2W95A

Structure of the discoidin i from dictyostelium discoideum in complex with galnac at 1.75 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 61
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w95A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w95A01
4OZOA 3WNNA 4XUNA 2W46A 1WCQA 3CDZB 4L0PA 2WUHA 3THDA 4CUBA 3FHAA 3WF3A 2PQSA 3IAPA 2VC9A 1UY0A 1OF3A 3LEIA 4QX0A 3JXSA 1UYZA 5JR2A 2ZEZA 1JZ6A 4CU7A 2JD9A 2CGZA 2WN3A 1KGYA 1UXXX 2Y6JA 2J1EA 2CE6A 2W87A 1JYNA 5DQ0A 4UI9L 2VOTA 4QB6A 3FHQA 3HJRA 3IIIA 1L7QA 4UAPA 2BGPA 4XUQA 3WNPA 3LE0A 3K46A 2OKXA 3VDAA 4Z2AA 4DXRA 3WMQA 4TXWA 2CDOA 1F4AA 3NQHA 2R7EB 2YC2A 4TTGA 1IQDC 1NKGA 2RVAA 2VZSA 3OGVA 2WN2A 1TG7A 3LEKA 4ARXA 1SDDB 3MBWA 2WO1A 1EUUA 2B9VA 1JU3A 4OUEA 3MV01 1F4HA 1OD3A 2QQKA 4JKLA 1PX4A 2WZ8A 2EIDA 3CIHA 2Y6HA 3T2OA 1UYXA 4GWIA 2XQXA 1CZTA 3LEGA 3HN3A 4GZ9A 4MGQA 1OT5A 5JXIA 1RYYA 4A6OA 3I2GA 3BN6A 4ZZ8A 2J1VA 2XONA 2QQLA 4CU6A 3CQOA 3NJXA 1ULOA 3GXUA 2VM9A 3MO4A 1K45A 2LW8A 3IAQA 4BK5A 4P02B 2X10A 1P8JA 4QX2A 5HXMA 1GOFA 1PX3A 3FL7A 3SEEA 1SG3A 3GDBA 2VZPA 3I3BA 4QAWA 4XVHA 2DDUA 1D7PM 5B4XA 5DPNA 3OGRA 3K4AA 4DEVA 2VZ3A 3A23A 2WO3A 4E8DA 4OMCA 2C9KA 3OBAA 1JYVA 3MUZ1 2V5DA 3HPNA 2VMCA 3K4DA 2L9LA 2QQOA 3PUHA 2BGOA 2WAOA 2W1QA 2WZEA 4XUOA 3WEZA 3T09A 4ZZ5A 2HYXA 4MO3M 2KD7A 2XHNA 2WBKA 4PQQA 3I3EA 2QBXA 2VZOA 1W9SA 3K77A 4A42A 1L7RA 3I2KA 2C26A 3EYPA 3WF0A 5IFPA 3VD3A 3DYOA 1OH4A 2Z4FA 3ETPA 3LQCA 3W5NA 4YPJA 2QQMA 5DN2A 1JZ5A 1JU4A 2RV9A 4KMQA 1UMIA 3UESA 1BHGA 2CDPA 4P08A 3IDAA 5C7GA 5JXJA 1GU3A 1UY3A 5C70A 2E31A 3SKJE 3SKVA 3I3DA 2QQIA 2VZUA 5JMOA 1GMMA 1T2XA 4IUGA 4UOJA 3WNMA 4CVUA 4QB2A 4QX1A 1CX1A 1HN1A 4A44A 2W94A 4P00B 4AAXA 3LPFA 3VDCA 2BERA 3C7HA 2J1UA 2WYSA 1CIYA 4W50A 2Y8KA 4QDQA 2JE8A 2E26A 1UY4A 5LCWL 1R64A 1NAEA 3ACGA 3HNYM 1J84A 2YFUA 1DYOA 4W8JA 1PMHX 2JKXA 2V4VA 2W5FA 4BDVB 2YFZA 3AC0A 2VZRA 2ZEWA 2Y6LA 3T0AA 5DMYA 1KEXA 3LPGA 4OYUA 1K12A 3WF2A 3WSOA 2W1UA 2BZDA 3C7GA 5EJ1B 2J7MA 4BK4A 1K42A 2W95A 2YB7A 3T0DA 5JUVA 1WKYA 2VMDA 2JDAA 3FN9A 2ZEXA 4M4RA 3GM8A 1US3A 3EB7A 3HEIA 1JZ8A 2RJ2A 4DXSA 3DECA 1W9TA 2ORZA 3F2ZA 3HNMA 2B4KA 2CCVA 1NX9A 3P1IA 1UX7A 1OF4A 1UXZA 1EUTA 1NUKA 1LNSA 4Q56A 1JZ3A 4CU8A 2WDBA 2VMEA 3CMGA 4A3ZA 2WABA 2ZEYA 3WF4A 1CZSA 5F7UA 4LQRA 1TVGA 1UY1A 2EICA 4DUXA 5I0DA 1O8SA 5LA1A 4KI5M 4RN5A 2WQ8A 2YC4A 1O8PA 4OMDA 2C4XA 3MV11 4DXTA 2EIEA 3C7EA 4M4PA 5EJZB 3C7OA 5C71A 3ACIA 3VD4A 4A4AA 2VJXA 4XUPA 2VCAA 4BJ0A 3NJVA 1XNAA 1XNTA 3BGAA 2J1SA 2X09A 1W9WA 1W8NA 3OGSA 5J1XA 3NRUA 2J1AA 4A45A 5HPOA 3OG2A 4P5YA 4W4ZA 3T0BA 3ABZA 2ZXQA 3OB8A 1UYYA 3UETA 5B4NA 5LA0A 1JYWA 3I2HA 5CYYA 2DCJA 4LKSA 2W47A 2ID4A 1YQ2A 4XZUG 2VTFA 3A21A 1GOHA 4XUTA 3VD7A 4ARYA 2BBAA 3D3AA 1XPWA 3CZJA 1UY2A 4MOAA 5IFTA 5JXHA 1JZ2A 5LA2A 1DP0A 1W99A 2W1WA 2VMFA 3NNGA 2W92A 2DCKA 1US2A 5IJRA 3T2QA 4JHZA 4JKKA 4BXSV 3C8XA 3WF1A 1UZ0A 2VZQA 4QPWA 2VR4A 1DLCA 1CZVA 4HG6B 2X05A 2LS6A 1JZ4A 4QB1A 2WO2A 3HNBM 1J83A 1JZ7A 4QX3A 3DYMA 4D0QA 3WMPA 2E33A 3GGLA 1UWWA 3K75B 4AG4A 3K4ZA 4QDSA 5FUIA 4ZY9A 4DUVA 1GNYA 3SEPA 2Y6GA 2VO5A 5EIYB 3P6BA 4LPLA 3T2PA 2QQNA 3PUIA 4MADA 5G05L 3VD9A 3CKHA 2J1RA 1H6XA 2EIBA 2W91A 5A1AA 3WNOA 3THCA 3WQBA 4DEQA 4PF1A 3I97A 2E32A 4GWJA 3MUY1 3ZM8A 3T08A 3WNLA 1JYXA 2XOMA 1ULPA 2W1SA 1K3IA 5CZKA 4A41A 4XURA 3WNKA 1SHWB 2QQJA 3W5MA 4E8CA 1W8OA 5IHRA 3IB3A 2Y64A 5JXGA 1O59A 2VZ1A 2VCCA 3DYPA 4LHSA 1XC6A 4CUCA 2W3JA 3ACHA 4PT6A 4FI9A 2YG0A 1PMJX 2W9XA 4ET7A 2Y6KA 2J22A 3A7QA 2VZVA 1JI6A 1GQPA 1I5PA 3I2FA 2VZTA 3I2JA 3ECQA 5G04L 4CUAA 4D8MA 1JHJA 4JKMA 2VQUA 3A22A 3VD5A 2CGYA 1W0NA 3J7HA 3VDBA 3OEBA 4ZXEA 4RYDA 4QDRA 4KWUA 3I2IA 3CZUA 2WAAA 3ACFA 4DUWA 3E1F1 3U37A 2HLEA 2VL4A 5IYYA 3UNPA 2ORXA 2VCBA 3HOBA 2J1TA 1H6YA 1UMHA 1MPXA 4MGSA 3OEAA 3C7FA 4JX0A 1GUIA 4CU9A 2VQTA 1GOGA 2V72A
chains in the Genus database with same CATH superfamily
