2W85A

Structure of pex14 in complex with pex19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Competitive Interactions of Pex14 with the Import Receptors Pex5 and Pex19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords PEROXISOMAL MEMBRANE ANCHOR PROTEIN PEX14
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w85A00
1XSDA 2FA5A 4DQ2A 1B1BA 1UB9A 4XLPF 1PDNC 2OQGA 3KLNA 3MEXA 4MQ9F 2ZO4A 2Q2EA 2XHKA 2QBYA 2L4AA 2H09A 5CYVA 4N0BA 4GYIA 1KQ8A 2NYXA 2M8EA 2EV5A 2CO5A 1BIBA 1O57A 2OBPA 1FYKA 4ZYDA 4Q48A 1U5TA 1WQ2A 1GXQA 2CQKA 5L3BA 2LF7A 4RAZA 2EA2A 4PGGA 1HSJA 3HSFA 4EJUA 3EQLF 4UV9A 2FBIA 4UV8A 3WE3A 2IP2A 3M7GA 4O5VA 4U7BA 3R0AA 3ROUA 1IN4A 3QP6A 1RUNA 1E17A 2VE8A 4L5JA 4M9XA 1J75A 2P5VA 3T8TA 2PG4A 1KU9A 1TTYA 1P4AA 1HW1A 5LHIA 4UUVA 2ESHA 1JHFA 4G6DA 2IW5A 3WU1B 1IRGA 2ZMEB 4BHCA 1J5YA 3ZMUA 1XB4A 4EGYA 3DQVC 3GWZA 1P4XA 3SXYA 4OIOF 1O3RA 2L54A 3V7CA 4YG2F 1EH7A 4G94A 1R23A 2A6HF 5HLHA 3I59B 1W5SA 1TQPA 2YSRA 3WTZA 3ZQ7A 1TNSA 4GYGA 4N9HA 2HFHA 1I6XA 1K7AA 3E6MA 3KP4A 4JQFA 2P5LC 2GA2A 2IRFG 5L3EA 2DTRA 1E2XA 3Q9VA 4XSXF 5HLGA 3RJPA 2WTEA 5IT9Z 1G3SA 5DD4A 4HA8A 3WU0A 1LNWA 2YR2A 2ZCWA 4RB1A 4OIPF 4G8XA 3E5QA 4UNOA 5HDNA 4BHPA 4KMUX 3W6JB 3DKWA 4D0PA 2C6YA 3U9GA 4ON0A 4G9YA 1WSUA 5J6XA 3R6SA 4A5MA 1L3LA 1P4WA 1LJ9A 1HW5A 3F22A 3REOA 4MQVA 2MLGA 3QAHA 1B6AA 2O61A 2VODA 1G4DA 1Q1HA 3ABUA 3L7WA 5DD8A 3LAJA 2M1BA 1O7LA 3N4MA 5ILVA 1A04A 3HOTA 5EEGA 4AD9A 5LBQA 5E8IA 1FYLA 1R1VA 1FX7A 3SZTA 2HDCA 5F64A 4ESFA 3QU6A 3HSEA 4WXHA 4HV5A 1ZARA 5H6QA 1YLFA 2ZBKA 3J81K 2XV4S 3IKVA 2FBKA 1XGNA 3ECOA 2R7FA 3N97A 3I4PA 1MJ9A 4FHTA 5DCMB 3FXRA 1FOKA 2QM3A 3QPHA 4BXUA 1J0RA 3JSPA 2XAQA 5E1ZB 4G6QA 3RPUA 3E3VA 2VONA 2VBYA 3V8JA 2OU2A 5K5OA 3F8BA 2O3FA 1VTNC 3LFKA 3CO7C 1X3UA 4EVIA 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 1AOYA 1BI0A 1F5TA 3M8EA 4I09A 1B9MA 2XROA 2PLYA 2DI3A 3FXUA 2M45A 2YX4A 4HDVA 3BY6A 1Z7UA 4HX4A 4CDGA 4RS8A 3K1MA 4A6EA 2OQRA 2FF4A 4GO1A 2K02A 3NEUA 3RKWA 3RTRA 4L0ZB 4Y17A 4A2UA 4UVBA 3WGIA 4OIRF 4IHSA 1GXPA 4ZH4F 3J81Z 5HOOA 4ZYEA 3L9FA 3I54A 3FMQA 4KN7X 3C3WA 1P2FA 2ZMEA 1YW7A 5E20A 2JPCA 3GYHX 3FHZA 1USTA 2EFPA 3WTUC 5KVRA 2BBYA 4I98B 4RB3C 3ERED 1JE8A 1S8NA 2VBZA 3SQNA 3LSTA 2FSWA 4HQMA 1U8RA 2X4HA 2PN6A 4R79A 4HX7A 2TDXA 2PFBA 3Q9SA 4HYEA 2UWMA 2EA4A 3FZVA 3ECHA 2J5PA 1QO0D 1OYWA 4YIFA 1F1ZA 1IN6A 2Z5UA 3CO6C 1QBJA 1G3TA 3U1DA 1J9IA 5HS9A 4HZFA 2RC4A 2QQAA 3GFMA 3WTXC 2EV0A 3OOPA 4G7OF 4BQAA 4I01A 2GXGA 1FBUA 3DF8A 4LMYA 1IZ1A 2JRTA 3T0YA 5LRSA 2BV6A 4NB5A 1MDMA 2V6CA 3FF5A 4RGRA 1G3YA 2A61A 3TO6A 4CZZA 3KP6A 2FMYA 3K1PA 2BE5F 2HGCA 3GVAA 3LA2A 1YS7A 2DLLA 1UHWA 1BJAA 5HDGA 2K4BA 5BS6A 5ILSA 4HF1A 3G3ZA 5HLIA 4Z2YA 2VC1A 4IJAA 1QPMA 5HS8A 4LG0A 2HWVA 4KN4X 4PDKA 1S7OA 2RDPA 3JAMZ 3T8RA 1KQ0A 2MH9A 2DAOA 4EQQA 4Y13A 5K1YA 3Q5FA 3V8LA 1R36A 5D4RA 4WK8F 2EB7A 1B4AA 4RAYA 4HDUA 1SFEA 1WKMA 2KRFA 2YU3A 3MCZA 5EEHA 5E1WA 4WF2A 1G3WA 3ABTA 5DUIA 2P5KA 1BIAA 3HOSA 2CG4A 5D6EA 4WWCA 5CVJA 2ESNA 3TO9A 4P9UA 2F5DA 1FNNA 1OYIA 2EFOA 3GUDA 3TDZC 2DO7A 2K7LA 1K78A 5BOXA 3AAFA 3ZPLA 1FYMA 3M1EA 4YFKF 2E7WA 2V9VA 5ICEA 2GIVA 3ZMDA 3WE2A 1GVJA 3KZYA 2XRNA 4ENMA 3K69A 4FT8A 1TQIA 2DU9A 1R00A 3LQQA 2IA2A 1FWZA 3T1BA 1T6SA 2RGVA 3KEOA 3KE2A 2WWYA 4RB0A 4H0EA 4ENJA 4UXNA 3FMRA 2Y48A 2B0LA 4HBLA 1BC7C 5LGTA 1HW2A 1QQIA 1RIOH 3NRVA 2DT5A 4FX4A 4XRFA 2Q8KA 4YFNF 1TW2A 3HHHA 3GFIA 3CUQC 3F6OA 4XBFA 1UFMA 1ZG1A 3RYPA 1FBSA 3RKYA 2EWNA 1FSEA 2D1HA 2ACJA 2UZKA 1MGTA 5FFZA 3ELKA 3CUQB 3BDDA 1WRJA 4P9FA 5D4SA 5LLQA 3GW2A 3O6BB 1ON1A 3KLOA 2EFWA 1TQMA 1R7JA 5L3FA 1YO5C 5FLXK 1LEBA 4O6JA 3HUGA 4M73A 1YS6A 2F5EA 1XDUA 4L9VA 2DBBA 2E1CA 2EK5A 2JZYA 2HQNA 1WWXA 3WTWC 1O3TA 3F23A 3FMSA 3LQRA 3KETA 1BC8C 2H6CA 1OMIA 5FFXA 4BHBA 2M87A 4L18B 4HLXA 2ZJ2A 4M9ZA 2V79A 1IN5A 2DFIA 4E70A 4OMYA 1KGSA 4XLNF 5TRDA 4XSZF 4A5NA 5LHGA 1IW7F 1FBQA 1O7FA 5LHHA 3K9TA 2XAGA 1R1UA 1KYWA 3LAPA 5K5QA 2COMA 1T2KA 2L01A 3HRSA 4EM2A 2VT2A 1JGSA 3LWFA 2IJLA 3CDHA 3HIFA 5D5VB 1MDMB 4N9IA 4HOBA 3GO5A 4A0ZA 1FLIA 1O3QA 3OV8A 3IWFA 2DK8A 1XSVA 1W7PB 3CUOA 3DFGA 2H27A 3HTSB 4U0WA 1IAWA 2H6BA 3V8KA 4JBAA 5CVVA 2FNAA 5FD6A 4RGSA 2R3SA 3EYYA 4U0VA 4LG0B 3RYRA 1BN5A 2QWWA 4HV6A 3JAMK 1KU7A 1YG2A 4OINF 2CFXA 1T98A 2IA1A 2F5CA 3GEZA 5L3DA 1ZREA 4HF2A 2HS5A 1ZLKA 2FRHA 3O3KA 2G9WA 3WTSC 2DPUA 1S3JA 1ZH5A 1XSXA 3LA7A 3HHGA 2XGXA 5BPDA 1EV7A 2O03A 3PQKA 1MJAA 1U5TC 1FP2A 1KU2A 3E5UA 4WCGA 1MZBA 3L09A 3GZ5A 5HS7A 4ESJA 1TW3A 3TGNA 1LDDA 5JI6A 4R8HA 1R5GA 5F6FA 4IF4A 1IXSB 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2LSOA 3FWEA 2NS0A 3BZ6A 1R22A 1RI7A 1R5HA 5LEJA 5E17F 2P6TA 4U0YA 3I53A 2O8XA 2CGPA 3F8CA 2XUBA 3D0SA 1QNTA 2OAZA 5BPIA 4EJTA 4CO8A 1RNLA 4QWQA 3HTUA 1ZGJA 3E5XA 1K79A 1J7KA 2ZNYA 2DW4A 3KP2A 2A3SA 2IVMA 3TQNA 3K1NA 3KP7A 2PMHA 2OZ6A 4ENKA 3BPXA 3P9CA 2O0YA 4WXCA 2MD5A 2ETHA 1I1SA 3W6KB 4LLLA 4I2OA 2OZUA 1IXRC 2FU4A 3HRTA 4Q5SF 4MTEA 2FEZA 4IRIA 1XMKA 3CUQA 1YW8A 3I0TA 2Z33A 2JSCA 3R4KA 3C18A 4L9TA 1HSTA 1R1TA 3M8FA 5AONA 4IRGA 5IT3A 4IXAA 2FBHA 3BPVA 5ED4A 2XKPA 3GZ6A 4BNCA 5LEKA 5TJJA 3IC7A 3EYIA 4P55A 3SZPA 3RI4A 4M71A 4OOIA 2VC0A 2DQLA 4AIKA 4EGZA 2GZWA 3VOEA 2LF8A 2LKPA 3BJOA 3PQJA 4DNCA 1U2WA 2A07F 1YIOA 4U88A 4IRHA 4GXOA 4KT5C 3S2WA 3ZMTA 5HDKA 1REPC 4YFXF 2MA3A 2W57A 2V1UA 1LB2A 1LQ1A 2D1VA 3I5UA 3HSRA 5FGMA 1L0OC 4EJVA 1C0WA 4UVAA 2P8TA 4EMSA 1QZZA 1FY7A 4HX8A 4MGRA 4EM0B 5E1XA 1P6RA 4L9NA 4AIJA 1EH8A 5H20A 2VT3A 2A5YB 2IA0A 2VBXA 3BROA 1SFXA 3L2CA 3BOQA 3MZYA 4CHUA 4KFCA 1W7PA 3H3ZA 3EETA 1JHHA 2K86A 3QPTA 1PP7U 3MWMA 4L9JA 4P96A 3BJ6A 2K27A 1FC3A 1ULYA 3I58A 4HW0A 2W85A 2MH2A 2VE9A 1V3FA 4ZYGA 4PZJA 1BBYA 2STWA 3E6CC 3SHFA 1W7PD 1Z9CA 4WXDA 5K5RA 1KU3A 3R60A 1SMTA 3BWGA 3H92A 1XD7A 2VOPA 4L0YB 5DYMA 3TO7A 3JSOA 2FOKA 4AIHA 2EFNA 4LJZF 4EJOA 3IRRA 1Z6RA 1FSHA 1LDKB 2GA1A 5D8KB 1U6GA 4B8XA 1U78A 1S7AA 1IF1A 5CJ9A 3PFIA 1MD0A 4B09A 2ZKZA 1DPUA 2HOEA 2QQBA 2Z99A 5DDGA 4I7HA 4IPAA 5ICFA 1Y0UA 1P92A 4LFUA 2XKOA 4M9SA 1HXDA 3QRFF 4Y15A 3R61A 5D8LB 1BI1A 3ZMZA 2QENA 2RKHA 5H6RA 2IPQX 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3GFJA 1LDJA 2D45A 1YYVA 2HR3A 1SD6A 4LLGF 2VBWA 1Z1DA 1UCRA 3ZMSA 1OPCA 4BYYA 2RVCA 2F2EA 3FM3A 1BI2A 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3P9KA 4UVCA 3WTYC 2CW0F 2XIGA 1CF7B 1OKRA 1IN8A 2XVCA 5HVQC 4EM1A 3WTVC 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 4LGWA 1U3EM 2E1NA 3WGHA 1H9GA 2G7UA 2XAHA 2PBIA 4IHTA 3ZMVA 4LLNA 5FLXZ 2QVOA 1XN7A 1IXCA 2PEXA 4ZYHA 2WC2A 4MNUA 3TOAA 2YPRA 2ADUA 1XGMA 4M74A 4NQWA 4I02A 3R0JA 2HQRA 3ISPA 1MKMA 2K4JA 2DPDA 4CXFA 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 2PQ8A 4LK0F 3MAJA 1K6OA 3E6DA 4UHTA 1Z6TA 1GHCA 2V1DA 3C1DA 1S29A 1I1GA 4K2EA 2M5WA 2BGCA 2L02A 1SD5A 3CTAA 2R7DA 3FM5A 2A69F 1ZG3A 1I5ZA 2A68F 2EJRA 3MFKA 5D5XB 2QUFA 4KIBA 2Y75A 3J7AO 2Y0MA 2RV8A 1ON2A 2OA4A 1FZPB 2O6GE 2VXZA 4HF0A 3I71A 5FD5A 3V7SA 3TOBA 4ETSA 1DUXC 3WGGA 1T0FA 1EH6A 1PP8F 4R1HA 2P7CB 4LB6B 1O3SA 4TV7A 5F1RA 4OU0A 2G7HA 4MTDA 4KICA 5CVUA 4A12A 5JFRA 3MZHA 1SFUA 1BI3A 5A2QK 3GXOA 2CSOA 5E8GA 3RIRA 2D2WA 4KIFA 1ZAOA 2PI0A 1XCBA 2ZNZA 4MEYF 2A6EF 3JTGA 4KUMA 2FMLA 5ERIA 4A0XA 3F21A 2RQPA 1DPRA 3V7RA 4KMFA 3KFWX 2BYVE 1T38A 5KK1A 1H0MA 4LD5A 3KCCA 3J80Z 1OR7A 4Q47A 3VB2A 3F3XA 2QQ9A 4ASNA 5LGNA 3IHUA 1HKTA 3DPLC 2HYFA 1TLHB 4A6DA 1J59A 4KYWA 3KEQA 2FQ3A 3DXJF 2GAUA 4G7HF 5L3CA 1IUYA 4PCQA 3RPQA 2ISYA 1SD7A 1S6LA 5DUKA 1DDNA 3BJAA 1KA8A 1RUOA 4BAYA 3ZP5A 4WX9A 2OD5A 1FP1D 4GCVA 3F8FA 5ICGA 1DP7P 2W25A 1T39A 2XAFA 2IT0A 3TKYA 4HLYA 3E6BA 2Z9OA 2ZXJA 2QZ8A 1FPQA 3JW4A 4U7DA 1Z05A 3WODF 1KYZA 1IRFA 1W5TA 3RDIA 3K0LA 2F5FA 1I27A 4GGGA 2NNNA 5J8FA 5LRRA 3EUHA 2EV6A 1LVAA 3DP7A 1CF7A 1USSA 3QOPA 3CLOA 6PAXA 3SFZA 1XGOA 1YQAA 4M6YA 4NHJA 3CJNA 4HAMA 1SMYF 3DV8A 4KNYA 1B9NA 2FNPA 4KDPA 3O2PE 1ZGAA 5AIPA 3KZZA 3ML6A 1W4MA 2EFQA 3I64A 3P9IA 4ZZLA 2GQQA 2WV0A 1ODDA 5AIQA 5D6FA 5ILUA 2KJCA 1ZLJA 2W84A 3HRUA 2NNYA 2QLZA 5D5UB 2HTJA 5D5WB 1ZN2A 3M9AA 4M6XA 4OMZA 5FO5A 1ZRCA 4QLCU 2KIFA 3EDPA 5CVIA 2KIUA 4BH9A 1LEAA 3MQ0A 2QBYB 1HBXG 5J8CA 1D3YA 1XCVA 2L4MA 1XGSA 2ISZA 1YFHA 3BP8A 4I0AA 5LGUA 1KQ9A 3L00A 4S04A 5ICCA 1ONVA 3TDUC 2W24A 1U5TB 3VODA 3B73A 3COAC 1OYYA 4F7ZA 4LK1F 2XASA 3LA3A 5JVTA 2HKXA 2DQRA 4S05A 4LB5A 3ULQB 1XDSA 2NAZA 2JPBA 3P7NA 3IRQA 2JTVA 4ZZDA 2M30A 3FX3A 3QP5A 1FT9A 3HYIA 1G6NA 4AWXB 2MC3A 3IWZA 1JXSA 2STTA 2ZFWA 2RNJA 5CLSA 3WTTC 2HZTA 2J5OA 2Q0OA 3F8NA 1ZG5A 1UHMA 2YX7A 3KP3A 2V1XA 2XAJA 4MEXF 2P4WA 1SAXA 3GX4X 2ELHA 2UXNA 1ZRFA 3I59A 4PGHA 1QZYA 2P6SA 4CGZA 4L5IA 2AXLA 2DK5A 2QYOA 4KA4A 2PJPA 3HRMA 3DPTA 1PUEE 5A2QZ 4I0BA 1H9TA 2HKOA 2KKOA 1ZYRF 3C7JA 2NRAC 1TBXA 5DCFA 2AS5F 5DEQA 3IKTA 2RN7A 5E18F 2HYGD 1XMAA 1QGPA 1B59A 2KIMA 3ZN1A 3GF2A 4JK1X 4RGXA 1IN7A 4YIIA 2Z3YA 1F4KA 3QU3A 4O3MA 2MLKA 1CGPA 3T5XA 1F9NA 1ZRDA 3G73A 1BOAA 3GLXA 3IL2A 3B02A 1D8KA 4HQEA 2GXBA 2FXAA 1BM9A 2VN2A 3VEPA 2KJBA 2UXXA 1R58A 3ZN0A 2VOOA 4P5OA 2L3DA 1HKSA 4RB2C 2E7XA 3J80K 1HQCA 1HKQA 3V4GA 3D5LA 3DEUA 3WG9A 1D8JA 3F72A 3KP5A 1YTYA 3K2ZA 2HEOA 4CYDA 4FX0A 5IT9K 4EV0A 1NHAA 5BMZA 3JTHA 5JHUA 2GWRA 3F8MA 1MJBA 3E97A 2BEOA 1D5VA 5FB2A 1J2XA 5BQTA 4M72A 4EJWA 4AVPA 5DV5A 3F6VA 1SD4A 4A0YA 1AWCA 1TNTA 1V4RA 2P7VB 3GFLA 1WI9A 5JR3A 1RZ4A 2HTSA 4G7ZF 5DCMA 2CYYA
chains in the Genus database with same CATH superfamily
1XSDA 2FA5A 4BE1A 3GLLA 2DN0A 4CYCB 5GTIC 1Y1WJ 5M3MJ 4DQ2A 1R5ID 3ESWB 3H1CA 1B1BA 4BUPA 1UB9A 4XLPF 2JK3A 3QODA 1LVKA 4NBQA 1PDNC 1X3ZB 2FUG2 2M8GX 2TRTA 4UUSA 1Z3YA 2OQGA 3KLNA 2UV1A 3MEXA 5E3NA 2HYJA 4MQ9F 2ZO4A 2Q2EA 2XHKA 2QBYA 1K6YA 2L4AA 3GZNB 2H09A 3O8GA 4LG3A 5CYVA 4N0BA 2GOMA 2VB6A 1VI0A 4GYIA 5GAGJ 1KQ8A 4KJZA 4F92B 2NYXA 2M8EA 2AQEA 2EV5A 4A3DJ 3QYFA 2CO5A 2M2EA 4BJTA 1BIBA 2Y30A 1O57A 2OBPA 3SDBA 2G0EA 1FYKA 4ZYDA 4Q48A 1W0TA 1U5TA 1WQ2A 3IAM2 2XB5A 1GXQA 2CQKA 2LF7A 4RAZA 5L3BA 3PNYA 3GBGA 4M3FA 2EA2A 1FEXA 4PGGA 1HSJA 3AKZA 4E7LA 3HSFA 2M0CA 4EJUA 4XOTA 1TWHJ 2WA0A 3EQLF 4UV9A 3FXMA 2FBIA 4XN0A 3OYAA 3FXKA 1P9QC 2Z16A 3KYDB 4UV8A 3WE3A 5IOZA 2IP2A 2DA2A 3M7GA 4O5VA 3ZQCA 1ZR4A 4U7BA 3R0AA 3ROUA 1IN4A 3N05A 4IOCF 1E3HA 2KDZA 4E4HA 4C30A 5EG0A 3QP6A 2K9SA 4A3KJ 1RUNA 1E17A 1I3QJ 3D5SC 2VE8A 2AHQA 4L5JA 2XSJC 4M9XA 4ZC3A 2P5VA 3T8TA 2LY1A 2PG4A 3HPGA 1J75A 1KU9A 3BR5A 1TTYA 1P4AA 1HW1A 4CCNA 1ENHA 5LHIA 4UUVA 2ESHA 1JHFA 4BACA 3BCBA 4G6DA 2IW5A 3HM5A 3WU1B 1Y6IA 4ANJA 1IRGA 2ZMEB 4OWRB 4BHCA 1J5YA 3ZMUA 1XB4A 4XONA 4EGYA 3DQVC 1ETYA 1SFKA 2ZSHB 3PUFA 1IC8A 3PSIA 1GT0C 3GWZA 1P4XA 3CMMA 3SXYA 4OIOF 1FTTA 2W48A 2YUSA 1O3RA 5FJ8J 2D5VA 1P7JA 2L54A 3H5NA 3V7CA 4YG2F 4E7IA 1EH7A 3DLAA 4G94A 3K70D 1WZ2A 1R23A 2A6HF 4BU2A 5HLHA 4IQJA 3I59B 1W5SA 3A2KA 2DJIA 1X19A 1TQPA 2YSRA 1OCPA 1GVDA 3QOEA 4LIUA 3WTZA 3ZQ7A 1QA6A 1TNSA 4HNUA 4GYGA 1MBFA 4N9HA 2HXOA 2HFHA 1I6XA 2EZKA 4QSHA 1K7AA 3E6MA 3KP4A 4JQFA 5EGOB 2P5LC 4E7JA 2GA2A 1TWCJ 2IRFG 5B1AH 5L3EA 2JA6J 2DTRA 1E2XA 2XAUA 3S3OA 3A03A 3Q9VA 1MH4A 4YRVA 2VI6A 4XSXF 5HLGA 3RJPA 3OY9A 2WTEA 5IT9Z 1MIJA 3H0DA 3CJRB 1G3SA 4XOPA 2F4IA 1X4OA 3HC7A 4II3A 5DD4A 4F55A 2BW3B 4HA8A 3WU0A 2ZXHA 1LNWA 3CCEI 2YR2A 2ZCWA 1RR8C 4RB1A 1Q1VA 4OIPF 4G8XA 2R4GA 1MMAA 3E5QA 3A01B 4DZPA 4UNOA 5HDNA 3PNTA 4BHPA 4KMUX 3KEYA 3W6JB 5K7HA 1F43A 3BCAA 3DKWA 4D0PA 1NTCA 4PFOA 2C6YA 3U9GA 3M1CA 3GTMJ 4ON0A 4G9YA 1NG7A 1WSUA 1OISA 4CZCA 5E79C 2IGOA 5J6XA 3R6SA 3FISA 4A5MA 1L3LA 1P4WA 1LJ9A 2DFFA 1HW5A 3F22A 2DFHA 3REOA 4RLFA 2HXIA 2JRMA 4MLOA 1RESA 4MQVA 1VQ5I 3S2HJ 2MLGA 3QAHA 4HNVA 2BVMA 3V42A 1B6AA 1VF9A 4XORA 2O61A 1XG1A 