  2DA4 A;  4E7L A;  3BPV A;  1EJ9 A;  3DTE A;  2XDV A;  4UHT A;  3H36 A;  3L2U A;  1VQM I;  3AFH A;  4Q4Z F;  4XN3 A;  3F9K A;  3DLA A;  2HQA A;  4CO8 A;  4C2T A;  2HOA A;  1ZRD A;  3ABU A;  1KYZ A;  5HDG A;  1AHD P;  1XG1 A;  2VQG A;  1OCC H;  4KN7 X;  1R1T A;  3CCL I;  1GT0 C;  5HS7 A;  1EA3 A;  3JCU C;  3CUQ B;  1LJ9 A;  2OU2 A;  2PBI A;  3TDZ C;  2NVT J;  2YU9 J;  4J19 A;  2RN7 A;  2F6C A;  3U2R A;  2V1N A;  1D8J A;  4RB0 A;  3CP8 A;  2DQR A;  2GQQ A;  1YI2 I;  1U8R A;  4EJT A;  3SHF A;  1LVK A;  5FRO A;  3G6E I;  1SMT A;  2D2W A;  2M8E A;  4OAZ A;  3A01 B;  2A3S A;  4HV5 A;  3BWG A;  3TOB A;  3ULQ B;  1D0Y A;  3MN2 A;  3ASO H;  3OY9 A;  2E1N A;  4BJT A;  1PP8 F;  4YIF A;  1TC3 C;  3C2B A;  3OIP A;  2RNG A;  1D5V A;  2HVR A;  3FBI B;  3D1N I;  1SFU A;  2JJ7 A;  4Y13 A;  3I0T A;  1W0T A;  1Y0U A;  3RPQ A;  3SEZ A;  2DA2 A;  1MMA A;  2VOO A;  3L09 A;  2HXO A;  3W6K B;  4ON0 A;  2VJ5 A;  1T98 A;  2KRF A;  2XAU A;  4G6Q A;  1MMS A;  2MH2 A;  1YIO A;  4C3J J;  1DPU A;  2E7X A;  3QU3 A;  1C0W A;  2DU9 A;  4XM3 A;  2V1X A;  3SQN A;  2DI3 A;  5B3S H;  3B02 A;  2UXN A;  2P5K A;  5E79 C;  1X1P A;  1R4M B;  1ETK A;  2E1O A;  1RR7 A;  1K7A A;  3V42 A;  2XC7 A;  2PJP A;  4R1H A;  5H6Q A;  2CWE A;  2L02 A;  5L3E A;  1HW5 A;  1UB9 A;  4HV6 A;  2CJJ A;  4L0Y B;  2F5C A;  2FOK A;  2L4A A;  3FXU A;  4WXD A;  3WHB A;  3PIP F;  1VQ9 I;  3QAH A;  2FMY A;  1G3Y A;  3L2Q A;  4B43 A;  4WX9 A;  2OQG A;  1PUE E;  1GXP A;  1R1U A;  2I5U A;  4IX7 A;  3ML6 A;  3VSL A;  2OTJ I;  1FBS A;  3PL8 A;  3IC7 A;  4M3F A;  2KDZ A;  2Z1D A;  4P1W A;  1R7J A;  4CDG A;  3ZQ7 A;  4QPQ A;  1OR7 A;  2ETH A;  3FXR A;  4HRI A;  4A3C J;  3VYU B;  3EDP A;  2R7Z J;  3KFW X;  1ZGJ A;  1QU3 A;  2JSC A;  3DWL E;  2ZB9 A;  3FHN A;  1R9T J;  4BQQ A;  4F7Z A;  1MH4 A;  4A3J J;  2VI6 A;  2Y9Z A;  4DIQ A;  1DGW Y;  3DPT A;  4IKF A;  2R7T A;  1FOK A;  3SFZ A;  1ZEL A;  1KQ8 A;  1IW7 F;  2Z9O A;  1RES A;  2A6H F;  4UB6 C;  6PAX A;  3W6J B;  1VTN C;  1SMY F;  4GCV A;  2H94 A;  2EIJ H;  3MCZ A;  4ENK A;  1KU3 A;  1B4A A;  1GV2 A;  1YRN B;  2WAD A;  1RPW A;  3VEP A;  1Z9C A;  1W4M A;  3PO2 J;  5EF6 A;  2E36 A;  1R4N B;  3VWB A;  1GUU A;  4KJZ A;  1P92 A;  1H0M A;  5HLH A;  2B63 J;  3M4O J;  1XX5 A;  2X6W A;  2KLO A;  1USS A;  2RKH A;  4S0H B;  4Y7N J;  1I3Q J;  1S6L A;  2LMD A;  1YE9 A;  3OMY A;  2XRO A;  3Q3S A;  4MHG A;  2E19 A;  5GP9 A;  1MW7 A;  2VL8 A;  4H0E A;  1IUY A;  5IYD J;  4F93 B;  2QBY B;  1A6Q A;  2LKX A;  1BR1 A;  2E5N A;  1R22 A;  2FQ4 A;  5F0H A;  1VI0 A;  3T8R A;  2P6T A;  3T5X A;  2IW5 A;  2AQE A;  3SDB A;  3H5A A;  1JUM A;  2BZT A;  4BEH B;  1JT0 A;  1GDT A;  3FZV A;  4X0G A;  3VYT B;  2WAF A;  2QKM B;  4YFN F;  3ECH A;  1UFM A;  2UV1 A;  1U9N A;  1RKW A;  5IY5 H;  4BNC A;  1LFB A;  1IN6 A;  1CF7 A;  2HDC A;  1W7P D;  4A12 A;  3WTU C;  4HZF A;  2BY1 A;  2ID6 A;  4AVZ A;  2VAS A;  1YIT I;  4KMF A;  2WAE A;  3LSH A;  2R7F A;  2ZKZ A;  1UST A;  4LD5 A;  5F0C A;  3OYG A;  2Y2Z A;  5AIP A;  2IGO A;  3A01 A;  2D5V A;  4PGG A;  4G8X A;  1SFK A;  3M07 A;  3N05 A;  3WOD F;  3QRF F;  1RRJ A;  2RGV A;  3S14 J;  1ETV A;  2XV4 S;  4GRI A;  3S93 A;  5FRN A;  4JP0 A;  1N78 A;  4NBQ A;  2F5E A;  2O5R A;  3K0L A;  1YOV B;  3O2P E;  1MNM C;  4O5V A;  4AC0 A;  5JHF A;  1P4W A;  4NQW B;  3ROU A;  3AG2 H;  5D8K B;  2M87 A;  4M72 A;  2DFE A;  2LBF B;  2KRH A;  2HPM A;  4JYK A;  4HBL A;  2DTZ A;  3DEE A;  1WJB A;  2VLA A;  2BHY A;  2GIZ A;  5TJJ A;  3KX2 A;  4RGS A;  4E7S A;  1BIA A;  2DDB A;  2EFO A;  2J5P A;  1IUF A;  5DD4 A;  1WI9 A;  1EH7 A;  3PNY A;  2E35 A;  1XGM A;  5F04 A;  5HS8 A;  5FFZ A;  2QQB A;  3A02 A;  5HNF A;  2EV0 A;  4LFU A;  1ZRE A;  2PQ8 A;  2X1D A;  4HAM A;  3HKZ A;  2EA4 A;  4XMY A;  3GUD A;  3DTK A;  2L9V A;  3VPR A;  2JA8 J;  4ZDO A;  1SC7 A;  2P7V B;  3RZO J;  3ZQQ A;  4BJ6 C;  2IA1 A;  3H3Z A;  5CVI A;  2WY8 Q;  2HU9 A;  1WRJ A;  1JGG A;  3DV8 A;  4Y3O A;  2G9W A;  2H8W A;  1OCR H;  5B5E C;  1HC8 A;  4F52 A;  3MKW B;  1B9N A;  1LEB A;  4O6J A;  2VQH A;  3BG3 A;  2PG4 A;  3TO9 A;  3K2Z A;  2ZCW A;  4KIT B;  3TBI A;  1E3O C;  1IV8 A;  5HLI A;  2FXA A;  2GIV A;  1WJA A;  1Y8R B;  3KLN A;  5LEK A;  2CV0 A;  1E17 A;  2KT0 A;  3H3U A;  3PM1 A;  5ILV A;  3RDI A;  4QLC U;  2R5Z B;  1PJR A;  1OJL A;  5CVV A;  1SAN A;  2D45 A;  2LG4 A;  2M8G X;  3F8C A;  1HQC A;  1UG2 A;  3S2W A;  3UR3 C;  1FYK A;  4GFB A;  3ZQL A;  4A6E A;  1VND A;  2HS5 A;  1N75 A;  2COM A;  4A3K J;  4V2F A;  1LUJ B;  2HTS A;  2KZV A;  3H5R A;  3H92 A;  4IEJ A;  2CS3 A;  3H3V K;  2LYC A;  2W24 A;  5LHG A;  5M3F J;  2MD5 A;  3NWT A;  2K9M A;  1BI1 A;  3F72 A;  3L2V A;  4A3F J;  1STZ A;  3I71 A;  1YS7 A;  4BJ5 C;  4AUX A;  4LB6 