2W95A

Structure of the discoidin i from dictyostelium discoideum in complex with galnac at 1.75 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 61
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w95A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w95A01
4JKKA 4L0PA 4BDVB 3A23A 3D3AA 4QB6A 2VM9A 3C7GA 3T0BA 1JZ8A 5JXGA 4LPLA 3DYPA 5EJZB 2DCKA 2W92A 1JI6A 1UYZA 3CZUA 2BBAA 5DQ0A 1JZ3A 4P00B 1GUIA 3MUZ1 4UI9L 5LA0A 2WQ8A 1GOGA 4CU8A 2VQTA 1JZ2A 4QX1A 1BHGA 3I2KA 3WEZA 2HLEA 1K12A 1R64A 3WF3A 3OEAA 2CCVA 2YC4A 3WNKA 3FL7A 4JHZA 3PUIA 2QQMA 4YPJA 3I3EA 4XUQA 5FUIA 2RJ2A 2J1TA 4PQQA 3VDBA 2VCAA 4JX0A 1W0NA 2YFZA 4A45A 4UOJA 3GM8A 3LQCA 1SHWB 5B4XA 1K3IA 2Y64A 5EJ1B 4CU7A 4BK5A 3EB7A 5HPOA 3A22A 5IJRA 2L9LA 1L7QA 2BGPA 1NAEA 2ORZA 4IUGA 2WN3A 1PX4A 2VZPA 1UZ0A 2XQXA 4MO3M 4D8MA 4TTGA 4OYUA 4Z2AA 2QQIA 1OH4A 4MADA 4BJ0A 4QDRA 3LPGA 2ZEXA 4DEVA 3C7HA 3HNMA 3NJVA 5C71A 1J83A 2E33A 4KWUA 5B4NA 1XPWA 4W4ZA 1XNAA 4XURA 3I2HA 3AC0A 3IB3A 5A1AA 3P1IA 1UY2A 2B9VA 3K77A 4A44A 2WAOA 1HN1A 1GOHA 1UX7A 2WO2A 4MOAA 4GZ9A 5F7UA 1F4AA 5JR2A 4QX2A 4XUTA 2VZQA 4QDQA 1W9WA 1KGYA 1CZVA 1JU4A 4W50A 1UYYA 1UMIA 1ULPA 4DUVA 1OT5A 3MV01 4JKMA 1NUKA 2Y6KA 1KEXA 5JUVA 2BZDA 3ABZA 4KMQA 1PMHX 5IHRA 2J1SA 4E8DA 2WBKA 3IAPA 4CU9A 3MUY1 2VZ1A 4TXWA 2VZTA 1OF3A 3E1F1 2C9KA 2CGYA 2VZUA 2W1WA 1UMHA 3WF0A 2J7MA 4QX0A 4DXRA 2E31A 3K75B 1UWWA 4RYDA 2CDOA 4RN5A 3W5MA 2VMEA 5LA1A 3HJRA 2CGZA 3T09A 2ZEZA 3CIHA 3K4DA 4GWJA 3VD9A 4A41A 2VQUA 2C4XA 2VZOA 3VD5A 5HXMA 3UESA 5LCWL 1MPXA 2DDUA 2J22A 2VTFA 3J7HA 5DPNA 3ACFA 3T2OA 4CUAA 4DXSA 5J1XA 2W91A 4ARXA 4ARYA 3VDAA 2PQSA 2QQKA 3HN3A 4LKSA 2W5FA 4A42A 1JYWA 2VCCA 2JE8A 2QBXA 4M4RA 2WO3A 2VJXA 4ZXEA 5DMYA 4JKLA 3WNPA 3MO4A 4DEQA 1ULOA 2W1SA 3OB8A 4A6OA 2X10A 2EICA 1K45A 3OGSA 2VOTA 4LQRA 5G04L 2Z4FA 4DUWA 3W5NA 4XZUG 3WQBA 3SKJE 2Y6JA 2JDAA 3HEIA 3C8XA 2CE6A 2QQLA 4W8JA 4DXTA 4CU6A 2W95A 3K46A 2OKXA 1CIYA 2Y6HA 2VL4A 2E26A 3U37A 3FHAA 3OGRA 3I3BA 3CDZB 3IDAA 3VD3A 1K42A 2EIDA 3ZM8A 1GOFA 1XNTA 1O8SA 1CZTA 2WZEA 1H6YA 4P02B 2Y6GA 3CMGA 2W46A 4CUCA 1LNSA 1PX3A 3JXSA 4HG6B 3C7EA 1GMMA 3DYMA 2ZEWA 3SEPA 4QPWA 1W9TA 4PF1A 2LS6A 2ORXA 5JXIA 3ECQA 2WAAA 2Y6LA 2VR4A 5LA2A 3LEIA 1JZ7A 4KI5M 5JXHA 1TG7A 1RYYA 2W3JA 5EIYB 3OBAA 2J1UA 4XUPA 5C70A 5CZKA 2Y8KA 1GU3A 2R7EB 1GNYA 2XHNA 2YC2A 3OEBA 4XUOA 3ETPA 2YB7A 3I3DA 2LW8A 5JXJA 2YFUA 4MGSA 2HYXA 3GDBA 1JYNA 4GWIA 1EUUA 3HNBM 3LEGA 1W9SA 3WNLA 4ZZ5A 4P08A 3CKHA 3WNNA 3SEEA 3T2PA 3ACIA 1SG3A 3VD4A 4OZOA 2V4VA 1SDDB 2BERA 3A21A 4QX3A 4A3ZA 2B4KA 3HOBA 1L7RA 5JMOA 3LPFA 3ACGA 1DP0A 4E8CA 4PT6A 2BGOA 1JZ4A 2VMCA 1UY0A 2J1EA 2DCJA 1UXXX 3GGLA 2QQNA 3VDCA 1H6XA 2J1VA 2VZRA 3WF1A 3I2JA 3WMQA 1UXZA 1WCQA 4ZY9A 3GXUA 3UNPA 3K4ZA 3IIIA 4Q56A 2VMFA 2XONA 5IFTA 1DLCA 3OG2A 2V72A 1GQPA 2J1AA 2J1RA 2KD7A 2W47A 2W9XA 2VZSA 3HPNA 2VZVA 2WN2A 2W87A 3OGVA 3F2ZA 1DYOA 4OMDA 5DN2A 1PMJX 4XUNA 3IAQA 3I97A 3WF4A 1JZ6A 4QAWA 5G05L 3MBWA 1W99A 2VZ3A 1O8PA 3FN9A 3MV11 1F4HA 5CYYA 1YQ2A 1TVGA 3C7FA 4UAPA 4ZZ8A 2X09A 3I2IA 3K4AA 4OMCA 1UY3A 4QB1A 4CUBA 1J84A 1I5PA 1JHJA 5IYYA 1US2A 1JU3A 2QQJA 1D7PM 2VO5A 3THCA 3SKVA 3BN6A 2WABA 1T2XA 1OF4A 3NJXA 4D0QA 3LE0A 2V5DA 1P8JA 4AG4A 4P5YA 3T2QA 2CDPA 2W1QA 3NQHA 4FI9A 4XVHA 2C26A 3T0DA 1US3A 3DECA 4AAXA 1IQDC 2W1UA 4OUEA 4A4AA 1NX9A 4M4PA 2QQOA 3WMPA 1W8OA 2ZEYA 3WNMA 3C7OA 3PUHA 2W94A 4BK4A 1EUTA 1XC6A 2VMDA 1CZSA 4LHSA 1OD3A 3FHQA 2WYSA 1UYXA 3VD7A 5C7GA 1O59A 1JYXA 3I2GA 2ID4A 3WSOA 2WO1A 2WZ8A 3ACHA 2EIBA 2RV9A 2VC9A 2VCBA 3I2FA 5IFPA 1JZ5A 5I0DA 2JD9A 2JKXA 3BGAA 1UY4A 4MGQA 2ZXQA 3WNOA 3THDA 1UY1A 2XOMA 3HNYM 4QDSA 3T0AA 3UETA 4DUXA 3P6BA 3CZJA 3NRUA 1W8NA 3LEKA 3T08A 3NNGA 2E32A 2RVAA 3CQOA 1JYVA 3DYOA 2WUHA 4QB2A 1CX1A 1WKYA 2EIEA 2X05A 4CVUA 2WDBA 2YG0A 1NKGA 3A7QA 4ET7A 4BXSV 3WF2A 3EYPA
chains in the Genus database with same CATH superfamily
5CGMA 3CFKA 1LE9A 1FYTD 4ZNCD 1F2NA 1ND3A 3DKQA 4KROC 1LDPH 4GINA 5I1JL 5IUCA 4L1DA 2KERA 4OZIF 4IV1A 2H3NA 1EYBA 4E42A 3KPMA 3UJTL 3JQWA 1UOJA 1PJ9A 4E4HA 2V7NA 1VENA 2XVKA 3HN5A 4R26H 5L4MA 4U1SB 3ALQA 4K5PA 2Z8RA 4ZMTA 2Q8DA 1BYOA 1XTMA 3MUZ1 4MASA 3UYPB 4NCDA 1Y0LA 5D7JD 5C92A 1NA1C 1GA2A 4PDWA 1J5DA 4HFWA 1ET7A 3BDBA 1BQHB 4APXA 4Z8BA 3BAYA 4Y5VC 2E56A 5ACA1 4MD0A 5JTWA 1SRDA 3QEUB 2W80C 1NAMA 3AXLA 3OEAA 1U3NA 1OA3A 2R23A 3QEGL 4KC3B 5B1BB 3JU9A 5F2WA 1MAML 1B4JL 3QDJB 2XQ0A 4LVHB 5KW9L 1KG0B 1HTYA 2NXYB 4ODSL 4W9DC 3DGTA 3TT1H 3BDYL 4L4VD 3U6RA 2J72A 4DKEH 5JW5B 3HT2A 4P2RD 3RYRA 1GBGA 3BWAB 2QDWA 1IGYA 2FZ3A 1WWWX 3QJRB 4ATFA 5K9JL 3STBA 3WXVH 2YFZA 3LKOA 5E89A 4OI2A 3GM8A 1VFMA 5TF0A 4K7FA 2XBZA 4MB5A 1XF1A 3BVUA 1DUZB 3C5ZA 3ZVVA 5BS0A 1ZGLM 3UJJH 3FMGA 1OD9A 3W59A 5DAVA 4JCKA 4HG4K 3KPNB 3GZAA 3WQ7A 4IRSA 5D71H 4F8OA 3OGCA 3DO7A 3C5ZD 1QBLL 2A9MH 2OP4L 1TMF1 1XWVA 2CBTA 1NAEA 1QJU2 3QJZA 2XNAB 3DX8A 4IRSD 4JDTL 2ORZA 4Y5XA 5HGBB 2MPVA 3LF7A 1Y7VA 1IL1B 2WXOA 3V0WH 1LHUA 1KXQA 1AYN2 4HPOL 4HP5A 3OJDA 3KPRE 3U0TB 2BSEA 3IMBA 3KDPB 5FYMA 4UYPA 5F1NB 3KL5A 2GCYA 