1ETXA 2Y9ZA 1WCMJ 2VODA 1G4DA 1Q1HA 3ABUA 3L7WA 4MIMA 5DD8A 2YU9J 5DTDA 3LMMA 3LAJA 2M4GA 2M1BA 4BEHB 3QYBA 1S9HA 1O7LA 4JOMA 3F0CA 3SZGA 5ILVA 3N4MA 4B44A 1A04A 3HOTA 5EEGA 1YJ9I 4AD9A 3PUBA 5LBQA 3DEWA 5E8IA 3MKZA 1FYLA 3HJEA 4XRMA 2CV2A 1BR1A 1R1VA 1FX7A 2XGEA 2LTPA 5F27A 3SZTA 4DJAA 2QSGX 4XKBA 3BG3A 4DZJA 2CJJA 4FETA 4BJ6C 2HDCA 5F64A 4ESFA 4NC6A 2E60A 3QU6A 3HSEA 5IP6A 4HSRA 3ZXSA 2NOGA 4XLEA 2CW8A 2X6YA 1CQTA 3BT9A 2IS2A 4WXHA 3CCSI 4HV5A 1ZARA 5H6QA 1OCCH 1YLFA 2ZBKA 3VSLA 2PX9A 3J81K 2XV4S 1ZK8A 3A1YA 3IKVA 2BY0A 1RPWA 3RPUD 1PYVA 2EINH 2M34A 2R7TA 2FBKA 2M7AA 4J19A 1XGNA 3ECOA 2R7FA 5J4YA 2CW7A 3N97A 3I4PA 1MJ9A 1UELB 4FHTA 5DCMB 3FXRA 1FOKA 2CV1A 2QSFX 2QM3A 3QPHA 4BXUA 3BG7A 4CYCA 1J0RA 3JSPA 3JRGA 2XAQA 5E1ZB 2EBIA 3ABKH 4G6QA 4BQNA 2DA4A 3RPUA 3E3VA 2VONA 4J00A 1MMNA 2W4SA 2VBYA 3V8JA 2OU2A 5K5OA 2W00A 2Q2EB 3F8BA 3TP0A 2O3FA 1VTNC 3LFKA 3CO7C 3WHCA 2VKHA 4D9JA 1MH3A 1X3UA 4EVIA 4B3XA 3CCVI 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 3CD6I 1AOYA 1BW6A 4XMYA 1VQ7I 2JJ7A 1BI0A 1F5TA 2DA6A 1OJLA 3M8EA 4I09A 1FMWA 2P81A 1J09A 1B9MA 1T8IA 1MNEA 5EZGA 5KAFC 4MO7A 4D7MA 2XROA 4BQOA 2PLYA 2DI3A 4AM3A 3FXUA 2KL4A 2M45A 4NUBA 1FJLA 2IBDA 2WV1A 2YX4A 3PJRA 3RZDJ 3DTKA 4HDVA 3BY6A 1GDTA 1Z7UA 2DT6A 2ID6A 3VPRA 3BR3A 4HX4A 4PSWA 4CDGA 4RS8A 3K1MA 3MKYB 4A6EA 5FRMA 3H9GA 2OQRA 2FF4A 1WJAA 4GO1A 1E3PA 2L9SA 2K02A 3NEUA 2OTLI 3RKWA 2EIMH 3RTRA 4M3DA 4L0ZB 4Y17A 4A2UA 5JHFA 4UVBA 2CUFA 5EG0B 5TISC 3WGIA 3QQAA 4OIRF 4DW6A 5IP7J 4IHSA 1GXPA 4A93J 3BR6A 4ZH4F 3J81Z 2FJ1A 5HOOA 1YX3A 4ZYEA 3AL0B 3L9FA 3I54A 1H89C 1HLVA 3FMQA 4KN7X 4A3LJ 3C3WA 5LFAA 5GPAA 1P2FA 1P7IA 1SAUA 2ZMEA 1IGNA 3J7AY 1YW7A 5E20A 2JPCA 3OS1A 3BC8A 3HKZN 3GYHX 2R7XA 3FHZA 1USTA 2EFPA 5CPRB 3I55I 1JKQC 3WTUC 3W2VA 5EZHA 5KVRA 2BBYA 2VQCA 4I98B 4RB3C 1ZGWA 3ERED 3K4JA 1JE8A 2E2HJ 1RKWA 1S8NA 2VBZA 2DT7B 3SQNA 1JI8A 3LSTA 1W36D 4GFBA 3HPHA 2FSWA 4HQMA 1U8RA 2H1LA 3HZJA 2X4HA 2PN6A 4A3EJ 3P5JA 1X58A 4R79A 4HX7A 2TDXA 1XC5A 1BR2A 1N75A 1WH5A 2PFBA 3Q0WA 2E1MB 2F4MB 1I39A 1Z3XA 4IHYA 3Q9SA 4HYEA 2UWMA 2EA4A 3FZVA 3DTEA 1M1EB 1D0ZA 3JRBA 1BR4A 2W82A 1V54H 4CSWA 1SC7A 3ECHA 2J5PA 2QEXI 1QO0D 3KYCB 1OYWA 2MD0A 4YIFA 1F1ZA 4A3IJ 1IN6A 2Z5UA 3CO6C 4Y33A 1H88C 1QBJA 1D1CA 1G3TA 3U1DA 1WJCA 3IUOA 3A01A 2AXTC 1TWGJ 3LSJA 3NARA 4NNJA 4BL0B 4C3IJ 1J9IA 5IYCJ 5HS9A 2BZTA 2I10A 2OF7A 3DPUA 1IDYA 4HZFA 1YHQI 2RC4A 2QQAA 1K4TA 4JX6A 3GFMA 2KLOA 3WTXC 2LRDA 2EV0A 3OOPA 4G7OF 3KIOA 4DGWB 3OS0A 2ZC2A 4BQAA 4I01A 2JSPA 2GXGA 2OV7A 1MBGA 1RKTA 2E1OA 1FBUA 3OYCA 2VPLA 3DF8A 4LMYA 1IZ1A 2CQNA 1I3AA 3LSRA 1U9OA 2NOJB 2L9RA 2JRTA 3T0YA 1AKHA 5LRSA 2BV6A 4NB5A 1EKEA 2V6CA 1MDMA 3FF5A 4JP0A 2K85A 4RGRA 1BL0A 1G3YA 1MNMC 1MMSA 2A61A 3TO6A 4CZZA 2L7MP 2HI3A 3KP6A 2FMYA 3K1PA 2BE5F 2JUCA 2PJRA 5EEAA 1HC8A 2HGCA 3GVAA 2BXZA 3LA2A 2R0QC 4BBSJ 1YE9A 2DYSH 2K5CA 1YS7A 4IKFA 1ZELA 2DLLA 1B72A 1UHWA 4BEHA 5F08A 5GAEJ 3CDIA 1BJAA 5HDGA 2K4BA 2VQLA 3S93A 5BS6A 5ILSA 1VQLI 3G3ZA 5HLIA 4HF1A 1GUUA 4Z2YA 2VC1A 4IJAA 2KISA 1QPMA 5HS8A 4LG0A 2MSYA 1N25A 5B66C 1R4MB 3IV5A 1WJ5A 2HWVA 4KN4X 4PDKA 1S7OA 1W1WE 4N4NB 2B7EA 2DYRH 3QYEA 2RDPA 3JAMZ 1W36C 3HBLA 3T8RA 2LD5A 4XNFA 5C44J 1KQ0A 1U8BA 2MH9A 2DAOA 3G71I 2NVQJ 3HDDA 4EQQA 4Y13A 1O4XA 5K1YA 3Q5FA 4RDUA 3O8HA 2VJ5A 3V8LA 4XLAA 3K10A 1R36A 2M7BA 5J40A 3IH2A 1TL8A 1RC9A 1EF4A 1UZCA 5D4RA 4WK8F 2XB0X 3OYLA 2EB7A 3LNQA 1HF0A 1B4AA 1V5FA 4RAYA 4HDUA 1SFEA 1WKMA 2KRFA 1WFXA 2YU3A 2EILH 2UUZA 1YJWI 3MCZA 5EEHA 5E1WA 4WF2A 1G3WA 3ABTA 3BR2A 3HB9A 2XPUA 4NC8A 5GP9A 5DUIA 3UKGA 4YEJA 2VQGA 2P5KA 3KPHA 1BIAA 3HOSA 3MZ8A 5LD2C 5F04A 2CG4A 2LVSA 3CCMI 5D6EA 1FOWA 1XMXA 5CVJA 2ESNA 4WWCA 1FOXA 3OYHA 2OTJI 3TO9A 1SFOJ 1MBHA 2R7WA 3OYJA 4P9UA 4BBRJ 2F5DA 1VQOI 1JT0A 2V26A 1FNNA 1OYIA 2BVLA 1PUFB 2EFOA 3DBLB 2NVYJ 1ETQA 1NK3P 3GUDA 2L9VA 3TDZC 1JTXA 1PJRA 5J1UA 2DO7A 2K7LA 4IEJA 5BOXA 4M3BA 3BR1A 1K78A 2JVGA 2KDOA 3AAFA 1FYMA 3ZPLA 3M1EA 3HOVJ 4YFKF 2E7WA 2V9VA 5ICEA 2GM4A 2EPFA 2GIVA 4UB6C 1SVOA 2DJNA 4OAYA 3WE2A 1GVJA 3ZMDA 1UMQA 2ECBA 2E1MC 1DGRM 4FCYA 3KZYA 1AA7A 2XRNA 1ITYA 3OIPA 4ENMA 1Y0NA 2QKMB 1I50J 2E36A 1MBEA 3FHNA 3K69A 4FT8A 1TQIA 2OPTA 2DU9A 4B48A 1R00A 4F91B 3LQQA 2IA2A 1FWZA 3T1BA 1T6SA 2RGVA 3KEOA 1V5GA 3OSGA 1T0FC 3KE2A 2WWYA 1IV6A 2N8GA 4RB0A 2K9MA 5F0CA 4H0EA 4ENJA 4A3GJ 3JRFA 1FTZA 1DU6A 4UXNA 3FMRA 3OYBA 2DFEA 2Y48A 3IP4B 2B0LA 2MW8A 4HBLA 2L2OA 3BG9A 1BC7C 5LGTA 1HW2A 1QQIA 1RIOH 3NRVA 3CZ6A 4QPQA 2DOAA 2KFDA 2DT5A 3PNVA 4FX4A 4XRFA 3PSFA 4G6TB 3I9V2 1XTAA 2Q8KA 4YFNF 1HA8A 1TW2A 3HHHA 5F0HA 3GFIA 3CUQC 3W6VA 4BKXA 3HKZA 3F6OA 3MKWB 3AG1H 4XBFA 1UFMA 1ZG1A 2CUZA 3RYPA 1FBSA 3SJMA 1APLC 3RKYA 2EWNA 1FSEA 3FBNB 2D1HA 4B47A 2ACJA 2RQQA 2UZKA 5M5WJ 1D1BA 5E3LA 1MGTA 5FFZA 3ELKA 3FKIJ 3MD2A 1VQ4I 3CUQB 3BDDA 4XRSA 1WRJA 1NG6A 4P9FA 1XX5A 2WB1A 4ZDLA 2JWTA 2Q1ZB 5D4SA 5LLQA 3GW2A 3O6BB 1JT6A 1ON1A 4XN3A 1OR7C 3KLOA 2EFWA 2XF5A 1TQMA 1R7JA 3E1SA 4XKCA 2P0WA 5L3FA 1YO5C 2QSHX 3I4MJ 5FLXK 3HOZJ 3U1KA 1LEBA 2MFZA 4O6JA 4AIDA 3HUGA 2V4JC 4M73A 1YS6A 1JTYA 2F5EA 4I99C 2CRGA 2I5UA 1R49A 1HDDC 1XDUA 1R6RA 2DBBA 2FQ4A 4L9VA 2X1CA 2E1CA 2EK5A 2JZYA 2HQNA 3FKJA 3K7AJ 1WWXA 3DBHB 1WI3A 2LY9A 3JREA 3WTWC 3DLLF 1OCOH 1Y39A 1O3TA 5FKMA 3F23A 3FMSA 3S16J 1F36A 3LQRA 3KETA 2DOFA 2KQRA 1BC8C 2H6CA 1A6QA 1OMIA 5FFXA 4BHBA 2M87A 2ME0A 3CC2I 4HLXA 4L18B 1UG0A 2ZJ2A 4M9ZA 2V79A 2CQ7A 1IN5A 4QPOA 2DFIA 4E70A 3AG4H 5K7ZA 4OMYA 3OOUA 3CF5F 1IUFA 3DU6A 4BQQA 4EATA 2LR8A 1KGSA 3D5RC 4XLNF 1Y1VJ 2WB1N 5TRDA 4XSZF 4A5NA 5LHGA 2VKEA 1IW7F 4DYRA 1FBQA 4XLFA 1O7FA 1V5EA 1QVTA 3K2AA 5LHHA 1Z67A 4HRIA 2VJIA 3K9TA 2XAGA 1R1UA 1KYWA 2F4OB 3LAPA 3GTOJ 2CV0A 5KCMA 4PJJA 5K5QA 2COMA 4C3HJ 1T2KA 4AVZA 1X2NA 2L01A 2M4KA 2M9HA 5J4VA 2K3FA 1QVUA 1X4PA 3JRIA 1IDZA 3HRSA 4EM2A 2VT2A 5EYRA 3SFIA 3BTLA 1JGSA 2WAQN 2IJLA 3LWFA 3OIQA 1G2HA 1BA5A 3CDHA 3HIFA 5D5VB 1AKHB 1LFBA 4AU7A 1MDMB 4N9IA 4HOBA 3GO5A 3D1NI 2QF7A 4A0ZA 1FLIA 1YI2I 1MNDA 2X85A 2KZVA 1O3QA 2BOLA 2XGCA 2PJRB 2X6OA 4GDFA 3OV8A 3GCMA 3IWFA 2DK8A 1B72B 1XSVA 1W7PB 3CUOA 2X6WA 3DFGA 3TBIA 2H27A 3HTSB 1FOYA 4U0WA 1IAWA 2H6BA 4U87A 3TP3A 2ZXWH 3V8KA 4JBAA 1POGA 3H0GJ 5CVVA 2FNAA 2LKSA 4XIDA 1V55H 1BJZA 1OCZH 3FK6A 2XPWA 3SDGA 5FD6A 4RGSA 2R3SA 3EYYA 2Y31A 4U0VA 2K40A 4LG0B 3RYRA 4HPQA 1JUPA 1BN5A 1YIJI 1ZQ3P 2QWWA 2DODA 1WPKA 2CU7A 4HV6A 3NWTA 2K3PA 3JAMK 1KU7A 4A3MJ 2IS1A 1YG2A 4OINF 4KT6A 3JRDA 2CFXA 4UY8I 1T98A 2IA1A 3ZQLA 2F5CA 3GEZA 5L3DA 1ZREA 4HF2A 1FIAA 2HS5A 5M3FJ 1JUSA 2VQHA 1ZLKA 2FRHA 3O3KA 2G9WA 5GAHJ 3WTSC 2DPUA 1S3JA 1UAAA 1ZH5A 2OC6A 2DMPA 1XSXA 3LA7A 3HHGA 2XGXA 2ZXIA 4E7HA 2CQXA 1NH3A 2R93J 4RBOA 3I56I 5BPDA 1EV7A 2O03A 5B5EC 3PQKA 1MJAA 1QRYA 1U5TC 1FP2A 4S0HB 1KU2A 3E5UA 4WCGA 2EQRA 2QKLB 2VIXA 3LSMA 1MZBA 3L09A 3GZ5A 5HS7A 2Y2ZA 4ESJA 3K4MA 3RSNA 1JJ6C 1Z7LA 2I8DA 1TW3A 2WADA 4I76A 1E3OC 3TGNA 1JKPC 3ABLH 1LDDA 5JI6A 5F0FA 4R8HA 1R5GA 5F6FA 4IF4A 1PUFA 2DXIA 2DMUA 1IXSB 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2OCEA 1Z21A 2JN6A 2LSOA 3ZQHA 3FWEA 4UB8C 2NS0A 3BZ6A 3BZCA 3S17J 1R22A 1RI7A 1R5HA 5LEJA 4IZZA 5IOYA 4D5CA 5E17F 2P6TA 1VQKI 4U0YA 4XR6A 3I53A 2O8XA 2CGPA 3F8CA 3S15J 2XUBA 2CMPA 1TP4A 2E71A 2ZJQF 3D0SA 4G12A 3H36A 5CQGA 4A3BJ 1QNTA 2HVQA 2OAZA 2IXSA 5BPIA 4EJTA 4CO8A 1RNLA 4QWQA 3HTUA 3ZR8X 4XQFA 1ZGJA 1W5CC 3E5XA 3LSGA 1LPQA 1K79A 2BY1A 1J7KA 4HNTA 2ZNYA 1Y8QB 2DW4A 1MW7A 1N77A 3KP2A 1G59A 2A3SA 2IVMA 3TQNA 3GTPJ 3H5AA 3K1NA 3KP7A 2VJJA 2PMHA 2OZ6A 4ENKA 3S2DJ 2LYCA 2FX0A 3BPXA 2EH3A 5JLWA 4FE7A 3OIOA 3P9CA 2O0YA 4PUSA 4WXCA 2MD5A 4AYBN 2ETHA 2R5ZA 3S32A 4E7KA 3W6KB 1I1SA 3S8PA 4LLLA 4I2OA 1WGXA 2OZUA 1IXRC 1HCRA 2HPMA 3OYNA 3DTIA 4XRSG 2FU4A 3BTIA 3HRTA 4Q5SF 1LKXA 4MTEA 2FEZA 4IRIA 1XMKA 3CUQA 4CUGA 2ELJA 1YW8A 1ACIA 2OCCH 3I0TA 2Z33A 3H3VK 5FKLA 1A36A 5EJCA 2JSCA 3R4KA 2KT0A 3C18A 4L9TA 3VSKA 2R5YA 5FKKA 1HSTA 1R1TA 3M8FA 4XLCA 5AONA 4MFDA 4IRGA 3CC4I 5IT3A 4IXAA 2FBHA 3HUGB 4NQWB 3BPVA 3VYSB 5DM6F 4DBRA 5F1JA 5ED4A 3PIPF 3W3CA 2XKPA 3HEFA 4B3AA 3GZ6A 1D0XA 2LY2A 4LITA 3PIOF 4V19K 4BNCA 5IP9J 5LEKA 4X1EA 5C4JJ 5TJJA 5J3LA 1ETVA 3IC7A 3EYIA 4P55A 2OUMA 3SZPA 3AL0C 3RI4A 3BTJA 4M71A 4OOIA 2VC0A 2DQLA 2WAQA 4AIKA 2E5NA 4EGZA 2GZWA 3VOEA 3CJQB 5E3MA 3TL4X 3TW6A 4IOAF 3HG9A 3FXJA 2LF8A 4CCLA 1B8IB 2LKPA 1VQMI 3BJOA 3PQJA 2V6EA 4DNCA 1U2WA 2LKXA 4PK4A 2A07F 1SVLA 1YIOA 4U88A 5FKOA 4IRHA 4YIRX 4GXOA 4Y52J 2Z1DA 2FOWA 4KT5C 3BTCA 3S2WA 3ZMTA 4X6AJ 5HDKA 1REPC 1DP3A 4CH7A 3A4CA 4YFXF 2HVSA 3VYUB 3M07A 2MA3A 2R7SA 2W57A 3OL4A 3HGYA 2V1UA 1IJWC 1LB2A 1LQ1A 2D1VA 3CCLI 3I5UA 3HSRA 2R7RA 5FGMA 1L0OC 3MVPA 4EJVA 1C0WA 4UVAA 4LOCA 2P8TA 3RQ4A 4EMSA 1QZZA 3FBIB 1FY7A 4HX8A 4MGRA 4XM3A 4EM0B 5E1XA 1MSEC 1VQNI 1P6RA 4CCKA 2QA4I 5HODA 4L9NA 1ORKA 5FLMJ 3S1MJ 1RETA 1T95A 1EH8A 5H20A 2VT3A 4AIJA 2A5YB 3GMEA 2IA0A 2TCTA 2VBXA 3JRCA 2WY7Q 3BROA 1SFXA 3L2CA 2CS3A 3S1QJ 3BOQA 3MZYA 4CHUA 3K70C 2Y9YA 2KMUA 4KFCA 4A3CJ 1W7PA 3EUHC 3H3ZA 2NVXJ 3EETA 2X48A 1JHHA 4BDZA 2XGDA 2K86A 4B43A 4CCJA 1HDPA 3QPTA 1PP7U 5FRNA 2HQ5A 3DEEA 3OR2C 3LFUA 1JUMA 3QWLA 3MWMA 1TWAJ 2WBMA 4Y7NJ 4L9JA 2KZGA 1AHDP 4P96A 3BJ6A 2K27A 3L1PA 2PMZN 1FC3A 1ULYA 1SEUA 5TGTA 3I58A 1Z0XA 1ERDA 4HW0A 2W85A 2MH2A 1S5LC 1PVEA 2VE9A 1V3FA 3PFYA 4ZYGA 4PZJA 5FKNA 1IO2A 1OCTC 2KIQA 1BBYA 2WY8Q 2STWA 3E6CC 2KPMA 3SHFA 2BXYA 4BS9A 1W7PD 1Z9CA 2DTZA 4WXDA 3EUKL 5K5RA 1IRXA 3G2BA 1TC3C 4C9YA 1KU3A 3R60A 1SMTA 3BWGA 3AG3H 4OAZA 2MGQA 2LK2A 3H92A 1XD7A 5HLTA 2VOPA 5KNLA 3SEZA 4L0YB 5DYMA 3TO7A 3JSOA 2FOKA 4AIHA 1IV8A 2EFNA 2JVHA 4LJZF 3M3YJ 4EJOA 5KHDA 3IRRA 4NDLA 1VQ8I 1Z6RA 1FSHA 4FASD 3X2QH 2X9DA 1LDKB 3TW7A 2GA1A 5D8KB 1U6GA 4B8XA 1ETKA 1MMGA 1U78A 1S7AA 1IF1A 3CF2A 3E0JB 4BGDA 5IYDJ 2E2IJ 3ONQA 2LG4A 3SYTA 5CJ9A 3PFIA 5JVGF 1MD0A 4B09A 4RLQA 3KX2A 4IL6C 1EJ9A 1IRZA 4D5FA 2VL8A 1AU7A 2HU9A 2X6XA 2ZKZA 1DPUA 3G1MA 2HOEA 4IX7A 5C4XJ 4CCOA 3MKLA 2QQBA 2DA7A 2JUGA 3OS2A 2Z99A 3OR1C 4PJNA 2BY2A 5DDGA 3ZQIA 4I7HA 1K83J 1ZR2A 4B4CA 1LE8A 4AUXA 1GV5A 4IPAA 4E6KG 5ICFA 1Y0UA 3BLYA 1P92A 2A6TA 3JRHA 3LOCA 4LFUA 2XKOA 4M9SA 1LFPA 1HXDA 3QRFF 4DYQA 4Y15A 4IO9F 3OSFA 3FIWA 3R61A 1QZEA 2X1DA 5D8LB 1BI1A 3ZMZA 2QENA 2RKHA 5H6RA 2Z2SB 2IPQX 2EZLA 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3GFJA 1IG7A 1LDJA 1YYVA 2HR3A 2D45A 1OLTA 1SD6A 4LLGF 2VBWA 3DU5A 1Z1DA 5B3SH 1UCRA 3ZMSA 2DA5A 4Z6YA 3BR0A 2XRLA 1OPCA 4BYYA 1WVRA 2F2EA 2RVCA 3FM3A 1BI2A 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3IH3A 3P9KA 3J7ZI 4UVCA 2R5ZB 3WTYC 2CW0F 2XIGA 1CF7B 2NS7A 2LFBA 1OKRA 1IN8A 2XVCA 5HVQC 3A0HC 4F52A 4PJMA 5KAIC 4EM1A 3WTVC 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 1X3WB 2DDBA 4LGWA 1U3EM 2E1NA 3L2QA 3WGHA 4A3FJ 1H9GA 5IPAA 3ZGKA 1NK2P 2F6CA 2G7UA 4DOZA 2XAHA 2A05A 1K61A 2MC4A 2PBIA 4IHTA 1ETOA 3EUAA 1X1PA 1R4NB 3ZMVA 4LLNA 1R71A 3SEQA 5FLXZ 2QVOA 1XN7A 1KZHA 4Y3OA 3ASOH 2PEXA 1IXCA 2R5YB 3LSIA 2ECCA 1VNDA 4ZYHA 3GTQJ 3HGGA 2WC2A 1D1AA 4MNUA 3TOAA 2YPRA 2ADUA 3CMEI 1XGMA 3KZIC 4M74A 4NQWA 4RMNA 1X1DA 4I02A 3R0JA 3CP2A 2HQRA 1WJEA 1OFCX 4GRIA 3WU2C 1XS9A 3ISPA 3B6AA 1JGGA 2H1KA 1MKMA 2K4JA 2DPDA 1YITI 4BXXJ 2ZB9A 4CXFA 1TT5B 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 2PQ8A 1BW5A 4LK0F 2O5RA 3MAJA 3S1NJ 1B8IA 1K6OA 4CCMA 3IH4A 4XKVA 3E6DA 2ZMEC 3CCYA 2RAEA 1Y56A 4UHTA 1MMDA 1Z6TA 1GHCA 3C2GA 5M5XJ 3C2BA 2V1DA 2IS4A 3C1DA 5FROA 1S29A 1N78A 1I1GA 2DA3A 2B9SA 1S7EA 3PM1A 2XDVA 4K2EA 2M5WA 2BGCA 2L02A 1SD5A 2HOAA 3CTAA 2R7DA 3L2RA 3FM5A 2A69F 1ZG3A 3L2WA 1I5ZA 5J1RA 4XK4A 2A68F 2EJRA 1FMVA 2E19A 4BXFA 5D5XB 3MFKA 4BE2A 2QUFA 