B;  1I27 A;  1LPQ A;  4E7I A;  3H35 A;  1H9T A;  2PMU A;  4EJU A;  1QVT A;  1HBX G;  1ZH5 A;  4BQA A;  1S3J A;  3CZ6 A;  3F8M A;  1ITY A;  4ZYE A;  1VQL I;  3WE3 A;  4X1E A;  2L9N A;  2M4G A;  1Z7U A;  5K7Z A;  1O4X A;  3ZPL A;  1MJB A;  4JX6 A;  2HQR A;  2QBY A;  1JKQ C;  2KIQ A;  2P0W A;  2BEO A;  2NNY A;  3EYI A;  1GHC A;  2DA5 A;  5F08 A;  4CHU A;  4A3B J;  2K9S A;  3H0G J;  3HOS A;  2VXD A;  1B1B A;  1FSH A;  5CPR B;  4HNT A;  2RQP A;  1O57 A;  2ZME B;  1N77 A;  3K1P A;  3K4M A;  2JTV A;  2XKP A;  3ZN1 A;  4LLN A;  1ETY A;  2TCT A;  2V4J C;  2YUS A;  3QYF A;  4HPQ A;  3OOU A;  1SVL A;  2DAO A;  4AIH A;  2ECC A;  5ICG A;  1IN4 A;  4JBA A;  4E7H A;  3RJP A;  3A0H C;  3HC7 A;  2O6G E;  3BQY A;  4WXC A;  1Q1V A;  2HKX A;  3VYR B;  1FIA A;  1ZGW A;  2JMW A;  1FYL A;  1D1A A;  1XGS A;  1RUN A;  1E3P A;  1QHH D;  4HQM A;  5KNL A;  4A3M J;  1F36 A;  1RET A;  2NVX J;  3QPS A;  3S3N A;  3QOD A;  2R7X A;  4HQE A;  2HEO A;  4D0P A;  3IV5 A;  5F1J A;  1X58 A;  1S29 A;  4A3I J;  2LK2 A;  2RQQ A;  2ZFU A;  5L3G A;  3OL4 A;  3WTZ A;  3PIO F;  2FBH A;  2J5O A;  4PJJ A;  4XOP A;  3FDY A;  1OR7 C;  4PFO A;  3E5Q A;  2EWN A;  1IN7 A;  3WTS C;  5IP9 J;  2ID3 A;  3CMA I;  5JFR A;  3ZQC A;  2M34 A;  5E1Z B;  3HHG A;  4ENJ A;  3Q9V A;  1I6X A;  5TGT A;  4PJN A;  4RB3 C;  1DQU A;  2D1H A;  5FD6 A;  1MNE A;  5HLG A;  1NTC A;  1A6I A;  2E1M B;  2LBF A;  5JR3 A;  2LTP A;  2YR2 A;  2XAQ A;  1EKE A;  2KRC A;  3TL4 X;  2M2E A;  3O6B B;  1K6O A;  1U2W A;  3GTQ J;  4MTD A;  4ITV A;  1JUS A;  1FTT A;  5KAF C;  4L9V A;  1DGR M;  2LKP A;  3LNQ A;  3OSF A;  5M5W J;  4RGR A;  1XGN A;  1YLF A;  1YS6 A;  4ESB A;  3G4S I;  1YW9 A;  4DYR A;  2DA3 A;  2IVM A;  2Z99 A;  3P9I A;  2K7L A;  4M3G A;  4PSW A;  1K4S A;  2X51 A;  3BZ6 A;  5BPI A;  2V7F A;  3GZ5 A;  3G3Z A;  3GBG A;  4XKC A;  5IT9 Z;  5IP6 A;  1S8N A;  3DKY A;  1B6A A;  2BYV E;  4Q48 A;  1WZ2 A;  4AID A;  2OA4 A;  2QSF X;  3K2A A;  3U1K A;  3I64 A;  2H1K A;  2BGC A;  3DCF A;  3DBH B;  2JA7 J;  2K3P A;  2NOJ B;  4E7K A;  2KZG A;  2NS0 A;  2FOW A;  2F5F A;  3VOE A;  2WV0 A;  5M5Y J;  2IGK A;  3E0J B;  4KDP A;  3ABM H;  3JW4 A;  3COA C;  5HNH A;  4OAY A;  1XTA A;  3CCJ I;  1O3R A;  3BT9 A;  4EEF G;  1RZ4 A;  1E2X A;  3PSF A;  2RVC A;  2ZXH A;  3DKW A;  4N9H A;  4WCG A;  1KU7 A;  5M5X J;  4IQ4 A;  5D5W B;  1R5H A;  4KIS A;  2BW3 B;  3G1O A;  4HF1 A;  2LY1 A;  4QIW N;  2QQ8 A;  1RI7 A;  3RZD J;  4Y15 A;  3DPU A;  5D4R A;  1JHH A;  3HDD A;  2F5D A;  3OYK A;  2DMN A;  4PFP A;  1DUX C;  2X6O A;  2HGC A;  2QEN A;  2PJR B;  3BR2 A;  1FMW A;  2W82 A;  4XKB A;  4UUV A;  4WWC A;  3BQZ A;  5F27 A;  2ZJR F;  2EFQ A;  3V4G A;  1FP1 D;  2YX4 A;  5E3N A;  4A5N A;  2DJI A;  4ESF A;  2NS7 A;  3GTJ J;  2A61 A;  4NDL A;  4YEL A;  1LE8 B;  4G6T B;  1Y1V J;  3S1N J;  5E17 F;  1BJA A;  1YW7 A;  3S1R J;  5DCF A;  2E2H J;  3QQA A;  2HVQ A;  2OUM A;  1SD5 A;  3LSG A;  3IRQ A;  3KP2 A;  4U88 A;  3A4C A;  1Z6R A;  4OWR B;  3HHH A;  3JRF A;  4XL9 A;  1BR2 A;  1FT9 A;  3GX4 X;  1I1S A;  1SFE A;  1Z7L A;  4HNU A;  2DYS H;  3JRG A;  1JXS A;  1Q1H A;  3DEU A;  2QYO A;  1IXS B;  2W57 A;  3M9A A;  1D1B A;  2XSD C;  2VBZ A;  2ZXJ A;  3HOT A;  1QNT A;  2HPI A;  2XGD A;  1NG6 A;  2JUC A;  4PDK A;  4CA0 A;  1UHS A;  5M3M J;  4ZTF A;  4PZJ A;  5KK1 A;  2WAQ N;  4XQF A;  4CCL A;  3CDL A;  4D7N A;  2DO7 A;  1ON2 A;  3WGI A;  1WJC A;  2IEK A;  2FD5 A;  1HF0 A;  3HG9 A;  3E6D A;  4BXU A;  2FUG 2;  3IKV A;  2LNB A;  3OYD A;  3LSR A;  1J2X A;  2CU7 A;  2H1L A;  1ODD A;  2PMZ N;  2W1O A;  3Q0W A;  5D5U B;  4BHC A;  1ZRC A;  4HF2 A;  1YX3 A;  4M6X A;  4UVB A;  2DMQ A;  1D8K A;  1Y6I A;  3CC7 I;  2LFB A;  2M7A A;  2WB1 N;  1VQ4 I;  2EIK H;  1WI3 A;  3IH4 A;  4ZC3 A;  3HSR A;  2IS6 A;  3DEW A;  4XRF A;  1VQN I;  3CO7 C;  3S8P A;  4A0X A;  4DJA A;  3OYA A;  5IT9 K;  4B44 A;  4UXN A;  2Y9Y A;  1FMV A;  5J40 A;  1BJZ A;  1RNL A;  2NRA C;  4ZYG A;  3AG3 H;  1ZG1 A;  1X2N A;  5GAG J;  1JTY A;  5E3O A;  2M1B A;  4EGY A;  4D1Q A;  5EYR A;  2H27 A;  2R5Y B;  4EV0 A;  1S7E A;  1ZYR F;  3OYL A;  1GLN A;  1OYW A;  2DQL A;  5LBQ A;  4DW6 A;  3OS0 A;  4ENM A;  3BZK A;  3RQI A;  1XMX A;  3RPU A;  2DW4 A;  4RLF A;  1QVU A;  3RKQ A;  3ZP5 A;  3OIO A;  3FKI J;  3ZQI A;  5K5O A;  2IT0 A;  4L0Z B;  2E7W A;  2VC0 A;  5KCM A;  3OYH A;  2D1V A;  3P9K A;  4IHS A;  1J7K A;  1WGX A;  4I7H A;  3MFK A;  3UKG A;  3AG4 H;  3L9F A;  4BQO A;  4UNO A;  2QEX I;  4XLC A;  2E34 A;  1EV7 A;  4FHT A;  1IJW C;  2F4O B;  2OJE D;  3DU6 A;  2XAF A;  4DYQ A;  3OYI A;  1MMG A;  2STW A;  4EM0 B;  3DBR B;  1XC5 A;  3LSM A;  3E6M A;  3I4M J;  4XRS G;  4BHB A;  2O8K A;  3T0Y A;  3ZR8 X;  2FML A;  1Z3X A;  2EBI A;  3W3C A;  1RIO