4LCCB 4ODUA 1KACB 4IK6A 3DF0A 1P5UC 3N06B 4C4BA 3L7EB 4XACA 4I18A 3TBVA 4JZNB 2WXJA 3WIHL 4PRPB 2YKLL 1CGPA 1OCWL 4ZXBA 1L0YA 5CILH 3UL2A 4A2MA 4IEXA 4PRHD 4JHAH 2ZEXA 1ZPLA 5I16A 4LF3A 3PAYA 3QW9A 3Q5OA 2X4RB 5DJAA 3AP4A 4OF8A 2NPIA 3AREA 3L4TA 4PJCA 1ZHNA 3IJHB 4ZO6A 4NWTH 5DJ6A 5HI5C 2I85A 5AWNL 3HAEA 3N50A 2ZG3A 3QFJD 3HRZA 4A1RA 2ZXCA 3KCCA 1GZCA 2AVFA 1QLRB 4XMLH 3QIUD 3ZFEB 4PGZA 3D0AA 1Y6NR 3QXDA 4PGBA 3IEAA 4A44A 3BGFC 2B9UA 3HVDA 5FKBA 4G8IB 4WK0B 1JNNH 3NCCB 1OKQA 3GSWB 4HJGB 2LLNA 1JN2P 4MNGB 3TJHC 3K8KA 2Y7SA 3WKPA 4DERA 1KEGH 2EVIA 2VDML 4HBQA 3RDTA 1DDHB 4GIAA 4N8VG 5BZWB 4IDZA 4O2EA 3I85A 3H9HB 5E8OB 4WF7A 1CD0A 3LFMA 3ZIWA 1J11A 1OB1A 1R75A 3ZXEA 1IVLA 1LO0L 3PP4L 2VR9A 5SWZE 1GW6A 1OURA 4Z7WB 2VLKA 3VBOC 3GRWH 3CSYB 4DUVA 5ADPL 3VFMA 5JIMA 2ADDA 5ISZA 3UG3A 2QPFA 3EH5B 5T50A 5IAXA 2BWQA 1ND0B 1Y18A 3PLQA 3RGBA 1KGIA 4JQVA 4WI0B 2I9TB 1RK0B 3RZKA 5ISZD 2XJSA 1RUMH 4B4RA 4OD1L 1J0HA 2YBGA 3ULUE 3GBEA 4KPHL 3VXRB 1F31A 1RU9L 5LNEA 1JGLL 2Q6WB 1J1OH 4PW3A 3I6GB 2IOOA 4ONHB 5JIPA 1HQ4A 1M9WA 3F7RA 1FVDA 4WO0A 3WUZA 2VRAA 3DURB 1OP4A 1ULFA 3AFGA 3ZYHA 3BSGA 3L3DB 3K81A 3NAPA 1VB9A 5EIVA 4X98A 4LEJA 5IF0A 1MR5A 4PP2B 1Q38A 4K07A 4YHOH 4ISQA 4Z92B 5FK8A 1ASPA 5BMFL 3EKCA 4R0LB 4TUKH 1E5IA 4AUYA 3SQRA 2OSYA 5TSWA 1YN7A 2A9DA 3LD8B 2DLEA 4GBXA 4PJHF 5A3TA 2FO4A 1OM3H 1N6UA 5CNHA 1SOQA 5AW6B 5B7FA 2DVBA 3CIHA 4XIKA 2G75B 5ITFA 4Q0XL 1AYOA 5JPNB 4FQJL 4BQ8A 1IBGL 3EYOA 2OL3H 2FHRA 4Y22A 2P5EB 4FN0A 4F8LA 4HSLA 4DRVA 3GMLA 1ZT4B 2WNKA 3RGHA 2MHFA 1F4XH 4HV8B 3RWNA 2A3YA 2CUIA 4G7SB 3MLUL 3QUML 3UBXA 1Z5LB 3GMMB 3VH8B 2HWF3 3M4FA 1ZREA 2NY2B 4EIUA 1YY9D 3UMNA 4N0UA 3O9WB 3QORD 3BPCB 3SGJA 5LQBH 3KE0A 2Q30A 2GJPA 1FC1A 2WD0A 3AQDA 2QR0B 5KJ7E 4A2FA 4PF5A 1KELL 4DHLA 1SLLA 4HOWA 1KYOJ 4OJFH 4DCQA 5TQ0L 1SFNA 1YPZB 4P3WA 5JYLA 1M7IB 4X9YA 3OMZA 1XZ0B 1A6VH 5CJ5A 3H7JA 4MTMA 2VXUH 3BTYA 5K9QI 1DZBA 2G3ZA 5FUNA 3JVFC 2HX8A 5L9DL 4R5TA 5DMYA 1KGUA 2R062 4DEPB 3GZOA 3T0XA 4NRZB 1Z78A 3MO4A 4HKWA 4LVOB 1JE6A 2AS5M 3RX8A 3QDJE 1VBC3 4WV8A 1H8LA 4OZGA 5ACA3 4OCWH 1H8NA 1X3DA 3RL1B 1LP9B 1DSYA 1F2QA 4GIQA 1YEJL 3PHMA 4O5LH 1FQ9C 3BE1H 4YHYB 3AITA 3AJYA 4J1WA 5I24A 1L9NA 1K4CB 4HL0A 2BP0B 4N9GA 1P4LA 3G6DL 4JG1H 2XZCH 5D96B 5E6RB 1A4BA 4AZUA 1UT9A 5JHLL 4IEFA 2YC1A 2F8VA 4I3GA 5DWPA 3OB0H 5GRJH 4IGOA 2QTWB 4AUJA 4XAAA 3BX7C 2BHUA 1Z9SB 2YY1A 3N3HA 2WXRA 4LFHD 1AR72 3OGRA 3UGHA 4UTBH 3S37X 4C56E 3U4EB 5TGBB 5FDBA 1D5MB 2HJLB 3HB3B 4LNVA 5EWIH 3ROLA 3SKNB 5GRVK 5C0IB 5IK8A 4F33B 4MHHG 1M71B 3IDJB 4XJZA 5I1CL 5JORA 2HWC1 2ICWI 1KPRA 1NEPA 3JUYA 4Q6IA 1OTTC 4ENZA 4Z3HA 2A77H 3MNVA 3MZHA 1RI8A 5L7OB 4Z82A 5F1KC 5AC91 5J3UA 1HEZA 4KZDL 4F7TB 1OSYA 2WNVA 1DBAH 4Q89A 2EVFA 1ONAA 3N43F 1T6GC 2XXFA 4HG6B 4Q4X1 2N7BA 1VFAB 2VW7A 2FIKB 5I9QC 4MSWA 4Y19A 5D2LB 3WFDL 5FW7A 3VBUC 5FHBH 1JFHA 1VIWB 4PF1A 4LMQI 3POHA 4HISA 5B1KA 1NQDA 5A40E 2WWKT 1EFXB 4Y19D 1OAXL 1NEUA 3IYLW 4KK8C 4GWMA 4FQ2L 4UM8B 5D70L 5L7XH 3FT1A 1DQML 1W6LA 4AEIH 4DZBA 3M7OA 1A25A 4X5QA 1TFHA 3O1RA 5HGAA 3IXTA 4M7ZB 4RMBA 1KJ3H 1J86A 3HPJA 4RWHA 4FQCL 4QDGA 3UBHA 2J4WL 5C0CA 2XTSA 2ADGA 5IESH 1C08B 2YD5A 1JDDA 1RFDL 3RZGA 1KFGA 4UZGA 2YBRB 4QGYA 3BGMA 3H85A 5C0CD 2E5EA 2Z4TA 4IBTA 4IU2A 3ZSTA 3U7WL 4YHML 2EUWA 1AJOA 4K71C 1W9SA 3OXSA 1F4YH 1MEXH 4M3CB 4P08A 2GAZA 3VWJC 3WL9B 4L0YA 2GK0A 3CKHA 5HI4D 4P2OB 2NCEA 3O6KL 1N10A 4F9PA 2JSFA 4KG8A 1UXSB 2BERA 2DD8L 4QX3A 4Z7WE 2B4KA 4D0CA 3QZMA 3EGSA 1ZHKA 1YSOA 3MNWA 5SWSA 4FG4A 5GGUA 1REEA 3WIIH 1O7DC 1F15A 4GA9A 3SPJA 3MLPA 2IZWA 3CN0A 3GNMH 4TNEA 5SWSD 1RMU3 2E7CA 2ZUVA 1JZHA 5CSGA 1BGXH 4LRIA 3L9EA 4MNHA 2BDRA 1NMAH 1AG0A 3VXRE 1EJ8A 2RHEA 1AIFB 5CN1A 2YUZA 4MXWH 3OGOE 1YUDA 2OMNA 3TONA 4DAGL 2EXHA 4MBOA 5GRWA 3DX6A 5KBLA 5DUPH 3KLHD 5FWQA 5LXGH 2OI9C 1PLBA 3P69A 1LTXA 1V3LA 4CRPA 4FQLH 4L8CA 3U07A 2HFTA 1M7DA 1NFIA 1D9KC 4XX1E 4EBQL 5LDUA 1RUPH 5F70A 4YSCA 3B9CA 1SNRA 2IDUA 2MPAL 3CSFA 5LHDA 1NA8A 5E2TL 1QOOA 4XB3A 3OG2A 4PS4H 4Y4KC 4WU5A 1JS4A 2BW5A 2YA1A 4WQOA 3CVIH 4UINL 5JW4M 1ZRIA 1MWAH 5SX5H 2X6AA 1UADC 2QKIB 1MUJB 1PZAA 4XBPB 4NO5A 2VD7A 1UA6L 2DJMA 1HILB 1UWFA 4FULA 4KHTH 2WRAA 4P9LA 5ACZB 4B4PA 2WK2A 3OQ3B 1JZ6A 3VBRB 2ZGNA 4QRPD 4Y8DC 3PYCA 4XO3A 3PL6B 4N68A 4P4KC 1X6LA 1RUG3 3KBEA 2OZJA 3MV11 3OAYH 4LMFA 2GHWB 3MREA 3UX9B 3WFEH 1MFAH 4QX7A 5CYYA 3BD4A 1B2YA 4CAGA 1Q9KA 3MBEC 5I15L 1IT9L 3RLSA 1E5ZA 3F62A 1PCSA 1I85A 2VTXJ 4HK8A 4BFRA 4XFCA 3W58A 1WBZA 1M57B 4N5UA 1NFDA 3FE5A 4HKOA 4PRDB 2C3VA 1IV8A 2ED7A 4W9LC 3B3IA 1BBDL 3TF4A 4DVRL 5KC5A 1UQSA 4M6AA 4HWEH 4URTB 1YPZE 2JTDA 2B1OA 5GGQL 5KZCD 3SH3A 2VUDA 1VAKA 4URAA 2N59A 1QG3A 5CZXD 3RI8A 4PIZA 2AEQL 4NRYA 3IFOB 3VSVA 4XILA 5D2NE 4X7DC 3NDYE 5A2KH 1WAAE 2P26A 3ABLB 2ARBA 1CFVL 2Y22A 2NR6C 4LKXA 5IBUB 2ZCLH 1HKFA 1ML0A 5EV7A 3VFNB 4BH7A 1W0OA 4WNQB 1YFXA 1E4XH 5F8RC 1FPTL 1QJZA 3WXPA 3KLKA 1A8JH 4M5TA 2YBPA 4FPHA 1FFPA 2LU7A 1LP9E 4QF1B 1FVCB 2Z5WA 5HHXH 1C12B 3W1ZA 1OP5K 2OT7A 2GY7B 4GG8B 1XEDA 3J26N 1US3A 4QHBA 3W57A 4AFCA 1QXPA 5IVNA 