2W85A

Structure of pex14 in complex with pex19
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
ENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Competitive Interactions of Pex14 with the Import Receptors Pex5 and Pex19.
pubmed doi rcsb
molecule keywords PEROXISOMAL MEMBRANE ANCHOR PROTEIN PEX14
molecule tags Protein transport
source organism Homo sapiens
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2w85A00
1ZGAA 3J7AO 1QO0D 2EFOA 4I7HA 1I27A 1A04A 3I71A 3E6DA 3QU3A 2ZO4A 2STWA 2L3DA 3BP8A 3WODF 4KMUX 4U7BA 1MDMB 3ECOA 2FEZA 5DUIA 1XGSA 2FOKA 2BE5F 1Z9CA 2ESNA 4HF1A 2GXGA 3EQLF 3SZTA 3K0LA 2CWEA 4BHBA 4G7HF 3BROA 2D1HA 3ZMZA 3EETA 2DK8A 1IRFA 3IRRA 2ZKZA 1GVJA 2HOEA 3PQKA 2VE9A 1FT9A 1IZ1A 1G4DA 3DV8A 2W24A 2O8XA 2A69F 1XCBA 3ECHA 4KIFA 3VOEA 1ZN2A 3R0AA 1CGPA 1SD7A 3JTHA 1IXCA 4TV7A 5LHIA 1ZREA 1B59A 5ILVA 3JTGA 4LD5A 3KZYA 5L3DA 4HDVA 3WTVC 3CUQB 2HTJA 3I5UA 5A2QK 3BY6A 3I0TA 2GIVA 2HYGD 2WTEA 2XV4S 3F8NA 4M9XA 3TDZC 4DQ2A 3I54A 1K79A 1R22A 3JAMZ 3ZN0A 3LA3A 1FBUA 1B9NA 3F8MA 5CLSA 1I1SA 2QENA 4HLYA 4MTEA 3EUHA 4R1HA 1FYMA 2IA1A 2UXXA 3CUQC 3CJNA 2OZ6A 2OBPA 5HDGA 2FBKA 4FX0A 3E97A 2CG4A 3FMQA 4EM1A 2QUFA 2D2WA 5D6FA 1Z6TA 2ZFWA 2VOPA 3R0JA 2XAFA 2FQ3A 1BI2A 2F5CA 3MZHA 3WTXC 1ZG5A 1LDDA 4HQEA 1JHHA 1X3UA 1KU3A 3KP6A 4KFCA 4WXHA 1YYVA 1TLHB 4BAYA 3W6KB 1W7PB 5HDKA 3Q9SA 3LA2A 4NB5A 5BMZA 3B73A 3KP3A 3R61A 3LSTA 2BEOA 2FMLA 1IW7F 1BI1A 2G7UA 2J5OA 3TDUC 5FLXK 2PLYA 1AOYA 3FF5A 4N9IA 4A0ZA 4CXFA 2CGPA 3GYHX 2ZCWA 4ENKA 4ZH4F 5ERIA 1K7AA 5K5QA 4I09A 3GLXA 2PJPA 4HX4A 4EGZA 3LAPA 5K5OA 4HBLA 2HR3A 4CHUA 3HRSA 3FXRA 1R58A 3B02A 1O3QA 3ML6A 1YG2A 2NYXA 3C1DA 1USSA 3GFMA 2AXLA 1O3SA 1ODDA 2OA4A 3IHUA 3L9FA 4UV8A 1ZARA 4UHTA 2RDPA 5IT9K 3V7CA 4CICA 4EJUA 1R23A 4ZZLA 3F21A 1MJ9A 3D5LA 3HYIA 4EJTA 3KFWX 2OQGA 1KU7A 4HDUA 1EH8A 2VN2A 3K1MA 3RIRA 4UUVA 4HW0A 3L09A 5HOOA 4QLCU 2YPRA 4S05A 2X0LA 3ZN1A 5FD5A 4BNCA 1I5ZA 5BQTA 2V1XA 4LK0F 4P55A 3ERED 4OU0A 2EA4A 3DPLC 4M9SA 1QQIA 4RGSA 2VC0A 3V8LA 1HXDA 3R4KA 3P9KA 3J81K 1R1VA 3WE3A 3V7SA 5CVIA 2K4JA 2VBZA 4LK1F 2FE3A 3F8FA 4HV6A 3WE2A 3F3XA 2L4MA 1J9IA 3M8FA 1RUOA 3F23A 3N97A 2EFPA 3SZPA 1XGMA 2ELHA 2RGVA 3M1EA 4NHJA 3WU1B 2XIGA 2IVMA 2P8TA 2K4BA 5BOXA 1H9TA 3BJ6A 2CO5A 2XROA 4RB0A 1T0FA 3M8EA 4LG0B 2A07F 2MC3A 4L5JA 1YTYA 4IJAA 3WGGA 4I98B 2CFXA 4Y17A 1FYKA 3WGHA 3ZMSA 2GA2A 4WF2A 1QZYA 3F8BA 4IPAA 1O7LA 5FO5A 1T39A 3M9AA 4KA4A 4IVNA 5KK1A 2FBIA 2P6SA 2QLZA 1U6GA 2KJBA 4PCQA 4RGRA 4KN4X 2HZTA 4AVPA 4RB3C 5L3FA 2VBYA 1LB2A 4WX9A 2A3SA 4GGGA 5HLIA 2RQPA 1ZAOA 4OIRF 1CF7B 3HSFA 2NNYA 2FRHA 3MZYA 5LGTA 5D6EA 3H3ZA 1HKQA 2M8EA 3E6BA 1ON2A 3EYIA 2LNBA 3FM5A 1SFEA 5AIPA 4R8HA 3U1DA 2FBHA 4Q47A 2FXAA 4G6QA 5HDNA 4A0YA 2XUBA 4L9VA 4BYYA 4KUMA 3O3KA 5ED4A 4I01A 3F22A 5F1RA 4EGYA 1P4WA 1FBSA 2J5PA 4L9JA 1FLIA 3QOPA 2C6YA 1ZYRF 2L02A 4E70A 2YU3A 3IL2A 3K9TA 2VXZA 2JPBA 1MGTA 2ZMEA 4CDGA 4ZYGA 3WU0A 3FZVA 4G94A 3S2WA 1FX7A 1YQAA 1I6XA 5LEKA 5JR3A 2CW0F 1OYYA 2FNAA 4LLNA 4WXDA 1DPRA 4OMZA 3E5QA 4LB5A 2KIUA 4RS8A 3KCCA 2GZWA 4P9FA 1P6RA 1HSJA 3QPHA 2ACJA 3TOAA 3GO5A 3RDIA 2VT2A 4L0ZB 1B6AA 2HFHA 4BXUA 3LQRA 2CYYA 4Q48A 1E17A 2NS0A 1DDNA 3V8JA 1IXRC 4EMSA 1ZG3A 3E5XA 4YFNF 2MH9A 5JVTA 1JHFA 2MLGA 1ZHFA 1D3YA 2P4WA 5ILSA 2LSOA 2XAHA 2JZYA 3I58A 5BS6A 4XLNF 3J80Z 2DW4A 2JSCA 1XDSA 3M7GA 2LDUA 2DI3A 4AIJA 3W6JB 3JAMK 1K78A 2M45A 1WSUA 3DXJF 1H9GA 3CLOA 4A5NA 1YS6A 5JHUA 1HW2A 1OR7A 2QWWA 3FXUA 3WG9A 2F5EA 2HWVA 5L3CA 3L00A 4EJWA 1GHCA 3PQJA 2GXBA 1E2XA 1SFXA 4UVBA 2R7FA 5D5UB 2QQBA 2OQRA 1R7JA 3FWEA 4GXOA 1UHWA 5CJ9A 3KP5A 2K86A 4IRGA 5D8KB 5LEJA 3ZQ7A 5EEHA 1XB4A 2A61A 3E3VA 4UNOA 2HYFA 1I1GA 4L5IA 2W85A 4YIFA 5JI6A 1K6OA 4H0EA 2ZJ2A 4IHSA 3R60A 1G3TA 3KETA 2STTA 5J8FA 3RYPA 2K7LA 4EJVA 2Z9OA 1JGSA 1G6NA 3HRTA 3E6CC 1XSDA 4Z2YA 5FFXA 1G3YA 2D45A 3CDHA 2IPQX 1O3TA 4N9HA 4U0WA 3IC7A 3I59B 3FXQA 1B1BA 2HGCA 4ZYHA 5LGNA 2HKOA 4ON0A 3T8TA 1TW2A 4F7ZA 3BJOA 1KU2A 3IKTA 3LQQA 4KMFA 3KLNA 2QVOA 1FOKA 1XGNA 4ESJA 2H09A 5FFZA 2XKPA 1BOAA 4YIIA 2VODA 4HAMA 1YO5C 1J0RA 2DO7A 3ROUA 2PFBA 2BGCA 3K1PA 3GZ6A 1TNTA 2IW5A 4WWCA 1LEBA 1TQIA 2P5LC 1ZG1A 2HEOA 3LA7A 2Z3YA 4HOBA 3P9IA 3ABTA 1XMKA 3LFKA 4A0XA 4Q4ZF 3ELKA 2JRTA 4PDKA 2PBIA 2E1NA 4O3MA 1HW1A 2VONA 1UCRA 1SD4A 4RAYA 2V1UA 1KGSA 4M6YA 4IXAA 4ENMA 3V8KA 1P92A 4AIKA 4Y13A 3NQOA 4S04A 4HX8A 1IN4A 4IHTA 1XSVA 1P4AA 5H6RA 5L3EA 5DUKA 2A68F 1F9NA 3E5UA 4ASNA 1Z91A 1O57A 4MQVA 2FU4A 1ZH5A 5TJJA 1IN7A 3HRUA 4EM0B 3P9CA 3TGNA 3QP5A 2ZMEB 3REOA 5CVVA 1FBQA 4A6EA 1J2XA 2L54A 4I2OA 2PI0A 4MHGA 2L4AA 3Q5FA 2GAUA 1XD7A 4ESFA 2Q0OA 4B8XA 1MZBA 1XGOA 3JSPA 4RGUA 2DTRA 2NNNA 1IF1A 3TO7A 1W5TA 1J75A 2RVCA 1XMAA 2V79A 3GEZA 2IA2A 2A6EF 4HYEA 1W7PD 5FD6A 3TQNA 2FMYA 4R79A 4G6DA 1NHAA 1GXPA 1W4MA 1IXSB 1TQMA 4U88A 4LLGF 5HS8A 3QPTA 4BHPA 4LMYA 2ETHA 3HIFA 3OV8A 3IRQA 1YFHA 2EV6A 2DPUA 3EDPA 3KZZA 2VBXA 2DFIA 2YR2A 3QP6A 4HF2A 4LFUA 1STZA 3WTYC 1BI3A 3O2PE 1B9MA 3SHFA 4CYDA 1IN5A 2W84A 1HQCA 3ISPA 5FLXZ 2W57A 1BBYA 3GW2A 1RI7A 4HA8A 1K78B 1JE8A 2DLLA 3NRVA 5F6FA 1O7FA 4MNUA 2JPCA 1BI0A 3BWGA 4BHCA 1U3EM 2X4HA 1LDKB 1GXQA 1DPUA 2XAJA 2MA3A 4G8XA 2H27A 2XAGA 1UHMA 3MCZA 2E1CA 2ZBKA 5H20A 5AIQA 3ZMUA 4CO8A 5DYMA 4ESBA 1J59A 1FP1D 5E8GA 1KU9A 2M5WA 4UXNA 2XGXA 3K69A 3T1BA 2ISZA 2KIMA 1LEAA 2XKOA 4HX7A 1SAXA 5IT9Z 1UFMA 2XASA 2Z5UA 1Q1HA 4LLLA 3LWFA 5DEQA 2DAOA 5F64A 2NRAC 3DFGA 5DD8A 1MJAA 1R36A 1W5SA 2M1BA 1J7KA 5E8IA 1T6SA 1KQ0A 1XN7A 1WKMA 2YX4A 4PGGA 5L3BA 1RZ4A 2H6BA 5H6QA 2L01A 3RKWA 2Y0MA 3O6BB 4G7OF 3J81Z 1PP8F 1S29A 4QWQA 1D8JA 3RTRA 3COAC 1QNTA 4M6XA 1BM9A 1ZRFA 3L2CA 1L3LA 4BQAA 3GUDA 2DQRA 4MTDA 3SFZA 2E7WA 2P5KA 1H0MA 4M71A 2RC4A 3D0SA 3HSEA 2IP2A 4LJZF 1XCVA 1FP2A 5E1XA 4HLXA 4L9TA 1RNLA 3ZMDA 3T5XA 5D5VB 3CUOA 3QAHA 4UVAA 5JFRA 1TW3A 2PMUA 1YS7A 1YIOA 3TKYA 5ICCA 5ICGA 1ZGJA 2IRFG 5K1YA 1TQPA 2Q8KA 1EV7A 4M9ZA 2ZXJA 3F72A 1ZLJA 5CVRA 3RKYA 2Q2EA 2B0LA 2VC1A 3GZ5A 4FX4A 4CZZA 3SQNA 3WGIA 1U2WA 5LBQA 3MFKA 2QQAA 2P7CB 3E6MA 3KP4A 1FYLA 2MD5A 4WXCA 2P5VA 1PP7U 3WTSC 2A5YB 2HKXA 3TOBA 1Y0UA 3FHZA 3DQVC 3F8CA 2UWMA 5FB2A 5CYVA 2ZNYA 2G7HA 5LLQA 3RKXA 3P7NA 2LKPA 3ULQB 2MBFA 4M74A 1ZRCA 1EH7A 1S8NA 1HKTA 1LVAA 3K1NA 4ZZDA 1BC7C 4AIHA 1FY7A 4P96A 4LB6B 4YG2F 1DUXC 3V7RA 1BC8C 4JK1X 2CSOA 3U9GA 3MQ0A 2M87A 2K02A 1R1UA 2ISYA 1YLFA 3H3UA 2IT0A 2BV6A 2DU9A 1IUYA 4OIQF 4PZJA 1FZPB 1S6LA 1OKRA 3RPQA 4IRIA 1KQ8A 5E18F 4U0YA 3HOTA 3MEXA 3H92A 5D4SA 3VFZA 2P7VB 5LRRA 4A5MA 2PEXA 3WTZA 1VTNC 1YW9A 4KIGA 1XSXA 2KIFA 3N4MA 2RNJA 1Z7UA 1S7AA 3EYYA 3KLOA 1FSHA 1HSTA 1ONVA 2OD5A 1J5YA 2GWRA 1ULYA 1RIOH 1B4AA 3KP2A 3HTSB 2GA1A 3L7WA 1HKSA 2P6TA 2VOOA 1R5GA 3DPTA 4OIOF 4LG0A 4ZYEA 4KIBA 4WCGA 5BPIA 2ZNZA 4M72A 1WRJA 1RUNA 2GQQA 1L0OC 4LGWA 1WI9A 1U5TA 3RI4A 3QRFF 1FSEA 5DCMA 1R5HA 4KN7X 3LAJA 2OAZA 1WQ2A 3BJAA 3BZ6A 1FNNA 1YW7A 4Q5SF 2CQKA 4MEYF 1BN5A 3WTWC 1PUEE 2QZ8A 1SD5A 2KJCA 4RB2C 2A6HF 4KYWA 4MGRA 4KDPA 5TRDA 2G9WA 1D5VA 3KEOA 4YFKF 2O61A 1CF7A 4KT5C 2F2EA 4DNCA 3VB2A 1BIBA 2BYVE 2DPDA 2K27A 4M73A 1MD0A 4P9UA 1IN8A 2PN6A 1G3SA 4A2UA 1S7OA 3PFIA 3K2ZA 2EB7A 3HSRA 3RYRA 2IA0A 4GYGA 2EV0A 3HRMA 4ENJA 1KYWA 3VEPA 3FX3A 3U2RA 2ESHA 3C3WA 2OU2A 1JXSA 2DBBA 2UXNA 1EH6A 3C7JA 4YFXF 5E1WA 4PGHA 3MWMA 4EM2A 3AAFA 4L18B 5HVQC 4D0PA 1OYWA 1QBJA 4XBFA 2D1VA 2PG4A 5A2QZ 3GFLA 2F5DA 3TO6A 5DD4A 3HOSA 2F5FA 1TNSA 4OOIA 4AWXB 1S3JA 3GWZA 5HS9A 2O6GE 4AD9A 4O5VA 1FC3A 3BDDA 4GO1A 2FNPA 2IJLA 2Z33A 3GFJA 4A12A 4P5OA 2EK5A 4ENNA 1KQ9A 3GXOA 1IN6A 3DP7A 3KEQA 2AS5F 4N0BA 2XRNA 3T8RA 2H6CA 4G7ZF 4UV9A 5ILUA 1U8RA 6PAXA 1AWCA 2Y75A 3I4PA 1MKMA 2VE8A 1BJAA 1FWZA 1LNWA 3BPVA 2RN7A 1OYIA 2DT5A 1MJBA 1R1TA 2W25A 4GCVA 4I02A 2JTVA 3GF2A 2QBYA 5E1ZB 2HTSA 2V9VA 3BPXA 1R00A 5LHGA 3FMSA 2DK5A 2HDCA 3SXYA 1XDUA 1SD6A 5L3GA 1ZRDA 2XHKA 4G9YA 3DF8A 4L9NA 5FGMA 1KA8A 2NAZA 2XAQA 4BH9A 2R3SA 1USTA 5DV5A 1MDMA 2PQ8A 1QGPA 5AONA 3KE2A 3FM3A 2MH2A 4HF0A 5D5XB 2H94A 2VT3A 2WWYA 4UVCA 1HBXG 4HQMA 4WK8F 1SMYF 4L0YB 1QPMA 3WTUC 2QYOA 2WV0A 3RPUA 5HLGA 2E7XA 2QQ9A 2KRFA 2FA5A 5E17F 3V4GA 3MAJA 1WWXA 2DQLA 4JBAA 1O3RA 2RKHA 1TTYA 2YSRA 2JT1A 3OOPA 4KNYA 1P2FA 2ADUA 1LJ9A 3GFIA 5ICEA 3JW4A 1TBXA 3DEUA 3DKWA 3RJPA 5DDGA 4OMYA 3CUQA 4B09A 3IWZA 2M30A 4RAZA 1C0WA 1QZZA 1U5TB 1ON1A 2UZKA 5DCFA 5DCMB 3I59A 4IF4A 5E20A 3GX4X 4Y15A 2PMHA 2BBYA 1SFUA 1V4RA 4IRHA 1KYZA 3JSOA 2FF4A 2YX7A 3CO7C 5LHHA 2FSWA 2TDXA 2XVCA 1OMIA 3I53A 4HZFA 1IAWA 4FHTA 5D5WB 4O6JA 1U5TC 3R6SA 4XLPF 4A6DA 1T98A 2Z99A 3GVAA 1G3WA 3NEUA 1IRGA 3G73A 1Z05A 3CO6C 4NQWA 3Q9VA 2O03A 5D4RA 4JQFA 3F6VA 2COMA 5LGUA 1T2KA 3ABUA 1SMTA 3C18A 4KICA 5CVJA 3F6OA 2EFWA 1T38A 5HS7A 1W7PA 5HLHA 4GYIA 2EFNA 1ZLKA 2EFQA 4OIPF 2R7DA 4U7DA 3ZPLA 3J80K 2HS5A 4ZYDA 3ZP5A 4XRFA 2V1DA 2EJRA 1F1ZA 1FPQA 1D8KA 4FT8A 5J6XA 2KKOA 1F5TA 2V6CA 5LRSA 3T0YA 4EV0A 2EA2A 1LQ1A 2LF7A 2OZUA 2VBWA 1V3FA 4I0BA 4HV5A 3CTAA 1HW5A 1REPC 3ZMVA 5J8CA 4MQ9F 1BIAA 1OPCA 4ETSA 1DP7P 1Z6RA 5BPDA 2MLKA 5D8LB 3HUGA 1YW8A 2O3FA 5ICFA 3WTTC 2EV5A 5CVUA 3TO9A 4OINF 4XSXF 3QU6A 4I0AA 4EVIA 2QM3A 4RB1A 2O0YA 3VODA 2LF8A 5K5RA 2WC2A 3G3ZA 4EQQA 5EEGA 2RV8A 4U0VA 5KVRA 4CGZA 1Z1DA 3FMRA 3I64A 3KP7A 5IT3A 4RGXA 1U78A 1PDNC 4MEXF 3HHGA 3HHHA 2QBYB 3ZMTA 3IWFA 1LDJA 3IKVA 2Y48A 1UB9A 2EWNA 4XSZF 4K2EA 1P4XA 3HTUA 3BOQA 2HQNA 1F4KA 4EJOA 2HQRA
chains in the Genus database with same CATH superfamily
1ZGAA 3J7AO 3HDDA 1QO0D 5GAHJ 5F04A 2EFOA 4I7HA 1I27A 1A04A 2EZKA 3I71A 3LSPA 3E6DA 2NOJB 2DYSH 1K4TA 3QU3A 2F4MB 2ZO4A 5KAFC 2STWA 4DIQA 1H88C 2AQEA 2L3DA 4M6VA 3BP8A 3WODF 1UZCA 4KMUX 4U7BA 1MDMB 3ECOA 2FEZA 5DUIA 2VL8A 1XGSA 2ECBA 3GLLA 1OLTA 2FOKA 4XM3A 1FOXA 1GUUA 2BE5F 1Z9CA 2KDZA 2ESNA 4F91B 1IO2A 4IHVA 4HF1A 2GXGA 3EQLF 3SZTA 1R71A 2FD5A 2M2EA 3K6GA 3RZOJ 3K0LA 2CWEA 3CCJI 4BHBA 4G7HF 3BROA 2D1HA 3ZMZA 2V4JC 3EETA 1B8IB 2DMUA 2DK8A 1IRFA 3IRRA 2ZKZA 4AIDA 2HI3A 1I50J 1H8AC 1JGGA 1Y56A 2HPMA 1GVJA 2HOEA 3PQKA 2OF7A 3CJQB 2BY0A 2NVTJ 5F27A 5TISC 2VE9A 1FT9A 2L9SA 4X0GA 2XC7A 5DTDA 1IZ1A 1G4DA 2VB6A 4FASD 4H4KC 1OCPA 3E7LA 3G71I 3PIOF 2NVXJ 1QVTA 3C2BA 5HNHA 3DV8A 1WCMJ 1VQNI 2W24A 1BOBA 4ZDOA 4UB6C 2O8XA 2A69F 4CCKA 1XCBA 3ECHA 4KIFA 3VOEA 1VQ6I 3KZIC 1ZN2A 3R0AA 1CGPA 2VQCA 1SD7A 4CCNA 2E36A 3JTHA 4OWRB 2E2HJ 1IXCA 4FCYA 3QOEA 4TV7A 3TP3A 1N75A 5LHIA 3IH2A 1ZREA 1B59A 5ILVA 3JTGA 2JUCA 4LD5A 3KZYA 3DCFA 5L3DA 4HDVA 3WHBA 3WTVC 1O4XA 2ZJRF 2BY2A 4DW6A 3CUQB 2HTJA 3I5UA 5A2QK 3BY6A 3I0TA 2GIVA 1D0YA 2HYGD 2WTEA 3OR1C 2XV4S 3F8NA 4M9XA 1GDTA 3TDZC 3H0DA 3ONQA 1JT0A 4DQ2A 3I54A 4LOCA 1R22A 1K79A 3JAMZ 2IGKA 1Y8QB 3ZN0A 3QYEA 3LA3A 5FJ8J 3CESA 2KLOA 1FBUA 1B9NA 3F8MA 5CLSA 4A3MJ 1I1SA 2QENA 4RLQA 4HLYA 3Q0VA 2KDOA 4MTEA 3HBLA 3EUHA 4PJ0C 3GCMA 2NVQJ 1MBHA 1TWHJ 4R1HA 1FYMA 2IA1A 5H2FC 3KIOA 2UXXA 3CUQC 3SJMA 3CJNA 2OZ6A 2PJRB 2OBPA 5HDGA 2FBKA 4FX0A 3E97A 2CG4A 3DWLE 3FMQA 4RM2A 5K7HA 2DDBA 4BBSJ 4EM1A 3S16J 2CQ7A 2OV7A 3BR0A 2QUFA 2D2WA 3Q3SA 5D6FA 1Z6TA 1POGA 2ZFWA 2VOPA 3TMOA 4NQWB 1HDDC 3R0JA 3AG1H 2XAFA 2FQ3A 1BI2A 2JSPA 2F5CA 3KX2A 4ABZA 3MZHA 1EKEA 3WTXC 3K70D 1ZG5A 1LDDA 3GZNB 4HQEA 3GTLJ 1JHHA 3DBHB 2F48A 3OYCA 1X3UA 1KU3A 3KP6A 4KFCA 4WXHA 1YYVA 1LFUP 2IGNA 1Z67A 2QF7A 3BQYA 2M7BA 2NXNB 5IP6A 1TLHB 3KYCB 4BAYA 3W6KB 1W7PB 5HDKA 2LKXA 3VYTB 3LOCA 2CRGA 3Q9SA 3LA2A 4RAGA 4NB5A 1I3QJ 5BMZA 1Z7LA 3B73A 3KP3A 3R61A 4F55A 3H0GJ 3LSTA 2Y0SA 2AQFA 1IJWC 2JRMA 5C4JJ 1R49A 2BEOA 2FMLA 3Q0WA 2M0CA 1VFCA 2BOLA 1WJBA 1IW7F 1BI1A 3DPUA 2AO9A 2VKDA 1MH3A 2G7UA 2J5OA 4X6AJ 1YX3A 3TDUC 4RLFA 2Q2EB 5FLXK 1YJWI 2PLYA 3BC8A 1S7EA 3G1MA 3IUOA 1AOYA 3FF5A 4N9IA 3AG2H 4EEFG 