H;  1X4P A;  3F23 A;  2E71 A;  2OTL I;  3GLL A;  3LSI A;  3K4K A;  5DS9 A;  3M1E A;  1X1B A;  4ANJ A;  3J7A O;  3J80 Z;  2K27 A;  1IG7 A;  1OPC A;  3HM5 A;  1G2H A;  1V5G A;  3QYB A;  2KHM A;  1P2F A;  4LG0 A;  1VQ5 I;  1U8B A;  2HKO A;  3NEU A;  5LEJ A;  3DFG A;  3PQJ A;  3JTH A;  3A1Y A;  4XLF A;  5J1R A;  4DGW B;  1Z0X A;  2BOL A;  1YIJ I;  2Y75 A;  3CMM A;  4P9F A;  3GFI A;  4FT8 A;  3PFY A;  3ERM A;  4QPO A;  3C3W A;  5A2Q Z;  4KYW A;  1VQ8 I;  1XSV A;  1LE8 A;  3PNT A;  3K4N A;  1AKH B;  2DFH A;  2FRH A;  3FF5 A;  5DM7 F;  2HYG D;  4A2U A;  5FLV A;  2LOO A;  5F6F A;  4AYB N;  1FWZ A;  3H1C A;  5LD2 C;  4CGZ A;  2R7R A;  1OKR A;  1G59 A;  1TWG J;  2KIU A;  3KLO A;  4MEX F;  3SEQ A;  2HDD A;  3WGG A;  4ZDL A;  2CGP A;  4UUS A;  1BIB A;  1HDD C;  3K4C A;  3I58 A;  1ZG3 A;  4IHW A;  3I59 B;  3TO7 A;  1X19 A;  4XLE A;  1POG A;  2R7W A;  3GFM A;  3GZ6 A;  4CIC A;  1IAW A;  4YFK F;  4HF0 A;  5IP7 J;  2P81 A;  3K4L A;  4MO7 A;  4UVC A;  3F6V A;  2LY9 A;  3REO A;  5ICC A;  2CV2 A;  3GLX A;  2MAB A;  2VON A;  1HKQ A;  4FX0 A;  4RS8 A;  3PQK A;  2LRE A;  2M7B A;  3QYE A;  2XF7 A;  2K4J A;  1BI3 A;  1ULY A;  3F3X A;  1WH5 A;  2W4S A;  3DKX A;  2PI0 A;  4FE4 A;  3A03 A;  3BC8 A;  2W7N A;  5D6F A;  2VIX A;  5JLX A;  2LLK A;  2VOD A;  3I4P A;  3CCV I;  4XLN F;  2PFB A;  5J4Y A;  3CCU I;  2LR8 A;  4BBR J;  1FLI A;  3HSE A;  4HSR A;  2YPR A;  3RQ4 A;  3V7R A;  2PMH A;  1MDM A;  4A3G J;  1KQ0 A;  1QHG A;  2OQR A;  1ZLJ A;  3CF5 F;  4EVI A;  1Z67 A;  2NVU B;  1R1V A;  3WU0 A;  4XID A;  2LY2 A;  3QOP A;  4B8X A;  1GXQ A;  3AL0 B;  2K5C A;  3PUF A;  5LHH A;  2XGC A;  3CC4 I;  4LK1 F;  3UNG C;  3BCA A;  4PJM A;  5FKL A;  2EA2 A;  4MFE A;  1T08 B;  1BBY A;  4G7Z F;  2QSG X;  3GF2 A;  2V79 A;  3JRD A;  2TDX A;  1MJA A;  5D8L B;  2F48 A;  1KON A;  3LA7 A;  3H0D A;  2P8T A;  1BI2 A;  3I4N J;  2ZJP F;  2ICW G;  5DV5 A;  1LDJ A;  1MMD A;  1LDD A;  3BJO A;  5HOO A;  2L7F P;  3BTI A;  1J09 A;  4EM2 A;  3IHU A;  1F43 A;  5LRS A;  3ZN0 A;  3SFI A;  5D4S A;  1ONV A;  1XS9 A;  1LKX A;  5GTH C;  3J80 K;  1R71 A;  3C2G A;  5K5R A;  2A07 F;  3IAM 2;  4GO1 A;  2GZW A;  4I0A A;  1TQI A;  2P4W A;  1SAX A;  2DT7 B;  3HGG A;  2O8X A;  1WQ2 A;  1TT5 B;  3GVA A;  5F64 A;  4HYE A;  4XSZ F;  4PUS A;  2Y69 H;  1WPK A;  2E5Z A;  1KQ9 A;  1BW5 A;  5D5V B;  4ZDP A;  3KP6 A;  3GCM A;  1ETX A;  5C3E J;  1K79 A;  3LA3 A;  1UCR A;  1SD6 A;  1W7P A;  3CDI A;  1ZGA A;  1Z6T A;  5HLT A;  2CYY A;  1FPQ A;  2NAZ A;  3BR0 A;  2GXG A;  3LQQ A;  3IL2 A;  2ZME C;  4M74 A;  5A2Q K;  4O3M A;  3O8G A;  3ZMZ A;  2K9L A;  5CKT A;  2LH9 A;  1K4T A;  1ACI A;  1A04 A;  4MLO A;  3SZT A;  2VOP A;  3EET A;  1KGS A;  4E70 A;  4CYD A;  2HYJ A;  2DYR H;  3GTK J;  4CZC A;  3E6B A;  2WV1 A;  4XK4 A;  4MFD A;  2RC4 A;  2EZK A;  3KEQ A;  3J81 K;  4LGW A;  5J8F A;  2WY7 Q;  2QQ9 A;  2RV8 A;  2OZU A;  2DOE A;  2BXZ A;  2IBD A;  2XPU A;  2BBY A;  2X48 A;  3SZP A;  3SYT A;  2XAH A;  2VE9 A;  4BBS J;  1QGP A;  5E1X A;  4G12 A;  2IS4 A;  2R7V A;  2P6S A;  2Z3Y A;  4XLH A;  3V7S A;  3VB2 A;  1HST A;  3EYY A;  3CUQ A;  1WHU A;  4C9Y A;  1A36 A;  3MVP A;  2QQA A;  4B4C A;  2Y30 A;  1W0U A;  5E8I A;  1IGN A;  3HKZ N;  3K7A J;  3OR2 C;  3HOU J;  2JSP A;  3BTL A;  1YQA A;  4I99 C;  4ASN A;  2L0K A;  3CLO A;  2XIG A;  1AKH A;  3TW6 A;  1OYI A;  2O3F A;  4Z6Y A;  2JZY A;  3QU6 A;  3WGH A;  4I09 A;  5J1Y A;  3BJA A;  3N97 A;  1FSE A;  2Y48 A;  2PN6 A;  4IHY A;  3GTP J;  5DTD A;  1ZN2 A;  3HOV J;  4ZYD A;  2E1M C;  2UZK A;  3HOW J;  2KIF A;  3SDG A;  4HX7 A;  4A69 C;  4D7M A;  1KA8 A;  4AM3 A;  5C4X J;  3Q0V A;  2HNH A;  3I59 A;  5IPA A;  2G0E A;  1D1C A;  3I9V 2;  5D5X B;  5D6E A;  3KCC A;  4KNY A;  1CGP A;  2OAZ A;  2CMP A;  2XPW A;  2BY3 A;  1V54 H;  2MLG A;  2OD5 A;  3PO3 J;  4L18 B;  2FNA A;  3RKW A;  2VKH A;  3S16 J;  3K4J A;  2MLK A;  3LST A;  1U3E M;  5GAD J;  5FKN A;  1BR4 A;  1MJ9 A;  4HA8 A;  2E60 A;  9ANT A;  5DCM B;  2NXN B;  1FTZ A;  2CSO A;  2M0C A;  4DBQ A;  4M6Y A;  4D5F A;  1I5Z A;  3SXY A;  4A0Y A;  3OIQ A;  4OIO F;  3R60 A;  2G7U A;  3BY6 A;  2NS8 A;  5FD5 A;  4MQV A;  3LAP A;  3MKY B;  1V4R A;  2KL4 A;  3CD6 I;  1LNW A;  3GTL J;  1YTY A;  4P96 A;  3CJQ B;  1HLV A;  1ZR2 A;  4BGD A;  1FOX A;  5CVU A;  5BS6 A;  1LFU P;  5EZH A;  3OOP A;  4FAS D;  4E7Z A;  2R7D A;  1O3T A;  4EJW A;  3L2R A;  5E20 A;  4IL6 C;  2HQ5 A;  2JWT A;  3M8E A;  3CLQ A;  2DK5 A;  1UAA A;  2V9K A;  2IRF G;  3MZY A;  4ZYA A;  1YJW I;  5B1A H;  3GXO A;  5HDK A;  1T6S A;  4D9J A;  1TL8 A;  3KYC B;  1X1A A;  3O3K A;  3KIO A;  3ISP A;  3L1P A;  2DJN A;  3OSG A;  4IZZ A;  2CQQ A;  2X6Y A;  2VUM J;  2COB A;  1B9M A;  1Z77 A;  2A5Y B;  3MZ8 A;  5H2F C;  5JLW