4W97A 2OJED 4KIBA 2KRHA 2Y75A 3J7AO 2Y0MA 2RV8A 4FQGA 4V2GA 2IGNA 1GLNA 2HNHA 1ON2A 2OA4A 1FZPB 3VYTB 3GTLJ 1A5JA 2O6GE 1S72I 2HOSA 3ZOBA 1T08B 2VXZA 4HF0A 3I71A 5FD5A 4PJLA 5H2FC 1A31A 1WH7A 3V7SA 3TOBA 4ETSA 1DUXC 2ZSIB 3GTGJ 3VDXA 3WGGA 1T0FA 4PFPA 4J01A 1EH6A 1PP8F 4R1HA 2P7CB 3G1OA 4LB6B 1O3SA 2HVRA 2QCOA 4TV7A 4C2MJ 5F1RA 2IAIA 5K7FA 4OU0A 3DBRB 2G7HA 2QGUA 4KICA 4MTDA 5CVUA 4A12A 4QIWN 5JFRA 3MZHA 1SFUA 4V2FA 1I6HJ 1QHHD 3K4CA 1BI3A 4BJ5C 3ZQGA 5A2QK 2K9LA 2VLAA 1RR7A 5GPCA 3GXOA 3CCUI 4RM3A 2CSOA 5E8GA 3RIRA 2D2WA 4KIFA 5CQEA 4HEA2 3CQZJ 4II2A 1ZAOA 4KITB 1XCBA 5DS9A 3OYFA 2PI0A 4HG2A 2ZNZA 4MEYF 1OCRH 4A3JJ 5EF6A 4M3EA 3ZQQA 2A6EF 4C2UA 3JTGA 4LIVA 4KUMA 2FMLA 5ERIA 4A0XA 3F21A 3WHBA 2NVTJ 2VUMJ 5C3EJ 2RQPA 1DPRA 3V7RA 2WAFA 4KMFA 3KFWX 2BYVE 1T38A 5KK1A 2H8RA 1H0MA 2IGKA 4LD5A 2Y0SN 3KCCA 3J80Z 1VQPI 3DKXA 3E7LA 3PO2J 1OR7A 3CMYA 4ZYAA 4Q47A 2GBYA 3VB2A 3F3XA 1Y8RB 4A69C 1K4SA 2QQ9A 4ASNA 5LGNA 2HDDA 3IHUA 2NXNB 4PSXA 1QPIA 1HKTA 3DPLC 2HYFA 3K4BA 1TLHB 4A6DA 1J59A 4KYWA 2JA7J 4AC0A 3KEQA 2FQ3A 4CA0A 3DXJF 2GAUA 4Y4RA 4G7HF 5L3CA 2KP6A 2L0KA 1IUYA 1JKRC 4PCQA 3RPQA 3CCRI 2ISYA 4F3QA 1U0JA 1SD7A 2XSDC 3HOWJ 1S6LA 5DUKA 1DDNA 3BJAA 4RM2A 1KA8A 4IQ4A 3I3LA 3CCQI 4E7ZA 1X1AA 1RUOA 1WJBA 4BAYA 1RRJA 3ZP5A 4WX9A 4E7SA 3G6EI 5J1YA 2OD5A 1FP1D 2BHZA 2PMZA 2AO9A 4FISA 4JX5A 3BG6A 3CC7I 1LE8B 4GCVA 4D1QA 3F8FA 3ERMA 4IHWA 3LSHA 3VWBA 1YJNI 5ICGA 2E5ZA 1DP7P 2W25A 1T39A 3C2HA 2XAFA 1YRNA 2IT0A 2E34A 3M8JA 1MSFC 4FE4A 2EZIA 3TKYA 4HLYA 3E6BA 3L2UA 2Z9OA 2ZFUA 2LP0A 2ZXJA 2QZ8A 5EDNA 1FPQA 2ICWG 3JW4A 3VYRB 9ANTA 2M3AA 4U7DA 2Y0SA 1Z05A 1X2MA 3L2VA 5JLXA 3WODF 1KYZA 1IRFA 3CCJI 1W5TA 3RDIA 2L7ZA 3OYMA 3BZKA 3K0LA 3U21A 4RA2A 3I4NJ 2F5FA 1I27A 4GGGA 2NNNA 5J8FA 3W2AA 2JA2A 3EUHA 2EV6A 5LRRA 4ITVA 3UR3C 1LVAA 3DP7A 3FXOA 1CF7A 1USSA 3EPZA 4M6VA 3QOPA 3J7YJ 3CLOA 1JJ8C 2HZDA 2VASA 1LUJB 5M5YJ 1BOBA 1VFCA 6PAXA 2GOXB 3RZOJ 2M0MA 2VXDA 3SFZA 2R7UA 3S1RJ 3OYGA 2L5QA 3M4OJ 1XGOA 1YQAA 2R7VA 4M6YA 4DBQA 4NHJA 3K6GA 3CJNA 1A6IA 2LMDA 4XL9A 2LBFB 3DWLE 2ZJRF 4HAMA 1SMYF 3IAS2 1FIPA 3DV8A 1G8XA 1YX5A 4KNYA 1B9NA 2BY3A 2FNPA 4KDPA 3O2PE 1ZGAA 5AIPA 3KZZA 4P1WA 2K9QA 3ML6A 1W4MA 1QU3A 1DGWY 2EFQA 3I64A 3P9IA 3RCOA 3FK7A 4ZZLA 3TMOA 5B1BH 2LREA 2GQQA 1GV2A 2WV0A 3CJTB 1ODDA 4BDYA 2O7OA 3LSKA 2EIKH 5AIQA 5D6FA 5ILUA 4QTRA 3RKQA 2JA8J 2KJCA 5E3OA 1ZLJA 2W84A 3HRUA 2NNYA 2QLZA 5D5UB 1VQ9I 2VPRA 3OYKA 2HTJA 2VJ4A 5D5WB 1ZN2A 3M9AA 4M6XA 4OMZA 3CLQA 2XF7A 5FO5A 2CH0A 4UUSB 1ZRCA 4QLCU 2KIFA 2CUEA 2HPIA 3EDPA 5CVIA 2KIUA 4BH9A 2JQ7A 1LEAA 1T33A 4UUTA 3MQ0A 1ZTRA 2QBYB 1HBXG 3OL3A 1D3YA 5J8CA 1XCVA 2L4MA 1XGSA 3K4LA 2ISZA 2VKVA 1YFHA 1Z77A 3BP8A 3DCFA 3CP8A 4I0AA 2B63J 2XPVA 1QHGA 2LC2A 2R7QA 4RAGA 3HOYJ 2DMQA 2IEKA 1KQ9A 3L00A 3W2WA 4C3JJ 5LGUA 2JA5J 4S04A 5ICCA 3CESA 3Q0VA 3A0BC 1ONVA 4AYBA 3TDUC 4KISA 2W24A 2EIJH 1U5TB 3G1LA 3VODA 3B73A 2KRCA 5CKTA 3COAC 1OYYA 3ASNH 4F7ZA 2IS6A 4LK1F 3JRAA 2X51A 2XASA 3LA3A 3RQIA 4ZJZA 4RAFA 2V9KA 3A02A 4EEFG 5JVTA 3H9QA 2RREA 2GXAA 2YS9A 4JYKA 2HKXA 3FDYA 2DQRA 4ZTFA 4S05A 2NVUB 4LB5A 3ULQB 1XDSA 3MN2A 1ETWA 2NAZA 4F93B 2JPBA 3S3MA 4ZTJA 3P7NA 3IRQA 3PO3J 2JTVA 4ZZDA 2M30A 3K4NA 3FX3A 3QP5A 1FT9A 3ZRGA 3HYIA 1A35A 4XICA 1G6NA 1VZ0A 4AWXB 2MC3A 1SVMA 3IWZA 3G4SI 2STTA 1JXSA 4BY1J 2ZFWA 2RNJA 5CLSA 3WTTC 3KYLA 2HZTA 2J5OA 4ZDOA 1X1BA 4IHXA 2HDWA 2Q0OA 3F8NA 1D5YA 3BG5A 1ZG5A 1UHMA 2YX7A 1TWFJ 1DU0A 3KP3A 4H4KC 3DKYA 2V1XA 2XAJA 4MEXF 2P4WA 3HXLA 1SAXA 3GX4X 3CMAI 3OMYA 3HOXJ 2ELHA 3QPLA 3ABMH 2UXNA 2VKDA 3LSPA 1ZRFA 2DOEA 3NWSA 4BY7J 3I59A 4NC7A 2DMNA 2L7FP 2NS8A 4PGHA 1QZYA 2CFOA 2RNGA 1E0EA 1ZKGA 2P6SA 5DM7F 1XPXA 4CGZA 1DQUA 1UG2A 3LL7A 2ME6A 3BQZA 2EZHA 4L5IA 2AXLA 5EGOA 2DK5A 2QYOA 5HNHA 4KA4A 2PJPA 3GTKJ 3HRMA 3S14J 2MYSA 3F9KA 2A5WA 3DPTA 3ZQFA 1WJDA 3WG7H 2R92J 1PUEE 2LOOA 5A2QZ 4I0BA 2W1OA 3K4KA 1H9TA 1UJ8A 2K9NA 2HKOA 2V1NA 4B1RA 2CQQA 2KKOA 1ZYRF 2Y69H 3C7JA 2NRAC 5IYBJ 2BW3A 1TBXA 5DCFA 2AS5F 1UHSA 5DEQA 3IKTA 4N4OB 1LFUP 3JCUC 2RN7A 4XLHA 2GIZA 3NAUA 5E18F 4YELA 2V9PA 2HYGD 3FXLA 1XMAA 1QGPA 1B59A 2KIMA 3BQYA 3ZN1A 1TT0A 2LLKA 3GF2A 3UNGC 2HOTA 4JK1X 1HOMA 1TZLA 4RGXA 3Q3SA 2KHMA 4C2TA 1IN7A 1KONA 5FLVA 4DYCA 1H8AC 4YIIA 2AQFA 2Z3YA 3CDLA 1F4KA 2XF6A 2DMTA 3QU3A 5GTHC 3PL8A 1U9NA 4O3MA 2MLKA 1CGPA 3T5XA 1F9NA 1WHUA 3G73A 1ZRDA 2HQAA 2WAEA 1BOAA 3GLXA 3IL2A 1YRNB 1SANA 5GADJ 4I6ZA 3B02A 1D8KA 3H35A 2MABA 4HQEA 1D0YA 2GXBA 2FXAA 5HNFA 1BM9A 2DCEA 2VN2A 4JX4A 3VEPA 3OYEA 2KJBA 1OQYA 2UXXA 2BHYA 1R58A 3ZN0A 2X1EA 2CUJA 2VOOA 4P5OA 3H5RA 2FD5A 2L3DA 3OWTA 4PJ0C 1HKSA 4RB2C 2O8KA 2E7XA 2W7NA 3J80K 4ZDPA 4XKWA 4D7NA 1VQ6I 1HQCA 1HKQA 3V4GA 3D5LA 1X1CA 3DEUA 3WG9A 1JKOC 5IY5H 3AG2H 1D8JA 2R7ZJ 3F72A 3MMYB 3KP5A 3TEDA 3JR9A 2ELKA 3OYDA 4ABZA 1YTYA 3K2ZA 2ZJPF 2DA1A 3OYIA 3AFHA 3HL2A 2HEOA 2COBA 1T56A 4CYDA 2MG4A 3S3NA 3Q0UA 3QPSA 4FX0A 2V7FA 5IT9K 2F48A 4EV0A 1NHAA 5BMZA 1MBJA 3JTHA 2LH9A 5JHUA 2GWRA 3F8MA 4BE0A 1R9TJ 1W0UA 2LBFA 5BNGA 2ID3A 1MJBA 4MFEA 2XC7A 2JMWA 2L7KA 1MBKA 3E97A 2BEOA 1D5VA 5FB2A 4HSTA 4W1UA 3H9JA 1J2XA 2R7OA 2E2JJ 2L9NA 4L5EA 4M72A 4EJWA 5BQTA 1WJFA 4AVPA 3HOUJ 4X0GA 5DV5A 2GLOA 3F6VA 3B6CA 1SD4A 4A0YA 2F5VA 1EA3A 3GTJJ 1AWCA 2QQ8A 1TNTA 1V4RA 2E35A 4DIQA 2H8WA 2O9LA 2P7VB 3GFLA 1WI9A 4FTHA 1YOVB 5JR3A 4IHVA 2IGMA 5J47A 3ZCOA 1RZ4A 2HTSA 4G7ZF 5DCMA 4M3GA 2CYYA 2DDAA
chains in the Genus database with same CATH topology
1XSDA 2FA5A 4DQ2A 1B1BA 1UB9A 4XLPF 1PDNC 2OQGA 3KLNA 3MEXA 4MQ9F 2ZO4A 2Q2EA 2XHKA 2QBYA 2L4AA 2H09A 5CYVA 4N0BA 4GYIA 1KQ8A 2NYXA 2M8EA 2EV5A 2CO5A 1BIBA 1O57A 2OBPA 1FYKA 4ZYDA 4Q48A 1U5TA 1WQ2A 1GXQA 2CQKA 5L3BA 2LF7A 4RAZA 2EA2A 4PGGA 1HSJA 3HSFA 4EJUA 3EQLF 4UV9A 2FBIA 4UV8A 3WE3A 2IP2A 3M7GA 4O5VA 4U7BA 3R0AA 3ROUA 1IN4A 3QP6A 1RUNA 1E17A 2VE8A 4L5JA 4M9XA 1J75A 2P5VA 3T8TA 2PG4A 1KU9A 1TTYA 1P4AA 1HW1A 5LHIA 4UUVA 2ESHA 1JHFA 4G6DA 2IW5A 3WU1B 1IRGA 2ZMEB 4BHCA 1J5YA 3ZMUA 1XB4A 4EGYA 3DQVC 3GWZA 1P4XA 3SXYA 4OIOF 1O3RA 2L54A 3V7CA 4YG2F 1EH7A 4G94A 1R23A 2A6HF 5HLHA 3I59B 1W5SA 1TQPA 2YSRA 3WTZA 3ZQ7A 1TNSA 4GYGA 4N9HA 2HFHA 1I6XA 1K7AA 3E6MA 3KP4A 4JQFA 2P5LC 2GA2A 2IRFG 5L3EA 2DTRA 1E2XA 3Q9VA 4XSXF 5HLGA 3RJPA 2WTEA 5IT9Z 1G3SA 5DD4A 4HA8A 3WU0A 1LNWA 2YR2A 2ZCWA 4RB1A 4OIPF 4G8XA 3E5QA 4UNOA 5HDNA 4BHPA 4KMUX 3W6JB 3DKWA 4D0PA 2C6YA 3U9GA 4ON0A 4G9YA 1WSUA 5J6XA 3R6SA 4A5MA 1L3LA 1P4WA 1LJ9A 1HW5A 3F22A 3REOA 4MQVA 2MLGA 3QAHA 1B6AA 2O61A 2VODA 1G4DA 1Q1HA 3ABUA 3L7WA 5DD8A 3LAJA 2M1BA 1O7LA 3N4MA 5ILVA 1A04A 3HOTA 5EEGA 4AD9A 5LBQA 5E8IA 1FYLA 1R1VA 1FX7A 3SZTA 2HDCA 5F64A 4ESFA 3QU6A 3HSEA 4WXHA 4HV5A 1ZARA 5H6QA 1YLFA 2ZBKA 3J81K 2XV4S 3IKVA 2FBKA 1XGNA 3ECOA 2R7FA 3N97A 3I4PA 1MJ9A 4FHTA 5DCMB 3FXRA 1FOKA 2QM3A 3QPHA 4BXUA 1J0RA 3JSPA 2XAQA 5E1ZB 4G6QA 3RPUA 3E3VA 2VONA 2VBYA 3V8JA 2OU2A 5K5OA 3F8BA 2O3FA 1VTNC 3LFKA 3CO7C 1X3UA 4EVIA 1K78B 4ENNA 1Z91A 3NQOA 5L3GA 1AOYA 1BI0A 1F5TA 3M8EA 4I09A 1B9MA 2XROA 2PLYA 2DI3A 3FXUA 2M45A 2YX4A 4HDVA 3BY6A 1Z7UA 4HX4A 4CDGA 4RS8A 3K1MA 4A6EA 2OQRA 2FF4A 4GO1A 2K02A 3NEUA 3RKWA 3RTRA 4L0ZB 4Y17A 4A2UA 4UVBA 3WGIA 4OIRF 4IHSA 1GXPA 4ZH4F 3J81Z 5HOOA 4ZYEA 3L9FA 3I54A 3FMQA 4KN7X 3C3WA 1P2FA 2ZMEA 1YW7A 5E20A 2JPCA 3GYHX 3FHZA 1USTA 2EFPA 3WTUC 5KVRA 2BBYA 4I98B 4RB3C 3ERED 1JE8A 1S8NA 2VBZA 3SQNA 3LSTA 2FSWA 4HQMA 1U8RA 2X4HA 2PN6A 4R79A 4HX7A 2TDXA 2PFBA 3Q9SA 4HYEA 2UWMA 2EA4A 3FZVA 3ECHA 2J5PA 1QO0D 1OYWA 4YIFA 1F1ZA 1IN6A 2Z5UA 3CO6C 1QBJA 1G3TA 3U1DA 1J9IA 5HS9A 4HZFA 2RC4A 2QQAA 3GFMA 3WTXC 2EV0A 3OOPA 4G7OF 4BQAA 4I01A 2GXGA 1FBUA 3DF8A 4LMYA 1IZ1A 2JRTA 3T0YA 5LRSA 2BV6A 4NB5A 1MDMA 2V6CA 3FF5A 4RGRA 1G3YA 2A61A 3TO6A 4CZZA 3KP6A 2FMYA 3K1PA 2BE5F 2HGCA 3GVAA 3LA2A 1YS7A 2DLLA 1UHWA 1BJAA 5HDGA 2K4BA 5BS6A 5ILSA 4HF1A 3G3ZA 5HLIA 4Z2YA 2VC1A 4IJAA 1QPMA 5HS8A 4LG0A 2HWVA 4KN4X 4PDKA 1S7OA 2RDPA 3JAMZ 3T8RA 1KQ0A 2MH9A 2DAOA 4EQQA 4Y13A 5K1YA 3Q5FA 3V8LA 1R36A 5D4RA 4WK8F 2EB7A 1B4AA 4RAYA 4HDUA 1SFEA 1WKMA 2KRFA 2YU3A 3MCZA 5EEHA 5E1WA 4WF2A 1G3WA 3ABTA 5DUIA 2P5KA 1BIAA 3HOSA 2CG4A 5D6EA 4WWCA 5CVJA 2ESNA 3TO9A 4P9UA 2F5DA 1FNNA 1OYIA 2EFOA 3GUDA 3TDZC 2DO7A 2K7LA 1K78A 5BOXA 3AAFA 3ZPLA 1FYMA 3M1EA 4YFKF 2E7WA 2V9VA 5ICEA 2GIVA 3ZMDA 3WE2A 1GVJA 3KZYA 2XRNA 4ENMA 3K69A 4FT8A 1TQIA 2DU9A 1R00A 3LQQA 2IA2A 1FWZA 3T1BA 1T6SA 2RGVA 3KEOA 3KE2A 2WWYA 4RB0A 4H0EA 4ENJA 4UXNA 3FMRA 2Y48A 2B0LA 4HBLA 1BC7C 5LGTA 1HW2A 1QQIA 1RIOH 3NRVA 2DT5A 4FX4A 4XRFA 2Q8KA 4YFNF 1TW2A 3HHHA 3GFIA 3CUQC 3F6OA 4XBFA 1UFMA 1ZG1A 3RYPA 1FBSA 3RKYA 2EWNA 1FSEA 2D1HA 2ACJA 2UZKA 1MGTA 5FFZA 3ELKA 3CUQB 3BDDA 1WRJA 4P9FA 5D4SA 5LLQA 3GW2A 3O6BB 1ON1A 3KLOA 2EFWA 1TQMA 1R7JA 5L3FA 1YO5C 5FLXK 1LEBA 4O6JA 3HUGA 4M73A 1YS6A 2F5EA 1XDUA 4L9VA 2DBBA 2E1CA 2EK5A 2JZYA 2HQNA 1WWXA 3WTWC 1O3TA 3F23A 3FMSA 3LQRA 3KETA 1BC8C 2H6CA 1OMIA 5FFXA 4BHBA 2M87A 4L18B 4HLXA 2ZJ2A 4M9ZA 2V79A 1IN5A 2DFIA 4E70A 4OMYA 1KGSA 4XLNF 5TRDA 4XSZF 4A5NA 5LHGA 1IW7F 1FBQA 1O7FA 5LHHA 3K9TA 2XAGA 1R1UA 1KYWA 3LAPA 5K5QA 2COMA 1T2KA 2L01A 3HRSA 4EM2A 2VT2A 1JGSA 3LWFA 2IJLA 3CDHA 3HIFA 5D5VB 1MDMB 4N9IA 4HOBA 3GO5A 4A0ZA 1FLIA 1O3QA 3OV8A 3IWFA 2DK8A 1XSVA 1W7PB 3CUOA 3DFGA 2H27A 3HTSB 4U0WA 1IAWA 2H6BA 3V8KA 4JBAA 5CVVA 2FNAA 5FD6A 4RGSA 2R3SA 3EYYA 4U0VA 4LG0B 3RYRA 1BN5A 2QWWA 4HV6A 3JAMK 1KU7A 1YG2A 4OINF 2CFXA 1T98A 2IA1A 2F5CA 3GEZA 5L3DA 1ZREA 4HF2A 2HS5A 1ZLKA 2FRHA 3O3KA 2G9WA 3WTSC 2DPUA 1S3JA 1ZH5A 1XSXA 3LA7A 3HHGA 2XGXA 5BPDA 1EV7A 2O03A 3PQKA 1MJAA 1U5TC 1FP2A 1KU2A 3E5UA 4WCGA 1MZBA 3L09A 3GZ5A 5HS7A 4ESJA 1TW3A 3TGNA 1LDDA 5JI6A 4R8HA 1R5GA 5F6FA 4IF4A 1IXSB 2CWEA 4MHGA 3FXQA 3U2RA 2MBFA 2LSOA 3FWEA 2NS0A 3BZ6A 1R22A 1RI7A 1R5HA 5LEJA 5E17F 2P6TA 4U0YA 3I53A 2O8XA 2CGPA 3F8CA 2XUBA 3D0SA 1QNTA 2OAZA 5BPIA 4EJTA 4CO8A 1RNLA 4QWQA 3HTUA 1ZGJA 3E5XA 1K79A 1J7KA 2ZNYA 2DW4A 3KP2A 2A3SA 2IVMA 3TQNA 3K1NA 3KP7A 2PMHA 2OZ6A 4ENKA 3BPXA 3P9CA 2O0YA 4WXCA 2MD5A 2ETHA 1I1SA 3W6KB 4LLLA 4I2OA 2OZUA 1IXRC 2FU4A 3HRTA 4Q5SF 4MTEA 2FEZA 4IRIA 1XMKA 3CUQA 1YW8A 3I0TA 2Z33A 2JSCA 3R4KA 3C18A 4L9TA 1HSTA 1R1TA 3M8FA 5AONA 4IRGA 5IT3A 4IXAA 2FBHA 3BPVA 5ED4A 2XKPA 3GZ6A 4BNCA 5LEKA 5TJJA 3IC7A 3EYIA 4P55A 3SZPA 3RI4A 4M71A 4OOIA 2VC0A 2DQLA 4AIKA 4EGZA 2GZWA 3VOEA 2LF8A 2LKPA 3BJOA 3PQJA 4DNCA 1U2WA 2A07F 1YIOA 4U88A 4IRHA 4GXOA 4KT5C 3S2WA 3ZMTA 5HDKA 1REPC 4YFXF 2MA3A 2W57A 2V1UA 1LB2A 1LQ1A 2D1VA 3I5UA 3HSRA 5FGMA 1L0OC 4EJVA 1C0WA 4UVAA 2P8TA 4EMSA 1QZZA 1FY7A 4HX8A 4MGRA 4EM0B 5E1XA 1P6RA 4L9NA 4AIJA 1EH8A 5H20A 2VT3A 2A5YB 2IA0A 2VBXA 3BROA 1SFXA 3L2CA 3BOQA 3MZYA 4CHUA 4KFCA 1W7PA 3H3ZA 3EETA 1JHHA 2K86A 3QPTA 1PP7U 3MWMA 4L9JA 4P96A 3BJ6A 2K27A 1FC3A 1ULYA 3I58A 4HW0A 2W85A 2MH2A 2VE9A 1V3FA 4ZYGA 4PZJA 1BBYA 2STWA 3E6CC 3SHFA 1W7PD 1Z9CA 4WXDA 5K5RA 1KU3A 3R60A 1SMTA 3BWGA 3H92A 1XD7A 2VOPA 4L0YB 5DYMA 3TO7A 3JSOA 2FOKA 4AIHA 2EFNA 4LJZF 4EJOA 3IRRA 1Z6RA 1FSHA 1LDKB 2GA1A 5D8KB 1U6GA 4B8XA 1U78A 1S7AA 1IF1A 5CJ9A 3PFIA 1MD0A 4B09A 2ZKZA 1DPUA 2HOEA 2QQBA 2Z99A 5DDGA 4I7HA 4IPAA 5ICFA 1Y0UA 1P92A 4LFUA 2XKOA 4M9SA 1HXDA 3QRFF 4Y15A 3R61A 5D8LB 1BI1A 3ZMZA 2QENA 2RKHA 5H6RA 2IPQX 2H94A 2X0LA 1ZHFA 3H3UA 4CICA 3GFJA 1LDJA 2D45A 1YYVA 2HR3A 1SD6A 4LLGF 2VBWA 1Z1DA 1UCRA 3ZMSA 1OPCA 4BYYA 2RVCA 2F2EA 3FM3A 1BI2A 2LDUA 3RKXA 2JT1A 4IVNA 4Q4ZF 3P9KA 4UVCA 3WTYC 2CW0F 2XIGA 1CF7B 1OKRA 1IN8A 2XVCA 5HVQC 4EM1A 3WTVC 3VFZA 2PMUA 1STZA 2FE3A 2LNBA 4LGWA 1U3EM 2E1NA 3WGHA 1H9GA 2G7UA 2XAHA 2PBIA 4IHTA 3ZMVA 4LLNA 5FLXZ 2QVOA 1XN7A 1IXCA 2PEXA 4ZYHA 2WC2A 4MNUA 3TOAA 2YPRA 2ADUA 1XGMA 4M74A 4NQWA 4I02A 3R0JA 2HQRA 3ISPA 1MKMA 2K4JA 2DPDA 