4QD2E 4XMPL 1P7QB 3ULVE 1MCKA 4HS3B 2AGSA 4HUMB 2EDFA 1A3LL 5TK2A 3ZDWA 1CF1A 3GQFA 1BXVA 1PZ7A 1HDMB 4E0RB 4FFZH 4DRRA 4L9LC 2BFVL 4EPSA 1LGNA 1OAXH 3N40F 4RFEA 1S9VA 4L9BA 2XL9A 4LPCA 3MLLA 3VKOA 1T5KA 3BQUC 4RDBA 2J44A 3FAWA 4F2MB 4U1IB 1IG3A 4MD4B 1RUC1 1CICC 5DHMC 3UJJH 5T1DH 3WN5C 2BVYA 1GYUA 4OUSA 1LMIA 2DI8A 3FTGB 1B3JA 5J4MA 1RUKH 1RUJ2 2BXYA 1Z66A 4ABVA 2D3RA 4PJGB 2C9RA 1CAVA 4PG9A 5C7XH 2IFRA 1OP9A 1YO8A 5DRZA 3DPBB 2YZ4A 1DFBL 2C4FT 1PYWA 4OM0L 3RNSA 4DY5A 4G1MA 3RNQA 4D0BB 4R4ZA 2E9GA 3DGGB 4ZMPA 3GBWA 4QXTB 5I5IA 1NL0H 5ALCL 4FMFA 1SEFA 5TK4A 1H8LA 3C6EA 5K9KB 2XLLA 4XHXA 5BNXD 1LESA 1CFMA 4G9DA 3VZOA 5FLVA 4PY8I 4MJ6B 1ZRRA 1V9U3 5CEZH 5E89A 3JZVA 3P30H 5KYXA 4NPKA 2JVUA 4PS4L 4RNRA 4TSAH 2UZPA 3D5OA 4LBJA 2EA7A 4MDIB 1SFNA 4B41A 4NENB 1WWCA 2P43B 2VDLB 3IFNH 4PCTA 3WP6A 5KC5A 4ZMVA 4AI8A 4ABUA 1JHNA 3ZN4A 1U95A 3DXAD 3V0AB 3D18A 2WP3T 1U3YA 1E3FA 1A3ZA 4PCKA 4Z6AT 5FZDA 4RAVB 1AGBA 3SO5A 4XJWA 3BB6A 1BX2B 1G7IA 5E00B 1XYPA 1PK6C 2KZBA 3U9PL 4F8LA 2EDOA 1V3KA 4RA3A 3U1SH 3SKMB 1VFMA 4TL5A 4KJQD 2W0FA 3WS6A 4I0PC 5IZ7A 4QHKI 3WHTA 1IVLA 2WZ8A 3KLQA 3HS0C 3MYZA 4WV1C 3OSDA 4YYOA 2G30A 3SDCC 5J48A 3QUZB 3Q1SH 1H3WM 4NMIA 3TASA 2ATPA 4LKFA 3CFQA 4ZK8A 2ZAHA 1TKWB 2GCYA 2VW4A 5C86A 5E6ID 1AXIB 5MP6L 3Q5OA 4S10A 1YFUA 5L4IA 4Z7IA 4DESA 1SBSL 4TVPH 4G5ZH 2UZYB 1YNLH 2BIPA 4F3JA 1V10A 1RMU2 4HKJA 2DVBA 2NY2B 4FRWA 4ZFOB 3VN4A 3C8KA 3NJNA 5E8EB 7CGTA 4HWBL 2YQGA 3BGMB 3FB8A 2LFEA 4TMPA 4NQQA 1XAKA 3CZNA 3SN6N 4W9JC 3EZ8A 3S36H 4CN6A 1Q0EA 3AUWB 5HHNA 4PREB 3JQWA 3BSZL 1G9MC 1CJDA 1I5ZA 1K45A 4PQ9A 1TJXA 1NY72 4WLCA 4L0ZA 3T2TA 4YVSB 5F3CA 1RK0B 2VDRL 1DGWX 3ILEA 4LK6A 3EF7A 3V95A 1N18A 4FSJA 2BLFA 3SJVD 3K6SA 1P8JA 4GJTB 5E00A 1RUG1 4NHYA 2A77L 2H4EA 2QT6A 5JXAL 3OVUB 4HCRA 4FYTA 2B1HH 3QORD 4OFIA 3SEEA 5GLTA 3ZO9A 1MAMH 3U83A 4IKLA 1OUSA 1WTGT 4GRMA 2X4RA 4HIHB 1S9YA 2ICEA 4JO3L 4AHYA 1NC2D 4W9DC 1D7PM 3QIUD 3ZU8A 1O9VA 3HQUA 3BP4B 1VALA 3H9YA 4NNXA 3NIFE 1UA6L 1E5RA 4U0QB 3JVFC 3NJYA 3FB5A 3QULB 5D2NC 5FY7A 2ZP9A 3BEWB 4F7TA 5CIRA 3AT0A 3QQ3B 1EPFA 3RL2B 3VRIB 4LHUD 3UJJL 3AYEA 3HPNA 5CCKL 1LDPL 5C4WB 4D2NA 4R7NB 2DMCA 3NRFA 4JFZH 4D7YA 5BUPA 1KGIA 2JB6A 3LSOB 2KR2A 5IESH 5JIAA 1A7QL 3KLKA 5KUKA 3WCSA 5HV0A 5DLML 2HWC2 1IU1A 1F31A 3SNMA 3MA9L 5E1IA 3ZMRA 3QJVB 1MS1A 4HSLA 4N2HA 1QHQA 3FT2A 4CRQA 4W9HC 5HYJA 1DQ5A 4ZHNA 5B21A 3I8TA 1W9SA 2A74A 1JZFA 2BP0A 4APXB 1RUG2 4ELMA 1MH5B 3A6BH 4LF3B 2APWA 4OZFG 4BHPA 1MCDA 3OLIA 3JB4C 3NFNA 4NJAH 5LW9A 3TVMD 1NOLA 3AJYA 3NSJA 1RIUH 2WGXA 4BCZA 5CFHA 5IW6A 5B3NA 1CAUA 1NMBH 4K1ZA 2HWF3 4QTHA 1D5ZA 4BQCA 3EO6A 2A6IA 1MIMH 2ZPXA 1UXSB 4QXKA 2PHTA 4DO5A 1FI2A 4OCMC 2E7AA 4XBGB 3VWKA 1QKZL 1HHGA 1KC5L 4U3SB 3SJVA 4LBMA 4POZC 5DMIL 2RD0A 1SF3A 2WQUA 4MS8C 3ZDXE 5TDOA 1C12A 1XMWA 1QQP3 2RS31 3IDGA 3L5JA 5I0UA 1PVHA 4XUPA 3GNMH 4AT6A 2R32A 2E4TA 4WKZA 2GSIA 1URIA 3QCUL 4RMTA 2J8OA 7FABL 1AR61 2VDNL 1YFYA 4JJOA 1T2XA 3ZKND 3M2MA 4CVUA 3WNMA 2WFF2 1JP5A 3GKZA 4XMLL 4HLTA 4YZ1A 4KX8A 3GTTA 4MXWL 4KK5C 1EZLA 1BW8A 2O5ZH 1PKQA 3MA9H 4FLOA 2VR9A 4JVWA 3JTSA 4KAQL 4KQ3H 4M7LH 4AQ8A 3DPRA 4IK7A 3QJTB 3OD0A 2AJUL 4BZ2L 3E6HB 4FNQA 4X8JB 3O0XA 4X6QB 4H88L 4X80L 3IWUA 7PCYA 2D7QA 4JAMA 4MBRA 4QDQA 2QSVA 3MPCA 4JMXA 4JHTA 1F58H 3DUHA 2A83B 4YOKA 1HZKA 4J1UB 3QQNA 3VBFC 3CMOH 5LDSA 3MO1B 2MMXA 2YFUA 2JKXA 4CGUB 1R3HA 2C24A 3QG6B 3IFPB 4F7PB 5BOPA 1UU4A 4X5LA 2WNVB 4BFOA 2ZEWA 1ZLEA 1UU6A 3EDKA 1OAZH 2X1OA 4DEWA 2E3VA 1TO5A 2FDBP 3BWZA 3QWQB 5GJTL 3TFBA 5CEYA 1MVEA 2VNGA 3NTCH 2FQFA 3O6FC 3RVXC 2DWYA 4P5KB 3BAEL 2EUVA 1RMFL 1EMTH 1O75A 4H7MA 3SCGA 3DUIA 3GXUB 4ERSH 2YB7A 4QRFA 5FIEA 2WFF1 1OAJA 5AVPA 3GZPA 2C7FA 4XZUA 4O7XA 3WN5B 1H9WA 5JIQA 1QXJA 2P4EA 2OVUA 4PJDF 3RUGE 3RWIA 2P24A 4M4RA 2H6CA 4UNVA 4AE2A 4B4PA 1E8WA 3LDBA 2X3BA 2HVKA 3BW9A 4W68A 3ROLB 2H0BA 2P8MA 2Y1AA 1P4IL 2FO8A 1VZGA 3VJ6B 2PAKA 1IPSA 4PY7A 