2W8GA

Aplysia californica achbp bound to in silico compound 35
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
pubmed doi rcsb
molecule tags Receptor
total genus 49
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2w8gA00
4ZRUA 5FJVA 3UU3A 5AFNA 2BYRA 2PGZA 2WZYA 3RIFA 5HCMA 2W8GA 5AFJA 5KZUA 2YMDA 4TNWA 2W8FA 5HEGA 4UM3A 5BW2A 4PIRA 3C79A 5SYOA 3WTHA 3SQ9A 3SIOA 5L4HA 3TLTA 2XNUA 3U8MA 2XQ8A 5CO5A 4ZZCA 4QAAA 4HFBA 4XHEA 2ZJVA 3U8KA 4A97A 4ZR6A 4UXUA 4BQTA 3TLVA 4UY2A 2C9TA 4HFDA 3RQUA 3UUBA 2UZ6A 3PMZA 4NPPA 3EHZA 3PEOA 4IL9A 4HFIA 4Z90A 2WNCA 2YOEA 2XNTA 2Y57A 4ILAA 4WV9A 3UU8A 5IUXA 4QH4A 4UM3P 2YN6A 4X5TA 3WTOA 4EZ1A 2WN9A 3IGQA 4HFEA 4TNVA 2XZ5A 4XK9A 5HEHA 5J5IA 3WTLA 2BG9E 1UV6A 5BRXA 3ZDHA 3UU4A 4HQPA 5AFMA 3P50A 3ZDGA 4ALXA 5AFLA 3LSVA 2BYSA 3TLSA 3T4MA 2XQ6A 2QC1B 2BYQA 2BG9A 3P4WA 4QABA 5J0ZA 4DBMA 1UW6A 5AFMB 2XZ6A 5HCJA 2XQ3A 4IL4A 2XQ4A 5HEJA 4FRRA 4QACA 5HEUA 3U8JA 3U8LA 2BG9B 3WTKA 3WTNA 2BR8A 2VL0A 2XQ5A 2WNLA 3UU5A 3JAEA 3C84A 4NZBA 2ZJUA 2XQ9A 4ILCA 3ZKRA 2YKSA 5J5FA 4HFCA 2Y7YA 5J5GA 3RI5A 3RIAA 1I9BA 3UU6A 4ZK1A 2PH9A 4ZZBA 3GUAA 1UX2A 5J5HA 5LG3A 2XQ7A 5L47A 3TLUA 3WTJA 2BYNA 3UQ7A 4ZK4A 2X00D 4LMKA 4TWDA 5HEOA 4F8HA 4QH5A 5AINA 2XYTA 3RQWA 2XYSA 4AFHA 3EI0A 3U8NA 5KE4A 2Y56A 4LMLA 5L4EA 5AFKA 4B5DA 2Y54A 4QH1A 2YMEA 5LXBA 4D01A 4ZJTA 4LMJA 2Y58A 4Z91A 2BYPA 3WIPA 2WNJA 4AFGA 4UM3S 3SQ6A 3UQ4A 2XNVA 3WTMA 3EAMA 4AFTA 4BFQA 2XQAA 5AFHA 2BG9C 4UM1A 3RHWA 3TLWA 4A98A 3JAFA 3JADA 4IREA 4TWHA 2BJ0A 2X00A 5TVCA 3SH1A 4TWFA 2BR7A 5BP0A 3WTIA 4COFA 5CFBA 4ZJSA 4ILBA 5JMEA 4HFHA
chains in the Genus database with same CATH superfamily
4ZRUA 5FJVA 3UU3A 5AFNA 2BYRA 2PGZA 2WZYA 3RIFA 5HCMA 2W8GA 5AFJA 5KZUA 2YMDA 4TNWA 2W8FA 5HEGA 4UM3A 5BW2A 4PIRA 3C79A 5SYOA 3WTHA 3SQ9A 3SIOA 5L4HA 3TLTA 2XNUA 3U8MA 2XQ8A 5CO5A 4ZZCA 4QAAA 4HFBA 4XHEA 2ZJVA 3U8KA 4A97A 4ZR6A 4UXUA 4BQTA 3TLVA 4UY2A 2C9TA 4HFDA 3RQUA 3UUBA 2UZ6A 3PMZA 4NPPA 3EHZA 3PEOA 4IL9A 4HFIA 4Z90A 2WNCA 2YOEA 2XNTA 2Y57A 4ILAA 4WV9A 3UU8A 5IUXA 4QH4A 4UM3P 2YN6A 4X5TA 3WTOA 4EZ1A 2WN9A 3IGQA 4HFEA 4TNVA 2XZ5A 4XK9A 5HEHA 5J5IA 3WTLA 2BG9E 