4CXFA 4ESBA 5CVRA 4KIGA 4OIQF 4RGUA 1YW9A 2PQ8A 4LK0F 3MAJA 1K6OA 3E6DA 4UHTA 1Z6TA 1GHCA 2V1DA 3C1DA 1S29A 1I1GA 4K2EA 2M5WA 2BGCA 2L02A 1SD5A 3CTAA 2R7DA 3FM5A 2A69F 1ZG3A 1I5ZA 2A68F 2EJRA 3MFKA 5D5XB 2QUFA 4KIBA 2Y75A 3J7AO 2Y0MA 2RV8A 1ON2A 2OA4A 1FZPB 2O6GE 2VXZA 4HF0A 3I71A 5FD5A 3V7SA 3TOBA 4ETSA 1DUXC 3WGGA 1T0FA 1EH6A 1PP8F 4R1HA 2P7CB 4LB6B 1O3SA 4TV7A 5F1RA 4OU0A 2G7HA 4MTDA 4KICA 5CVUA 4A12A 5JFRA 3MZHA 1SFUA 1BI3A 5A2QK 3GXOA 2CSOA 5E8GA 3RIRA 2D2WA 4KIFA 1ZAOA 2PI0A 1XCBA 2ZNZA 4MEYF 2A6EF 3JTGA 4KUMA 2FMLA 5ERIA 4A0XA 3F21A 2RQPA 1DPRA 3V7RA 4KMFA 3KFWX 2BYVE 1T38A 5KK1A 1H0MA 4LD5A 3KCCA 3J80Z 1OR7A 4Q47A 3VB2A 3F3XA 2QQ9A 4ASNA 5LGNA 3IHUA 1HKTA 3DPLC 2HYFA 1TLHB 4A6DA 1J59A 4KYWA 3KEQA 2FQ3A 3DXJF 2GAUA 4G7HF 5L3CA 1IUYA 4PCQA 3RPQA 2ISYA 1SD7A 1S6LA 5DUKA 1DDNA 3BJAA 1KA8A 1RUOA 4BAYA 3ZP5A 4WX9A 2OD5A 1FP1D 4GCVA 3F8FA 5ICGA 1DP7P 2W25A 1T39A 2XAFA 2IT0A 3TKYA 4HLYA 3E6BA 2Z9OA 2ZXJA 2QZ8A 1FPQA 3JW4A 4U7DA 1Z05A 3WODF 1KYZA 1IRFA 1W5TA 3RDIA 3K0LA 2F5FA 1I27A 4GGGA 2NNNA 5J8FA 5LRRA 3EUHA 2EV6A 1LVAA 3DP7A 1CF7A 1USSA 3QOPA 3CLOA 6PAXA 3SFZA 1XGOA 1YQAA 4M6YA 4NHJA 3CJNA 4HAMA 1SMYF 3DV8A 4KNYA 1B9NA 2FNPA 4KDPA 3O2PE 1ZGAA 5AIPA 3KZZA 3ML6A 1W4MA 2EFQA 3I64A 3P9IA 4ZZLA 2GQQA 2WV0A 1ODDA 5AIQA 5D6FA 5ILUA 2KJCA 1ZLJA 2W84A 3HRUA 2NNYA 2QLZA 5D5UB 2HTJA 5D5WB 1ZN2A 3M9AA 4M6XA 4OMZA 5FO5A 1ZRCA 4QLCU 2KIFA 3EDPA 5CVIA 2KIUA 4BH9A 1LEAA 3MQ0A 2QBYB 1HBXG 5J8CA 1D3YA 1XCVA 2L4MA 1XGSA 2ISZA 1YFHA 3BP8A 4I0AA 5LGUA 1KQ9A 3L00A 4S04A 5ICCA 1ONVA 3TDUC 2W24A 1U5TB 3VODA 3B73A 3COAC 1OYYA 4F7ZA 4LK1F 2XASA 3LA3A 5JVTA 2HKXA 2DQRA 4S05A 4LB5A 3ULQB 1XDSA 2NAZA 2JPBA 3P7NA 3IRQA 2JTVA 4ZZDA 2M30A 3FX3A 3QP5A 1FT9A 3HYIA 1G6NA 4AWXB 2MC3A 3IWZA 1JXSA 2STTA 2ZFWA 2RNJA 5CLSA 3WTTC 2HZTA 2J5OA 2Q0OA 3F8NA 1ZG5A 1UHMA 2YX7A 3KP3A 2V1XA 2XAJA 4MEXF 2P4WA 1SAXA 3GX4X 2ELHA 2UXNA 1ZRFA 3I59A 4PGHA 1QZYA 2P6SA 4CGZA 4L5IA 2AXLA 2DK5A 2QYOA 4KA4A 2PJPA 3HRMA 3DPTA 1PUEE 5A2QZ 4I0BA 1H9TA 2HKOA 2KKOA 1ZYRF 3C7JA 2NRAC 1TBXA 5DCFA 2AS5F 5DEQA 3IKTA 2RN7A 5E18F 2HYGD 1XMAA 1QGPA 1B59A 2KIMA 3ZN1A 3GF2A 4JK1X 4RGXA 1IN7A 4YIIA 2Z3YA 1F4KA 3QU3A 4O3MA 2MLKA 1CGPA 3T5XA 1F9NA 1ZRDA 3G73A 1BOAA 3GLXA 3IL2A 3B02A 1D8KA 4HQEA 2GXBA 2FXAA 1BM9A 2VN2A 3VEPA 2KJBA 2UXXA 1R58A 3ZN0A 2VOOA 4P5OA 2L3DA 1HKSA 4RB2C 2E7XA 3J80K 1HQCA 1HKQA 3V4GA 3D5LA 3DEUA 3WG9A 1D8JA 3F72A 3KP5A 1YTYA 3K2ZA 2HEOA 4CYDA 4FX0A 5IT9K 4EV0A 1NHAA 5BMZA 3JTHA 5JHUA 2GWRA 3F8MA 1MJBA 3E97A 2BEOA 1D5VA 5FB2A 1J2XA 5BQTA 4M72A 4EJWA 4AVPA 5DV5A 3F6VA 1SD4A 4A0YA 1AWCA 1TNTA 1V4RA 2P7VB 3GFLA 1WI9A 5JR3A 1RZ4A 2HTSA 4G7ZF 5DCMA 2CYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSD A;  2FA5 A;  4DQ2 A;  1B1B A;  1UB9 A;  4XLP F;  1PDN C;  2OQG A;  3KLN A;  3MEX A;  4MQ9 F;  2ZO4 A;  2Q2E A;  2XHK A;  2QBY A;  2L4A A;  2H09 A;  5CYV A;  4N0B A;  4GYI A;  1KQ8 A;  2NYX A;  2M8E A;  2EV5 A;  2CO5 A;  1BIB A;  1O57 A;  2OBP A;  1FYK A;  4ZYD A;  4Q48 A;  1U5T A;  1WQ2 A;  1GXQ A;  2CQK A;  5L3B A;  2LF7 A;  4RAZ A;  2EA2 A;  4PGG A;  1HSJ A;  3HSF A;  4EJU A;  3EQL F;  4UV9 A;  2FBI A;  4UV8 A;  3WE3 A;  2IP2 A;  3M7G A;  4O5V A;  4U7B A;  3R0A A;  3ROU A;  1IN4 A;  3QP6 A;  1RUN A;  1E17 A;  2VE8 A;  4L5J A;  4M9X A;  1J75 A;  2P5V A;  3T8T A;  2PG4 A;  1KU9 A;  1TTY A;  1P4A A;  1HW1 A;  5LHI A;  4UUV A;  2ESH A;  1JHF A;  4G6D A;  2IW5 A;  3WU1 B;  1IRG A;  2ZME B;  4BHC A;  1J5Y A;  3ZMU A;  1XB4 A;  4EGY A;  3DQV C;  3GWZ A;  1P4X A;  3SXY A;  4OIO F;  1O3R A;  2L54 A;  3V7C A;  4YG2 F;  1EH7 A;  4G94 A;  1R23 A;  2A6H F;  5HLH A;  3I59 B;  1W5S A;  1TQP A;  2YSR A;  3WTZ A;  3ZQ7 A;  1TNS A;  4GYG A;  4N9H A;  2HFH A;  1I6X A;  1K7A A;  3E6M A;  3KP4 A;  4JQF A;  2P5L C;  2GA2 A;  2IRF G;  5L3E A;  2DTR A;  1E2X A;  3Q9V A;  4XSX F;  5HLG A;  3RJP A;  2WTE A;  5IT9 Z;  1G3S A;  5DD4 A;  4HA8 A;  3WU0 A;  1LNW A;  2YR2 A;  2ZCW A;  4RB1 A;  4OIP F;  4G8X A;  3E5Q A;  4UNO A;  5HDN A;  4BHP A;  4KMU X;  3W6J B;  3DKW A;  4D0P A;  2C6Y A;  3U9G A;  4ON0 A;  4G9Y A;  1WSU A;  5J6X A;  3R6S A;  4A5M A;  1L3L A;  1P4W A;  1LJ9 A;  1HW5 A;  3F22 A;  3REO A;  4MQV A;  2MLG A;  3QAH A;  1B6A A;  2O61 A;  2VOD A;  1G4D A;  1Q1H A;  3ABU A;  3L7W A;  5DD8 A;  3LAJ A;  2M1B A;  1O7L A;  3N4M A;  5ILV A;  1A04 A;  3HOT A;  5EEG A;  4AD9 A;  5LBQ A;  5E8I A;  1FYL A;  1R1V A;  1FX7 A;  3SZT A;  2HDC A;  5F64 A;  4ESF A;  3QU6 A;  3HSE A;  4WXH A;  4HV5 A;  1ZAR A;  5H6Q A;  1YLF A;  2ZBK A;  3J81 K;  2XV4 S;  3IKV A;  2FBK A;  1XGN A;  3ECO A;  2R7F A;  3N97 A;  3I4P A;  1MJ9 A;  4FHT A;  5DCM B;  3FXR A;  1FOK A;  2QM3 A;  3QPH A;  4BXU A;  1J0R A;  3JSP A;  2XAQ A;  5E1Z B;  4G6Q A;  3RPU A;  3E3V A;  2VON A;  2VBY A;  3V8J A;  2OU2 A;  5K5O A;  3F8B A;  2O3F A;  1VTN C;  3LFK A;  3CO7 C;  1X3U A;  4EVI A;  1K78 B;  4ENN A;  1Z91 A;  3NQO A;  5L3G A;  1AOY A;  1BI0 A;  1F5T A;  3M8E A;  4I09 A;  1B9M A;  2XRO A;  2PLY A;  2DI3 A;  3FXU A;  2M45 A;  2YX4 A;  4HDV A;  3BY6 A;  1Z7U A;  4HX4 A;  4CDG A;  4RS8 A;  3K1M A;  4A6E A;  2OQR A;  2FF4 A;  4GO1 A;  2K02 A;  3NEU A;  3RKW A;  3RTR A;  4L0Z B;  4Y17 A;  4A2U A;  4UVB A;  3WGI A;  4OIR F;  4IHS A;  1GXP A;  4ZH4 F;  3J81 Z;  5HOO A;  4ZYE A;  3L9F A;  3I54 A;  3FMQ A;  4KN7 X;  3C3W A;  1P2F A;  2ZME A;  1YW7 A;  5E20 A;  2JPC A;  3GYH X;  3FHZ A;  1UST A;  2EFP A;  3WTU C;  5KVR A;  2BBY A;  4I98 B;  4RB3 C;  3ERE D;  1JE8 A;  1S8N A;  2VBZ A;  3SQN A;  3LST A;  2FSW A;  4HQM A;  1U8R A;  2X4H A;  2PN6 A;  4R79 A;  4HX7 A;  2TDX A;  2PFB A;  3Q9S A;  4HYE A;  2UWM A;  2EA4 A;  3FZV A;  3ECH A;  2J5P A;  1QO0 D;  1OYW A;  4YIF A;  1F1Z A;  1IN6 A;  2Z5U A;  3CO6 C;  1QBJ A;  1G3T A;  3U1D A;  1J9I A;  5HS9 A;  4HZF A;  2RC4 A;  2QQA A;  3GFM A;  3WTX C;  2EV0 A;  3OOP A;  4G7O F;  4BQA A;  4I01 A;  2GXG A;  1FBU A;  3DF8 A;  4LMY A;  1IZ1 A;  2JRT A;  3T0Y A;  5LRS A;  2BV6 A;  4NB5 A;  1MDM A;  2V6C A;  3FF5 A;  4RGR A;  1G3Y A;  2A61 A;  3TO6 A;  4CZZ A;  3KP6 A;  2FMY A;  3K1P A;  2BE5 F;  2HGC A;  3GVA A;  3LA2 A;  1YS7 A;  2DLL A;  1UHW A;  1BJA A;  5HDG A;  2K4B A;  5BS6 A;  5ILS A;  4HF1 A;  3G3Z A;  5HLI A;  4Z2Y A;  2VC1 A;  4IJA A;  1QPM A;  5HS8 A;  4LG0 A;  2HWV A;  4KN4 X;  4PDK A;  1S7O A;  2RDP A;  3JAM Z;  3T8R A;  1KQ0 A;  2MH9 A;  2DAO A;  4EQQ A;  4Y13 A;  5K1Y A;  3Q5F A;  3V8L A;  1R36 A;  5D4R A;  4WK8 F;  2EB7 A;  1B4A A;  4RAY A;  4HDU A;  1SFE A;  1WKM A;  2KRF A;  2YU3 A;  3MCZ A;  5EEH A;  5E1W A;  4WF2 A;  1G3W A;  3ABT A;  5DUI A;  2P5K A;  1BIA A;  3HOS A;  2CG4 A;  5D6E A;  4WWC A;  5CVJ A;  2ESN A;  3TO9 A;  4P9U A;  2F5D A;  1FNN A;  1OYI A;  2EFO A;  3GUD A;  3TDZ C;  2DO7 A;  2K7L A;  1K78 A;  5BOX A;  3AAF A;  3ZPL A;  1FYM A;  3M1E A;  4YFK F;  2E7W A;  2V9V A;  5ICE A;  2GIV A;  3ZMD A;  3WE2 A;  1GVJ A;  3KZY A;  2XRN A;  4ENM A;  3K69 A;  4FT8 A;  1TQI A;  2DU9 A;  1R00 A;  3LQQ A;  2IA2 A;  1FWZ A;  3T1B A;  1T6S A;  2RGV A;  3KEO A;  3KE2 A;  2WWY A;  4RB0 A;  4H0E A;  4ENJ A;  4UXN A;  3FMR A;  2Y48 A;  2B0L A;  4HBL A;  1BC7 C;  5LGT A;  1HW2 A;  1QQI A;  1RIO H;  3NRV A;  2DT5 A;  4FX4 A;  4XRF A;  2Q8K A;  4YFN F;  1TW2 A;  3HHH A;  3GFI A;  3CUQ C;  3F6O A;  4XBF A;  1UFM A;  1ZG1 A;  3RYP A;  1FBS A;  3RKY A;  2EWN A;  1FSE A;  2D1H A;  2ACJ A;  2UZK A;  1MGT A;  5FFZ A;  3ELK A;  3CUQ B;  3BDD A;  1WRJ A;  4P9F A;  5D4S A;  5LLQ A;  3GW2 A;  3O6B B;  1ON1 A;  3KLO A;  2EFW A;  1TQM A;  1R7J A;  5L3F A;  1YO5 C;  5FLX K;  1LEB A;  4O6J A;  3HUG A;  4M73 A;  1YS6 A;  2F5E A;  1XDU A;  4L9V A;  2DBB A;  2E1C A;  2EK5 A;  2JZY A;  2HQN A;  1WWX A;  3WTW C;  1O3T A;  3F23 A;  3FMS A;  3LQR A;  3KET A;  1BC8 C;  2H6C A;  1OMI A;  5FFX A;  4BHB A;  2M87 A;  4L18 B;  4HLX A;  2ZJ2 A;  4M9Z A;  2V79 A;  1IN5 A;  2DFI A;  4E70 A;  4OMY A;  1KGS A;  4XLN F;  5TRD A;  4XSZ F;  4A5N A;  5LHG A;  1IW7 F;  1FBQ A;  1O7F A;  5LHH A;  3K9T A;  2XAG A;  1R1U A;  1KYW A;  3LAP A;  5K5Q A;  2COM A;  1T2K A;  2L01 A;  3HRS A;  4EM2 A;  2VT2 A;  1JGS A;  3LWF A;  2IJL A;  3CDH A;  3HIF A;  5D5V B;  1MDM B;  4N9I A;  4HOB A;  3GO5 A;  4A0Z A;  1FLI A;  1O3Q A;  3OV8 A;  3IWF A;  2DK8 A;  1XSV A;  1W7P B;  3CUO A;  3DFG A;  2H27 A;  3HTS B;  4U0W A;  1IAW A;  2H6B A;  3V8K A;  4JBA A;  5CVV A;  2FNA A;  5FD6 A;  4RGS A;  2R3S A;  3EYY A;  4U0V A;  4LG0 B;  3RYR A;  1BN5 A;  2QWW A;  4HV6 A;  3JAM K;  1KU7 A;  1YG2 A;  4OIN F;  2CFX A;  1T98 A;  2IA1 A;  2F5C A;  3GEZ A;  5L3D A;  1ZRE A;  4HF2 A;  2HS5 A;  1ZLK A;  2FRH A;  3O3K A;  2G9W A;  3WTS C;  2DPU A;  1S3J A;  1ZH5 A;  1XSX A;  3LA7 A;  3HHG A;  2XGX A;  5BPD A;  1EV7 A;  2O03 A;  3PQK A;  1MJA A;  1U5T C;  1FP2 A;  1KU2 A;  3E5U A;  4WCG A;  1MZB A;  3L09 A;  3GZ5 A;  5HS7 A;  4ESJ A;  1TW3 A;  3TGN A;  1LDD A;  5JI6 A;  4R8H A;  1R5G A;  5F6F A;  4IF4 A;  1IXS B;  2CWE A;  4MHG A;  3FXQ A;  3U2R A;  2MBF A;  2LSO A;  3FWE A;  2NS0 A;  3BZ6 A;  1R22 A;  1RI7 A;  1R5H A;  5LEJ A;  5E17 F;  2P6T A;  4U0Y A;  3I53 A;  2O8X A;  2CGP A;  3F8C A;  2XUB A;  3D0S A;  1QNT A;  2OAZ A;  5BPI A;  4EJT A;  4CO8 A;  1RNL A;  4QWQ A;  3HTU A;  1ZGJ A;  3E5X A;  1K79 A;  1J7K A;  2ZNY A;  2DW4 A;  3KP2 A;  2A3S A;  2IVM A;  3TQN A;  3K1N A;  3KP7 A;  2PMH A;  2OZ6 A;  4ENK A;  3BPX A;  3P9C A;  2O0Y A;  4WXC A;  2MD5 A;  2ETH A;  1I1S A;  3W6K B;  4LLL A;  4I2O A;  2OZU A;  1IXR C;  2FU4 A;  3HRT A;  4Q5S F;  4MTE A;  2FEZ A;  4IRI A;  1XMK A;  3CUQ A;  1YW8 A;  3I0T A;  2Z33 A;  2JSC A;  3R4K A;  3C18 A;  4L9T A;  1HST A;  1R1T A;  3M8F A;  5AON A;  4IRG A;  5IT3 A;  4IXA A;  2FBH A;  3BPV A;  5ED4 A;  2XKP A;  3GZ6 A;  4BNC A;  5LEK A;  5TJJ A;  3IC7 A;  3EYI A;  4P55 A;  3SZP A;  3RI4 A;  4M71 A;  4OOI A;  2VC0 A;  2DQL A;  4AIK A;  4EGZ A;  2GZW A;  3VOE A;  2LF8 A;  2LKP A;  3BJO A;  3PQJ A;  4DNC A;  1U2W A;  2A07 F;  1YIO A;  4U88 A;  4IRH A;  4GXO A;  4KT5 C;  3S2W A;  3ZMT A;  5HDK A;  1REP C;  4YFX F;  2MA3 A;  2W57 A;  2V1U A;  1LB2 A;  1LQ1 A;  2D1V A;  3I5U A;  3HSR A;  5FGM A;  1L0O C;  4EJV A;  1C0W A;  4UVA A;  2P8T A;  4EMS A;  1QZZ A;  1FY7 A;  4HX8 A;  4MGR A;  4EM0 B;  5E1X A;  1P6R A;  4L9N A;  4AIJ A;  1EH8 A;  5H20 A;  2VT3 A;  2A5Y B;  2IA0 A;  2VBX A;  3BRO A;  1SFX A;  3L2C A;  3BOQ A;  3MZY A;  4CHU A;  4KFC A;  1W7P A;  3H3Z A;  3EET A;  1JHH A;  2K86 A;  3QPT A;  1PP7 U;  3MWM A;  4L9J A;  4P96 A;  3BJ6 A;  2K27 A;  1FC3 A;  1ULY A;  3I58 A;  4HW0 A;  2W85 A;  2MH2 A;  2VE9 A;  1V3F A;  4ZYG A;  4PZJ A;  1BBY A;  2STW A;  3E6C C;  3SHF A;  1W7P D;  1Z9C A;  4WXD A;  5K5R A;  1KU3 A;  3R60 A;  1SMT A;  3BWG A;  3H92 A;  1XD7 A;  2VOP A;  4L0Y B;  5DYM A;  3TO7 A;  3JSO A;  2FOK A;  4AIH A;  2EFN A;  4LJZ F;  4EJO A;  3IRR A;  1Z6R A;  1FSH A;  1LDK B;  2GA1 A;  5D8K B;  1U6G A;  4B8X A;  1U78 A;  1S7A A;  1IF1 A;  5CJ9 A;  3PFI A;  1MD0 A;  4B09 A;  2ZKZ A;  1DPU A;  2HOE A;  2QQB A;  2Z99 A;  5DDG A;  4I7H A;  4IPA A;  5ICF A;  1Y0U A;  1P92 A;  4LFU A;  2XKO A;  4M9S A;  1HXD A;  3QRF F;  4Y15 A;  3R61 A;  5D8L B;  1BI1 A;  3ZMZ A;  2QEN A;  2RKH A;  5H6R A;  2IPQ X;  2H94 A;  2X0L A;  1ZHF A;  3H3U A;  4CIC A;  3GFJ A;  1LDJ A;  2D45 A;  1YYV A;  2HR3 A;  1SD6 A;  4LLG F;  2VBW A;  1Z1D A;  1UCR A;  3ZMS A;  1OPC A;  4BYY A;  2RVC A;  2F2E A;  3FM3 A;  1BI2 A;  2LDU A;  3RKX A;  2JT1 A;  4IVN A;  4Q4Z F;  3P9K A;  4UVC A;  3WTY C;  2CW0 F;  2XIG A;  1CF7 B;  1OKR A;  1IN8 A;  2XVC