2W95A

Structure of the discoidin i from dictyostelium discoideum in complex with galnac at 1.75 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 61
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w95A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w95A01
1GOGA 5EJ1B 2BGPA 1JU3A 1W9SA 4XUTA 3HPNA 2EIBA 2W94A 1D7PM 1W99A 1WCQA 2BBAA 1K12A 2WO2A 1UY4A 1I5PA 4LHSA 4ARXA 3AC0A 3CKHA 3WF0A 4MO3M 4MGSA 2WDBA 5C7GA 2J1SA 3PUIA 1UWWA 4P02B 1OD3A 2DDUA 2YB7A 2WN3A 4PT6A 1GOFA 3ACFA 2WAOA 3A21A 2QQJA 3D3AA 3WQBA 3WMQA 1SHWB 4UI9L 2C9KA 2QQMA 2W1SA 1UY1A 4GWJA 5C70A 4ARYA 2Z4FA 4BXSV 2W5FA 2W1WA 2EICA 1MPXA 1US2A 2W9XA 2XHNA 3IIIA 3WSOA 2W92A 4QX0A 3LPGA 2Y6KA 3HNYM 1XC6A 2J1TA 1L7RA 2XOMA 3NNGA 5IHRA 3WF1A 3CIHA 4CVUA 2VJXA 4XVHA 2Y64A 2VM9A 2ORXA 1SG3A 2VO5A 3SEPA 3W5MA 1W9TA 4JHZA 4QX2A 3F2ZA 2CDOA 2VZUA 2RJ2A 2OKXA 2ZEWA 1PX3A 2VCBA 1WKYA 2EIDA 4BJ0A 2C26A 2V5DA 4A45A 4OUEA 1EUUA 2E31A 3HNMA 5JMOA 1O8SA 2WBKA 2QQNA 4MOAA 1RYYA 1UY0A 5CZKA 4KI5M 5HXMA 2QQOA 3I2KA 2VL4A 3WEZA 5A1AA 5EIYB 2VZOA 4D8MA 5JUVA 4DUWA 1PMJX 1TG7A 3T2PA 2Y6GA 3T0AA 1UY3A 4E8DA 4QX1A 3UETA 1DYOA 2HLEA 5I0DA 3HOBA 4JKMA 1JZ5A 3JXSA 4DXTA 2VZVA 3OBAA 2CE6A 2BERA 2WABA 3C8XA 4IUGA 3DECA 4XZUG 2WN2A 2E32A 2ORZA 3CZUA 5B4NA 3I2GA 3VD7A 1F4AA 5DPNA 3K77A 2QBXA 2VR4A 2EIEA 4P00B 2Y6LA 1CZTA 4BK4A 3WNNA 1DLCA 5JXJA 1NAEA 2VTFA 5HPOA 3IB3A 4QB1A 5C71A 3SEEA 4MGQA 2ZEYA 1PX4A 2J1VA 2VZRA 3MUZ1 3WNLA 2VOTA 3K75B 3THDA 2QQLA 5G05L 1JZ3A 4MADA 4A3ZA 4M4PA 1XNTA 2B4KA 4HG6B 3GXUA 2W46A 1R64A 2VZ3A 4CU8A 5LA1A 1JZ6A 3WNPA 3P1IA 2R7EB 3IAQA 4ZY9A 1JZ7A 1OF3A 1NKGA 3LEGA 2VQUA 2RV9A 3WF2A 4OMCA 1JHJA 2LW8A 1LNSA 2ZEXA 5IJRA 1TVGA 3WMPA 2HYXA 1H6XA 4E8CA 4XUPA 3GGLA 2X09A 3FL7A 3NQHA 3BN6A 2XONA 1GUIA 2VZ1A 3FHQA 2VC9A 2PQSA 1UXZA 2RVAA 1JYVA 3VD5A 1GQPA 4A44A 1US3A 2CCVA 3FN9A 4XURA 1O59A 2Y8KA 3I2HA 4AG4A 3VD4A 2YC4A 3WF4A 2JKXA 1K42A 1P8JA 1W0NA 3ACGA 4XUQA 3W5NA 3MO4A 2V72A 5FUIA 1OF4A 3HEIA 3C7GA 5JXGA 2VMCA 3LPFA 4UAPA 2JDAA 1UY2A 4BK5A 1ULOA 3CDZB 2C4XA 5DQ0A 4QDQA 5CYYA 2V4VA 2YC2A 3UNPA 4CU9A 3WNOA 2YG0A 3OGSA 3I2IA 4Z2AA 1UMIA 4JX0A 1NUKA 1UX7A 3EYPA 3ACHA 3T0DA 4OZOA 2WUHA 1F4HA 2WYSA 2YFUA 4QPWA 2WZEA 2L9LA 1UYXA 2KD7A 4GZ9A 3OGVA 4QDRA 3I2FA 3CQOA 2DCKA 1JYNA 3OEBA 4CUAA 1CZSA 1UXXX 2BZDA 4ET7A 3NJVA 3IAPA 4QB2A 2J1AA 3T0BA 1JZ4A 3GDBA 4GWIA 1J83A 2E26A 5LCWL 1SDDB 1K3IA 4CU6A 4W8JA 4QB6A 4P08A 1DP0A 3C7OA 1K45A 5G04L 3PUHA 2WO1A 3HNBM 1EUTA 4PF1A 3EB7A 3THCA 4RN5A 3NRUA 2B9VA 4FI9A 1CZVA 4QDSA 4LQRA 4TXWA 3LQCA 1W9WA 2Y6HA 3DYOA 3FHAA 2QQKA 1IQDC 3BGAA 5JXHA 2J7MA 4P5YA 3I2JA 3P6BA 3T2OA 3DYPA 4KWUA 2VCCA 4JKLA 5IFPA 3MV01 2J1EA 4DEVA 2VMDA 4DXRA 4QAWA 1KEXA 4UOJA 2VMEA 3OGRA 3LE0A 3I3DA 1GMMA 3DYMA 3K4DA 3VD3A 1JYXA 3I97A 4LKSA 3K4AA 2VZTA 4PQQA 2JD9A 1H6YA 2JE8A 4KMQA 4DXSA 2W3JA 2CGZA 4BDVB 2DCJA 4RYDA 5DMYA 3ZM8A 4D0QA 5DN2A 3VDCA 5IYYA 3I3BA 4CU7A 1W8OA 3T09A 1J84A 3U37A 1CX1A 1O8PA 4TTGA 3ECQA 3WF3A 3K4ZA 3T2QA 2J22A 3K46A 1UYZA 4XUOA 1GOHA 4QX3A 1L7QA 3OG2A 3WNKA 4A42A 4A41A 2CDPA 2W1QA 2W91A 4A6OA 3OB8A 2Y6JA 3VD9A 3CMGA 2VCAA 4OYUA 4OMDA 1GNYA 5JR2A 2ZEZA 1NX9A 1UYYA 2W95A 3ETPA 2J1UA 3CZJA 1CIYA 4Q56A 4JKKA 1PMHX 3NJXA 4W4ZA 2VMFA 3IDAA 4DUXA 3HN3A 2ID4A 3A23A 3LEKA 5EJZB 4W50A 1HN1A 1T2XA 4XUNA 2WO3A 5IFTA 1KGYA 4YPJA 5JXIA 2CGYA 1XNAA 3MBWA 2XQXA 2LS6A 3A7QA 1YQ2A 3J7HA 3SKJE 2QQIA 5F7UA 3OEAA 2YFZA 2BGOA 2WZ8A 3VDBA 1OH4A 1W8NA 4DUVA 1UMHA 2W47A 1GU3A 3UESA 2W87A 3WNMA 2W1UA 1JYWA 3C7EA 3SKVA 3HJRA 5B4XA 3A22A 1JZ2A 4CUCA 5LA0A 3VDAA 3LEIA 4L0PA 3C7HA 4AAXA 4ZXEA 3MV11 4M4RA 3T08A 1JU4A 5LA2A 3I3EA 2X05A 4ZZ8A 3ABZA 2X10A 4DEQA 1XPWA 2VQTA 4ZZ5A 1BHGA 4CUBA 5J1XA 3E1F1 2J1RA 2WQ8A 2WAAA 3ACIA 3MUY1 3GM8A 1ULPA 2VZPA 1JI6A 2VZQA 1UZ0A 2ZXQA 1OT5A 3C7FA 4A4AA 1JZ8A 4LPLA 2E33A 2VZSA
chains in the Genus database with same CATH superfamily
2J71A 4YHKH 2LUWA 1XQ4A 3B8SA 2MQGA 1PDKB 3H1ZA 2OXGB 1W06A 3ES4A 2R1DA 3OY8A 1AMYA 1NBZA 4HWNA 3TEZA 3QNXB 3TV3L 2FD6L 2P8LA 4Y89A 2LAAA 3KV5A 3SOTA 2CDGB 2WO2A 3J7NA 1J8SA 2A9ML 5LATA 2D3JA 3QI9C 2HVJB 4KWKA 2X89D 5EYYA 3NK4A 3FMGL 2PW2A 4ZPTA 1NBVL 2GABA 1IGJA 2J4WL 5EUOE 4LO4B 1HHGB 1IHMA 3SN6N 4FA7B 1A6CA 3PUIA 5AKVA 3VFOA 5KC6A 2H6PA 3QH3A 1MCPH 4YGAB 4IU3B 4FYTA 2WAOA 1BVKA 3VBHB 4ADGA 2IXCA 3GGWB 1YY9D 2FDFA 3CUPB 1MFBH 1JZGA 3HG3A 3UAFA 3WMQA 1Q56A 1LOGA 4C55A 3VUAA 3HI1A 3MV9E 2VLKB 1WZAA 3O2WH 2FQFA 1PK6C 3IPVA 3KM5A 3MJ8A 2BVEA 2Z0BA 5CEYA 3VSTA 4DT2A 4A7GA 2IPKB 3HBGA 4F2MB 5I1DB 3U83A 4FFVD 4QRFA 4OZIA 3MJ9A 4JRXA 4BCYA 1WCKA 4XHJC 2OR8A 4XJWA 2JKJA 5F3HB 2VTXA 5FKAA 2W1WA 1AR91 5FWEA 3B7YA 4P2QB 4PV8A 1OHZA 5H94A 4P5RA 5EEXA 1T3FB 2ALWA 4A6YH 5KEZA 1IC5L 4N43A 2D2CC 4NOBA 4QX0A 3O3DA 5L4MA 1BVOA 2O93L 2P8LB 4LE4A 3KGTA 2ADIA 2VULA 3VXTA 3MBWB 1FH5L 2XTJE 2EXWC 1QDOA 3KL0A 3H9HB 4GW4A 4OM1H 5DJ6B 4CVUA 1P4IL 4X8JB 2NY0C 4P3CH 2W68A 2UZYA 3WS6A 5T5FL 1TMQA 1HX6A 4HJGA 3G5ZB 2ETEA 1J0IA 2PELA 1UJ3A 4WI6A 1MCWW 3SEPA 3R05A 1BIIA 2FT6A 3EO6A 1TZGH 3NPSC 1W9TA 