5IYBJ 4IKFA 4Y33A 4A0ZA 4CXFA 5EEAA 2CGPA 3GYHX 3MMYB 2W82A 2ZCWA 2XGEA 4ENKA 4ZH4F 5ERIA 2M8GX 2VJJA 1K7AA 2BY3A 3P5JA 4BU2A 5K5QA 2Z1DA 2DMTA 3KYLA 4I09A 3GLXA 2PJPA 4HX4A 4EGZA 2LBFB 3ZQGA 3LNQA 3LAPA 5K5OA 4HBLA 4KISA 4JYKA 1WI3A 1SANA 2HR3A 3HUGB 4CHUA 3HRSA 1ETOA 3VSKA 3FXRA 1R58A 3B02A 3J7ZI 2CV1A 2V26A 1B72A 3AG4H 3ML6A 1O3QA 2EH3A 1YG2A 4PSXA 4BQNA 2NYXA 2X48A 3C1DA 3FKIJ 4BBRJ 1USSA 4PUSA 3GFMA 2AXLA 3LSJA 2VI6A 4NC7A 2Z2SB 3PSIA 1O3SA 1ODDA 1U9NA 2OA4A 3IHUA 4A3CJ 3H3VK 1G59A 3SZGA 3L9FA 4UV8A 1ZARA 1J09A 4DJAA 4AC0A 4UHTA 2RDPA 5IT9K 1FIPA 3V7CA 4CICA 4EJUA 1R23A 2HOTA 1R4NB 2VXDA 5EF6A 1Y6IA 4A3LJ 4ZZLA 3F21A 3GTJJ 1MJ9A 3D5LA 3HYIA 4EJTA 3KFWX 2OQGA 3GTQJ 1KU7A 4NUBA 4HDUA 1EH8A 2YUSA 3EPZA 1JUPA 1P9QC 5EG0B 2VN2A 3CCYA 2E1MB 3FXKA 3LSRA 3K1MA 3RIRA 4UUVA 4HW0A 3L09A 1WH7A 2E5NA 5HOOA 4QLCU 2HVRA 2YPRA 4S05A 2Y0SN 3NAUA 2X0LA 3ZN1A 3ZQHA 2RREA 5LD2C 3W6VA 5FD5A 3G1OA 3HOYJ 1T56A 1BR1A 4BNCA 1I5ZA 4CCOA 4II2A 5BQTA 3DBRB 1SC7A 2V1XA 4LK0F 4P55A 3ERED 4OU0A 2EA4A 2X6WA 3L2QA 3DPLC 5F0CA 1Z3YA 1QQIA 4M9SA 4RGSA 2QEXI 2VC0A 3V8LA 2XB5A 1SVLA 1HXDA 5J4YA 3R4KA 3P9KA 2DT7B 2Y9ZA 3J81K 1FMVA 1VNDA 1R1VA 3A02A 3WE3A 1BJZA 3IAS2 2EZIA 2XRLA 3V7SA 2RQQA 4UUTA 5CVIA 3DU6A 3RZDJ 2K4JA 2LFBA 2EIMH 2VBZA 4LK1F 2FE3A 1I3AA 3F9KA 3UKGA 2CMPA 3F8FA 4HV6A 3WE2A 3CCUI 3F3XA 2L4MA 1A6IA 1X1DA 3M8FA 1RUOA 1J9IA 2ICWG 1EF4A 4HSRA 3F23A 1MMGA 3N97A 2EFPA 4B44A 2M4KA 4E7KA 2IEKA 5K7ZA 3SZPA 1XGMA 2ELHA 2Q1ZB 3SDBA 3CDLA 2RGVA 3M1EA 4NHJA 3WU1B 1OFCX 4CCMA 2V7FA 3DEEA 1YJ9I 2XIGA 2IVMA 2L7MP 3I56I 1XMXA 2DODA 2P8TA 2VQHA 3ERMA 2K4BA 1XC5A 4XQFA 5BOXA 1H9TA 3BJ6A 2CO5A 2XROA 2ZB9A 4MLOA 4XRSG 5LFAA 4RB0A 4NC6A 1R5ID 1E0EA 5E3LA 1T0FA 2K9MA 3M8EA 3OY9A 4LG0B 2A07F 5FKOA 3K4BA 3QPLA 4YEJA 2MC3A 3HOZJ 2H8RA 3HPGA 4L5JA 1YTYA 3FDYA 4IJAA 2ZC2A 3FBNB 3WGGA 4ANJA 5KHDA 4I98B 2CFXA 4Y17A 1FYKA 1X2NA 4NC8A 3OYEA 1X58A 3WGHA 3ZMSA 2OTLI 4E7LA 2HDWA 2GA2A 4WF2A 1RR7A 1N78A 2MFZA 1QZYA 3F8BA 4IPAA 4E7IA 3I4MJ 2L9NA 1O7LA 4B4CA 4XR6A 5FO5A 1T39A 1OISA 2F4OB 1ZR2A 1W5CC 3M9AA 2DFEA 5J40A 2LTPA 3K4CA 4KA4A 3ZQLA 3BLYA 1MMNA 2NVUB 4BEHA 2HOAA 4BQQA 3RQ4A 4IVNA 3DLAA 4UUSB 3U21A 5KK1A 2FBIA 2IXSA 3BCAA 2P6SA 2OPTA 2QLZA 1UMQA 2NVYJ 1U6GA 2KJBA 4PCQA 4RGRA 1ITYA 4KN4X 2HZTA 4AVPA 4M3FA 3CCEI 4RB3C 1E3OC 1JKOC 3BG6A 5L3FA 2VBYA 1LB2A 4ZC3A 4WX9A 2A3SA 4GGGA 5HLIA 1MBJA 2RQPA 1ZAOA 4OIRF 1CF7B 3HSFA 2NNYA 1X1CA 2FRHA 3MZYA 3M07A 5LGTA 5D6EA 3H3ZA 1HKQA 2M8EA 2OUMA 1HA8A 1OCOH 2W4SA 3IAM2 3E6BA 4IEJA 1GT0C 3G6EI 5BNGA 1ON2A 4XIDA 3EYIA 2LNBA 4A3JJ 3FM5A 1SFEA 3VPRA 5AIPA 3F0CA 1Q1VA 4R8HA 3U1DA 1ETQA 3BTIA 2FBHA 3S3NA 4Q47A 2HNHA 2CUEA 2IS4A 2FXAA 4G6QA 3GBGA 5HDNA 4A0YA 2CV0A 2JA2A 5J47A 5B3SH 4XMYA 3X2QH 3LSIA 2XUBA 1UHSA 3EUHC 1YX5A 4L9VA 2L9RA 4EATA 4I6ZA 5J4VA 4BYYA 5GAGJ 4KUMA 3O3KA 5ED4A 4V2FA 4IL6C 2GOMA 3QYFA 4I01A 3F22A 5F1RA 4EGYA 1P4WA 3FHNA 1G8XA 2L2OA 2CFOA 1FBSA 2J5PA 4L9JA 5K7FA 1ZELA 2LMDA 2R7WA 1FLIA 3QOPA 2C6YA 1ZYRF 1SVMA 2L02A 1WJEA 4E70A 3S1MJ 1TWGJ 2YU3A 5CQEA 3IL2A 2ZJQF 2X9DA 3K9TA 2DXIA 5HLTA 2VXZA 2JPBA 1MGTA 2ZMEA 3V42A 4QTRA 1TL8A 3AG3H 4CDGA 1UG2A 4BXFA 4ZYGA 3WU0A 2E35A 3FZVA 4G94A 3S2WA 1FX7A 1YQAA 1I6XA 5LEKA 5JR3A 3GMEA 2CW0F 1OYYA 1W36C 3K4LA 2W48A 4CA0A 2FNAA 1IRXA 1AA7A 4LLNA 3Q0UA 1DPRA 4WXDA 4OMZA 5J1RA 1XTAA 2BXZA 3E5QA 2X1EA 4LB5A 2KIUA 4RS8A 4CYCA 3KCCA 5E3MA 1XPXA 1AHDP 3ZRGA 1TZLA 2DA6A 3DTIA 2GZWA 3JR9A 4P9FA 1FTTA 1ORKA 1P6RA 2DOAA 3OIOA 1HSJA 1YOVB 3H1CA 3QPHA 4PJMA 2ACJA 2QSHX 2R5ZB 3GO5A 3TOAA 3RDIA 2RAEA 2VT2A 3RCOA 3CDIA 3JRAA 4ZTJA 1B72B 4L0ZB 1ETKA 3VDXA 2XDVA 2KRCA 1B6AA 1X1BA 1A6QA 4XRMA 2HFHA 2WB1A 4BXUA 3LQRA 2CYYA 4Q48A 5EZGA 3TBIA 2CV2A 1E17A 2LKSA 2NS0A 1DDNA 2V9KA 3V8JA 4BE1A 3MKLA 5FROA 1IXRC 4EMSA 2W00A 1ZG3A 4XKWA 3E5XA 2H1LA 4YFNF 4BS9A 2QSGX 1XS9A 2MH9A 5JVTA 1JHFA 2MLGA 1ZHFA 4F93B 3TL4X 1D3YA 4C9YA 3IH3A 3OS2A 4LIUA 3CMAI 2P4WA 1FTZA 5ILSA 2LSOA 4IZZA 1S9HA 1APLC 2XAHA 2JZYA 2MABA 3I58A 5FLMJ 5BS6A 4DBRA 4XLNF 3J80Z 2DW4A 2JSCA 3JRBA 3EUAA 2X1CA 3DBLB 4KJZA 4YRVA 1XDSA 2DMNA 2BXYA 3M7GA 1DQUA 2LY2A 2LDUA 3W2VA 2DI3A 4M3EA 4AIJA 3W6JB 3JAMK 1K78A 1VQKI 4PJLA 2M45A 1JJ8C 3SEZA 2LD5A 5E3NA 3DXJF 4BQOA 4BDYA 1YITI 1WSUA 1H9GA 3CLOA 4A5NA 3CC2I 1YS6A 3HG9A 5JHUA 1HW2A 4AM3A 1OR7A 2QWWA 3FXUA 1YE9A 2M34A 3WG9A 2F5EA 3K4KA 2HWVA 3L00A 3D5RC 4FE4A 4B3XA 4EJWA 3PQJA 5L3CA 1GHCA 4DGWB 1LPQA 2GXBA 1E2XA 1N77A 4DYQA 1SFXA 4UVBA 3ZCOA 1LFPA 2JN6A 2V1NA 2R7FA 5D5UB 4XLFA 3FK6A 2QQBA 4A3BJ 4BY7J 2E19A 2OQRA 4IOCF 2N8GA 5IYCJ 1R7JA 3JRCA 3FWEA 2L7ZA 4GXOA 3S1QJ 5EGOA 3A01A 3M3YJ 1PVEA 2IAIA 1UHWA 5CJ9A 3JREA 3KP5A 2GOXB 1BL0A 3CC7I 4RAFA 2K86A 2DOEA 2JVGA 1MBKA 4GRIA 4IRGA 3CD6I 5D8KB 1MBFA 5LEJA 1R4MB 5TGTA 4ZTFA 3ZQ7A 5EEHA 3ABKH 2PMZA 2WADA 4F3QA 1XB4A 2A61A 2WB1N 3E3VA 4UNOA 2HYFA 3OYNA 1I1GA 4L5IA 2W85A 4YIFA 5JI6A 1K6OA 4H0EA 2ZJ2A 2VIXA 3I3LA 3TP0A 2VKEA 3R60A 4IHSA 1G3TA 3KETA 3MVPA 2YU9J 2DT6A 2DA3A 2STTA 5J8FA 3RYPA 4RBOA 2K7LA 4EJVA 2Z9OA 2QKLB 1JGSA 4IO9F 1G6NA 2X6XA 3HRTA 3E6CC 4BY1J 2JVHA 1XSDA 4Z2YA 5FFXA 5F08A 1G3YA 2LOOA 4A3IJ 2D45A 3CDHA 2IPQX 1O3TA 4Y52J 4PK4A 5IOZA 2HQ5A 4N9HA 4ZDPA 4U0WA 3UNGC 1LUJB 3IC7A 2JJ7A 3FXQA 3I59B 4IQJA 1B1BA 2HGCA 2I10A 2ZXHA 4ZYHA 5LGNA 2HKOA 4ON0A 3L1PA 4UY8I 2HQAA 3T8TA 1TW2A 1QPIA 3M4OJ 4F7ZA 3M8JA 1T0FC 3LSHA 2B63J 5JLWA 3BJOA 5B66C 1KU2A 3IKTA 1ETVA 1V55H 3LQQA 4KMFA 3KLNA 2QVOA 4XLEA 1FOKA 2L5QA 3BTLA 4QPQA 1XGNA 4ESJA 3VYUB 2H09A 3CZ6A 3OYKA 5KAIC 5FFZA 2XKPA 4IHYA 5M5WJ 1BOAA 3UR3C 2DA1A 4YIIA 2BY1A 2VODA 4HAMA 3MZ8A 3OYAA 1YO5C 1J0RA 3RPUD 1K83J 2DO7A 3ROUA 2PFBA 2L7KA 2BGCA 3K1PA 2OJED 3GZ6A 1WPKA 3MKWB 1TNTA 2IW5A 4WWCA 1LEBA 1TQIA 2R7RA 2P5LC 4XORA 1ZG1A 2M7AA 2HEOA 3CJRB 3LA7A 2Z3YA 3BG3A 4HOBA 3OL3A 3P9IA 1QA6A 3ABTA 3G1LA 1XMKA 3LFKA 4A0XA 2EIJH 4Q4ZF 5JHFA 3ELKA 3PM1A 2JRTA 3GTKJ 2DTZA 3K4JA 3ZOBA 3A0HC 4PDKA 2PBIA 4J19A 2E1NA 1WFXA 4O3MA 1XX5A 3S8PA 2ZSIB 1LFBA 1HW1A 2VONA 1VQ7I 1UJ8A 1UCRA 1SD4A 3S2DJ 4RAYA 3O8GA 3FXMA 2BHYA 4E4HA 3LFUA 1MMAA 2V1UA 1KGSA 4M6YA 1FEXA 4IXAA 4ENMA 2B9SA 3PNTA 1MSFC 2XPUA 3V8KA 1P92A 4AIKA 4RA2A 4XNFA 4Y13A 2ZXWH 2K3PA 3NQOA 4S04A 4HX8A 1KZHA 1IN4A 4IHTA 1TP4A 1VF9A 1YRNA 4I99C 1XSVA 2WBMA 1P4AA 1U0JA 5H6RA 5L3EA 5DUKA 2A68F 1F9NA 2KRHA 2YS9A 3E5UA 4E6KG 3H36A 4ASNA 3PNVA 4A3FJ 3C2GA 1Z91A 1O57A 4MQVA 5FRNA 2FU4A 1ZH5A 2K5CA 2K85A 5TJJA 1IN7A 3D5SC 3S2HJ 5DS9A 3PIPF 1X2MA 1IC8A 3HRUA 3QYBA 4EM0B 3ABMH 2ZXIA 3BR2A 1EA3A 3P9CA 4FETA 3TGNA 4W97A 2OCCH 5F0FA 2CW8A 3QP5A 2AHQA 2ZMEB 3REOA 2JA6J 5CVVA 4DZPA 1FBQA 4A6EA 4IOAF 1J2XA 2L54A 4I2OA 2PI0A 4MHGA 3PSFA 2L4AA 4CZCA 4E7JA 3Q5FA 2GAUA 1XD7A 3ASNH 4ESFA 3MKYB 4D9JA 1ZGWA 3VYSB 2Q0OA 4AYBA 4B8XA 3N05A 1YHQI 1FJLA 1MZBA 1HLVA 3PFYA 1SAUA 1XGOA 3ZQIA 3H35A 3JSPA 4S0HB 4RGUA 2DTRA 1TWAJ 1VZ0A 4MFEA 4E7HA 2NNNA 2UUZA 1IF1A 1DP3A 4D5FA 2TCTA 1T33A 3BR1A 2IGOA 3TO7A 2O9LA 2ZMEC 1W5TA 3LSMA 1J75A 2RVCA 1XMAA 2GIZA 2V79A 3GEZA 2IA2A 2A6EF 2ZFUA 3BQZA 4HYEA 1K61A 3GTOJ 1X4OA 1W7PD 5FD6A 3TQNA 2FMYA 4R79A 5FLVA 4G6DA 1NHAA 1GXPA 1W4MA 1IXSB 1TQMA 2WAQA 4U88A 4LLGF 5CQGA 3TEDA 5HS8A 3QPTA 2KZVA 4BHPA 4B43A 3WHCA 4LMYA 2XPVA 3JRIA 3A03A 2ETHA 3HIFA 2ME0A 1MNEA 3OV8A 3IRQA 1YFHA 1PUFA 2EV6A 1W1WE 2DPUA 2M4GA 3BR5A 2P0WA 3EDPA 3KZZA 2VBXA 1BR4A 2HVSA 2DFIA 2YR2A 3QP6A 5EDNA 4HF2A 4LFUA 1STZA 4LITA 1S5LC 2VUMJ 2HZDA 2EIKH 1ETXA 1BI3A 4QSHA 5C44J 2ELKA 3O2PE 1IUFA 1B9MA 2X1DA 3SHFA 4CYDA 1IN5A 2W84A 3L2VA 5CPRB 1HQCA 3ISPA 5FLXZ 1NTCA 1WJAA 2WY7Q 3HKZA 2DFHA 2W57A 1BBYA 3K2AA 4B48A 3GW2A 4CCJA 1RI7A 3OIQA 3L2UA 4HA8A 3OYGA 3HOXJ 1K78B 1JE8A 1RR8C 1TT5B 2DLLA 3NRVA 5F6FA 2NS8A 1O7FA 4MNUA 3WTYC 2JPCA 1BI0A 1HDPA 3BWGA 4FISA 4LG3A 4BHCA 1U3EM 1VQOI 2A6TA 1ERDA 2HXOA 3CC4I 4BJ5C 2X4HA 4BE0A 1LDKB 2L9VA 1GXQA 1DPUA 3W2AA 2XAUA 2XAJA 4JOMA 3BZCA 2G0EA 2MA3A 4N4NB 3J7AY 3I55I 4G8XA 2VJIA 2H27A 4AYBN 2XAGA 1JUSA 1VQPI 2COBA 1UHMA 2CUFA 3MCZA 2E1CA 4AUXA 2BW3A 2ZBKA 1A31A 5H20A 5AIQA 3ZMUA 1LKXA 4CO8A 5EGOB 2R4GA 5DYMA 4ESBA 3A01B 1J59A 2LC2A 4CH7A 1FP1D 5E8GA 1KU9A 2M5WA 1QZEA 4UXNA 2IBDA 2XGXA 4HEA2 3K69A 3T1BA 2ISZA 2KIMA 1LEAA 2XKOA 4C30A 1S72I 3OR2C 3G2BA 5CKTA 2HU9A 1OR7C 1ZTRA 4HX7A 4FQGA 1SAXA 5IT9Z 1UFMA 2XASA 2LYCA 4F52A 1T08B 4L5EA 2Z5UA 1Q1HA 4LLLA 2VQLA 3LWFA 5DEQA 1UELB 4BL0B 2DAOA 5F64A 2NRAC 3DFGA 3NWTA 5DD8A 4B3AA 4G6TB 4BKXA 4E7ZA 4HPQA 1MJAA 3OWTA 3JRHA 1R36A 1KONA 1W5SA 2NS7A 2A05A 4A3EJ 3EUKL 4XOPA 2M1BA 4F92B 3IH4A 1J7KA 1EJ9A 2X85A 5E8IA 5J3LA 4QIWN 1T6SA 1JKQC 1KQ0A 1XN7A 1MNMC 3LSKA 1WKMA 1WJCA 4XOTA 2YX4A 3BG9A 3HZJA 3CMYA 4PGGA 4CUGA 3HL2A 4M3GA 1X3ZB 5L3BA 3CCQI 4D5CA 2HYJA 1SEUA 1T95A 1X1PA 1RZ4A 4P1WA 2H6BA 3H5RA 5H6QA 2L01A 3RKWA 3HKZN 2Y0MA 4J00A 3O6BB 4G7OF 1FIAA 1D0ZA 2CS3A 3HEFA 1OCRH 5IPAA 2VLAA 4ZDLA 4D1QA 3J81Z 4HNTA 1PP8F 1IGNA 3C2HA 1NG7A 2JA5J 1S29A 4QWQA 2E1OA 2VJ5A 1D8JA 2M0MA 3RTRA 3COAC 2CQNA 1QNTA 2DYRH 3K7AJ 4M6XA 1BM9A 5KNLA 1ZRFA 3L2CA 1IDZA 3I9V2 1L3LA 4BQAA 1ZK8A 3GUDA 3QWLA 2DQRA 4MTDA 1Y1WJ 1IRZA 3SFZA 2E7WA 2P5KA 3HGYA 2MD0A 1H0MA 4M71A 1Z3XA 2IS1A 2RC4A 3D0SA 3HSEA 1VQ8I 1D1CA 2IP2A 1NK3P 3D1NI 1RKTA 1BW5A 4LJZF 1XCVA 1OCCH 3DTEA 1FP2A 5E1XA 4HLXA 2WV1A 4L9TA 1X4PA 1RNLA 3ZMDA 4BXXJ 3T5XA 3OSFA 5D5VB 2X6OA 2XB0X 3CUOA 3QAHA 4UVAA 2L0KA 3HB9A 5JFRA 1TW3A 2PMUA 1YS7A 4PFOA 1YIOA 3TKYA 2MYSA 5ICCA 5ICGA 1ZGJA 2IRFG 5K1YA 4C3HJ 1TQPA 3OSGA 3FXLA 2Q8KA 2E5ZA 1EV7A 2E2IJ 4M9ZA 2ZXJA 2O8KA 3F72A 1ZLJA 2DMPA 3S15J 5CVRA 5IOYA 4XONA 3A4CA 2OTJI 1XG1A 1UAAA 3RKYA 1A36A 2Q2EA 3HPHA 2B0LA 2KHMA 2JK3A 2VC1A 3GZ5A 2WY8Q 1W0UA 2R93J 1RESA 2AXTC 4FX4A 1YRNB 2ECCA 3K4MA 4CZZA 3SQNA 3WGIA 1U2WA 2D5VA 5LBQA 1MIJA 3MFKA 2QQAA 2P7CB 1IV8A 5HNFA 1MH4A 3E6MA 3KP4A 1LE8A 1FYLA 2QA4I 1CQTA 1OQYA 2MD5A 1JT6A 4WXCA 2P5VA 1PP7U 4HRIA 3WTSC 3GTGJ 1QHHD 2A5YB 2EZLA 2HKXA 1RKWA 3TOBA 2W7NA 1R9TJ 3S14J 1HC8A 1Y0UA 1JKRC 3FHZA 2W1OA 3DQVC 1NH3A 3F8CA 1BA5A 2TRTA 4DOZA 2UWMA 5GPCA 1MW7A 5FB2A 4C3JJ 4QPOA 5CYVA 2ZNYA 2G7HA 1D1AA 3A2KA 4XKCA 5LLQA 3RKXA 1VQ4I 3P7NA 2LKPA 1MMSA 3ULQB 2MBFA 1DU6A 4M74A 2CUJA 1ZRCA 1DGWY 3ZR8X 1EH7A 1S8NA 1HKTA 1LVAA 3K1NA 4ZZDA 1WJDA 4AIHA 1BC7C 1FY7A 4P96A 4LB6B 4YG2F 2DJIA 3OS0A 1DUXC 3HM5A 1LVKA 3V7RA 1BC8C 2LY1A 3GTPJ 2E34A 2KP6A 2IGMA 4HG2A 4JK1X 2CSOA 2LLKA 3U9GA 1X19A 5FKMA 3JRFA 2LH9A 3MQ0A 3B6CA 1M1EB 2M87A 4FTHA 2R7TA 2FOWA 2K02A 1F36A 4D7NA 1R1UA 2ISYA 4BACA 5IP9J 5HODA 1YLFA 3CLQA 1VQ5I 2VKVA 1W36D 4CSWA 3H3UA 4MO7A 3WG7H 2IT0A 2BV6A 2DU9A 1IUYA 4NBQA 4OIQF 2K9NA 2QSFX 4PZJA 1ZR4A 3AL0B 1DU0A 1FZPB 1FMWA 1S6LA 2PX9A 3CCSI 1OKRA 3BG7A 3RPQA 3I4NJ 1ETYA 4IRIA 1KQ8A 3IV5A 5E18F 4U0YA 3HOTA 3OL4A 3MEXA 4MFDA 5E3OA 3H92A 3U1KA 5D4SA 3TW7A 1HCRA 3VFZA 1ETWA 3OYMA 2P7VB 5LRRA 4IQ4A 4A5MA 2PEXA 2Z16A 3QPSA 3WTZA 2DA4A 1VTNC 1YW9A 1Z0XA 4Z6YA 4KIGA 2ID3A 1XSXA 2KIFA 3N4MA 1D5YA 2RNJA 3PO3J 2LG4A 1U9OA 1ZKGA 3BTCA 1Z7UA 1S7AA 3EYYA 2EINH 3AL0C 2P81A 2OCEA 3KLOA 1U8BA 3MKZA 1FSHA 1JI8A 2HOSA 2RNGA 2ELJA 1HSTA 5M3FJ 1ONVA 4UB8C 3OYDA 2OD5A 3CP8A 4YELA 1J5YA 3BG5A 4JX6A 2GWRA 2KIQA 2BVLA 4D7MA 1ULYA 1TT0A 1JUMA 4CCLA 4C2UA 1ENHA 1RIOH 2LY9A 4OAZA 1OCTC 1B4AA 3KP2A 3MN2A 3HTSB 3J7YJ 3B6AA 2GA1A 3L7WA 2R0QC 3H9GA 4NNJA 1HKSA 5JVGF 3S3MA 2R7XA 2P6TA 4XL9A 4DBQA 2BW3B 2VOOA 1R5GA 3FIWA 1Y0NA 3DPTA 4OIOF 2Y31A 3LMMA 4LG0A 4ZYEA 2FQ4A 4KIBA 4WCGA 5BPIA 2ZNZA 4M72A 1WRJA 3CJTB 2VKHA 5F0HA 4XKBA 4ZYAA 1RUNA 2GQQA 1L0OC 1JTXA 3DKYA 3LSGA 1V5EA 4LGWA 1WI9A 1U5TA 3W3CA 3RI4A 2LK2A 3QRFF 4XLHA 1FSEA 5DCMA 2IS2A 1R5HA 5E79C 2DJNA 4KN7X 3LAJA 2HPIA 3DEWA 2OAZA 2QKMB 1VI0A 3DKXA 1WQ2A 3BJAA 3BZ6A 