A;  5HVQ C;  4EM1 A;  3WTV C;  3VFZ A;  2PMU A;  1STZ A;  2FE3 A;  2LNB A;  4LGW A;  1U3E M;  2E1N A;  3WGH A;  1H9G A;  2G7U A;  2XAH A;  2PBI A;  4IHT A;  3ZMV A;  4LLN A;  5FLX Z;  2QVO A;  1XN7 A;  1IXC A;  2PEX A;  4ZYH A;  2WC2 A;  4MNU A;  3TOA A;  2YPR A;  2ADU A;  1XGM A;  4M74 A;  4NQW A;  4I02 A;  3R0J A;  2HQR A;  3ISP A;  1MKM A;  2K4J A;  2DPD A;  4CXF A;  4ESB A;  5CVR A;  4KIG A;  4OIQ F;  4RGU A;  1YW9 A;  2PQ8 A;  4LK0 F;  3MAJ A;  1K6O A;  3E6D A;  4UHT A;  1Z6T A;  1GHC A;  2V1D A;  3C1D A;  1S29 A;  1I1G A;  4K2E A;  2M5W A;  2BGC A;  2L02 A;  1SD5 A;  3CTA A;  2R7D A;  3FM5 A;  2A69 F;  1ZG3 A;  1I5Z A;  2A68 F;  2EJR A;  3MFK A;  5D5X B;  2QUF A;  4KIB A;  2Y75 A;  3J7A O;  2Y0M A;  2RV8 A;  1ON2 A;  2OA4 A;  1FZP B;  2O6G E;  2VXZ A;  4HF0 A;  3I71 A;  5FD5 A;  3V7S A;  3TOB A;  4ETS A;  1DUX C;  3WGG A;  1T0F A;  1EH6 A;  1PP8 F;  4R1H A;  2P7C B;  4LB6 B;  1O3S A;  4TV7 A;  5F1R A;  4OU0 A;  2G7H A;  4MTD A;  4KIC A;  5CVU A;  4A12 A;  5JFR A;  3MZH A;  1SFU A;  1BI3 A;  5A2Q K;  3GXO A;  2CSO A;  5E8G A;  3RIR A;  2D2W A;  4KIF A;  1ZAO A;  2PI0 A;  1XCB A;  2ZNZ A;  4MEY F;  2A6E F;  3JTG A;  4KUM A;  2FML A;  5ERI A;  4A0X A;  3F21 A;  2RQP A;  1DPR A;  3V7R A;  4KMF A;  3KFW X;  2BYV E;  1T38 A;  5KK1 A;  1H0M A;  4LD5 A;  3KCC A;  3J80 Z;  1OR7 A;  4Q47 A;  3VB2 A;  3F3X A;  2QQ9 A;  4ASN A;  5LGN A;  3IHU A;  1HKT A;  3DPL C;  2HYF A;  1TLH B;  4A6D A;  1J59 A;  4KYW A;  3KEQ A;  2FQ3 A;  3DXJ F;  2GAU A;  4G7H F;  5L3C A;  1IUY A;  4PCQ A;  3RPQ A;  2ISY A;  1SD7 A;  1S6L A;  5DUK A;  1DDN A;  3BJA A;  1KA8 A;  1RUO A;  4BAY A;  3ZP5 A;  4WX9 A;  2OD5 A;  1FP1 D;  4GCV A;  3F8F A;  5ICG A;  1DP7 P;  2W25 A;  1T39 A;  2XAF A;  2IT0 A;  3TKY A;  4HLY A;  3E6B A;  2Z9O A;  2ZXJ A;  2QZ8 A;  1FPQ A;  3JW4 A;  4U7D A;  1Z05 A;  3WOD F;  1KYZ A;  1IRF A;  1W5T A;  3RDI A;  3K0L A;  2F5F A;  1I27 A;  4GGG A;  2NNN A;  5J8F A;  5LRR A;  3EUH A;  2EV6 A;  1LVA A;  3DP7 A;  1CF7 A;  1USS A;  3QOP A;  3CLO A;  6PAX A;  3SFZ A;  1XGO A;  1YQA A;  4M6Y A;  4NHJ A;  3CJN A;  4HAM A;  1SMY F;  3DV8 A;  4KNY A;  1B9N A;  2FNP A;  4KDP A;  3O2P E;  1ZGA A;  5AIP A;  3KZZ A;  3ML6 A;  1W4M A;  2EFQ A;  3I64 A;  3P9I A;  4ZZL A;  2GQQ A;  2WV0 A;  1ODD A;  5AIQ A;  5D6F A;  5ILU A;  2KJC A;  1ZLJ A;  2W84 A;  3HRU A;  2NNY A;  2QLZ A;  5D5U B;  2HTJ A;  5D5W B;  1ZN2 A;  3M9A A;  4M6X A;  4OMZ A;  5FO5 A;  1ZRC A;  4QLC U;  2KIF A;  3EDP A;  5CVI A;  2KIU A;  4BH9 A;  1LEA A;  3MQ0 A;  2QBY B;  1HBX G;  5J8C A;  1D3Y A;  1XCV A;  2L4M A;  1XGS A;  2ISZ A;  1YFH A;  3BP8 A;  4I0A A;  5LGU A;  1KQ9 A;  3L00 A;  4S04 A;  5ICC A;  1ONV A;  3TDU C;  2W24 A;  1U5T B;  3VOD A;  3B73 A;  3COA C;  1OYY A;  4F7Z A;  4LK1 F;  2XAS A;  3LA3 A;  5JVT A;  2HKX A;  2DQR A;  4S05 A;  4LB5 A;  3ULQ B;  1XDS A;  2NAZ A;  2JPB A;  3P7N A;  3IRQ A;  2JTV A;  4ZZD A;  2M30 A;  3FX3 A;  3QP5 A;  1FT9 A;  3HYI A;  1G6N A;  4AWX B;  2MC3 A;  3IWZ A;  1JXS A;  2STT A;  2ZFW A;  2RNJ A;  5CLS A;  3WTT C;  2HZT A;  2J5O A;  2Q0O A;  3F8N A;  1ZG5 A;  1UHM A;  2YX7 A;  3KP3 A;  2V1X A;  2XAJ A;  4MEX F;  2P4W A;  1SAX A;  3GX4 X;  2ELH A;  2UXN A;  1ZRF A;  3I59 A;  4PGH A;  1QZY A;  2P6S A;  4CGZ A;  4L5I A;  2AXL A;  2DK5 A;  2QYO A;  4KA4 A;  2PJP A;  3HRM A;  3DPT A;  1PUE E;  5A2Q Z;  4I0B A;  1H9T A;  2HKO A;  2KKO A;  1ZYR F;  3C7J A;  2NRA C;  1TBX A;  5DCF A;  2AS5 F;  5DEQ A;  3IKT A;  2RN7 A;  5E18 F;  2HYG D;  1XMA A;  1QGP A;  1B59 A;  2KIM A;  3ZN1 A;  3GF2 A;  4JK1 X;  4RGX A;  1IN7 A;  4YII A;  2Z3Y A;  1F4K A;  3QU3 A;  4O3M A;  2MLK A;  1CGP A;  3T5X A;  1F9N A;  1ZRD A;  3G73 A;  1BOA A;  3GLX A;  3IL2 A;  3B02 A;  1D8K A;  4HQE A;  2GXB A;  2FXA A;  1BM9 A;  2VN2 A;  3VEP A;  2KJB A;  2UXX A;  1R58 A;  3ZN0 A;  2VOO A;  4P5O A;  2L3D A;  1HKS A;  4RB2 C;  2E7X A;  3J80 K;  1HQC A;  1HKQ A;  3V4G A;  3D5L A;  3DEU A;  3WG9 A;  1D8J A;  3F72 A;  3KP5 A;  1YTY A;  3K2Z A;  2HEO A;  4CYD A;  4FX0 A;  5IT9 K;  4EV0 A;  1NHA A;  5BMZ A;  3JTH A;  5JHU A;  2GWR A;  3F8M A;  1MJB A;  3E97 A;  2BEO A;  1D5V A;  5FB2 A;  1J2X A;  5BQT A;  4M72 A;  4EJW A;  4AVP A;  5DV5 A;  3F6V A;  1SD4 A;  4A0Y A;  1AWC A;  1TNT A;  1V4R A;  2P7V B;  3GFL A;  1WI9 A;  5JR3 A;  1RZ4 A;  2HTS A;  4G7Z F;  5DCM A;  2CYY A; 
#chains in the Genus database with same CATH topology
 1XSD A;  2FA5 A;  4BE1 A;  3GLL A;  2DN0 A;  4CYC B;  5GTI C;  1Y1W J;  5M3M J;  4DQ2 A;  1R5I D;  3ESW B;  3H1C A;  1B1B A;  4BUP A;  1UB9 A;  4XLP F;  2JK3 A;  3QOD A;  1LVK A;  4NBQ A;  1PDN C;  1X3Z B;  2FUG 2;  2M8G X;  2TRT A;  4UUS A;  1Z3Y A;  2OQG A;  3KLN A;  2UV1 A;  3MEX A;  5E3N A;  2HYJ A;  4MQ9 F;  2ZO4 A;  2Q2E A;  2XHK A;  2QBY A;  1K6Y A;  2L4A A;  3GZN B;  2H09 A;  3O8G A;  4LG3 A;  5CYV A;  4N0B A;  2GOM A;  2VB6 A;  1VI0 A;  4GYI A;  5GAG J;  1KQ8 A;  4KJZ A;  4F92 B;  2NYX A;  2M8E A;  2AQE A;  2EV5 A;  4A3D J;  3QYF A;  2CO5 A;  2M2E A;  4BJT A;  1BIB A;  2Y30 A;  1O57 A;  2OBP A;  3SDB A;  2G0E A;  1FYK A;  4ZYD A;  4Q48 A;  1W0T A;  1U5T A;  1WQ2 A;  3IAM 2;  2XB5 A;  1GXQ A;  2CQK A;  2LF7 A;  4RAZ A;  5L3B A;  3PNY A;  3GBG A;  4M3F A;  2EA2 A;  1FEX A;  4PGG A;  1HSJ A;  3AKZ A;  4E7L A;  3HSF A;  2M0C A;  4EJU A;  4XOT A;  1TWH J;  2WA0 A;  3EQL F;  4UV9 A;  3FXM A;  2FBI A;  4XN0 A;  3OYA A;  3FXK A;  1P9Q C;  2Z16 A;  3KYD B;  4UV8 A;  3WE3 A;  5IOZ A;  2IP2 A;  2DA2 A;  3M7G A;  4O5V A;  3ZQC A;  1ZR4 A;  4U7B A;  3R0A A;  3ROU A;  1IN4 A;  3N05 A;  4IOC F;  1E3H A;  2KDZ A;  4E4H A;  4C30 A;  5EG0 A;  3QP6 A;  2K9S A;  4A3K J;  1RUN A;  1E17 A;  1I3Q J;  3D5S C;  2VE8 A;  2AHQ A;  4L5J A;  2XSJ C;  4M9X A;  4ZC3 A;  2P5V A;  3T8T A;  2LY1 A;  2PG4 A;  3HPG A;  1J75 A;  1KU9 A;  3BR5 A;  1TTY A;  1P4A A;  1HW1 A;  4CCN A;  1ENH A;  5LHI A;  4UUV A;  2ESH A;  1JHF A;  4BAC A;  3BCB A;  4G6D A;  2IW5 A;  3HM5 A;  3WU1 B;  1Y6I A;  4ANJ A;  1IRG A;  2ZME B;  4OWR B;  4BHC A;  1J5Y A;  3ZMU A;  1XB4 A;  4XON A;  4EGY A;  3DQV C;  1ETY A;  1SFK A;  2ZSH B;  3PUF A;  1IC8 A;  3PSI A;  1GT0 C;  3GWZ A;  1P4X A;  3CMM A;  3SXY A;  4OIO F;  1FTT A;  2W48 A;  2YUS A;  1O3R A;  5FJ8 J;  2D5V A;  1P7J A;  2L54 A;  3H5N A;  3V7C A;  4YG2 F;  4E7I A;  1EH7 A;  3DLA A;  4G94 A;  3K70 D;  1WZ2 A;  1R23 A;  2A6H F;  4BU2 A;  5HLH A;  4IQJ A;  3I59 B;  1W5S A;  3A2K A;  2DJI A;  1X19 A;  1TQP A;  2YSR A;  1OCP A;  1GVD A;  3QOE A;  4LIU A;  3WTZ A;  3ZQ7 A;  1QA6 A;  1TNS A;  4HNU A;  4GYG A;  1MBF A;  4N9H A;  2HXO A;  2HFH A;  1I6X A;  2EZK A;  4QSH A;  1K7A A;  3E6M A;  3KP4 A;  4JQF A;  5EGO B;  2P5L C;  4E7J A;  2GA2 A;  1TWC J;  2IRF G;  5B1A H;  5L3E A;  2JA6 J;  2DTR A;  1E2X A;  2XAU A;  3S3O A;  3A03 A;  3Q9V A;  1MH4 A;  4YRV A;  2VI6 A;  4XSX F;  5HLG A;  3RJP A;  3OY9 A;  2WTE A;  5IT9 Z;  1MIJ A;  3H0D A;  3CJR B;  1G3S A;  4XOP A;  2F4I A;  1X4O A;  3HC7 A;  4II3 A;  5DD4 A;  4F55 A;  2BW3 B;  4HA8 A;  3WU0 A;  2ZXH A;  1LNW A;  3CCE I;  2YR2 A;  2ZCW A;  1RR8 C;  4RB1 A;  1Q1V A;  4OIP F;  4G8X A;  2R4G A;  1MMA A;  3E5Q A;  3A01 B;  4DZP A;  4UNO A;  5HDN A;  3PNT A;  4BHP A;  4KMU X;  3KEY A;  3W6J B;  5K7H A;  1F43 A;  3BCA A;  3DKW A;  4D0P A;  1NTC A;  4PFO A;  2C6Y A;  3U9G A;  3M1C A;  3GTM J;  4ON0 A;  4G9Y A;  1NG7 A;  1WSU A;  1OIS A;  4CZC A;  5E79 C;  2IGO A;  5J6X A;  3R6S A;  3FIS A;  4A5M A;  1L3L A;  1P4W A;  1LJ9 A;  2DFF A;  1HW5 A;  3F22 A;  2DFH A;  3REO A;  4RLF A;  2HXI A;  2JRM A;  4MLO A;  1RES A;  4MQV A;  1VQ5 I;  3S2H J;  2MLG A;  3QAH A;  4HNV A;  2BVM A;  3V42 A;  1B6A A;  1VF9 A;  4XOR A;  2O61 A;  1XG1 A;  1ETX A;  2Y9Z A;  1WCM J;  2VOD A;  1G4D A;  1Q1H A;  3ABU A;  3L7W A;  4MIM A;  5DD8 A;  2YU9 J;  5DTD A;  3LMM A;  3LAJ A;  2M4G A;  2M1B A;  4BEH B;  3QYB A;  1S9H A;  1O7L A;  4JOM A;  3F0C A;  3SZG A;  5ILV A;  3N4M A;  4B44 A;  1A04 A;  3HOT A;  5EEG A;  1YJ9 I;  4AD9 A;  3PUB A;  5LBQ A;  3DEW A;  5E8I A;  3MKZ A;  1FYL A;  3HJE A;  4XRM A;  2CV2 A;  1BR1 A;  1R1V A;  1FX7 A;  2XGE A;  2LTP A;  5F27 A;  3SZT A;  4DJA A;  2QSG X;  4XKB A;  3BG3 A;  4DZJ A;  2CJJ A;  4FET A;  4BJ6 C;  2HDC A;  5F64 A;  4ESF A;  4NC6 A;  2E60 A;  3QU6 A;  3HSE A;  5IP6 A;  4HSR A;  3ZXS A;  2NOG A;  4XLE A;  2CW8 A;  2X6Y A;  1CQT A;  3BT9 A;  2IS2 A;  4WXH A;  3CCS I;  4HV5 A;  1ZAR A;  5H6Q A;  1OCC H;  1YLF A;  2ZBK A;  3VSL A;  2PX9 A;  3J81 K;  2XV4 S;  1ZK8 A;  3A1Y A;  3IKV A;  2BY0 A;  1RPW A;  3RPU D;  1PYV A;  2EIN H;  2M34 A;  2R7T A;  2FBK A;  2M7A A;  4J19 A;  1XGN A;  3ECO A;  2R7F A;  5J4Y A;  2CW7 A;  3N97 A;  3I4P A;  1MJ9 A;  1UEL B;  4FHT A;  5DCM B;  3FXR A;  1FOK A;  2CV1 A;  2QSF X;  2QM3 A;  3QPH A;  4BXU A;  3BG7 A;  4CYC A;  1J0R A;  3JSP A;  3JRG A;  2XAQ A;  5E1Z B;  2EBI A;  3ABK H;  4G6Q A;  4BQN A;  2DA4 A;  3RPU A;  3E3V A;  2VON A;  4J00 A;  1MMN A;  2W4S A;  2VBY A;  3V8J A;  2OU2 A;  5K5O A;  2W00 A;  2Q2E B;  3F8B A;  3TP0 A;  2O3F A;  1VTN C;  3LFK A;  3CO7 C;  3WHC A;  2VKH A;  4D9J A;  1MH3 A;  1X3U A;  4EVI A;  4B3X A;  3CCV I;  1K78 B;  4ENN A;  1Z91 A;  3NQO A;  5L3G A;  3CD6 I;  1AOY A;  1BW6 A;  4XMY A;  1VQ7 I;  2JJ7 A;  1BI0 A;  1F5T A;  2DA6 A;  1OJL A;  3M8E A;  4I09 A;  1FMW A;  2P81 A;  1J09 A;  1B9M A;  1T8I A;  1MNE A;  5EZG A;  5KAF C;  4MO7 A;  4D7M A;  2XRO A;  4BQO A;  2PLY A;  2DI3 A;  4AM3 A;  3FXU A;  2KL4 A;  2M45 A;  4NUB A;  1FJL A;  2IBD A;  2WV1 A;  2YX4 A;  3PJR A;  3RZD J;  3DTK A;  4HDV A;  3BY6 A;  1GDT A;  1Z7U A;  2DT6 A;  2ID6 A;  3VPR A;  3BR3 A;  4HX4 A;  4PSW A;  4CDG A;  4RS8 A;  3K1M A;  3MKY B;  4A6E A;  5FRM A;  3H9G A;  2OQR A;  2FF4 A;  1WJA A;  4GO1 A;  1E3P A;  2L9S A;  2K02 A;  3NEU A;  2OTL I;  3RKW A;  2EIM H;  3RTR A;  4M3D A;  4L0Z B;  4Y17 A;  4A2U A;  5JHF A;  4UVB A;  2CUF A;  5EG0 B;  5TIS C;  3WGI A;  3QQA A;  4OIR F;  4DW6 A;  5IP7 J;  4IHS A;  1GXP A;  4A93 J;  3BR6 A;  4ZH4 F;  3J81 Z;  2FJ1 A;  5HOO A;  1YX3 A;  4ZYE A;  3AL0 B;  3L9F A;  3I54 A;  1H89 C;  1HLV A;  3FMQ A;  4KN7 X;  4A3L J;  3C3W A;  5LFA A;  5GPA A;  1P2F A;  1P7I A;  1SAU A;  2ZME A;  1IGN A;  3J7A Y;  1YW7 A;  5E20 A;  2JPC A;  3OS1 A;  3BC8 A;  3HKZ N;  3GYH X;  2R7X A;  3FHZ A;  1UST A;  2EFP A;  5CPR B;  3I55 I;  1JKQ C;  3WTU C;  3W2V A;  5EZH A;  5KVR A;  2BBY A;  2VQC A;  4I98 B;  4RB3 C;  1ZGW A;  3ERE D;  3K4J A;  1JE8 A;  2E2H J;  1RKW A;  1S8N A;  2VBZ A;  2DT7 B;  3SQN A;  1JI8 A;  3LST A;  1W36 D;  4GFB A;  3HPH A;  2FSW A;  4HQM A;  1U8R A;  2H1L A;  3HZJ A;  2X4H A;  2PN6 A;  4A3E J;  3P5J A;  1X58 A;  4R79 A;  4HX7 A;  2TDX A;  1XC5 A;  1BR2 A;  1N75 A;  1WH5 A;  2PFB A;  3Q0W A;  2E1M B;  2F4M B;  1I39 A;  1Z3X A;  4IHY A;  3Q9S A;  4HYE A;  2UWM A;  2EA4 A;  3FZV A;  3DTE A;  1M1E B;  1D0Z A;  3JRB A;  1BR4 A;  2W82 A;  1V54 H;  4CSW A;  1SC7 A;  3ECH A;  2J5P A;  2QEX I;  1QO0 D;  3KYC B;  1OYW A;  2MD0 A;  4YIF A;  1F1Z A;  4A3I J;  1IN6 A;  2Z5U A;  3CO6 C;  4Y33 A;  1H88 C;  1QBJ A;  1D1C A;  1G3T A;  3U1D A;  1WJC A;  3IUO A;  3A01 A;  2AXT C;  1TWG J;  3LSJ A;  3NAR A;  4NNJ A;  4BL0 B;  4C3I J;  1J9I A;  5IYC J;  5HS9 A;  2BZT A;  2I10 A;  2OF7 A;  3DPU A;  1IDY A;  4HZF A;  1YHQ I;  2RC4 A;  2QQA A;  1K4T A;  4JX6 A;  3GFM A;  2KLO A;  3WTX C;  2LRD A;  2EV0 A;  3OOP A;  4G7O F;  3KIO A;  4DGW B;  3OS0 A;  2ZC2 A;  4BQA A;  4I01 A;  2JSP A;  2GXG A;  2OV7 A;  1MBG A;  1RKT A;  2E1O A;  1FBU A;  3OYC A;  