2KPWA 1WFUA 1IGTA 3MR9A 3UTOA 4JJ5B 1JCKA 2X2UA 3VNZA 5B38G 1WBYB 4QWWC 4ZS7H 4L9LC 5BZWA 5JQHC 3H7YA 5FGCB 3ZIMA 2YR3A 4R6UA 1LEIB 2HWB3 3D6GA 3D0VA 1XGYL 3F58L 2R69L 3E3QE 4KMTH 4UV4L 3RIKA 1LEMA 2AEYA 1FT9A 4H7VA 3N85H 5KVEE 2B59B 5FPUA 3J7LA 3L3OA 4I4WB 2EXJA 5ICYA 3QQDB 2Z8WC 3UBGA 2UURA 3HKFA 1ZANH 2R59A 4BH7B 3N55A 3KBEA 4WJ5A 3I84A 3R0MA 4AHYA 3DMMC 3REWB 1XGQB 4Y5XC 3VXSD 3CHPA 1UUSA 5EIYB 4D8MA 1ZK5A 4HVQA 1HDMA 4F7PB 1AR92 1MPAL 2OL3L 3J8F2 3BZFA 5IG7A 4TQHA 1KOAA 2WOYA 2A5ZA 1NCQA 4ICXA 4FKEA 1M9SA 1AGBA 5DGQA 3LZOA 3L3KA 5DURD 1BZQK 1D5IH 1VGEL 2G3NA 3V0BA 1IGYA 1NMAH 4YZFE 1U95A 5FF6A 3NZ8B 1I1RA 2BOCA 2ADGA 3KEHA 4OLUL 5I8CA 3HZVA 3TYJA 5AYUH 1G9NH 5HI3D 2CYFA 4XJ8A 2Z4TA 5DGRA 4LE3A 1U2CA 3B2PA 1XF2A 1E3FA 5I8TA 1WGOA 1QA9B 3HB3B 3IE4A 3O6KL 5D6DC 4PDWC 5LA9A 1JUHA 1LJMA 3UGGA 1A2YA 5E8OB 1RZFL 3EGXA 2HRLA 5CEZE 5HYEA 4RRPG 5JXJA 3N1QC 4LLQA 3TBCA 2CZNA 4XC1H 3IMTA 4NWTL 3SYAA 5FQ0B 5IQMA 1AYM2 1ZT7B 1REFA 1V6MA 1DCEA 5CP3H 2VDNB 3L3JA 3WNLA 1E9QB 8FABA 3APDA 1F42A 1A0QL 2A6YA 3ZHDA 4JY5L 3TCXA 3FH7A 3TBBA 2FIKA 1ZZ6A 2UXGA 3MNZA 4M5SA 4OGYH 3HLAB 1ULFA 1URXA 1GWLA 3M3EA 4K1ZA 2HPOA 3MLVH 4OCXH 5AOZA 4HKBB 4GSUA 2QDVA 1CFSB 3OVUB 4QTHB 2IO5A 5H8DA 4GRLC 4G2AA 4AVJA 4YL4A 1SLLA 4TSBH 2KZBA 3SYCA 2QADD 2VGLM 3LZFL 4P9HC 4UU9A 2X1PA 4KAQH 4NO0D 4DVRL 3GXIA 4AQ8C 3CNKA 3FZ3A 2JJTA 3N9GH 2XN9D 1GY2A 4TULH 1G9DA 1NLRA 1OF3A 1NCGA 3UX9B 4LQ1A 1Q8VA 1HH6B 1I1FA 2ADJB 3TVMD 3PHOB 2K46A 1J87A 3H8NA 4LA2A 2DF3A 4UM8A 4F7KA 1UQXA 2WUBL 3FQXB 2EA7A 1W0VA 2V3DA 1HRV3 1U41A 3V5HA 1XRUA 4UQDA 4DZ8A 4PREA 4GQQA 4WEBH 2DURA 3OF6D 3RX8A 4LEXH 3PRZA 5J89A 3BN6A 4QXBA 1ZAGA 3FN0H 1E90A 4XP4L 4AIOA 3ARUA 4RFT0 4JN1H 2C3XA 2IWFA 3MRBA 3SDAD 4LGPB 2YZ1A 3TWCH 1LOEA 2PQSA 1WLHA 2VCMA 3EH2A 3QNZA 3CJIA 3H3KA 3ARFC 4A44A 5A7WA 2BV4A 5EZJB 1ZZ9A 2B5HA 4AG4A 3RJQB 1FNZA 2D31A 4NP9A 3RX7A 5KHJA 3IPEA 4UNUA 5KSAA 1L0PA 4Y4KB 3RVVD 1WMFA 4PP1D 1GTNA 4Q4W1 5DJAB 3HAEG 1CLCA 3C9NB 1S7UA 5AVVB 5JPMB 2F7PA 1SBFA 3M17B 1PZSA 3MREA 3UEZA 4ATFA 2VDQH 4LEOA 2PYFB 4R4BA 5EO0B 1Z6JT 4R4FL 2ZMNA 2C3VA 1MQTB 5EC2A 2BNQA 3ARGA 5HJ3A 1MNNA 2YKLL 5FYKE 3QD6A 1HOCA 3MGOA 2PA7A 1L9SA 1CL7L 1KBWA 2WXMA 1PLGH 5L2KE 1G9BA 4OCRL 2O61B 1V9U3 4GPVA 1D3CA 5DTFA 2D5FA 3ARRA 1J0HA 3WY4A 5IMMB 5FGBC 1HU8A 3ZXFA 1A4CA 4OLXL 1T0NA 2DU1A 1D5MA 4YW7A 5D2LF 2DWYA 4ZW5A 3HCVA 3K8KA 3TN0D 2CD0A 3FSVA 3PWJA 4IEWA 1JFQL 2WZR1 3DRQB 3ZKMC 1QJU2 1G86A 1Q90A 2GFBA 1TMF1 5CBAB 2WWKT 4GZ9A 2HBUA 2P7TA 4ZMTA 1AZVA 4QDRA 4NN7C 3QS2A 4FGMA 3DMMB 4P2YA 3DROB 1OQOA 1T20B 4E68A 2BSBA 2ZABA 3QA3A 4EUPB 3GC3A 2DW5A 3IAPA 4I13B 3TC9A 2R043 3BDYH 1S9WA 2OMTB 5AB9A 2WYIA 1BZ9B 4GAGH 4YWAA 2V7NB 4RIRB 2E8ZA 1CD1A 4XPAL 1YY9C 5CLXA 3CUPA 4MLIA 1I7RA 1CXKA 5EWIL 4D8PB 3QC5X 4U1JB 2GVYA 2HWB1 4N43B 1LVEA 2C7FA 2WBJB 3FTXA 4PJ8A 4ONGL 4L1LA 3CFBA 3UGXA 1UKRA 4D9LL 3ZSMA 5C33A 2H0JA 3UP1A 4RSYA 4JPWL 1WZ1H 3O4OB 1U58B 2GSIB 3GHPA 3QUMB 4IYKA 4NO2A 4CVXB 3MF6A 4LQRA 3PNAA 3TRSB 3DOHA 5SWSD 1UTDA 1MWAH 4NQED 4JDEB 1P7KB 3MOQA 1ZANL 4NNXB 4XP6L 3U7WL 2Q0ZX 2PWFA 2ZSVB 3N50A 4PI0A 5TE4H 2NX5D 2WQSA 5CINL 3ABGA 1ZVSB 1UU4A 3P6BA 3UMNA 4GG8B 1HYSD 2O30A 1TTCA 4HISA 4NHXA 5KHIA 1WS8A 4MDRA 1UM6H 3JBG7 3QO1A 4OZGA 1FFTB 1NAMB 2BINA 3A4FA 2Q1FA 4JDNA 2WWOA 2QR0B 1BVP1 1AY1H 4Y24A 3H55A 1OAQL 4M6AA 4N3UA 5GALA 1A7BA 2J1ZA 3B2XA 4JDTH 4ZXBC 2EYRA 2KH2B 2OI9B 1IQDB 2XWEA 3VXSE 4IK6A 3FK3A 4P05A 4WW2C 1QBMH 1W0WA 3RWEB 5DUPH 1R5WA 3O11A 5HGDA 3T3MF 2JD9A 2JE8A 4QHLB 4I3RH 1V00A 3KLHD 1YHFA 4PJCB 4RMBA 2DCJA 3ZPOA 3TM6A 1KCLA 3CDYA 4JCWA 2OMZB 4KK9D 4LEJA 4YPGA 5AVRB 4LPYA 3OCPA 2EDHA 1OP9A 2OBGA 2QADC 4NAJA 1YNTA 1WD4A 3SKJL 3DOSA 5JIPA 3MI8A 3U37A 1MS8A 2CBPA 2Y6SD 4TTGA 2V5YA 5I1EL 4M3CA 4F7PA 3H42H 2H9GB 3T2QA 2X41A 1XVSA 1VBD1 4LBKA 3QK0A 3N91A 3BKCL 5ABAA 1FNEB 3CFEB 2N7AA 4HCFA 5E5LA 3RNQA 3MV7D 4X5QA 1ZGLM 1W90A 2P2KA 4FOMA 3EJSA 1KGIA 1MFBL 4U1NA 3UC2A 4AZUA 4NBYB 1EDQA 1KCUH 2Y6SC 4JPKL 1A2YB 5E8OA 3GSUB 4AK2A 4DINB 1DEEA 1U6AL 2PCPA 4L3EB 1UM5H 4HJEA 1JSYA 3H6JA 3QXTA 4RGNE 1RUG3 2VU9A 2HJLB 2WZPD 4KK5D 4YC2C 5GS0L 4V11A 4G8FA 3H42L 5HGBB 2FBRA 3SE9H 4HUMB 4YVWC 1ZDSA 3FTUA 1B0GA 1GNYA 2CHWA 3G5YA 2I5YH 1T2JA 5HDLA 1DU3D 4JO5A 2P8PA 4NM8L 4EF3A 4I1PA 1OALA 2BNQE 1LO2L 4IOFD 1KIPB 4FKHA 3VKOA 1O3QA 4EWEA 1EAPB 3ZHNA 5ISZE 4OD2B 3MGTA 3ZFEB 3GLZA 4U6VL 4I77L 3CVIH 2RJLA 1YCIA 4N2DA 3NUKA 3N35A 3BD3A 1DLHB 3G04B 4AYGA 3JWDC 3JTTB 3S5ZA 2RQEA 2WVVA 5IHHA 1MCCA 1NC4B 3CLFL 1L9TA 3GXTA 5EB9A 3DOSB 3ZFGA 2SBAA 3MO1A 2E8YA 5AB2A 4ENED 4AEMA 3POEA 3BGMA 4UYBA 4NKDB 4F2ME 1NUDA 2J1KA 4GW1A 5DDHB 5F5CA 5IT6A 3O1MA 5JXIA 4U1SB 1PVC1 4GRLD 2VNGA 4JRXD 4KRPC 1BX2B 1N0LA 1QLFA 2IDSA 4NZUH 2DM3A 1QRKA 4TNWF 3GI8L 4N8VG 2LS6A 2IDQA 2JTDA 5DZLA 4PGBB 1MFCL 5CGYD 4IKIA 1RPUA 1W05A 4Z0BH 5IQLA 1OANA 2BVQA 2IALA 2F19L 4AC4A 5LGKA 3BP5A 1IZKA 4EWAA 1SLWA 5JWPA 5TFSL 4HPOH 1OH4A 1N9PA 4TVPE 3QUZB 3S98A 4DEPB 5BNQA 1UIKA 2A71A 4IMKC 3VGAC 1M2OA 1X9UA 2BDNL 1JS9A 3ELNA 3MRLA 2KZWA 2SLIA 4C8DA 