1F43A 1FNNA 1YW7A 3CCLI 1YJNI 5C4XJ 2VQGA 4DZJA 2IS6A 4BEHB 3K70C 4UUSA 4Q5SF 2CQKA 4MEYF 3DTKA 3KEYA 1BN5A 1PYVA 3WTWC 1PUEE 2QZ8A 1VQLI 3KPHA 5DM7F 2JWTA 3AKZA 3ZQFA 1SD5A 2KJCA 4RB2C 3CF2A 3VWBA 3PJRA 3S3OA 3ZXSA 2A6HF 4Y3OA 4KYWA 4BGDA 2CQQA 4MGRA 2X6YA 4KDPA 5TRDA 2G9WA 2MC4A 1D5VA 2KZGA 5FRMA 3OYBA 4G12A 4N4OB 3KEOA 4YFKF 2O61A 1CF7A 1ACIA 1Y1VJ 4KT5C 2F2EA 5GP9A 2VPLA 5J1YA 4DNCA 4Y4RA 3VB2A 3QQAA 1BIBA 2V9PA 3PL8A 2BYVE 2DPDA 2K27A 2Y9YA 1W0TA 1PJRA 1P7JA 2QQ8A 4M73A 2I5UA 5EJCA 1RPWA 1MD0A 4P9UA 1IN8A 4HSTA 2MGQA 2PN6A 4J01A 1G3SA 5FKKA 2BHZA 3W2WA 4A2UA 1S7OA 3TW6A 4GDFA 2PMZN 3BZKA 3OYFA 3CF5F 3PFIA 4U87A 2K3FA 3K2ZA 2EB7A 2EPFA 1G2HA 3HSRA 2GM4A 3RYRA 3CMMA 2IA0A 4JX5A 3FBIB 4GYGA 2EV0A 3HRMA 4ENJA 1GV5A 2MW8A 1WJFA 3ZQQA 1KYWA 3VEPA 3FX3A 3U2RA 2ESHA 3C3WA 2OU2A 1VQMI 3HC7A 1JXSA 2DBBA 5IP7J 3OS1A 4XK4A 2UXNA 1WHUA 1EH6A 1AKHA 3C7JA 1GLNA 4YFXF 2CQXA 3NWSA 5B1BH 5E1WA 4PGHA 2KT0A 3MWMA 4EM2A 3AAFA 2JA8J 1Z77A 4L18B 4II3A 5HVQC 1E3HA 1GV2A 4D0PA 1OYWA 9ANTA 1QBJA 3BT9A 4XBFA 2D1VA 2PG4A 5M5XJ 5A2QZ 2FUG2 3PUFA 3S93A 3G4SI 5B1AH 2HVQA 2F5DA 3GFLA 3H5NA 3TO6A 2GLOA 1QHGA 5DD4A 3HOSA 2R7SA 3S32A 2ME6A 3OMYA 2F5FA 4XKVA 2F6CA 1TNSA 3NARA 4OOIA 4AWXB 1S3JA 2DMQA 3GWZA 5HS9A 2O6GE 4AD9A 4O5VA 1FC3A 1GVDA 3BDDA 3A0BC 4GO1A 1LE8B 5EZHA 2FNPA 1H89C 2IJLA 2XGCA 3ASOH 2Z33A 3GFJA 2ZJPF 3FK7A 4A3KJ 4A12A 4P5OA 2EK5A 4ENNA 2DCEA 4CYCB 1Y39A 2KFDA 3CMEI 4C3IJ 3LL7A 1KQ9A 2E71A 3GXOA 5F1JA 1IN6A 3DP7A 3RKQA 3ZGKA 2R5ZA 3KEQA 4LIVA 2AS5F 5GPAA 4N0BA 2XRNA 3T8RA 2H6CA 1E3PA 4G7ZF 1HOMA 4MIMA 1RETA 4UV9A 5ILUA 1K4SA 3BR6A 4KITB 1U8RA 6PAXA 3RQIA 3SDGA 1QU3A 1AWCA 2Y75A 2I8DA 4IHWA 2CH0A 3I4PA 1MKMA 2VE8A 4XLCA 1BJAA 1FWZA 1LNWA 3BPVA 2EZHA 2LRDA 2RN7A 4KT6A 2XSDC 1OYIA 2DT5A 2CUZA 1MJBA 1R1TA 3H9JA 2W25A 4GCVA 4I02A 3FISA 2JTVA 3GF2A 2QBYA 2R5YA 5E1ZB 2DA7A 3RSNA 3SEQA 5J1UA 2DFFA 2HTSA 4V2GA 2VJ4A 5M5YJ 2V9VA 3BPXA 2K9SA 1R00A 5LHGA 1X1AA 2H8WA 2DA2A 3FMSA 3HXLA 2L7FP 1MBGA 2BZTA 2DK5A 1TWCJ 3BR3A 2K9LA 1QVUA 3OOUA 4M3DA 2HDCA 5IYDJ 5GAEJ 2XSJC 3FKJA 3SXYA 3VYRB 1XDUA 1SD6A 4A69C 5B5EC 5L3GA 1ZRDA 2XHKA 4XN0A 4DYCA 4G9YA 3DF8A 4L9NA 1OJLA 3OYHA 5FGMA 2JQ7A 1MNDA 1KA8A 2NAZA 3L2RA 2XAQA 4BH9A 2R3SA 1USTA 4AVZA 5DV5A 1MDMA 2PQ8A 1A35A 2CJJA 3ZQCA 4IHXA 2LP0A 1QGPA 5AONA 2R7UA 3CCRI 2H1KA 3KE2A 3FM3A 2MH2A 1BR2A 4HF0A 2Y30A 5IY5H 2H94A 5D5XB 1FOYA 2VT3A 2WWYA 2E1MC 4UVCA 1MMDA 1HBXG 1JTYA 2KQRA 4B1RA 4HQMA 1JJ6C 2JMWA 1B8IA 4X1EA 3HOVJ 4WK8F 3E0JB 2ID6A 1SMYF 4L0YB 1QPMA 3WTUC 2QYOA 2WV0A 3RPUA 2R7OA 5HLGA 5GTIC 3DLLF 2LVSA 2E7XA 4DYRA 2MG4A 2QQ9A 3OYLA 2R7ZJ 5DM6F 2HDDA 2KRFA 2FA5A 1UG0A 5E17F 1P7IA 3V4GA 1RRJA 4XN3A 3MAJA 1WWXA 1SFOJ 4RDUA 2V6EA 2DQLA 3K4NA 4JBAA 2KL4A 1O3RA 3MD2A 1R6RA 2RKHA 1TTYA 2YSRA 2JT1A 3BTJA 2XPWA 1IG7A 2WAEA 3S1NJ 3OOPA 4KNYA 3JRDA 1P2FA 4XICA 2ADUA 4OAYA 1LJ9A 1Z21A 3IP4B 4FE7A 3FXJA 4RM3A 3PNYA 5FKNA 4BE2A 4I76A 5ICEA 3GFIA 4W1UA 3JW4A 1TBXA 1OCZH 2BVMA 2WAQN 3HJEA 3DEUA 4A3GJ 4IX7A 1T8IA 5M3MJ 3DKWA 3RJPA 5DDGA 1WGXA 2XF7A 4OMYA 2FX0A 2VPRA 3OIPA 4JX4A 2WA0A 4A93J 3CUQA 4B09A 3IWZA 2M30A 4RAZA 3S1RJ 1C0WA 3CCVI 1QZZA 1U5TB 1ON1A 2UZKA 2M3AA 2XF5A 5DCFA 5DCMB 3I59A 4IF4A 5KCMA 5E20A 3GX4X 4ITVA 2XGDA 3CP2A 4BUPA 4Y15A 2PMHA 2DN0A 2BBYA 3M1CA 1SFUA 1V4RA 4IRHA 4ZJZA 1KYZA 3JSOA 2FF4A 1Y8RB 2CW7A 2YX7A 2JUGA 3CO7C 1NK2P 1TWFJ 1IDYA 5LHHA 4A3DJ 2NOGA 2FSWA 2TDXA 2XVCA 1OMIA 3I53A 4HZFA 1IAWA 4FHTA 3CQZJ 1V54H 2WAFA 4O6JA 5D5WB 4PFPA 3ABLH 4C2MJ 2PJRA 3QODA 1U5TC 3WU2C 3R6SA 4XLPF 3SYTA 3KYDB 1SVOA 4A6DA 1K6YA 1T98A 2MSYA 1RC9A 4XRSA 2Z99A 4PJJA 3GVAA 1G3WA 3NEUA 1IRGA 1WZ2A 3G73A 1Z05A 3CO6C 2K9QA 4NQWA 2O5RA 3Q9VA 4XLAA 5C3EJ 2O03A 5D4RA 4JQFA 2CU7A 3F6VA 2COMA 5LGUA 1T2KA 1WJ5A 3ABUA 4V19K 1SMTA 3C18A 2UV1A 3VSLA 4KICA 3JCUC 5CVJA 2QGUA 3F6OA 2EFWA 1MBEA 1T38A 4RMNA 5HS7A 1W7PA 3H9QA 5HLHA 4GYIA 1NG6A 1YI2I 1VQ9I 2EFNA 2B7EA 2O7OA 4M3BA 2Y69H 1SFKA 1ZLKA 1I6HJ 3JRGA 2EFQA 2GBYA 5EYRA 2E60A 4PSWA 4OIPF 3BCBA 1HF0A 2R7DA 4BJTA 4U7DA 3ZPLA 1DGRM 2EBIA 2EILH 3J80K 2HS5A 2FJ1A 4ZYDA 1IV6A 3ZP5A 2HXIA 4XRFA 1AKHB 3O8HA 2V1DA 3DU5A 2EJRA 3H5AA 1F1ZA 3ESWB 1FPQA 3HOUJ 1D8KA 2A5WA 4FT8A 5J6XA 2KKOA 1F5TA 2V6CA 2X51A 5LRSA 2LREA 3T0YA 4EV0A 4Y7NJ 2KISA 2EA2A 1LQ1A 2LF7A 1N25A 2OZUA 1A5JA 2VBWA 1V3FA 4I0BA 4HV5A 2OC6A 3CTAA 3SFIA 1MSEC 1HW5A 1FOWA 1REPC 3ZMVA 3FXOA 5J8CA 4MQ9F 5JLXA 2LR8A 1BIAA 1OPCA 2DA5A 4ETSA 1DP7P 1Z6RA 3A1YA 1V5GA 2LBFA 5BPDA 3OYJA 2MLKA 5D8LB 3S17J 4BJ6C 3HUGA 2E2JJ 1ZQ3P 1YW8A 5GTHC 4GFBA 3PUBA 2O3FA 4YIRX 2Y2ZA 5ICFA 1D0XA 3WTTC 2JA7J 1D1BA 2EV5A 1JKPC 5CVUA 2KPMA 2DDAA 3TO9A 4NDLA 3PO2J 3CCMI 4OINF 4XSXF 3QU6A 3OYIA 3E1SA 1YIJI 4I0AA 2R7VA 2QCOA 4AU7A 4EVIA 2QM3A 1V5FA 3HGGA 4RB1A 2O0YA 3VODA 4BDZA 2LF8A 4JP0A 5K5RA 2WC2A 2R7QA 3G3ZA 5GADJ 3GTMJ 3L2WA 4EQQA 2R92J 4PJNA 2F4IA 2M9HA 3HOWJ 5EEGA 2RV8A 2DOFA 2KMUA 1WH5A 2VASA 4U0VA 5EG0A 5KVRA 1I39A 4CGZA 1Z1DA 3FMRA 1WVRA 3I64A 4HNUA 3KP7A 5IT3A 4RGXA 4C2TA 1U78A 1PDNC 1QRYA 4HNVA 4MEXF 1TC3C 3HHGA 3AFHA 3HHHA 2R5YB 2QBYB 3ZMTA 3IWFA 1LDJA 3IKVA 1BW6A 2Y48A 2GXAA 1UB9A 1PUFB 4E7SA 2K40A 2EWNA 4XSZF 5FKLA 4K2EA 1P4XA 3HTUA 3BOQA 2HQNA 2ZSHB 1F4KA 1X3WB 1AU7A 2XF6A 4B47A 4EJOA 2F5VA 2EQRA 3K10A 2HQRA
chains in the Genus database with same CATH topology
1ZGAA 3J7AO 1QO0D 2EFOA 4I7HA 1I27A 1A04A 3I71A 3E6DA 3QU3A 2ZO4A 2STWA 2L3DA 3BP8A 3WODF 4KMUX 4U7BA 1MDMB 3ECOA 2FEZA 5DUIA 1XGSA 2FOKA 2BE5F 1Z9CA 2ESNA 4HF1A 2GXGA 3EQLF 3SZTA 3K0LA 2CWEA 4BHBA 4G7HF 3BROA 2D1HA 3ZMZA 3EETA 2DK8A 1IRFA 3IRRA 2ZKZA 1GVJA 2HOEA 3PQKA 2VE9A 1FT9A 1IZ1A 1G4DA 3DV8A 2W24A 2O8XA 2A69F 1XCBA 3ECHA 4KIFA 3VOEA 1ZN2A 3R0AA 1CGPA 1SD7A 3JTHA 1IXCA 4TV7A 5LHIA 1ZREA 1B59A 5ILVA 3JTGA 4LD5A 3KZYA 5L3DA 4HDVA 3WTVC 3CUQB 2HTJA 3I5UA 5A2QK 3BY6A 3I0TA 2GIVA 2HYGD 2WTEA 2XV4S 3F8NA 4M9XA 3TDZC 4DQ2A 3I54A 1K79A 1R22A 3JAMZ 3ZN0A 3LA3A 1FBUA 1B9NA 3F8MA 5CLSA 1I1SA 2QENA 4HLYA 4MTEA 3EUHA 4R1HA 1FYMA 2IA1A 2UXXA 3CUQC 3CJNA 2OZ6A 2OBPA 5HDGA 2FBKA 4FX0A 3E97A 2CG4A 3FMQA 4EM1A 2QUFA 2D2WA 5D6FA 1Z6TA 2ZFWA 2VOPA 3R0JA 2XAFA 2FQ3A 1BI2A 2F5CA 3MZHA 3WTXC 1ZG5A 1LDDA 4HQEA 1JHHA 1X3UA 1KU3A 3KP6A 4KFCA 4WXHA 1YYVA 1TLHB 4BAYA 3W6KB 1W7PB 5HDKA 3Q9SA 3LA2A 4NB5A 5BMZA 3B73A 3KP3A 3R61A 3LSTA 2BEOA 2FMLA 1IW7F 1BI1A 2G7UA 2J5OA 3TDUC 5FLXK 2PLYA 1AOYA 3FF5A 4N9IA 4A0ZA 4CXFA 2CGPA 3GYHX 2ZCWA 4ENKA 4ZH4F 5ERIA 1K7AA 5K5QA 4I09A 3GLXA 2PJPA 4HX4A 4EGZA 3LAPA 5K5OA 4HBLA 2HR3A 4CHUA 3HRSA 3FXRA 1R58A 3B02A 1O3QA 3ML6A 1YG2A 2NYXA 3C1DA 1USSA 3GFMA 2AXLA 1O3SA 1ODDA 2OA4A 3IHUA 3L9FA 4UV8A 1ZARA 4UHTA 2RDPA 5IT9K 3V7CA 4CICA 4EJUA 1R23A 4ZZLA 3F21A 1MJ9A 3D5LA 3HYIA 4EJTA 3KFWX 2OQGA 1KU7A 4HDUA 1EH8A 2VN2A 3K1MA 3RIRA 4UUVA 4HW0A 3L09A 5HOOA 4QLCU 2YPRA 4S05A 2X0LA 3ZN1A 5FD5A 4BNCA 1I5ZA 5BQTA 2V1XA 4LK0F 4P55A 3ERED 4OU0A 2EA4A 3DPLC 4M9SA 1QQIA 4RGSA 2VC0A 3V8LA 1HXDA 3R4KA 3P9KA 3J81K 1R1VA 3WE3A 3V7SA 5CVIA 2K4JA 2VBZA 4LK1F 2FE3A 3F8FA 4HV6A 3WE2A 3F3XA 2L4MA 1J9IA 3M8FA 1RUOA 3F23A 3N97A 2EFPA 3SZPA 1XGMA 2ELHA 2RGVA 3M1EA 4NHJA 3WU1B 2XIGA 2IVMA 2P8TA 2K4BA 5BOXA 1H9TA 3BJ6A 2CO5A 2XROA 4RB0A 1T0FA 3M8EA 4LG0B 2A07F 2MC3A 4L5JA 1YTYA 4IJAA 3WGGA 4I98B 2CFXA 4Y17A 1FYKA 3WGHA 3ZMSA 2GA2A 4WF2A 1QZYA 3F8BA 4IPAA 1O7LA 5FO5A 1T39A 3M9AA 4KA4A 4IVNA 5KK1A 2FBIA 2P6SA 2QLZA 1U6GA 2KJBA 4PCQA 4RGRA 4KN4X 2HZTA 4AVPA 4RB3C 5L3FA 2VBYA 1LB2A 4WX9A 2A3SA 4GGGA 5HLIA 2RQPA 1ZAOA 4OIRF 1CF7B 3HSFA 2NNYA 2FRHA 3MZYA 5LGTA 5D6EA 3H3ZA 1HKQA 2M8EA 3E6BA 1ON2A 3EYIA 2LNBA 3FM5A 1SFEA 5AIPA 4R8HA 3U1DA 2FBHA 4Q47A 2FXAA 4G6QA 5HDNA 4A0YA 2XUBA 4L9VA 4BYYA 4KUMA 3O3KA 5ED4A 4I01A 3F22A 5F1RA 4EGYA 1P4WA 1FBSA 2J5PA 4L9JA 1FLIA 3QOPA 2C6YA 1ZYRF 2L02A 4E70A 2YU3A 3IL2A 3K9TA 2VXZA 2JPBA 1MGTA 2ZMEA 4CDGA 4ZYGA 3WU0A 3FZVA 4G94A 3S2WA 1FX7A 1YQAA 1I6XA 5LEKA 5JR3A 2CW0F 1OYYA 2FNAA 4LLNA 4WXDA 1DPRA 4OMZA 3E5QA 4LB5A 2KIUA 4RS8A 3KCCA 2GZWA 4P9FA 1P6RA 1HSJA 3QPHA 2ACJA 3TOAA 3GO5A 3RDIA 2VT2A 4L0ZB 1B6AA 2HFHA 4BXUA 3LQRA 2CYYA 4Q48A 1E17A 2NS0A 1DDNA 3V8JA 1IXRC 4EMSA 1ZG3A 3E5XA 4YFNF 2MH9A 5JVTA 1JHFA 2MLGA 1ZHFA 1D3YA 2P4WA 5ILSA 2LSOA 2XAHA 2JZYA 3I58A 5BS6A 4XLNF 3J80Z 2DW4A 2JSCA 1XDSA 3M7GA 2LDUA 2DI3A 4AIJA 3W6JB 3JAMK 1K78A 2M45A 1WSUA 3DXJF 1H9GA 3CLOA 4A5NA 1YS6A 5JHUA 1HW2A 1OR7A 2QWWA 3FXUA 3WG9A 2F5EA 2HWVA 5L3CA 3L00A 4EJWA 1GHCA 3PQJA 2GXBA 1E2XA 1SFXA 4UVBA 2R7FA 5D5UB 2QQBA 2OQRA 1R7JA 3FWEA 4GXOA 1UHWA 5CJ9A 3KP5A 2K86A 4IRGA 5D8KB 5LEJA 3ZQ7A 5EEHA 1XB4A 2A61A 3E3VA 4UNOA 2HYFA 1I1GA 4L5IA 2W85A 4YIFA 5JI6A 1K6OA 4H0EA 2ZJ2A 4IHSA 3R60A 1G3TA 3KETA 2STTA 5J8FA 3RYPA 2K7LA 4EJVA 2Z9OA 1JGSA 1G6NA 3HRTA 3E6CC 1XSDA 4Z2YA 5FFXA 1G3YA 2D45A 3CDHA 2IPQX 1O3TA 4N9HA 4U0WA 3IC7A 3I59B 3FXQA 1B1BA 2HGCA 4ZYHA 5LGNA 2HKOA 4ON0A 3T8TA 1TW2A 4F7ZA 3BJOA 1KU2A 3IKTA 3LQQA 4KMFA 3KLNA 2QVOA 1FOKA 1XGNA 4ESJA 2H09A 5FFZA 2XKPA 1BOAA 4YIIA 2VODA 4HAMA 1YO5C 1J0RA 2DO7A 3ROUA 2PFBA 2BGCA 3K1PA 3GZ6A 1TNTA 2IW5A 4WWCA 1LEBA 1TQIA 2P5LC 1ZG1A 2HEOA 3LA7A 2Z3YA 4HOBA 3P9IA 3ABTA 1XMKA 3LFKA 4A0XA 4Q4ZF 3ELKA 2JRTA 4PDKA 2PBIA 2E1NA 4O3MA 1HW1A 2VONA 1UCRA 1SD4A 4RAYA 2V1UA 1KGSA 4M6YA 4IXAA 4ENMA 3V8KA 1P92A 4AIKA 4Y13A 3NQOA 4S04A 4HX8A 1IN4A 4IHTA 1XSVA 1P4AA 5H6RA 5L3EA 5DUKA 2A68F 1F9NA 3E5UA 4ASNA 1Z91A 1O57A 4MQVA 2FU4A 1ZH5A 5TJJA 1IN7A 3HRUA 4EM0B 3P9CA 3TGNA 3QP5A 2ZMEB 3REOA 5CVVA 1FBQA 4A6EA 1J2XA 2L54A 4I2OA 2PI0A 4MHGA 2L4AA 3Q5FA 2GAUA 1XD7A 4ESFA 2Q0OA 4B8XA 1MZBA 1XGOA 3JSPA 4RGUA 2DTRA 2NNNA 1IF1A 3TO7A 1W5TA 1J75A 2RVCA 1XMAA 2V79A 3GEZA 2IA2A 2A6EF 4HYEA 1W7PD 5FD6A 3TQNA 2FMYA 4R79A 4G6DA 1NHAA 1GXPA 1W4MA 1IXSB 1TQMA 4U88A 4LLGF 5HS8A 3QPTA 4BHPA 4LMYA 2ETHA 3HIFA 3OV8A 3IRQA 1YFHA 2EV6A 2DPUA 3EDPA 3KZZA 2VBXA 2DFIA 2YR2A 3QP6A 4HF2A 4LFUA 1STZA 3WTYC 1BI3A 3O2PE 1B9MA 3SHFA 4CYDA 1IN5A 2W84A 1HQCA 3ISPA 5FLXZ 2W57A 1BBYA 3GW2A 1RI7A 4HA8A 1K78B 1JE8A 2DLLA 3NRVA 5F6FA 1O7FA 4MNUA 2JPCA 1BI0A 3BWGA 4BHCA 1U3EM 2X4HA 1LDKB 1GXQA 1DPUA 2XAJA 2MA3A 4G8XA 2H27A 2XAGA 1UHMA 3MCZA 2E1CA 2ZBKA 5H20A 5AIQA 3ZMUA 4CO8A 5DYMA 4ESBA 1J59A 1FP1D 5E8GA 1KU9A 2M5WA 4UXNA 2XGXA 3K69A 3T1BA 2ISZA 2KIMA 1LEAA 2XKOA 4HX7A 1SAXA 5IT9Z 1UFMA 2XASA 2Z5UA 1Q1HA 4LLLA 3LWFA 5DEQA 2DAOA 5F64A 2NRAC 3DFGA 5DD8A 1MJAA 1R36A 1W5SA 2M1BA 1J7KA 5E8IA 1T6SA 1KQ0A 1XN7A 1WKMA 2YX4A 4PGGA 5L3BA 1RZ4A 2H6BA 5H6QA 2L01A 3RKWA 2Y0MA 3O6BB 4G7OF 3J81Z 1PP8F 1S29A 4QWQA 1D8JA 3RTRA 3COAC 1QNTA 4M6XA 1BM9A 1ZRFA 3L2CA 1L3LA 4BQAA 3GUDA 2DQRA 4MTDA 3SFZA 2E7WA 2P5KA 1H0MA 4M71A 2RC4A 3D0SA 3HSEA 2IP2A 4LJZF 1XCVA 1FP2A 5E1XA 4HLXA 4L9TA 1RNLA 3ZMDA 3T5XA 5D5VB 3CUOA 3QAHA 4UVAA 5JFRA 1TW3A 2PMUA 1YS7A 1YIOA 3TKYA 5ICCA 5ICGA 1ZGJA 2IRFG 5K1YA 1TQPA 2Q8KA 1EV7A 4M9ZA 2ZXJA 3F72A 1ZLJA 5CVRA 3RKYA 2Q2EA 2B0LA 2VC1A 3GZ5A 4FX4A 4CZZA 3SQNA 3WGIA 1U2WA 5LBQA 3MFKA 2QQAA 2P7CB 3E6MA 3KP4A 1FYLA 2MD5A 4WXCA 2P5VA 1PP7U 3WTSC 2A5YB 2HKXA 3TOBA 1Y0UA 3FHZA 3DQVC 3F8CA 2UWMA 5FB2A 5CYVA 2ZNYA 2G7HA 5LLQA 3RKXA 3P7NA 2LKPA 3ULQB 2MBFA 4M74A 1ZRCA 1EH7A 1S8NA 1HKTA 1LVAA 3K1NA 4ZZDA 1BC7C 4AIHA 1FY7A 4P96A 4LB6B 4YG2F 1DUXC 3V7RA 1BC8C 4JK1X 2CSOA 3U9GA 3MQ0A 2M87A 2K02A 1R1UA 2ISYA 1YLFA 3H3UA 2IT0A 2BV6A 2DU9A 1IUYA 4OIQF 4PZJA 1FZPB 1S6LA 1OKRA 3RPQA 4IRIA 1KQ8A 5E18F 4U0YA 3HOTA 3MEXA 3H92A 5D4SA 3VFZA 2P7VB 5LRRA 4A5MA 2PEXA 3WTZA 1VTNC 1YW9A 4KIGA 1XSXA 2KIFA 3N4MA 2RNJA 1Z7UA 1S7AA 3EYYA 3KLOA 1FSHA 1HSTA 1ONVA 2OD5A 1J5YA 2GWRA 1ULYA 1RIOH 1B4AA 3KP2A 3HTSB 2GA1A 3L7WA 1HKSA 2P6TA 2VOOA 1R5GA 3DPTA 4OIOF 4LG0A 4ZYEA 4KIBA 4WCGA 5BPIA 2ZNZA 4M72A 1WRJA 1RUNA 