2VPL A;  3DF8 A;  4LMY A;  1IZ1 A;  2CQN A;  1I3A A;  3LSR A;  1U9O A;  2NOJ B;  2L9R A;  2JRT A;  3T0Y A;  1AKH A;  5LRS A;  2BV6 A;  4NB5 A;  1EKE A;  2V6C A;  1MDM A;  3FF5 A;  4JP0 A;  2K85 A;  4RGR A;  1BL0 A;  1G3Y A;  1MNM C;  1MMS A;  2A61 A;  3TO6 A;  4CZZ A;  2L7M P;  2HI3 A;  3KP6 A;  2FMY A;  3K1P A;  2BE5 F;  2JUC A;  2PJR A;  5EEA A;  1HC8 A;  2HGC A;  3GVA A;  2BXZ A;  3LA2 A;  2R0Q C;  4BBS J;  1YE9 A;  2DYS H;  2K5C A;  1YS7 A;  4IKF A;  1ZEL A;  2DLL A;  1B72 A;  1UHW A;  4BEH A;  5F08 A;  5GAE J;  3CDI A;  1BJA A;  5HDG A;  2K4B A;  2VQL A;  3S93 A;  5BS6 A;  5ILS A;  1VQL I;  3G3Z A;  5HLI A;  4HF1 A;  1GUU A;  4Z2Y A;  2VC1 A;  4IJA A;  2KIS A;  1QPM A;  5HS8 A;  4LG0 A;  2MSY A;  1N25 A;  5B66 C;  1R4M B;  3IV5 A;  1WJ5 A;  2HWV A;  4KN4 X;  4PDK A;  1S7O A;  1W1W E;  4N4N B;  2B7E A;  2DYR H;  3QYE A;  2RDP A;  3JAM Z;  1W36 C;  3HBL A;  3T8R A;  2LD5 A;  4XNF A;  5C44 J;  1KQ0 A;  1U8B A;  2MH9 A;  2DAO A;  3G71 I;  2NVQ J;  3HDD A;  4EQQ A;  4Y13 A;  1O4X A;  5K1Y A;  3Q5F A;  4RDU A;  3O8H A;  2VJ5 A;  3V8L A;  4XLA A;  3K10 A;  1R36 A;  2M7B A;  5J40 A;  3IH2 A;  1TL8 A;  1RC9 A;  1EF4 A;  1UZC A;  5D4R A;  4WK8 F;  2XB0 X;  3OYL A;  2EB7 A;  3LNQ A;  1HF0 A;  1B4A A;  1V5F A;  4RAY A;  4HDU A;  1SFE A;  1WKM A;  2KRF A;  1WFX A;  2YU3 A;  2EIL H;  2UUZ A;  1YJW I;  3MCZ A;  5EEH A;  5E1W A;  4WF2 A;  1G3W A;  3ABT A;  3BR2 A;  3HB9 A;  2XPU A;  4NC8 A;  5GP9 A;  5DUI A;  3UKG A;  4YEJ A;  2VQG A;  2P5K A;  3KPH A;  1BIA A;  3HOS A;  3MZ8 A;  5LD2 C;  5F04 A;  2CG4 A;  2LVS A;  3CCM I;  5D6E A;  1FOW A;  1XMX A;  5CVJ A;  2ESN A;  4WWC A;  1FOX A;  3OYH A;  2OTJ I;  3TO9 A;  1SFO J;  1MBH A;  2R7W A;  3OYJ A;  4P9U A;  4BBR J;  2F5D A;  1VQO I;  1JT0 A;  2V26 A;  1FNN A;  1OYI A;  2BVL A;  1PUF B;  2EFO A;  3DBL B;  2NVY J;  1ETQ A;  1NK3 P;  3GUD A;  2L9V A;  3TDZ C;  1JTX A;  1PJR A;  5J1U A;  2DO7 A;  2K7L A;  4IEJ A;  5BOX A;  4M3B A;  3BR1 A;  1K78 A;  2JVG A;  2KDO A;  3AAF A;  1FYM A;  3ZPL A;  3M1E A;  3HOV J;  4YFK F;  2E7W A;  2V9V A;  5ICE A;  2GM4 A;  2EPF A;  2GIV A;  4UB6 C;  1SVO A;  2DJN A;  4OAY A;  3WE2 A;  1GVJ A;  3ZMD A;  1UMQ A;  2ECB A;  2E1M C;  1DGR M;  4FCY A;  3KZY A;  1AA7 A;  2XRN A;  1ITY A;  3OIP A;  4ENM A;  1Y0N A;  2QKM B;  1I50 J;  2E36 A;  1MBE A;  3FHN A;  3K69 A;  4FT8 A;  1TQI A;  2OPT A;  2DU9 A;  4B48 A;  1R00 A;  4F91 B;  3LQQ A;  2IA2 A;  1FWZ A;  3T1B A;  1T6S A;  2RGV A;  3KEO A;  1V5G A;  3OSG A;  1T0F C;  3KE2 A;  2WWY A;  1IV6 A;  2N8G A;  4RB0 A;  2K9M A;  5F0C A;  4H0E A;  4ENJ A;  4A3G J;  3JRF A;  1FTZ A;  1DU6 A;  4UXN A;  3FMR A;  3OYB A;  2DFE A;  2Y48 A;  3IP4 B;  2B0L A;  2MW8 A;  4HBL A;  2L2O A;  3BG9 A;  1BC7 C;  5LGT A;  1HW2 A;  1QQI A;  1RIO H;  3NRV A;  3CZ6 A;  4QPQ A;  2DOA A;  2KFD A;  2DT5 A;  3PNV A;  4FX4 A;  4XRF A;  3PSF A;  4G6T B;  3I9V 2;  1XTA A;  2Q8K A;  4YFN F;  1HA8 A;  1TW2 A;  3HHH A;  5F0H A;  3GFI A;  3CUQ C;  3W6V A;  4BKX A;  3HKZ A;  3F6O A;  3MKW B;  3AG1 H;  4XBF A;  1UFM A;  1ZG1 A;  2CUZ A;  3RYP A;  1FBS A;  3SJM A;  1APL C;  3RKY A;  2EWN A;  1FSE A;  3FBN B;  2D1H A;  4B47 A;  2ACJ A;  2RQQ A;  2UZK A;  5M5W J;  1D1B A;  5E3L A;  1MGT A;  5FFZ A;  3ELK A;  3FKI J;  3MD2 A;  1VQ4 I;  3CUQ B;  3BDD A;  4XRS A;  1WRJ A;  1NG6 A;  4P9F A;  1XX5 A;  2WB1 A;  4ZDL A;  2JWT A;  2Q1Z B;  5D4S A;  5LLQ A;  3GW2 A;  3O6B B;  1JT6 A;  1ON1 A;  4XN3 A;  1OR7 C;  3KLO A;  2EFW A;  2XF5 A;  1TQM A;  1R7J A;  3E1S A;  4XKC A;  2P0W A;  5L3F A;  1YO5 C;  2QSH X;  3I4M J;  5FLX K;  3HOZ J;  3U1K A;  1LEB A;  2MFZ A;  4O6J A;  4AID A;  3HUG A;  2V4J C;  4M73 A;  1YS6 A;  1JTY A;  2F5E A;  4I99 C;  2CRG A;  2I5U A;  1R49 A;  1HDD C;  1XDU A;  1R6R A;  2DBB A;  2FQ4 A;  4L9V A;  2X1C A;  2E1C A;  2EK5 A;  2JZY A;  2HQN A;  3FKJ A;  3K7A J;  1WWX A;  3DBH B;  1WI3 A;  2LY9 A;  3JRE A;  3WTW C;  3DLL F;  1OCO H;  1Y39 A;  1O3T A;  5FKM A;  3F23 A;  3FMS A;  3S16 J;  1F36 A;  3LQR A;  3KET A;  2DOF A;  2KQR A;  1BC8 C;  2H6C A;  1A6Q A;  1OMI A;  5FFX A;  4BHB A;  2M87 A;  2ME0 A;  3CC2 I;  4HLX A;  4L18 B;  1UG0 A;  2ZJ2 A;  4M9Z A;  2V79 A;  2CQ7 A;  1IN5 A;  4QPO A;  2DFI A;  4E70 A;  3AG4 H;  5K7Z A;  4OMY A;  3OOU A;  3CF5 F;  1IUF A;  3DU6 A;  4BQQ A;  4EAT A;  2LR8 A;  1KGS A;  3D5R C;  4XLN F;  1Y1V J;  2WB1 N;  5TRD A;  4XSZ F;  4A5N A;  5LHG A;  2VKE A;  1IW7 F;  4DYR A;  1FBQ A;  4XLF A;  1O7F A;  1V5E A;  1QVT A;  3K2A A;  5LHH A;  1Z67 A;  4HRI A;  2VJI A;  3K9T A;  2XAG A;  1R1U A;  1KYW A;  2F4O B;  3LAP A;  3GTO J;  2CV0 A;  5KCM A;  4PJJ A;  5K5Q A;  2COM A;  4C3H J;  1T2K A;  4AVZ A;  1X2N A;  2L01 A;  2M4K A;  2M9H A;  5J4V A;  2K3F A;  1QVU A;  1X4P A;  3JRI A;  1IDZ A;  3HRS A;  4EM2 A;  2VT2 A;  5EYR A;  3SFI A;  3BTL A;  1JGS A;  2WAQ N;  2IJL A;  3LWF A;  3OIQ A;  1G2H A;  1BA5 A;  3CDH A;  3HIF A;  5D5V B;  1AKH B;  1LFB A;  4AU7 A;  1MDM B;  4N9I A;  4HOB A;  3GO5 A;  3D1N I;  2QF7 A;  4A0Z A;  1FLI A;  1YI2 I;  1MND A;  2X85 A;  2KZV A;  1O3Q A;  2BOL A;  2XGC A;  2PJR B;  2X6O A;  4GDF A;  3OV8 A;  3GCM A;  3IWF A;  2DK8 A;  1B72 B;  1XSV A;  1W7P B;  3CUO A;  2X6W A;  3DFG A;  3TBI A;  2H27 A;  3HTS B;  1FOY A;  4U0W A;  1IAW A;  2H6B A;  4U87 A;  3TP3 A;  2ZXW H;  3V8K A;  4JBA A;  1POG A;  3H0G J;  5CVV A;  2FNA A;  2LKS A;  4XID A;  1V55 H;  1BJZ A;  1OCZ H;  3FK6 A;  2XPW A;  3SDG A;  5FD6 A;  4RGS A;  2R3S A;  3EYY A;  2Y31 A;  4U0V A;  2K40 A;  4LG0 B;  3RYR A;  4HPQ A;  1JUP A;  1BN5 A;  1YIJ I;  1ZQ3 P;  2QWW A;  2DOD A;  1WPK A;  2CU7 A;  4HV6 A;  3NWT A;  2K3P A;  3JAM K;  1KU7 A;  4A3M J;  2IS1 A;  1YG2 A;  4OIN F;  4KT6 A;  3JRD A;  2CFX A;  4UY8 I;  1T98 A;  2IA1 A;  3ZQL A;  2F5C A;  3GEZ A;  5L3D A;  1ZRE A;  4HF2 A;  1FIA A;  2HS5 A;  5M3F J;  1JUS A;  2VQH A;  1ZLK A;  2FRH A;  3O3K A;  2G9W A;  5GAH J;  3WTS C;  2DPU A;  1S3J A;  1UAA A;  1ZH5 A;  2OC6 A;  2DMP A;  1XSX A;  3LA7 A;  3HHG A;  2XGX A;  2ZXI A;  4E7H A;  2CQX A;  1NH3 A;  2R93 J;  4RBO A;  3I56 I;  5BPD A;  1EV7 A;  2O03 A;  5B5E C;  3PQK A;  1MJA A;  1QRY A;  1U5T C;  1FP2 A;  4S0H B;  1KU2 A;  3E5U A;  4WCG A;  2EQR A;  2QKL B;  2VIX A;  3LSM A;  1MZB A;  3L09 A;  3GZ5 A;  5HS7 A;  2Y2Z A;  4ESJ A;  3K4M A;  3RSN A;  1JJ6 C;  1Z7L A;  2I8D A;  1TW3 A;  2WAD A;  4I76 A;  1E3O C;  3TGN A;  1JKP C;  3ABL H;  1LDD A;  5JI6 A;  5F0F A;  4R8H A;  1R5G A;  5F6F A;  4IF4 A;  1PUF A;  2DXI A;  2DMU A;  1IXS B;  2CWE A;  4MHG A;  3FXQ A;  3U2R A;  2MBF A;  2OCE A;  1Z21 A;  2JN6 A;  2LSO A;  3ZQH A;  3FWE A;  4UB8 C;  2NS0 A;  3BZ6 A;  3BZC A;  3S17 J;  1R22 A;  1RI7 A;  1R5H A;  5LEJ A;  4IZZ A;  5IOY A;  4D5C A;  5E17 F;  2P6T A;  1VQK I;  4U0Y A;  4XR6 A;  3I53 A;  2O8X A;  2CGP A;  3F8C A;  3S15 J;  2XUB A;  2CMP A;  1TP4 A;  2E71 A;  2ZJQ F;  3D0S A;  4G12 A;  3H36 A;  5CQG A;  4A3B J;  1QNT A;  2HVQ A;  2OAZ A;  2IXS A;  5BPI A;  4EJT A;  4CO8 A;  1RNL A;  4QWQ A;  3HTU A;  3ZR8 X;  4XQF A;  1ZGJ A;  1W5C C;  3E5X A;  3LSG A;  1LPQ A;  1K79 A;  2BY1 A;  1J7K A;  4HNT A;  2ZNY A;  1Y8Q B;  2DW4 A;  1MW7 A;  1N77 A;  3KP2 A;  1G59 A;  2A3S A;  2IVM A;  3TQN A;  3GTP J;  3H5A A;  3K1N A;  3KP7 A;  2VJJ A;  2PMH A;  2OZ6 A;  4ENK A;  3S2D J;  2LYC A;  2FX0 A;  3BPX A;  2EH3 A;  5JLW A;  4FE7 A;  3OIO A;  3P9C A;  2O0Y A;  4PUS A;  4WXC A;  2MD5 A;  4AYB N;  2ETH A;  2R5Z A;  3S32 A;  4E7K A;  3W6K B;  1I1S A;  3S8P A;  4LLL A;  4I2O A;  1WGX A;  2OZU A;  1IXR C;  1HCR A;  2HPM A;  3OYN A;  3DTI A;  4XRS G;  2FU4 A;  3BTI A;  3HRT A;  4Q5S F;  1LKX A;  4MTE A;  2FEZ A;  4IRI A;  1XMK A;  3CUQ A;  4CUG A;  2ELJ A;  1YW8 A;  1ACI A;  2OCC H;  3I0T A;  2Z33 A;  3H3V K;  5FKL A;  1A36 A;  5EJC A;  2JSC A;  3R4K A;  2KT0 A;  3C18 A;  4L9T A;  3VSK A;  2R5Y A;  5FKK A;  1HST A;  1R1T A;  3M8F A;  4XLC A;  5AON A;  4MFD A;  4IRG A;  3CC4 I;  5IT3 A;  4IXA A;  2FBH A;  3HUG B;  4NQW B;  3BPV A;  3VYS B;  5DM6 F;  4DBR A;  5F1J A;  5ED4 A;  3PIP F;  3W3C A;  2XKP A;  3HEF A;  4B3A A;  3GZ6 A;  1D0X A;  2LY2 A;  4LIT A;  3PIO F;  4V19 K;  4BNC A;  5IP9 J;  5LEK A;  4X1E A;  5C4J J;  5TJJ A;  5J3L A;  1ETV A;  3IC7 A;  3EYI A;  4P55 A;  2OUM A;  3SZP A;  3AL0 C;  3RI4 A;  3BTJ A;  4M71 A;  4OOI A;  2VC0 A;  2DQL A;  2WAQ A;  4AIK A;  2E5N A;  4EGZ A;  2GZW A;  3VOE A;  3CJQ B;  5E3M A;  3TL4 X;  3TW6 A;  4IOA F;  3HG9 A;  3FXJ A;  2LF8 A;  4CCL A;  1B8I B;  2LKP A;  1VQM I;  3BJO A;  3PQJ A;  2V6E A;  4DNC A;  1U2W A;  2LKX A;  4PK4 A;  2A07 F;  1SVL A;  1YIO A;  4U88 A;  5FKO A;  4IRH A;  4YIR X;  4GXO A;  4Y52 J;  2Z1D A;  2FOW A;  4KT5 C;  3BTC A;  3S2W A;  3ZMT A;  4X6A J;  5HDK A;  1REP C;  1DP3 A;  4CH7 A;  3A4C A;  4YFX F;  2HVS A;  3VYU B;  3M07 A;  2MA3 A;  2R7S A;  2W57 A;  3OL4 A;  3HGY A;  2V1U A;  1IJW C;  1LB2 A;  1LQ1 A;  2D1V A;  3CCL I;  3I5U A;  3HSR A;  2R7R A;  5FGM A;  1L0O C;  3MVP A;  4EJV A;  1C0W A;  4UVA A;  4LOC A;  2P8T A;  3RQ4 A;  4EMS A;  1QZZ A;  3FBI B;  1FY7 A;  4HX8 A;  4MGR A;  4XM3 A;  4EM0 B;  5E1X A;  1MSE C;  1VQN I;  1P6R A;  4CCK A;  2QA4 I;  5HOD A;  4L9N A;  1ORK A;  5FLM J;  3S1M J;  1RET A;  1T95 A;  1EH8 A;  5H20 A;  2VT3 A;  4AIJ A;  2A5Y B;  3GME A;  2IA0 A;  2TCT A;  2VBX A;  3JRC A;  2WY7 Q;  3BRO A;  1SFX A;  3L2C A;  2CS3 A;  3S1Q J;  3BOQ A;  3MZY A;  4CHU A;  3K70 C;  2Y9Y A;  2KMU A;  4KFC A;  4A3C J;  1W7P A;  3EUH C;  3H3Z A;  2NVX J;  3EET A;  2X48 A;  1JHH A;  4BDZ A;  2XGD A;  2K86 A;  4B43 A;  4CCJ A;  1HDP A;  3QPT A;  1PP7 U;  5FRN A;  2HQ5 A;  3DEE A;  3OR2 C;  3LFU A;  1JUM A;  3QWL A;  3MWM A;  1TWA J;  2WBM A;  4Y7N J;  4L9J A;  2KZG A;  1AHD P;  4P96 A;  3BJ6 A;  2K27 A;  3L1P A;  2PMZ N;  1FC3 A;  1ULY A;  1SEU A;  5TGT A;  3I58 A;  1Z0X A;  1ERD A;  4HW0 A;  2W85 A;  2MH2 A;  1S5L C;  1PVE A;  2VE9 A;  1V3F A;  3PFY A;  4ZYG A;  4PZJ A;  5FKN A;  1IO2 A;  1OCT C;  2KIQ A;  1BBY A;  2WY8 Q;  2STW A;  3E6C C;  2KPM A;  3SHF A;  2BXY A;  4BS9 A;  1W7P D;  1Z9C A;  2DTZ A;  4WXD A;  3EUK L;  5K5R A;  1IRX A;  3G2B A;  1TC3 C;  4C9Y A;  1KU3 A;  3R60 A;  1SMT A;  3BWG A;  3AG3 H;  4OAZ A;  2MGQ A;  2LK2 A;  3H92 A;  1XD7 A;  5HLT A;  2VOP A;  5KNL A;  3SEZ A;  4L0Y B;  5DYM A;  3TO7 A;  3JSO A;  2FOK A;  4AIH A;  1IV8 A;  2EFN A;  2JVH A;  4LJZ F;  3M3Y J;  4EJO A;  5KHD A;  3IRR A;  4NDL A;  1VQ8 I;  1Z6R A;  1FSH A;  4FAS D;  3X2Q H;  2X9D A;  1LDK B;  3TW7 A;  2GA1 A;  5D8K B;  1U6G A;  4B8X A;  1ETK A;  1MMG A;  1U78 A;  1S7A A;  1IF1 A;  3CF2 A;  3E0J B;  4BGD A;  5IYD J;  2E2I J;  3ONQ A;  2LG4 A;  3SYT A;  5CJ9 A;  3PFI A;  5JVG F;  1MD0 A;  4B09 A;  4RLQ A;  3KX2 A;  4IL6 C;  1EJ9 A;  1IRZ A;  4D5F A;  2VL8 A;  1AU7 A;  2HU9 A;  2X6X A;  2ZKZ A;  1DPU A;  3G1M A;  2HOE A;  4IX7 A;  5C4X J;  4CCO A;  3MKL A;  2QQB A;  2DA7 A;  2JUG A;  3OS2 A;  2Z99 A;  3OR1 C;  4PJN A;  2BY2 A;  5DDG A;  3ZQI A;  4I7H A;  1K83 J;  1ZR2 A;  4B4C A;  1LE8 A;  4AUX A;  1GV5 A;  4IPA A;  4E6K G;  5ICF A;  1Y0U A;  3BLY A;  1P92 A;  2A6T A;  3JRH A;  3LOC A;  4LFU A;  2XKO A;  4M9S A;  1LFP A;  1HXD A;  3QRF F;  4DYQ A;  4Y15 A;  4IO9 F;  3OSF A;  3FIW A;  3R61 A;  1QZE A;  2X1D A;  5D8L B;  1BI1 A;  3ZMZ A;  2QEN A;  2RKH A;  5H6R A;  2Z2S B;  2IPQ X;  2EZL A;  2H94 A;  2X0L A;  1ZHF A;  3H3U A;  4CIC A;  3GFJ A;  1IG7 A;  1LDJ A;  1YYV A;  2HR3 A;  2D45 A;  1OLT A;  1SD6 A;  4LLG F;  2VBW A;  3DU5 A;  1Z1D A;  5B3S H;  1UCR A;  3ZMS A;  2DA5 A;  4Z6Y