2A73B 4MNQB 4RFNC 5LO7A 3BP6B 4B7KA 2BP8A 3TT1L 3TNPB 4XBPB 3ULAB 1J9TA 5CJXA 2R0HA 2XBO1 3AMNA 2WA4A 4X9GA 4IBYA 4QXUL 1S7QA 3V10A 1AKJA 1NDTA 4AAXA 4NIGA 4CEWC 3GHNA 2ZCKH 2OAAA 5KVEL 4WWKC 1AR1C 3MRBB 1D2OA 3HNTL 4UIMB 7PCYA 1U3HB 3DHUA 3GS7A 3TT3H 1ND0A 3QULA 5CIRA 1HCZA 4HQQH 3I4IA 2RR3A 1U8IB 4N2CA 1ZBE3 2BLFA 2A75A 1RZIA 2VQTA 5BS0A 2P42B 2Y69B 4PPTA 1JXKA 4FXGB 4UT7H 1PM4A 3Q1SL 1FV3A 3MRQB 5I1JH 2FLRT 1G7YA 2NQDA 1I3GL 1UD4A 2W07B 4KKLD 1N3QA 5KHHA 3MIBA 2H6UA 3C87A 3D9AL 4I18B 3JV6A 3WFEL 3RZZA 1N68A 5TK2A 3FE5A 1A22B 1T0NB 3WTYA 1BFOB 2BVOA 4XMZA 3DX8A 4OF6A 4Y4FA 4KY1H 3POSA 3CLPA 3ZYHA 2EILB 2HWF1 4YSOA 5AEAA 1JU3A 1W9SA 2V5SA 1U91B 3LD8B 4MHHG 2DWSA 4EAEA 5FEBA 5FZFA 4Y9EA 2RMU3 4CP0A 1ETJA 1DDTA 5LLIC 1LYQA 2BBAA 2JE9A 2FBOJ 3E8VA 4PCSA 4ZO6A 5GZND 5JXAL 4PLOA 1EO8L 3RUGF 2VC2H 3EJTA 3KH4A 5A3UA 4XFIA 3NV3A 4BH9A 2VMJA 4G6KL 5AZEH 3BIEA 2BSDA 4LQFH 1KJVA 2OTUB 2GIYA 1TNFA 1UKGA 2EXYD 3IKWA 3DKQA 2IWGB 2V9UA 5IP4A 4PRAA 5AVPA 1I4FA 4MV2A 2V9TA 1JRHI 3DUUB 4N25A 2VAUA 1OTTD 4N68A 2UYAA 3NAPB 5DJ8B 4AQOA 1CDUA 2PHLA 4S1SH 3L5HA 1ZE3H 1SHWB 2JWPA 4JANA 5H9QA 1UCBH 3JVFC 3T0XA 1EP0A 5KSBB 2EVJA 3LIZA 3JT2A 5EN2B 1G9MH 3JYBA 2HFGL 3F6JA 3P69A 4HHAA 4P5TD 5KBMA 2QHLA 3P3SA 4PTUB 4OFYA 4QX8A 4Z77A 1PDKA 4XGZB 2Y0OA 1D7BA 4BXSV 4ES8A 4QQHA 4N5EC 1XF3A 4QX7A 3V6ZA 3VTTA 2WANA 2NOYA 2XHNA 4XETA 2F7IA 3QZWA 2ZXEB 3OD3A 1UACL 4JJOA 4GG8A 4IBLT 4QXWA 5E8EA 4R5VA 1LOFC 1WH0A 4NO0A 4WFGD 1WLTA 3H54A 4Z3HA 1F1DA 3LKSB 4GKNB 1YYMH 4NZRH 4Y4HA 4ANKA 1O91A 5A3NA 2EDWA 3HS0B 3BVNB 4KV5F 3CVCA 4NAOA 4YVSC 3P2DA 3KVBA 2HCZX 3LN4A 5DD5H 1A8DA 1IAIM 1E5RA 4GQ9L 1PGL1 4TUJB 2I60L 3MDJA 1GS6X 4XFCA 3SKJH 2A9MH 3R4DB 4HIIA 5B1JC 1T7XA 4LDLB 4IGBA 2MOVA 4QX5A 1MH5A 3BLPX 3P0YL 4OUUB 4XMUA 5BJTA 3QDJE 1OTSC 2KMWA 3C09C 2QQKL 3QO1B 4WNSA 4QHLA 2AR6A 1F8TH 3BPOC 5EBWB 4I3RL 1I5ZA 4JUSA 5HSFA 2EUXA 4GUPA 2A6XA 1J58A 3BIKB 1UWFA 3L4CA 1E6JH 1B9ZA 3T77A 2BWAA 4DN4L 1J88A 2HA1A 4LEBA 5ENWA 3RGVA 3OHXB 3RWCA 3TEUA 3NMEA 3VH8B 2H41A 3KPPA 1DVFC 1HEZA 3PHQB 3CJIC 4CGTA 3ZL2A 2BP6A 1WWCA 2QQOA 4MAYC 1DBNA 4XGZA 2ZGOA 4OLVL 3NSJA 4WDIA 3P40A 5I1AA 2OR7A 4AG4H 1ZGLB 3W1ZA 1JPEA 3U1SH 1UY3A 2ID5A 4GJZA 3VGGA 3F01A 5FZEA 4UZUA 4WFED 3WIHH 1J5OL 4GI8A 4LU5H 1RFDL 4IJ3C 4PJIA 3TH4T 4GBXD 2EVHA 2F1EA 2JWYA 4UF7C 1IBBA 2FR4B 5LY1A 3RY5A 3HOBA 4MAYD 5TGBB 1JGVL 3JXSA 3KPRD 3SOBL 1C8M1 4BJLA 4NFBA 2X3BA 1BQHG 3LPPA 4B9ZA 1POV0 3O41A 4XZUG 2XT1B 4FTDA 1OGPA 2ZGQA 3OKOA 3QNFA 3FUHA 3QXVA 2JG9B 2VC2B 1FGVH 4ZMPA 1JN6A 3UC0H 1O6SA 4PU2A 4U1LB 3SGEH 2IDUA 4LBQA 1B09A 2I7SA 2WIIA 3K2MC 5EBWA 4E9WA 3WHE0 2EIEA 1BPVA 4BFKA 5A3ID 4FI8A 5DK0B 3UJTH 4E9SA 2RCSL 1Q0YH 1Z7S2 1VB4A 5EBLA 3D69B 1E5UI 2WUCL 2EH8H 1H6FA 1CDHA 4FTEA 5EDXA 1XB3A 3MUUA 4XIOA 3QEGL 2CM5A 3GJEB 1GJUA 3U6XA 5E4EC 1PK6B 3IWUA 3PGDA 2I26N 3LNEA 4N8VB 2C5DC 2IFFH 3BZFB 5F0MB 3CBJB 3DX9A 3O6FD 4I0PA 1AOZA 3O0VA 4MADA 5ANQA 4WSKA 3PAVA 2QTWB 5T3XE 2OK0L 3SDCC 2H45A 4DK3A 1SLUA 1LU1A 2MHAB 4LNRB 4Z8FH 4XN9A 1CF8L 1MR5A 5F70A 5FGBA 1CXEA 5EOCJ 3DETC 4CU8A 1ODAA 1JZ6A 1F5WA 4EZJA 5I66A 3HI5H 4F91B 1PFCA 2MOGA 3Q8EA 5B1JA 1ZHNA 2ZGKA 2AK4B 3NNLA 5EIIB 3CX2A 2OCFD 1HHIB 4WUKH 4OMCA 4AL8L 5SWSA 3W9DB 4EIGB 3HR9A 2WSUA 4OGXH 5I1HL 2MFNA 4JZNA 1NKOA 4JPIB 1MACA 2QQUA 1LGVA 2ZHKA 4M1DL 1CYGA 4YXLH 1BAFL 1HSBB 1N19A 1ZHLB 1PZ5A 4UFHA 3N0PB 3VI4F 1HYSC 1KXVC 2W9DH 3BAIA 1FL3A 4UIMA 4YJZL 4JGYB 3BDYL 2UYBA 2DLGA 3BVDB 4NDMB 1HXYB 1B88A 3FHQA 4QXVA 2RACA 5HBBA 3O0XA 4DXZA 1JXDA 3BKZA 2P17A 2WT0A 1HXS2 3IDIA 5FY9A 4XBPA 4HUUB 3VD5A 2H6CA 3F7YB 4H8UA 5JW4R 3QO0B 5HP5A 5ESQA 4Z3GA 1BSIA 1UC6A 4MH0E 5F37A 1VESA 1U8KA 4NRMA 1R75A 2V7HB 2SODB 4X2UA 5FMCA 3WR0A 3U0PB 2XWJA 4PWEA 5GGQH 3ACGA 3ZW3A 5LQBL 3W5NA 3KZ4C 3GJFK 3BUDA 1AACA 4QF1B 5I8SA 5IB1B 4JZOB 1BVNP 3SPJA 4LULA 1BREA 2V72A 5A6XA 2Z69A 1DZRA 2WKOF 3OPZL 4M3HA 5T55A 3BXNB 2W07A 4AGQA 1BLIA 1Q38A 4A6YA 2XXFA 3HI6L 3MN8A 4QTFA 2JDAA 4Y26A 3IFNH 1F6AB 3H4FA 5DVKA 5AG8A 4NPRA 1LO0L 1QSFD 3B56A 5F8RC 3VWKB 5CWSA 4DZ8B 2WB1A 4U6HB 2AEPL 3MJ9H 4RQPB 3B3IB 1IEBA 4U6VH 4XNBA 3QUXB 4UDUB 4BZ1L 1M6OB 4DGIL 4G9SB 2TAAA 3QORC 3QRFM 4J5VA 2CWSA 3X29B 2YPKB 1SLCA 1XV8A 3JB8A 1W72B 4LSUH 3P5BA 4KHTL 1HXYA 3FCBA 1QFWI 4TUKH 5JMRA 4WIQA 3QEQE 43CAB 5IVXB 2WZPA 1MFMA 2L8AA 1EGJH 4QRTB 3O9WD 4LLDB 5D1ZC 3LV3A 3SJVA 1JVKA 5I73C 4CXXA 3HJEA 2BRRH 1ZLWH 4FNLH 5HCBA 1DSFL 1DQIA 3UKVA 3L7EB 1ASOA 4Z7NB 4Q4X2 1TKWB 2WVUA 4JPKH 2CU5A 2J1AA 1GMIA 2X89A 3MKKA 4LBOA 3RWFA 4JRYA 1AYN3 2CRIA 4N1EA 4ZFZA 4BFIB 1VB2A 4UFJA 3CLEL 4YN3A 4CU6A 3O3EB 3WQ7A 3PWVB 3C5ZC 3U0ZA 3EZJB 5DZOA 1SF5A 1XD0A 3B9KC 1SXNA 4KPHH 4QB6A 5FYKD 4QUOA 1FN4A 2JG8B 1S7VB 1IEAB 3MVSA 1ZLWK 4GI6A 2N7GA 3E6DA 3A4EA 2KLTA 3QHZL 4OZGB 4V2BA 5AW6B 4P2OD 4HFUL 1GP6A 2Y2WA 4PTUA 5IB2A 2K3HA 3LX9A 3MLYH 4APXA 4DPAX 1CZVA 3AQYA 1Z3RA 3L17A 2IBZY 4ODWB 4EN3D 1NCUA 1PNGA 4HX1A 4ICWA 2AV1B 1T0MB 1R3LB 4OUOA 1AR71 4L0PB 3T0EA 1NE6A 2RS51 2EEFA 1EVTC 3RWEA 2L7JA 3QQ4B 2VVDA 3WL9B 3VU2A 4EQVA 4HC1H 