5D96C 4MG2A 3EOBB 2OTPA 1HXS3 4Y5TA 1MCBA 5DUPH 3DA0A 5L2KA 1NX9A 2IQ9H 5F70A 1H8VA 3FTUA 4HWZA 4KO6A 4ONOA 1UXZA 4BHUI 3TNNB 3TN93 1CLZL 4J3OH 4FFYL 4Z77A 4QOKD 5K59E 4HGMA 5KN5A 3RUGB 1LO0L 5E1AA 3GCWA 4NM4L 4F9PA 3K5RA 4I0KA 4KTEL 1P4UA 2J1KA 5FYLL 1BF2A 4E27A 4JM4H 4BFJA 4ZPVB 1HE8A 2C3GA 4LLYA 2TEPA 4PIRF 1UYWH 5A2KH 2CPCA 5FLHA 2YXFA 5EULV 1LGVA 1MEXH 2K6ZA 3A4AA 3RWCA 1W90A 3R4SA 1A9BA 2G9KA 3VFPB 4PJEE 9PCYA 2LR4A 2JDKA 1KGXA 4LPWA 1ZBE2 1VBB3 4NQXB 1HESA 1QVOA 4MHHG 4Z3FA 2G9GA 1X44A 3QG7L 4XXPA 2BSTB 3R18A 3U46A 3ZZLA 4L1TA 2VCAA 3MAWA 4X7DC 4G9SB 1WGVA 4M5YH 5HGDB 3PWUB 3CN2A 3L1OL 2WNXA 4HWNA 4HBCH 1VMJA 2W38A 4XX5A 1MG3C 2YD1A 3VYOA 5CZRA 3OQ3B 5GHWL 4E5XB 4OZHE 1L9QA 3CLPA 2Q86A 4GXVL 4NFBA 1WSST 1AGFB 5LAXB 4G7YL 5IK3B 1GXEA 5FY5A 2YGVA 5EU7C 3HNTH 4LKSA 3LB6D 4H8WL 5DUML 1MEC3 2GMPA 1DVQA 4OLUL 4PWEA 3I59B 2IMNA 3K6OA 4FXTA 4GH7B 3RTQD 2VDKH 4XUTA 1NCTA 2DWDB 3C8DA 1T5WB 4H2AA 5DQDH 3DVGA 3II2A 4D8OA 4GUOA 5KHJA 3BPSA 3ZPDA 1HHIA 1OQEA 4R7DB 4YQXH 1JXKA 1V7NL 5E5MA 4M3HA 4U0RB 1WYJA 3RWFA 3BUYB 5IHBA 4NPMA 4O58L 4I9WD 4JFEE 1CQ9A 2BFUS 1QOOA 1CR9H 3VGHA 5FK9B 5IJCC 1N64H 3LRMA 3ZHFA 1G7PA 1PK6A 4Z07A 4DK6A 1GKOA 3NSFA 1ZCRA 1E4KC 5GZGA 1ND2B 1IV8A 2JF1A 4P2OB 4YGVB 4BXVA 3NJFA 1PZDA 2NLRA 5CGTA 5FGCB 7PAZA 5JDSA 2JEMA 4CKQA 4XCBA 1RUG3 3G6JA 4HJ1A 5ABDE 2X2UA 1U92B 5EBLB 3HI1B 2VL5A 3W57A 1LLAA 2C3VA 2VR7A 3WMPA 3ZFEB 1FHGA 4QWWD 5B7MA 1SMVA 3THPA 2UXFA 5AW6B 3W9AA 2UURA 2G5BB 4RDQF 4LMFA 1Z5LB 4HJEA 4L5FL 4YDVB 1OTTD 4EBQL 3DTDA 2ERFA 2VAUA 1DGWA 3M17B 1OVSA 4L23A 1YMMA 4JZJB 4PR5A 4KFZC 2DYPB 5J13C 4NHXA 2V5TA 2JG8C 1J1PH 1DBML 1Q1JL 2X87A 4ZS6C 1Z0HA 1JERA 2TSAA 4AYSA 2QQNA 5G05L 1X5AA 2YARA 3DPBA 3SDDC 1BMV1 3KPOB 4XXDB 3K6SB 1CFBA 2B20A 3WV0A 3M46A 3P11L 2HLFC 4H55A 2JNZA 2XI9A 4JRXD 2KERA 4ODSH 1X6LA 4WRLA 5ITBL 1OC1A 4YVSA 5HV4A 4OCTA 1U5XA 1I8IA 4N5ED 4N0UA 4Z9KB 4WJG3 3MJ9A 1YA5A 2Z6FA 4IRZL 3TV8A 3L48A 1C9SA 2P37A 1V0AA 5D8AC 4NO3A 4KNQA 4B8EA 2XVLA 3F7QA 1KQRA 5F96L 3TURA 3RAJH 1SXCA 4EIGB 1VFBA 2CH8A 4Y1TA 5C07D 3HUJA 2E4FA 2GITB 4HH9B 4ZOCA 4YHKL 2EAKA 5JXGA 3DYPA 1SEBA 5I6MA 1KXHA 3I9GH 2FYYB 2M1KA 4FQXD 5L4MA 1J9SA 3IDNB 4YDJA 4L4VE 5IBTL 4AJYV 3S4SG 5HYSB 4XPVA 1BZQK 1B90A 1S2EA 1C7TA 1MHHA 4NCDA 3SPIA 3U4KA 4UCFA 2IG2H 4I3SH 2BUKA 2EE3A 1AR81 3D6EA 2KLSA 3WIAA 1A3RL 3AT9A 1UOGA 1NLDL 1GQPA 3HHSB 3ZXLA 3FKUS 5LKNA 3JCIA 2PW2A 4KZCA 4S2FA 1W2TA 3V65A 4CUAA 4RFT0 3D52A 1BFVL 1ZWIB 2PWGA 2LU5A 5ESAB 3IMWA 4CN1A 2F15A 1RJ7A 4N0CC 1KJ2B 1TZIB 2WLMA 3VD5A 4KXCA 4WM7A 5FDBA 5AW2B 3ZTCC 4GI6A 3MBED 1ID2A 5E8NB 1H2MA 3K51A 3AL5A 4ORZC 1KACB 3HC4H 5JIKA 2NXYD 1VKXA 4ZPVA 2DWEA 4ZXEA 4MMZC 4JPVH 3NJGA 4B9GA 1GZQA 2XA3A 3BP7A 3IXAA 3T77A 4MXVF 4NXSA 4XCCL 4Z0XA 3GJFB 3VWKC 3L3IB 3QIBA 4PIZA 2UYLB 3GJFK 2EDHA 4QM9A 2XV3A 2VCBA 2WBWB 2Y9RT 5EYXA 4BWOA 1O4ZA 3BAKA 1OARL 2QHLA 4RMWA 3CWGA 4X2UA 1NL0L 4FNLH 1KCRL 3V5DB 4K6BA 3WDXA 2W80C 5CBAA 1GOGA 1NEZA 2V2WB 1FFOA 5C07A 1F0LA 4BUQA 2HMID 3O3EA 4IS6B 2VLJB 2YBRB 2WC7A 4JDEA 1GYKA 3MO1A 3D3VE 1QVOB 4L0PA 3O41A 4PJ5B 2Z0BA 1OURA 1G1KA 4HYTB 5D6CA 2DWRA 3MCLL 1LEGB 4NNYB 4LLUA 1KCLA 4PWFA 2Z31B 2RDQA 3IAPA 4P05A 3MODH 3F7YB 3RZCD 2QFEA 1F3DH 5C3TA 3L5HA 3FFCB 5D7LD 1KIQB 5FOBA 2IAND 4FPEA 3ZIYA 4RMQA 4TWTA 2ESVD 1HX6A 4P3CH 3VO0A 3HC2A 4PJGE 3NA4A 4MXWH 5EH1A 1E2VA 3B69A 4NGHH 3HMWL 3NBNA 4WTZG 3V4VB 5DUBA 3D51A 5K9JL 3DUSB 2J2ZA 3TJHD 2PHFA 2B1AL 1DDLA 4S1DD 3VGIA 2OXGA 4XH2A 3OKOA 1NDMA 1BZDA 1KY6A 1XR9B 2F54A 3CG8A 4LCUB 3GXMA 4MAYD 4MCMA 4RMBA 1LOAA 2X8KA 5JYLA 2PYEE 5IVXB 4O2FB 2YQBA 3ARSA 2IPUG 1YMME 3AJZA 1EGJA 3SY0A 1T1XB 2AV1A 2CDFA 5TDPB 4DY3A 1P7KB 2DVDA 3V4UH 1M6UA 3K6NA 4I9WE 4JDMA 5KAQG 5CP7A 4FQ1L 3UP1A 1PGL2 4AWJC 3B00A 4QXGL 2WP3O 1PO13 1YG9A 3OKMA 4AT6B 1CR9L 5IMLB 3N4MA 3MMEA 3GRGA 1XYNA 3TZVA 5I18H 2QADB 1Y18B 1WWWX 1DQLL 4ONHB 1CUOA 4N2CA 4TQHA 