A;  5C44 J;  1O3S A;  1ZAO A;  2GAU A;  2LF7 A;  3KPH A;  1OYY A;  3CP2 A;  4MNU A;  4EM1 A;  2EFN A;  1HKT A;  4U7D A;  4BY7 J;  1K6Y A;  1YRN A;  3B73 A;  3OV8 A;  2XSJ C;  1DU6 A;  4I2O A;  4XIC A;  1QPI A;  4HDU A;  1GVD A;  5E18 F;  5HOD A;  4Y33 A;  3FIS A;  2CQX A;  4OMY A;  3G1M A;  3RSN A;  1IN8 A;  1MBG A;  2L4M A;  1G3S A;  5BMZ A;  1W36 D;  4IRG A;  3I5U A;  1MMN A;  4IHT A;  2QM3 A;  5HDN A;  1A5J A;  5K1Y A;  2CUF A;  3JTG A;  1A35 A;  1OCZ H;  2Y0S A;  1NK2 P;  5K7H A;  2M30 A;  4I02 A;  2NNN A;  2L7M P;  4PGH A;  5LHI A;  2FU4 A;  1R5G A;  4LOC A;  5EEH A;  2CQK A;  1U78 A;  1U5T B;  2OPT A;  1MBF A;  2KMU A;  1HDP A;  4BKX A;  2O0Y A;  2VT3 A;  3E7L A;  3ZMS A;  4F55 A;  2DLL A;  4JQF A;  3WG7 H;  3FXL A;  3RI4 A;  2KIM A;  4BEH A;  4FTH A;  3ASN H;  1WJ5 A;  2JN6 A;  2XRL A;  4ZH4 F;  1UZC A;  1YW8 A;  3OYB A;  4DNC A;  2QSH X;  1T2K A;  2DTR A;  2HZT A;  1O7L A;  3KE2 A;  4C3H J;  1MGT A;  3OYF A;  1BN5 A;  1FZP B;  1DDN A;  2Q1Z B;  4YG2 F;  4S04 A;  4FX4 A;  3FIW A;  3HRS A;  2L9R A;  4BYY A;  2FE3 A;  1B59 A;  2CUJ A;  3SZG A;  1ZRF A;  3BJ6 A;  2KKO A;  5TRD A;  2HYF A;  5L3F A;  5EGO B;  4UY8 I;  4PSX A;  3CCR I;  4KMU X;  5IYC J;  1T95 A;  1T56 A;  3HZJ A;  4HLY A;  3U9G A;  2ZBK A;  2LVS A;  3K1N A;  1ZQ3 P;  5E3M A;  4CCK A;  3ZQF A;  1NHA A;  5J4V A;  1TBX A;  4NQW A;  4GXO A;  3I53 A;  3R0A A;  5LRR A;  1NK3 P;  2KIS A;  1DP7 P;  1G3W A;  4P55 A;  2H09 A;  4IO9 F;  3IUO A;  4M3D A;  1S9H A;  2N8G A;  3LFK A;  1WKM A;  4XKW A;  3V7C A;  4N4O B;  3HUG B;  3JAM Z;  2F4M B;  3I55 I;  2B9S A;  2Z5U A;  5DCM A;  3KEO A;  3DBL B;  2XRN A;  2DCE A;  2E1C A;  3LFU A;  5AON A;  1T8I A;  2VJJ A;  2R7U A;  2K9Q A;  4XKV A;  4KIG A;  4EQQ A;  2M9H A;  3BG9 A;  1U9O A;  5EG0 B;  3CCE I;  1XN7 A;  2UXX A;  4JX4 A;  4BE1 A;  3PUB A;  4XON A;  1NH3 A;  5FRM A;  4Y4R A;  3HB9 A;  1QRY A;  2GOX B;  2DPU A;  3EQL F;  4F3Q A;  3K1M A;  2LKS A;  1P7J A;  3MD2 A;  3DQV C;  2QF7 A;  5BQT A;  2YS9 A;  2XGE A;  1J9I A;  3D5S C;  2E2J J;  3QP6 A;  4N9I A;  5IOY A;  3CF2 A;  1G6N A;  1P4A A;  3S15 J;  3A2K A;  2WC2 A;  5FLX K;  2XAG A;  3FK7 A;  5LFA A;  2FBI A;  3GEZ A;  1FEX A;  3VDX A;  2HI3 A;  2R5Z A;  2QWW A;  2IJL A;  4AU7 A;  3FK6 A;  4ZYH A;  3LSK A;  3JRC A;  1PUF B;  1IRX A;  2K9N A;  3WTW C;  2PEX A;  4LLL A;  1TQM A;  1LVA A;  1K78 B;  2DMU A;  3OS1 A;  3EUH A;  3CUQ C;  3Q9S A;  5KHD A;  3FX3 A;  5H6R A;  4U0Y A;  2NVY J;  1MKM A;  1AWC A;  2JK3 A;  3S3M A;  2ELJ A;  1FJL A;  2XAJ A;  2PLY A;  3K9T A;  3DXJ F;  1VQP I;  4RB1 A;  3R4K A;  1OMI A;  1TLH B;  2A6T A;  5EZG A;  5FGM A;  4P5O A;  4PK4 A;  4HNV A;  4GYI A;  3FXO A;  2IA2 A;  3GTM J;  1RC9 A;  4B47 A;  3BR6 A;  2OCC H;  1ETO A;  2DBB A;  3BTC A;  2O61 A;  1TWH J;  1R6R A;  4IPA A;  5K7F A;  1ETW A;  5JVT A;  2DT6 A;  5CJ9 A;  4A93 J;  4M9S A;  4E7J A;  3S2H J;  4I98 B;  1X4O A;  2BHZ A;  3KZI C;  4AVP A;  4DOZ A;  2P5L C;  2JVG A;  1U5T A;  4XN0 A;  2F2E A;  3E1S A;  3ERE D;  1WVR A;  1VQ7 I;  4WK8 F;  1QA6 A;  1KU2 A;  3M3Y J;  3EUA A;  2HWV A;  2KQR A;  2ZME A;  4BAC A;  4UVA A;  2CFO A;  2RRE A;  1YO5 C;  4KT6 A;  4DYC A;  2K86 A;  3LSJ A;  2JA2 A;  4NHJ A;  4RAZ A;  4M73 A;  3FMR A;  2O03 A;  1MBJ A;  1IXC A;  2LC2 A;  5K5Q A;  4NB5 A;  4J00 A;  3R0J A;  4AD9 A;  5DEQ A;  4MEY F;  3IH3 A;  1RR8 C;  3IWZ A;  1S7A A;  3JRH A;  2AXL A;  3WHC A;  4BS9 A;  2MA3 A;  1YG2 A;  4XNF A;  4C30 A;  2VKD A;  2FX0 A;  3OYN A;  4LB5 A;  4NUB A;  3OS2 A;  3TP0 A;  4PJL A;  2R3S A;  1D0Z A;  5J47 A;  1VQO I;  3A0B C;  1ZKG A;  3CJR B;  1Y0N A;  4U7B A;  1PDN C;  3JAM K;  2V9P A;  1W5S A;  3PNV A;  4KUM A;  3AL0 C;  3K6G A;  3FXM A;  5BPD A;  3HL2 A;  4W97 A;  1Z1D A;  2ZXW H;  2XB5 A;  5DUK A;  1QZY A;  1H8A C;  1VQK I;  1FBU A;  4PJ0 C;  3GZN B;  3K69 A;  2B7E A;  4BH9 A;  2LD5 A;  3OYM A;  5DM6 F;  2ISZ A;  2FSW A;  2TRT A;  2OCE A;  1FNN A;  4A5M A;  1MBE A;  3FXQ A;  1T33 A;  4YRV A;  1MBH A;  2XPV A;  1PYV A;  4LJZ F;  4LK0 F;  4BXF A;  4Q47 A;  1OIS A;  3KP7 A;  5ILU A;  2VBW A;  3H5N A;  4BHP A;  4V19 K;  4OIQ F;  2O7O A;  3HGY A;  3CJT B;  2DOA A;  3P5J A;  4GYG A;  1QZZ A;  3FM5 A;  3K4B A;  3TGN A;  5GAH J;  1G8X A;  1JTX A;  1NG7 A;  4AIJ A;  1Y39 A;  1FYM A;  4B1R A;  3BLY A;  2AXT C;  1OQY A;  1I3A A;  1REP C;  4RB2 C;  2IA0 A;  3OR1 C;  4CYC B;  2EFW A;  5DUI A;  2RNJ A;  4CZZ A;  1Y56 A;  3FWE A;  1VFC A;  2DXI A;  1XB4 A;  2FBK A;  3WU2 C;  3ECO A;  2VJ4 A;  3BPX A;  3F8B A;  5FJ8 J;  4U87 A;  2ZSI B;  5HS9 A;  5CQE A;  2LF8 A;  2L7Z A;  3IH2 A;  3H9Q A;  4M71 A;  1GV5 A;  3QPH A;  3LMM A;  3P9C A;  3G71 I;  4NC8 A;  4R79 A;  2CUZ A;  1QPM A;  1XCB A;  2QUF A;  3E3V A;  