5IBUB 3D4YA 3SD5A 2AQTA 3QYMA 2CY6A 3DDFA 2DMHA 1FYTA 3CFTA 1NGXB 1UWEL 1CLYH 1U8MA 4H1LG 4MQSB 4WO4C 3RX9A 1RMFL 3TN0B 2F5AL 2ARCA 5AVSB 3MLWL 4AEEA 4EZMA 2J1YA 1A0QH 1QOKA 1H1MA 3K0YA 4P2CG 2ADFH 1WTGT 1A3RH 4H8WH 1YNKH 3HG0A 4OJCA 4UT9L 2FEEI 4ESKA 2RS32 4LKDA 4K40A 4K55A 3KCXA 3Q6FA 3KCCA 2XIBA 3TZVB 1RL3A 1OIOA 2AAAA 1A4KA 4XNYL 1MHPL 4MA7L 4WDIB 4UQBA 1A3KA 2IBGA 2ZGRA 3H8XA 2VW4A 5TE4L 4RYDA 1X33A 5D7LB 3P1VA 2AACA 2H3KA 3IM0A 3LAGA 4D0QA 3ZDZE 5LY2A 4Y5SA 2IUWA 2FR4A 1EWHA 1FO0H 2YPLB 4TUOA 4IRSA 1Z9NA 4J3OD 1I8IA 3LKPB 3OKKB 1J84A 1U5IA 1YMMA 3SQBA 4JAMB 3ZGIA 4WEMB 1N8ZB 2YGMA 1WTLA 3RHWF 1ZA4A 4NYLA 2YPVH 2ESVB 2O72A 1W9FA 4Y2OA 1N70A 2NY5C 1KELL 2X88A 2FX7H 5KYWB 4FFWD 1QWHA 4M7LH 1OSPL 4UT6H 2X5IA 5IK7A 1KTRL 4WWPA 3VKMA 4XPAH 3HTLX 4HK3N 2EUZA 4XCEA 3FO1B 5E08L 2E4TA 3KJ6L 3TN0A 5AAPA 3OZLA 4XP1H 3RQ3A 3W0WD 1HE7A 1I3RA 1RUKL 3RILA 3VD9A 3CMGA 1PIV2 1OE1A 2QVFB 1M57B 1L0XA 5D1QC 2B1AL 4PJBF 4XAKE 1B35C 1KB5L 5LNEA 1NA1B 2DVDA 1DLHA 1WIPA 1SQMA 1YIFA 4WHYG 3KPQA 5BRQA 4AW4A 2JLLA 3KBHE 3PUUA 5K9QI 4BIOA 4ZUTB 2R0LH 4H0LC 3FRUA 4Y1TA 4K23L 4FFHA 5K1JA 1BZWA 4MA3A 2DTMH 2X4TB 1UT9A 2OMXB 3C2SA 4GW1B 3ILDA 4RZCB 1BIHA 4MD5A 4KX7A 1YEIL 3BZ4B 3MYJB 4R3SA 4TNGA 4AC2A 5IQ9B 3MJGX 1WZMA 2IFFL 1TMF2 4IRJD 3Q2CA 3KW8A 4Q56A 4NXKA 4JKKA 3NJXA 5A6IA 5KYYB 3V79C 1VPOH 5BRZD 5KYUB 3MIFA 4YQXH 1MDAA 4TPRL 2ID4A 1E4KA 1AE6H 3O4LE 4X7TB 5TE6L 1ZA6B 2Q76B 4NQXB 1T2XA 2B4CC 4XMTA 4FLQA 1DJHA 1SGKA 5AFAA 2EEBA 2IPTL 4OIAA 4UTBH 2BWIA 2IC1A 4OFKA 4CKVX 1MFEH 1VP6A 1VBA1 1FGVL 3GF8A 4NQCA 4AQ1B 1O7SA 5JW4M 5F9WB 5A1FA 1KTLB 1OOAA 1WWBX 2Y36L 3OX8A 4X5RA 2YV8A 2F18A 5PAZA 1QXJA 1R1A3 3DIFB 4FXKB 3SOBH 1YEFL 4JGYA 1WA1X 4LFHG 1RUG2 4LSTH 2ZZQA 4YW2A 4RGGA 1IGIL 5K9QG 1XH2A 2W1UA 4RS5A 3SLIA 5HGAB 4Z6AT 1ADQH 1LDPH 1G5GA 3HJRA 2WB7A 3W11C 3V8CA 4EWDA 1X5XA 1F11B 1HHJB 5IR1B 5TQ2H 1R9FA 1OGTA 1O9ZA 1OOPA 1TQCB 4WO0A 4XNMA 1HHKA 2FDBP 3DX0A 4CGUB 2BRRL 1P53A 3D05A 3RWJA 4KQ0A 3CZKA 4WI0B 3JV6B 1TNNA 2Y38A 4UZGA 4OD1L 2GPZA 5KYUA 2FECI 5DMKA 5LA2A 3SDDC 3FFCE 2R2EB 2K7QA 1NM9A 4AT6B 4W6XA 1LP9E 3APFA 4ZZ8A 5TD4A 4NLAA 1FPN2 5C0FB 1V6KA 4BIFA 1U93A 2DJMA 4JHVA 1CG9B 2VXTH 4F8LA 5DTFB 1EMTH 3OMZA 5T1DL 3TLRA 5ID0A 2J1RA 3I2CL 2QJVA 3N44B 3QNZB 3CJIB 1T66D 2J57A 4FP3A 5EZLB 1FWXA 5L36A 3SGDI 1T6WA 2QQVA 1S4CA 4O5LH 1QLRB 2BVPB 1DO6A 2DIBA 2EAAA 1JYNA 1PY0A 1ID2A 3K81A 3IMRA 3ZKQD 4IERA 4OZXA 1K3ZA 3LN9A 2BVUA 3HI5L 3ULVC 3C5XA 2WXGA 3FULA 3ZY7A 4Q9RL 3K3QA 3VBUC 4JFEE 3RL1B 4AXWB 2ZKWA 3RNSA 2GW5A 4B29A 1AGEB 5SV4A 2E53A 1WFOA 1U21A 3GIVB 1SHWA 4PRHD 1PLAA 4DB5A 1RJZA 3VHPA 4QDGA 2DUOA 1Y1DA 4XBMA 4Y19A 1KXVA 2BCMA 1TJXA 3NSCA 3W59A 1F1AA 4Q2FA 4LBQD 5CHNB 1G0DA 3WHTA 3DPRB 3P2TA 1FNYA 3UPCA 3VFSB 4TVPL 4J1XA 1COV3 2CNZA 3PREA 4WV1B 5D96B 5D4HA 4I1NB 1GSMA 4GKZB 3MRKA 1SPDA 3GBNL 3QXDB 4PJEA 4TVUA 5CEXB 2ADYA 4X9IA 3D3AA 1KJ2L 5JIQA 3DRQA 3NIGF 4NQDB 4HN0A 4COZA 1ND3C 4N0YH 1BDYA 3F64A 2H1XA 4JPVH 4EJ1C 1QFWL 3CFJA 3FB5A 4HETA 4X6DA 4GW5A 4WEUD 2AW2A 5KVMC 1RK7A 4FHJA 3NK3A 1UM4H 5D70H 5D7SH 3UBXA 4K7JA 5GLUA 5KUMA 5KG9A 3B9KD 1IKNA 1H2LA 5ICXA 2NP0A 1TTAA 1NMCC 5JUEH 4I7ZC 4TMPA 1J9CT 2AERT 3SDCA 2X29A 5L8KB 4IEZA 2A4ZA 4FD0A 2RS31 1RURH 1QJX3 2CK0H 4J3VA 5DAPA 3TNQA 1ICTA 5I6NA 1EHKB 2BNRE 1DN0B 1RU9L 4APQA 3H9SA 2Y22A 3RNKA 2BOIA 4PP1C 3WF1A 4WLCA 1BZOA 1LO4H 4GSDH 3V9CA 2TSBA 4C90A 1MFCH 2FZ3B 5F3HA 1A6ZB 5EU6B 1SG3A 1BXAA 1MJ8L 2B3IA 2Y07L 3BYWA 1NGXA 3KLHC 1WV7T 4N6RB 3VXQB 1MNUH 2XPJA 5J3HD 2OKXA 1OOPC 4FYSA 3IPVB 1PX3A 1K6QH 2D2OA 2R4SL 3AB0C 3L4XA 4LPTA 1LHOA 5JNYA 1WLDA 2H8PB 4IKNA 3L3GA 4GALA 4GRWB 5C6WH 2YGOA 3B7MA 5J57B 3PIGA 5L9DH 4O58H 2IV8A 1YI7A 4M00A 2YLHA 4WI8A 1BMWA 4JV4A 2WFF3 3T6XA 2CGPA 4FXGC 1T3FA 3N42F 5SX5H 2XWCA 1ML0A 2WTPA 4E9TA 2CHHA 4Y4FD 3GSWA 3AZUA 3BUYB 4HJSA 1HRI1 2GC7C 5A1AA 1UB6B 1LK3L 3Q44A 1U8NA 4LTAA 4YM1A 3BZEB 2A6JB 4XRCA 3V0IA 3VFTA 2XL7A 2Y6GA 3DKHA 1PD6A 2HT3C 3IXAB 1LEIA 4M61A 3UERA 4AI7A 2YPLD 4TWTA 4TUOB 5GRZA 1INEH 2BFGA 5GKAC 4A6SA 4NIKB 5FA3B 3C5SB 1KCVL 3IFLL 4NN5B 2DQTL 2LABA 1YYML 5I0DA 3QQ3A 5ITBH 4HVBA 2BW4A 4LVOC 1EERB 4WJ5B 4YHOH 2RM21 4IGBB 3SBPA 3VGAB 2FNWA 4IUGA 1EJOH 1KCUL 3RB5A 3M70A 5CSBA 3RGVC 3ZXEA 3ILRA 4WKXA 1NIAA 1CR9H 1NGPL 4HIXH 4XO3A 1BF5A 1QHQA 5D2LA 5IHZA 2WS93 1H3XA 3MRGA 1N3NA 5CJBA 1BG1A 3VXOA 3ZL4L 4GUQA 2ZAHA 3BRFA 2CNAA 4B4RA 4U6TA 5DWUH 4NBZB 4AGRA 4WK4B 3WN5B 1NC2D 1AR1B 1WUNT 5TE7L 2BOJA 4B7EA 3A47A 2GEEA 1OSEA 1JNLL 3SDDD 4HXAL 2UUDK 1HQRA 3QPQD 5HVWA 5I71C 4EDXA 5C71A 5DDHA 3PJNA 3U36A 4I77H 1PS3A 4F1ZA 2WO3B 4KXZH 1UJTA 4F3FB 3IDCB 3RL2A 2MCAA 3IMMA 4MD4A 4FQCL 4B1MA 4DP5X 1LM8V 4LBAA 4HKJB 3GBEA 5ISZA 3NSYA 1L5GA 5GHWH 1WFIA 2EADA 1XBRA 4QKDA 5FYHA 1JRHH 2JCWA 5I1GL 1UYPA 1C5CL 1ETZB 1W6WA 3IFOA 3AYAA 3NJLA 4ODBD 5LKNA 3HC0B 5ID1B 4NKIH 2ICES 1QO3A 5I8EB 5AL0A 1XF2B 3JV4B 1B4JH 1GAFH 2RBLA 3UAEA 4LAJH 2FRGP 1KYUA 1VA9A 3J2PA 3P3YA 2UWCA 1RIVL 3MNZB 4EN3A 4QRQB 3RZMA 2BRTA 3MRGB 4FLHA 3UACA 2ITCB 3TYGL 5ES4B 4YLBA 2VNRA 1IGMH 