A;  3BR0 A;  2XRL A;  1OPC A;  4BYY A;  1WVR A;  2F2E A;  2RVC A;  3FM3 A;  1BI2 A;  2LDU A;  3RKX A;  2JT1 A;  4IVN A;  4Q4Z F;  3IH3 A;  3P9K A;  3J7Z I;  4UVC A;  2R5Z B;  3WTY C;  2CW0 F;  2XIG A;  1CF7 B;  2NS7 A;  2LFB A;  1OKR A;  1IN8 A;  2XVC A;  5HVQ C;  3A0H C;  4F52 A;  4PJM A;  5KAI C;  4EM1 A;  3WTV C;  3VFZ A;  2PMU A;  1STZ A;  2FE3 A;  2LNB A;  1X3W B;  2DDB A;  4LGW A;  1U3E M;  2E1N A;  3L2Q A;  3WGH A;  4A3F J;  1H9G A;  5IPA A;  3ZGK A;  1NK2 P;  2F6C A;  2G7U A;  4DOZ A;  2XAH A;  2A05 A;  1K61 A;  2MC4 A;  2PBI A;  4IHT A;  1ETO A;  3EUA A;  1X1P A;  1R4N B;  3ZMV A;  4LLN A;  1R71 A;  3SEQ A;  5FLX Z;  2QVO A;  1XN7 A;  1KZH A;  4Y3O A;  3ASO H;  2PEX A;  1IXC A;  2R5Y B;  3LSI A;  2ECC A;  1VND A;  4ZYH A;  3GTQ J;  3HGG A;  2WC2 A;  1D1A A;  4MNU A;  3TOA A;  2YPR A;  2ADU A;  3CME I;  1XGM A;  3KZI C;  4M74 A;  4NQW A;  4RMN A;  1X1D A;  4I02 A;  3R0J A;  3CP2 A;  2HQR A;  1WJE A;  1OFC X;  4GRI A;  3WU2 C;  1XS9 A;  3ISP A;  3B6A A;  1JGG A;  2H1K A;  1MKM A;  2K4J A;  2DPD A;  1YIT I;  4BXX J;  2ZB9 A;  4CXF A;  1TT5 B;  4ESB A;  5CVR A;  4KIG A;  4OIQ F;  4RGU A;  1YW9 A;  2PQ8 A;  1BW5 A;  4LK0 F;  2O5R A;  3MAJ A;  3S1N J;  1B8I A;  1K6O A;  4CCM A;  3IH4 A;  4XKV A;  3E6D A;  2ZME C;  3CCY A;  2RAE A;  1Y56 A;  4UHT A;  1MMD A;  1Z6T A;  1GHC A;  3C2G A;  5M5X J;  3C2B A;  2V1D A;  2IS4 A;  3C1D A;  5FRO A;  1S29 A;  1N78 A;  1I1G A;  2DA3 A;  2B9S A;  1S7E A;  3PM1 A;  2XDV A;  4K2E A;  2M5W A;  2BGC A;  2L02 A;  1SD5 A;  2HOA A;  3CTA A;  2R7D A;  3L2R A;  3FM5 A;  2A69 F;  1ZG3 A;  3L2W A;  1I5Z A;  5J1R A;  4XK4 A;  2A68 F;  2EJR A;  1FMV A;  2E19 A;  4BXF A;  5D5X B;  3MFK A;  4BE2 A;  2QUF A;  4W97 A;  2OJE D;  4KIB A;  2KRH A;  2Y75 A;  3J7A O;  2Y0M A;  2RV8 A;  4FQG A;  4V2G A;  2IGN A;  1GLN A;  2HNH A;  1ON2 A;  2OA4 A;  1FZP B;  3VYT B;  3GTL J;  1A5J A;  2O6G E;  1S72 I;  2HOS A;  3ZOB A;  1T08 B;  2VXZ A;  4HF0 A;  3I71 A;  5FD5 A;  4PJL A;  5H2F C;  1A31 A;  1WH7 A;  3V7S A;  3TOB A;  4ETS A;  1DUX C;  2ZSI B;  3GTG J;  3VDX A;  3WGG A;  1T0F A;  4PFP A;  4J01 A;  1EH6 A;  1PP8 F;  4R1H A;  2P7C B;  3G1O A;  4LB6 B;  1O3S A;  2HVR A;  2QCO A;  4TV7 A;  4C2M J;  5F1R A;  2IAI A;  5K7F A;  4OU0 A;  3DBR B;  2G7H A;  2QGU A;  4KIC A;  4MTD A;  5CVU A;  4A12 A;  4QIW N;  5JFR A;  3MZH A;  1SFU A;  4V2F A;  1I6H J;  1QHH D;  3K4C A;  1BI3 A;  4BJ5 C;  3ZQG A;  5A2Q K;  2K9L A;  2VLA A;  1RR7 A;  5GPC A;  3GXO A;  3CCU I;  4RM3 A;  2CSO A;  5E8G A;  3RIR A;  2D2W A;  4KIF A;  5CQE A;  4HEA 2;  3CQZ J;  4II2 A;  1ZAO A;  4KIT B;  1XCB A;  5DS9 A;  3OYF A;  2PI0 A;  4HG2 A;  2ZNZ A;  4MEY F;  1OCR H;  4A3J J;  5EF6 A;  4M3E A;  3ZQQ A;  2A6E F;  4C2U A;  3JTG A;  4LIV A;  4KUM A;  2FML A;  5ERI A;  4A0X A;  3F21 A;  3WHB A;  2NVT J;  2VUM J;  5C3E J;  2RQP A;  1DPR A;  3V7R A;  2WAF A;  4KMF A;  3KFW X;  2BYV E;  1T38 A;  5KK1 A;  2H8R A;  1H0M A;  2IGK A;  4LD5 A;  2Y0S N;  3KCC A;  3J80 Z;  1VQP I;  3DKX A;  3E7L A;  3PO2 J;  1OR7 A;  3CMY A;  4ZYA A;  4Q47 A;  2GBY A;  3VB2 A;  3F3X A;  1Y8R B;  4A69 C;  1K4S A;  2QQ9 A;  4ASN A;  5LGN A;  2HDD A;  3IHU A;  2NXN B;  4PSX A;  1QPI A;  1HKT A;  3DPL C;  2HYF A;  3K4B A;  1TLH B;  4A6D A;  1J59 A;  4KYW A;  2JA7 J;  4AC0 A;  3KEQ A;  2FQ3 A;  4CA0 A;  3DXJ F;  2GAU A;  4Y4R A;  4G7H F;  5L3C A;  2KP6 A;  2L0K A;  1IUY A;  1JKR C;  4PCQ A;  3RPQ A;  3CCR I;  2ISY A;  4F3Q A;  1U0J A;  1SD7 A;  2XSD C;  3HOW J;  1S6L A;  5DUK A;  1DDN A;  3BJA A;  4RM2 A;  1KA8 A;  4IQ4 A;  3I3L A;  3CCQ I;  4E7Z A;  1X1A A;  1RUO A;  1WJB A;  4BAY A;  1RRJ A;  3ZP5 A;  4WX9 A;  4E7S A;  3G6E I;  5J1Y A;  2OD5 A;  1FP1 D;  2BHZ A;  2PMZ A;  2AO9 A;  4FIS A;  4JX5 A;  3BG6 A;  3CC7 I;  1LE8 B;  4GCV A;  4D1Q A;  3F8F A;  3ERM A;  4IHW A;  3LSH A;  3VWB A;  1YJN I;  5ICG A;  2E5Z A;  1DP7 P;  2W25 A;  1T39 A;  3C2H A;  2XAF A;  1YRN A;  2IT0 A;  2E34 A;  3M8J A;  1MSF C;  4FE4 A;  2EZI A;  3TKY A;  4HLY A;  3E6B A;  3L2U A;  2Z9O A;  2ZFU A;  2LP0 A;  2ZXJ A;  2QZ8 A;  5EDN A;  1FPQ A;  2ICW G;  3JW4 A;  3VYR B;  9ANT A;  2M3A A;  4U7D A;  2Y0S A;  1Z05 A;  1X2M A;  3L2V A;  5JLX A;  3WOD F;  1KYZ A;  1IRF A;  3CCJ I;  1W5T A;  3RDI A;  2L7Z A;  3OYM A;  3BZK A;  3K0L A;  3U21 A;  4RA2 A;  3I4N J;  2F5F A;  1I27 A;  4GGG A;  2NNN A;  5J8F A;  3W2A A;  2JA2 A;  3EUH A;  2EV6 A;  5LRR A;  4ITV A;  3UR3 C;  1LVA A;  3DP7 A;  3FXO A;  1CF7 A;  1USS A;  3EPZ A;  4M6V A;  3QOP A;  3J7Y J;  3CLO A;  1JJ8 C;  2HZD A;  2VAS A;  1LUJ B;  5M5Y J;  1BOB A;  1VFC A;  6PAX A;  2GOX B;  3RZO J;  2M0M A;  2VXD A;  3SFZ A;  2R7U A;  3S1R J;  3OYG A;  2L5Q A;  3M4O J;  1XGO A;  1YQA A;  2R7V A;  4M6Y A;  4DBQ A;  4NHJ A;  3K6G A;  3CJN A;  1A6I A;  2LMD A;  4XL9 A;  2LBF B;  3DWL E;  2ZJR F;  4HAM A;  1SMY F;  3IAS 2;  1FIP A;  3DV8 A;  1G8X A;  1YX5 A;  4KNY A;  1B9N A;  2BY3 A;  2FNP A;  4KDP A;  3O2P E;  1ZGA A;  5AIP A;  3KZZ A;  4P1W A;  2K9Q A;  3ML6 A;  1W4M A;  1QU3 A;  1DGW Y;  2EFQ A;  3I64 A;  3P9I A;  3RCO A;  3FK7 A;  4ZZL A;  3TMO A;  5B1B H;  2LRE A;  2GQQ A;  1GV2 A;  2WV0 A;  3CJT B;  1ODD A;  4BDY A;  2O7O A;  3LSK A;  2EIK H;  5AIQ A;  5D6F A;  5ILU A;  4QTR A;  3RKQ A;  2JA8 J;  2KJC A;  5E3O A;  1ZLJ A;  2W84 A;  3HRU A;  2NNY A;  2QLZ A;  5D5U B;  1VQ9 I;  2VPR A;  3OYK A;  2HTJ A;  2VJ4 A;  5D5W B;  1ZN2 A;  3M9A A;  4M6X A;  4OMZ A;  3CLQ A;  2XF7 A;  5FO5 A;  2CH0 A;  4UUS B;  1ZRC A;  4QLC U;  2KIF A;  2CUE A;  2HPI A;  3EDP A;  5CVI A;  2KIU A;  4BH9 A;  2JQ7 A;  1LEA A;  1T33 A;  4UUT A;  3MQ0 A;  1ZTR A;  2QBY B;  1HBX G;  3OL3 A;  1D3Y A;  5J8C A;  1XCV A;  2L4M A;  1XGS A;  3K4L A;  2ISZ A;  2VKV A;  1YFH A;  1Z77 A;  3BP8 A;  3DCF A;  3CP8 A;  4I0A A;  2B63 J;  2XPV A;  1QHG A;  2LC2 A;  2R7Q A;  4RAG A;  3HOY J;  2DMQ A;  2IEK A;  1KQ9 A;  3L00 A;  3W2W A;  4C3J J;  5LGU A;  2JA5 J;  4S04 A;  5ICC A;  3CES A;  3Q0V A;  3A0B C;  1ONV A;  4AYB A;  3TDU C;  4KIS A;  2W24 A;  2EIJ H;  1U5T B;  3G1L A;  3VOD A;  3B73 A;  2KRC A;  5CKT A;  3COA C;  1OYY A;  3ASN H;  4F7Z A;  2IS6 A;  4LK1 F;  3JRA A;  2X51 A;  2XAS A;  3LA3 A;  3RQI A;  4ZJZ A;  4RAF A;  2V9K A;  3A02 A;  4EEF G;  5JVT A;  3H9Q A;  2RRE A;  2GXA A;  2YS9 A;  4JYK A;  2HKX A;  3FDY A;  2DQR A;  4ZTF A;  4S05 A;  2NVU B;  4LB5 A;  3ULQ B;  1XDS A;  3MN2 A;  1ETW A;  2NAZ A;  4F93 B;  2JPB A;  3S3M A;  4ZTJ A;  3P7N A;  3IRQ A;  3PO3 J;  2JTV A;  4ZZD A;  2M30 A;  3K4N A;  3FX3 A;  3QP5 A;  1FT9 A;  3ZRG A;  3HYI A;  1A35 A;  4XIC A;  1G6N A;  1VZ0 A;  4AWX B;  2MC3 A;  1SVM A;  3IWZ A;  3G4S I;  2STT A;  1JXS A;  4BY1 J;  2ZFW A;  2RNJ A;  5CLS A;  3WTT C;  3KYL A;  2HZT A;  2J5O A;  4ZDO A;  1X1B A;  4IHX A;  2HDW A;  2Q0O A;  3F8N A;  1D5Y A;  3BG5 A;  1ZG5 A;  1UHM A;  2YX7 A;  1TWF J;  1DU0 A;  3KP3 A;  4H4K C;  3DKY A;  2V1X A;  2XAJ A;  4MEX F;  2P4W A;  3HXL A;  1SAX A;  3GX4 X;  3CMA I;  3OMY A;  3HOX J;  2ELH A;  3QPL A;  3ABM H;  2UXN A;  2VKD A;  3LSP A;  1ZRF A;  2DOE A;  3NWS A;  4BY7 J;  3I59 A;  4NC7 A;  2DMN A;  2L7F P;  2NS8 A;  4PGH A;  1QZY A;  2CFO A;  2RNG A;  1E0E A;  1ZKG A;  2P6S A;  5DM7 F;  1XPX A;  4CGZ A;  1DQU A;  1UG2 A;  3LL7 A;  2ME6 A;  3BQZ A;  2EZH A;  4L5I A;  2AXL A;  5EGO A;  2DK5 A;  2QYO A;  5HNH A;  4KA4 A;  2PJP A;  3GTK J;  3HRM A;  3S14 J;  2MYS A;  3F9K A;  2A5W A;  3DPT A;  3ZQF A;  1WJD A;  3WG7 H;  2R92 J;  1PUE E;  2LOO A;  5A2Q Z;  4I0B A;  2W1O A;  3K4K A;  1H9T A;  1UJ8 A;  2K9N A;  2HKO A;  2V1N A;  4B1R A;  2CQQ A;  2KKO A;  1ZYR F;  2Y69 H;  3C7J A;  2NRA C;  5IYB J;  2BW3 A;  1TBX A;  5DCF A;  2AS5 F;  1UHS A;  5DEQ A;  3IKT A;  4N4O B;  1LFU P;  3JCU C;  2RN7 A;  4XLH A;  2GIZ A;  3NAU A;  5E18 F;  4YEL A;  2V9P A;  2HYG D;  3FXL A;  1XMA A;  1QGP A;  1B59 A;  2KIM A;  3BQY A;  3ZN1 A;  1TT0 A;  2LLK A;  3GF2 A;  3UNG C;  2HOT A;  4JK1 X;  1HOM A;  1TZL A;  4RGX A;  3Q3S A;  2KHM A;  4C2T A;  1IN7 A;  1KON A;  5FLV A;  4DYC A;  1H8A C;  4YII A;  2AQF A;  2Z3Y A;  3CDL A;  1F4K A;  2XF6 A;  2DMT A;  3QU3 A;  5GTH C;  3PL8 A;  1U9N A;  4O3M A;  2MLK A;  1CGP A;  3T5X A;  1F9N A;  1WHU A;  3G73 A;  1ZRD A;  2HQA A;  2WAE A;  1BOA A;  3GLX A;  3IL2 A;  1YRN B;  1SAN A;  5GAD J;  4I6Z A;  3B02 A;  1D8K A;  3H35 A;  2MAB A;  4HQE A;  1D0Y A;  2GXB A;  2FXA A;  5HNF A;  1BM9 A;  2DCE A;  2VN2 A;  4JX4 A;  3VEP A;  3OYE A;  2KJB A;  1OQY A;  2UXX A;  2BHY A;  1R58 A;  3ZN0 A;  2X1E A;  2CUJ A;  2VOO A;  4P5O A;  3H5R A;  2FD5 A;  2L3D A;  3OWT A;  4PJ0 C;  1HKS A;  4RB2 C;  2O8K A;  2E7X A;  2W7N A;  3J80 K;  4ZDP A;  4XKW A;  4D7N A;  1VQ6 I;  1HQC A;  1HKQ A;  3V4G A;  3D5L A;  1X1C A;  3DEU A;  3WG9 A;  1JKO C;  5IY5 H;  3AG2 H;  1D8J A;  2R7Z J;  3F72 A;  3MMY B;  3KP5 A;  3TED A;  3JR9 A;  2ELK A;  3OYD A;  4ABZ A;  1YTY A;  3K2Z A;  2ZJP F;  2DA1 A;  3OYI A;  3AFH A;  3HL2 A;  2HEO A;  2COB A;  1T56 A;  4CYD A;  2MG4 A;  3S3N A;  3Q0U A;  3QPS A;  4FX0 A;  2V7F A;  5IT9 K;  2F48 A;  4EV0 A;  1NHA A;  5BMZ A;  1MBJ A;  3JTH A;  2LH9 A;  5JHU A;  2GWR A;  3F8M A;  4BE0 A;  1R9T J;  1W0U A;  2LBF A;  5BNG A;  2ID3 A;  1MJB A;  4MFE A;  2XC7 A;  2JMW A;  2L7K A;  1MBK A;  3E97 A;  2BEO A;  1D5V A;  5FB2 A;  4HST A;  4W1U A;  3H9J A;  1J2X A;  2R7O A;  2E2J J;  2L9N A;  4L5E A;  4M72 A;  4EJW A;  5BQT A;  1WJF A;  4AVP A;  3HOU J;  4X0G A;  5DV5 A;  2GLO A;  3F6V A;  3B6C A;  1SD4 A;  4A0Y A;  2F5V A;  1EA3 A;  3GTJ J;  1AWC A;  2QQ8 A;  1TNT A;  1V4R A;  2E35 A;  4DIQ A;  2H8W A;  2O9L A;  2P7V B;  3GFL A;  1WI9 A;  4FTH A;  1YOV B;  5JR3 A;  4IHV A;  2IGM A;  5J47 A;  3ZCO A;  1RZ4 A;  2HTS A;  4G7Z F;  5DCM A;  4M3G A;  2CYY A;  2DDA A; 
#chains in the Genus database with same CATH homology