5F7NC 4F9PC 4XVTL 1DQQA 3M1BA 1JSYA 5JPMB 4TYSA 1J58A 4PIXA 3MV01 4YZ2A 4G6KL 4ZX3A 3R06A 2QQKA 1G7PB 1UUSA 1E5BA 5DRNA 4E9VA 4P9IA 5DABA 3JU9A 4PRHB 2XZAH 2F58H 4K3DH 4GW5B 4WWKC 3UZEC 1R1A3 3AXHA 1MHCB 3VFOB 1QQP1 3F2LA 4DFHA 4JFFE 4OF7A 6TAAA 2C9PA 4BB3A 2ZOUA 1G8WA 3N7MA 4PTTB 3FMGL 1ND3C 2ZXDA 1F56A 3USUA 1X4XA 1C5BH 4L05A 5F7YC 2NZ9A 4WTQA 4DK5A 2K70A 4WEUD 4NERA 4QO1A 4YGDA 4FULA 2OZ4H 2YLHA 4I9XA 3HRZB 4ENEC 2A9MH 4FJ6A 4TLGA 3L9BA 1KJRA 2ZX1A 1FC1A 1AZRA 5FP8A 2ADJB 5GSVA 2VQ1B 4LQFH 2Y6SC 3O9WD 2XY1A 3WCYA 3RY4A 1T20A 1WJ3A 4AJ0A 3FSOA 5I1GH 3ZFEC 3AVRA 5DVLA 5MI0C 1IM3D 2X10A 1EAH1 3FB7A 2HUHA 1FNGA 3MV7A 3ZKYA 3T2LA 1B9KA 1QFUL 2CMRH 2PCPB 1YEFL 4NZJA 5I1GL 4DP9X 3N3HA 4CJ0A 2XBZA 3WIFB 1JV2B 1OTUD 1PZBA 3MBXL 5MEPB 2E6PA 4BK5C 1KEGH 3T30A 2P28B 4HKJB 1BJQA 1S9YB 2ICEB 3SYCA 2VERN 3QZPA 3UBHA 4KK6C 4AM0Q 1EV11 3BVXA 1IKPA 2OTWB 1RPQA 2P5WB 3N04A 3I3BA 1WA0X 4OJEH 3DIFA 1UMZA 3LIGA 4TVPL 2ZCKL 1T1YA 4OZHB 3IKKA 4BE6A 3QUZA 1RUE2 5BQ7A 1TPXB 3DSNB 3LKOA 1BLIA 1A4BA 1CVSC 1HWGB 3TBWB 3W21A 1UASA 1CFNA 2VAAA 2X6VA 3MLRL 3MJWA 2MNWA 1JYVA 1QLEH 1NE6A 3B9CA 4TL4A 2CK0H 2DCZA 5IQLA 5CHNA 2GFBB 3VFMA 5L7XL 5K8SA 5DO2D 3TBYA 2ZABA 3QEUA 5C0AA 4LIQE 4YGEA 5D2LB 4AG4L 3NNMA 1Z6JT 4ZMXA 3GKWL 2EF6A 4PBVC 4DGVH 1HQNA 4GXFA 4K40A 3PV7A 1B4JL 3U78A 3BUBA 5LN4A 4BZYA 5F6IC 3NO8A 4EI6A 4ZYKB 2AITA 3RYRA 1MI5E 3C09C 2KZKA 4Y2NA 1L7RA 2P5BA 3CX5K 4DT2A 2WWNA 2YGPA 3NP3A 2DJ4A 2AKRA 3F7RA 3PP3H 4WY7L 4FQXB 4U2ZA 3DBSA 4JG5A 3VD3A 4UBGA 4OGXH 3H9SE 1K6QL 2FZ3B 3L2NA 5DEGA 3LKQA 4QRPD 3HMYA 3A4FA 5HYQB 3EHBD 4G42A 3H42L 4F7MA 4ELKA 1LO2L 4HK0B 2X5IC 2R0KH 1NCQB 1UACL 5AUMA 1B0GA 1MVYA 3FCTA 5F39A 3KB5A 1OVPA 1WW4A 3KXFD 2NUTA 3UC0L 1XX9C 3NZ8A 5AQ0A 4ZTEA 1J9CT 1SOQA 4H8WH 3I3DA 5GGRY 3EO9L 5I82A 1MS5A 3HQXA 5MEND 2FD6H 1JXJA 3BTXA 2XR4A 1CX1A 1NCBL 4NRMA 4XE5B 3RTQA 4WFHD 3BOVA 3UGHA 1X5LA 32C2A 4YX2L 3HLAA 2KDGA 2XNAA 1K5MA 1TJIL 4ZOEA 3ZSKA 3UTPD 2JELH 2QQPA 3FU9A 3X3FH 5CFDA 3IDMB 2A83A 1A47A 1OGAA 2QDVA 1KZYA 4OLYL 5EWIL 3QPXH 4M48H 1K5NB 5HJBA 3S98A 2EDBA 1BMGA 1OH3A 4MLSA 4GG8A 4ZUSA 1JGUH 1E7UA 5DS8B 4FKKA 1X9LA 5AB1A 5BYNA 5C09D 5JSPA 4W9IC 2Y6LA 3UYJA 3INUH 1AKJB 2R042 2W0KA 3QO1B 4QRQA 2YD2A 4FG4A 4G43B 4JY5H 1J5OL 3B5HA 3N44B 1E5YA 3FXIC 1FH5L 5K0UA 4MNQE 5B2GB 2J7MA 4JFFD 4Z7OF 1PK6B 2PETA 2XSKA 1AYN3 2MPFA 5T3XE 3FRPG 4PP1D 2LT9A 3M1OA 4JY5L 3I85A 5EF0A 1J5OH 3QDGA 4UQ2A 1JPFB 4CCMA 5JUVA 3MLUL 4UILH 1G9FA 3QZNA 4GAYA 5DR5L 3L4UA 3JWDC 1TQVA 3QC5X 4G72B 2AK1L 2ARWA 3LS5H 3VZLA 4EJRA 2VISB 4PPTA 1T1XA 3AG1B 3IN9A 1Q0YL 1NC4A 4Y7MA 2J57A 3P5BA 4XFAA 3WGVB 1OA2A 1US3A 4QQ2A 3I2OA 2K4AA 4WI8A 1HI6B 4F58H 2C1PB 4A2MA 1LHVA 1P7QA 1TEIA 3F2ZA 1FGVH 4XPAL 1X5GA 2Z7ZA 3F64A 1J5HA 1VRH2 4TN9A 5D7IA 1D5IH 1MW2A 3DNKA 1JVLA 2R1XB 4HOMA 1NQJA 1AS7A 3HS8A 4YHNB 3ZDYE 4FG2A 5EU4B 4QHNA 5I1CH 3MV7E 1NCBH 2YOAA 5D7SL 4IERA 1W39A 5ABJC 2PW1A 2W60B 3NJLA 3C6LC 1F4XL 2I60H 4LNRB 2JB5L 1ZLWK 5MENE 3KYAA 5I1HL 3FU7B 5FKAA 1O6SB 2FWOA 1EXUB 4URKA 5C6WH 3L7EA 1FNEB 1IGFL 3HBGA 2UWEF 2BNRE 4DUXA 3P0VL 3O45A 3SGKC 1DBBL 1QJEA 4FO9A 5D2LF 1KCUL 3CK0L 3IJ9A 4M93B 1G6RL 1QZ1A 2ENQA 5CSZA 4R7XA 4OZIE 1I8MB 2WSUA 3H42H 3RDIA 4LLUB 4Y4FC 4DN4L 5LBEA 4RRPG 1QKQA 5E9DB 3C7EA 1IFHH 3O3UN 2Y36H 3V4VA 4LSTL 1E4XL 2GG1A 3AM2A 4BH8B 1CLOH 5B39B 1DZQA 2XWBA 3WKPA 1W0VA 4WU5B 2IAMA 4KVNH 5DURB 4FNRA 3TO4A 5IJKA 1UM4H 5FFLA 2JSFA 2FAUA 5JMRA 4Y19D 1W8NA 4PGCB 5DZLA 5KBMA 1SJHB 4GG6B 2PQQA 1EY2A 2OR7A 2WWUA 3STLA 1Q5OA 2X1QA 1HQRB 1X7QB 1K4DB 2ZXQA 1KJVA 3TA3B 4IJ3B 1HIXA 3DC0A 4JE4B 5CYYA 3O3DA 1MPAH 4G6AD 5GRWA 3ILNA 1BFTA 2CR0A 3RVTD 1IGTB 3EJYD 2GH2A 2V6HA 4F8OA 1FLRH 3KBEA 1MFVA 2HH0H 3TT1L 3TT1H 4B9YA 4QPGA 3OKKB 2KUTA 2VECA 4TSCH 4PRIE 1GW6A 2DQHH 1A1OA 1IT9H 1G7YA 4PRDB 1Q8OA 3QUMA 3SPJA 3A4UA 2HVJA 2I9TB 4HIEA 2HT2C 3AP4A 5IFTA 3WR0A 3Q48A 3BIAX 4NPYB 5D1ZD 5IF0A 