1CFVL 4DPBX 1KCRH 5D7JD 4HWZA 5E9AA 1U8KB 4AL8C 1QQP3 2HYMA 3OHMB 2SEBB 4CILA 2OYPA 4LHNA 2K9UA 2VQ4A 2VC9A 1D4M3 5INCA 1JNHB 2WXLA 2CIKB 3FQWB 2WT1A 2C4FU 5TH2A 4BFFA 5CILH 3RFRA 3QDME 1G7PB 5DZEA 4XURA 3S37L 4YVWB 5DHYA 3NAAL 2A73A 4UBDD 1PM7A 4XI5D 2VOXA 3IXTB 3TNNA 1GZWB 4K8FA 4ZFGL 2FH6A 1NGQH 3R8QA 4MAYA 4KXDA 3B02A 5TDNA 3B00A 1OT4A 3EJYC 2Y7OA 3PHOA 3O45B 2COVD 2VH9A 1N67A 2NY0B 5I2IA 5KBPA 5IMOA 3LPFA 4KY1L 2WWKO 3B2UD 5F72S 2X4RA 4QXGL 4Q4V2 2AC0A 1WC7A 2J88L 2YLKA 3CDZB 4PJGB 1ULOA 1W2TA 5J9PB 1DQ1A 2GNTA 4P49A 5ESVB 4G80B 3W38A 1PGW2 3GXUB 5AALA 4YRDA 5JMCA 2F9BT 3LZPA 1LAJA 1FORL 2ZQKA 1KTKE 1ZIBA 4FP8L 4HIJB 1P2CA 4R97C 3TBSA 4Z2AA 5HI0A 1EXGA 2XZCL 4WHTB 4LLVB 3S3BB 4CSZA 1P4UA 5LDUA 1U0AA 2LM3A 3RSJA 1IM9A 1J8HB 4CCNA 5EF0A 4WM8B 3ALQA 2K2SA 3AX4A 3WD5A 2ILLA 2ZUWA 4MXWL 3S0MA 5BUGA 2CWMA 1TDQA 2OX5B 3HNSL 1ET5A 5E6IB 3WUCA 4OKVB 3TPUB 4Z3FA 2VLME 4ABUA 4IOIB 3UPAA 2R15A 4Y1XA 1Z0HA 5BY5A 3OLGA 1TQUA 3PNWB 4Y9FA 1RUJ3 1LO2H 3UBXB 5HPMA 5T1LA 1SDYA 1FO0L 4O51A 1IARB 2D7TH 2ZUQB 4IIQA 5FP3A 4CZSA 3WLBA 2AK1H 4ALAL 4YDLB 3OAYK 3T0EB 2FAUA 4H1LH 2NW2B 4LARL 2HEYF 3F00A 3I54A 2A6KB 3UGHA 3NZHH 3WGVB 3OZKA 4P08A 4QRPE 4I88A 4XF0A 3VXPB 1K45A 2EE2A 1W9YA 2R56H 1CXIA 4PJ8D 3QA3B 1SUHA 3FN3A 4PTTB 4WJKB 1JDDA 4HKXB 4IV3B 2VITB 1T4KA 1EFXA 1Q9WA 2WQUA 1Q72H 5FCUH 4IHOA 3FDWA 3LIHA 1MCPL 3E9UA 4ELKA 1JK9B 2NDGA 5FB8A 5ITBL 2VR8A 2ZONA 4OV6F 3UYPB 4AZ8A 5CBAA 3K6SA 4HK8A 4XZPA 2VLRE 2AEQH 3FUFA 4G6MH 3WE1A 2WUBH 3FRPB 4NCDA 2B77A 3VU1A 3ABKB 2HKXA 5FW6A 2Z93B 2PTTB 5CLWA 4MXQD 1Z5LA 3L6FB 3TA3D 4GAZA 3WYRA 5EQUA 5IFPA 1JJUA 2G75B 1OGSA 4EI6A 2OS2A 5DAWA 3WG3A 2LE9A 1YEWA 1TFHA 2BNRB 4QAWA 1HJGA 5BNPB 1ERNA 1M7IB 4R4FH 1CJDA 5C6CA 2JJ6A 5ALCL 4N0UE 4X98B 1A7OL 4IL7A 4B41A 4ZU7A 2R1BA 2VNVA 1QFUL 5DCCA 2QVKA 2EDRA 1I82A 2NR6A 4UQAA 3NZUA 4LUKA 1B3IA 2C1PB 1X5ZA 4J3BA 2JFCA 3FLTA 3WFHB 4HLZH 4JJ5A 2P5PA 2WS91 2N0KA 3HJ0A 1AI1H 2XU9A 5GGUB 3KXFA 4BFEA 3S35H 1HK6A 2O1AA 1G7MA 3FFCD 3O8XB 3IDNA 2X6VA 2QR0A 1UWXK 4U1KB 3KV6A 5DS8B 4AYMC 1GWMA 4MJIB 4POZC 4HU2A 3FB7B 2UX6A 1TETL 3BIKA 5TDPA 2R16A 4HAGA 1BBT3 3B5GA 3O5SA 3ILPB 1NZIA 3JWNH 5F3FA 3CLWA 5KC5A 1O0VA 1N18A 4I3GA 4MGXA 4ZTEA 4ZMZA 3HFMH 5IVJA 1CLOL 4G5ZL 4WTWA 2ROXA 2ATKB 3E5XA 1GOHA 5IVYA 4RAUA 2JELL 4BLJA 5LHDA 4LPCA 4PJYA 5AFEA 1SMVA 4JE0A 2P4AB 3F62A 5GGTH 1SN0A 3OG2A 3IETA 5D1QD 4Z3TA 3PP3K 4G1MA 1P9MC 5FPBA 1RINA 1E8XA 2L0DA 4JC1A 2XA8H 2YMOA 4OFQA 5LGHL 5F3BA 5C9AA 1G9HA 3OKEB 4J3OG 2QTVA 1X4XA 2DQUL 4NAQA 4ZW7A 5A2JH 4GEJA 4IHBA 1A7QH 5I6OA 3L1EA 3CJXA 4ONFH 3WUWG 5J3UA 1FIGH 1F31A 2GI7A 2WXJA 1LGCA 2Y60A 1A6VH 2LU3A 5IVEA 1YQ6A 1WJ3A 1FSKB 4W9ZA 3FB6A 3NCCB 1HHHA 4M8QA 1KXHA 3B4NA 3PP3H 4HG4J 1JTTA 5FYJH 3UTSE 1L7LA 4W4ZA 1ONQB 4Q8BA 4PJAE 2J2ZA 4LIQH 5IIEB 2VDQB 1E5BA 1XCXA 4PB0L 3EJYD 2XZAH 4LCCB 3RZLA 2YD1A 1E27A 5BNNC 1E9OB 4MD4B 5TDOA 1FX5A 2AEWA 4OI1A 4M93C 3DO3A 5AW9B 4CVWA 5C2BL 4AOCA 4UT9H 2BHYA 5C3QA 1PO13 2X0WA 4Y4RA 3K72B 4FCAA 2R23B 1YAZA 5E2VH 3T2TA 4AEIL 2E9QA 4YSCA 4AE0A 2VGDA 4EJRA 2GY7B 1P6FA 2HEWF 4P9XA 1KNOB 1BPLB 1WUZA 1UWXH 1TTGA 4LPWA 3SDXE 3UZEA 4G3YH 5AAWA 2X6MA 1J5IA 2AJZB 1HN0A 4FQXC 2QBWA 2MPAH 1DVFA 1KLGB 4PWGA 4GB32 2IFGA 2CHNA 4PJ7B 4NR1A 2R061 2V2WA 3LQAC 3I2DA 3H2WA 4BLIA 2YD2A 2FZ1A 1RUF1 3MYJA 5HJBA 2Q87A 3B2MA 1ZV9A 2X1OA 5TQ0H 2B3RA 4UM8B 6FABL 1XH3A 4FG2A 3NABL 3BC9A 4P2OC 2D3LA 5HHMB 4P23D 3WP4A 1S7TA 2DMCA 4NSKA 5F7DA 2X42A 4H3WA 1J9QA 2ZX1A 4AL9A 1CFVH 5JIHA 4M4RA 2Q8EA 1KGUA 4A7YA 1NCRA 2UZIH 3K3OA 1DDHA 1XSJA 5I74B 1J5OH 1YPZE 5EORL 3NNFA 3OJDB 2O5NA 5ABJA 3KWXA 4G8EB 3U0TB 3ZDXF 4DZBB 5BRZB 3DO7B 3QH6A 1FSKC 3FT4A 2EXTA 5CD5D 1KWGA 2QGEA 2ARBA 3MUJA 5SWQB 1YN6A 1B4JL 1GAFL 2DZEA 3G6DH 3E1F1 3W2DH 1AQDA 4F2EA 2DVGA 2ITDB 5C7XL 4BSVB 2IAMA 3LHAA 1UYWH 1NCRC 3X3GH 3IDIB 3FNKA 4B3NA 4UOZA 3D4ZA 1GCFA 2VDPB 2J4WH 4PEEA 3Q6GL 1OK8A 2CO7A 5A2BA 3I6KB 5I73B 1WA4A 1U3HC 1FFPA 2EXYC 1S7UB 4LSSL 3KBFA 1SN2A 4N9GB 4P2RD 4YWGL 1KBVA 2BO0A 4PGCB 3RTQC 4IMLA 1SBEA 3VD2A 4FE9A 2V7HA 4UDTB 3KMDA 2PTUA 3ZSLA 2XG5A 4AUYA 4GP4B 4RGOH 2NNCA 1XJAA 4FBFA 2RR12 2CJUL 5E2UL 3V9EA 3LGRA 4BQ6A 4BZ1H 4DGIH 4GLRI 5SWZE 2WWSA 3MLRH 4OCSH 1W99A 5FZLA 4TSBL 1NG0A 2AJXL 1W0OA 1HCFX 1K12A 3ESUF 2NY4B 2QPUA 5E2JA 3UBXG 2X3AA 3IN0A 1KCSH 1NCCH 1YCSA 4HV8A 4NUJA 2I5YL 1LRHA 1SEFA 1QSZA 4XWGL 3S6CA 3MPBA 4EXKA 5GLZA 1EV2E 1O5DT 1SOSA 5CIPA 3C2UA 3VM5A 3IGLA 4IGPA 1EEZB 4KTGA 2XVKA 4FXGA 4JQIA 4LL4A 4O2FB 1LO3H 5F7LB 4PGDB 1RFDH 4EVNA 2GP5A 1GY1A 4V2CB 4OCWH 4WVZA 5FZ6A 2BZCA 5BRZA 4AIEA 3DO7A 1YG9A 3R4UA 4HJIA 2B08A 3ERXA 4ADJA 4YHNA 2XQBH 4ZD3L 1KTDB 2BCKA 4HK0A 1GMEA 4HJ1A 2DTML 3RZGA 3VAEA 4AWJC 4MCNA 4AFDA 4X7EC 4DFIA 3W81A 1Z7JA 1OPMA 2OMUB 5JZ7D 1S3RA 1GGBH 1T0MA 2IBBA 4DMIA 4QHKJ 5H9PA 3C5JA 3BHBA 4W9IC 4A39A 3TCLA 4GWJA 3DJZA 2R0FA 3ZXGA 3DBXA 4DY5A 2ZF9A 3PV6A 5EZOL 2IWGA 2W60B 2HTKC 3H7LA 4NQCD 3M45A 3TH3T 3D85B 3OKDB 5CUSL 2X4QA 3KCPB 2VDKL 4HUWB 3O14A 1XYNA 3ZYPA 1IKFH 1CLZL 2FX8H 4OCSL 5T1KD 1TSHA 1KPVB 