5EEZA 4JZJA 1D6VH 3CBJB 5DZLA 4N43B 5FZOB 1DCLA 5EO9A 1IGML 1HDMA 1OALA 3LXCA 3GXDA 2H41A 2V2WB 4X50A 4KRLB 5D7KD 2DL2A 4PJCF 5IEHB 4XTMA 5TDOB 1F3DJ 4XPHL 1CAXB 1WCUA 2BVVA 2G2PA 5IEKB 5LK7B 4Y4FC 1QLFB 1PO12 1V00A 1SXNA 3H55A 4XBEL 1PD6A 4C1WA 2F6BA 3CFEA 1G9MH 4HJSA 1G8WA 2VAUA 3GPEA 3HR5A 4J3OD 4NNXB 3TCTA 4QWNA 1DE4A 4R7XA 1RIVL 3CSTA 5IFAH 2R59A 4KK5C 1UASA 3GPSA 4QHZA 4UDUA 4K3JH 2EH7L 4UV7L 4WM7C 1CI5A 5DVNA 4S1DD 1INDL 1U0AA 1HXYB 2E51A 3MF6A 1JCVA 2UZIL 2RV9A 4XVJH 5C5TA 4YVSC 3DPRB 3CFTA 2A74C 2AGJH 4D7YA 4GXUN 2JENA 4WV1B 3B3BA 5CUSH 3SKJL 2JD9A 3S98A 2G4EA 5AC93 2R29H 1MRFH 2VIRB 1NGXB 2XY2A 1UOWA 2ZXQA 1MCIA 4LDEB 4LU5L 5D2LE 1OCOB 3WFHA 2OTUB 5FY1A 1COV3 1F86A 4M3KB 2PHLA 2FYYB 2Z35A 2EC9T 3H6AA 3MX0B 4XO9A 4BSWB 4CMHB 4FP2A 5AAMC 4LLVA 1NOVA 4XCAA 2AKRA 1UWGH 4JGZA 2RG4A 1AG6A 1AKJB 4TM9A 5HJDA 1GSLA 3Q05A 3TCXA 2FIRT 1KCLA 3VA6A 3RFZA 4H1LB 3S96A 1WKYA 4GRWB 3C6LA 1DANT 2VH5H 1MS9A 5KWYC 1GZHC 4HMDA 1WLWA 2HVJB 3SQBA 2VQ1B 1WP6A 3IGAB 1QIQA 4M5SA 1Y4WA 2D2OA 2IXJA 3ISWA 1RPUA 3EJPA 1LOFA 4EN7B 1HJGA 5EUKA 3DXAA 1WO2A 3LAGA 2XACC 3QLQA 1Y7BA 4JTNA 4WGVB 5DUVA 5CS7A 4ATEA 4R83A 3RAJL 2Y33A 2VMJA 3MJ9A 4TNFA 3T0BA 5HYJA 2NQ3A 4M3CE 5I8TA 3CVHH 4LCWE 3DXAD 5AKSA 3BEWB 3IJYA 4HIEB 4DK6A 4JPSA 1KENH 2NZ9A 1D5BB 3CGTA 3OKNA 1DJIA 5G4MA 4KGGA 3K1KC 4E2SA 1WFJA 1PEZA 3ARVA 2W8CA 3KWXA 3LQMA 1GZQB 4QHMB 2K6ZA 4JPIB 2NZ9D 2NW3A 4AJ0A 3ULUH 5C3OA 1YIFA 2P24A 4HH9B 2DIJA 3R0MA 4YLCA 3UJOA 1JTTA 3RWEA 3UZEA 1XXNA 3LOWA 3LCYA 3SO3C 4FPOB 4KKPA 3ZDSA 1NGQH 1V7NL 3OMNB 1OAUH 4LE8A 2ZKNA 3NJLA 4DNYA 4WLCA 4Q4W3 2A83A 4R90H 2IGFH 1C5DA 2CCWA 2V9TA 4XVSH 3LZLA 1XIWB 4YE4H 3D34A 3SQOA 4XFBA 1XGUB 4KY2A 3WTVA 1VFBA 1R3IL 2OK0H 5I17A 5J6GB 5TPWH 3CDGA 2UWEA 2BSDA 5DCCA 3KV4A 5HJ3B 2LRPA 2AEOA 5AOMA 1P9MC 5I1EL 3EB7A 5IK4A 2WVSA 3M8OL 5JMOC 1WTGT 4ASMB 1JRHH 3DTXA 4OZGF 2DQCH 4ES9A 4MMXB 4I5BA 5AEAA 1L7LA 2O14A 2A6DA 3IWVA 3PDDA 4IMKA 4OZFB 5CJXA 2JD4A 3B2UC 4GWNA 1FHNA 2MCG1 3UDWA 1S4IA 2AHIA 1KC5H 4GLRI 2FL5A 5E8NA 3ILDA 3U36A 5HPMB 2XQXA 1Y6KR 3M3IA 3JV4A 3KH3A 2XKPA 4FTSA 3WN5B 4ELMB 4Q1RA 3FONA 1YNKH 2IANA 1UKRA 1VBE2 3AFKA 1AHWB 3KWWA 1OSZB 3QC5X 4HUMB 4MADA 2Y26A 2OX5B 3A0OA 1TSHA 2C7UB 3DPBB 4M6OL 3S37H 4AT6B 1GP4A 5HYSB 3CH8A 1GZ9A 4U49A 1T4KA 2ERJB 1WAEA 1JGEA 2A9BA 3BP6A 5C71A 4JG9A 3LKPA 4KWUA 3DGDA 2FX9L 4B7LA 3AKTA 1KIPA 4OM1H 3RL2A 4BZ2L 5FXZA 3NMBA 4QD2A 1KY6A 4IRZL 4XXDA 1IZJA 4GB33 1HYRC 4I3SL 2EDBA 1XGRA 3U46B 1JF6A 1P1VA 2EILB 1I7TB 4HT1L 3BALA 5T52A 1H3TA 1OK0A 4H13C 2N4IA 4X9HA 5L4IA 4CXXA 5CD5D 4IOIB 1KGYE 3G6JA 1GOHA 4QKBA 3T2LA 1UX7A 4GG6E 2IH3B 4Q0SA 5E6ID 1JF1B 1FNSL 3AAZA 3MRQB 1WEJL 4NQCA 4CEYC 1UURA 2WXIA 1KZQA 1CFQB 3S8GB 4PY8I 5E70A 5HDQL 1TMF2 4QGNA 1VRH1 3GSVA 3C2SA 4FXGA 2H0JA 1G9NH 3FS9A 1YN6A 4AQ1A 2WLLA 1JTZX 2C9QA 3KVDD 1UMIA 1U95B 3O3AB 4J12A 4XOAA 4P46D 2HVKA 5LBVA 4RZKA 1G6RB 3KLAA 3T2TA 4PIYA 3WEXB 4JFXB 2ROXA 4DP6X 4QTIL 1LHWA 4PIXA 2D2CC 3EW3B 1PBYA 5LEKA 2AK4D 2Y07L 3IDNA 4D6QA 5C3SA 2HJKA 4POZC 1QBMH 4CVWA 3SDDB 3CFIC 1HHIA 3O8XA 2VE1A 2ISDA 5IY5B 4Z7QB 1GJWA 5E88A 2SLIA 4WWKC 1TQWA 1E3XA 4DB5A 3O8XD 2V8MA 1I1YA 2HLEB 3OXRB 3VWKB 1OP3H 1E2VA 1UXMA 4W9CC 4B9JA 1WD4A 2NY4B 2ZOOA 3DOSB 1LGCA 3KYKH 4L5FL 4OLWH 2QTVA 2YIHA 2ICWA 1RURL 2BOBB 3GUFA 5DMJB 5GS2D 5KSVA 3G7DA 3TA4D 4OTXL 1MJUL 4YIQA 2MRYA 3HNSL 3V0IA 3ZRSA 4RN5A 4B5EA 2NY5L 5FBZA 4K8FA 1AR1C 3Q6FB 5JPMA 5E99L 5DR5L 2JIXB 1IGJA 4ENED 3N9QA 3NMEA 4GRWE 1JCKA 3FT9A 4E4ZA 2NLJB 4LNRA 1A9BA 4KKBC 2GVYA 3U4AA 1P2CB 1O9VA 2GUOB 3WGUB 4YFDB 4IV3B 1P7BA 3PREA 3C8KB 3EFDH 4PIBA 4BKSC 4FADA 1C8NA 1H2MA 3KSCA 4AK3A 4MA3B 3P11H 5HI3C 2YLHA 3TBWA 2AP2A 3MIDA 5EZLB 4BQCA 4Z9KB 3D9AL 5LXVA 1CLZL 4G1MB 5D4QA 3K6SB 4L9LB 3U9WA 1KXVC 3LV3B 4WTZG 3V4PB 3DUIA 1JGIA 4KJWC 4PJEB 1BJ1H 3TN91 2R0ZH 3BCWA 1T89C 3O3BB 1JZJA 4L1TA 1A6AB 3F7PC 4WFGD 1EFQA 4IQHA 1X5XA 3LIUA 3OD3A 3RVXD 2B39A 4HW6A 4OD3L 3B9EA 2GTZB 2AITA 4ONFH 5AKTA 2AXFA 4AQZA 5C0RL 3J9SA 1HL5A 1I4FB 5FLVA 2YAMA 2FJSA 2BSTA 5MEQB 5M95B 5IG7B 4JKLA 1H9PA 4X8NA 1HB3A 4EROA 1IX2A 2AV1B 5ANNA 1FXZA 4LO7A 2TNFA 1PDKB 4PCTA 5FZLA 1S3RA 4Q0QA 2I7SA 4YW4A 3HPLB 4JY5L 1MF2H 5G04L 2GN7A 3K2IA 3POWA 3QEQB 1A0QL 43C9A 3WS6C 5C0BB 4BM8A 4N2OA 1CWPA 4JFPB 2ED6A 2BIIA 1RPQA 4WFFD 1A6TB 2CO2A 1NGPH 4YGDA 2OKXA 1XSRA 5D7SL 3ZHLA 4C90A 2Y6HA 3GF8A 2WXMA 3ZYJB 4LPVA 1LCLA 2FLMA 4HUCA 4S2HA 1JV2B 4KRPC 4P99A 1ZE3C 4YBQD 5DT1L 3AT8A 1NDTA 2ZYHA 3CMOL 5CMAA 4ZW8A 1K42A 4OVVA 4TVPE 4BE3A 1FVEA 1XR9A 5EBGA 4M8QB 3WUWB 2AXGB 2NLRA 4FF9A 2WY3B 4EI5B 2V4AA 1DVFC 4PJ9A 2GNDA 1UD4A 2W88A 5E2WH 4L2LA 4DVBA 1SBEA 5DS8A 4XNZB 2Y6GA 2CDGA 4YZ5A 4Z76A 3FO0H 3KPLB 2ZT9C 3GJEA 3N91A 3H0OA 4PJ9D 2ITDB 3TAYA 1QFPA 5CG9A 3JQXA 5K8SA 1E6JL 5HVWA 3RMYA 5E00A 4CVXA 1OD7A 3HFMH 4PLJD 3QJQB 2WR9A 3FOLA 3H3BC 5JIUA 1STMA 2DFBA 1IRAY 4COUA 5CXPA 4OZHB 1SM3H 5ACMA 4META 1NJ9B 2DVDA 3AKSA 1XBFA 1P4BL 25C8L 5JHDB 3SY6A 1E4JA 4S2FA 4J2QA 3K6OA 3ZDZF 2J1UA 2OR8A 4XUPA 5ABJC 5IQ9B 1O9ZA 5I1DA 2QMKA 1NC4D 