3CDH A;  4EJO A;  3ZQH A;  2H8R A;  3BOQ A;  2EZH A;  2JA5 J;  3D0S A;  3M1C A;  4I01 A;  1HA8 A;  4LIV A;  3RKX A;  2CUE A;  1ON1 A;  2MBF A;  4U0W A;  1U6G A;  3WTT C;  1R58 A;  4RAY A;  1IF1 A;  2BW3 A;  2EPF A;  1YFH A;  1U0J A;  2V1U A;  4OIN F;  1H9G A;  3LSP A;  3M7G A;  2VKE A;  1IDZ A;  1BC8 C;  3BRO A;  4A3E J;  2OF7 A;  4A3D J;  2Q2E B;  2VBX A;  5J3L A;  4BY1 J;  2VKV A;  1ENH A;  3NAR A;  2PJR A;  3H9J A;  2AO9 A;  2EZL A;  1UJ8 A;  2CQN A;  1TP4 A;  2L7K A;  1A31 A;  3DLL F;  1F5T A;  2HOE A;  3S1M J;  4L9J A;  2K85 A;  3C2H A;  3DP7 A;  3Q0U A;  2KFD A;  5FKK A;  3IAS 2;  1HW1 A;  1IO2 A;  1X3U A;  4U0V A;  3HPG A;  1WJF A;  1QQI A;  3P7N A;  1XPX A;  3MKZ A;  1B8I B;  5L3D A;  2ME6 A;  3IRR A;  2Z16 A;  4FE7 A;  3J81 Z;  1TZL A;  2KJB A;  2CG4 A;  2M4K A;  1CF7 B;  2QKL B;  3J7Z I;  3E97 A;  3LOC A;  5DDG A;  1BOA A;  2W48 A;  2KJC A;  1SD4 A;  4S05 A;  1Y1W J;  1V55 H;  1P7I A;  2IPQ X;  5ICE A;  5FLM J;  3HRU A;  1H89 C;  3HYI A;  4EJV A;  1FOW A;  3HTU A;  3BR3 A;  3GTO J;  2L9S A;  2CRG A;  5ED4 A;  1JT6 A;  2GM4 A;  1IZ1 A;  1WH7 A;  3E5U A;  3E6C C;  2MYS A;  4WF2 A;  3BZC A;  1I50 J;  4XRS A;  2PX9 A;  3CES A;  4CH7 A;  2ME0 A;  1M1E B;  3GYH X;  4FCY A;  2GOM A;  2MSY A;  3LQR A;  5BNG A;  5C4J J;  4KFC A;  4IRI A;  2VPL A;  1VF9 A;  5B66 C;  3CC2 I;  2QGU A;  3OYC A;  4C2M J;  2WWY A;  1TW3 A;  1QZE A;  3BG5 A;  2ADU A;  3QPL A;  2R4G A;  2B0L A;  2HXI A;  3B6A A;  4N0B A;  4BE0 A;  2VE8 A;  2E2I J;  2H6C A;  1X1D A;  2V1D A;  1O3Q A;  2FF4 A;  1PVE A;  4P9U A;  4XOR A;  1IRG A;  1K61 A;  4XLP F;  1D3Y A;  4ENN A;  3EPZ A;  5LGN A;  3CTA A;  2R7S A;  3EUH C;  1JHF A;  1ZTR A;  3GME A;  2R5Y A;  1W5T A;  2JRT A;  1HKS A;  2K3F A;  5EDN A;  3AAF A;  3S1Q J;  1JI8 A;  1XD7 A;  3KP5 A;  4AYB A;  1H88 C;  3WU1 B;  2DA7 A;  4YIR X;  1SFO J;  3ZMT A;  5LGU A;  2HOS A;  1F1Z A;  3Q5F A;  1T38 A;  4G9Y A;  4RLQ A;  4CYC A;  4RM3 A;  4BL0 B;  2W85 A;  4KN4 X;  3RCO A;  4CUG A;  1ORK A;  5E1W A;  2HTJ A;  1YJ9 I;  3MWM A;  3HBL A;  4KIF A;  2X85 A;  3B6C A;  1JKO C;  4RBO A;  2HR3 A;  1U5T C;  1I39 A;  2FNP A;  3GO5 A;  2ZSH B;  2P5V A;  3HOX J;  1DPR A;  2LP0 A;  5J6X A;  1SEU A;  3IWF A;  2BVL A;  4IHX A;  2QLZ A;  4XSX F;  3F21 A;  1T0F A;  1Y8Q B;  2ELH A;  4L5E A;  1LEA A;  3S2D J;  2IP2 A;  2XB0 X;  2YU3 A;  4M3E A;  2DPD A;  1KYW A;  1TW2 A;  5H20 A;  4IOA F;  3VYS B;  3ABK H;  2GA2 A;  3TW7 A;  2NVQ J;  1R5I D;  4HW0 A;  3HRM A;  2Q2E A;  3CO6 C;  3U21 A;  1FY7 A;  1ZLK A;  4EAT A;  4IHV A;  3KZZ A;  5IYB J;  2DMT A;  3CCY A;  3DU5 A;  3M8J A;  4IQJ A;  4M9X A;  3CCM I;  3C7J A;  1R00 A;  2FA5 A;  4A3L J;  2HVS A;  4IRH A;  3HOY J;  2EFP A;  3FM3 A;  4CCO A;  2EJR A;  1X3W B;  3WTX C;  1MSE C;  3TDU C;  2ESN A;  2A05 A;  2AQF A;  3IKT A;  5B1B H;  4KT5 C;  2MG4 A;  4PCQ A;  5FO5 A;  4CCM A;  1B8I A;  5GTI C;  5ERI A;  4OIR F;  4OIP F;  2VT2 A;  1JGS A;  1X3Z B;  3GFJ A;  4Y17 A;  5CYV A;  3RYR A;  1APL C;  1HW2 A;  1WWX A;  2HZD A;  3JRE A;  4MTE A;  2BY0 A;  2VC1 A;  2X6X A;  1LDK B;  3X2Q H;  3W2V A;  4E6K G;  2RAE A;  2W25 A;  4ZTJ A;  4QWQ A;  3HIF A;  4BE2 A;  2X0L A;  3OWT A;  3D5R C;  4CCJ A;  2HFH A;  3PJR A;  2DA1 A;  4HX8 A;  3W2A A;  5AIQ A;  3VOD A;  1ZR4 A;  4OOI A;  1P4X A;  1XSX A;  4M6V A;  3T1B A;  4HST A;  4I6Z A;  5ILS A;  4X6A J;  2A6E F;  1MIJ A;  1XGO A;  1SFX A;  3JRB A;  1QO0 D;  1I6H J;  1TNT A;  2DOF A;  1FC3 A;  4H4K C;  2DMP A;  3VSK A;  3CME I;  4MGR A;  3TOA A;  4C3I J;  2OZ6 A;  1ETQ A;  3GW2 A;  2ISY A;  1BA5 A;  2JRM A;  1RUO A;  5FFX A;  3DTI A;  5L3C A;  2AS5 F;  4HEA 2;  2MFZ A;  3ZMD A;  2Y0S N;  2F4I A;  2JQ7 A;  3QPT A;  3T8T A;  3ZOB A;  2EK5 A;  3GTG J;  1WFX A;  5FKO A;  5CQG A;  5LLQ A;  2CW7 A;  1TWF J;  4J01 A;  4CSW A;  2R7O A;  1IDY A;  3KEY A;  4UUT A;  1SD7 A;  1JE8 A;  2X1E A;  4LLG F;  3KYL A;  1KU9 A;  1Z3Y A;  2DK8 A;  3L7W A;  4BUP A;  2EIL H;  3BDD A;  3R61 A;  1LQ1 A;  3W6V A;  2AHQ A;  2QCO A;  2M0M A;  2VQC A;  4G7O F;  3F6O A;  1HXD A;  3LL7 A;  4YEJ A;  3RYP A;  1L3L A;  1BC7 C;  1HOM A;  2ECB A;  1LB2 A;  4BXX J;  5KVR A;  4A6D A;  2Z33 A;  1OFC X;  5DD8 A;  3ZQG A;  4GDF A;  2UWM A;  2Z2S B;  4B3X A;  1FIP A;  1VZ0 A;  1E3H A;  4EMS A;  2IGM A;  1B72 A;  1G3T A;  4HLX A;  3S3O A;  5F0F A;  4OMZ A;  2MC3 A;  2ZFW A;  2CO5 A;  2VBY A;  2R7Q A;  4I76 A;  1YX5 A;  5BOX A;  5CVR A;  3HJE A;  3ZMV A;  2XUB A;  2JUG A;  2I8D A;  4ETS A;  4CCN A;  3K10 A;  1YJN I;  1J59 A;  4QSH A;  5FLX Z;  3FHZ A;  5L3B A;  1JKP C;  2WBM A;  2A68 F;  3QWL A;  3I54 A;  2R92 J;  3HTS B;  1ZHF A;  2X9D A;  2UUZ A;  3GWZ A;  3ABT A;  4B09 A;  2V26 A;  5HVQ C;  2K40 A;  1IRZ A;  4JX5 A;  1IRF A;  