2GQQA 1L0OC 4LGWA 1WI9A 1U5TA 3RI4A 3QRFF 1FSEA 5DCMA 1R5HA 4KN7X 3LAJA 2OAZA 1WQ2A 3BJAA 3BZ6A 1FNNA 1YW7A 4Q5SF 2CQKA 4MEYF 1BN5A 3WTWC 1PUEE 2QZ8A 1SD5A 2KJCA 4RB2C 2A6HF 4KYWA 4MGRA 4KDPA 5TRDA 2G9WA 1D5VA 3KEOA 4YFKF 2O61A 1CF7A 4KT5C 2F2EA 4DNCA 3VB2A 1BIBA 2BYVE 2DPDA 2K27A 4M73A 1MD0A 4P9UA 1IN8A 2PN6A 1G3SA 4A2UA 1S7OA 3PFIA 3K2ZA 2EB7A 3HSRA 3RYRA 2IA0A 4GYGA 2EV0A 3HRMA 4ENJA 1KYWA 3VEPA 3FX3A 3U2RA 2ESHA 3C3WA 2OU2A 1JXSA 2DBBA 2UXNA 1EH6A 3C7JA 4YFXF 5E1WA 4PGHA 3MWMA 4EM2A 3AAFA 4L18B 5HVQC 4D0PA 1OYWA 1QBJA 4XBFA 2D1VA 2PG4A 5A2QZ 3GFLA 2F5DA 3TO6A 5DD4A 3HOSA 2F5FA 1TNSA 4OOIA 4AWXB 1S3JA 3GWZA 5HS9A 2O6GE 4AD9A 4O5VA 1FC3A 3BDDA 4GO1A 2FNPA 2IJLA 2Z33A 3GFJA 4A12A 4P5OA 2EK5A 4ENNA 1KQ9A 3GXOA 1IN6A 3DP7A 3KEQA 2AS5F 4N0BA 2XRNA 3T8RA 2H6CA 4G7ZF 4UV9A 5ILUA 1U8RA 6PAXA 1AWCA 2Y75A 3I4PA 1MKMA 2VE8A 1BJAA 1FWZA 1LNWA 3BPVA 2RN7A 1OYIA 2DT5A 1MJBA 1R1TA 2W25A 4GCVA 4I02A 2JTVA 3GF2A 2QBYA 5E1ZB 2HTSA 2V9VA 3BPXA 1R00A 5LHGA 3FMSA 2DK5A 2HDCA 3SXYA 1XDUA 1SD6A 5L3GA 1ZRDA 2XHKA 4G9YA 3DF8A 4L9NA 5FGMA 1KA8A 2NAZA 2XAQA 4BH9A 2R3SA 1USTA 5DV5A 1MDMA 2PQ8A 1QGPA 5AONA 3KE2A 3FM3A 2MH2A 4HF0A 5D5XB 2H94A 2VT3A 2WWYA 4UVCA 1HBXG 4HQMA 4WK8F 1SMYF 4L0YB 1QPMA 3WTUC 2QYOA 2WV0A 3RPUA 5HLGA 2E7XA 2QQ9A 2KRFA 2FA5A 5E17F 3V4GA 3MAJA 1WWXA 2DQLA 4JBAA 1O3RA 2RKHA 1TTYA 2YSRA 2JT1A 3OOPA 4KNYA 1P2FA 2ADUA 1LJ9A 3GFIA 5ICEA 3JW4A 1TBXA 3DEUA 3DKWA 3RJPA 5DDGA 4OMYA 3CUQA 4B09A 3IWZA 2M30A 4RAZA 1C0WA 1QZZA 1U5TB 1ON1A 2UZKA 5DCFA 5DCMB 3I59A 4IF4A 5E20A 3GX4X 4Y15A 2PMHA 2BBYA 1SFUA 1V4RA 4IRHA 1KYZA 3JSOA 2FF4A 2YX7A 3CO7C 5LHHA 2FSWA 2TDXA 2XVCA 1OMIA 3I53A 4HZFA 1IAWA 4FHTA 5D5WB 4O6JA 1U5TC 3R6SA 4XLPF 4A6DA 1T98A 2Z99A 3GVAA 1G3WA 3NEUA 1IRGA 3G73A 1Z05A 3CO6C 4NQWA 3Q9VA 2O03A 5D4RA 4JQFA 3F6VA 2COMA 5LGUA 1T2KA 3ABUA 1SMTA 3C18A 4KICA 5CVJA 3F6OA 2EFWA 1T38A 5HS7A 1W7PA 5HLHA 4GYIA 2EFNA 1ZLKA 2EFQA 4OIPF 2R7DA 4U7DA 3ZPLA 3J80K 2HS5A 4ZYDA 3ZP5A 4XRFA 2V1DA 2EJRA 1F1ZA 1FPQA 1D8KA 4FT8A 5J6XA 2KKOA 1F5TA 2V6CA 5LRSA 3T0YA 4EV0A 2EA2A 1LQ1A 2LF7A 2OZUA 2VBWA 1V3FA 4I0BA 4HV5A 3CTAA 1HW5A 1REPC 3ZMVA 5J8CA 4MQ9F 1BIAA 1OPCA 4ETSA 1DP7P 1Z6RA 5BPDA 2MLKA 5D8LB 3HUGA 1YW8A 2O3FA 5ICFA 3WTTC 2EV5A 5CVUA 3TO9A 4OINF 4XSXF 3QU6A 4I0AA 4EVIA 2QM3A 4RB1A 2O0YA 3VODA 2LF8A 5K5RA 2WC2A 3G3ZA 4EQQA 5EEGA 2RV8A 4U0VA 5KVRA 4CGZA 1Z1DA 3FMRA 3I64A 3KP7A 5IT3A 4RGXA 1U78A 1PDNC 4MEXF 3HHGA 3HHHA 2QBYB 3ZMTA 3IWFA 1LDJA 3IKVA 2Y48A 1UB9A 2EWNA 4XSZF 4K2EA 1P4XA 3HTUA 3BOQA 2HQNA 1F4KA 4EJOA 2HQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGA A;  3J7A O;  1QO0 D;  2EFO A;  4I7H A;  1I27 A;  1A04 A;  3I71 A;  3E6D A;  3QU3 A;  2ZO4 A;  2STW A;  2L3D A;  3BP8 A;  3WOD F;  4KMU X;  4U7B A;  1MDM B;  3ECO A;  2FEZ A;  5DUI A;  1XGS A;  2FOK A;  2BE5 F;  1Z9C A;  2ESN A;  4HF1 A;  2GXG A;  3EQL F;  3SZT A;  3K0L A;  2CWE A;  4BHB A;  4G7H F;  3BRO A;  2D1H A;  3ZMZ A;  3EET A;  2DK8 A;  1IRF A;  3IRR A;  2ZKZ A;  1GVJ A;  2HOE A;  3PQK A;  2VE9 A;  1FT9 A;  1IZ1 A;  1G4D A;  3DV8 A;  2W24 A;  2O8X A;  2A69 F;  1XCB A;  3ECH A;  4KIF A;  3VOE A;  1ZN2 A;  3R0A A;  1CGP A;  1SD7 A;  3JTH A;  1IXC A;  4TV7 A;  5LHI A;  1ZRE A;  1B59 A;  5ILV A;  3JTG A;  4LD5 A;  3KZY A;  5L3D A;  4HDV A;  3WTV C;  3CUQ B;  2HTJ A;  3I5U A;  5A2Q K;  3BY6 A;  3I0T A;  2GIV A;  2HYG D;  2WTE A;  2XV4 S;  3F8N A;  4M9X A;  3TDZ C;  4DQ2 A;  3I54 A;  1K79 A;  1R22 A;  3JAM Z;  3ZN0 A;  3LA3 A;  1FBU A;  1B9N A;  3F8M A;  5CLS A;  1I1S A;  2QEN A;  4HLY A;  4MTE A;  3EUH A;  4R1H A;  1FYM A;  2IA1 A;  2UXX A;  3CUQ C;  3CJN A;  2OZ6 A;  2OBP A;  5HDG A;  2FBK A;  4FX0 A;  3E97 A;  2CG4 A;  3FMQ A;  4EM1 A;  2QUF A;  2D2W A;  5D6F A;  1Z6T A;  2ZFW A;  2VOP A;  3R0J A;  2XAF A;  2FQ3 A;  1BI2 A;  2F5C A;  3MZH A;  3WTX C;  1ZG5 A;  1LDD A;  4HQE A;  1JHH A;  1X3U A;  1KU3 A;  3KP6 A;  4KFC A;  4WXH A;  1YYV A;  1TLH B;  4BAY A;  3W6K B;  1W7P B;  5HDK A;  3Q9S A;  3LA2 A;  4NB5 A;  5BMZ A;  3B73 A;  3KP3 A;  3R61 A;  3LST A;  2BEO A;  2FML A;  1IW7 F;  1BI1 A;  2G7U A;  2J5O A;  3TDU C;  5FLX K;  2PLY A;  1AOY A;  3FF5 A;  4N9I A;  4A0Z A;  4CXF A;  2CGP A;  3GYH X;  2ZCW A;  4ENK A;  4ZH4 F;  5ERI A;  1K7A A;  5K5Q A;  4I09 A;  3GLX A;  2PJP A;  4HX4 A;  4EGZ A;  3LAP A;  5K5O A;  4HBL A;  2HR3 A;  4CHU A;  3HRS A;  3FXR A;  1R58 A;  3B02 A;  1O3Q A;  3ML6 A;  1YG2 A;  2NYX A;  3C1D A;  1USS A;  3GFM A;  2AXL A;  1O3S A;  1ODD A;  2OA4 A;  3IHU A;  3L9F A;  4UV8 A;  1ZAR A;  4UHT A;  2RDP A;  5IT9 K;  3V7C A;  4CIC A;  4EJU A;  1R23 A;  4ZZL A;  3F21 A;  1MJ9 A;  3D5L A;  3HYI A;  4EJT A;  3KFW X;  2OQG A;  1KU7 A;  4HDU A;  1EH8 A;  2VN2 A;  3K1M A;  3RIR A;  4UUV A;  4HW0 A;  3L09 A;  5HOO A;  4QLC U;  2YPR A;  4S05 A;  2X0L A;  3ZN1 A;  5FD5 A;  4BNC A;  1I5Z A;  5BQT A;  2V1X A;  4LK0 F;  4P55 A;  3ERE D;  4OU0 A;  2EA4 A;  3DPL C;  4M9S A;  1QQI A;  4RGS A;  2VC0 A;  3V8L A;  1HXD A;  3R4K A;  3P9K A;  3J81 K;  1R1V A;  3WE3 A;  3V7S A;  5CVI A;  2K4J A;  2VBZ A;  4LK1 F;  2FE3 A;  3F8F A;  4HV6 A;  3WE2 A;  3F3X A;  2L4M A;  1J9I A;  3M8F A;  1RUO A;  3F23 A;  3N97 A;  2EFP A;  3SZP A;  1XGM A;  2ELH A;  2RGV A;  3M1E A;  4NHJ A;  3WU1 B;  2XIG A;  2IVM A;  2P8T A;  2K4B A;  5BOX A;  1H9T A;  3BJ6 A;  2CO5 A;  2XRO A;  4RB0 A;  1T0F A;  3M8E A;  4LG0 B;  2A07 F;  2MC3 A;  4L5J A;  1YTY A;  4IJA A;  3WGG A;  4I98 B;  2CFX A;  4Y17 A;  1FYK A;  3WGH A;  3ZMS A;  2GA2 A;  4WF2 A;  1QZY A;  3F8B A;  4IPA A;  1O7L A;  5FO5 A;  1T39 A;  3M9A A;  4KA4 A;  4IVN A;  5KK1 A;  2FBI A;  2P6S A;  2QLZ A;  1U6G A;  2KJB A;  4PCQ A;  4RGR A;  4KN4 X;  2HZT A;  4AVP A;  4RB3 C;  5L3F A;  2VBY A;  1LB2 A;  4WX9 A;  2A3S A;  4GGG A;  5HLI A;  2RQP A;  1ZAO A;  4OIR F;  1CF7 B;  3HSF A;  2NNY A;  2FRH A;  3MZY A;  5LGT A;  5D6E A;  3H3Z A;  1HKQ A;  2M8E A;  3E6B A;  1ON2 A;  3EYI A;  2LNB A;  3FM5 A;  1SFE A;  5AIP A;  4R8H A;  3U1D A;  2FBH A;  4Q47 A;  2FXA A;  4G6Q A;  5HDN A;  4A0Y A;  2XUB A;  4L9V A;  4BYY A;  4KUM A;  3O3K A;  5ED4 A;  4I01 A;  3F22 A;  5F1R A;  4EGY A;  1P4W A;  1FBS A;  2J5P A;  4L9J A;  1FLI A;  3QOP A;  2C6Y A;  1ZYR F;  2L02 A;  4E70 A;  2YU3 A;  3IL2 A;  3K9T A;  2VXZ A;  2JPB A;  1MGT A;  2ZME A;  4CDG A;  4ZYG A;  3WU0 A;  3FZV A;  4G94 A;  3S2W A;  1FX7 A;  1YQA A;  1I6X A;  5LEK A;  5JR3 A;  2CW0 F;  1OYY A;  2FNA A;  4LLN A;  4WXD A;  1DPR A;  4OMZ A;  3E5Q A;  4LB5 A;  2KIU A;  4RS8 A;  3KCC A;  2GZW A;  4P9F A;  1P6R A;  1HSJ A;  3QPH A;  2ACJ A;  3TOA A;  3GO5 A;  3RDI A;  2VT2 A;  4L0Z B;  1B6A A;  2HFH A;  4BXU A;  3LQR A;  2CYY A;  4Q48 A;  1E17 A;  2NS0 A;  1DDN A;  3V8J A;  1IXR C;  4EMS A;  1ZG3 A;  3E5X A;  4YFN F;  2MH9 A;  5JVT A;  1JHF A;  2MLG A;  1ZHF A;  1D3Y A;  2P4W A;  5ILS A;  2LSO A;  2XAH A;  2JZY A;  3I58 A;  5BS6 A;  4XLN F;  3J80 Z;  2DW4 A;  2JSC A;  1XDS A;  3M7G A;  2LDU A;  2DI3 A;  4AIJ A;  3W6J B;  3JAM K;  1K78 A;  2M45 A;  1WSU A;  3DXJ F;  1H9G A;  3CLO A;  4A5N A;  1YS6 A;  5JHU A;  1HW2 A;  1OR7 A;  2QWW A;  3FXU A;  3WG9 A;  2F5E A;  2HWV A;  5L3C A;  3L00 A;  4EJW A;  1GHC A;  3PQJ A;  2GXB A;  1E2X A;  1SFX A;  4UVB A;  2R7F A;  5D5U B;  2QQB A;  2OQR A;  1R7J A;  3FWE A;  4GXO A;  1UHW A;  5CJ9 A;  3KP5 A;  2K86 A;  4IRG A;  5D8K B;  5LEJ A;  3ZQ7 A;  5EEH A;  1XB4 A;  2A61 A;  3E3V A;  4UNO A;  2HYF A;  1I1G A;  4L5I A;  2W85 A;  4YIF A;  5JI6 A;  1K6O A;  4H0E A;  2ZJ2 A;  4IHS A;  3R60 A;  1G3T A;  3KET A;  2STT A;  5J8F A;  3RYP A;  2K7L A;  4EJV A;  2Z9O A;  1JGS A;  1G6N A;  3HRT A;  3E6C C;  1XSD A;  4Z2Y A;  5FFX A;  1G3Y A;  2D45 A;  3CDH A;  2IPQ X;  1O3T A;  4N9H A;  4U0W A;  3IC7 A;  3I59 B;  3FXQ A;  1B1B A;  2HGC A;  4ZYH A;  5LGN A;  2HKO A;  4ON0 A;  3T8T A;  1TW2 A;  4F7Z A;  3BJO A;  1KU2 A;  3IKT A;  3LQQ A;  4KMF A;  3KLN A;  2QVO A;  1FOK A;  1XGN A;  4ESJ A;  2H09 A;  5FFZ A;  2XKP A;  1BOA A;  4YII A;  2VOD A;  4HAM A;  1YO5 C;  1J0R A;  2DO7 A;  3ROU A;  2PFB A;  2BGC A;  3K1P A;  3GZ6 A;  1TNT A;  2IW5 A;  4WWC A;  1LEB A;  1TQI A;  2P5L C;  1ZG1 A;  2HEO A;  3LA7 A;  2Z3Y A;  4HOB A;  3P9I A;  3ABT A;  1XMK A;  3LFK A;  4A0X A;  4Q4Z F;  3ELK A;  2JRT A;  4PDK A;  2PBI A;  2E1N A;  4O3M A;  1HW1 A;  2VON A;  1UCR A;  1SD4 A;  4RAY A;  2V1U A;  1KGS A;  4M6Y A;  4IXA A;  4ENM A;  3V8K A;  1P92 A;  4AIK A;  4Y13 A;  3NQO A;  4S04 A;  4HX8 A;  1IN4 A;  4IHT A;  1XSV A;  1P4A A;  5H6R A;  5L3E A;  5DUK A;  2A68 F;  1F9N A;  3E5U A;  4ASN A;  1Z91 A;  1O57 A;  4MQV A;  2FU4 A;  1ZH5 A;  5TJJ A;  1IN7 A;  3HRU A;  4EM0 B;  3P9C A;  3TGN A;  3QP5 A;  2ZME B;  3REO A;  5CVV A;  1FBQ A;  4A6E A;  1J2X A;  2L54 A;  4I2O A;  2PI0 A;  4MHG A;  2L4A A;  3Q5F A;  2GAU A;  1XD7 A;  4ESF A;  2Q0O A;  4B8X A;  1MZB A;  1XGO A;  3JSP A;  4RGU A;  2DTR A;  2NNN A;  1IF1 A;  3TO7 A;  1W5T A;  1J75 A;  2RVC A;  1XMA A;  2V79 A;  3GEZ A;  2IA2 A;  2A6E F;  4HYE A;  1W7P D;  5FD6 A;  3TQN A;  2FMY A;  4R79 A;  4G6D A;  1NHA A;  1GXP A;  1W4M A;  1IXS B;  1TQM A;  4U88 A;  4LLG F;  5HS8 A;  3QPT A;  4BHP A;  4LMY A;  2ETH A;  3HIF A;  3OV8 A;  3IRQ A;  1YFH A;  2EV6 A;  2DPU A;  3EDP A;  3KZZ A;  2VBX A;  2DFI A;  2YR2 A;  3QP6 A;  4HF2 A;  4LFU A;  1STZ A;  3WTY C;  1BI3 A;  3O2P E;  1B9M A;  3SHF A;  4CYD A;  1IN5 A;  2W84 A;  1HQC A;  3ISP A;  5FLX Z;  2W57 A;  1BBY A;  3GW2 A;  1RI7 A;  4HA8 A;  1K78 B;  1JE8 A;  2DLL A;  3NRV A;  5F6F A;  1O7F A;  4MNU A;  2JPC A;  1BI0 A;  3BWG A;  4BHC A;  1U3E M;  2X4H A;  1LDK B;  1GXQ A;  1DPU A;  2XAJ A;  2MA3 A;  4G8X A;  2H27 A;  2XAG A;  1UHM A;  3MCZ A;  2E1C A;  2ZBK A;  5H20 A;  5AIQ A;  3ZMU A;  4CO8 A;  5DYM A;  4ESB A;  1J59 A;  1FP1 D;  5E8G A;  1KU9 A;  2M5W A;  4UXN A;  2XGX A;  3K69 A;  3T1B A;  2ISZ A;  2KIM A;  1LEA A;  2XKO A;  4HX7 A;  1SAX A;  5IT9 Z;  1UFM A;  2XAS A;  2Z5U A;  1Q1H A;  4LLL A;  3LWF A;  5DEQ A;  2DAO A;  5F64 A;  2NRA C;  3DFG A;  5DD8 A;  1MJA A;  1R36 A;  1W5S A;  2M1B A;  1J7K A;  5E8I A;  1T6S A;  1KQ0 A;  1XN7 A;  1WKM A;  2YX4 A;  4PGG A;  5L3B A;  1RZ4 A;  2H6B A;  5H6Q A;  2L01 A;  3RKW A;  2Y0M A;  3O6B B;  4G7O F;  3J81 Z;  1PP8 F;  1S29 A;  4QWQ A;  1D8J A;  3RTR A;  3COA C;  1QNT A;  4M6X A;  1BM9 A;  1ZRF A;  3L2C A;  1L3L A;  4BQA A;  3GUD A;  2DQR A;  4MTD A;  3SFZ A;  2E7W A;  2P5K A;  1H0M A;  4M71 A;  2RC4 A;  3D0S A;  3HSE A;  2IP2 A;  4LJZ F;  1XCV A;  1FP2 A;  5E1X A;  4HLX A;  4L9T A;  1RNL A;  3ZMD A;  3T5X A;  5D5V B;  3CUO A;  3QAH A;  4UVA A;  5JFR A;  1TW3 A;  2PMU A;  1YS7 A;  1YIO A;  3TKY A;  5ICC A;  5ICG A;  1ZGJ A;  2IRF G;  5K1Y A;  1TQP A;  2Q8K A;  1EV7 A;  4M9Z A;  2ZXJ A;  3F72 A;  1ZLJ A;  5CVR A;  3RKY A;  2Q2E A;  2B0L A;  2VC1 A;  3GZ5 A;  4FX4 A;  4CZZ A;  3SQN A;  3WGI A;  1U2W A;  5LBQ A;  3MFK A;  2QQA A;  2P7C B;  3E6M A;  3KP4 A;  1FYL A;  2MD5 A;  4WXC A;  2P5V A;  1PP7 U;  3WTS C;  2A5Y B;  2HKX A;  3TOB A;  1Y0U A;  3FHZ A;  3DQV C;  3F8C A;  2UWM A;  5FB2 A;  5CYV A;  2ZNY A;  2G7H A;  5LLQ A;  3RKX A;  3P7N A;  2LKP A;  3ULQ B;  2MBF A;  4M74 A;  1ZRC A;  1EH7 A;  1S8N A;  1HKT A;  1LVA A;  3K1N A;  4ZZD A;  1BC7 C;  4AIH A;  1FY7 A;  4P96 A;  4LB6 B;  4YG2 F;  1DUX C;  3V7R A;  1BC8 C;  4JK1 X;  2CSO A;  3U9G A;  3MQ0 A;  2M87 A;  2K02 A;  1R1U A;  2ISY A;  1YLF A;  3H3U A;  2IT0 A;  2BV6 A;  2DU9 A;  1IUY A;  4OIQ F;  4PZJ A;  1FZP B;  1S6L A;  1OKR A;  3RPQ A;  4IRI A;  1KQ8 A;  5E18 F;  4U0Y A;  