5A3LA 2CLVB 3D34A 2TRYA 4K94H 1PGW2 3OZLA 4Z2WA 4A7SA 1FYTD 4NHUA 4HIXL 4Q8BA 4XNQB 5C8JB 4N90A 1N8ZB 4G2AA 5IHLB 2XA8L 2IBZY 1CLOL 3BZEB 1JGLH 2X4UB 3RLSA 5L2KE 4X7EC 2AMUA 3LZZA 1XE0A 3DJSA 1H1MA 4MZRA 2WFPA 3U11A 4ZUVB 1TMCB 2CLVA 2VYRE 2ZWKA 1U8PB 2AAVA 5LBSL 1YI7A 1T3FA 4L9LA 5B3SB 1RZ7H 5A2CA 1KY7A 2OMTA 2QVKA 5HD8C 1T0PB 1A6ZB 1DQDH 4ES8A 3SSGA 3KYOB 5FZOB 3VH8B 2AKRB 1GA2A 4JN1H 1RJYB 1CVRA 5DJ0B 2R49A 5EN3A 4XACA 2I74A 4CP9A 5SWZA 1CDYA 4IOIB 4YSEA 2P9RA 3GZQA 1IZKA 1OAZL 3ZT5A 4BWUA 5DZJA 1M2VB 1S9KC 3W37A 2PUQT 1NXD1 1SLCA 2H47C 1RUJ3 3BODA 3PABB 1FE8H 3NAAL 3TJEL 5FHAH 3HE7A 4QLWA 1WAAE 3H7BA 4MYPA 1AR1B 2YUZA 2XIBA 4Y4HA 2JIXB 3S5ZA 2JB4A 3BKJH 4UFLA 3FB7B 3QB7C 1YRZA 3EDJA 3QJHA 2PKDA 1N5AB 3B2MA 3CC5A 4EDWH 1RVF1 2KH2B 3EBGA 4UINL 4UIMA 2P17A 4NQDD 5FQ0A 4CKVX 1DQMH 2XWBB 5H37H 4IBZA 1AJKA 4XMVA 5JXAH 4LR4A 3OJDA 4G6KH 5ANHA 4URTB 1IVTA 1MS0A 4FQHA 3WQBA 2DBLL 1ZRDA 4ZUWA 2GSYA 1N3NA 4UB0H 3MXVH 4MRBA 3QZWB 1L5GB 2O5ZL 2IWKA 2XY2A 3V6BR 5ANMA 3PHSA 3L2MA 4QY8A 2R9HC 4PGBA 1A3LH 1GANA 1J8HD 3T6XA 4M1GH 1JYXA 2Z31C 4NZ8A 4XFFA 1ULFA 1T5XA 5JSOA 2A4EA 3CFEA 4MQTB 2EUXA 4U05A 2VW2A 2YAQA 3HN1A 3KLDA 1XGYH 1R081 5LBCA 3SOBL 1W8OA 4HPYL 3CH8A 2YD9A 3SPGA 1QJZA 2LE9A 4NZFA 3TX4A 2Q76A 1L9OA 3BD3A 1ULGA 4LVNC 1L5GA 1NDTA 3NAPC 1LMKA 1LTXA 1VIWA 2ITCA 3PL6D 4NFDA 3QIUC 4PGEA 3ARUA 4PMEA 2VC2B 1IBZA 4M56A 4ALAC 1EJ8A 2CD0A 2JK5A 1XF2B 1KN4H 4K3JH 4N22A 1JV5A 4QWNA 1AJ7H 3BKYL 2WIMA 4N26A 4HKOA 5IOKA 5L73A 1F45A 1O5DT 2XXCB 2ZUSA 3WAKA 3JUUA 4TNWK 3ARBA 1N12A 4GRWF 4DFSA 3NCBB 3UIZA 4FTVB 5MERA 1UD8A 4KROC 1KT2A 1QI4A 4R26H 4XC3L 1W3XA 5E2JA 4ZONA 1AYRA 2KL6A 3GT6A 1U8MB 2DQIH 1PS3A 3U1PA 4D8MA 1WAAF 1ZBE3 3AZZA 4HAFA 1RFDL 4FFWD 1KCBA 1OAYL 1GIGH 1U3JA 2BHUA 2VQUA 3AJ7A 3N40P 5DUPL 2ZP8A 5FUNA 5T5LA 4KRLB 3L4VA 4LDEB 5E03A 1DGLA 4MUVA 1P4IH 2A74B 2YSSA 3MODL 3TVMC 1COV2 4FTVA 5MERB 3ZVVA 5A3ID 4NCC1 4H0HB 4GSDH 4GUPB 3I2IA 3FH8A 1AUYA 1FATA 2GY7B 3U6XA 2ZSVA 1W8ZA 5FC9A 2ENJA 4P2QE 4MXWA 1CL7L 1RCYA 3RX8A 2AEWA 4HZLB 1S2BA 4OLLA 5JR1H 2ZGKA 1YNKL 5KS9A 3WQ0A 4POZD 5F3FA 3JWNE 3NK3A 1UYWL 5D55A 4NHKA 3MTRA 3HZKA 5GIRB 1CLYL 5D71H 1IL1A 5FXVA 1ZBA2 4K8RB 3FT3B 4AYGA 3MRQA 1MAJA 1PZ9A 5AZEL 4NZUH 4BELD 2YFNA 3APFA 3QDHA 4OF0A 2YBSA 5HHOE 3T04D 2JX9A 4AH2A 1KENH 4E9TA 3DVGB 1RZ7L 3SBWC 4N6QA 4NSKA 4FP3A 4AI2A 2BJML 1SMOA 1K5MC 5A6ZA 3FU3A 2OQ7A 1CDHA 5ACZA 1W15A 3QC6X 3TPUB 4PD4J 2OYPA 1XOYA 1E5IA 3DDFA 3PYCA 4G8IA 4BRVA 1ZBE1 3HG3A 3O4LA 1HCYA 3CMOL 2EEXA 2N1KA 2APFA 1HXYA 5FAAA 4X4XA 5A3NA 4ABQA 4OQTL 1P4LA 1N6UA 4HGKC 1I9JH 5GZNC 2G4IA 2OBGA 4FZEH 2ICES 4H0LC 1WUZA 3D0AA 4QQPA 2K4WA 2XTJD 2YEQA 5BZDB 1V70A 3M3CA 4Q74A 2ZEZA 3W2DH 3QI9D 4JCMA 3SODB 2VGDA 4PB9H 1IC0A 2GK0A 1NLDH 2NQCA 1P2CA 4AR2A 4ZAKB 4XIKA 1N8ZA 1UCTA 3STZA 4F3FB 1OF2A 4XXWA 2E7QA 1WLCA 2B0SH 2DWEB 1Q43A 3FQTA 3WFEH 4YBLC 3J26N 3OF1A 3PMEA 4ZSOB 3TONA 1YUKB 4JTOA 4EOWL 1E4WH 1NAKL 4MAYA 2I7SA 1UWFA 4OIFA 1PBYA 4EI6B 1Q8MA 3FSZA 1A25A 5J6GA 3U4SA 5B38A 2ADDA 4QPGB 1FJ1A 2DQMA 2E6VA 4DVBB 1UA3A 1E6JH 2VH5H 2YK1H 3VRLE 3ZSTA 2AENA 1DLHB 2GVYA 3O3AB 4PYHA 3ZBMA 5ISZE 3UTTD 4Z7VB 4QKBA 5HJDA 1AF9A 4ATEA 4G7QB 2XKNA 4ZFGL 1F8TL 5EJ3A 4HK3N 1OGTA 5T50A 4Z3GA 2AS5M 1EDQA 1ZGLB 2VITA 2XZZA 3OV6A 5DK0A 4CADA 4XVUD 3TIEB 5JW5B 2YMZA 3I54A 5FA3A 5LGJB 2EC9U 4U1MB 3AITA 2XVKA 5TFSH 1MF2H 3V8CA 1F4YH 5JW3H 2EIDA 4RNRB 3H8NA 3QJRB 2VSKB 4XJ8A 4LHUB 1RZPA 1FBIL 4AHZA 5I1JL 5HHOB 3NCYS 2CHWA 2VN7A 3MREA 5BJTB 1DBMH 1LL1A 1Q1JH 2J5LB 1TNFA 3GYDA 3JB8A 3MZTA 4IU2A 4A7VA 4NQVB 2WIIB 5D1QB 2CKBA 2ZOWA 1JZHA 5CD5C 3OGOE 5AD0A 4BA0A 1LE5B 3BN6A 4XC9A 1YCSA 3OCPA 4BE5A 1QXPA 1E90A 1XCQA 2RIKA 2ZCHH 4JFFB 5AVYB 1AZNA 3L1FA 4MJ2A 3RVWC 5IJKC 2CA4A 2GDFA 5C0CE 1NEUA 5DWPA 3VQ2C 5KYUB 5DO8A 2BNNA 3SQOA 1MCFA 1F5FA 1SUHA 2AGJH 1XGTA 2CZNA 2VM9A 4LBEA 4E42B 1T0MB 2WNGA 2MHAA 2RHPA 3EIFA 