4LKDA 1U8MB 3V4UH 2EIMB 1W6NA 4YQXH 3QYNA 5FXVA 2IQ9H 2QNKA 4CDQC 3ETPA 3I3DA 4MGSA 4DMIA 2ZONA 2FUQA 3QA3A 4QHKJ 5KSBA 2BCMA 2ZF9A 1XV8A 2FJGB 1YO4A 1USQA 1HB1A 3DBXB 4RGMB 3HZMB 4BISA 4W9KC 1N5YL 1VBD2 1XL4A 4JJ5A 3QULA 5CJQH 3U25A 1HQRB 2XQYK 3QPXH 2H6CA 4EDWL 1AQDA 4FFHA 4AIOA 3SE8H 5TF1L 4KU7A 2QVMA 4ZUWB 5DU7A 1EEQA 2NOYA 3H7LA 4ZFOL 5IR1B 2HWC2 2WCSA 3BVNB 5EG6C 2Q7YB 2SEBA 4KI5F 2GT9A 4NHUB 3QJHA 5D2AA 2J6EH 1EAOA 4RNRB 3LQZA 4EN3B 3JV5A 3X13B 5IJCC 1MG2C 2KPNA 4Q2ZA 5DAQA 5F5AA 4MQXC 5EULV 1B2WL 4Q4X2 4U1LA 4ODWA 5H2BB 1RVFL 3UMTA 3SO5A 3H6JA 1JV5B 1XDTT 3WKMH 1AQ8A 1RK7A 5C4WA 3AACA 2VCMA 3WINE 3BUTA 3QQ3A 3MGTA 1EGJA 4Z7QE 2ATPA 1MEC1 2R1DA 5I8EA 2YMZA 1LK2B 1VZHA 4WI5A 4GKZA 4QHUA 5CCKH 1AZDA 4OF7A 1M2OA 3V5HA 2P44B 4BQXA 2PR9A 2XKNB 3O6FA 3MICA 3UIYA 5EZPA 4ZNEE 1BQPA 5C0AD 5KAQG 3FCTA 3QIWA 1GCYA 1IAIH 3STLB 1XAUA 1RHI3 3O6FD 1GIGH 1OHZA 5FFLA 5IVYA 2DIAA 3REWB 2P6HA 3VKFC 4K21A 4AI2A 4B9YA 1WFMA 1UOFA 4MJ4A 4YVUA 2ARWA 2VZVA 5F9WC 5FYKU 3CN4A 4LRNH 3E2HB 1B0GB 1S0EA 4HLZH 2XTJC 3MRIB 5DMIH 2AZAA 3L95B 2WIIB 4YXHL 1AD9A 4FOMA 4K7PX 5GSVB 2Q8BL 4LSSL 4RHV3 1W99A 1D7DA 1X9RA 1TTFA 2UWEF 1W2TA 2X6MA 4WFHD 1R4XA 5CFCC 5FCUH 2X09A 1QBAA 3NP4A 3PWPB 1ZGLB 1Q8MA 4QB1A 5D1XB 3DSNA 1I5PA 5I8KL 3X3FL 1NFKA 1BZ9B 4OH2A 3BKMH 5DZ9A 1N68A 4PJEE 5T1LB 2Q8AL 1RMFH 1LODA 4CCOA 3M3OA 2R1WB 2Q0ZX 3EH4B 1EEYA 2VN3A 4UT9L 2LVEA 2P5PA 3V52H 3THCA 2O6DA 4BJLA 2YMOA 4JLRA 1H4GA 3K5SA 1KBPA 3JWNC 3LTVA 3BN6A 5LCVA 4YZ2A 3TN93 1ZZBA 4KTDL 3L3KB 4OSUL 2YQGA 3V5DA 2DM7A 3X2QB 1CAVA 4DP1X 3P77B 4ABUA 4EAEA 4NPJA 2G2RA 1JNLL 1N59B 1HIML 1ACYH 3LKQA 4Y9EA 4BBWA 2OCCB 5B4MD 5F89A 1I1FB 2Q76B 5KG9B 1XQ4A 4KY1H 1BZQK 4W6XA 1JXDA 1CE6A 1IG0A 5J7CC 2CDPA 4UW5A 5JHBA 5FUPA 4NIKB 2DJ4A 3QEQE 3EUUA 1IIKA 5SV8A 2CHWA 2ZAIA 2H8PB 2FMDA 3OHXC 4XPTL 5FXCH 1U4FA 3OJMB 5EZOH 3V9CA 3X3GL 3I2CH 3ZLQC 4IRJD 3HI5H 4N1HB 4JGNA 4ELMF 1NFAA 3JYBA 3TA3B 1X6NA 1CYWA 1EUTA 2W94A 3HQRA 1KTRL 1GSKA 5FY7A 5F44A 1RUC1 2VXQL 3GC3A 4QRSA 2Q87A 3G6JF 1GKEA 4IEWA 2A4EA 1E9PA 5EF3A 1YO8A 2F1BA 3UPCA 1UD5A 2XV2A 2A9NL 2L7UA 5HHNA 5FYKD 2CO1A 3U9UA 2D7NA 2WGXA 3IGFA 4TQEH 3TT3L 4F7EB 5C7XL 4MD5B 5HGHA 2WZ8A 5LEJA 3VFUB 3RUGA 4BHUI 5E1AB 4XP5H 4XCEB 4PV9B 1FZOB 3EIFA 5IVOA 1CE1H 1ET5A 4OFIA 1LEDA 5DK2B 3VX1A 2XPZA 1DCEA 1IC1A 4XC3H 5BV7L 3ZMOA 1IAKA 3WCYA 5INCA 2JB6A 3PAZA 2CWSA 2XX1A 1TTCA 3LS5L 3OKDB 1NCRB 4GKNA 4W6YB 3SCMB 3EOYG 3HTLX 4YDIL 1UY1A 1MCOL 4QDSA 2EIJB 1G9MC 3GMQB 5D93B 1ONQB 5E94A 2A6JA 4LGPB 3ST7A 2F2HA 4R2GC 5F2FA 1SHXA 2Y25A 4Z7VB 4LHJB 5L2KB 2CIKB 5JHDE 1PFOA 3DYOA 3WW1A 4FQXD 3L6FA 1JIBA 3DV4B 4OCYL 5BQDA 1N1YA 3IKCB 2YOCA 32C2A 4N6QA 1LEIA 3D69A 4HUXA 3RIFF 1HINH 3R1GH 4XMTA 4NO3B 1NXMA 1E5BA 1CD1A 2OQJB 2ZNXA 1NBZB 5DJDA 1E9OA 3SYOA 1J1TA 5E16A 4ZMLA 4L1SA 2DI9A 2JKWA 4I9XA 4BE6A 3PWNB 4XZ4A 5JA8B 1GTFA 5LA9A 5FDYA 1BREA 1P6AB 2EABA 2GW5A 2ZGOA 4FTDA 4YLQT 4QB6A 4XPFL 1JZ8A 2J2ZA 4KVNH 1DN0B 5JXGA 3WUDA 2YSTA 3SBQA 1PM7A 3ZT6A 2W92A 1SDWA 3O45B 2CLZA 3INUL 3RFRA 1JI6A 3DJSA 1KT2A 1LR5A 3I6LD 4ZW6A 3BSZL 5TE7L 3PJYA 2P52A 4BKLA 3UROR 1W2OA 4HX1B 1FFTB 4TUUA 3T0EA 4XCYA 5DQ9A 4NQED 4KXCA 3DKHA 2X5IC 1E4WH 1UOVA 4KL1A 4NPLA 4ANWA 3T0ED 1YYLH 2GIMA 3ILQD 2RM21 2YUEA 4M00A 5IQ7H 2NXZB 3U2IA 1F6AA 4P5TC 2BWDA 3PUIA 1DVXA 1XF3A 2XWTA 2DYCA 4MB3A 4XUQA 1L3WA 2V8LA 4QHLA 2IALA 3CCHA 3B2XA 3QIBC 1TNRA 1OF2A 5SX4I 4DP2X 2MOQA 4R4ND 5IB1A 3BO8A 1F41A 1MVUB 1MEC3 2ZHLA 3QYMA 4XBLA 1B4RA 2J88H 3B2VH 3KPQA 4H1LH 4K8RB 2IAMB 2YHJA 4GRWH 1UVQA 3AT0A 1FE8H 3QNYA 1OARH 3B7RL 3D05A 4ZMQA 3EBRA 5GZGA 5IHHA 3NFSL 4RMQA 5JHAA 3PHQA 2BHZA 2JXMB 4DO6A 1WRFA 3GJFK 2O61B 2K4WA 4U1KA 4KGQA 1A1OB 4K1YA 1FT9A 2NN8A 4M43H 4JHBA 4YDMA 2ETWA 4WHYH 4Z3FA 2UY9A 1UCTA 1ZPUA 2YEZA 3CXHJ 3GSRB 4J27A 3RZWA 1ND3C 2O5XH 4DQOH 1QI4A 3ZO9A 1OPGL 3MJ8B 4F92B 1CGYA 5D7LD 1QNIA 4OVUA 1OKOA 5E7FA 2BTVC 5FLHA 4P5KA 2AQ3A 1CF8L 3GMOA 1CICC 1S7UB 4LSUH 4YDZA 4W6YA 1U3HC 3PWPE 5T1KA 3CPUA 2WNUA 3G04A 4QU1A 4NO2B 3NCJH 4U1IB 1QNWA 5DSCA 1AR61 1AXTL 1A7OH 4NN5C 1WBLA 1IJNA 1YUKB 5EOCJ 2OMYB 3CFMA 5T5FL 4QTHB 4Y88A 4IGPA 2IDQA 2WCPA 3UAFA 4JKWA 2R0WH 2YRZA 4HKXA 4D9RE 1J1PH 3H8OA 1FHGA 2Y4SA 1KLUB 4KUZH 1N0XH 5FIEA 2EO1A 1WLTA 5EFIB 1EANA 5G5DA 3IB3A 3MRPA 4OF3A 4TRPL 1DQKA 1OQ1A 1V6IA 3P1IA 4MLOA 3AS2A 1RXFA 3H1MA 4JBSA 1PZCA 4XFIA 4LLQB 5LNDA 1NY71 1TYEB 3IJ7A 1G7HB 3ZDYB 2Z31D 3OD4A 3DJRA 4IESA 3U7YH 3TEYA 2X1XR 4GQ7A 2ZSVB 4JFHE 3GI8L 5H37G 1OTSC 3K5RA 1YNAA 4XNYL 5AOLA 1XZWA 3IFNH 1CDJA 1MCWM 4IMLB 4OZFH 4DP9X 5C9JA 4YW2A 3S5LA 3O12A 4DS0A 2WWKO 4TVPH 1CZVA 4LVHC 2DL9A 1E5RA 1AMXA 4L0PB 4LSDA 4XMZA 3BI3A 2J5LC 2DPKA 2NXYC 2YQ3A 3FZUC 4CADB 4QYOA 1JDCA 4F24A 2YPJA 2AW2A 2RAMA 3MRKB 5FM5M 1RD6A 4XRCA 1UD6A 4XF3A 4NZFA 2W9DH 1MREH 3ENEA 3FB5A 1Z1WA 2VBDA 1S6NA 4NZRH 5KSBF 4OZHF 4KTGA 1UKQA 2Y6KA 2GJ6B 1MNNA 4JFED 3PMSA 1RUC3 3V10A 3FLPA 1ZANH 4SLIA 2FYVA 5C3IA 4XNMA 1UIJA 1ZTMA 1L9QA 2O5YL 3Q9PA 2WYFA 4CGUB 1B0IA 3LX9A 1E7UA 4Y4HA 4OULA 1QTSA 4R7NA 3VGHA 1JOBA 2PXYA 2APBA 