2KPM A;  2MD0 A;  1UG0 A;  2JPC A;  4LG3 A;  2IXS A;  2M45 A;  4TV7 A;  1N25 A;  2YSR A;  4BDZ A;  2Q8K A;  1F9N A;  1IV6 A;  3BG6 A;  5GAE J;  3JR9 A;  1RKT A;  1JUP A;  5CVJ A;  1XSD A;  5CLS A;  2W00 A;  4NC6 A;  2ZJQ F;  3QOE A;  3N4M A;  1OCP A;  4IF4 A;  3MMY B;  3JRA A;  3MKL A;  2P7C B;  3TKY A;  2XKO A;  2FEZ A;  1SVO A;  3NQO A;  2DOD A;  3CCS I;  4KA4 A;  5JVG F;  3KZY A;  3KP3 A;  2QA4 I;  2CFX A;  5J1U A;  4XRM A;  2ZC2 A;  3ESW B;  3WTV C;  1DU0 A;  2KDO A;  2V6C A;  1BL0 A;  4B48 A;  2O9L A;  1GVJ A;  4FET A;  4II2 A;  5DYM A;  3K70 D;  2DDA A;  1V5E A;  4RDU A;  1S72 I;  3LA2 A;  4YFX F;  1AU7 A;  3MAJ A;  2G7H A;  1I1G A;  4RA2 A;  3AG1 H;  2ACJ A;  2C6Y A;  2XAS A;  2IS2 A;  2XVC A;  2V6E A;  4WXH A;  4FIS A;  2EIM H;  4LMY A;  5F1R A;  2ESH A;  3F0C A;  2VB6 A;  3H9G A;  1BM9 A;  1XCV A;  2GA1 A;  2EIN H;  2K4B A;  3BTJ A;  2X4H A;  4DZJ A;  1ZG5 A;  1XMK A;  1BOB A;  1IN5 A; 
#chains in the Genus database with same CATH homology
 3PFI A;  4MQ9 F;  2Y0M A;  4ZZD A;  2DFI A;  3CUO A;  4OU0 A;  1FP2 A;  4DQ2 A;  4UV8 A;  2LSO A;  3ZMU A;  1PP7 U;  1O7F A;  1R36 A;  3WG9 A;  3F22 A;  3F8N A;  4GGG A;  5J8C A;  5JI6 A;  2Q0O A;  3RIR A;  1TQP A;  2L54 A;  2M5W A;  4G7H F;  1EH6 A;  1V3F A;  2GWR A;  3FMQ A;  3QP5 A;  3TO6 A;  4Q5S F;  4L5I A;  2OBP A;  2W84 A;  3KP4 A;  2ZNZ A;  3LWF A;  3V8J A;  1XMA A;  2LDU A;  3RTR A;  1F4K A;  3V8L A;  4K2E A;  1MD0 A;  4XBF A;  4CXF A;  1G4D A;  1ZAR A;  3FMS A;  4HOB A;  4EGZ A;  4LG0 B;  1FBQ A;  4JK1 X;  3DPL C;  2ZNY A;  1TNS A;  4I0B A;  4M9Z A;  1L0O C;  2K02 A;  1MZB A;  1J5Y A;  1AOY A;  2H6B A;  2VXZ A;  2ZO4 A;  4IJA A;  3V8K A;  3G73 A;  2CW0 F;  2STT A;  4KIB A;  2ZJ2 A;  1IXR C;  2EB7 A;  2EV5 A;  3D5L A;  1EH8 A;  3TQN A;  4HDV A;  5JHU A;  3NRV A;  1P6R A;  4AWX B;  2EV6 A;  4L9N A;  5IT3 A;  4G6D A;  2QVO A;  4BAY A;  1XDU A;  1HSJ A;  3HRT A;  1QBJ A;  3F8F A;  2NYX A;  4YII A;  3ELK A;  1J75 A;  2QZ8 A;  4UV9 A;  3CJN A;  3GFL A;  3HSF A;  3BP8 A;  3MQ0 A;  2L01 A;  3WE2 A;  3MZH A;  1Z91 A;  3M8F A;  2A69 F;  3L00 A;  1Z05 A;  5EEG A;  2DT5 A;  5ICF A;  4G94 A;  3HUG A;  1MDM B;  3RKY A;  3L2C A;  2RDP A;  3WTY C;  3C18 A;  3JSP A;  1BI0 A;  1XDS A;  4RGX A;  4L9T A;  2VN2 A;  1TTY A;  2MH9 A;  3E5X A;  1J0R A;  4RGU A;  4Z2Y A;  4A0Z A;  1T39 A;  4R8H A;  1UHM A;  5FB2 A;  3C1D A;  4HX4 A;  3U1D A;  4AIK A;  5E8G A;  2XGX A;  4IXA A;  1YYV A;  3DF8 A;  4IVN A;  2BE5 F;  4ESJ A;  3LAJ A;  2WTE A;  3JSO A;  2JT1 A;  3MEX A;  1UHW A;  4L5J A;  1S7O A;  2YX7 A;  2BV6 A;  1K78 A;  3VFZ A;  1W7P B;  2FQ3 A;  2XHK A;  1R23 A;  2L3D A;  2GXB A;  2V9V A;  5LGT A;  3R6S A;  3KET A;  1WSU A;  4ZZL A;  4KIC A;  2JPB A;  1FX7 A;  2HQN A;  3BPV A;  4UHT A;  4Q4Z F;  4CO8 A;  1ZRD A;  3ABU A;  1KYZ A;  5HDG A;  4KN7 X;  1R1T A;  5HS7 A;  3CUQ B;  1LJ9 A;  2OU2 A;  2PBI A;  3TDZ C;  2RN7 A;  3U2R A;  1D8J A;  4RB0 A;  2DQR A;  2GQQ A;  1U8R A;  4EJT A;  3SHF A;  1SMT A;  2D2W A;  2M8E A;  2A3S A;  4HV5 A;  3BWG A;  3TOB A;  3ULQ B;  2E1N A;  1PP8 F;  4YIF A;  1D5V A;  1SFU A;  4Y13 A;  3I0T A;  1Y0U A;  3RPQ A;  2VOO A;  3L09 A;  3W6K B;  4ON0 A;  1T98 A;  2KRF A;  4G6Q A;  1DPU A;  2MH2 A;  1YIO A;  2E7X A;  3QU3 A;  1C0W A;  2DU9 A;  2V1X A;  3SQN A;  2DI3 A;  3B02 A;  2P5K A;  2UXN A;  1K7A A;  2PJP A;  4R1H A;  5H6Q A;  2CWE A;  2L02 A;  5L3E A;  1HW5 A;  1UB9 A;  4HV6 A;  4L0Y B;  2F5C A;  2FOK A;  2L4A A;  3FXU A;  4WXD A;  3QAH A;  2FMY A;  1G3Y A;  4WX9 A;  2OQG A;  1PUE E;  1GXP A;  1R1U A;  3ML6 A;  1FBS A;  3IC7 A;  1R7J A;  4CDG A;  3ZQ7 A;  1OR7 A;  2ETH A;  3FXR A;  3EDP A;  3KFW X;  1ZGJ A;  2JSC A;  4F7Z A;  3DPT A;  1FOK A;  3SFZ A;  1KQ8 A;  1IW7 F;  2Z9O A;  2A6H F;  6PAX A;  3W6J B;  1VTN C;  1SMY F;  4GCV A;  2H94 A;  3MCZ A;  4ENK A;  1KU3 A;  1B4A A;  3VEP A;  1Z9C A;  1W4M A;  1P92 A;  1H0M A;  5HLH A;  1USS A;  2RKH A;  1S6L A;  2XRO A;  4MHG A;  1IUY A;  4H0E A;  2QBY B;  1R22 A;  3T8R A;  2P6T A;  3T5X A;  2IW5 A;  3FZV A;  4YFN F;  3ECH A;  1UFM A;  4BNC A;  1IN6 A;  1CF7 A;  2HDC A;  1W7P D;  4A12 A;  3WTU C;  4HZF A;  4KMF A;  2R7F A;  2ZKZ A;  1UST A;  4LD5 A;  5AIP A;  4PGG A;  4G8X A;  3WOD F;  3QRF F;  2RGV A;  2XV4 S;  2F5E A;  3K0L A;  3O2P E;  4O5V A;  1P4W A;  3ROU A;  5D8K B;  2M87 A;  4M72 A;  4HBL A;  5TJJ A;  4RGS A;  1BIA A;  2EFO A;  2J5P A;  5DD4 A;  1WI9 A;  1EH7 A;  1XGM A;  5HS8 A;  5FFZ A;  2QQB A;  2EV0 A;  4LFU A;  1ZRE A;  2PQ8 A;  4HAM A;  2EA4 A;  3GUD A;  2P7V B;  2IA1 A;  3H3Z A;  5CVI A;  1WRJ A;  3DV8 A;  2G9W A;  1LEB A;  1B9N A;  4O6J A;  2PG4 A;  3TO9 A;  3K2Z A;  2ZCW A;  5HLI A;  2FXA A;  2GIV A;  3KLN A;  5LEK A;  1E17 A;  3H3U A;  