1KS5A 1XFPA 4NIGA 3POGA 2EDKA 1KELH 2NNCA 4Z7UE 1URLA 5H4YA 2FK9A 4N2EA 5I9QB 3MIHA 1W91A 2XN1A 4XCFH 4WHCA 3LB6C 3PIQB 4WAFA 1KIUA 2GJ6D 2DZEA 2J1XA 3ZVXA 1RUPH 2AERT 1NWPA 1J12A 1G7HB 4MNGB 4AEIH 3DX7A 1TLMA 3GDBA 5DWUL 3H1WA 1BM3H 2D7FA 3MLJA 1SLBA 3POBA 5FJKA 4HUNB 3SO3B 5IEHB 1EX0A 2Q1EA 2B16A 1NCUA 4G9FA 2ZZUT 3NV3A 2UU8A 5LCVL 5LWYH 4Q26A 3P9LB 1BAFL 5F6HJ 4M29A 4JC1A 3LXUX 4ZO8A 1KCWA 2WANA 3LEXB 3ZTNH 4LCCA 4KTDH 5A7SA 3G3LA 1AR82 3BGFB 2HRGA 1CDCA 2HX7A 1KCSH 1S7WA 3QRGL 4H8WC 1Z9OA 1EAPA 2OR9L 2W1QA 2WZEA 4AVAA 1ZSDB 5EFIB 1SMAA 1YMMB 4JZJA 1TJIH 4PR5B 1AFVH 1EBAA 1KD7A 5GLZA 2WXQA 4F5CE 3AKPA 4I2XB 4Y7OC 4RR3A 2DEYX 5EIQA 3UYRL 1X50A 4ISVB 2E7TA 3DHMA 1UWEH 5GGQL 1N47A 2WLLB 1D7FA 4HMCA 1F3DJ 3ZL4H 2WMPA 1FAKT 2PO6B 2A6VA 1IKFH 1CD8A 3DYOA 1GKEA 4GLRH 4EKJA 4MMYB 3HI1A 1M71A 2ZHKA 3DO7B 1UWGH 1BGXL 5FX3A 5LQBL 4Y1AE 1OLRA 4R3SB 3TBDA 4MVBD 3KYNA 1EYBA 1X36A 2VLKD 3EYUL 4Y4HC 1GC1L 4Q9CA 3RPIA 4GP4B 1NCWH 4WFGD 5FYZA 4YG3A 3D08A 3DTXB 4G59C 2O5YL 2RB8A 3HD8B 4WFHE 1IM9A 3QO1A 2B7YA 2EDXA 4ZS6D 1POV3 3WV6A 3SE4A 5E6RB 1IGYA 1IAII 1GU3A 1FPN3 2JLPA 3MRJB 4V2CB 4P5MB 3SDDD 3ARFB 3OD3A 5LCVA 2DLGA 2E75C 3CSYB 3PREA 3S4SB 5GRJL 4XBNA 3L9RA 1WAPA 1LCLA 3KXFE 4BM8A 5BUGA 4BBWA 1GMMA 4UOJA 1NCGA 1HE7A 3C60D 1T1YB 3F00A 4OZHA 4YPGA 4A44A 1UOVA 3LKQB 3HG1B 4HEPG 3IDMA 4OBRA 3VBSB 4PGBB 4RAHA 1G86A 3D3VA 2K7QA 3EGDA 4YSUA 4NHMA 5IVYA 2CUHA 5EZIH 3OR7A 1Q38A 3QUYB 4JPIB 4XPAH 1RUC2 3QDJD 1NTDA 2CAVA 4YSOA 1E30A 4NHCL 5E70A 1OE1A 2ZXGA 4P23B 4Z7UF 1IAMA 1WT5A 4XBPB 4O02B 5I30H 1CZ8H 5ETUA 3RVUD 3DO4A 4IGQA 1OP4A 1NCWL 3QCWA 4HHWA 5I6XB 1HOEA 3H9HB 2EADA 3LPGA 3O81A 4UM8A 1NPJA 5CZVL 3QUML 1JF6A 4AQ1A 1W0YT 1JE6A 1KG0B 3DX0A 4PJ9A 3AG2B 2IVIB 2OPKA 2OCJA 4AOFA 4XIOA 1A9EA 5H35A 2W95A 3PCYA 3NKGA 1RPKA 3WNIA 3WXWL 3U2SB 5IVZB 1SHMA 3C2AH 4MDRA 4N2KA 3WFBH 1SCSA 4I0AA 4HC1L 4QMAA 2WNOA 1T22A 3EH2A 2G2RB 1QFPA 2CKBH 4P9ML 5I1DB 1LU2A 3POEA 4ZG1A 1D6VL 2IWFA 3MR9A 4XPFL 3W11C 2NY2C 3WLBA 2B9AA 5EORH 3HG4A 5F0LB 4J3VA 3MNDA 4DTGH 3ZYJA 2GKIA 3DVNA 3HEIA 5GGSA 2FX9L 2A73B 2Z1KA 3WYRA 3O8XD 5FV1L 3MBEC 3TYFA 5IP4A 2NY5H 1HHJB 4H8UA 2NXYC 4KDWA 5CJ5A 1IGOA 4UFMA 1R3LA 4TNVF 3LKSA 5GLUA 3MRLB 1SOKA 1YDPB 2FHBA 2EDNA 4K8RD 3KHOA 2D03H 3VMOA 1NUKA 3ZK0A 2Z93B 3NABL 3LEVL 4R26L 3LYRA 4TSBL 4O2CB 3BPOB 2VWEC 3HBQA 3MCKB 3NSYA 4MJ4A 2I69A 3FT4A 5I8EA 4MB5A 3UYPA 7FABH 1Y7BA 3SYAA 2O61B 1M7UA 1RULH 3VI4B 4LMQE 1KXTB 1OIOA 1PFOA 3I9PA 4HULB 3VRLF 5F88B 5TDPA 2VVDA 5FZMA 2OA9A 1S9WB 2ZOKA 2E9BA 3ZUNC 4F7EA 5I1KL 1NZCA 4LLDA 1KTCA 2XPGB 1WIUA 4FNTA 4XXCC 5EZLA 1K3ZA 2C4FU 5FA4B 3B9IA 4FQCH 4JMNA 5EBWB 5LNDA 2XHKA 3ZFGA 4AFDA 5D7LE 1HRV2 1FQ9C 3HNVL 1YHFA 2J5WA 2X2HA 2ZPKH 3L4WA 1QBLL 4NLAA 1A02N 1JN2P 1Y9QA 3WW3A 1SXSA 4DWHA 4ODTH 3MGAA 2EYSB 2XVBA 3KWWA 2EDJA 2QQNH 1MCOH 2R4SL 1MS8A 2DYSB 4NN7C 2GIMA 2DQEL 4KI5E 4OCWL 4L2NA 5AC93 4MA8H 1DL7H 5IQ7L 5LRRA 4JFED 4ZTPH 2AJ3B 3LVEA 4ZTPL 1R47A 3I6GA 43C9A 1NY71 2CO6B 2BDRA 3AUVA 4JFDA 5FYBA 4C1XA 2F1BA 3VKFC 1T7WA 5FMDA 3V0BB 1WCSA 2X09A 4X4YA 1R083 5IEHA 3B5TA 4JDZB 4JRXA 5AD0B 4LVOC 2EEBA 3OG2A 4P5YA 2ZXBA 2N0MA 3T0BA 4W4ZA 4YBQD 1II4E 3P73A 4PJGF 5CLTA 5ILTL 5CSZB 3FFCD 4XXWC 5LLIC 5D1QD 1N4XL 5GQBA 4S1DC 4KNSA 1CFVH 3MRNB 4WJ5B 3TFKC 1MCRA 4DHLA 1T6GC 1DSFL 2JDZA 2AEIT 2FJFB 4MAYC 4J5VA 2FT8A 4IRSA 4PW3A 3S3BB 3V5HB 2A70A 3KBHE 3QIBC 4UTCA 3PLYA 2CGRL 4XABA 5IQNA 1Y0LB 3EOTH 2R4RH 1NA1B 2BNQB 3M7FB 2FATL 1RUE1 3KT7A 3R06B 1FO0H 2B77A 1NBZA 1AHMA 1T89C 4ZMOA 4JPWL 5HGAA 4YHOH 4HXCA 1GGIH 4WFEE 4WDIA 5D8AA 3MUGB 3ZRCC 1LE5A 3RZKA 3IRPX 1DLHA 5LXGH 4XPTH 3KPRE 1YYMH 4N9HA 2XG4B 3V5KB 2JB6B 1DZ0A 2P3JA 4N4YB 4X6CA 5HJ3A 3NSCA 4JM2A 4YHZH 2X4QA 3JXAA 1DBJH 4IV3B 1NFIB 5KC6A 4PJCB 3ZDZB 3CN4A 4W6YA 4HHGA 1K2DA 2VNCA 4ADGA 1T0NB 1AFVL 4TLUA 2KA3A 3CBNA 2EDTA 3OJMB 3V8OA 5IT6A 3V9CA 4PJFB 2NPLX 4MXVE 2PXYA 3AYDA 