5AZUA 7CGTA 2UYLA 5E9DB 3JBG1 1OV8A 1YECL 2OS7A 4H0GA 3WF0A 2PXYD 1HW5A 1H3VA 4Y7MA 2KBGA 4J5VA 2W65B 4I88A 1XGPA 2BVEA 4MQTB 4LCCC 4GXVH 4WK2B 1D2OA 3HG1E 4Z7VE 2J71A 5L2KE 4XJWA 2A6IB 2PCYA 3FF8A 1EAH1 3WOGA 1BIIB 5KJRH 1SBDA 3ZQ9A 4KH2A 1NBVL 1J9RA 1HKLH 1ZD6A 1ED3A 3ET9F 3I6SA 3C2AL 2WINB 3GJFA 1VRH2 3O0LA 1G1YA 2P80D 3PWJB 1WBYB 5C0DA 3W39A 2BH0A 2JKSA 2LLGA 3PHSA 3RWCB 4LHNA 1JH5A 3HOGA 1MPXA 4CC4A 4NN7B 3FPXA 2JV6A 3O0RL 4AI9A 1B6UA 3TVMB 1OOWA 3B7SA 3NJFA 3EADA 3AP7A 5GS1C 5J1XA 1OE1A 2P17A 4TULL 3KS7A 1HRI3 4RCAA 1J5OL 1G6RH 2PETA 4R4BA 1I3GL 1OAQL 1BMV1 4BSJA 4DINB 3B2DC 5EU7E 4AVKA 3CJIB 1L6ZA 1XCQB 3HN3A 1P53A 4RIRB 5E7BA 1CJDA 4XPVA 3EJTA 5DI8A 5DMKA 4XBGB 2C3HA 4JQVC 2ADFH 2VOVA 4K7PH 4N1EA 3U0WL 3D39A 5I93A 1AO7B 1EO8H 2XZQH 4LO9A 4BYHA 4X7TA 5MP6H 5DD6B 5DEFA 3NJJA 3PUAA 3MGAA 4G7VH 2NP0A 2OS2A 5A6QA 1LO2H 3P3TA 1F3JB 3ZYPA 4NRQA 4JFQB 3RKPA 3ZOIA 1P4UA 2EEAA 3QEHB 3HE6A 2KQNA 1IC5L 4KK6D 3TWIA 1U92A 1FL5B 5FLUA 2ZKHH 4U0QB 4E9TA 1KFAL 3IJEA 2JDAA 2R0LH 1W80A 2VDKL 2WS92 2WZR1 5CEXB 1AQKL 3HE6D 2OMWB 2G60H 2FK9A 1SFPA 4FA6A 1ZA3B 3MNMA 4MDIA 4CZSA 3JBG7 3MCYA 5EC1B 3RY6A 4MKMA 3T3MB 3GBDA 1Z32X 2R69H 5BNXD 3WAKA 2VNOA 3OYWA 3DUSB 4XXCC 4I77H 2Y5TB 4QEGA 5EU3A 3H1YA 2YN3A 1GHFH 4UT7H 5CB7A 4PJGB 4UI2A 4MAYA 4JUSA 5I6PA 3U4BH 3T2NL 4OFVA 1SFDA 2SBAA 3PNWB 4MAYD 3ON7A 1O8SA 7FABL 5A33B 4RR3A 2BP5M 3QRGH 4PGCA 4QAMB 1IEBA 4QRTB 2D4FA 4Z0XA 3V4PH 3CMGA 5DC0A 1WLHA 4L1HA 3AM2A 3FB8B 1DN2A 1KF9B 3V6FA 1E2WA 1BAGA 4QQ2A 1BBJA 1HOCA 2HN7A 4FQQA 5GGSB 1MQTA 3LD8C 4LE3A 1VPOH 4O61A 5KVMC 5I19H 3C5JB 3GBNL 1KLGB 3IPEA 3MKKA 2D6OX 2WOBA 1CU4L 2XXZA 1KJVB 1ACXA 1SEQH 1FNAA 4KKQA 5DD1L 1WFTA 4AENB 5JPNC 3QOPA 3BKYH 1FYTB 2BRTA 1S5IL 2C24A 2EKSB 1V70A 2HH9A 4BSVB 1EZVX 4W9FC 4M1GH 1Z9PA 2CKBA 5BO1H 1DTUA 3RUGF 4ITCA 1AR63 1P4IL 3VHRA 4A6YB 3WE6A 3WD5A 4AI8A 2R9HD 3JWDC 1KB5H 4M62H 4P57A 1K5MC 1S46A 2NY2C 3AP5A 3ZFFB 2XJKA 3HHSA 1T1WB 2BY3A 4NWUH 1GU3A 3SDAA 5C6TL 4IIQB 1ZLUH 1C1EL 4MJ5A 2ZJCA 5D7JB 2ARJB 3SDAD 4D7BA 4LSTH 3GDBA 2HYXA 5T5LA 4GNKB 3ZDYE 3MJGX 4NUJB 3A4UA 3HNBM 4PDWB 4GH7B 1C8M3 3OPZL 2O6EA 1R34A 4APXB 1BX2B 1O3QA 4MD0B 2ENRA 5FKAA 5FUOH 3FUJA 2H6PB 5JW3H 4HSQA 3CDFA 3T2PA 4DEPC 2AI0H 2VDPB 3QPQC 5BNOA 1C5CL 4L4VB 1MW1A 4LVOC 2YJQA 3CX2A 3NZHH 1LHZA 3A21A 4P2RB 3CZNA 3RZCC 3VQLA 2OIIA 1VGKB 5BCAA 3J7MA 3MI8A 1KCVH 1EXUB 2VRQA 3V9EA 5KVDE 4AZ8A 4OKVB 3BZEA 1Q90A 4YSEA 1ZSDA 2BZCA 2J1EA 4MA7L 5IVEA 2DCJA 3QO0A 2GJ6E 5I0XA 3BRGC 3GGLA 3GNEA 2A1WL 4HWBH 5B22A 5CJOL 3UYRH 5D96C 5IB4A 4TLGA 1T20A 1UM4L 2GHZA 2F0CA 1MFVA 3C60D 4MCMA 3BPZA 1N6VA 1RV6X 5JMCA 5BQ7B 1I1CA 3O2VL 3M3EA 4IRSB 4MJID 1MHCB 1TTRA 3OGCB 1PF3A 5F9OL 5C08D 3SBWA 4YS4A 2D7QA 4U6YA 1YQVH 3PWLB 3UNPA 4HN0A 3LIGA 1MW3A 5E9DE 4YXKL 4HHGA 2V9RA 2ZOWA 3RGVA 5CR8A 1H8TB 4KU8A 1BVLB 3C2UA 3LDRA 1JGVL 4BHUA 4Y4YA 2WXLA 1I8KB 4PSRA 3OJDB 5L7OC 1LDPL 1AXKA 3RGVD 2FBOJ 3N1GC 1D7PM 2GCYB 1Q8SA 3T8VA 3VGFA 3JBG3 1YMHA 3T4AC 4WI4A 4RQPA 4CYDA 1H3UA 3L4WA 2MHAB 3T3PF 4PRHB 4R26L 3EOAB 4BFIB 1XCXA 3D4ZA 1PMJX 4XWOC 1D2QA 3FOMB 3GHBH 1JHKH 4P0DA 5ESQA 4AR2A 4HCIA 2Z7UA 5H9SA 4YHPB 5FQ0B 3I2DA 4LF3B 5EB9A 1HNYA 1QQDA 3IMRA 1ZLWK 3RHWK 1NIAA 3QFJB 1PZ5A 3QUHA 2BEOA 4PH8A 5F6IB 4CJ1A 4XDQA 3QIUB 4EN9B 4PJFA 3SHSA 1SPDA 2XN0A 2ZCKH 3HRZB 3ZT5A 2XVLA 2H4EA 1AXSA 3UTPD 4G7QB 3RZMA 4FFWD 4Q8KA 3LH2H 1R3KB 2VLJD 3AG3B 3MRFA 4XFFA 4NQQA 4WDIA 1DANU 3GSNB 3TT1L 4DKEL 4KVCH 2QQJA 1B35A 3NSDA 5F5CA 1ODMA 3BAJA 5EU6A 3EGDA 3NIFB 1GRWA 3V6OA 3WXVL 4WI8A 1KYOK 4U7SA 1X4ZA 4ELKB 4Z78A 1F35A 4UUJA 3BIWE 2FSEA 4X6EA 5EU6D 3RILA 4NM8H 4K9EH 2DIBA 4IIZA 3BVVA 4O2EB 5D5MA 3RPBA 1G5AA 1INEL 2GY5A 3HR9A 2CBMA 3UJJL 3IKWA 1KXTA 3VW3H 3TEZA 1DQDH 1YEKH 4FI8A 5D71L 2BGCA 2NMNA 4JDZB 5BNPB 2A9ML 1GWLA 1E42A 3ZJAA 1MPAH 5B38A 4QWWD 2J8UB 4M61A 3ZKMC 4AI0A 4Z7OF 4LAQH 3UO8B 1TNNA 5LO7A 3V0WL 1I8MA 1KRIA 3SZKC 2BCKA 4P9HC 3B43A 3HMYA 5FYCA 2HKFH 2EUXA 4LLOA 1IHMA 4AIZB 4P2CG 3T3ME 2ED9A 5MEOB 5DZOA 2VDRB 1EVUA 3KL3A 5F96H 5DTFA 3MN8A 3EXUA 4IEPA 2E75C 4PJGE 3BRFA 2IF7A 1CN4A 5J11C 1R33A 5CILL 1FNEB 2J1WA 3PIJA 1FVDB 3PWUB 4JHAL 2HBUA 1X36A 3OKMA 5EN2B 3LEYH 1Q43A 3DX7B 2WLQA 4AXWB 4X98B 3I75B 3ELNA 1SACA 5I0ZA 1NDMA 4BFBD 4AVAA 3NIDB 3QNXB 4XETA 2CHNA 5ETUB 3WUCA 4UBGA 4GXUM 1ZIBA 1NQBA 4JGMA 4NWTL 2X6UA 5A2IH 5IREA 3ATDA 3ARRA 4Y1TA 3BQUC 1PLGH 3MLTA 4Y2OB 3VE0A 4WW2F 3RYKA 4NMIA 5DO2D 4LCVA 3QZNA 4HUVA 1VCBC 4WVRA 2M8XA 4AEJA 5DVOA 4DW2H 1JNNL 5FY0A 1FYTE 3IDCB 3P6BA 3GRBA 4MD4A 3VBRC 3K2MC 1AP2B 2KZWA 1SBSH 5HTSA 1WUNT 3W0WA 4LO5B 3CX5J 1KEGL 1XD0A 3RIKA 2VLLA 1IGCH 3L4XA 1E8YA 3IETB 2FGWH 3QORB 5A3NA 3FDWA 3D0LA 1IBZA 3UBXB 2DMBA 2J55A 4KKAD 1M3JA 2J12B 3UTSA 3VGIA 4DGIH 1DGWX 1X5MA 2AUYA 4LBAA 1AOZA 4PRNA 1PNFA 1O5LA 4XP1H 3VDDA 2D7TH 3UTSD 2EE2A 5I71C 1X5KA 3GRWL 4X99A 3ZMNA 5EC2B 4HVOA 5AG9A 3CVCA 4DCQB 4AVVA 3HQUA 3K72B 1VJSA 1HU8A 4I3RH 3LKRB 2BQPA 4FJYA 4F2FA 2AQQA 3P40A 2ETEA 1RUML 2JI3A 5DDJ1 2E6JA 3VYOA 3GHMA 3MRDB 2IG2H 3FSOA 4MRBA 1NLBH 2BP6A 