5HDBF 4K5OA 4PJ5D 1S0BA 5J1TC 4XPBH 2DBIA 4XNUL 4YHYB 1BMV2 4YDZA 5DQJB 2J1TA 4B9KC 4PFEA 5EF2A 1MVEA 2HTKD 4FN0A 4YSPA 3QUMA 7CGTA 3VRLF 3HI6H 1B4TA 1UEMA 3JD72 1ZDQA 3Q8FA 1RZ8A 3CFCH 4GJTB 4GMSH 2VM9A 1UOVA 5IEKA 4HGWA 1L3JA 3BB6A 3ESPA 3OBZA 4RETB 3UPRA 4JHZA 4O2FA 2AZ5A 2VKXA 1DQVA 5DHDA 3LA2A 3M2MA 2VZUA 1RZQA 3QDAA 4OAWB 3KH3A 3FBKA 4AVKA 1VBD3 3G6DL 4U3HA 2H32H 4UQ3A 3WEXB 4YHYC 1XR9A 2YGPA 3L5XH 4U3SB 1VAHA 3HE7D 4M61B 4XOCA 3LN4B 1OCOB 4ZMLA 1O3TA 3X12B 3I49A 3AZYA 1YPZB 1OD9A 4OD3H 5E7FA 3WI9A 4WI7A 5CINH 1I85C 3P4OB 1AS6A 1MW1A 4BHPA 2DI8A 5FPLA 1FNHA 2FJSA 3KSCA 2IOOA 4FFIA 2C9SA 1ZT4A 2HP4A 2XIIA 3WDJA 4RAVB 2P5WD 2W60A 3O11B 2EEDA 3BPOB 1QKQA 3LSOB 4EE2A 2APXA 4Y9BA 5D2LB 5IHZB 1RERA 1S5IL 5JR1L 2DQIL 1IU1A 1JZHA 2NR6C 1QBLL 4IM8A 3G7DA 4GNKB 4ZS2A 2VXSH 1UD3A 2HJFA 1AYOA 4NHUA 1TEYA 4UT6L 1AHKA 5C5TA 4Z7WA 3ECBB 2IANA 3UC0L 2JQMA 1BQLL 1Z78A 4FSJA 2UZXB 5LGHH 2W59A 5EU6A 1JHKH 3NIDF 4LIQE 2NUTA 3QDGD 3ZDYF 4DF9A 2YC0A 4HH9B 4Q4W2 1LCLA 2COQA 4JDOA 1RUF2 4X6FB 2BFUL 4PAZA 4FAGA 5E7BA 1NCAL 4QHUB 1CFNA 3OZ9L 1E2VA 3MLPA 2J20A 3VW3H 4HZFA 1JGVH 4I0PC 5KJRL 3DIVA 5IGXH 1PTZA 1OLMA 4GUOA 1F4AA 1WBYA 5H37H 1LLAA 1TEIA 5DYOA 5KVFE 1NBCA 2GSMB 1AH1A 1KS4A 1OKQA 4TNFA 4GXFA 4NO2B 3FB8A 5F97E 3CSTA 5I6MA 1DLCA 1WAPA 3W0WA 4DN3L 1OGAD 1UL9A 4ZMAT 4LIQL 2IV9A 3HUJA 5E4AA 4ZTPH 3GUTA 4HUXB 1ZVSA 1E9OA 2VLMD 3QQNA 5IQOA 1GZPB 3S5QA 5T5OA 2B5IB 3DHPA 5FDWA 4K94C 2J1VA 5FK7A 3K75B 1TO5A 1O6SB 4U1LA 3E5UA 1N6UA 2V17L 2FMDA 1C12A 3NAPC 4ATWA 3WVJA 4N43C 1GP4A 1EAPA 2H1LM 3LCPA 2YHGA 3T1WA 1EEQA 2EQDA 3DJSA 1P7BA 3M46A 5KSVA 3SDXB 3N1PC 5DD1L 1L0YA 1GS8A 3K91A 5F6IC 2ENJA 2IADB 4JG5A 4G7RB 1T1ZB 4M9PA 1OP3K 3GNML 3JWOL 3LEXA 4NZJA 1XFPA 3U6RA 4OGZA 4OCMC 3BGMB 4AGLA 2X9XA 4O9HL 1V9U2 4K3JL 3H9SD 3K2UL 1I8KA 4KVNL 3VM7A 2KQMA 4K5NA 3P3UA 3LEGA 5INCB 5A3IC 5FHAL 3FBYA 1ZTXL 5J6HB 4PLMA 5K1VA 4POUB 2XCMC 1OGTB 4EZKA 2LW8A 5GZOA 5LB1A 3PWPE 4Q6IB 4YNYB 3V7AG 2Y34A 4KWJA 5IJRA 5FPVA 2ROYA 2Q8BL 4NP4L 3E6FB 3D4CA 4OUMA 1IL1B 1WPCA 4P3DA 3IVKB 3K5RA 3K71A 1H9DA 3D18B 3IXTA 2F58L 4G7YL 1MLBB 3KPNB 4NJ9L 4NRYB 4NRZA 3TNNB 1GZWA 3JBG3 5TQ2L 3KDPB 3MICA 5E94A 5MEQB 1QJY3 1GP5A 2JICA 5DO2C 2XJPA 4N2IA 2FT7A 3B9KB 5EORH 2JXMB 4I18C 2WQVA 4DVBB 3MUHL 4ZUUA 3GB7A 2DTYA 1VBA3 4CP9B 4N24A 1E9QA 3KLKA 1GFF2 4P2QD 1NCQC 1US3A 4W6WB 1F4YH 4HALA 1S9YB 1TENA 2J7LA 3CFIC 1R5IA 1UGNA 1GZQB 3V4UH 3NSXA 2JKBA 4L92A 2HX9A 4YO0B 3INAA 1CFSA 4HJUA 5FREA 1OB1A 1P8JA 1FO0B 1GGCH 2P5WB 4KKLC 5IK3B 3FFCA 1ZXKA 5KVDH 3VDDA 5HY9A 2CPUA 3GSNH 4HT1L 4A7VA 1PZ9A 5I0RA 5FWQA 3S2AA 2KUTA 2ICEA 4CADA 4I30A 4BBWA 2Z3FA 3T1FB 4X8NA 3FOLB 1KD7A 4QD2E 1F6LL 1SDWA 2OT7A 1L9QA 4EN3B 5HCAA 1YHPA 4WTZA 2P26A 3GIVA 3TN0C 1MZFA 2XOTA 3HEIA 5LXGL 2D3VA 2DLTA 5EUOF 1SEBA 4JCLA 3EG9A 2GJPA 1LJ7A 2GTWB 4S2FA 2ZOLB 2YXSA 3NJMA 5DXWA 5I15H 1U5XA 4HD9A 3ZQXA 4LLYA 5F6IB 4H13C 5BUVA 3FCTB 1ZS8B 3VFSA 1IL1A 4F27A 4RFOH 1AO7D 4JLRB 2VBBA 3QAQA 4UF0B 4HXCA 4KGJA 2XH6A 1K8DA 1PAMA 4NC1E 5BW7A 2B42B 3ACHA 4RGAA 3WS6C 4JO3L 2VOVA 4PIRF 2WUHA 2IH3B 1AC0A 4XH2B 4Q52A 3HG1D 3REVA 1LHNA 2E9GA 1A6UH 1I1EA 1TVBB 2ERFA 4HPYH 4K2UH 3RHWK 4C0HA 1M53A 2BSEA 2M8XA 2CV6A 4PBPA 4ABQA 2CNYA 2BNNA 3BP4A 1CUOA 1IGIH 2WD0A 2BSSA 4WW1B 3KQRA 2QPFA 3D52A 1S9YA 1RCYA 5JOEA 1M56B 1XGRA 2MQ0A 4U1GB 2VDLH 2PYEA 3GDBA 4H0GA 4XXDA 2CPCA 5DJCB 3U82B 4E36A 1GYAA 1XH0A 2NPLX 2YZ8A 4MZRA 3K80A 3T3PB 3VKFC 1MI5A 5IHUH 3JWOH 3KLDA 4FFYL 2K6WA 4YXLL 3AZWA 2F8OA 3KGZA 4NJ4A 3ZMOA 5DRWA 2D7NA 4FQ2H 4KX8A 1YY8A 3B3IA 1BQUA 4PJHE 4G6KH 5AZEL 1JZIA 1ZT1B 1BWWA 2HLFC 2VSDA 1J0YA 3L1OH 1EUTA 3TBWA 3VRJA 3QZBA 2YAHA 4C59B 5FUOH 4CCOA 2GTWA 4ECNA 1M6UA 1OP4A 3AVEA 4HKZB 3U07A 1OW0A 4MS8D 1NAKH 4DKFH 3GHEH 4UAOB 2G1MA 1W9XA 3RIAK 3D1MC 4CSWA 4HUKB 4YXHH 3B5HA 3D4KA 4XN1A 5F71A 1BK0A 2J7MA 4DEPC 3KT4A 2DLFL 5L88L 2JB5H 3SC7X 3RVUD 4FQXB 2VCCA 4N6QA 3IGUA 4HUNB 1MRFH 4PRIA 3H85A 4MCZB 1MFUA 4ATTA 3WXWL 1LE5A 2Z7ZA 4NNPH 1SRDA 3HG2A 4IOIA 1PZ8A 4G8GD 3ZMNA 4AHZA 2M1KA 1Y6NR 5DABA 2W5PA 2XPGB 4KRNA 4U7KA 4HJGB 1BEV1 3M1BA 4QT5B 2VMEA 1W80A 1O7FA 3WX5A 3H9SB 4DKFL 4HIHA 3OGRA 4CEWB 4BZ4A 2OPCA 1VFOA 4YBLC 3DEMA 4DCQB 3GMRB 1BGXL 1GMMA 2ARXA 3UL2A 1JYXA 3I97A 2Q3ZA 1F6FB 1KLFB 2HT3D 5JA8B 1H6YA 1IGOA 4X5XA 3HR6A 1JE6A 3DXAE 1A7NH 3KS0J 1T20A 1GS7A 3D4GA 5J3HC 3OSKA 3X17A 4DO4A 4IV3A 5DN2A 1CLZH 3DJRA 5C07D 2D0GA 5BXFA 1K5WA 2FB4H 1NFAA 3WJLC 2IXQB 2FDHA 2E27H 3RWGA 1K5NA 1S9VA 1F2XK 3VBHC 3POFA 4U7SA 3SZKC 3VFPA 2FQEA 2B2XL 2IAMD 5FKPA 2WAHA 2Q5BA 4QOKB 2OSYA 1I7RB 4XVSH 2I24N 2VLRD 2VW6A 3NV4A 4U4IA 1A8JH 3P77A 2W81C 5FA4B 3ZO9A 4AGGA 4JGNA 2DWDB 3D09A 4P2RE 3HG4A 4KTEL 3BWSA 2AK4E 4MA1B 4WWKD 5I8KL 4R7DA 1ACYL 4I0KA 4A42A 3GNEA 3PDGA 4PRIB 4ZD3H 4QGNA 2DIEA 2J8UE 1I75A 4NCC2 1D6EA 1LK2B 1J1XH 2Q7YB 4IW3A 4JAMA 3IF1A 2PTVA 3IDXH 4JDEA 2J8OA 1JERA 4JRWA 1KS5A 1CFNB 5DO2D 4C4BA 2N0MA 1GZPA 1Z1WA 1FA4A 2BK8A 3DPBA 1V0AA 1S5HB 1DVQA 1PLGL 3ZDVA 2FWOB 4O5LL 1NAMA 4WVMA 5FM4A 3KPTA 2DIJA 4F8QA 3PVNA 3CNAA 1FFRA 