1QQDB 2AK4E 2GJPA 2H6UA 4Y8DC 2JDYA 2A6KB 2DWSA 2R23B 3I75B 1UWWA 1W28A 1CFTB 5HHVL 1VMHA 4ADJA 1W06A 4QXCA 3EFFB 1G7JB 4ILDA 4LCWD 1IPKA 3H9SA 2WK2A 1MQTB 1X3DA 3MRKB 3MA7B 4FI7A 2OYLA 1R1CA 3GMRA 4Y1AD 3AP5A 1X5MA 1XGTB 4R4NC 1U93B 3ZGHA 1CLZH 4F57L 4X5XB 3AU1A 4IV3C 4RA0C 4TRPH 3JUYA 4WW2A 4XMKL 3KMDA 4YGBA 3TIDA 4NQCD 1MHHB 2PPAA 4FMVA 2C5DC 1M7XA 4ENED 1QTYT 1KJ3L 2AJVH 2GUOB 4EI5A 5JHDB 2WZR1 3OPTA 4HKWA 5DDJ3 1D6EA 3BAJA 3WG4A 3RZCB 2N1TE 4BYYA 4I18A 2Z8WC 1OE3A 2F8OA 2DMGA 3DXTA 4M7KL 5EZOH 1Z3GH 4DEQA 1YEFH 1H8TB 2VUKA 4Z0XB 3MICA 3FO2B 5DQ9B 4MQXD 5EN2A 4XAWH 1WFJA 1Z9PA 2NW2A 3QPKA 4ANXA 5EF1A 1WFMA 1ADWA 1I3GH 5LUMA 3BQVA 3QHFH 3GJAA 1HHHA 2ED7A 3L1EA 2VIRA 4HKBA 1VP6A 2W1SA 1J87A 2XBDA 3ZDVA 1K3IA 4L4TB 5J0BA 1JWSA 4NVPA 3OYWA 4ADIA 2CJUL 2XXMB 1UZGA 4GBXD 4MYWB 5J37A 1MZ5A 4JDTH 1JXNA 3A0NA 4JLRB 1ID5I 2V3FA 5CIPH 3LRGA 2HFTA 5CGYC 2ZUTA 2RDNA 2VCCA 2NY0B 2JJSC 3DV4B 1JPTH 3FCSB 3WJLC 1G0YR 1T21A 1IGFH 1U4FA 2KLRA 2ZUXA 3EUUA 4LSSL 3N9GL 4AENB 4DVBA 4HZFA 1HOCA 1A6TB 1C5DB 2P5WD 1MI5B 2GTZA 3BX7C 2KQNA 5HYSA 1DLFL 1A7RH 2XRAH 4LKDA 4NWTL 2P5WE 1OSEA 4JGNA 2X42A 3L5WB 4A1RA 3BQUA 1S0CA 3D0JA 2ADIB 3OXSA 2LAGB 4EQ3A 4P23C 2B4CL 3HUJB 4IDZA 2BWCA 5C33A 3WN5A 5B4MD 2AJYL 3ZE0E 1ITBB 1ODUA 5I0ZA 1VACA 1QJX2 3BAIA 5D1XC 3II1A 4Q9RH 4OUMA 3CFBB 3R05A 1PO11 3SCMD 3X17A 3ULUC 1JUFB 2CWSA 4B7KA 2DPKA 2YMOA 4XILA 1AG6A 4CXWA 5SWSE 4BU2A 3IEAA 2XTJB 4J27A 3U0WL 3B5LB 1QMJA 5BZDA 1BX2A 3D06A 3SKJL 2OMUB 5EOCJ 1GTNA 5D7IE 1E65A 3K72B 3VXRE 4YDJB 5LXVA 4BFGA 2H3NA 3VE0A 5C0GA 4A2DA 3O6LL 5FK9A 4AL9A 1FL5B 3DSFH 5CZXD 5HYSG 2BP8A 4DP6X 4KVPA 4M7JH 1KGUA 1SNRA 3ARFD 4Q0UA 4HN1A 4UOW1 5HHMD 4C83B 4NDMB 5CR1A 4YDKH 3AMLA 2XJSA 1ZE3C 3PHAA 3SPVB 4LBQB 5LBGA 4FT8A 1VRH3 1SYSA 3BFWA 3OAYH 3MRPB 4KUCF 1JHLL 1AIFB 1JGVL 3CDZB 1OD5A 1DVZA 5F3HA 1MVUA 1PQZA 2AV7B 5ENWA 3CFTA 1XGPA 2FH6A 4UT5A 2PF6A 2IH1A 4NZDA 1C5CL 2FO1A 3M7OA 5FXXA 2VC9A 2FMYA 2I24N 4OLVH 4UDTB 4FEIA 5DRZB 2XCMC 2YA2A 3BISA 3JT2A 4G11A 4I3PA 1KFAL 4WHTA 5E94B 3OR6B 2Z4QA 4XNXH 4D9RE 5KSUA 3ZXJA 3V52L 1F97A 4PJ9C 4CCLA 1JZJA 4MVTA 3DV8A 1U21A 3EYVB 4K23H 4OZHF 4AL8H 1REDA 3LPPA 1HNGA 3NDZE 2I2SA 1FNYA 5AAPA 4JCLA 4NZUL 4RHV3 3U6RB 3ARBD 2KMWA 2NTSP 2Y22A 3TTYA 4EUPG 2P6HA 4MAUH 2WA4A 1KEGL 2Y5TB 1FL5A 2P7TA 3U4EA 1CE1L 4ZU4A 3VDAA 1HH9B 1NQBA 2Z7YA 1VEPA 3SH5A 1ENSA 4DZBA 3QYCA 1BAGA 4HS3A 4XMUA 5JOFB 1KLFA 1I7RA 4WCYL 3AS3A 4Y5YA 3UJIH 1F4AA 5EP9A 2Z93A 4WEMB 2FRGP 3T3PB 5T54A 4GOSA 4HK8A 2LU4A 2APVA 4EAEA 4OFYD 4QNPF 3NP4A 1IB5A 5TD4A 5EUKA 2WT0A 5LK5A 1KPUB 1E6JL 2UX6A 1AX1A 1HHJA 1GGCL 4XQDA 3I50L 3NPZB 5F9JB 3PU3A 2JKNA 2MPVA 1MREH 3NYKA 5CP7B 4W81A 1BYNA 1TG7A 2DTWA 3EJCA 4BDVA 4OLZH 1EZUA 1GJWA 1BFVH 1K8DA 3MBWA 4IQHA 2HN7B 1PZ8A 1K4CA 1OOPA 2HG5A 3PNWA 3W0WB 4XDPA 4K7PX 4UQBA 1U2CA 4ZQKA 1MS4A 1V27A 4DGVL 2B9VA 2I5YH 5KS9E 2VVFA 4QHBA 3IPEA 4LRIC 4Z3JA 3NSXA 3O11A 3POCA 4OZ4A 1A6WH 4OIAA 1EEYB 1FZMA 4X9FA 2RMNA 2J7LA 3MRIA 1J8RA 3NH7H 4L4VD 5B22A 3PIJA 4YFEA 4LCUA 2PHWA 1HQWA 1F9KA 3ZFGC 2N01B 4GWIA 3QIUB 2DY2A 1YLBB 5LCVH 1N19A 3PNRB 1KJVB 2OPCA 1CZTA 4IBWA 1P5VA 1GV9A 4LCYA 3FQUA 4QT5A 4YDMA 2LLNA 2VB5A 1DQKA 1AGEA 1J5CA 5K93A 2Q86B 1UM4L 3EJUA 3AXDA 4Z7OE 5F1NA 4EI0A 1ACXA 4NPLA 2X4OB 1S0GA 2KC0A 1N6VA 4HDIB 5J12C 5IMMB 5MEQB 1I85C 1M7IA 1KN2L 4HIPA 4GBXB 2EXSA 3Q5TA 5BMFH 3WIHL 1L0YA 4AEFA 2CWRA 1GJIA 3LN4B 4GXLA 4QCIB 5KBNC 1W6MA 1XB6A 2ZPKL 4H8PA 3VFSA 3KCYA 1JUIA 4JHVA 2J12B 3A67H 1AHWB 4PJAF 4CEYC 4FQCL 1TEFA 4MJIB 2HTKD 4MA7H 3T65B 5IATA 1GOFA 4RS5A 4N6RB 3RVTC 4FQJL 4I18B 2IALB 1QJY2 1N64L 4X4ME 3PURA 3ITQA 4FQQB 4AQAB 3KPLB 5IV2B 5LB6A 4Z92B 4IRSC 4Y4FB 4YSQA 4PRIB 5LO7A 1M7DA 1BD2B 5JXEC 1AVBA 1FYTA 1OZTG 3OGRA 1YEEL 5D1ZI 3VM7A 4QHPA 4QHNB 2R2CA 4JKNA 5LGKA 1OAQH 4S2GA 1PZUB 2N59A 4I85A 1W72B 1YI9A 4Y16C 1I4FB 1NKOA 4Z18A 2C0ZA 3AVEA 4JFOA 3K4DA 1PNFA 