3K71B 5IB5A 4L4VE 1X5LA 3MBWB 3G5VA 3WIFA 4FAAB 4P2RE 4NUPA 3V6BR 1J1OL 3K2UH 3U1PA 2HFEA 1SXBA 3CHSA 3O1MA 4JV4A 2FGZA 5L19A 4AE1A 2A0LD 3RVUC 3NSCA 4HANA 4XQWA 3MLRH 5E0FA 3D85A 1F5FA 4PD4J 1TUPA 5ICYB 4GAZA 3OGJA 4KQ4H 4LTAA 3QZOA 1E3ZA 4YHOL 1R1ZA 3IDYC 4IKIA 5ITBH 1WW6A 3P5BA 4NIIA 4TUKL 4IEFB 4C1XA 2FDHA 2OPKA 4CDWC 2W59A 3MLYH 2LGNA 1TOXA 3KM1A 4FO9A 4LITA 4QQPA 3ZYIB 3V4VA 3S2CA 2NY3D 1OM3L 1FG2B 5JA9A 3O1UA 1F02I 1DJHA 2PW1B 1D6EA 3GXNA 1OSPH 1NIBA 3RDJA 1NXD1 4OZXA 2VLMD 4TPRH 4HLJA 1IPJA 5DFAA 2OL3L 3FO1A 4QRRA 1I1AA 5JORB 2VECA 4LJHA 1UGKA 3GK8H 4R3SA 4Q6IB 1FDLH 1F4XL 3R0NA 2EAAA 5FY5A 1MW0A 4B9IA 5CHNA 5CCGE 2EDYA 2R0HA 4KRMB 2Q1FA 3IGUA 3S34H 3F95A 3N35A 2WXQA 3QUZD 3BZDA 4YHIA 3DPRC 1PAMA 4BCZA 4TN7A 3USSA 3C6LC 2OJZH 5LQBL 4WV1C 2CHZA 4WVWA 1QASA 4PRHE 4QXUH 4OI0A 4KI5C 4FTVA 5KHKA 1DVZA 4IUGA 4Y19B 4NUBA 5EA0H 4OJFL 3HHMA 2XZAH 2C1PB 5D6DA 5CF3A 4GQZA 1V6LA 1ASJ1 3NNJA 2YPVH 3FU9A 1NPJA 4FTVD 5EIIG 4R5XA 1A6VL 5CIPA 4K40A 3MHZA 3KQRA 5IK5A 2CR6A 4P23A 2D3LA 2KDYA 3DV6A 2VXUL 3QFJE 4YDNA 2NNFA 5AVYB 4DP5X 1MCRA 1D4VB 1FATA 2VXRA 3VBSB 3WG1A 4RRPA 5EU5A 2W08A 1HL4A 1AGBA 1H9DA 3QWRA 2QADC 1WE5A 1MS1A 4OCWL 2ZMKA 2XCMC 4H2CA 4B3NA 4NKMB 4UOQA 3QRLA 3JVGC 1RZQA 3MI6A 1UJ3A 2VAAB 3BE1L 3GSQB 4O5LL 4LEOA 5C0CB 5C8JA 3HNMA 1BQUA 3NIFE 1VEPA 2YGOA 3UZEC 2QTEA 1ETA1 4PGDB 2WZAA 4UQBA 4IU2B 3S5AA 4Z1VA 4ESKA 3VFTA 3I2HA 4JG1L 2XZCL 4O58H 1ADQH 3RWGA 4PJ7B 4KO9A 4H3WA 4GEIA 2UY7A 3O4LA 1DVTA 1MFBH 1TVHB 1M6OA 2J8HA 4HUUB 5GRJL 3X14A 1YHFA 3JD71 1A6CA 1PTZA 1NCQA 2CAUA 3R0RA 3BRDA 4UTBL 1LEKA 4AUUA 2ZOEB 3MIFA 4O2FA 4X4ZA 1I9IH 2ZGMA 1PO23 3K80A 1F4AA 5EWIL 4O4YH 1OFSA 5ISZE 1JK9B 3VLBB 5GGUB 1UEYA 3EQEA 2J8UE 2FQGA 3AVEA 4RWYH 2CIIA 3Q01A 1GPOL 1R5IB 2A77L 2BIPA 3EHBD 3HE7D 3DOIA 1R5WB 4KOCA 1T6BX 2X9ZA 3SYQA 4WSKA 3O3UN 4F9LA 4AH2A 5FK7A 2QJVA 4ZOEA 4M93C 2Z8VC 4DKDC 4Z5RB 4IM8A 4AE0A 1CYXA 4I2XA 4NAOA 4HCRA 3GFUA 4JM4H 1U58B 3QUMA 2RR13 1MFCH 3JWOC 4MXQC 4FFYA 4CBZA 2XYCA 3B1UA 2X4NA 2XWZA 1QSFD 5FHBL 5IHUH 3ZR5A 3GS0A 4OD2A 5IVJA 1I5ZA 3P3YA 3EYQC 3GDCA 3K2KA 1M7DB 1NFIB 4FPYA 5L7XL 4MGTA 3NIDE 3PRZA 1VBB3 4A6SA 4WWID 4AEIL 4ZMPA 1OOPB 4FHBD 1BQ5A 43CAA 5F3GA 1Z9NA 2WKOF 4CDXA 3EDJA 3JWNG 3N9MA 3AJ7A 2OTWA 3ZVXA 4OHWA 1YLLA 3MUY1 1KJ3L 3DRTA 3R06B 4P9WA 4PV8B 3KYMA 4QRPB 3SBPA 2HPTA 5IESL 4BQWA 3WN6A 4JQXA 4NXKA 3ZN5A 3CF6E 1QTYT 1S3KH 3LRSB 4NKIH 2LABA 5FW6A 1UOLA 4NERA 1F4YL 4D0BA 1MEXL 1CFTA 5IWLC 5FO2A 2I5YH 4MX7B 3ZPYA 3DJ9A 4HU8A 2BSBA 3PNAA 5CU1A 5HCFA 4J39A 4N0UE 3QZWA 1SJVA 1I9RH 4W9HC 4OI7A 4CUGA 1BW8A 1WBZB 4U1JB 5I28A 1AI1H 4P3CH 1MZ6A 2C3VB 3RVWD 5DJ2A 1X5JA 3B3IB 2D31A 1GQHA 2Q86A 1LMKA 3FBQA 2X4PB 3WIIL 2XIDA 5AUMB 3ASNB 4RAVA 3PTYA 4DP8X 4XBQA 5LBGA 1QNYA 3GNML 4AQAB 3K0YA 4DP7X 3POFA 5FZEA 1IU1A 3H2WA 5ABDE 1A64A 4ZRGA 1NPUA 4YNYB 4TKWA 5BRZA 5D8AA 1BGXL 3VZNA 5F0MB 1NMAL 4Z3JA 3PV7A 4LKXB 5KVDH 5B39A 4BM7A 1EIBA 1GS7A 1A4JB 4MXWL 1POQA 5BRZD 4JGYB 4KXAA 4GMP3 4AF9A 1U8OA 1FFPB 2WAHA 3ECUA 4G6AD 4YE0A 5J8OA 5DUPL 5LXGL 4LKSA 1JYWA 1LJMA 5FV3A 3EFOA 2CO4A 3TBDA 2BOIA 4FQLL 2VTXA 2Q9OA 5CEHA 1AZBA 2OR7A 3CVBA 4JZJB 4ZOBA 3OSKA 5EO9B 1OLQA 1RUPL 4Q4EA 1AF9A 2UVFA 5JAXA 1HHHB 4HOXA 4S2SB 4Y1UA 1GH7A 4M7KH 1Z5YD 2MCPH 5JZGC 4HK0B 4PS4L 3C75A 4F7CA 1KQRA 4F37F 2HWD2 3OGSA 2P48B 2PNDA 3CVIL 3CXFA 5LB1A 4Q6YA 3NBNA 4MZ3A 4CC0A 1MWAL 3TBYB 4OCSH 3LKSA 4PRBB 4F7KA 3HEIA 5DDHA 1XT5A 5H4ZA 5D8JH 1FOD3 1BLIA 4KHTL 1EAH2 4M56A 3CQFA 3LNEA 5B2GB 1CONA 3DBSA 4U6TA 1TZIA 5D5MF 3WFEL 1MFAL 1ULGA 4EZHA 5CADA 1OANA 3FHAA 2BVPA 1FPN3 3EXLA 3ZZQA 5FYLD 2R041 1TQ5A 3RVHA 5K39A 2EIZA 1FFOA 3BVTA 1IC4H 4N2GA 1H2LA 1UO9A 5FYSA 5F8QC 2D0GA 1GOFA 2NY4C 2RFXA 4Y19E 1CCZA 1YJLA 4HWEL 1V6OA 1Q94B 5JXED 5LN8A 2VOXA 3ZKUA 2H5UA 1BMV2 2Z35B 1U8LB 1X4YA 4GKLA 4LLVB 1OIOA 2EIGA 2W46A 4KWLA 3N7JA 4F5CA 1UQXA 1O9WA 2A7AA 3B7TA 3ZFGA 3C7EA 3EUDA 2ZCLL 3NJNA 4NUQA 4QHNA 4CW1A 3PABA 3MNZB 3N9PA 2OTPA 1E4XL 4I4WA 2CCLA 3O6LL 4JFVA 3S96B 3PFQA 2B3RA 3RFZB 3I59A 2WTPA 3TTYA 2RDNA 1EDHA 2HXAA 5HHXL 2V3EA 5C0CE 4IV3C 5I1IH 1SQMA 1PVC2 2JB4A 3CTTA 5GALA 5KR7A 3SQBB 4XMVA 3LEIA 2FJFA 2BNMA 2ZGRA 3V0EA 1D6VL 2DN7A 3MRCB 4TVSa 4MHUA 3BPNB 4HOMA 4JFYB 3DXAB 4OBRA 5J3HD 4WWPA 3OGGA 1ZWIA 1KN2H 5L8JB 4HAGA 2WZR2 3ABKB 4L9LC 3DRQB 4BUGA 4BRVA 5BUAA 4IE4A 1G9ML 1JYNA 3OKNB 5C9KA 3ZDXF 3U4SA 3BAXA 4FFZH 4QJ4B 3ULVD 5SWSE 1XSOA 2MQ0A 2NW3B 4YSSA 5IFAL 1F1AA 4Q8BA 4M6MH 3JD73 2P24B 5F3HA 2NQYA 4ORFA 4H0LC 4K3JL 5T1DH 5A3OA 3B9DA 1VF5C 4X0NA 3DMMB 5DS1A 4ALAH 1TITA 1T1YA 2AJUH 4N0YH 2R2HA 1R9FA 1SG3A 3FT2A 4XVJL 1ND2B 4XC1H 4DETA 2AGJL 3IWZA 2RQ8A 4ERSH 2UX7A 5CSZB 5CUSL 5C09A 2G9GA 5F9AC 1XB6A 2R29L 1MRFL 2DI8A 2V33A 1YEWA 5JSRA 2X9WA 1Z0NA 5B1JA 5C09D 3B5LB 5ABAA 4C55A 4LLWB 2VVEA 2WLKA 4MS6A 2KZ1B 1AX1A 2J1VA 2VU9A 1QJY2 1UWGL 5CZRA 4U33A 3LZPA 1M4WA 3QCUH 4NUGH 4XF4A 1WPCA 4G8AC 4FDWA 4JRYA 3BI9X 1FSKC 4N2NA 4U05A 1FZMB 2EE3A 4YBHA 1JN6A 1H6EA 5CD3A 2ZUTA 5CWSA 4I5BB 4G8EA 2A6DB 1NCTA 1XGQA 2VH5L 2WO3B 4JRYD 5AOKA 1K6QH 