5ILV A;  3RDI A;  4QLC U;  5CVV A;  2D45 A;  3F8C A;  1HQC A;  3S2W A;  1FYK A;  4A6E A;  2HS5 A;  2COM A;  2HTS A;  3H92 A;  2W24 A;  5LHG A;  2MD5 A;  1BI1 A;  3F72 A;  1STZ A;  3I71 A;  1YS7 A;  4LB6 B;  1I27 A;  1H9T A;  2PMU A;  4EJU A;  1HBX G;  1ZH5 A;  4BQA A;  1S3J A;  3F8M A;  4ZYE A;  3WE3 A;  3ZPL A;  1Z7U A;  1MJB A;  2HQR A;  2QBY A;  2BEO A;  2NNY A;  3EYI A;  1GHC A;  4CHU A;  3HOS A;  1B1B A;  1FSH A;  2RQP A;  1O57 A;  2ZME B;  3K1P A;  2JTV A;  2XKP A;  3ZN1 A;  4LLN A;  2DAO A;  4AIH A;  5ICG A;  1IN4 A;  4JBA A;  3RJP A;  2O6G E;  4WXC A;  2HKX A;  1FYL A;  1XGS A;  1RUN A;  4HQM A;  4HQE A;  2HEO A;  4D0P A;  1S29 A;  5L3G A;  3WTZ A;  2FBH A;  2J5O A;  3E5Q A;  2EWN A;  1IN7 A;  3WTS C;  5JFR A;  5E1Z B;  3HHG A;  4ENJ A;  3Q9V A;  1I6X A;  4RB3 C;  2D1H A;  5FD6 A;  5HLG A;  5JR3 A;  2YR2 A;  2XAQ A;  3O6B B;  1K6O A;  1U2W A;  4MTD A;  4L9V A;  2LKP A;  4RGR A;  1YS6 A;  1XGN A;  1YLF A;  4ESB A;  1YW9 A;  2IVM A;  2Z99 A;  3P9I A;  2K7L A;  3BZ6 A;  5BPI A;  3GZ5 A;  3G3Z A;  5IT9 Z;  1S8N A;  1B6A A;  2BYV E;  4Q48 A;  2OA4 A;  3I64 A;  2BGC A;  2NS0 A;  2F5F A;  3VOE A;  2WV0 A;  4KDP A;  3JW4 A;  3COA C;  1O3R A;  1RZ4 A;  1E2X A;  2RVC A;  3DKW A;  4N9H A;  4WCG A;  1KU7 A;  5D5W B;  1R5H A;  4HF1 A;  1RI7 A;  4Y15 A;  5D4R A;  1JHH A;  2F5D A;  1DUX C;  2HGC A;  2QEN A;  4UUV A;  4WWC A;  2EFQ A;  3V4G A;  1FP1 D;  2YX4 A;  4A5N A;  4ESF A;  2A61 A;  5E17 F;  1BJA A;  1YW7 A;  5DCF A;  1SD5 A;  3IRQ A;  3KP2 A;  4U88 A;  1Z6R A;  3HHH A;  1FT9 A;  1I1S A;  3GX4 X;  1SFE A;  1JXS A;  1Q1H A;  3DEU A;  2QYO A;  1IXS B;  2W57 A;  3M9A A;  2VBZ A;  2ZXJ A;  3HOT A;  1QNT A;  4PDK A;  4PZJ A;  5KK1 A;  2DO7 A;  1ON2 A;  3WGI A;  3E6D A;  4BXU A;  3IKV A;  2LNB A;  1J2X A;  1ODD A;  5D5U B;  4BHC A;  1ZRC A;  4HF2 A;  4M6X A;  4UVB A;  1D8K A;  3HSR A;  4XRF A;  3CO7 C;  4A0X A;  5IT9 K;  4UXN A;  1RNL A;  2NRA C;  4ZYG A;  1ZG1 A;  2M1B A;  4EGY A;  2H27 A;  4EV0 A;  1ZYR F;  1OYW A;  2DQL A;  5LBQ A;  4ENM A;  3RPU A;  2DW4 A;  3ZP5 A;  5K5O A;  2IT0 A;  4L0Z B;  2E7W A;  2VC0 A;  2D1V A;  3P9K A;  4IHS A;  1J7K A;  4I7H A;  3MFK A;  3L9F A;  4UNO A;  4FHT A;  1EV7 A;  2XAF A;  2STW A;  4EM0 B;  3E6M A;  4BHB A;  3T0Y A;  2FML A;  1RIO H;  3F23 A;  3M1E A;  3J7A O;  3J80 Z;  2K27 A;  1OPC A;  1P2F A;  4LG0 A;  2HKO A;  3NEU A;  5LEJ A;  3DFG A;  3PQJ A;  3JTH A;  2Y75 A;  4P9F A;  3GFI A;  4FT8 A;  3C3W A;  5A2Q Z;  4KYW A;  1XSV A;  2FRH A;  3FF5 A;  2HYG D;  4A2U A;  5F6F A;  1FWZ A;  4CGZ A;  1OKR A;  2KIU A;  3KLO A;  4MEX F;  3WGG A;  2CGP A;  1BIB A;  3I58 A;  1ZG3 A;  3I59 B;  3TO7 A;  3GFM A;  3GZ6 A;  4CIC A;  1IAW A;  4YFK F;  4HF0 A;  4UVC A;  3F6V A;  5ICC A;  3REO A;  3GLX A;  2VON A;  1HKQ A;  4FX0 A;  4RS8 A;  3PQK A;  2K4J A;  1BI3 A;  1ULY A;  3F3X A;  2PI0 A;  5D6F A;  2VOD A;  3I4P A;  4XLN F;  2PFB A;  1FLI A;  3HSE A;  2YPR A;  3V7R A;  2PMH A;  1MDM A;  1KQ0 A;  2OQR A;  1ZLJ A;  4EVI A;  3WU0 A;  1R1V A;  4B8X A;  3QOP A;  1GXQ A;  5LHH A;  4LK1 F;  2EA2 A;  4G7Z F;  1BBY A;  3GF2 A;  2V79 A;  2TDX A;  1MJA A;  5D8L B;  3LA7 A;  2P8T A;  1BI2 A;  5DV5 A;  1LDJ A;  1LDD A;  3BJO A;  5HOO A;  4EM2 A;  3IHU A;  5LRS A;  3ZN0 A;  5D4S A;  1ONV A;  3J80 K;  5K5R A;  2A07 F;  4GO1 A;  2GZW A;  4I0A A;  1TQI A;  2P4W A;  1SAX A;  2O8X A;  1WQ2 A;  3GVA A;  5F64 A;  4HYE A;  4XSZ F;  1KQ9 A;  5D5V B;  3KP6 A;  1K79 A;  3LA3 A;  1UCR A;  1SD6 A;  1W7P A;  1ZGA A;  1Z6T A;  2CYY A;  1FPQ A;  2NAZ A;  2GXG A;  3LQQ A;  3IL2 A;  4M74 A;  5A2Q K;  4O3M A;  3ZMZ A;  1A04 A;  3SZT A;  2VOP A;  3EET A;  1KGS A;  4E70 A;  4CYD A;  3E6B A;  2RC4 A;  3KEQ A;  3J81 K;  4LGW A;  5J8F A;  2QQ9 A;  2RV8 A;  2OZU A;  2BBY A;  3SZP A;  2VE9 A;  2XAH A;  1QGP A;  5E1X A;  2P6S A;  2Z3Y A;  3V7S A;  3VB2 A;  1HST A;  3EYY A;  3CUQ A;  2QQA A;  5E8I A;  4ASN A;  1YQA A;  3CLO A;  2XIG A;  1OYI A;  2O3F A;  3N97 A;  2JZY A;  3QU6 A;  3WGH A;  4I09 A;  3BJA A;  1FSE A;  2Y48 A;  2PN6 A;  1ZN2 A;  4ZYD A;  2UZK A;  2KIF A;  4HX7 A;  1KA8 A;  3I59 A;  5D5X B;  5D6E A;  3KCC A;  4KNY A;  1CGP A;  2OAZ A;  2MLG A;  2OD5 A;  4L18 B;  2FNA A;  3RKW A;  2MLK A;  3LST A;  1U3E M;  1MJ9 A;  4HA8 A;  5DCM B;  2CSO A;  4M6Y A;  1I5Z A;  3SXY A;  4A0Y A;  4OIO F;  3R60 A;  2G7U A;  3BY6 A;  5FD5 A;  4MQV A;  3LAP A;  1V4R A;  1LNW A;  1YTY A;  4P96 A;  5CVU A;  5BS6 A;  3OOP A;  2R7D A;  1O3T A;  4EJW A;  5E20 A;  3M8E A;  2DK5 A;  2IRF G;  3MZY A;  3GXO A;  5HDK A;  1T6S A;  3O3K A;  3ISP A;  1B9M A;  2A5Y B;  1O3S A;  1ZAO A;  2GAU A;  2LF7 A;  1OYY A;  4MNU A;  4EM1 A;  2EFN A;  1HKT A;  4U7D A;  3B73 A;  3OV8 A;  4I2O A;  4HDU A;  5E18 