4LDEB 3BIAX 2DN7A 4Q0SA 3UIZA 4KHXH 3SPHA 2HJIA 4Y2OB 3NPSB 1PYWA 2IPTH 3P0YH 1RKRA 2OMYA 2X4OB 1DHKA 4RGMC 5JIMA 1N6QH 5EJZB 1S9VB 1HN1A 3GJFA 5J6SA 4W50A 5FPAA 5L9DL 3VA6A 2WQZC 2W08A 1BGXH 3I59A 3SCHA 4ZDHA 1UOKA 2ZCZA 2NM1A 3UTPE 1TCRA 1BW8A 2CGYA 1TME3 1RUD3 5DJZB 1OAQH 3TA4D 2O8QA 5HGBA 3BMWA 2R1XB 4I0AA 2Q8AL 1YQ2A 1A78A 3QEHA 4YAQB 1L5GB 3RG0A 2OLDA 3OKEA 3J7MA 1J0JA 4FPFA 5BVJA 2PCPB 5F3IA 4XABA 5T1KA 2RMU2 4YHLH 4FT8A 4KZEH 1JNHA 1U8HB 5CN2A 5CEZL 4OI0A 3VFMB 4HZ1A 1DQKA 3WKQA 5FAAA 2VAJA 2XFXB 2XN2A 1UASA 3OJ2C 4ODXB 5E2WH 5AB0A 1JYWA 3FT4B 1LGBA 3C7EA 2LTNA 3VW3L 5D5MB 3CC1A 3SB3A 4GKSA 4A7QA 4FZ8H 4C58B 4EBQL 4X5LA 4NNYA 3WCSA 1ZA6A 2Q76A 4NQXA 2C7UA 2HWZH 2ORBL 1F3JA 5EEZA 4UBHA 1G94A 2W88A 5CMAA 1VLXA 5TF0A 1MCEA 2TBVA 3IDEA 4ZXEA 3RG1C 4ONUA 3AAZA 3C75A 4K7PY 1NZRA 3SDAB 3RTQB 3JV0A 1YZZA 5IJKC 1YEEH 2FWUA 3FTWA 3TZVC 1T89A 4NHYA 5T3NA 2FSEB 4EZ4A 3GJFH 1IM3D 5J1XA 4MB5A 1O75A 1FFNA 2YBRB 3L1GA 1R081 3CK0L 5KYXA 3B3QE 3WLWC 3WNXA 5J37A 3T04D 1YJDC 5EEVA 3MBXH 3IWZA 4WI2A 1NC2B 3AQZA 1UZ6E 2W1NA 3VXRE 4PGBA 1MHPH 4Y9GA 2R30A 4Z7UF 3NCYP 4QXGH 2D7FA 1Z2KA 4UF0A 3BP6A 4YGVB 2AHIA 1K72A 2R27A 1KQRA 4ZJ9A 5C0FA 4JFDD 3GSXB 1KCWA 1E6OH 1LESA 1TQ5A 2VL5B 4PGDA 5I16A 3TO2A 2DYPA 1U4FA 1PGRB 4UAHA 3JQXA 5JCTA 4UMSA 5DDJ1 3NSFA 4GRWF 5DHMC 2EIBA 1RIRA 3AMHA 4FKKA 1BG9A 3OZ9H 4MJJA 4N0RA 1NFIA 2GAUA 2LLNA 25C8L 5C3PA 3EBHA 3BTZA 2CIIA 3DXUA 5IVFA 4NSKB 5F7DB 1YFYA 4N9HA 4HCRH 2O5ZL 5FUOL 4EZHA 1JWUA 2IJ0C 5HPMB 3AC0A 1SHXA 4IJTA 4IBQA 1MHHA 4K8RC 5DLLA 4B50A 1AXSB 3HS9A 4ZNCD 1ULEA 3ASIA 2AXWA 2YSTA 2Y6FA 3ARED 3UP6A 2WVTA 2AZUA 2BM3A 2WDBA 4MGSA 2IGLA 4QPIA 1G1OA 4HFWB 4F9PC 4G8EA 3U0TA 5FFLA 2I9LB 1RXFA 3QQ9D 2ZX4A 4UFMA 3DX2A 1QFWH 2BSCA 3JUZA 4FMVA 3KYNB 4MJ5A 3L3HA 1FZMA 1J7VR 2EINB 2G9HB 4RA0C 2BSRB 4CVXA 1BBJB 3IS1X 1WFTA 4RVBA 3IMUA 2EIKB 4H25A 4ZUSB 5BOPA 5GS2H 1EEYA 3SIKA 2AS5M 1T1YA 1OUSA 1YECL 3CWGA 1OURA 1VIWB 4YBQC 4M93B 2IAMC 3T2LA 4XB8A 3ARFB 2NLRA 1BM3L 5A6YA 1HDKA 4RZKA 1LMIA 3D3VD 3NJGA 1QNIA 3A3YB 1JFQH 3NVQA 3QIUB 3HWJA 2OSWA 3D39B 4Y5VC 4LPXA 1A9BB 2K78A 1AXYA 1HX0A 4FNLL 4HGKC 5FO9A 4ZS7L 1Y18B 3HPLB 1NBYA 3ZZQA 1OQ1A 3L13A 3TESA 2WNXA 1OKOA 5ERLA 4ZYKB 4HV8B 1ORSA 4NUJB 3MREB 3UTZA 1AF9A 1X8EA 5E88A 5JI7A 1GKBA 4JFDB 3PWPB 5LK7B 3MODL 2QGCA 2FL5B 15C8L 1IS3A 2PHWA 1HSAA 4Q6IC 2QDNA 3FHIB 5ICXB 4RGNC 4XBQA 1QRND 2VECA 4B95C 1F8TL 1PJ9A 1RXLA 5D1QE 2ZGPA 1A7OH 3AQXA 2CDOA 5SWZB 3WIIH 4YK4B 4X5XB 4BQ2A 2MTAA 1J59A 4GW5B 4NHCL 5F88A 2EIDA 1EVUA 3AITA 5C3SA 3DXAA 1W72H 1LD9A 4AEDA 5C07E 2ZUUA 3QR2A 3IS0X 4PP2A 4ZX5A 4IU2A 4OGAD 3GDCA 3O6MH 4GRLB 1AVBA 3SGKC 5DJXB 3O6FB 4XZUB 4NXSA 4JY4B 2BIIA 5F6KA 5HYFA 3DVFA 5CFCC 1SBSH 3AG4B 4FG0A 1PX8A 2Z1PA 4GBXC 2ESVE 1OQDA 3S5LA 1NCIA 3NIGE 4RAUB 3RRQA 3OWRA 1IFHH 1S6NA 3LA7A 3F65A 5EMYA 2CO6A 4OSUH 4FQJH 1UM6L 4LLUA 5JNYB 4OQTA 4BA0A 3LZLA 5CEYB 2FLMA 3QCVL 4U6XA 5AD0B 5L88H 5D7LE 1S0DA 4U36A 1I7UB 4BZ2A 2RHPA 3IJSA 3L2MA 4C8XA 1FNLA 1TKWA 1P4LA 1SDDA 4N0UA 5IF0B 3TJPA 3MA9H 1D6EB 1SCSA 4XC9A 4Q0UA 3D85D 5DS8A 4X6CE 4YHPB 3UO8B 2JDNA 3O2VL 3QUHA 3FMGH 3PL0A 5IEKB 2WXNA 2DB8A 3FAWA 5DO8A 4LKCB 1I3HA 1MAJA 2CKBH 4MAUH 1DGRN 3T77B 2I74A 5IM7A 3QJRB 4IKJA 4P2AA 2DICA 1SEQL 1JI2A 4GT0A 2WXQA 4IW4C 5CKMA 1MCHA 4BISA 1N1YA 2CJUH 5E2UH 3LRSB 5IV2A 2QBXA 1MDTA 2DI9A 4N1CA 3S4SB 4OY9A 4QXTB 5C09B 1YLLA 1ZZ7A 2DQIH 3AW5A 3I9AA 5K9OA 2A7BA 2H2SC 3GSQB 4HCRL 4OQ9A 2P5ED 4XVJH 3O4LB 2NXZB 4ACPA 4PCYA 1PKQB 2EIJB 3HZKA 5HHOA 4JJHA 3T8XA 3D8MA 2DDQH 1RK0B 4BKSC 1BD2B 3SDDA 2V0AA 4Z7NE 2E7LA 3MRCA 4YM0A 2WQXA 1U2HA 3RAJL 4OCLC 5C3LD 4PDWA 5KANI 4IE5A 3NN8A 1N3NB 5CKQA 2EEXA 3CVHA 4JDZA 4KU1A 1A6UL 1IB5A 1AR61 2OI9C 2VOWA 3V7MA 4Y4HD 2CMRL 4HLJA 1FFQA 2R1XA 2JIGA 1ZV2A 1NC4D 1BJ1H 1THAA 2DQFB 4QRPB 3ZIYA 2PXYD 1HHHB 1NQJA 1H0DB 1KN4H 2HT2D 4PJEF 5CCHE 4CNIA 5LBBA 3V0BB 3KPMB 1A4JB 3QAZC 3GXFA 4K9EC 4OQ8A 1EO5A 1I1YB 4RD7A 5GXBB 4SLIA 1HZHH 4A1RA 2AH2A 1U8HA 4HJ0D 2WTRB 4YZ3A 5J7MA 4CXYA 1CJYA 1MFDH 3T2NL 4CDUB 1WIUA 3LEYL 1O3SA 2VR3A 2JXMA 1EAJA 1ZSDA 2EABA 3SO3B 4I01A 3WF2A 4CP9A 3ST7A 3QEHB 4UIKL 5E00B 4JM2C 5F3EA 4XOAA 5FY5A 2VUJA 5I82A 3INUH 1A1NA 2BPA2 4Y5XA 1U95B 4NNYB 3DV4B 4UINL 3U25A 5CD3B 1H6XA 4LBLA 4NROA 3AUWB 1SYSB 4UYPA 1N0XL 1BMV1 2FNBA 4X8CA 1N64H 1UOLA 3DUSB 3GSQA 2B0SH 1FNEA 3CFEA 4DZBA 1XBDA 3SDAA 3K51A 4L11A 3VACA 4Z82A 1BF8A 1YVLA 2VZ1A 3P0VH 3H9SE 5LASA 1HEHC 3ZL1A 1CPMA 4KNCA 3T1FA 5AOJA 5I6PA 3UO1L 4FP8H 1Q94B 3PGDB 2W0PA 4OD1H 3PWPD 4MMYA 1DQTA 1OAUH 2OW7A 1NGYB 3BQUC 1ZHNB 1O5PA 1WMDA 1AYN2 1UXWB 1TE1B 2MJWA 4HWZB 2MHAA 3LRGA 2ARJQ 4LEXL 5HHXL 5FZCA 1T66C 5KXEA 4MJIE 4N2BA 5FO8B 3KYKH 3S8WA 2QNKA 1TQWA 3FTVA 2FCUA 4GFXA 1BQHA 4OIIH 3SODB 2FGWL 2CIKA 5BS0E 2IH3A 4LSDA 4UT7L 1COV1 4D0BB 4GMSL 4JRAA 2YXVA 5BPPA 1G1KA 3N1MC 4QGMA 1R5VB 5HHQA 3W39B 3UJTL 2GTZB 4LLAA 1EPFA 4W68A 4ONFL 4KQ7A 3JWNE 2WOBA 1D2QA 1A47A 1XD1A 4D6QA 4Y4FB 5BPXA 3WCYA 3SJVE 1FBIH 4XWOC 4YS4A 1RIHL 1UMIA 4P9GA 2GBAA 3VXUE 5KJ7E 2YD4A 2O26U 3R18A 