1OA2A 2AEWA 1GYUA 4QRPE 1I8AA 2BINA 4JVWA 4A6YH 4YM2A 3AXIA 5EEYA 4LBKA 4X4YB 1G7IA 2Y1ZA 4EI5C 5DAXA 4PVNA 1C4RA 4FLRA 4C59B 2FL5B 5E8NB 4G7YH 3U36B 2AVGA 3JV4B 4XNZC 2OUJA 1R3HA 5JW4R 5JZ7D 2BP8A 4HEPG 2JIJA 3W38A 2ZWSA 3CVHL 3RB5A 4F2MB 2RB8A 1KENL 4QY8A 4J4PA 1C9SA 4PVLA 1NFDE 3KEHA 4I7ZC 2EP6A 5IT2H 4Q4V2 1IILE 3ULUL 4MZ2A 4TYSA 2KDGA 4HJIA 5LDSA 4KKLC 4PBOA 3BT0A 2QQQA 5A7QA 2QV2A 5E6HA 4OI9A 2BV4A 1F8TH 5M7QA 3IXAA 3I2IA 1OW0C 1NBYA 5KBFA 4COYA 1SY6A 3ARTA 2NY0C 4J25A 1NGQL 1YY8A 2V2XB 1OAUL 3STZB 3BPSA 3B4NA 4GW1A 4L2YA 5LRSA 3EGXB 1KBKA 3K3QA 1QH7A 3PGFH 4R90L 2IGFL 2PWGA 1GR7A 5E6IB 2P7TA 1BBT3 5BO0D 2HEYF 4XVSL 1CJYA 4YE4L 2P4AB 2EYTA 3O11B 3TN0D 2EYSB 1CMOA 1BVKA 3BUPA 1A1NA 3HLAA 3AAZB 5D7KE 2HWE2 3IBEA 4M01A 5A6YA 3FMGH 2OK0L 3VXTA 4RGMC 2VMIA 3O1OA 4XZUA 5TPWL 4PG2A 1S7SA 2A6WA 3LAFA 4APQD 3MGOA 1OE2A 4IBLT 4PLNC 3LE0A 2BOLA 2YARA 3GSVB 1RJZA 3BHBA 2NY6C 3U9PH 4P46B 3ZXAC 4FXGB 4AYUA 1MXDA 1JRHL 2B5IB 5FO9A 3VB8A 3OM3B 1LE5B 2DQCL 4P5YA 2WLLB 1T66D 5D1QC 3V0VB 4QXBA 3HAEG 1DJZA 3T0DA 1T0NA 4OUEA 1MXGA 2HVKB 2QPDB 4K3GA 4QCIA 3E5XA 3I54A 4EXPX 2AK4B 5EHDA 4CKVX 4JRXA 2UURA 1X82A 4QXTB 3ARGC 1KC5L 2EC8A 4Y16A 5FYJD 4BFNA 1RUJ1 2OQ7A 4BFEA 3TV8A 4ZPVB 4F93B 3DK2A 1THCA 4G80A 3WDHA 2YPKB 1AS8A 3IMUA 1F11A 4Y16D 1MLCA 5DHYA 1V3KA 5DJYB 1YNKL 2VOWA 2YWYA 1HWGB 3O8XB 3VYNA 4LHSA 1TTBA 3U11A 4LXFA 3BSHA 1IAOB 3QWOB 3CVDA 1TVDA 5F7BA 4X0KB 3OKEA 1Z5HA 3WY2A 4ZUUB 1I1YB 5A6MA 3S37L 9CGTA 2G9ZA 2CRMA 3TPUB 3HBPA 2C9UA 2JG8B 2ICWB 1URZA 3HAEH 4I1RA 2BIOA 2FX7H 3JZYA 3O6MH 4AEDA 1KCUL 1QSZA 3HC0B 1J18A 4GAYA 4OM1L 3ZIYA 2P42B 1VMJA 1DSWA 4P2QD 4PJ7F 3GSNH 5IFPA 1C5IA 3LEMA 2F7QA 2DTWA 1ET8A 5CGYC 3E2HC 5FW8A 3W9EA 4AGRA 2A5ZA 3AK0A 3RTQC 2AJZA 4MGQA 3TO2A 4C47A 4TSBH 3L7FA 2XOMA 1V10A 3HS8A 1UA7A 1WD3A 3IM0A 2Y3AA 3MA9H 1EP0A 2GMPA 4CP9B 3CU1A 1BFTA 2VOKA 1W8NA 3WDTA 2PUQT 3BPOB 2ZWKA 1T4WA 1GYVA 4IKJA 2E32A 3QJVB 3FUOA 5I1JH 3E9TA 2FMYA 1CK0H 2B1HH 3DXAE 4ATWA 2ZYRA 3ARFB 2FZ1A 4RX4A 4BMEA 5D1XC 2FJUB 3TNMB 1QR1B 1BEV2 4HJ0C 2YG0A 1G9NL 3K2OA 5T55A 3VKNA 2QELA 3ECWA 1RZFH 4YLZA 3WCSA 3AQYA 4FNSA 1N6QH 3RWIB 2P9RA 2X6VA 3KH4A 1GC1H 4FTEA 1SLUA 3AGVA 2ZGPA 4LLMB 5DJ0A 1ZM1A 4OHYA 3Q2LA 4OQTA 3EG9A 4NPYA 1OOAA 3KNBA 2JJTC 2YYOA 4HD9A 2VDRH 3PDGA 3HJEA 2VM9A 5CZVH 3P9LB 4NQSB 4CPBD 1B09A 4GUPA 1QBML 5KBNC 1O6SB 3DYPA 2CM6A 3D25A 3MLZH 3M7AA 4QXKA 5EJZB 4HKBB 3RI5K 4E5XB 3ZXGA 3CZUA 5DQ0A 4BFJA 3TV3H 3ZSEA 2HT4C 4NQDA 4ZOAA 4UI9L 2WQ8A 1ZSHA 1GOGA 2JCCA 5TJWK 4B5ZA 2YFOA 4KBPA 4DO0A 5DRZA 4XH2A 1OH3A 4AGOA 2OQ6A 3KYKL 4OLWL 5JW4Q 3B3QE 3DJTA 4GO9A 1DJXA 4ZUVA 5ELIA 3TA3C 4N6RB 2I74A 4ELDA 4N8CH 4Y9FA 3I3EA 3FO2B 3E8UH 3HC4H 4RRPM 2QMJA 5FCCA 3WNXA 4HIHA 1S78D 2OCJA 3MBXH 1BZEA 1MIEH 3QJFB 1TZ8A 1YI9A 2QPUA 4CL7A 1Z9MA 5DZJA 2WKKA 1T7VA 4XMPH 3F7YA 4PGEA 3MIGA 3EF4A 1ZHBA 4H26B 2KLRA 3B5TA 4CNIB 3N1QC 3P11L 4LKFA 1BD2D 4PUBH 2E53A 2CDGB 4ORGA 3C9NA 3PJNA 2DFCA 3PV6A 3WX5A 4RSYA 2WUCH 5JNYB 1V7MH 4LBEB 5TD4A 5J6SA 1L7QA 4UFKA 5LBEA 1A3LH 1Y07A 3BN3B 5AOZA 2W07B 3OUJA 3QISA 3HG4A 5E00B 1MAJA 4CVXB 1BXHA 1NCRC 4IETA 2R0ZL 1ZJBA 3NH7H 1YFYA 5DDJ2 2RS31 1DLFH 3AU0A 3HCVA 4WM8A 5D93C 4N2LA 2NDGA 3ITQA 3ZR6A 3ARXA 1MS0A 1Q1JH 2R39A 4LVEA 3I3MA 5AW8B 1LD9A 1NC4B 1BZDA 5CNAA 4FI7A 1JMXA 3L3IB 4DPBX 4FTBA 2QBWA 5J7MA 1CXFA 1IE4A 2F74B 2UUDK 3SDYH 1TQBB 4JO8A 3IRCA 3T1FB 4E0RA 5C86A 4BE5A 4D0QA 1BG9A 4L8QA 4Y20B 4TQPA 1HLCA 1MF2L 2V17H 3FTVA 3RPQA 1ZZ9A 3MRBA 3E0GA 4PREA 4PJ8C 4AV4A 2L7EA 3NACH 3QA3B 4NZTH 3X11B 3MAWA 2OXGA 1PJWA 3ZU8A 1JZEA 1XNAA 2QZ2A 5FZFA 3RY4A 1NGPL 3QR1A 4IDJH 1ULEA 2JDYA 1MQKH 2G4IA 5HBAA 1AQDB 2FQPA 1C7SA 3CNKA 3FTGB 3NQKA 4OAWA 1RL3A 5TH2B 3MLLA 2G0LA 5EU7C 5JHMA 2K3HA 4GRLA 1PQZA 2CK2A 1BZ7A 3VTAA 4TUOB 4AI1A 4N9HA 3BLPX 4N85A 2AK4E 5SV5A 5J6HB 5IM7B 1LNUB 3LQZB 2F5BH 2HTLC 2B59A 3N40F 4GRLD 4RAUA 2ARJQ 2JWYA 2N0MA 4L1BA 4Z7UA 5KXCA 5FZ1A 4RMVA 5E2WL 1AR91 4BFFA 2PABA 3MR9A 5JOPD 3U0PA 1FN4A 5HYEA 3FO0L 1SQ4A 1UM6H 1BAWA 3LHPH 4TTDD 1H3XA 2OZ6A 1YVLA 4JVUA 4G83A 2QVSB 1K2DB 3HI6H 3MGTB 3SJVA 4JMXA 1GKOA 3X12A 4L18A 3O7OA 4YPGA 2VGLM 1VA9A 1UH2A 3GB7A 4N24A 5I8EB 3HFML 3MACH 2DQFA 5C0AB 4IGBA 3SJVD 1MS4A 3V5HB 2PHRA 3IM1A 3O6FB 2MEJB 4CKQA 1SM3L 1Q8VA 2HLAA 2EXYC 4HWZA 4B4QA 4AGPA 4FG0A 2UV3A 1OCZB 4K8RC 5TDPA 4A67A 4KXZH 2IAMC 5DS2A 4G3YC 3VBHB 3V55A 1JSYA 2I27N 3IDIA 4L3EA 1RUH2 3KHCA 3E6HA 4F8QA 1JPGA 2BS9A 4ZJ9A 5EZWA 4IBYA 2WNUC 2EYRA 2V5SA 3OTFA 3UKNA 1MZ5A 3BESR 3WTSA 3V4UL 1NMBH 2VZ1A 4L3ED 3ZKNC 1L3NA 3ZSLA 5KWRA 1OF3A 4YQXL 4RQQA 1Q4NX 3QARA 2IQ9L 3FQRA 2IMNA 4JANB 2R7EA 1KPVA 4A2HA 4KGJA 4F8TA 2W1WA 4UQDA 1MFDH 4WGWB 1LHVA 4HS6B 1EAPA 2PCFB 3O81A 4NN6C 1L0QA 2XWBA 3VXOA 4CVZA 1KPUB 3MOAH 4UB0L 1CAUA 5HYQB 3MLUH 5CJQL 2XXMB 4P2YA 3QPXL 4L8DA 2ZWNA 3SE8L 1WA4A 2ITFA 3F00A 5F71A 4R5VA 5MERB 5L0QC 4WFGE 4NE9A 2WFF1 3N4MA 2HWZH 3H3UA 5JI9A 5I5JA 2J6EL 4C8XA 4EUPB 1H3PH 4IU3A 4MA1B 3A67H 2CJ3A 2XPGB 3WFZA 1A8DA 3VMNA 1KTDA 2Z64C 4RFNB 4HHAB 2Q1ZB 3EZJB 3FFDA 3VRLE 3WKML 