1UV6A 5BRXA 3ZDHA 3UU4A 4HQPA 5AFMA 3P50A 3ZDGA 4ALXA 5AFLA 3LSVA 2BYSA 3TLSA 3T4MA 2XQ6A 2QC1B 2BYQA 2BG9A 3P4WA 4QABA 5J0ZA 4DBMA 1UW6A 5AFMB 2XZ6A 5HCJA 2XQ3A 4IL4A 2XQ4A 5HEJA 4FRRA 4QACA 5HEUA 3U8JA 3U8LA 2BG9B 3WTKA 3WTNA 2BR8A 2VL0A 2XQ5A 2WNLA 3UU5A 3JAEA 3C84A 4NZBA 2ZJUA 2XQ9A 4ILCA 3ZKRA 2YKSA 5J5FA 4HFCA 2Y7YA 5J5GA 3RI5A 3RIAA 1I9BA 3UU6A 4ZK1A 2PH9A 4ZZBA 3GUAA 1UX2A 5J5HA 5LG3A 2XQ7A 5L47A 3TLUA 3WTJA 2BYNA 3UQ7A 4ZK4A 2X00D 4LMKA 4TWDA 5HEOA 4F8HA 4QH5A 5AINA 2XYTA 3RQWA 2XYSA 4AFHA 3EI0A 3U8NA 5KE4A 2Y56A 4LMLA 5L4EA 5AFKA 4B5DA 2Y54A 4QH1A 2YMEA 5LXBA 4D01A 4ZJTA 4LMJA 2Y58A 4Z91A 2BYPA 3WIPA 2WNJA 4AFGA 4UM3S 3SQ6A 3UQ4A 2XNVA 3WTMA 3EAMA 4AFTA 4BFQA 2XQAA 5AFHA 2BG9C 4UM1A 3RHWA 3TLWA 4A98A 3JAFA 3JADA 4IREA 4TWHA 2BJ0A 2X00A 5TVCA 3SH1A 4TWFA 2BR7A 5BP0A 3WTIA 4COFA 5CFBA 4ZJSA 4ILBA 5JMEA 4HFHA
chains in the Genus database with same CATH topology
4ZRUA 5FJVA 3UU3A 5AFNA 2BYRA 2PGZA 2WZYA 3RIFA 5HCMA 2W8GA 5AFJA 5KZUA 2YMDA 4TNWA 2W8FA 5HEGA 4UM3A 5BW2A 4PIRA 3C79A 5SYOA 3WTHA 3SQ9A 3SIOA 5L4HA 3TLTA 2XNUA 3U8MA 2XQ8A 5CO5A 4ZZCA 4QAAA 4HFBA 4XHEA 2ZJVA 3U8KA 4A97A 4ZR6A 4UXUA 4BQTA 3TLVA 4UY2A 2C9TA 4HFDA 3RQUA 3UUBA 2UZ6A 3PMZA 4NPPA 3EHZA 3PEOA 4IL9A 4HFIA 4Z90A 2WNCA 2YOEA 2XNTA 2Y57A 4ILAA 4WV9A 3UU8A 5IUXA 4QH4A 4UM3P 2YN6A 4X5TA 3WTOA 4EZ1A 2WN9A 3IGQA 4HFEA 4TNVA 2XZ5A 4XK9A 5HEHA 5J5IA 3WTLA 2BG9E 1UV6A 5BRXA 3ZDHA 3UU4A 4HQPA 5AFMA 3P50A 3ZDGA 4ALXA 5AFLA 3LSVA 2BYSA 3TLSA 3T4MA 2XQ6A 2QC1B 2BYQA 2BG9A 3P4WA 4QABA 5J0ZA 4DBMA 1UW6A 5AFMB 2XZ6A 5HCJA 2XQ3A 4IL4A 2XQ4A 5HEJA 4FRRA 4QACA 5HEUA 3U8JA 3U8LA 2BG9B 3WTKA 3WTNA 2BR8A 2VL0A 2XQ5A 2WNLA 3UU5A 3JAEA 3C84A 4NZBA 2ZJUA 2XQ9A 4ILCA 3ZKRA 2YKSA 5J5FA 4HFCA 2Y7YA 5J5GA 3RI5A 3RIAA 1I9BA 3UU6A 4ZK1A 2PH9A 4ZZBA 3GUAA 1UX2A 5J5HA 5LG3A 2XQ7A 5L47A 3TLUA 3WTJA 2BYNA 3UQ7A 4ZK4A 2X00D 4LMKA 4TWDA 5HEOA 4F8HA 4QH5A 5AINA 2XYTA 3RQWA 2XYSA 4AFHA 3EI0A 3U8NA 5KE4A 2Y56A 4LMLA 5L4EA 5AFKA 4B5DA 2Y54A 4QH1A 2YMEA 5LXBA 4D01A 4ZJTA 4LMJA 2Y58A 4Z91A 2BYPA 3WIPA 2WNJA 4AFGA 4UM3S 3SQ6A 3UQ4A 2XNVA 3WTMA 3EAMA 4AFTA 4BFQA 2XQAA 5AFHA 2BG9C 4UM1A 3RHWA 