3HOT A;  3MEX A;  3H92 A;  5D4S A;  3VFZ A;  2P7V B;  5LRR A;  4A5M A;  2PEX A;  3WTZ A;  1VTN C;  1YW9 A;  4KIG A;  1XSX A;  2KIF A;  3N4M A;  2RNJ A;  1Z7U A;  1S7A A;  3EYY A;  3KLO A;  1FSH A;  1HST A;  1ONV A;  2OD5 A;  1J5Y A;  2GWR A;  1ULY A;  1RIO H;  1B4A A;  3KP2 A;  3HTS B;  2GA1 A;  3L7W A;  1HKS A;  2P6T A;  2VOO A;  1R5G A;  3DPT A;  4OIO F;  4LG0 A;  4ZYE A;  4KIB A;  4WCG A;  5BPI A;  2ZNZ A;  4M72 A;  1WRJ A;  1RUN A;  2GQQ A;  1L0O C;  4LGW A;  1WI9 A;  1U5T A;  3RI4 A;  3QRF F;  1FSE A;  5DCM A;  1R5H A;  4KN7 X;  3LAJ A;  2OAZ A;  1WQ2 A;  3BJA A;  3BZ6 A;  1FNN A;  1YW7 A;  4Q5S F;  2CQK A;  4MEY F;  1BN5 A;  3WTW C;  1PUE E;  2QZ8 A;  1SD5 A;  2KJC A;  4RB2 C;  2A6H F;  4KYW A;  4MGR A;  4KDP A;  5TRD A;  2G9W A;  1D5V A;  3KEO A;  4YFK F;  2O61 A;  1CF7 A;  4KT5 C;  2F2E A;  4DNC A;  3VB2 A;  1BIB A;  2BYV E;  2DPD A;  2K27 A;  4M73 A;  1MD0 A;  4P9U A;  1IN8 A;  2PN6 A;  1G3S A;  4A2U A;  1S7O A;  3PFI A;  3K2Z A;  2EB7 A;  3HSR A;  3RYR A;  2IA0 A;  4GYG A;  2EV0 A;  3HRM A;  4ENJ A;  1KYW A;  3VEP A;  3FX3 A;  3U2R A;  2ESH A;  3C3W A;  2OU2 A;  1JXS A;  2DBB A;  2UXN A;  1EH6 A;  3C7J A;  4YFX F;  5E1W A;  4PGH A;  3MWM A;  4EM2 A;  3AAF A;  4L18 B;  5HVQ C;  4D0P A;  1OYW A;  1QBJ A;  4XBF A;  2D1V A;  2PG4 A;  5A2Q Z;  3GFL A;  2F5D A;  3TO6 A;  5DD4 A;  3HOS A;  2F5F A;  1TNS A;  4OOI A;  4AWX B;  1S3J A;  3GWZ A;  5HS9 A;  2O6G E;  4AD9 A;  4O5V A;  1FC3 A;  3BDD A;  4GO1 A;  2FNP A;  2IJL A;  2Z33 A;  3GFJ A;  4A12 A;  4P5O A;  2EK5 A;  4ENN A;  1KQ9 A;  3GXO A;  1IN6 A;  3DP7 A;  3KEQ A;  2AS5 F;  4N0B A;  2XRN A;  3T8R A;  2H6C A;  4G7Z F;  4UV9 A;  5ILU A;  1U8R A;  6PAX A;  1AWC A;  2Y75 A;  3I4P A;  1MKM A;  2VE8 A;  1BJA A;  1FWZ A;  1LNW A;  3BPV A;  2RN7 A;  1OYI A;  2DT5 A;  1MJB A;  1R1T A;  2W25 A;  4GCV A;  4I02 A;  2JTV A;  3GF2 A;  2QBY A;  5E1Z B;  2HTS A;  2V9V A;  3BPX A;  1R00 A;  5LHG A;  3FMS A;  2DK5 A;  2HDC A;  3SXY A;  1XDU A;  1SD6 A;  5L3G A;  1ZRD A;  2XHK A;  4G9Y A;  3DF8 A;  4L9N A;  5FGM A;  1KA8 A;  2NAZ A;  2XAQ A;  4BH9 A;  2R3S A;  1UST A;  5DV5 A;  1MDM A;  2PQ8 A;  1QGP A;  5AON A;  3KE2 A;  3FM3 A;  2MH2 A;  4HF0 A;  5D5X B;  2H94 A;  2VT3 A;  2WWY A;  4UVC A;  1HBX G;  4HQM A;  4WK8 F;  1SMY F;  4L0Y B;  1QPM A;  3WTU C;  2QYO A;  2WV0 A;  3RPU A;  5HLG A;  2E7X A;  2QQ9 A;  2KRF A;  2FA5 A;  5E17 F;  3V4G A;  3MAJ A;  1WWX A;  2DQL A;  4JBA A;  1O3R A;  2RKH A;  1TTY A;  2YSR A;  2JT1 A;  3OOP A;  4KNY A;  1P2F A;  2ADU A;  1LJ9 A;  3GFI A;  5ICE A;  3JW4 A;  1TBX A;  3DEU A;  3DKW A;  3RJP A;  5DDG A;  4OMY A;  3CUQ A;  4B09 A;  3IWZ A;  2M30 A;  4RAZ A;  1C0W A;  1QZZ A;  1U5T B;  1ON1 A;  2UZK A;  5DCF A;  5DCM B;  3I59 A;  4IF4 A;  5E20 A;  3GX4 X;  4Y15 A;  2PMH A;  2BBY A;  1SFU A;  1V4R A;  4IRH A;  1KYZ A;  3JSO A;  2FF4 A;  2YX7 A;  3CO7 C;  5LHH A;  2FSW A;  2TDX A;  2XVC A;  1OMI A;  3I53 A;  4HZF A;  1IAW A;  4FHT A;  5D5W B;  4O6J A;  1U5T C;  3R6S A;  4XLP F;  4A6D A;  1T98 A;  2Z99 A;  3GVA A;  1G3W A;  3NEU A;  1IRG A;  3G73 A;  1Z05 A;  3CO6 C;  4NQW A;  3Q9V A;  2O03 A;  5D4R A;  4JQF A;  3F6V A;  2COM A;  5LGU A;  1T2K A;  3ABU A;  1SMT A;  3C18 A;  4KIC A;  5CVJ A;  3F6O A;  2EFW A;  1T38 A;  5HS7 A;  1W7P A;  5HLH A;  4GYI A;  2EFN A;  1ZLK A;  2EFQ A;  4OIP F;  2R7D A;  4U7D A;  3ZPL A;  3J80 K;  2HS5 A;  4ZYD A;  3ZP5 A;  4XRF A;  2V1D A;  2EJR A;  1F1Z A;  1FPQ A;  1D8K A;  4FT8 A;  5J6X A;  2KKO A;  1F5T A;  2V6C A;  5LRS A;  3T0Y A;  4EV0 A;  2EA2 A;  1LQ1 A;  2LF7 A;  2OZU A;  2VBW A;  1V3F A;  4I0B A;  4HV5 A;  3CTA A;  1HW5 A;  1REP C;  3ZMV A;  5J8C A;  4MQ9 F;  1BIA A;  1OPC A;  4ETS A;  1DP7 P;  1Z6R A;  5BPD A;  2MLK A;  5D8L B;  3HUG A;  1YW8 A;  2O3F A;  5ICF A;  3WTT C;  2EV5 A;  5CVU A;  3TO9 A;  4OIN F;  4XSX F;  3QU6 A;  4I0A A;  4EVI A;  2QM3 A;  4RB1 A;  2O0Y A;  3VOD A;  2LF8 A;  5K5R A;  2WC2 A;  3G3Z A;  4EQQ A;  5EEG A;  2RV8 A;  4U0V A;  5KVR A;  4CGZ A;  1Z1D A;  3FMR A;  3I64 A;  3KP7 A;  5IT3 A;  4RGX A;  1U78 A;  1PDN C;  4MEX F;  3HHG A;  3HHH A;  2QBY B;  3ZMT A;  3IWF A;  1LDJ A;  3IKV A;  2Y48 A;  1UB9 A;  2EWN A;  4XSZ F;  4K2E A;  1P4X A;  3HTU A;  3BOQ A;  2HQN A;  1F4K A;  4EJO A;  2HQR A; 
#chains in the Genus database with same CATH topology
 1ZGA A;  3J7A O;  3HDD A;  1QO0 D;  5GAH J;  5F04 A;  2EFO A;  4I7H A;  1I27 A;  1A04 A;  2EZK A;  3I71 A;  3LSP A;  3E6D A;  2NOJ B;  2DYS H;  1K4T A;  3QU3 A;  2F4M B;  2ZO4 A;  5KAF C;  2STW A;  4DIQ A;  1H88 C;  2AQE A;  2L3D A;  4M6V A;  3BP8 A;  3WOD F;  1UZC A;  4KMU X;  4U7B A;  1MDM B;  3ECO A;  2FEZ A;  5DUI A;  2VL8 A;  1XGS A;  2ECB A;  3GLL A;  1OLT A;  2FOK A;  4XM3 A;  1FOX A;  1GUU A;  2BE5 F;  1Z9C A;  2KDZ A;  2ESN A;  4F91 B;  1IO2 A;  4IHV A;  4HF1 A;  2GXG A;  3EQL F;  3SZT A;  1R71 A;  2FD5 A;  2M2E A;  3K6G A;  3RZO J;  3K0L A;  2CWE A;  3CCJ I;  4BHB A;  4G7H F;  3BRO A;  2D1H A;  3ZMZ A;  2V4J C;  3EET A;  1B8I B;  2DMU A;  2DK8 A;  1IRF A;  3IRR A;  2ZKZ A;  4AID A;  2HI3 A;  1I50 J;  1H8A C;  1JGG A;  1Y56 A;  2HPM A;  1GVJ A;  2HOE A;  3PQK A;  2OF7 A;  3CJQ B;  2BY0 A;  2NVT J;  5F27 A;  5TIS C;  2VE9 A;  1FT9 A;  2L9S A;  4X0G A;  2XC7 A;  5DTD A;  1IZ1 A;  1G4D A;  2VB6 A;  4FAS D;  4H4K C;  1OCP A;  3E7L A;  3G71 I;  3PIO F;  2NVX J;  1QVT A;  3C2B A;  5HNH A;  3DV8 A;  1WCM J;  1VQN I;  2W24 A;  1BOB A;  4ZDO A;  4UB6 C;  2O8X A;  2A69 F;  4CCK A;  1XCB A;  3ECH A;  4KIF A;  3VOE A;  1VQ6 I;  3KZI C;  1ZN2 A;  3R0A A;  1CGP A;  2VQC A;  1SD7 A;  4CCN A;  2E36 A;  3JTH A;  4OWR B;  2E2H J;  1IXC A;  4FCY A;  3QOE A;  4TV7 A;  3TP3 A;  1N75 A;  5LHI A;  3IH2 A;  1ZRE A;  1B59 A;  5ILV A;  3JTG A;  2JUC A;  4LD5 A;  3KZY A;  3DCF A;  5L3D A;  4HDV A;  3WHB A;  3WTV C;  1O4X A;  2ZJR F;  2BY2 A;  4DW6 A;  3CUQ B;  2HTJ A;  3I5U A;  5A2Q K;  3BY6 A;  3I0T A;  2GIV A;  1D0Y A;  2HYG D;  2WTE A;  3OR1 C;  2XV4 S;  3F8N A;  4M9X A;  1GDT A;  3TDZ C;  3H0D A;  3ONQ A;  1JT0 A;  4DQ2 A;  3I54 A;  4LOC A;  1R22 A;  1K79 A;  3JAM Z;  2IGK A;  1Y8Q B;  3ZN0 A;  3QYE A;  3LA3 A;  5FJ8 J;  3CES A;  2KLO A;  1FBU A;  1B9N A;  3F8M A;  5CLS A;  4A3M J;  1I1S A;  2QEN A;  4RLQ A;  4HLY A;  3Q0V A;  2KDO A;  4MTE A;  3HBL A;  3EUH A;  4PJ0 C;  3GCM A;  2NVQ J;  1MBH A;  1TWH J;  4R1H A;  1FYM A;  2IA1 A;  5H2F C;  3KIO A;  2UXX A;  3CUQ C;  3SJM A;  3CJN A;  2OZ6 A;  2PJR B;  2OBP A;  5HDG A;  2FBK A;  4FX0 A;  3E97 A;  2CG4 A;  3DWL E;  3FMQ A;  4RM2 A;  5K7H A;  2DDB A;  4BBS J;  4EM1 A;  3S16 J;  2CQ7 A;  2OV7 A;  3BR0 A;  2QUF A;  2D2W A;  3Q3S A;  5D6F A;  1Z6T A;  1POG A;  2ZFW A;  2VOP A;  3TMO A;  4NQW B;  1HDD C;  3R0J A;  3AG1 H;  2XAF A;  2FQ3 A;  1BI2 A;  2JSP A;  2F5C A;  3KX2 A;  4ABZ A;  3MZH A;  1EKE A;  3WTX C;  3K70 D;  1ZG5 A;  1LDD A;  3GZN B;  4HQE A;  3GTL J;  1JHH A;  3DBH B;  2F48 A;  3OYC A;  1X3U A;  1KU3 A;  3KP6 A;  4KFC A;  4WXH A;  1YYV A;  1LFU P;  2IGN A;  1Z67 A;  2QF7 A;  3BQY A;  2M7B A;  2NXN B;  5IP6 A;  1TLH B;  3KYC B;  4BAY A;  3W6K B;  1W7P B;  5HDK A;  2LKX A;  3VYT B;  3LOC A;  2CRG A;  3Q9S A;  3LA2 A;  4RAG A;  4NB5 A;  1I3Q J;  5BMZ A;  1Z7L A;  3B73 A;  3KP3 A;  3R61 A;  4F55 A;  3H0G J;  3LST A;  2Y0S A;  2AQF A;  1IJW C;  2JRM A;  5C4J J;  1R49 A;  2BEO A;  2FML A;  3Q0W A;  2M0C A;  1VFC A;  2BOL A;  1WJB A;  1IW7 F;  1BI1 A;  3DPU A;  2AO9 A;  2VKD A;  1MH3 A;  2G7U A;  2J5O A;  4X6A J;  1YX3 A;  3TDU C;  4RLF A;  2Q2E B;  5FLX K;  1YJW I;  2PLY A;  3BC8 A;  1S7E A;  3G1M A;  3IUO A;  1AOY A;  3FF5 A;  4N9I A;  3AG2 H;  4EEF G;  5IYB J;  4IKF A;  4Y33 A;  4A0Z A;  4CXF A;  5EEA A;  2CGP A;  3GYH X;  3MMY B;  2W82 A;  2ZCW A;  2XGE A;  4ENK A;  4ZH4 F;  5ERI A;  2M8G X;  2VJJ A;  1K7A A;  2BY3 A;  3P5J A;  4BU2 A;  5K5Q A;  2Z1D A;  2DMT A;  3KYL A;  4I09 A;  3GLX A;  2PJP A;  4HX4 A;  4EGZ A;  2LBF B;  3ZQG A;  3LNQ A;  3LAP A;  5K5O A;  4HBL A;  4KIS A;  4JYK A;  1WI3 A;  1SAN A;  2HR3 A;  3HUG B;  4CHU A;  3HRS A;  1ETO A;  3VSK A;  3FXR A;  1R58 A;  3B02 A;  3J7Z I;  2CV1 A;  2V26 A;  1B72 A;  3AG4 H;  3ML6 A;  1O3Q A;  2EH3 A;  1YG2 A;  4PSX A;  4BQN A;  2NYX A;  2X48 A;  3C1D A;  3FKI J;  4BBR J;  1USS A;  4PUS A;  3GFM A;  2AXL A;  3LSJ A;  2VI6 A;  4NC7 A;  2Z2S B;  3PSI A;  1O3S A;  1ODD A;  1U9N A;  2OA4 A;  3IHU A;  4A3C J;  3H3V K;  1G59 A;  3SZG A;  3L9F A;  4UV8 A;  1ZAR A;  1J09 A;  4DJA A;  4AC0 A;  4UHT A;  2RDP A;  5IT9 K;  1FIP A;  3V7C A;  4CIC A;  4EJU A;  1R23 A;  2HOT A;  1R4N B;  2VXD A;  5EF6 A;  1Y6I A;  4A3L J;  4ZZL A;  3F21 A;  3GTJ J;  1MJ9 A;  3D5L A;  3HYI A;  4EJT A;  3KFW X;  2OQG A;  3GTQ J;  1KU7 A;  4NUB A;  4HDU A;  1EH8 A;  2YUS A;  3EPZ A;  1JUP A;  1P9Q C;  5EG0 B;  2VN2 A;  3CCY A;  2E1M B;  3FXK A;  3LSR A;  3K1M A;  3RIR A;  4UUV A;  4HW0 A;  3L09 A;  1WH7 A;  2E5N A;  5HOO A;  4QLC U;  2HVR A;  2YPR A;  4S05 A;  2Y0S N;  3NAU A;  2X0L A;  3ZN1 A;  3ZQH A;  2RRE A;  5LD2 C;  3W6V A;  5FD5 A;  3G1O A;  3HOY J;  1T56 A;  1BR1 A;  4BNC A;  1I5Z A;  4CCO A;  4II2 A;  5BQT A;  3DBR B;  1SC7 A;  2V1X A;  4LK0 F;  4P55 A;  3ERE D;  4OU0 A;  2EA4 A;  2X6W A;  3L2Q A;  3DPL C;  5F0C A;  1Z3Y A;  1QQI A;  4M9S A;  4RGS A;  2QEX I;  2VC0 A;  3V8L A;  2XB5 A;  1SVL A;  1HXD A;  5J4Y A;  3R4K A;  3P9K A;  2DT7 B;  2Y9Z A;  3J81 K;  1FMV A;  1VND A;  1R1V A;  3A02 A;  3WE3 A;  1BJZ A;  3IAS 2;  2EZI A;  2XRL A;  3V7S A;  2RQQ A;  4UUT A;  5CVI A;  3DU6 A;  3RZD J;  2K4J A;  2LFB A;  2EIM H;  2VBZ A;  4LK1 F;  2FE3 A;  1I3A A;  3F9K A;  3UKG A;  2CMP A;  3F8F A;  4HV6 A;  3WE2 A;  3CCU I;  3F3X A;  2L4M A;  1A6I A;  1X1D A;  3M8F A;  1RUO A;  1J9I A;  2ICW G;  1EF4 A;  4HSR A;  3F23 A;  1MMG A;  3N97 A;  2EFP A;  4B44 A;  2M4K A;  4E7K A;  2IEK A;  5K7Z A;  3SZP A;  1XGM A;  2ELH A;  2Q1Z B;  3SDB A;  3CDL A;  2RGV A;  3M1E A;  4NHJ A;  3WU1 B;  1OFC X;  4CCM A;  2V7F A;  3DEE A;  1YJ9 I;  2XIG A;  2IVM A;  2L7M P;  3I56 I;  1XMX A;  2DOD A;  2P8T A;  2VQH A;  3ERM A;  2K4B A;  1XC5 A;  4XQF A;  5BOX A;  1H9T A;  3BJ6 A;  2CO5 A;  2XRO A;  2ZB9 A;  4MLO A;  4XRS G;  5LFA A;  4RB0 A;  4NC6 A;  1R5I D;  1E0E A;  5E3L A;  1T0F A;  2K9M A;  3M8E A;  3OY9 A;  4LG0 B;  2A07 F;  5FKO A;  3K4B A;  3QPL A;  4YEJ A;  2MC3 A;  3HOZ J;  2H8R A;  3HPG A;  4L5J A;  1YTY A;  3FDY A;  4IJA A;  2ZC2 A;  3FBN B;  3WGG A;  4ANJ A;  5KHD A;  4I98 B;  2CFX A;  4Y17 A;  1FYK A;  1X2N A;  4NC8 A;  3OYE A;  1X58 A;  3WGH A;  3ZMS A;  2OTL I;  4E7L A;  2HDW A;  2GA2 A;  4WF2 A;  1RR7 A;  1N78 A;  2MFZ A;  1QZY A;  3F8B A;  4IPA A;  4E7I A;  3I4M J;  2L9N A;  1O7L A;  4B4C A;  4XR6 A;  5FO5 A;  1T39 A;  1OIS A;  2F4O B;  1ZR2 A;  1W5C C;  3M9A A;  2DFE A;  5J40 A;  2LTP A;  3K4C A;  4KA4 A;  3ZQL A;  3BLY A;  1MMN A;  2NVU B;  4BEH A;  2HOA A;  4BQQ A;  3RQ4 A;  4IVN A;  3DLA A;  4UUS B;  3U21 A;  5KK1 A;  2FBI A;  2IXS A;  3BCA A;  2P6S A;  2OPT A;  2QLZ A;  1UMQ A;  2NVY J;  1U6G A;  2KJB A;  4PCQ A;  4RGR A;  1ITY A;  4KN4 X;  2HZT A;  4AVP A;  4M3F A;  3CCE I;  4RB3 C;  1E3O C;  1JKO C;  3BG6 A;  5L3F A;  2VBY A;  1LB2 A;  4ZC3 A;  4WX9 A;  2A3S A;  4GGG A;  5HLI A;  1MBJ A;  2RQP A;  1ZAO A;  4OIR F;  1CF7 B;  3HSF A;  2NNY A;  1X1C A;  2FRH A;  3MZY A;  3M07 A;  5LGT A;  5D6E A;  3H3Z A;  1HKQ A;  2M8E A;  2OUM A;  1HA8 A;  1OCO H;  2W4S A;  3IAM 2;  3E6B A;  4IEJ A;  1GT0 C;  3G6E I;  5BNG A;  1ON2 A;  4XID A;  3EYI A;  2LNB A;  