1CAVB 4ARXA 1ZEAH 5DRWA 3ARDD 4Y1VA 4H8HA 4JE4B 3LKQB 3TIDA 2QQKA 4WW2C 4J6RH 5C3QA 1I7RB 3BTAA 5C8CB 4B97A 2ZOKB 1CE6B 2ZX7A 1DLHA 2UY6A 4YFLI 5FPBA 4E4DX 1UZ6E 5CCKL 3WKYA 2R2BB 4X6BA 3WQ1A 4WFFE 1TPXB 4IRJB 3W81A 1OSGA 3KVBA 4Z7AA 1RUE1 1IAIL 5DJZB 1GIGL 2X4OA 2XX0A 5H35A 2A70A 2AEIT 2NYYD 4C4KO 1K45A 2EDJA 5C3LD 4ZFZB 4D9QD 4GIPD 1ZYBA 3SPCA 2VNRA 4LRNL 3OKLA 3HG5A 4PBVC 1TENA 1X5ZA 3OF6A 4JL1A 4N28A 4UILH 2XRAH 1URLA 1L5GA 2CBQA 2CE6A 4TLTA 1MHHB 4NQVB 5FA3B 1YNTB 1E9PB 5I1LB 3L1GA 2A71A 5FFGA 1TME1 4FXTA 2XR4A 3LNHA 3KLQA 4WGKA 2GBTA 3OF6D 2EDLA 5HHNB 3WJLC 2YS4A 4QO1A 2VDLB 1GYCA 1LEGB 4X6CA 3ZSSA 4L0ZA 3TWYA 4JEGB 3RPIA 5HGHB 1AL21 1X9TA 4KZDH 4NBZB 1WFOA 4EZMA 3S4SA 3JT2A 5E8EA 1ZX5A 4V2CB 5FCUL 4Q9CA 4Y3OA 3II1A 3QSKB 5LZ6A 4KDWA 1BVZA 5INCB 1SOSA 2JB6B 3BKML 3QJUB 5FK9A 5LGKA 4I2OA 1CQ9A 1RMFL 4EDXA 3S7GA 1RUH1 2AJYH 1SLTA 4QNPF 3V52L 2MNGA 5F1IB 4P02B 1QXRA 1I53A 2I9LA 3VI4A 2CLRA 1I1EA 4TNVK 1S0FA 2VBBA 3GJAA 4FQXB 2W2IA 5E94B 4Z2WA 4WU7B 2CO6B 2OMVB 5DC9B 1WLCA 3CXHK 3BOVA 4P9XA 2RS33 4KKRA 2Y2YA 2DH2A 3DYMA 1ACYL 2R8SH 4GQ9H 3EO1A 2BS8A 4HS3B 4I0PB 3QXAB 4KROD 4KY1L 4KX8A 5IATA 5FZ7A 4R52A 4HKJA 1JZFA 1LEIB 3ZDVA 3R7RA 4A7UA 5APAA 1XX9C 1MELA 4TMPA 1CD1B 5GJTH 1HRV1 4NN7C 1UT1A 5KSBE 1NA1A 3I6KB 4YHMH 5DFVC 4J3OH 5EZOL 2PLV2 1M42A 3TVMC 3I2CL 5B1CA 4Y5VA 3HI5L 2X4UA 5CN3A 2FLRT 1I1RA 2NQCA 3R4DB 3ZYRA 1DZQA 1HI6A 3F3HA 4XN5A 2XHNA 2H1PH 1OAKH 1PGL2 4IKKA 3MV9A 3CHQA 3ZKXC 4NEHB 4HUWA 2CLZB 4U3SA 4NQEB 1LO5B 4WRLA 1FF5A 3MV9D 1BWWA 3T0EB 2DLIA 2R042 3SLIA 2XBO1 1NGWA 1IBBA 3OMIB 2TAAA 4TQEL 3WEAA 1FMD3 5K33A 2HJIA 2ICEB 3WNNA 3PDOB 3L16A 4J3UA 4LARH 4XP5L 5KYXB 4XB8A 1CE1L 1T80A 5J1AA 4QT6A 4EWAA 4UANA 3HZKA 2EDEA 5FOJA 5BXFA 1JMUB 4EZ4A 4XC3L 1XF3B 3U10A 1L7RA 2YDEA 2GJZB 4YZFF 5F1RA 3EYFB 4G7RB 1RCYA 4Y1SA 4WVMA 3NOIA 3CFNA 5C0AE 4HJJH 4A37A 2L3BA 3O2DH 5FPXA 5DJCB 2GFBA 1RVF3 2F53A 3SE3C 2NNCA 3DROA 3UZVA 2QQNA 2IXLA 4YDLB 1W8EA 4EBQH 4LUKA 3ZZLA 2YR3A 2XV0A 1FZJA 3P4LA 3QWQB 4OLZH 3KPQB 1D0GA 3BLBA 1UVQB 3UYOD 3QNYB 3MCKB 3VMOA 4OCTA 4TZDA 4BIFA 1UXZA 2G5UA 1V05A 5FECB 2Q10A 3UACA 1P5UA 1LM8V 1F00I 3FTYA 2JCCF 4U1KB 4EMZA 1M56B 3ASIA 4CP1A 2E9JA 2R1XA 3H9AA 1HINL 3R1GL 1ZRDA 1VBA1 1AGDB 2A6KA 3DSFH 1ZS2A 3CLEH 4H2AA 2C7FA 5B7EA 2BXYA 2XYBA 2YEZB 5D7LB 4KJYA 4B0MM 3MJ9H 4I87A 4WFHE 4QMEA 1ZBE1 5FWJA 2W60B 2V72A 5HHOA 4PP1C 3KCPB 3II3A 4Q6KA 1DYPA 5F21B 4P5KB 4JFOA 1IT9H 4KVNL 4JC1A 1QXJA 5HHOD 1BYPA 2XXCB 4PJXA 3V6ZA 4YFEA 4OI4A 3QDHA 2WVVA 2ZXBA 3LIHA 4IEZA 3VGGA 2BC4A 1BBDH 5HI5D 5DSCB 2CJUH 1K8DA 1XCWA 4K7PY 5KS9F 5LGHH 4D0DA 5C0EA 2IXQB 1CIWA 1WCKA 5A3LA 3T71A 3ZK0A 1YQ2A 2F61A 5EO0B 3UTZB 3ZIXA 1E4WL 2HH0H 1A4KB 4HKXB 2P3KA 4NHXA 4JREB 3OSVA 1YYLL 2GI7A 2NW2A 5AKRA 1YJKA 3ZFFC 5IQ7L 1IFHH 5HYIA 1MFEH 4CUBA 4DP0X 3VA2C 3TJHD 2HT2D 3GSOA 3OKOB 2H0BA 2VITB 3RWKX 1IKFH 5G5DB 5AB9A 3MRPB 4P48A 3S57A 3LEXA 4XO8A 3WLUA 5D7JC 2O5ZH 4X9IA 1V54B 2Z31B 1KLFA 4HJUA 1OP5H 2XFXA 3A3YB 3T8MA 2YBKA 3SKVA 1EHAA 3M3QA 3VBOA 4XXPA 4KRNA 1L9PA 2YHGA 4L8BB 2AXWA 2BNOA 2EEFA 2JX9A 4B29A 5E9AA 2A6XA 2WT1A 2J88L 3GTNA 3B2VL 3Q3GA 4J8RA 4NX0A 3RTLA 2PCPA 3WG3A 2D7MA 5C9JB 3P73A 2IDFA 2EE6A 1FE8L 1K4DA 1SHWA 1OARL 3SY0B 1JMZA 3NIGB 1BVNT 4XHJC 1NCUA 4U1NB 2F54B 5HJGA 1NE4A 1FH5H 2ZUUA 4CCMA 2I7OA 2NTFA 4W65A 2WVTA 5J09A 3ES4A 3AY4C 4QYOB 1MWOA 4M43L 4Q0UA 1DVQA 4R4XA 5CBLA 3VCLA 2MH4A 4JFEB 4XRCB 5E56A 2R51A 5FYKE 3FB5B 3VSUA 1JL8A 2DLTA 4JR9H 4I30A 2O5XL 4MZIA 4DQOL 1K5WA 3C7OA 4BFKA 3O0WA 3NSFA 4XNMB 4A7GA 2BRRH 4LSUL 5K9QG 2C3GA 1TME3 1OE3A 4P59H 4MVBC 1NC2B 3ATAA 5ICXB 3NCJL 1ZBA3 3ETBF 3MMEA 1O5UA 1A7OL 3WSOA 1G7YA 3ZXFA 4JG5A 1PMYA 1H8TC 2VW2A 2FSDA 2UYLB 1I7UB 1HX0A 4UDTA 3T6VA 4RSUA 4Z7UF 4PTTA 4R4ZA 5E2VH 4OLUH 2R0WL 3BN9C 3TOPA 4Y2DB 1UWEH 1J1PL 1XGPB 5AYQA 3AXEA 3A4EA 4KUZL 5HJBA 5CG8A 5BVJA 3TL5A 1N0XL 3HZVB 4HJEA 1G6NA 1K8IB 2QSQA 3SGKC 3ZX7A 1J3QA 3RI5F 1JP5A 3THDA 4EIGB 1GP6A 2VN7A 3A0NA 1ED3B 3GJFB 1E2ZA 1HN0A 1HH9B 5IMKA 3ZTJG 5ALCH 1W6PB 2QDRA 3KPSA 1MCPH 3T08A 4B9FA 4OCMC 3U7YL 3CQOA 4COVA 3URFA 5J96B 4I1PA 3SE4C 3FWEA 2WUHA 3KPSD 1W05A 3QIUC 4W4NA 3JZVA 3S7IA 3IFNL 3NZSA 4WCYH 2A4ZA 2IDCA 1WLDA 4OFYA 3I6LE 4PCSA 4C54A 1NEZA 4TVPL 1HRV3 4UNTA 4DPRA 3VKLA 1RUJ2 1AR81 3VZOA 1ORQA 3NPSB 4BQBA 1YDPA 4OFYD 2DBJA 1BWMA 3QNZA 4NQEE 5CIRA 4HONA 2VJ8A 4UU9B 4ZO9A 1VFOA 1MREL 1QLEB 1IBFA 2ITCA 2IQAB 2PN5A 2W9DL 3CZLA 4NZRL 3D2UD 5DQJA 3T0EE 3HAGA 4F7ZA 1ZA6B 1VADB 2KQMA 2Z2SB 5F72S 1KTKE 1QEWA 1ZANL 4UQAA 4KQ7A 3T65A 2KA3A 2XMLA 4X5XB 1GJIA 3QT2A 4B53A 5GS2H 3DO4A 1DF0A 1UYZA 4P9YA 5F3EA 2WKLA 1J8HA 1J0YA 5EDXA 1ITCA 3HE6B 5BNPC 3BIKA 2K9ZA 1U92B 2PMWB 5C3PA 1CXIA 1J8HD 1G9FA 4IBSA 5KVEE 3TXAA 1E6OH 4MMZA 3SISA 4R7DB 3PHOA 4UTAA 4ANXA 1GC1C 1G7JA 3SKUD 3WNKA 2VR8A 4MDIB 5T5FA 4AQ8A 1YWKA 2XPJA 2R4SH 1D4M1 1LKNA 4GXVL 3T4VA 2E9GA 1W0WA 1KV7A 2ADJA 4GUQA 4DQAA 1XSKA 4G6FD 5KJRL 4AQEA 1H30A 1OTTD 3FU5A 1UB6A 2K8QA 3VX0A 3BZ4A 4KITB 3GUTB 1TCRB 4YHKH 1ZXKA 8FABB 2MTAA 1HKLL 4MAYB 3V7AE 2J43A