3TLWA 4A98A 3JAFA 3JADA 4IREA 4TWHA 2BJ0A 2X00A 5TVCA 3SH1A 4TWFA 2BR7A 5BP0A 3WTIA 4COFA 5CFBA 4ZJSA 4ILBA 5JMEA 4HFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRU A;  5FJV A;  3UU3 A;  5AFN A;  2BYR A;  2PGZ A;  2WZY A;  3RIF A;  5HCM A;  2W8G A;  5AFJ A;  5KZU A;  2YMD A;  4TNW A;  2W8F A;  5HEG A;  4UM3 A;  5BW2 A;  4PIR A;  3C79 A;  5SYO A;  3WTH A;  3SQ9 A;  3SIO A;  5L4H A;  3TLT A;  2XNU A;  3U8M A;  2XQ8 A;  5CO5 A;  4ZZC A;  4QAA A;  4HFB A;  4XHE A;  2ZJV A;  3U8K A;  4A97 A;  4ZR6 A;  4UXU A;  4BQT A;  3TLV A;  4UY2 A;  2C9T A;  4HFD A;  3RQU A;  3UUB A;  2UZ6 A;  3PMZ A;  4NPP A;  3EHZ A;  3PEO A;  4IL9 A;  4HFI A;  4Z90 A;  2WNC A;  2YOE A;  2XNT A;  2Y57 A;  4ILA A;  4WV9 A;  3UU8 A;  5IUX A;  4QH4 A;  4UM3 P;  2YN6 A;  4X5T A;  3WTO A;  4EZ1 A;  2WN9 A;  3IGQ A;  4HFE A;  4TNV A;  2XZ5 A;  4XK9 A;  5HEH A;  5J5I A;  3WTL A;  2BG9 E;  1UV6 A;  5BRX A;  3ZDH A;  3UU4 A;  4HQP A;  5AFM A;  3P50 A;  3ZDG A;  4ALX A;  5AFL A;  3LSV A;  2BYS A;  3TLS A;  3T4M A;  2XQ6 A;  2QC1 B;  2BYQ A;  2BG9 A;  3P4W A;  4QAB A;  5J0Z A;  4DBM A;  1UW6 A;  5AFM B;  2XZ6 A;  5HCJ A;  2XQ3 A;  4IL4 A;  2XQ4 A;  5HEJ A;  4FRR A;  4QAC A;  5HEU A;  3U8J A;  3U8L A;  2BG9 B;  3WTK A;  3WTN A;  2BR8 A;  2VL0 A;  2XQ5 A;  2WNL A;  3UU5 A;  3JAE A;  3C84 A;  4NZB A;  2ZJU A;  2XQ9 A;  4ILC A;  3ZKR A;  2YKS A;  5J5F A;  4HFC A;  2Y7Y A;  5J5G A;  3RI5 A;  3RIA A;  1I9B A;  3UU6 A;  4ZK1 A;  2PH9 A;  4ZZB A;  3GUA A;  1UX2 A;  5J5H A;  5LG3 A;  2XQ7 A;  5L47 A;  3TLU A;  3WTJ A;  2BYN A;  3UQ7 A;  4ZK4 A;  2X00 D;  4LMK A;  4TWD A;  5HEO A;  4F8H A;  4QH5 A;  5AIN A;  2XYT A;  3RQW A;  2XYS A;  4AFH A;  3EI0 A;  3U8N A;  5KE4 A;  2Y56 A;  4LML A;  5L4E A;  5AFK A;  4B5D A;  2Y54 A;  4QH1 A;  2YME A;  5LXB A;  4D01 A;  4ZJT A;  4LMJ A;  2Y58 A;  4Z91 A;  2BYP A;  3WIP A;  2WNJ A;  4AFG A;  4UM3 S;  3SQ6 A;  3UQ4 A;  2XNV A;  3WTM A;  3EAM A;  4AFT A;  4BFQ A;  2XQA A;  5AFH A;  2BG9 C;  4UM1 A;  3RHW A;  3TLW A;  4A98 A;  3JAF A;  3JAD A;  4IRE A;  4TWH A;  2BJ0 A;  2X00 A;  5TVC A;  3SH1 A;  4TWF A;  2BR7 A;  5BP0 A;  3WTI A;  4COF A;  5CFB A;  4ZJS A;  4ILB A;  5JME A;  4HFH A; 