4A3J J;  3FM5 A;  1SFE A;  3VPR A;  5AIP A;  3F0C A;  1Q1V A;  4R8H A;  3U1D A;  1ETQ A;  3BTI A;  2FBH A;  3S3N A;  4Q47 A;  2HNH A;  2CUE A;  2IS4 A;  2FXA A;  4G6Q A;  3GBG A;  5HDN A;  4A0Y A;  2CV0 A;  2JA2 A;  5J47 A;  5B3S H;  4XMY A;  3X2Q H;  3LSI A;  2XUB A;  1UHS A;  3EUH C;  1YX5 A;  4L9V A;  2L9R A;  4EAT A;  4I6Z A;  5J4V A;  4BYY A;  5GAG J;  4KUM A;  3O3K A;  5ED4 A;  4V2F A;  4IL6 C;  2GOM A;  3QYF A;  4I01 A;  3F22 A;  5F1R A;  4EGY A;  1P4W A;  3FHN A;  1G8X A;  2L2O A;  2CFO A;  1FBS A;  2J5P A;  4L9J A;  5K7F A;  1ZEL A;  2LMD A;  2R7W A;  1FLI A;  3QOP A;  2C6Y A;  1ZYR F;  1SVM A;  2L02 A;  1WJE A;  4E70 A;  3S1M J;  1TWG J;  2YU3 A;  5CQE A;  3IL2 A;  2ZJQ F;  2X9D A;  3K9T A;  2DXI A;  5HLT A;  2VXZ A;  2JPB A;  1MGT A;  2ZME A;  3V42 A;  4QTR A;  1TL8 A;  3AG3 H;  4CDG A;  1UG2 A;  4BXF A;  4ZYG A;  3WU0 A;  2E35 A;  3FZV A;  4G94 A;  3S2W A;  1FX7 A;  1YQA A;  1I6X A;  5LEK A;  5JR3 A;  3GME A;  2CW0 F;  1OYY A;  1W36 C;  3K4L A;  2W48 A;  4CA0 A;  2FNA A;  1IRX A;  1AA7 A;  4LLN A;  3Q0U A;  1DPR A;  4WXD A;  4OMZ A;  5J1R A;  1XTA A;  2BXZ A;  3E5Q A;  2X1E A;  4LB5 A;  2KIU A;  4RS8 A;  4CYC A;  3KCC A;  5E3M A;  1XPX A;  1AHD P;  3ZRG A;  1TZL A;  2DA6 A;  3DTI A;  2GZW A;  3JR9 A;  4P9F A;  1FTT A;  1ORK A;  1P6R A;  2DOA A;  3OIO A;  1HSJ A;  1YOV B;  3H1C A;  3QPH A;  4PJM A;  2ACJ A;  2QSH X;  2R5Z B;  3GO5 A;  3TOA A;  3RDI A;  2RAE A;  2VT2 A;  3RCO A;  3CDI A;  3JRA A;  4ZTJ A;  1B72 B;  4L0Z B;  1ETK A;  3VDX A;  2XDV A;  2KRC A;  1B6A A;  1X1B A;  1A6Q A;  4XRM A;  2HFH A;  2WB1 A;  4BXU A;  3LQR A;  2CYY A;  4Q48 A;  5EZG A;  3TBI A;  2CV2 A;  1E17 A;  2LKS A;  2NS0 A;  1DDN A;  2V9K A;  3V8J A;  4BE1 A;  3MKL A;  5FRO A;  1IXR C;  4EMS A;  2W00 A;  1ZG3 A;  4XKW A;  3E5X A;  2H1L A;  4YFN F;  4BS9 A;  2QSG X;  1XS9 A;  2MH9 A;  5JVT A;  1JHF A;  2MLG A;  1ZHF A;  4F93 B;  3TL4 X;  1D3Y A;  4C9Y A;  3IH3 A;  3OS2 A;  4LIU A;  3CMA I;  2P4W A;  1FTZ A;  5ILS A;  2LSO A;  4IZZ A;  1S9H A;  1APL C;  2XAH A;  2JZY A;  2MAB A;  3I58 A;  5FLM J;  5BS6 A;  4DBR A;  4XLN F;  3J80 Z;  2DW4 A;  2JSC A;  3JRB A;  3EUA A;  2X1C A;  3DBL B;  4KJZ A;  4YRV A;  1XDS A;  2DMN A;  2BXY A;  3M7G A;  1DQU A;  2LY2 A;  2LDU A;  3W2V A;  2DI3 A;  4M3E A;  4AIJ A;  3W6J B;  3JAM K;  1K78 A;  1VQK I;  4PJL A;  2M45 A;  1JJ8 C;  3SEZ A;  2LD5 A;  5E3N A;  3DXJ F;  4BQO A;  4BDY A;  1YIT I;  1WSU A;  1H9G A;  3CLO A;  4A5N A;  3CC2 I;  1YS6 A;  3HG9 A;  5JHU A;  1HW2 A;  4AM3 A;  1OR7 A;  2QWW A;  3FXU A;  1YE9 A;  2M34 A;  3WG9 A;  2F5E A;  3K4K A;  2HWV A;  3L00 A;  3D5R C;  4FE4 A;  4B3X A;  4EJW A;  3PQJ A;  5L3C A;  1GHC A;  4DGW B;  1LPQ A;  2GXB A;  1E2X A;  1N77 A;  4DYQ A;  1SFX A;  4UVB A;  3ZCO A;  1LFP A;  2JN6 A;  2V1N A;  2R7F A;  5D5U B;  4XLF A;  3FK6 A;  2QQB A;  4A3B J;  4BY7 J;  2E19 A;  2OQR A;  4IOC F;  2N8G A;  5IYC J;  1R7J A;  3JRC A;  3FWE A;  2L7Z A;  4GXO A;  3S1Q J;  5EGO A;  3A01 A;  3M3Y J;  1PVE A;  2IAI A;  1UHW A;  5CJ9 A;  3JRE A;  3KP5 A;  2GOX B;  1BL0 A;  3CC7 I;  4RAF A;  2K86 A;  2DOE A;  2JVG A;  1MBK A;  4GRI A;  4IRG A;  3CD6 I;  5D8K B;  1MBF A;  5LEJ A;  1R4M B;  5TGT A;  4ZTF A;  3ZQ7 A;  5EEH A;  3ABK H;  2PMZ A;  2WAD A;  4F3Q A;  1XB4 A;  2A61 A;  2WB1 N;  3E3V A;  4UNO A;  2HYF A;  3OYN A;  1I1G A;  4L5I A;  2W85 A;  4YIF A;  5JI6 A;  1K6O A;  4H0E A;  2ZJ2 A;  2VIX A;  3I3L A;  3TP0 A;  2VKE A;  3R60 A;  4IHS A;  1G3T A;  3KET A;  3MVP A;  2YU9 J;  2DT6 A;  2DA3 A;  2STT A;  5J8F A;  3RYP A;  4RBO A;  2K7L A;  4EJV A;  2Z9O A;  2QKL B;  1JGS A;  4IO9 F;  1G6N A;  2X6X A;  3HRT A;  3E6C C;  4BY1 J;  2JVH A;  1XSD A;  4Z2Y A;  5FFX A;  5F08 A;  1G3Y A;  2LOO A;  4A3I J;  2D45 A;  3CDH A;  2IPQ X;  1O3T A;  4Y52 J;  4PK4 A;  5IOZ A;  2HQ5 A;  4N9H A;  4ZDP A;  4U0W A;  3UNG C;  1LUJ B;  3IC7 A;  2JJ7 A;  3FXQ A;  3I59 B;  4IQJ A;  1B1B A;  2HGC A;  2I10 A;  2ZXH A;  4ZYH A;  5LGN A;  2HKO A;  4ON0 A;  3L1P A;  4UY8 I;  2HQA A;  3T8T A;  1TW2 A;  1QPI A;  3M4O J;  4F7Z A;  3M8J A;  1T0F C;  3LSH A;  2B63 J;  5JLW A;  3BJO A;  5B66 C;  1KU2 A;  3IKT A;  1ETV A;  1V55 H;  3LQQ A;  4KMF A;  3KLN A;  2QVO A;  4XLE A;  1FOK A;  2L5Q A;  3BTL A;  4QPQ A;  1XGN A;  4ESJ A;  3VYU B;  2H09 A;  3CZ6 A;  3OYK A;  5KAI C;  5FFZ A;  2XKP A;  4IHY A;  5M5W J;  1BOA A;  3UR3 C;  2DA1 A;  4YII A;  2BY1 A;  2VOD A;  4HAM A;  3MZ8 A;  3OYA A;  1YO5 C;  1J0R A;  3RPU D;  1K83 J;  2DO7 A;  3ROU A;  2PFB A;  2L7K A;  2BGC A;  3K1P A;  2OJE D;  3GZ6 A;  1WPK A;  3MKW B;  1TNT A;  2IW5 A;  4WWC A;  1LEB A;  1TQI A;  2R7R A;  2P5L C;  4XOR A;  1ZG1 A;  2M7A A;  2HEO A;  3CJR B;  3LA7 A;  2Z3Y A;  3BG3 A;  4HOB A;  3OL3 A;  3P9I A;  1QA6 A;  3ABT A;  3G1L A;  1XMK A;  3LFK A;  4A0X A;  2EIJ H;  4Q4Z F;  5JHF A;  3ELK A;  3PM1 A;  2JRT A;  3GTK J;  2DTZ A;  3K4J A;  3ZOB A;  3A0H C;  4PDK A;  2PBI A;  4J19 A;  2E1N A;  1WFX A;  4O3M A;  1XX5 A;  3S8P A;  2ZSI B;  1LFB A;  1HW1 A;  2VON A;  1VQ7 I;  1UJ8 A;  1UCR A;  1SD4 A;  3S2D J;  4RAY A;  3O8G A;  3FXM A;  2BHY A;  4E4H A;  3LFU A;  1MMA A;  2V1U A;  1KGS A;  4M6Y A;  1FEX A;  4IXA A;  4ENM A;  2B9S A;  3PNT A;  1MSF C;  2XPU A;  3V8K A;  1P92 A;  4AIK A;  4RA2 A;  4XNF A;  4Y13 A;  2ZXW H;  2K3P A;  3NQO A;  4S04 A;  4HX8 A;  1KZH A;  1IN4 A;  4IHT A;  1TP4 A;  1VF9 A;  1YRN A;  4I99 C;  1XSV A;  2WBM A;  1P4A A;  1U0J A;  5H6R A;  5L3E A;  5DUK A;  2A68 F;  1F9N A;  2KRH A;  2YS9 A;  3E5U A;  4E6K G;  3H36 A;  4ASN A;  3PNV A;  4A3F J;  3C2G A;  1Z91 A;  1O57 A;  4MQV A;  5FRN A;  2FU4 A;  1ZH5 A;  2K5C A;  2K85 A;  5TJJ A;  1IN7 A;  3D5S C;  3S2H J;  5DS9 A;  3PIP F;  1X2M A;  1IC8 A;  3HRU A;  3QYB A;  4EM0 B;  3ABM H;  2ZXI A;  3BR2 A;  1EA3 A;  3P9C A;  4FET A;  3TGN A;  4W97 A;  2OCC H;  5F0F A;  2CW8 A;  3QP5 A;  2AHQ A;  2ZME B;  3REO A;  2JA6 J;  5CVV A;  4DZP A;  1FBQ A;  4A6E A;  4IOA F;  1J2X A;  2L54 A;  4I2O A;  2PI0 A;  4MHG A;  3PSF A;  2L4A A;  4CZC A;  4E7J A;  3Q5F A;  2GAU A;  1XD7 A;  3ASN H;  4ESF A;  3MKY B;  4D9J A;  1ZGW A;  3VYS B;  2Q0O A;  4AYB A;  4B8X A;  3N05 A;  1YHQ I;  1FJL A;  1MZB A;  1HLV A;  3PFY A;  1SAU A;  1XGO A;  3ZQI A;  3H35 A;  3JSP A;  4S0H B;  4RGU A;  2DTR A;  1TWA J;  1VZ0 A;  4MFE A;  4E7H A;  2NNN A;  2UUZ A;  1IF1 A;  1DP3 A;  4D5F A;  2TCT A;  1T33 A;  3BR1 A;  2IGO A;  3TO7 A;  2O9L A;  2ZME C;  1W5T A;  3LSM A;  1J75 A;  2RVC A;  1XMA A;  2GIZ A;  2V79 A;  3GEZ A;  2IA2 A;  2A6E F;  2ZFU A;  3BQZ A;  4HYE A;  1K61 A;  3GTO J;  1X4O A;  1W7P D;  5FD6 A;  3TQN A;  2FMY A;  4R79 A;  5FLV A;  4G6D A;  1NHA A;  1GXP A;  1W4M A;  1IXS B;  1TQM A;  2WAQ A;  4U88 A;  4LLG F;  5CQG A;  3TED A;  5HS8 A;  3QPT A;  2KZV A;  4BHP A;  4B43 A;  3WHC A;  4LMY A;  2XPV A;  3JRI A;  3A03 A;  2ETH A;  3HIF A;  2ME0 A;  1MNE A;  3OV8 A;  3IRQ A;  1YFH A;  1PUF A;  2EV6 A;  1W1W E;  2DPU A;  2M4G A;  3BR5 A;  2P0W A;  3EDP A;  3KZZ A;  2VBX A;  1BR4 A;  2HVS A;  2DFI A;  2YR2 A;  3QP6 A;  5EDN A;  4HF2 A;  4LFU A;  1STZ A;  4LIT A;  1S5L C;  2VUM J;  2HZD A;  2EIK H;  1ETX A;  1BI3 A;  4QSH A;  5C44 J;  2ELK A;  3O2P E;  1IUF A;  1B9M A;  2X1D A;  3SHF A;  4CYD A;  1IN5 A;  2W84 A;  3L2V A;  5CPR B;  1HQC A;  3ISP A;  5FLX Z;  1NTC A;  1WJA A;  2WY7 Q;  3HKZ A;  2DFH A;  2W57 A;  1BBY A;  3K2A A;  4B48 A;  3GW2 A;  4CCJ A;  1RI7 A;  3OIQ A;  3L2U A;  4HA8 A;  3OYG A;  3HOX J;  1K78 B;  1JE8 A;  1RR8 C;  1TT5 B;  2DLL A;  3NRV A;  5F6F A;  2NS8 A;  1O7F A;  4MNU A;  3WTY C;  2JPC A;  1BI0 A;  1HDP A;  3BWG A;  4FIS A;  4LG3 A;  4BHC A;  1U3E M;  1VQO I;  2A6T A;  1ERD A;  2HXO A;  3CC4 I;  4BJ5 C;  2X4H A;  4BE0 A;  1LDK B;  2L9V A;  1GXQ A;  1DPU A;  3W2A A;  2XAU A;  2XAJ A;  4JOM A;  3BZC A;  2G0E A;  2MA3 A;  4N4N B;  3J7A Y;  3I55 I;  4G8X A;  2VJI A;  2H27 A;  4AYB N;  2XAG A;  1JUS A;  1VQP I;  2COB A;  1UHM A;  2CUF A;  3MCZ A;  2E1C A;  4AUX A;  2BW3 A;  2ZBK A;  1A31 A;  5H20 A;  5AIQ A;  3ZMU A;  1LKX A;  4CO8 A;  5EGO B;  2R4G A;  5DYM A;  4ESB A;  3A01 B;  1J59 A;  2LC2 A;  4CH7 A;  1FP1 D;  5E8G A;  1KU9 A;  2M5W A;  1QZE A;  4UXN A;  2IBD A;  2XGX A;  4HEA 2;  3K69 A;  3T1B A;  2ISZ A;  2KIM A;  1LEA A;  2XKO A;  4C30 A;  1S72 I;  3OR2 C;  3G2B A;  5CKT A;  2HU9 A;  1OR7 C;  1ZTR A;  4HX7 A;  4FQG A;  1SAX A;  5IT9 Z;  1UFM A;  2XAS A;  2LYC A;  4F52 A;  1T08 B;  4L5E A;  2Z5U A;  1Q1H A;  4LLL A;  2VQL A;  3LWF A;  5DEQ A;  1UEL B;  4BL0 B;  2DAO A;  5F64 A;  2NRA C;  3DFG A;  3NWT A;  5DD8 A;  4B3A A;  4G6T B;  4BKX A;  4E7Z A;  4HPQ A;  1MJA A;  3OWT A;  3JRH A;  1R36 A;  1KON A;  1W5S A;  2NS7 A;  2A05 A;  4A3E J;  3EUK L;  4XOP A;  2M1B A;  4F92 B;  3IH4 A;  1J7K A;  1EJ9 A;  2X85 A;  5E8I A;  5J3L A;  4QIW N;  1T6S A;  1JKQ C;  1KQ0 A;  1XN7 A;  1MNM C;  3LSK A;  1WKM A;  1WJC A;  4XOT A;  2YX4 A;  3BG9 A;  3HZJ A;  3CMY A;  4PGG A;  4CUG A;  3HL2 A;  4M3G A;  1X3Z B;  5L3B A;  3CCQ I;  4D5C A;  2HYJ A;  1SEU A;  1T95 A;  1X1P A;  1RZ4 A;  4P1W A;  2H6B A;  3H5R A;  5H6Q A;  2L01 A;  3RKW A;  3HKZ N;  2Y0M A;  4J00 A;  3O6B B;  4G7O F;  1FIA A;  1D0Z A;  2CS3 A;  3HEF A;  1OCR H;  5IPA A;  2VLA A;  4ZDL A;  4D1Q A;  3J81 Z;  4HNT A;  1PP8 F;  1IGN A;  3C2H A;  1NG7 A;  2JA5 J;  1S29 A;  4QWQ A;  2E1O A;  2VJ5 A;  1D8J A;  2M0M A;  3RTR A;  3COA C;  2CQN A;  1QNT A;  2DYR H;  3K7A J;  4M6X A;  1BM9 A;  5KNL A;  1ZRF A;  3L2C A;  1IDZ A;  3I9V 2;  1L3L A;  4BQA A;  1ZK8 A;  3GUD A;  3QWL A;  2DQR A;  4MTD A;  1Y1W J;  1IRZ A;  3SFZ A;  2E7W A;  2P5K A;  3HGY A;  2MD0 A;  1H0M A;  4M71 A;  1Z3X A;  2IS1 A;  2RC4 A;  3D0S A;  3HSE A;  1VQ8 I;  1D1C A;  2IP2 A;  1NK3 P;  3D1N I;  1RKT A;  1BW5 A;  4LJZ F;  1XCV A;  1OCC H;  3DTE A;  1FP2 A;  5E1X A;  4HLX A;  2WV1 A;  4L9T A;  1X4P A;  1RNL A;  3ZMD A;  4BXX J;  3T5X A;  3OSF A;  5D5V B;  2X6O A;  2XB0 X;  3CUO A;  3QAH A;  4UVA A;  2L0K A;  3HB9 A;  5JFR A;  1TW3 A;  2PMU A;  1YS7 A;  4PFO A;  1YIO A;  3TKY A;  2MYS A;  5ICC A;  5ICG A;  1ZGJ A;  2IRF G;  5K1Y A;  4C3H J;  1TQP A;  3OSG A;  3FXL A;  2Q8K A;  2E5Z A;  1EV7 A;  2E2I J;  4M9Z A;  2ZXJ A;  2O8K A;  3F72 A;  1ZLJ A;  2DMP A;  3S15 J;  5CVR A;  5IOY A;  4XON A;  3A4C A;  2OTJ I;  1XG1 A;  1UAA A;  3RKY A;  1A36 A;  2Q2E A;  3HPH A;  2B0L A;  2KHM A;  2JK3 A;  2VC1 A;  3GZ5 A;  2WY8 Q;  1W0U A;  2R93 J;  1RES A;  2AXT C;  4FX4 A;  1YRN B;  2ECC A;  3K4M A;  4CZZ A;  3SQN A;  3WGI A;  1U2W A;  2D5V A;  5LBQ A;  1MIJ A;  3MFK A;  2QQA A;  2P7C B;  1IV8 A;  5HNF A;  1MH4 A;  3E6M A;  3KP4 A;  1LE8 A;  1FYL A;  2QA4 I;  1CQT A;  1OQY A;  2MD5 A;  1JT6 A;  4WXC A;  2P5V A;  1PP7 U;  4HRI A;  3WTS C;  3GTG J;  1QHH D;  2A5Y B;  2EZL A;  2HKX A;  1RKW A;  3TOB A;  2W7N A;  1R9T J;  3S14 J;  1HC8 A;  1Y0U A;  1JKR C;  3FHZ A;  2W1O A;  3DQV C;  1NH3 A;  3F8C A;  1BA5 A;  2TRT A;  4DOZ A;  2UWM A;  5GPC A;  1MW7 A;  5FB2 A;  4C3J J;  4QPO A;  5CYV A;  2ZNY A;  2G7H A;  1D1A A;  3A2K A;  4XKC A;  5LLQ A;  3RKX A;  1VQ4 I;  3P7N A;  2LKP A;  1MMS A;  3ULQ B;  2MBF A;  1DU6 A;  4M74 A;  2CUJ A;  1ZRC A;  1DGW Y;  3ZR8 X;  1EH7 A;  1S8N A;  1HKT A;  1LVA A;  3K1N A;  4ZZD A;  1WJD A;  4AIH A;  1BC7 C;  1FY7 A;  4P96 A;  4LB6 B;  4YG2 F;  2DJI A;  3OS0 A;  1DUX C;  3HM5 A;  1LVK A;  3V7R A;  1BC8 C;  2LY1 A;  3GTP J;  2E34 A;  2KP6 A;  2IGM A;  4HG2 A;  4JK1 X;  2CSO A;  2LLK A;  3U9G A;  1X19 A;  5FKM A;  3JRF A;  2LH9 A;  3MQ0 A;  3B6C