5DFWH 1KEMH 1BOYA 5TH2B 1DQML 1FFPB 2HB0A 4J1WA 5EIIA 2Z79A 3PUCA 1F1GA 4NENB 3PQYE 1IAKB 4X50A 4ERSL 1KGCE 2R1WA 3MLJA 1WFMA 2L9LA 2HTLC 3ZFFB 3BQVA 1JGUH 3OMAB 3HAEB 4JY5H 1BECA 4YVNA 1VRH1 3L3IA 4MMXB 3ARPA 4WRLA 3RLSA 4AK3A 1WAEA 2RS33 2HWB2 2EE9A 4L0YA 2X2IA 4JO2H 4YO0A 4V33A 1J9RA 1JF1B 3ZX7A 4F93B 4X6QB 2WHVA 3UJQA 4NPJA 4KG8A 3Q13A 5JOPD 2D7QA 4WI9A 1EQWA 4YBHA 3GZAA 3WTTA 1KIUB 1PO22 3VBRA 1ADQL 1LDPL 2BC4A 3C8KA 4XCNA 2C5DA 4Q4Y2 1K3IA 3UGUA 2CSGA 1BYOA 4AI3A 3EJJX 4MDIA 2ZX9A 3B93A 4BHUI 3QXDA 1BBJA 4PJEB 4BEIA 4OZGF 7FABH 1C8M3 4Y4KD 5FO9B 3POBA 1PG7W 5DMIH 4XW3A 3MUGB 2ZSWB 3NQKA 5DJAA 1AR93 1TME1 5JZGA 3HNBM 2D7TL 3LXBA 3MRIA 4PF1A 2NXYC 5EPAA 2V37A 5IWLA 3B1TA 4JFPA 4ZAKC 3VG9C 3SXWA 5EFIA 4AQAA 3GSNB 3NSDA 1SBBA 4WJG3 1R34A 5FMOS 2WQ4A 5HJ3B 2Y6HA 5B1BB 3CF6E 3RKDD 3DURA 3VFVB 1Q1PA 2I27N 2M2DA 3Q05A 3P3NA 1ZA3A 4XZ4A 3QPXL 4P5MA 3LKOB 1EDYA 4PJDE 3ZTNH 2YUXA 3ULVD 1P9MA 1XCQA 4YMPA 3M1HA 3PU3A 4JKLA 4ZAKD 4K3EL 1MJJA 2NQ3A 5JXAH 4MB4A 4PYHA 2CG9X 3S3CB 4META 2BMKB 1NFDB 1QR4A 2EALA 1AUYA 4QO1B 1P7HL 5A2IH 3CBRA 3A6OA 3ARWA 5DJXA 4TN9A 5K93A 5DQJA 5C7XH 1I8MA 2UVFA 5JSPA 5HHXH 1CIWA 4OZHE 3ISRA 1D5XA 4JFTA 2AQNA 2AMGA 5HYSB 3GO1H 2J6EA 3K4DA 4JRYB 3S36X 2CBOA 4E9YA 2X0VA 3K4AA 4FABH 5T5PA 2ZA9A 1AGEA 4IBSA 5GISH 1KY6A 3N3EA 3PPEA 4CN6A 4HSLA 5EHDA 2UZIL 1OVZA 1FG9C 3EDFA 3AP4A 2PNDA 4BSJA 5D1ZA 4BCZA 4Z7WB 5BNPA 3MUGA 3RWCB 1FOD1 5ANMB 4C56B 3GRWH 3CK0H 1J9SA 3FQRB 2DI7A 2V8LA 4IEFA 4N0CC 4UNTA 1T5WB 4OHVA 3U14A 5LBFA 4M5TA 5DJ0A 2Y7QA 4RH4A 1CX1A 1DANU 1BVNT 2PTTA 3K2OA 2ZKHH 2BFVH 3MLZH 4HQQL 3NAPA 3PWVA 3OM3B 4CDXC 1H8SA 4WVRA 3N9PA 4JANB 1UB6A 4G42A 3RA7L 2R8SH 2VJ0A 4LRNL 5EWIH 5AQ0A 5CM1A 4Z3IA 3M1OA 1BXUA 3S4SG 1IBFA 4FJ6A 1SEQH 1U33A 1R1A2 1A21A 2VC2L 4PJBB 4BFGA 4WI3A 1K4CB 4CMHB 1AJKA 4LP5A 2NY3D 25C8H 1UA6H 4X99B 2XLGA 2TSAA 5C2UB 1TPXC 4AX3A 4V2VA 4JDTL 2IGFH 4NJAH 3EOBB 3O2DH 1C3HA 1RLBA 3OPTA 2FYYB 3MGAA 4H0IA 2FE0A 3RGHA 4MD0A 4B97A 1UD8A 4HFSA 4PWFA 4UANA 3IDNB 4FABL 3PUSA 4PRNA 4TKWA 5J09A 4FEIA 5EZIL 1JGEA 4PJCA 1MZ5A 2E51A 4KKCD 1NOLA 4XX1E 3QEUA 4DOUA 4F8PA 1T7YA 2EDDA 3LIZL 2GUOA 3AREC 4QLWA 3GK8L 1PNFA 2OPKA 4BELD 1X5LA 3SKOA 1R5WB 4JTOA 1J8HD 5BQ7A 5C1MB 4KG0A 3KPSE 1WZ1L 3IMSA 1G7JA 2DKUA 4IDJH 2DVAA 5EU7E 2Y7QB 4LT7A 5DJ2B 4GKYA 2F8IA 3FUDA 4KKQA 4BYYA 5DJDA 1I9JH 3O3BB 5GHWL 4AGPA 5FLVA 4F3FA 2WO3A 5A80A 3TVMA 4YPGB 2NCMA 4LCWB 3RQ0A 4FFYA 2BH0A 1FGNH 4YPJA 2NLJA 2PPAA 4I02A 5LW9A 3WIIL 4U4BA 1MFNA 1X4ZA 2AK4D 3MBWA 3VFRA 1KJMB 2YMXL 3G6JB 5HHMD 4AVAA 4DH2A 1CFTB 3DI2B 1FZOB 4KY2A 1K2DA 5FZIA 4EBQH 4L4VD 4CDWB 4RBPK 3UJJH 4XDPA 1ZD6A 5MHSD 4F7ZA 3GPEA 1U8OA 1LODA 2JH2A 2Q7AA 1J8KA 4XBLA 3VDBA 1Q8MA 5IMLA 1AZRA 1V05A 4L3CB 1RJYB 4R0LB 3ZQ9A 1DGRA 4HKWA 3KDMB 5EOQH 3WHXB 2JCCA 3BWUF 4KZEL 3PVBB 1PU0A 2R23A 1IZ3A 2KR2A 3H56A 4F33A 1GZQA 1AYN1 1YAIA 4WZ9A 4BV1A 2J8UB 1FQ9C 5KS9B 4R90H 3BVCA 4BQ9A 1DSFH 1J05B 3SY0A 4ORGA 1JGDA 4KTEH 1COV2 4LOTA 1C7SA 3MLXL 3PL6A 5CFDC 2X3CA 4JFED 3NZHL 4B60A 2R042 2FVNA 4FJYA 1CQYA 1FC1A 1ET7A 1U8LB 1YRKA 2OSXA 3M8OH 5C0RH 2Z31D 4XVTH 4ZS6D 1T5KA 5I1EH 1M7UA 4NRYA 4LFHD 4NRZB 3NABH 4O02B 1OP5H 1YEKL 3ESOA 1SQ4A 4C91A 2VL5A 3ESMA 3N40P 1MN4A 1PHMA 4Z95H 5KHKA 1UD5A 5E56A 2ZOLA 3FYIB 4TULL 5J7CC 4U2AA 1A9EA 3LRKA 4ODUA 1QFUH 3H1MA 4JG9A 4C1XA 5CJOH 4URTB 4UT5A 4WWKA 2Y5EA 4M1DH 3QWRD 1WS7A 1NCDL 4MNQD 3AKPA 2OSLB 3C6LB 2BVQB 4WZFA 1FI8C 1KTLA 4PRDA 4OKDA 5IB1A 1UZ0A 5B1CA 4XYXA 5FMBA 4F8NA 1L0QA 1LEGA 2E33A 2XJRA 2RB8A 3MXVL 3QRLA 5E6IC 3UEQA 4EPSA 5EYXA 4KVCL 5DQDH 1HQ4B 5IVXF 4B7IA 1OMIA 3QZOA 1J8HE 1SHSA 1J10A 3NDZE 2DTWA 3KLSA 3AMQA 1KRIA 3ZMRA 4AJ0A 2BGPA 3ZL4H 1G0YR 2WCGA 5FK8A 3QDGB 4A2EA 1JXNA 3NCJH 3T6ZA 1DBKL 2W94A 4YSEA 5J56B 5DMGC 1D7PM 3BRDA 3J8F7 1GYVA 4WZCA 1VADB 1HNFA 1CI5A 1T5XA 3C6LC 1G9EA 2PWDA 4YDLC 1TXKA 5KS9A 4GQPH 4XXDB 1R3JA 1RZFH 5D7JC 2WJSA 1GJIA 4KZCA 1W0PA 1PO23 2DQGH 4XO8A 4HMDA 3IDMA 1J18A 4PCKA 2JDZA 1HXKA 3WFDH 2CK0L 2ZOEB 1INEL 3PIQB 3BTYA 4LLDA 4PT6A 2YWYA 1GR7A 2A70A 4JFHD 3I8TA 1RUH1 4KI1A 3B9CA 4OLUH 3B69A 3QYCA 3ALPA 3AS0A 3ZN6A 3KJ6H 3WQBA 3WG7B 4UW5A 4HOWA 2YA0A 4Z7VF 4Y7MA 4NN0A 5KVDE 1NC2A 2BNUA 4RSUA 5I18L 3MHZA 3V52L 5C4WA 4E4DX 5D70L 1ZVHA 4L3ED 5D7SL 5KVGE 4YSAA 3QWQB 1VMJA 4UI9L 1VBB2 1KC5L 4R8WH 3TO4C 4BCUA 2VBPA 4IEQA 3QQXA 5EP9A 2FCTA 3ZOIA 3GMQB 5EU7C 1VBE1 1NGWB 3ATAA 3C6EA 3F85A 4K7PX 2JKSA 1YUHA 4PJFB 3T3PE 3N9NA 2JG9C 1MPXA 3LPWA 4JFQA 1NCBL 4HWBH 2BDNH 1UZGA 5GGRB 4NN6C 3NSTA 2C8NA 5EZLA 5DEFA 3PY9A 2X1QA 2XN9A 4N2LA 4FNTA 1NIEA 1CVRA 3S8FB 4P4KB 3J4UH 5H9SA 5ACZB 4IHOB 4LZKA 4CC4C 4TLSA 4FFZL 4I0CC 3WQ1A 5DZVA 3E7JA 3L5XL 3CPLB 1I7TB 2G5BB 1URZA 3QJXA 4QWNA 2A9DA 3ENRA 4ISQA 4XP6H 5LAXA 3VWKA 3EYVB 1JZEA 1MJJB 4RFOL 5AVTB 1PLBA 2JKLA 1AQKL 2WLNA 4G7VL 5FLHA 1TZGL 1E5CA 2QTEA 5EUKA 5BNNB 2ZUXA 2APBA 3VI3B 1RUKH 1CC3A 4PWHA 5JORB 4JCKA 3MCKA 1DBJL 2ZUVA 1APNA 1W8UA 1LEDA 1U8JA 1XTMA 4NO3B 3SDCB 4G8GA 3R4SA 1GANA 1YXWA 1KYAA 3BUCA 1DQQA 4PY8I 1IGFH 1B6DA 4YSDA 3FU6A 4YHPA