#chains in the Genus database with same CATH topology
 4ZRU A;  5FJV A;  3UU3 A;  5AFN A;  2BYR A;  2PGZ A;  2WZY A;  3RIF A;  5HCM A;  2W8G A;  5AFJ A;  5KZU A;  2YMD A;  4TNW A;  2W8F A;  5HEG A;  4UM3 A;  5BW2 A;  4PIR A;  3C79 A;  5SYO A;  3WTH A;  3SQ9 A;  3SIO A;  5L4H A;  3TLT A;  2XNU A;  3U8M A;  2XQ8 A;  5CO5 A;  4ZZC A;  4QAA A;  4HFB A;  4XHE A;  2ZJV A;  3U8K A;  4A97 A;  4ZR6 A;  4UXU A;  4BQT A;  3TLV A;  4UY2 A;  2C9T A;  4HFD A;  3RQU A;  3UUB A;  2UZ6 A;  3PMZ A;  4NPP A;  3EHZ A;  3PEO A;  4IL9 A;  4HFI A;  4Z90 A;  2WNC A;  2YOE A;  2XNT A;  2Y57 A;  4ILA A;  4WV9 A;  3UU8 A;  5IUX A;  4QH4 A;  4UM3 P;  2YN6 A;  4X5T A;  3WTO A;  4EZ1 A;  2WN9 A;  3IGQ A;  4HFE A;  4TNV A;  2XZ5 A;  4XK9 A;  5HEH A;  5J5I A;  3WTL A;  2BG9 E;  1UV6 A;  5BRX A;  3ZDH A;  3UU4 A;  4HQP A;  5AFM A;  3P50 A;  3ZDG A;  4ALX A;  5AFL A;  3LSV A;  2BYS A;  3TLS A;  3T4M A;  2XQ6 A;  2QC1 B;  2BYQ A;  2BG9 A;  3P4W A;  4QAB A;  5J0Z A;  4DBM A;  1UW6 A;  5AFM B;  2XZ6 A;  5HCJ A;  2XQ3 A;  4IL4 A;  2XQ4 A;  5HEJ A;  4FRR A;  4QAC A;  5HEU A;  3U8J A;  3U8L A;  2BG9 B;  3WTK A;  3WTN A;  2BR8 A;  2VL0 A;  2XQ5 A;  2WNL A;  3UU5 A;  3JAE A;  3C84 A;  4NZB A;  2ZJU A;  2XQ9 A;  4ILC A;  3ZKR A;  2YKS A;  5J5F A;  4HFC A;  2Y7Y A;  5J5G A;  3RI5 A;  3RIA A;  1I9B A;  3UU6 A;  4ZK1 A;  2PH9 A;  4ZZB A;  3GUA A;  1UX2 A;  5J5H A;  5LG3 A;  2XQ7 A;  5L47 A;  3TLU A;  3WTJ A;  2BYN A;  3UQ7 A;  4ZK4 A;  2X00 D;  4LMK A;  4TWD A;  5HEO A;  4F8H A;  4QH5 A;  5AIN A;  2XYT A;  3RQW A;  2XYS A;  4AFH A;  3EI0 A;  3U8N A;  5KE4 A;  2Y56 A;  4LML A;  5L4E A;  5AFK A;  4B5D A;  2Y54 A;  4QH1 A;  2YME A;  5LXB A;  4D01 A;  4ZJT A;  4LMJ A;  2Y58 A;  4Z91 A;  2BYP A;  3WIP A;  2WNJ A;  4AFG A;  4UM3 S;  3SQ6 A;  3UQ4 A;  2XNV A;  3WTM A;  3EAM A;  4AFT A;  4BFQ A;  2XQA A;  5AFH A;  2BG9 C;  4UM1 A;  3RHW A;  3TLW A;  4A98 A;  3JAF A;  3JAD A;  4IRE A;  4TWH A;  2BJ0 A;  2X00 A;  5TVC A;  3SH1 A;  4TWF A;  2BR7 A;  5BP0 A;  3WTI A;  4COF A;  5CFB A;  4ZJS A;  4ILB A;  5JME A;  4HFH A; 