F;  4OMY A;  1IN8 A;  2L4M A;  1G3S A;  5BMZ A;  4IRG A;  3I5U A;  4IHT A;  2QM3 A;  5HDN A;  5K1Y A;  3JTG A;  2M30 A;  4I02 A;  2NNN A;  4PGH A;  5LHI A;  2FU4 A;  1R5G A;  5EEH A;  2CQK A;  1U78 A;  1U5T B;  2O0Y A;  2VT3 A;  3ZMS A;  3RI4 A;  2DLL A;  4JQF A;  2KIM A;  4ZH4 F;  1YW8 A;  4DNC A;  1T2K A;  2DTR A;  2HZT A;  1O7L A;  3KE2 A;  1MGT A;  1BN5 A;  1FZP B;  1DDN A;  4YG2 F;  4S04 A;  4FX4 A;  3HRS A;  4BYY A;  2FE3 A;  1B59 A;  1ZRF A;  3BJ6 A;  2KKO A;  5TRD A;  2HYF A;  5L3F A;  4KMU X;  4HLY A;  3U9G A;  2ZBK A;  3K1N A;  1NHA A;  1TBX A;  4NQW A;  4GXO A;  3I53 A;  3R0A A;  5LRR A;  1DP7 P;  1G3W A;  4P55 A;  2H09 A;  3LFK A;  1WKM A;  3V7C A;  3JAM Z;  2Z5U A;  5DCM A;  3KEO A;  2XRN A;  2E1C A;  5AON A;  4KIG A;  4EQQ A;  1XN7 A;  2UXX A;  2DPU A;  3EQL F;  3K1M A;  3DQV C;  5BQT A;  1J9I A;  3QP6 A;  4N9I A;  1G6N A;  1P4A A;  2WC2 A;  5FLX K;  2XAG A;  2FBI A;  3GEZ A;  2QWW A;  2IJL A;  4ZYH A;  3WTW C;  2PEX A;  4LLL A;  1TQM A;  1LVA A;  1K78 B;  3EUH A;  3CUQ C;  3Q9S A;  3FX3 A;  5H6R A;  4U0Y A;  1MKM A;  1AWC A;  2XAJ A;  2PLY A;  3K9T A;  3DXJ F;  4RB1 A;  3R4K A;  1OMI A;  1TLH B;  5FGM A;  4P5O A;  4GYI A;  2IA2 A;  2DBB A;  2O61 A;  4IPA A;  5JVT A;  5CJ9 A;  4M9S A;  4I98 B;  4AVP A;  2P5L C;  1U5T A;  2F2E A;  3ERE D;  4WK8 F;  1KU2 A;  2HWV A;  2ZME A;  4UVA A;  1YO5 C;  2K86 A;  4NHJ A;  4RAZ A;  4M73 A;  3FMR A;  2O03 A;  1IXC A;  5K5Q A;  4NB5 A;  3R0J A;  4AD9 A;  5DEQ A;  4MEY F;  3IWZ A;  1S7A A;  2AXL A;  2MA3 A;  1YG2 A;  4LB5 A;  2R3S A;  4U7B A;  1PDN C;  3JAM K;  1W5S A;  4KUM A;  5BPD A;  1Z1D A;  5DUK A;  1QZY A;  1FBU A;  3K69 A;  4BH9 A;  2ISZ A;  2FSW A;  1FNN A;  4A5M A;  3FXQ A;  4LJZ F;  4LK0 F;  4Q47 A;  3KP7 A;  5ILU A;  2VBW A;  4BHP A;  4OIQ F;  4GYG A;  1QZZ A;  3FM5 A;  3TGN A;  4AIJ A;  1FYM A;  1REP C;  4RB2 C;  2IA0 A;  2EFW A;  5DUI A;  2RNJ A;  4CZZ A;  3FWE A;  1XB4 A;  2FBK A;  3ECO A;  3BPX A;  3F8B A;  5HS9 A;  2LF8 A;  4M71 A;  3QPH A;  3P9C A;  4R79 A;  1QPM A;  1XCB A;  2QUF A;  3E3V A;  3CDH A;  4EJO A;  3BOQ A;  3D0S A;  4I01 A;  3RKX A;  1ON1 A;  2MBF A;  4U0W A;  1U6G A;  3WTT C;  1R58 A;  4RAY A;  1IF1 A;  1YFH A;  2V1U A;  4OIN F;  1H9G A;  3M7G A;  1BC8 C;  3BRO A;  2VBX A;  1F5T A;  2HOE A;  4L9J A;  3DP7 A;  1HW1 A;  1X3U A;  4U0V A;  1QQI A;  3P7N A;  5L3D A;  3IRR A;  3J81 Z;  2KJB A;  2CG4 A;  1CF7 B;  3E97 A;  5DDG A;  1BOA A;  2KJC A;  1SD4 A;  4S05 A;  2IPQ X;  5ICE A;  3HRU A;  3HYI A;  4EJV A;  3HTU A;  5ED4 A;  1IZ1 A;  3E5U A;  3E6C C;  4WF2 A;  3GYH X;  3LQR A;  4KFC A;  4IRI A;  2WWY A;  1TW3 A;  2ADU A;  2B0L A;  4N0B A;  2VE8 A;  2H6C A;  2V1D A;  1O3Q A;  2FF4 A;  4P9U A;  1IRG A;  4XLP F;  1D3Y A;  4ENN A;  5LGN A;  3CTA A;  1JHF A;  1W5T A;  2JRT A;  1HKS A;  3AAF A;  1XD7 A;  3KP5 A;  3WU1 B;  3ZMT A;  5LGU A;  1F1Z A;  3Q5F A;  1T38 A;  4G9Y A;  2W85 A;  4KN4 X;  5E1W A;  2HTJ A;  3MWM A;  4KIF A;  2HR3 A;  1U5T C;  2FNP A;  3GO5 A;  2P5V A;  1DPR A;  5J6X A;  3IWF A;  2QLZ A;  4XSX F;  3F21 A;  1T0F A;  2ELH A;  1LEA A;  2IP2 A;  2YU3 A;  2DPD A;  1KYW A;  1TW2 A;  5H20 A;  2GA2 A;  4HW0 A;  3HRM A;  2Q2E A;  3CO6 C;  1FY7 A;  1ZLK A;  3KZZ A;  4M9X A;  3C7J A;  1R00 A;  2FA5 A;  4IRH A;  2EFP A;  3FM3 A;  2EJR A;  3WTX C;  3TDU C;  2ESN A;  3IKT A;  4KT5 C;  4PCQ A;  5FO5 A;  5ERI A;  4OIR F;  4OIP F;  2VT2 A;  1JGS A;  3GFJ A;  4Y17 A;  5CYV A;  3RYR A;  1HW2 A;  1WWX A;  4MTE A;  2VC1 A;  1LDK B;  2W25 A;  4QWQ A;  3HIF A;  2X0L A;  2HFH A;  4HX8 A;  5AIQ A;  3VOD A;  4OOI A;  1P4X A;  1XSX A;  3T1B A;  5ILS A;  2A6E F;  1XGO A;  1SFX A;  1QO0 D;  1TNT A;  1FC3 A;  4MGR A;  3TOA A;  2OZ6 A;  3GW2 A;  2ISY A;  1RUO A;  5FFX A;  5L3C A;  2AS5 F;  3ZMD A;  3QPT A;  3T8T A;  2EK5 A;  5LLQ A;  1SD7 A;  1JE8 A;  4LLG F;  1KU9 A;  2DK8 A;  3L7W A;  3BDD A;  3R61 A;  1LQ1 A;  4G7O F;  3F6O A;  1HXD A;  3RYP A;  1L3L A;  1BC7 C;  1LB2 A;  5KVR A;  4A6D A;  2Z33 A;  5DD8 A;  2UWM A;  4EMS A;  1G3T A;  4HLX A;  4OMZ A;  2MC3 A;  2ZFW A;  2CO5 A;  2VBY A;  5BOX A;  5CVR A;  3ZMV A;  2XUB A;  4ETS A;  1J59 A;  5FLX Z;  3FHZ A;  5L3B A;  2A68 F;  3I54 A;  3HTS B;  1ZHF A;  3GWZ A;  3ABT A;  4B09 A;  5HVQ C;  1IRF A;  2JPC A;  2M45 A;  4TV7 A;  2YSR A;  2Q8K A;  1F9N A;  5CVJ A;  1XSD A;  5CLS A;  3N4M A;  4IF4 A;  2P7C B;  3TKY A;  2XKO A;  2FEZ A;  3NQO A;  4KA4 A;  3KZY A;  3KP3 A;  2CFX A;  3WTV C;  2V6C A;  1GVJ A;  5DYM A;  3LA2 A;  4YFX F;  3MAJ A;  2G7H A;  1I1G A;  2ACJ A;  2C6Y A;  2XAS A;  2XVC A;  4WXH A;  4LMY A;  5F1R A;  2ESH A;  1BM9 A;  1XCV A;  2GA1 A;  2K4B A;  2X4H A;  1ZG5 A;  1XMK A;  1IN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...