A;  1M1E B;  2M87 A;  4FTH A;  2R7T A;  2FOW A;  2K02 A;  1F36 A;  4D7N A;  1R1U A;  2ISY A;  4BAC A;  5IP9 J;  5HOD A;  1YLF A;  3CLQ A;  1VQ5 I;  2VKV A;  1W36 D;  4CSW A;  3H3U A;  4MO7 A;  3WG7 H;  2IT0 A;  2BV6 A;  2DU9 A;  1IUY A;  4NBQ A;  4OIQ F;  2K9N A;  2QSF X;  4PZJ A;  1ZR4 A;  3AL0 B;  1DU0 A;  1FZP B;  1FMW A;  1S6L A;  2PX9 A;  3CCS I;  1OKR A;  3BG7 A;  3RPQ A;  3I4N J;  1ETY A;  4IRI A;  1KQ8 A;  3IV5 A;  5E18 F;  4U0Y A;  3HOT A;  3OL4 A;  3MEX A;  4MFD A;  5E3O A;  3H92 A;  3U1K A;  5D4S A;  3TW7 A;  1HCR A;  3VFZ A;  1ETW A;  3OYM A;  2P7V B;  5LRR A;  4IQ4 A;  4A5M A;  2PEX A;  2Z16 A;  3QPS A;  3WTZ A;  2DA4 A;  1VTN C;  1YW9 A;  1Z0X A;  4Z6Y A;  4KIG A;  2ID3 A;  1XSX A;  2KIF A;  3N4M A;  1D5Y A;  2RNJ A;  3PO3 J;  2LG4 A;  1U9O A;  1ZKG A;  3BTC A;  1Z7U A;  1S7A A;  3EYY A;  2EIN H;  3AL0 C;  2P81 A;  2OCE A;  3KLO A;  1U8B A;  3MKZ A;  1FSH A;  1JI8 A;  2HOS A;  2RNG A;  2ELJ A;  1HST A;  5M3F J;  1ONV A;  4UB8 C;  3OYD A;  2OD5 A;  3CP8 A;  4YEL A;  1J5Y A;  3BG5 A;  4JX6 A;  2GWR A;  2KIQ A;  2BVL A;  4D7M A;  1ULY A;  1TT0 A;  1JUM A;  4CCL A;  4C2U A;  1ENH A;  1RIO H;  2LY9 A;  4OAZ A;  1OCT C;  1B4A A;  3KP2 A;  3MN2 A;  3HTS B;  3J7Y J;  3B6A A;  2GA1 A;  3L7W A;  2R0Q C;  3H9G A;  4NNJ A;  1HKS A;  5JVG F;  3S3M A;  2R7X A;  2P6T A;  4XL9 A;  4DBQ A;  2BW3 B;  2VOO A;  1R5G A;  3FIW A;  1Y0N A;  3DPT A;  4OIO F;  2Y31 A;  3LMM A;  4LG0 A;  4ZYE A;  2FQ4 A;  4KIB A;  4WCG A;  5BPI A;  2ZNZ A;  4M72 A;  1WRJ A;  3CJT B;  2VKH A;  5F0H A;  4XKB A;  4ZYA A;  1RUN A;  2GQQ A;  1L0O C;  1JTX A;  3DKY A;  3LSG A;  1V5E A;  4LGW A;  1WI9 A;  1U5T A;  3W3C A;  3RI4 A;  2LK2 A;  3QRF F;  4XLH A;  1FSE A;  5DCM A;  2IS2 A;  1R5H A;  5E79 C;  2DJN A;  4KN7 X;  3LAJ A;  2HPI A;  3DEW A;  2OAZ A;  2QKM B;  1VI0 A;  3DKX A;  1WQ2 A;  3BJA A;  3BZ6 A;  1F43 A;  1FNN A;  1YW7 A;  3CCL I;  1YJN I;  5C4X J;  2VQG A;  4DZJ A;  2IS6 A;  4BEH B;  3K70 C;  4UUS A;  4Q5S F;  2CQK A;  4MEY F;  3DTK A;  3KEY A;  1BN5 A;  1PYV A;  3WTW C;  1PUE E;  2QZ8 A;  1VQL I;  3KPH A;  5DM7 F;  2JWT A;  3AKZ A;  3ZQF A;  1SD5 A;  2KJC A;  4RB2 C;  3CF2 A;  3VWB A;  3PJR A;  3S3O A;  3ZXS A;  2A6H F;  4Y3O A;  4KYW A;  4BGD A;  2CQQ A;  4MGR A;  2X6Y A;  4KDP A;  5TRD A;  2G9W A;  2MC4 A;  1D5V A;  2KZG A;  5FRM A;  3OYB A;  4G12 A;  4N4O B;  3KEO A;  4YFK F;  2O61 A;  1CF7 A;  1ACI A;  1Y1V J;  4KT5 C;  2F2E A;  5GP9 A;  2VPL A;  5J1Y A;  4DNC A;  4Y4R A;  3VB2 A;  3QQA A;  1BIB A;  2V9P A;  3PL8 A;  2BYV E;  2DPD A;  2K27 A;  2Y9Y A;  1W0T A;  1PJR A;  1P7J A;  2QQ8 A;  4M73 A;  2I5U A;  5EJC A;  1RPW A;  1MD0 A;  4P9U A;  1IN8 A;  4HST A;  2MGQ A;  2PN6 A;  4J01 A;  1G3S A;  5FKK A;  2BHZ A;  3W2W A;  4A2U A;  1S7O A;  3TW6 A;  4GDF A;  2PMZ N;  3BZK A;  3OYF A;  3CF5 F;  3PFI A;  4U87 A;  2K3F A;  3K2Z A;  2EB7 A;  2EPF A;  1G2H A;  3HSR A;  2GM4 A;  3RYR A;  3CMM A;  2IA0 A;  4JX5 A;  3FBI B;  4GYG A;  2EV0 A;  3HRM A;  4ENJ A;  1GV5 A;  2MW8 A;  1WJF A;  3ZQQ A;  1KYW A;  3VEP A;  3FX3 A;  3U2R A;  2ESH A;  3C3W A;  2OU2 A;  1VQM I;  3HC7 A;  1JXS A;  2DBB A;  5IP7 J;  3OS1 A;  4XK4 A;  2UXN A;  1WHU A;  1EH6 A;  1AKH A;  3C7J A;  1GLN A;  4YFX F;  2CQX A;  3NWS A;  5B1B H;  5E1W A;  4PGH A;  2KT0 A;  3MWM A;  4EM2 A;  3AAF A;  2JA8 J;  1Z77 A;  4L18 B;  4II3 A;  5HVQ C;  1E3H A;  1GV2 A;  4D0P A;  1OYW A;  9ANT A;  1QBJ A;  3BT9 A;  4XBF A;  2D1V A;  2PG4 A;  5M5X J;  5A2Q Z;  2FUG 2;  3PUF A;  3S93 A;  3G4S I;  5B1A H;  2HVQ A;  2F5D A;  3GFL A;  3H5N A;  3TO6 A;  2GLO A;  1QHG A;  5DD4 A;  3HOS A;  2R7S A;  3S32 A;  2ME6 A;  3OMY A;  2F5F A;  4XKV A;  2F6C A;  1TNS A;  3NAR A;  4OOI A;  4AWX B;  1S3J A;  2DMQ A;  3GWZ A;  5HS9 A;  2O6G E;  4AD9 A;  4O5V A;  1FC3 A;  1GVD A;  3BDD A;  3A0B C;  4GO1 A;  1LE8 B;  5EZH A;  2FNP A;  1H89 C;  2IJL A;  2XGC A;  3ASO H;  2Z33 A;  3GFJ A;  2ZJP F;  3FK7 A;  4A3K J;  4A12 A;  4P5O A;  2EK5 A;  4ENN A;  2DCE A;  4CYC B;  1Y39 A;  2KFD A;  3CME I;  4C3I J;  3LL7 A;  1KQ9 A;  2E71 A;  3GXO A;  5F1J A;  1IN6 A;  3DP7 A;  3RKQ A;  3ZGK A;  2R5Z A;  3KEQ A;  4LIV A;  2AS5 F;  5GPA A;  4N0B A;  2XRN A;  3T8R A;  2H6C A;  1E3P A;  4G7Z F;  1HOM A;  4MIM A;  1RET A;  4UV9 A;  5ILU A;  1K4S A;  3BR6 A;  4KIT B;  1U8R A;  6PAX A;  3RQI A;  3SDG A;  1QU3 A;  1AWC A;  2Y75 A;  2I8D A;  4IHW A;  2CH0 A;  3I4P A;  1MKM A;  2VE8 A;  4XLC A;  1BJA A;  1FWZ A;  1LNW A;  3BPV A;  2EZH A;  2LRD A;  2RN7 A;  4KT6 A;  2XSD C;  1OYI A;  2DT5 A;  2CUZ A;  1MJB A;  1R1T A;  3H9J A;  2W25 A;  4GCV A;  4I02 A;  3FIS A;  2JTV A;  3GF2 A;  2QBY A;  2R5Y A;  5E1Z B;  2DA7 A;  3RSN A;  3SEQ A;  5J1U A;  2DFF A;  2HTS A;  4V2G A;  2VJ4 A;  5M5Y J;  2V9V A;  3BPX A;  2K9S A;  1R00 A;  5LHG A;  1X1A A;  2H8W A;  2DA2 A;  3FMS A;  3HXL A;  2L7F P;  1MBG A;  2BZT A;  2DK5 A;  1TWC J;  3BR3 A;  2K9L A;  1QVU A;  3OOU A;  4M3D A;  2HDC A;  5IYD J;  5GAE J;  2XSJ C;  3FKJ A;  3SXY A;  3VYR B;  1XDU A;  1SD6 A;  4A69 C;  5B5E C;  5L3G A;  1ZRD A;  2XHK A;  4XN0 A;  4DYC A;  4G9Y A;  3DF8 A;  4L9N A;  1OJL A;  3OYH A;  5FGM A;  2JQ7 A;  1MND A;  1KA8 A;  2NAZ A;  3L2R A;  2XAQ A;  4BH9 A;  2R3S A;  1UST A;  4AVZ A;  5DV5 A;  1MDM A;  2PQ8 A;  1A35 A;  2CJJ A;  3ZQC A;  4IHX A;  2LP0 A;  1QGP A;  5AON A;  2R7U A;  3CCR I;  2H1K A;  3KE2 A;  3FM3 A;  2MH2 A;  1BR2 A;  4HF0 A;  2Y30 A;  5IY5 H;  2H94 A;  5D5X B;  1FOY A;  2VT3 A;  2WWY A;  2E1M C;  4UVC A;  1MMD A;  1HBX G;  1JTY A;  2KQR A;  4B1R A;  4HQM A;  1JJ6 C;  2JMW A;  1B8I A;  4X1E A;  3HOV J;  4WK8 F;  3E0J B;  2ID6 A;  1SMY F;  4L0Y B;  1QPM A;  3WTU C;  2QYO A;  2WV0 A;  3RPU A;  2R7O A;  5HLG A;  5GTI C;  3DLL F;  2LVS A;  2E7X A;  4DYR A;  2MG4 A;  2QQ9 A;  3OYL A;  2R7Z J;  5DM6 F;  2HDD A;  2KRF A;  2FA5 A;  1UG0 A;  5E17 F;  1P7I A;  3V4G A;  1RRJ A;  4XN3 A;  3MAJ A;  1WWX A;  1SFO J;  4RDU A;  2V6E A;  2DQL A;  3K4N A;  4JBA A;  2KL4 A;  1O3R A;  3MD2 A;  1R6R A;  2RKH A;  1TTY A;  2YSR A;  2JT1 A;  3BTJ A;  2XPW A;  1IG7 A;  2WAE A;  3S1N J;  3OOP A;  4KNY A;  3JRD A;  1P2F A;  4XIC A;  2ADU A;  4OAY A;  1LJ9 A;  1Z21 A;  3IP4 B;  4FE7 A;  3FXJ A;  4RM3 A;  3PNY A;  5FKN A;  4BE2 A;  4I76 A;  5ICE A;  3GFI A;  4W1U A;  3JW4 A;  1TBX A;  1OCZ H;  2BVM A;  2WAQ N;  3HJE A;  3DEU A;  4A3G J;  4IX7 A;  1T8I A;  5M3M J;  3DKW A;  3RJP A;  5DDG A;  1WGX A;  2XF7 A;  4OMY A;  2FX0 A;  2VPR A;  3OIP A;  4JX4 A;  2WA0 A;  4A93 J;  3CUQ A;  4B09 A;  3IWZ A;  2M30 A;  4RAZ A;  3S1R J;  1C0W A;  3CCV I;  1QZZ A;  1U5T B;  1ON1 A;  2UZK A;  2M3A A;  2XF5 A;  5DCF A;  5DCM B;  3I59 A;  4IF4 A;  5KCM A;  5E20 A;  3GX4 X;  4ITV A;  2XGD A;  3CP2 A;  4BUP A;  4Y15 A;  2PMH A;  2DN0 A;  2BBY A;  3M1C A;  1SFU A;  1V4R A;  4IRH A;  4ZJZ A;  1KYZ A;  3JSO A;  2FF4 A;  1Y8R B;  2CW7 A;  2YX7 A;  2JUG A;  3CO7 C;  1NK2 P;  1TWF J;  1IDY A;  5LHH A;  4A3D J;  2NOG A;  2FSW A;  2TDX A;  2XVC A;  1OMI A;  3I53 A;  4HZF A;  1IAW A;  4FHT A;  3CQZ J;  1V54 H;  2WAF A;  4O6J A;  5D5W B;  4PFP A;  3ABL H;  4C2M J;  2PJR A;  3QOD A;  1U5T C;  3WU2 C;  3R6S A;  4XLP F;  3SYT A;  3KYD B;  1SVO A;  4A6D A;  1K6Y A;  1T98 A;  2MSY A;  1RC9 A;  4XRS A;  2Z99 A;  4PJJ A;  3GVA A;  1G3W A;  3NEU A;  1IRG A;  1WZ2 A;  3G73 A;  1Z05 A;  3CO6 C;  2K9Q A;  4NQW A;  2O5R A;  3Q9V A;  4XLA A;  5C3E J;  2O03 A;  5D4R A;  4JQF A;  2CU7 A;  3F6V A;  2COM A;  5LGU A;  1T2K A;  1WJ5 A;  3ABU A;  4V19 K;  1SMT A;  3C18 A;  2UV1 A;  3VSL A;  4KIC A;  3JCU C;  5CVJ A;  2QGU A;  3F6O A;  2EFW A;  1MBE A;  1T38 A;  4RMN A;  5HS7 A;  1W7P A;  3H9Q A;  5HLH A;  4GYI A;  1NG6 A;  1YI2 I;  1VQ9 I;  2EFN A;  2B7E A;  2O7O A;  4M3B A;  2Y69 H;  1SFK A;  1ZLK A;  1I6H J;  3JRG A;  2EFQ A;  2GBY A;  5EYR A;  2E60 A;  4PSW A;  4OIP F;  3BCB A;  1HF0 A;  2R7D A;  4BJT A;  4U7D A;  3ZPL A;  1DGR M;  2EBI A;  2EIL H;  3J80 K;  2HS5 A;  2FJ1 A;  4ZYD A;  1IV6 A;  3ZP5 A;  2HXI A;  4XRF A;  1AKH B;  3O8H A;  2V1D A;  3DU5 A;  2EJR A;  3H5A A;  1F1Z A;  3ESW B;  1FPQ A;  3HOU J;  1D8K A;  2A5W A;  4FT8 A;  5J6X A;  2KKO A;  1F5T A;  2V6C A;  2X51 A;  5LRS A;  2LRE A;  3T0Y A;  4EV0 A;  4Y7N J;  2KIS A;  2EA2 A;  1LQ1 A;  2LF7 A;  1N25 A;  2OZU A;  1A5J A;  2VBW A;  1V3F A;  4I0B A;  4HV5 A;  2OC6 A;  3CTA A;  3SFI A;  1MSE C;  1HW5 A;  1FOW A;  1REP C;  3ZMV A;  3FXO A;  5J8C A;  4MQ9 F;  5JLX A;  2LR8 A;  1BIA A;  1OPC A;  2DA5 A;  4ETS A;  1DP7 P;  1Z6R A;  3A1Y A;  1V5G A;  2LBF A;  5BPD A;  3OYJ A;  2MLK A;  5D8L B;  3S17 J;  4BJ6 C;  3HUG A;  2E2J J;  1ZQ3 P;  1YW8 A;  5GTH C;  4GFB A;  3PUB A;  2O3F A;  4YIR X;  2Y2Z A;  5ICF A;  1D0X A;  3WTT C;  2JA7 J;  1D1B A;  2EV5 A;  1JKP C;  5CVU A;  2KPM A;  2DDA A;  3TO9 A;  4NDL A;  3PO2 J;  3CCM I;  4OIN F;  4XSX F;  3QU6 A;  3OYI A;  3E1S A;  1YIJ I;  4I0A A;  2R7V A;  2QCO A;  4AU7 A;  4EVI A;  2QM3 A;  1V5F A;  3HGG A;  4RB1 A;  2O0Y A;  3VOD A;  4BDZ A;  2LF8 A;  4JP0 A;  5K5R A;  2WC2 A;  2R7Q A;  3G3Z A;  5GAD J;  3GTM J;  3L2W A;  4EQQ A;  2R92 J;  4PJN A;  2F4I A;  2M9H A;  3HOW J;  5EEG A;  2RV8 A;  2DOF A;  2KMU A;  1WH5 A;  2VAS A;  4U0V A;  5EG0 A;  5KVR A;  1I39 A;  4CGZ A;  1Z1D A;  3FMR A;  1WVR A;  3I64 A;  4HNU A;  3KP7 A;  5IT3 A;  4RGX A;  4C2T A;  1U78 A;  1PDN C;  1QRY A;  4HNV A;  4MEX F;  1TC3 C;  3HHG A;  3AFH A;  3HHH A;  2R5Y B;  2QBY B;  3ZMT A;  3IWF A;  1LDJ A;  3IKV A;  1BW6 A;  2Y48 A;  2GXA A;  1UB9 A;  1PUF B;  4E7S A;  2K40 A;  2EWN A;  4XSZ F;  5FKL A;  4K2E A;  1P4X A;  3HTU A;  3BOQ A;  2HQN A;  2ZSH B;  1F4K A;  1X3W B;  1AU7 A;  2XF6 A;  4B47 A;  4EJO A;  2F5V A;  2EQR A;  3K10 A;  2HQR A; 
#chains in the Genus database with same CATH homology
 1ZGA A;  3J7A O;  1QO0 D;  2EFO A;  4I7H A;  1I27 A;  1A04 A;  3I71 A;  3E6D A;  3QU3 A;  2ZO4 A;  2STW A;  2L3D A;  3BP8 A;  3WOD F;  4KMU X;  4U7B A;  1MDM B;  3ECO A;  2FEZ A;  5DUI A;  1XGS A;  2FOK A;  2BE5 F;  1Z9C A;  2ESN A;  4HF1 A;  2GXG A;  3EQL F;  3SZT A;  3K0L A;  2CWE A;  4BHB A;  4G7H F;  3BRO A;  2D1H A;  3ZMZ A;  3EET A;  2DK8 A;  1IRF A;  3IRR A;  2ZKZ A;  1GVJ A;  2HOE A;  3PQK A;  2VE9 A;  1FT9 A;  1IZ1 A;  1G4D A;  3DV8 A;  2W24 A;  2O8X A;  2A69 F;  1XCB A;  3ECH A;  4KIF A;  3VOE A;  1ZN2 A;  3R0A A;  1CGP A;  1SD7 A;  3JTH A;  1IXC A;  4TV7 A;  5LHI A;  1ZRE A;  1B59 A;  5ILV A;  3JTG A;  4LD5 A;  3KZY A;  5L3D A;  4HDV A;  3WTV C;  3CUQ B;  2HTJ A;  3I5U A;  5A2Q K;  3BY6 A;  3I0T A;  2GIV A;  2HYG D;  2WTE A;  2XV4 S;  3F8N A;  4M9X A;  3TDZ C;  4DQ2 A;  3I54 A;  1K79 A;  1R22 A;  3JAM Z;  3ZN0 A;  3LA3 A;  1FBU A;  1B9N A;  3F8M A;  5CLS A;  1I1S A;  2QEN A;  4HLY A;  4MTE A;  3EUH A;  4R1H A;  1FYM A;  2IA1 A;  2UXX A;  3CUQ C;  3CJN A;  2OZ6 A;  2OBP A;  5HDG A;  2FBK A;  4FX0 A;  3E97 A;  2CG4 A;  3FMQ A;  4EM1 A;  2QUF A;  2D2W A;  5D6F A;  1Z6T A;  2ZFW A;  2VOP A;  3R0J A;  2XAF A;  2FQ3 A;  1BI2 A;  2F5C A;  3MZH A;  3WTX C;  1ZG5 A;  1LDD A;  4HQE A;  1JHH A;  1X3U A;  1KU3 A;  3KP6 A;  4KFC A;  4WXH A;  1YYV A;  1TLH B;  4BAY A;  3W6K B;  1W7P B;  5HDK A;  3Q9S A;  3LA2 A;  4NB5 A;  5BMZ A;  3B73 A;  3KP3 A;  3R61 A;  3LST A;  2BEO A;  2FML A;  1IW7 F;  1BI1 A;  2G7U A;  2J5O A;  3TDU C;  5FLX K;  2PLY A;  1AOY A;  3FF5 A;  4N9I A;  4A0Z A;  4CXF A;  2CGP A;  3GYH X;  2ZCW A;  4ENK A;  4ZH4 F;  5ERI A;  1K7A A;  5K5Q A;  4I09 A;  3GLX A;  2PJP A;  4HX4 A;  4EGZ A;  3LAP A;  5K5O A;  4HBL A;  2HR3 