 1XSD A;  2FA5 A;  4DQ2 A;  1B1B A;  1UB9 A;  4XLP F;  1PDN C;  2OQG A;  3KLN A;  3MEX A;  4MQ9 F;  2ZO4 A;  2Q2E A;  2XHK A;  2QBY A;  2L4A A;  2H09 A;  5CYV A;  4N0B A;  4GYI A;  1KQ8 A;  2NYX A;  2M8E A;  2EV5 A;  2CO5 A;  1BIB A;  1O57 A;  2OBP A;  1FYK A;  4ZYD A;  4Q48 A;  1U5T A;  1WQ2 A;  1GXQ A;  2CQK A;  5L3B A;  2LF7 A;  4RAZ A;  2EA2 A;  4PGG A;  1HSJ A;  3HSF A;  4EJU A;  3EQL F;  4UV9 A;  2FBI A;  4UV8 A;  3WE3 A;  2IP2 A;  3M7G A;  4O5V A;  4U7B A;  3R0A A;  3ROU A;  1IN4 A;  3QP6 A;  1RUN A;  1E17 A;  2VE8 A;  4L5J A;  4M9X A;  1J75 A;  2P5V A;  3T8T A;  2PG4 A;  1KU9 A;  1TTY A;  1P4A A;  1HW1 A;  5LHI A;  4UUV A;  2ESH A;  1JHF A;  4G6D A;  2IW5 A;  3WU1 B;  1IRG A;  2ZME B;  4BHC A;  1J5Y A;  3ZMU A;  1XB4 A;  4EGY A;  3DQV C;  3GWZ A;  1P4X A;  3SXY A;  4OIO F;  1O3R A;  2L54 A;  3V7C A;  4YG2 F;  1EH7 A;  4G94 A;  1R23 A;  2A6H F;  5HLH A;  3I59 B;  1W5S A;  1TQP A;  2YSR A;  3WTZ A;  3ZQ7 A;  1TNS A;  4GYG A;  4N9H A;  2HFH A;  1I6X A;  1K7A A;  3E6M A;  3KP4 A;  4JQF A;  2P5L C;  2GA2 A;  2IRF G;  5L3E A;  2DTR A;  1E2X A;  3Q9V A;  4XSX F;  5HLG A;  3RJP A;  2WTE A;  5IT9 Z;  1G3S A;  5DD4 A;  4HA8 A;  3WU0 A;  1LNW A;  2YR2 A;  2ZCW A;  4RB1 A;  4OIP F;  4G8X A;  3E5Q A;  4UNO A;  5HDN A;  4BHP A;  4KMU X;  3W6J B;  3DKW A;  4D0P A;  2C6Y A;  3U9G A;  4ON0 A;  4G9Y A;  1WSU A;  5J6X A;  3R6S A;  4A5M A;  1L3L A;  1P4W A;  1LJ9 A;  1HW5 A;  3F22 A;  3REO A;  4MQV A;  2MLG A;  3QAH A;  1B6A A;  2O61 A;  2VOD A;  1G4D A;  1Q1H A;  3ABU A;  3L7W A;  5DD8 A;  3LAJ A;  2M1B A;  1O7L A;  3N4M A;  5ILV A;  1A04 A;  3HOT A;  5EEG A;  4AD9 A;  5LBQ A;  5E8I A;  1FYL A;  1R1V A;  1FX7 A;  3SZT A;  2HDC A;  5F64 A;  4ESF A;  3QU6 A;  3HSE A;  4WXH A;  4HV5 A;  1ZAR A;  5H6Q A;  1YLF A;  2ZBK A;  3J81 K;  2XV4 S;  3IKV A;  2FBK A;  1XGN A;  3ECO A;  2R7F A;  3N97 A;  3I4P A;  1MJ9 A;  4FHT A;  5DCM B;  3FXR A;  1FOK A;  2QM3 A;  3QPH A;  4BXU A;  1J0R A;  3JSP A;  2XAQ A;  5E1Z B;  4G6Q A;  3RPU A;  3E3V A;  2VON A;  2VBY A;  3V8J A;  2OU2 A;  5K5O A;  3F8B A;  2O3F A;  1VTN C;  3LFK A;  3CO7 C;  1X3U A;  4EVI A;  1K78 B;  4ENN A;  1Z91 A;  3NQO A;  5L3G A;  1AOY A;  1BI0 A;  1F5T A;  3M8E A;  4I09 A;  1B9M A;  2XRO A;  2PLY A;  2DI3 A;  3FXU A;  2M45 A;  2YX4 A;  4HDV A;  3BY6 A;  1Z7U A;  4HX4 A;  4CDG A;  4RS8 A;  3K1M A;  4A6E A;  2OQR A;  2FF4 A;  4GO1 A;  2K02 A;  3NEU A;  3RKW A;  3RTR A;  4L0Z B;  4Y17 A;  4A2U A;  4UVB A;  3WGI A;  4OIR F;  4IHS A;  1GXP A;  4ZH4 F;  3J81 Z;  5HOO A;  4ZYE A;  3L9F A;  3I54 A;  3FMQ A;  4KN7 X;  3C3W A;  1P2F A;  2ZME A;  1YW7 A;  5E20 A;  2JPC A;  3GYH X;  3FHZ A;  1UST A;  2EFP A;  3WTU C;  5KVR A;  2BBY A;  4I98 B;  4RB3 C;  3ERE D;  1JE8 A;  1S8N A;  2VBZ A;  3SQN A;  3LST A;  2FSW A;  4HQM A;  1U8R A;  2X4H A;  2PN6 A;  4R79 A;  4HX7 A;  2TDX A;  2PFB A;  3Q9S A;  4HYE A;  2UWM A;  2EA4 A;  3FZV A;  3ECH A;  2J5P A;  1QO0 D;  1OYW A;  4YIF A;  1F1Z A;  1IN6 A;  2Z5U A;  3CO6 C;  1QBJ A;  1G3T A;  3U1D A;  1J9I A;  5HS9 A;  4HZF A;  2RC4 A;  2QQA A;  3GFM A;  3WTX C;  2EV0 A;  3OOP A;  4G7O F;  4BQA A;  4I01 A;  2GXG A;  1FBU A;  3DF8 A;  4LMY A;  1IZ1 A;  2JRT A;  3T0Y A;  5LRS A;  2BV6 A;  4NB5 A;  1MDM A;  2V6C A;  3FF5 A;  4RGR A;  1G3Y A;  2A61 A;  3TO6 A;  4CZZ A;  3KP6 A;  2FMY A;  3K1P A;  2BE5 F;  2HGC A;  3GVA A;  3LA2 A;  1YS7 A;  2DLL A;  1UHW A;  1BJA A;  5HDG A;  2K4B A;  5BS6 A;  5ILS A;  4HF1 A;  3G3Z A;  5HLI A;  4Z2Y A;  2VC1 A;  4IJA A;  1QPM A;  5HS8 A;  4LG0 A;  2HWV A;  4KN4 X;  4PDK A;  1S7O A;  2RDP A;  3JAM Z;  3T8R A;  1KQ0 A;  2MH9 A;  2DAO A;  4EQQ A;  4Y13 A;  5K1Y A;  3Q5F A;  3V8L A;  1R36 A;  5D4R A;  4WK8 F;  2EB7 A;  1B4A A;  4RAY A;  4HDU A;  1SFE A;  1WKM A;  2KRF A;  2YU3 A;  3MCZ A;  5EEH A;  5E1W A;  4WF2 A;  1G3W A;  3ABT A;  5DUI A;  2P5K A;  1BIA A;  3HOS A;  2CG4 A;  5D6E A;  4WWC A;  5CVJ A;  2ESN A;  3TO9 A;  4P9U A;  2F5D A;  1FNN A;  1OYI A;  2EFO A;  3GUD A;  3TDZ C;  2DO7 A;  2K7L A;  1K78 A;  5BOX A;  3AAF A;  3ZPL A;  1FYM A;  3M1E A;  4YFK F;  2E7W A;  2V9V A;  5ICE A;  2GIV A;  3ZMD A;  3WE2 A;  1GVJ A;  3KZY A;  2XRN A;  4ENM A;  3K69 A;  4FT8 A;  1TQI A;  2DU9 A;  1R00 A;  3LQQ A;  2IA2 A;  1FWZ A;  3T1B A;  1T6S A;  2RGV A;  3KEO A;  3KE2 A;  2WWY A;  4RB0 A;  4H0E A;  4ENJ A;  4UXN A;  3FMR A;  2Y48 A;  2B0L A;  4HBL A;  1BC7 C;  5LGT A;  1HW2 A;  1QQI A;  1RIO H;  3NRV A;  2DT5 A;  4FX4 A;  4XRF A;  2Q8K A;  4YFN F;  1TW2 A;  3HHH A;  3GFI A;  3CUQ C;  3F6O A;  4XBF A;  1UFM A;  1ZG1 A;  3RYP A;  1FBS A;  3RKY A;  2EWN A;  1FSE A;  2D1H A;  2ACJ A;  2UZK A;  1MGT A;  5FFZ A;  3ELK A;  3CUQ B;  3BDD A;  1WRJ A;  4P9F A;  5D4S A;  5LLQ A;  3GW2 A;  3O6B B;  1ON1 A;  3KLO A;  2EFW A;  1TQM A;  1R7J A;  5L3F A;  1YO5 C;  5FLX K;  1LEB A;  4O6J A;  3HUG A;  4M73 A;  1YS6 A;  2F5E A;  1XDU A;  4L9V A;  2DBB A;  2E1C A;  2EK5 A;  2JZY A;  2HQN A;  1WWX A;  3WTW C;  1O3T A;  3F23 A;  3FMS A;  3LQR A;  3KET A;  1BC8 C;  2H6C A;  1OMI A;  5FFX A;  4BHB A;  2M87 A;  4L18 B;  4HLX A;  2ZJ2 A;  4M9Z A;  2V79 A;  1IN5 A;  2DFI A;  4E70 A;  4OMY A;  1KGS A;  4XLN F;  5TRD A;  4XSZ F;  4A5N A;  5LHG A;  1IW7 F;  1FBQ A;  1O7F A;  5LHH A;  3K9T A;  2XAG A;  1R1U A;  1KYW A;  3LAP A;  5K5Q A;  2COM A;  1T2K A;  2L01 A;  3HRS A;  4EM2 A;  2VT2 A;  1JGS A;  3LWF A;  2IJL A;  3CDH A;  3HIF A;  5D5V B;  1MDM B;  4N9I A;  4HOB A;  3GO5 A;  4A0Z A;  1FLI A;  1O3Q A;  3OV8 A;  3IWF A;  2DK8 A;  1XSV A;  1W7P B;  3CUO A;  3DFG A;  2H27 A;  3HTS B;  4U0W A;  1IAW A;  2H6B A;  3V8K A;  4JBA A;  5CVV A;  2FNA A;  5FD6 A;  4RGS A;  2R3S A;  3EYY A;  4U0V A;  4LG0 B;  3RYR A;  1BN5 A;  2QWW A;  4HV6 A;  3JAM K;  1KU7 A;  1YG2 A;  4OIN F;  2CFX A;  1T98 A;  2IA1 A;  2F5C A;  3GEZ A;  5L3D A;  1ZRE A;  4HF2 A;  2HS5 A;  1ZLK A;  2FRH A;  3O3K A;  2G9W A;  3WTS C;  2DPU A;  1S3J A;  1ZH5 A;  1XSX A;  3LA7 A;  3HHG A;  2XGX A;  5BPD A;  1EV7 A;  2O03 A;  3PQK A;  1MJA A;  1U5T C;  1FP2 A;  1KU2 A;  3E5U A;  4WCG A;  1MZB A;  3L09 A;  3GZ5 A;  5HS7 A;  4ESJ A;  1TW3 A;  3TGN A;  1LDD A;  5JI6 A;  4R8H A;  1R5G A;  5F6F A;  4IF4 A;  1IXS B;  2CWE A;  4MHG A;  3FXQ A;  3U2R A;  2MBF A;  2LSO A;  3FWE A;  2NS0 A;  3BZ6 A;  1R22 A;  1RI7 A;  1R5H A;  5LEJ A;  5E17 F;  2P6T A;  4U0Y A;  3I53 A;  2O8X A;  2CGP A;  3F8C A;  2XUB A;  3D0S A;  1QNT A;  2OAZ A;  5BPI A;  4EJT A;  4CO8 A;  1RNL A;  4QWQ A;  3HTU A;  1ZGJ A;  3E5X A;  1K79 A;  1J7K A;  2ZNY A;  2DW4 A;  3KP2 A;  2A3S A;  2IVM A;  3TQN A;  3K1N A;  3KP7 A;  2PMH A;  2OZ6 A;  4ENK A;  3BPX A;  3P9C A;  2O0Y A;  4WXC A;  2MD5 A;  2ETH A;  1I1S A;  3W6K B;  4LLL A;  4I2O A;  2OZU A;  1IXR C;  2FU4 A;  3HRT A;  4Q5S F;  4MTE A;  2FEZ A;  4IRI A;  1XMK A;  3CUQ A;  1YW8 A;  3I0T A;  2Z33 A;  2JSC A;  3R4K A;  3C18 A;  4L9T A;  1HST A;  1R1T A;  3M8F A;  5AON A;  4IRG A;  5IT3 A;  4IXA A;  2FBH A;  3BPV A;  5ED4 A;  2XKP A;  3GZ6 A;  4BNC A;  5LEK A;  5TJJ A;  3IC7 A;  3EYI A;  4P55 A;  3SZP A;  3RI4 A;  4M71 A;  4OOI A;  2VC0 A;  2DQL A;  4AIK A;  4EGZ A;  2GZW A;  3VOE A;  2LF8 A;  2LKP A;  3BJO A;  3PQJ A;  4DNC A;  1U2W A;  2A07 F;  1YIO A;  4U88 A;  4IRH A;  4GXO A;  4KT5 C;  3S2W A;  3ZMT A;  5HDK A;  1REP C;  4YFX F;  2MA3 A;  2W57 A;  2V1U A;  1LB2 A;  1LQ1 A;  2D1V A;  3I5U A;  3HSR A;  5FGM A;  1L0O C;  4EJV A;  1C0W A;  4UVA A;  2P8T A;  4EMS A;  1QZZ A;  1FY7 A;  4HX8 A;  4MGR A;  4EM0 B;  5E1X A;  1P6R A;  4L9N A;  4AIJ A;  1EH8 A;  5H20 A;  2VT3 A;  2A5Y B;  2IA0 A;  2VBX A;  3BRO A;  1SFX A;  3L2C A;  3BOQ A;  3MZY A;  4CHU A;  4KFC A;  1W7P A;  3H3Z A;  3EET A;  1JHH A;  2K86 A;  3QPT A;  1PP7 U;  3MWM A;  4L9J A;  4P96 A;  3BJ6 A;  2K27 A;  1FC3 A;  1ULY A;  3I58 A;  4HW0 A;  2W85 A;  2MH2 A;  2VE9 A;  1V3F A;  4ZYG A;  4PZJ A;  1BBY A;  2STW A;  3E6C C;  3SHF A;  1W7P D;  1Z9C A;  4WXD A;  5K5R A;  1KU3 A;  3R60 A;  1SMT A;  3BWG A;  3H92 A;  1XD7 A;  2VOP A;  4L0Y B;  5DYM A;  3TO7 A;  3JSO A;  2FOK A;  4AIH A;  2EFN A;  4LJZ F;  4EJO A;  3IRR A;  1Z6R A;  1FSH A;  1LDK B;  2GA1 A;  5D8K B;  1U6G A;  4B8X A;  1U78 A;  1S7A A;  1IF1 A;  5CJ9 A;  3PFI A;  1MD0 A;  4B09 A;  2ZKZ A;  1DPU A;  2HOE A;  2QQB A;  2Z99 A;  5DDG A;  4I7H A;  4IPA A;  5ICF A;  1Y0U A;  1P92 A;  4LFU A;  2XKO A;  4M9S A;  1HXD A;  3QRF F;  4Y15 A;  3R61 A;  5D8L B;  1BI1 A;  3ZMZ A;  2QEN A;  2RKH A;  5H6R A;  2IPQ X;  2H94 A;  2X0L A;  1ZHF A;  3H3U A;  4CIC A;  3GFJ A;  1LDJ A;  2D45 A;  1YYV A;  2HR3 A;  1SD6 A;  4LLG F;  2VBW A;  1Z1D A;  1UCR A;  3ZMS A;  1OPC A;  4BYY A;  2RVC A;  2F2E A;  3FM3 A;  1BI2 A;  2LDU A;  3RKX A;  2JT1 A;  4IVN A;  4Q4Z F;  3P9K A;  4UVC A;  3WTY C;  2CW0 F;  2XIG A;  1CF7 B;  1OKR A;  1IN8 A;  2XVC A;  5HVQ C;  4EM1 A;  3WTV C;  3VFZ A;  2PMU A;  1STZ A;  2FE3 A;  2LNB A;  4LGW A;  1U3E M;  2E1N A;  3WGH A;  1H9G A;  2G7U A;  2XAH A;  2PBI A;  4IHT A;  3ZMV A;  4LLN A;  5FLX Z;  2QVO A;  1XN7 A;  1IXC A;  2PEX A;  4ZYH A;  2WC2 A;  4MNU A;  3TOA A;  2YPR A;  2ADU A;  1XGM A;  4M74 A;  4NQW A;  4I02 A;  3R0J A;  2HQR A;  3ISP A;  1MKM A;  2K4J A;  2DPD A;  4CXF A;  4ESB A;  5CVR A;  4KIG A;  4OIQ F;  4RGU A;  1YW9 A;  2PQ8 A;  4LK0 F;  3MAJ A;  1K6O A;  3E6D A;  4UHT A;  1Z6T A;  1GHC A;  2V1D A;  3C1D A;  1S29 A;  1I1G A;  4K2E A;  2M5W A;  2BGC A;  2L02 A;  1SD5 A;  3CTA A;  2R7D A;  3FM5 A;  2A69 F;  1ZG3 A;  1I5Z A;  2A68 F;  2EJR A;  3MFK A;  5D5X B;  2QUF A;  4KIB A;  2Y75 A;  3J7A O;  2Y0M A;  2RV8 A;  1ON2 A;  2OA4 A;  1FZP B;  2O6G E;  2VXZ A;  4HF0 A;  3I71 A;  5FD5 A;  3V7S A;  3TOB A;  4ETS A;  1DUX C;  3WGG A;  1T0F A;  1EH6 A;  1PP8 F;  4R1H A;  2P7C B;  4LB6 B;  1O3S A;  4TV7 A;  5F1R A;  4OU0 A;  2G7H A;  4MTD A;  4KIC A;  5CVU A;  4A12 A;  5JFR A;  3MZH A;  1SFU A;  1BI3 A;  5A2Q K;  3GXO A;  2CSO A;  5E8G A;  3RIR A;  2D2W A;  4KIF A;  1ZAO A;  2PI0 A;  1XCB A;  2ZNZ A;  4MEY F;  2A6E F;  3JTG A;  4KUM A;  2FML A;  5ERI A;  4A0X A;  3F21 A;  2RQP A;  1DPR A;  3V7R A;  4KMF A;  3KFW X;  2BYV E;  1T38 A;  5KK1 A;  1H0M A;  4LD5 A;  3KCC A;  3J80 Z;  1OR7 A;  4Q47 A;  3VB2 A;  3F3X A;  2QQ9 A;  4ASN A;  5LGN A;  3IHU A;  1HKT A;  3DPL C;  2HYF A;  1TLH B;  4A6D A;  1J59 A;  4KYW A;  3KEQ A;  2FQ3 A;  3DXJ F;  2GAU A;  4G7H F;  5L3C A;  1IUY A;  4PCQ A;  3RPQ A;  2ISY A;  1SD7 A;  1S6L A;  5DUK A;  1DDN A;  3BJA A;  1KA8 A;  1RUO A;  4BAY A;  3ZP5 A;  4WX9 A;  2OD5 A;  1FP1 D;  4GCV A;  3F8F A;  5ICG A;  1DP7 P;  2W25 A;  1T39 A;  2XAF A;  2IT0 A;  3TKY A;  4HLY A;  3E6B A;  2Z9O A;  2ZXJ A;  2QZ8 A;  1FPQ A;  3JW4 A;  4U7D A;  1Z05 A;  3WOD F;  1KYZ A;  1IRF A;  1W5T A;  3RDI A;  3K0L A;  2F5F A;  1I27 A;  4GGG A;  2NNN A;  5J8F A;  5LRR A;  3EUH A;  2EV6 A;  1LVA A;  3DP7 A;  1CF7 A;  1USS A;  3QOP A;  3CLO A;  6PAX A;  3SFZ A;  1XGO A;  1YQA A;  4M6Y A;  4NHJ A;  3CJN A;  4HAM A;  1SMY F;  3DV8 A;  4KNY A;  1B9N A;  2FNP A;  4KDP A;  3O2P E;  1ZGA A;  5AIP A;  3KZZ A;  3ML6 A;  1W4M A;  2EFQ A;  3I64 A;  3P9I A;  4ZZL A;  2GQQ A;  2WV0 A;  1ODD A;  5AIQ A;  5D6F A;  5ILU A;  2KJC A;  1ZLJ A;  2W84 A;  3HRU A;  2NNY A;  2QLZ A;  5D5U B;  2HTJ A;  5D5W B;  1ZN2 A;  3M9A A;  4M6X A;  4OMZ A;  5FO5 A;  1ZRC A;  4QLC U;  2KIF A;  3EDP A;  5CVI A;  2KIU A;  4BH9 A;  1LEA A;  3MQ0 A;  2QBY B;  1HBX G;  5J8C A;  1D3Y A;  1XCV A;  2L4M A;  1XGS A;  2ISZ A;  1YFH A;  3BP8 A;  4I0A A;  5LGU A;  1KQ9 A;  3L00 A;  4S04 A;  5ICC A;  1ONV A;  3TDU C;  2W24 A;  1U5T B;  3VOD A;  3B73 A;  3COA C;  1OYY A;  4F7Z A;  4LK1 F;  2XAS A;  3LA3 A;  5JVT A;  2HKX A;  2DQR A;  4S05 A;  4LB5 A;  3ULQ B;  1XDS A;  2NAZ A;  2JPB A;  3P7N A;  3IRQ A;  2JTV A;  4ZZD A;  2M30 A;  3FX3 A;  3QP5 A;  1FT9 A;  3HYI A;  1G6N A;  4AWX B;  2MC3 A;  3IWZ A;  1JXS A;  2STT A;  2ZFW A;  2RNJ A;  5CLS A;  3WTT C;  2HZT A;  2J5O A;  2Q0O A;  3F8N A;  1ZG5 A;  1UHM A;  2YX7 A;  3KP3 A;  2V1X A;  2XAJ A;  4MEX F;  2P4W A;  1SAX A;  3GX4 X;  2ELH A;  2UXN A;  1ZRF A;  3I59 A;  4PGH A;  1QZY A;  2P6S A;  4CGZ A;  4L5I A;  2AXL A;  2DK5 A;  2QYO A;  4KA4 A;  2PJP A;  3HRM A;  3DPT A;  1PUE E;  5A2Q Z;  4I0B A;  1H9T A;  2HKO A;  2KKO A;  1ZYR F;  3C7J A;  2NRA C;  1TBX A;  5DCF A;  2AS5 F;  5DEQ A;  3IKT A;  2RN7 A;  5E18 F;  2HYG D;  1XMA A;  1QGP A;  1B59 A;  2KIM A;  3ZN1 A;  3GF2 A;  4JK1 X;  4RGX A;  1IN7 A;  4YII A;  2Z3Y A;  1F4K A;  3QU3 A;  4O3M A;  2MLK A;  1CGP A;  3T5X A;  1F9N A;  1ZRD A;  3G73 A;  1BOA A;  3GLX A;  3IL2 A;  3B02 A;  1D8K A;  4HQE A;  2GXB A;  2FXA A;  1BM9 A;  2VN2 A;  3VEP A;  2KJB A;  2UXX A;  1R58 A;  3ZN0 A;  2VOO A;  4P5O A;  2L3D A;  1HKS A;  4RB2 C;  2E7X A;  3J80 K;  1HQC A;  1HKQ A;  3V4G A;  3D5L A;  3DEU A;  3WG9 A;  1D8J A;  3F72 A;  3KP5 A;  1YTY A;  3K2Z A;  2HEO A;  4CYD A;  4FX0 A;  5IT9 K;  4EV0 A;  1NHA A;  5BMZ A;  3JTH A;  5JHU A;  2GWR A;  3F8M A;  1MJB A;  3E97 A;  2BEO A;  1D5V A;  5FB2 A;  1J2X A;  5BQT A;  4M72 A;  4EJW A;  4AVP A;  5DV5 A;  3F6V A;  1SD4 A;  4A0Y A;  1AWC A;  1TNT A;  1V4R A;  2P7V B;  3GFL A;  1WI9 A;  5JR3 A;  1RZ4 A;  2HTS A;  4G7Z F;  5DCM A;  2CYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...