#chains in the Genus database with same CATH homology
 4ZRU A;  5FJV A;  3UU3 A;  5AFN A;  2BYR A;  2PGZ A;  2WZY A;  3RIF A;  5HCM A;  2W8G A;  5AFJ A;  5KZU A;  2YMD A;  4TNW A;  2W8F A;  5HEG A;  4UM3 A;  5BW2 A;  4PIR A;  3C79 A;  5SYO A;  3WTH A;  3SQ9 A;  3SIO A;  5L4H A;  3TLT A;  2XNU A;  3U8M A;  2XQ8 A;  5CO5 A;  4ZZC A;  4QAA A;  4HFB A;  4XHE A;  2ZJV A;  3U8K A;  4A97 A;  4ZR6 A;  4UXU A;  4BQT A;  3TLV A;  4UY2 A;  2C9T A;  4HFD A;  3RQU A;  3UUB A;  2UZ6 A;  3PMZ A;  4NPP A;  3EHZ A;  3PEO A;  4IL9 A;  4HFI A;  4Z90 A;  2WNC A;  2YOE A;  2XNT A;  2Y57 A;  4ILA A;  4WV9 A;  3UU8 A;  5IUX A;  4QH4 A;  4UM3 P;  2YN6 A;  4X5T A;  3WTO A;  4EZ1 A;  2WN9 A;  3IGQ A;  4HFE A;  4TNV A;  2XZ5 A;  4XK9 A;  5HEH A;  5J5I A;  3WTL A;  2BG9 E;  1UV6 A;  5BRX A;  3ZDH A;  3UU4 A;  4HQP A;  5AFM A;  3P50 A;  3ZDG A;  4ALX A;  5AFL A;  3LSV A;  2BYS A;  3TLS A;  3T4M A;  2XQ6 A;  2QC1 B;  2BYQ A;  2BG9 A;  3P4W A;  4QAB A;  5J0Z A;  4DBM A;  1UW6 A;  5AFM B;  2XZ6 A;  5HCJ A;  2XQ3 A;  4IL4 A;  2XQ4 A;  5HEJ A;  4FRR A;  4QAC A;  5HEU A;  3U8J A;  3U8L A;  2BG9 B;  3WTK A;  3WTN A;  2BR8 A;  2VL0 A;  2XQ5 A;  2WNL A;  3UU5 A;  3JAE A;  3C84 A;  4NZB A;  2ZJU A;  2XQ9 A;  4ILC A;  3ZKR A;  2YKS A;  5J5F A;  4HFC A;  2Y7Y A;  5J5G A;  3RI5 A;  3RIA A;  1I9B A;  3UU6 A;  4ZK1 A;  2PH9 A;  4ZZB A;  3GUA A;  1UX2 A;  5J5H A;  5LG3 A;  2XQ7 A;  5L47 A;  3TLU A;  3WTJ A;  2BYN A;  3UQ7 A;  4ZK4 A;  2X00 D;  4LMK A;  4TWD A;  5HEO A;  4F8H A;  4QH5 A;  5AIN A;  2XYT A;  3RQW A;  2XYS A;  4AFH A;  3EI0 A;  3U8N A;  5KE4 A;  2Y56 A;  4LML A;  5L4E A;  5AFK A;  4B5D A;  2Y54 A;  4QH1 A;  2YME A;  5LXB A;  4D01 A;  4ZJT A;  4LMJ A;  2Y58 A;  4Z91 A;  2BYP A;  3WIP A;  2WNJ A;  4AFG A;  4UM3 S;  3SQ6 A;  3UQ4 A;  2XNV A;  3WTM A;  3EAM A;  4AFT A;  4BFQ A;  2XQA A;  5AFH A;  2BG9 C;  4UM1 A;  3RHW A;  3TLW A;  4A98 A;  3JAF A;  3JAD A;  4IRE A;  4TWH A;  2BJ0 A;  2X00 A;  5TVC A;  3SH1 A;  4TWF A;  2BR7 A;  5BP0 A;  3WTI A;  4COF A;  5CFB A;  4ZJS A;  4ILB A;  5JME A;  4HFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...