A;  4CHU A;  3HRS A;  3FXR A;  1R58 A;  3B02 A;  1O3Q A;  3ML6 A;  1YG2 A;  2NYX A;  3C1D A;  1USS A;  3GFM A;  2AXL A;  1O3S A;  1ODD A;  2OA4 A;  3IHU A;  3L9F A;  4UV8 A;  1ZAR A;  4UHT A;  2RDP A;  5IT9 K;  3V7C A;  4CIC A;  4EJU A;  1R23 A;  4ZZL A;  3F21 A;  1MJ9 A;  3D5L A;  3HYI A;  4EJT A;  3KFW X;  2OQG A;  1KU7 A;  4HDU A;  1EH8 A;  2VN2 A;  3K1M A;  3RIR A;  4UUV A;  4HW0 A;  3L09 A;  5HOO A;  4QLC U;  2YPR A;  4S05 A;  2X0L A;  3ZN1 A;  5FD5 A;  4BNC A;  1I5Z A;  5BQT A;  2V1X A;  4LK0 F;  4P55 A;  3ERE D;  4OU0 A;  2EA4 A;  3DPL C;  4M9S A;  1QQI A;  4RGS A;  2VC0 A;  3V8L A;  1HXD A;  3R4K A;  3P9K A;  3J81 K;  1R1V A;  3WE3 A;  3V7S A;  5CVI A;  2K4J A;  2VBZ A;  4LK1 F;  2FE3 A;  3F8F A;  4HV6 A;  3WE2 A;  3F3X A;  2L4M A;  1J9I A;  3M8F A;  1RUO A;  3F23 A;  3N97 A;  2EFP A;  3SZP A;  1XGM A;  2ELH A;  2RGV A;  3M1E A;  4NHJ A;  3WU1 B;  2XIG A;  2IVM A;  2P8T A;  2K4B A;  5BOX A;  1H9T A;  3BJ6 A;  2CO5 A;  2XRO A;  4RB0 A;  1T0F A;  3M8E A;  4LG0 B;  2A07 F;  2MC3 A;  4L5J A;  1YTY A;  4IJA A;  3WGG A;  4I98 B;  2CFX A;  4Y17 A;  1FYK A;  3WGH A;  3ZMS A;  2GA2 A;  4WF2 A;  1QZY A;  3F8B A;  4IPA A;  1O7L A;  5FO5 A;  1T39 A;  3M9A A;  4KA4 A;  4IVN A;  5KK1 A;  2FBI A;  2P6S A;  2QLZ A;  1U6G A;  2KJB A;  4PCQ A;  4RGR A;  4KN4 X;  2HZT A;  4AVP A;  4RB3 C;  5L3F A;  2VBY A;  1LB2 A;  4WX9 A;  2A3S A;  4GGG A;  5HLI A;  2RQP A;  1ZAO A;  4OIR F;  1CF7 B;  3HSF A;  2NNY A;  2FRH A;  3MZY A;  5LGT A;  5D6E A;  3H3Z A;  1HKQ A;  2M8E A;  3E6B A;  1ON2 A;  3EYI A;  2LNB A;  3FM5 A;  1SFE A;  5AIP A;  4R8H A;  3U1D A;  2FBH A;  4Q47 A;  2FXA A;  4G6Q A;  5HDN A;  4A0Y A;  2XUB A;  4L9V A;  4BYY A;  4KUM A;  3O3K A;  5ED4 A;  4I01 A;  3F22 A;  5F1R A;  4EGY A;  1P4W A;  1FBS A;  2J5P A;  4L9J A;  1FLI A;  3QOP A;  2C6Y A;  1ZYR F;  2L02 A;  4E70 A;  2YU3 A;  3IL2 A;  3K9T A;  2VXZ A;  2JPB A;  1MGT A;  2ZME A;  4CDG A;  4ZYG A;  3WU0 A;  3FZV A;  4G94 A;  3S2W A;  1FX7 A;  1YQA A;  1I6X A;  5LEK A;  5JR3 A;  2CW0 F;  1OYY A;  2FNA A;  4LLN A;  4WXD A;  1DPR A;  4OMZ A;  3E5Q A;  4LB5 A;  2KIU A;  4RS8 A;  3KCC A;  2GZW A;  4P9F A;  1P6R A;  1HSJ A;  3QPH A;  2ACJ A;  3TOA A;  3GO5 A;  3RDI A;  2VT2 A;  4L0Z B;  1B6A A;  2HFH A;  4BXU A;  3LQR A;  2CYY A;  4Q48 A;  1E17 A;  2NS0 A;  1DDN A;  3V8J A;  1IXR C;  4EMS A;  1ZG3 A;  3E5X A;  4YFN F;  2MH9 A;  5JVT A;  1JHF A;  2MLG A;  1ZHF A;  1D3Y A;  2P4W A;  5ILS A;  2LSO A;  2XAH A;  2JZY A;  3I58 A;  5BS6 A;  4XLN F;  3J80 Z;  2DW4 A;  2JSC A;  1XDS A;  3M7G A;  2LDU A;  2DI3 A;  4AIJ A;  3W6J B;  3JAM K;  1K78 A;  2M45 A;  1WSU A;  3DXJ F;  1H9G A;  3CLO A;  4A5N A;  1YS6 A;  5JHU A;  1HW2 A;  1OR7 A;  2QWW A;  3FXU A;  3WG9 A;  2F5E A;  2HWV A;  5L3C A;  3L00 A;  4EJW A;  1GHC A;  3PQJ A;  2GXB A;  1E2X A;  1SFX A;  4UVB A;  2R7F A;  5D5U B;  2QQB A;  2OQR A;  1R7J A;  3FWE A;  4GXO A;  1UHW A;  5CJ9 A;  3KP5 A;  2K86 A;  4IRG A;  5D8K B;  5LEJ A;  3ZQ7 A;  5EEH A;  1XB4 A;  2A61 A;  3E3V A;  4UNO A;  2HYF A;  1I1G A;  4L5I A;  2W85 A;  4YIF A;  5JI6 A;  1K6O A;  4H0E A;  2ZJ2 A;  4IHS A;  3R60 A;  1G3T A;  3KET A;  2STT A;  5J8F A;  3RYP A;  2K7L A;  4EJV A;  2Z9O A;  1JGS A;  1G6N A;  3HRT A;  3E6C C;  1XSD A;  4Z2Y A;  5FFX A;  1G3Y A;  2D45 A;  3CDH A;  2IPQ X;  1O3T A;  4N9H A;  4U0W A;  3IC7 A;  3I59 B;  3FXQ A;  1B1B A;  2HGC A;  4ZYH A;  5LGN A;  2HKO A;  4ON0 A;  3T8T A;  1TW2 A;  4F7Z A;  3BJO A;  1KU2 A;  3IKT A;  3LQQ A;  4KMF A;  3KLN A;  2QVO A;  1FOK A;  1XGN A;  4ESJ A;  2H09 A;  5FFZ A;  2XKP A;  1BOA A;  4YII A;  2VOD A;  4HAM A;  1YO5 C;  1J0R A;  2DO7 A;  3ROU A;  2PFB A;  2BGC A;  3K1P A;  3GZ6 A;  1TNT A;  2IW5 A;  4WWC A;  1LEB A;  1TQI A;  2P5L C;  1ZG1 A;  2HEO A;  3LA7 A;  2Z3Y A;  4HOB A;  3P9I A;  3ABT A;  1XMK A;  3LFK A;  4A0X A;  4Q4Z F;  3ELK A;  2JRT A;  4PDK A;  2PBI A;  2E1N A;  4O3M A;  1HW1 A;  2VON A;  1UCR A;  1SD4 A;  4RAY A;  2V1U A;  1KGS A;  4M6Y A;  4IXA A;  4ENM A;  3V8K A;  1P92 A;  4AIK A;  4Y13 A;  3NQO A;  4S04 A;  4HX8 A;  1IN4 A;  4IHT A;  1XSV A;  1P4A A;  5H6R A;  5L3E A;  5DUK A;  2A68 F;  1F9N A;  3E5U A;  4ASN A;  1Z91 A;  1O57 A;  4MQV A;  2FU4 A;  1ZH5 A;  5TJJ A;  1IN7 A;  3HRU A;  4EM0 B;  3P9C A;  3TGN A;  3QP5 A;  2ZME B;  3REO A;  5CVV A;  1FBQ A;  4A6E A;  1J2X A;  2L54 A;  4I2O A;  2PI0 A;  4MHG A;  2L4A A;  3Q5F A;  2GAU A;  1XD7 A;  4ESF A;  2Q0O A;  4B8X A;  1MZB A;  1XGO A;  3JSP A;  4RGU A;  2DTR A;  2NNN A;  1IF1 A;  3TO7 A;  1W5T A;  1J75 A;  2RVC A;  1XMA A;  2V79 A;  3GEZ A;  2IA2 A;  2A6E F;  4HYE A;  1W7P D;  5FD6 A;  3TQN A;  2FMY A;  4R79 A;  4G6D A;  1NHA A;  1GXP A;  1W4M A;  1IXS B;  1TQM A;  4U88 A;  4LLG F;  5HS8 A;  3QPT A;  4BHP A;  4LMY A;  2ETH A;  3HIF A;  3OV8 A;  3IRQ A;  1YFH A;  2EV6 A;  2DPU A;  3EDP A;  3KZZ A;  2VBX A;  2DFI A;  2YR2 A;  3QP6 A;  4HF2 A;  4LFU A;  1STZ A;  3WTY C;  1BI3 A;  3O2P E;  1B9M A;  3SHF A;  4CYD A;  1IN5 A;  2W84 A;  1HQC A;  3ISP A;  5FLX Z;  2W57 A;  1BBY A;  3GW2 A;  1RI7 A;  4HA8 A;  1K78 B;  1JE8 A;  2DLL A;  3NRV A;  5F6F A;  1O7F A;  4MNU A;  2JPC A;  1BI0 A;  3BWG A;  4BHC A;  1U3E M;  2X4H A;  1LDK B;  1GXQ A;  1DPU A;  2XAJ A;  2MA3 A;  4G8X A;  2H27 A;  2XAG A;  1UHM A;  3MCZ A;  2E1C A;  2ZBK A;  5H20 A;  5AIQ A;  3ZMU A;  4CO8 A;  5DYM A;  4ESB A;  1J59 A;  1FP1 D;  5E8G A;  1KU9 A;  2M5W A;  4UXN A;  2XGX A;  3K69 A;  3T1B A;  2ISZ A;  2KIM A;  1LEA A;  2XKO A;  4HX7 A;  1SAX A;  5IT9 Z;  1UFM A;  2XAS A;  2Z5U A;  1Q1H A;  4LLL A;  3LWF A;  5DEQ A;  2DAO A;  5F64 A;  2NRA C;  3DFG A;  5DD8 A;  1MJA A;  1R36 A;  1W5S A;  2M1B A;  1J7K A;  5E8I A;  1T6S A;  1KQ0 A;  1XN7 A;  1WKM A;  2YX4 A;  4PGG A;  5L3B A;  1RZ4 A;  2H6B A;  5H6Q A;  2L01 A;  3RKW A;  2Y0M A;  3O6B B;  4G7O F;  3J81 Z;  1PP8 F;  1S29 A;  4QWQ A;  1D8J A;  3RTR A;  3COA C;  1QNT A;  4M6X A;  1BM9 A;  1ZRF A;  3L2C A;  1L3L A;  4BQA A;  3GUD A;  2DQR A;  4MTD A;  3SFZ A;  2E7W A;  2P5K A;  1H0M A;  4M71 A;  2RC4 A;  3D0S A;  3HSE A;  2IP2 A;  4LJZ F;  1XCV A;  1FP2 A;  5E1X A;  4HLX A;  4L9T A;  1RNL A;  3ZMD A;  3T5X A;  5D5V B;  3CUO A;  3QAH A;  4UVA A;  5JFR A;  1TW3 A;  2PMU A;  1YS7 A;  1YIO A;  3TKY A;  5ICC A;  5ICG A;  1ZGJ A;  2IRF G;  5K1Y A;  1TQP A;  2Q8K A;  1EV7 A;  4M9Z A;  2ZXJ A;  3F72 A;  1ZLJ A;  5CVR A;  3RKY A;  2Q2E A;  2B0L A;  2VC1 A;  3GZ5 A;  4FX4 A;  4CZZ A;  3SQN A;  3WGI A;  1U2W A;  5LBQ A;  3MFK A;  2QQA A;  2P7C B;  3E6M A;  3KP4 A;  1FYL A;  2MD5 A;  4WXC A;  2P5V A;  1PP7 U;  3WTS C;  2A5Y B;  2HKX A;  3TOB A;  1Y0U A;  3FHZ A;  3DQV C;  3F8C A;  2UWM A;  5FB2 A;  5CYV A;  2ZNY A;  2G7H A;  5LLQ A;  3RKX A;  3P7N A;  2LKP A;  3ULQ B;  2MBF A;  4M74 A;  1ZRC A;  1EH7 A;  1S8N A;  1HKT A;  1LVA A;  3K1N A;  4ZZD A;  1BC7 C;  4AIH A;  1FY7 A;  4P96 A;  4LB6 B;  4YG2 F;  1DUX C;  3V7R A;  1BC8 C;  4JK1 X;  2CSO A;  3U9G A;  3MQ0 A;  2M87 A;  2K02 A;  1R1U A;  2ISY A;  1YLF A;  3H3U A;  2IT0 A;  2BV6 A;  2DU9 A;  1IUY A;  4OIQ F;  4PZJ A;  1FZP B;  1S6L A;  1OKR A;  3RPQ A;  4IRI A;  1KQ8 A;  5E18 F;  4U0Y A;  3HOT A;  3MEX A;  3H92 A;  5D4S A;  3VFZ A;  2P7V B;  5LRR A;  4A5M A;  2PEX A;  3WTZ A;  1VTN C;  1YW9 A;  4KIG A;  1XSX A;  2KIF A;  3N4M A;  2RNJ A;  1Z7U A;  1S7A A;  3EYY A;  3KLO A;  1FSH A;  1HST A;  1ONV A;  2OD5 A;  1J5Y A;  2GWR A;  1ULY A;  1RIO H;  1B4A A;  3KP2 A;  3HTS B;  2GA1 A;  3L7W A;  1HKS A;  2P6T A;  2VOO A;  1R5G A;  3DPT A;  4OIO F;  4LG0 A;  4ZYE A;  4KIB A;  4WCG A;  5BPI A;  2ZNZ A;  4M72 A;  1WRJ A;  1RUN A;  2GQQ A;  1L0O C;  4LGW A;  1WI9 A;  1U5T A;  3RI4 A;  3QRF F;  1FSE A;  5DCM A;  1R5H A;  4KN7 X;  3LAJ A;  2OAZ A;  1WQ2 A;  3BJA A;  3BZ6 A;  1FNN A;  1YW7 A;  4Q5S F;  2CQK A;  4MEY F;  1BN5 A;  3WTW C;  1PUE E;  2QZ8 A;  1SD5 A;  2KJC A;  4RB2 C;  2A6H F;  4KYW A;  4MGR A;  4KDP A;  5TRD A;  2G9W A;  1D5V A;  3KEO A;  4YFK F;  2O61 A;  1CF7 A;  4KT5 C;  2F2E A;  4DNC A;  3VB2 A;  1BIB A;  2BYV E;  2DPD A;  2K27 A;  4M73 A;  1MD0 A;  4P9U A;  1IN8 A;  2PN6 A;  1G3S A;  4A2U A;  1S7O A;  3PFI A;  3K2Z A;  2EB7 A;  3HSR A;  3RYR A;  2IA0 A;  4GYG A;  2EV0 A;  3HRM A;  4ENJ A;  1KYW A;  3VEP A;  3FX3 A;  3U2R A;  2ESH A;  3C3W A;  2OU2 A;  1JXS A;  2DBB A;  2UXN A;  1EH6 A;  3C7J A;  4YFX F;  5E1W A;  4PGH A;  3MWM A;  4EM2 A;  3AAF A;  4L18 B;  5HVQ C;  4D0P A;  1OYW A;  1QBJ A;  4XBF A;  2D1V A;  2PG4 A;  5A2Q Z;  3GFL A;  2F5D A;  3TO6 A;  5DD4 A;  3HOS A;  2F5F A;  1TNS A;  4OOI A;  4AWX B;  1S3J A;  3GWZ A;  5HS9 A;  2O6G E;  4AD9 A;  4O5V A;  1FC3 A;  3BDD A;  4GO1 A;  2FNP A;  2IJL A;  2Z33 A;  3GFJ A;  4A12 A;  4P5O A;  2EK5 A;  4ENN A;  1KQ9 A;  3GXO A;  1IN6 A;  3DP7 A;  3KEQ A;  2AS5 F;  4N0B A;  2XRN A;  3T8R A;  2H6C A;  4G7Z F;  4UV9 A;  5ILU A;  1U8R A;  6PAX A;  1AWC A;  2Y75 A;  3I4P A;  1MKM A;  2VE8 A;  1BJA A;  1FWZ A;  1LNW A;  3BPV A;  2RN7 A;  1OYI A;  2DT5 A;  1MJB A;  1R1T A;  2W25 A;  4GCV A;  4I02 A;  2JTV A;  3GF2 A;  2QBY A;  5E1Z B;  2HTS A;  2V9V A;  3BPX A;  1R00 A;  5LHG A;  3FMS A;  2DK5 A;  2HDC A;  3SXY A;  1XDU A;  1SD6 A;  5L3G A;  1ZRD A;  2XHK A;  4G9Y A;  3DF8 A;  4L9N A;  5FGM A;  1KA8 A;  2NAZ A;  2XAQ A;  4BH9 A;  2R3S A;  1UST A;  5DV5 A;  1MDM A;  2PQ8 A;  1QGP A;  5AON A;  3KE2 A;  3FM3 A;  2MH2 A;  4HF0 A;  5D5X B;  2H94 A;  2VT3 A;  2WWY A;  4UVC A;  1HBX G;  4HQM A;  4WK8 F;  1SMY F;  4L0Y B;  1QPM A;  3WTU C;  2QYO A;  2WV0 A;  3RPU A;  5HLG A;  2E7X A;  2QQ9 A;  2KRF A;  2FA5 A;  5E17 F;  3V4G A;  3MAJ A;  1WWX A;  2DQL A;  4JBA A;  1O3R A;  2RKH A;  1TTY A;  2YSR A;  2JT1 A;  3OOP A;  4KNY A;  1P2F A;  2ADU A;  1LJ9 A;  3GFI A;  5ICE A;  3JW4 A;  1TBX A;  3DEU A;  3DKW A;  3RJP A;  5DDG A;  4OMY A;  3CUQ A;  4B09 A;  3IWZ A;  2M30 A;  4RAZ A;  1C0W A;  1QZZ A;  1U5T B;  1ON1 A;  2UZK A;  5DCF A;  5DCM B;  3I59 A;  4IF4 A;  5E20 A;  3GX4 X;  4Y15 A;  2PMH A;  2BBY A;  1SFU A;  1V4R A;  4IRH A;  1KYZ A;  3JSO A;  2FF4 A;  2YX7 A;  3CO7 C;  5LHH A;  2FSW A;  2TDX A;  2XVC A;  1OMI A;  3I53 A;  4HZF A;  1IAW A;  4FHT A;  5D5W B;  4O6J A;  1U5T C;  3R6S A;  4XLP F;  4A6D A;  1T98 A;  2Z99 A;  3GVA A;  1G3W A;  3NEU A;  1IRG A;  3G73 A;  1Z05 A;  3CO6 C;  4NQW A;  3Q9V A;  2O03 A;  5D4R A;  4JQF A;  3F6V A;  2COM A;  5LGU A;  1T2K A;  3ABU A;  1SMT A;  3C18 A;  4KIC A;  5CVJ A;  3F6O A;  2EFW A;  1T38 A;  5HS7 A;  1W7P A;  5HLH A;  4GYI A;  2EFN A;  1ZLK A;  2EFQ A;  4OIP F;  2R7D A;  4U7D A;  3ZPL A;  3J80 K;  2HS5 A;  4ZYD A;  3ZP5 A;  4XRF A;  2V1D A;  2EJR A;  1F1Z A;  1FPQ A;  1D8K A;  4FT8 A;  5J6X A;  2KKO A;  1F5T A;  2V6C A;  5LRS A;  3T0Y A;  4EV0 A;  2EA2 A;  1LQ1 A;  2LF7 A;  2OZU A;  2VBW A;  1V3F A;  4I0B A;  4HV5 A;  3CTA A;  1HW5 A;  1REP C;  3ZMV A;  5J8C A;  4MQ9 F;  1BIA A;  1OPC A;  4ETS A;  1DP7 P;  1Z6R A;  5BPD A;  2MLK A;  5D8L B;  3HUG A;  1YW8 A;  2O3F A;  5ICF A;  3WTT C;  2EV5 A;  5CVU A;  3TO9 A;  4OIN F;  4XSX F;  3QU6 A;  4I0A A;  4EVI A;  2QM3 A;  4RB1 A;  2O0Y A;  3VOD A;  2LF8 A;  5K5R A;  2WC2 A;  3G3Z A;  4EQQ A;  5EEG A;  2RV8 A;  4U0V A;  5KVR A;  4CGZ A;  1Z1D A;  3FMR A;  3I64 A;  3KP7 A;  5IT3 A;  4RGX A;  1U78 A;  1PDN C;  4MEX F;  3HHG A;  3HHH A;  2QBY B;  3ZMT A;  3IWF A;  1LDJ A;  3IKV A;  2Y48 A;  1UB9 A;  2EWN A;  4XSZ F;  4K2E A;  1P4X A;  3HTU A;  3BOQ A;  2HQN A;  1F4K A;  4EJO A;  2HQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...