1GZWA 4JFPA 1RIVH 1AKJD 3VH8G 3RKDD 1D4VB 2IXQB 5AOKA 3GB7B 5IKCA 1NWOA 3KV6A 3RKPA 3O45B 5DS2A 2WJ5A 4UFJA 5E88A 1OQDA 4PQQA 2RAMA 2I07A 3ZQWA 3FUOA 3RWIB 3FX3A 4AQEB 4HBCL 2C26A 1WGOA 2CBMA 3DMMC 4B9FA 3VGBA 1R3KB 2ARJB 4UM9D 3JD72 4MCYB 2VMHA 4HCRH 1XSRA 2Y6FA 2W07A 4LP8A 2F54B 2TAAA 4PLKC 2VDRB 4RGOL 2QQNL 4JFUA 4L48A 2QQMA 4RA0A 3RY6C 3T8VA 1E2ZA 4Y26A 2VXTL 5KG9B 4Y1AB 3IWZA 3P2DA 2JTDA 5MENB 2NYYA 1NAMB 2EKJA 4GAAA 2G4EA 4EI5C 4IXLA 5F5CA 2VLRD 1RHHA 1SRDA 1WLTA 4PF5A 1BQUA 5I93A 3F7PC 3WQ1A 3NKTA 1H3XA 4RGMC 4KK9C 4GG8B 2PWEA 4ZUSB 5FZAA 5FYLH 5CCJA 3QS3A 3KT1A 3N9NA 1E9OA 3IETB 5E5LA 2QQIA 2AQQA 3M6DA 5JMOA 2ED8A 4YRDA 4A7GF 1KWGA 2LW3A 1PDKB 1ETB1 1EANA 4GRWH 4LDLB 4P00B 4UTBH 5B8CA 4D0CA 3L2YA 5D6CB 1A4KB 5E6UB 2R9HD 2O6PA 3NIFF 4YBLB 2XL7A 1PJWA 1JZGA 2YWYA 3JTSB 1O4YA 4ZQTA 5ABJA 2ITEA 5KBLA 5CO1A 4C91A 1RZFH 1VBD1 4OQTH 2CQVA 1NFDE 1NKRA 2BP0B 3LD8B 4ABWA 5I73C 5JA8B 3WHE1 1JNJA 2HJFB 1UYPA 1IFHL 4LBNA 4W8JA 4R6UA 3J8F7 4HS6B 1XQ4A 3LN9A 2JJSA 1WS8A 4LVOB 4MNQB 5T3XD 5KXEA 1NJ9B 1ET8A 1ZV5A 2IH1B 1KSRA 2P45B 1XH3B 2BC4A 3BWAA 4I4WA 3G9VA 4QRTA 5EZJA 5F1SA 5FW7A 4JFXB 4ERSL 1K12A 3TBSB 4XBGA 1EV12 2WTOA 3T9WA 2FMDA 4Y4RA 1J1OH 4NIHA 5EJ1B 2BCKA 2B3RA 2PTVA 2ZIDA 2R0ZL 3NZHL 4Z7WA 1TJHH 2FCBA 1S9WA 2ZOKB 3EJQA 5BRZD 1JOPA 1RSFA 3IDXH 2PHXA 1VEMA 3TA3D 1ZLVH 3CVHA 4FOQA 3WJJC 3BI9X 5GLVA 3M88A 2YA1A 2OP4H 5IB1A 1G84A 1LWRA 1OSZA 4IRJA 4TUKL 3OC5A 1QR1A 2VN5A 2XN9B 2FX7L 3ERXA 4HIJB 3PL6B 2PW2B 2CUMA 4OF3A 1UZ8A 1RL1A 3MN8A 4FFWC 3Q7JA 4RSVA 3SDAC 1XBRA 2VDQL 3N50A 4A7TA 1QNYA 3B3BA 2W1NA 5LNGA 3U9UA 1EP0A 2GFBA 3H3UA 4WQOA 3BU7A 4LVHC 1O6UA 4OJAA 4R4FH 4ASLA 4GMTH 4U6TA 3JV4A 1OAUH 4NRPA 2XG3A 3AYCA 5DMJB 4DEPB 1SN2A 2YD4A 3LOIA 4YBHA 2CO7A 2XJUA 1PG7H 4DFIA 5T1KD 5F3BA 3I2DA 1F1GA 1XEUA 2WNKA 4FOMA 4HJGA 3NGBC 3W38A 4XCEA 3O2VL 1ZZ8A 2FHRA 4DETA 3KPMB 3QHZH 4OZIA 1CD0A 5FZBA 3CFKB 1V6JA 2V7NA 1ZS2A 4GBXA 3ZTJH 1BK1A 1UU5A 2X1PA 4KI5M 1LILA 4XFCA 2A5ZA 4FABL 2IXIA 5EU6D 1M3JA 3LIHA 5CLZA 4FNPA 5ADPH 4JPQA 4U6XB 1WMEA 3K6IA 4K20A 3V4LA 3OPZL 4YSTA 4DPBX 2A6ZA 1VDGA 2AGJL 4MNHA 3VD4A 2H1PH 4UBDD 3T0EB 1WBYA 2W8CA 4GKZA 5ADOL 4AYUA 3FYIB 3F7VB 2F4LA 4LLVB 4AW4A 2OSWA 1WWBX 3NACH 4XVJH 3VX1A 1ZZ7A 2C7UA 2EEDA 3FRPA 4PRPE 3FTGA 3RILA 2ARJQ 2XTJC 4KQ3L 4M7LL 1BYOA 3WS3B 3GBNL 4RAVA 4NQXA 4CC4A 5JHAA 4ZS2A 2V3DA 3QI9C 3REWB 2DBLH 1W9FA 3UETA 3CVHL 4CVZB 5GS0D 4JGUA 3CDCA 2DLFL 3OKLB 3K6DA 2WXFA 1NCQC 2BRRH 3CJIA 1RPUA 1CN4A 3QSKB 1AO7B 4XZUG 2MCPL 1GOHA 1WMFA 5T3XL 1U3HC 3ARXA 2R041 2BY2A 4UUJB 3D09A 1AZCA 4K55A 1QKZH 3NJHA 5JXHA 4FHJA 1DQLH 4XOCA 1H1AA 1LO2H 1TMQA 2XN2A 4XN8A 5DJYA 1FVDA 1NYWA 5CAZA 3I7DA 1KFAH 2NQ3A 4LSVH 3ILRA 2XYBA 2KPNA 4K7PL 1US2A 5IJRA 1FT9A 4B0MB 4KGGA 2VDML 4KXZI 1TEGA 1L0QA 5HDQL 1HQLA 4B4QA 1MCWM 3WF1A 2BW4A 5F9WC 2Y07H 2AK1H 3LS5L 3QHFL 4X6EA 2EINB 3LQAC 3VRJA 2D3NA 4H0GA 4NRYA 4PIYA 2AUYA 1KXVC 1TF4A 1NMAH 3TWCL 4HG6B 1ZT4B 1COBA 1JZ4A 3HN8A 3PGFL 1T5XB 1AR1D 3F84A 3R1GH 4QX3A 5MHSE 1N3OA 5L7XH 1LDPH 2MNJB 2ZCHL 3ZN6A 3ARBB 3LEXA 3APBA 1SDAB 1TTUA 4NM4H 3GMMB 4SBVA 5GKAC 2D4FA 2OAAA 2A3XA 2G1MA 1I9IH 1JTPA 2MQCA 3C8HA 3V0VB 1T20B 3GUTA 2A3YA 4OCRL 3O4LE 3D12B 1ZRIA 2JXMA 5CD5D 2LUWA 3CL1A 1W6OA 3RDTD 2IXLA 1ORSA 4MADA 3HBZA 3HMXA 4M43L 4GAJH 1MI5D 4MD5A 3DX7B 4Z1PA 4AGNA 4XO4A 3F83A 4PRPD 3LKPA 2Q10A 3WO4C 5KZCB 3E38A 3WNOA 1E8ZA 3MBXH 3R7QA 3X1BA 1JPEA 1HILA 1I8KB 2QCSB 4URAA 2NY3C 1ETA1 5EOQH 3TNMB 2VR3A 1I9RL 4MMZA 4XO9A 5I8CA 1HAUA 3IF1A 5FGBA 4HETA 3HQRA 2BJMH 3UBXI 5JLVA 4S2SA 2QTWB 2XOMA 3GRWA 4KVNL 3BI3A 1NFDB 2CU5A 2V5MA 2NMOA 4K3GA 3R19A 1Z0MA 5FTTC 3T4YA 1KCRH 3TN0A 1LNUB 4FVVA 3JYCA 1TTFA 5IJBC 1XWVA 4KH9A 2IH8A 4MA3B 5GJTH 1Y9GA 4U1JB 1QW8A 4EN9B 5SV4A 1H8SA 2ZXCA 1S5HB 3RGVC 1UXMA 5FP4A 1HINL 1X7SA 2K7PA 2QV4A 1G9CA 4K5PA 2OMVB 5FZ4A 5FUCE 4AAPA 1MWAA 4R7LA 2EYTA 1UXWA 3FCUB 3ZLQC 1J1XL 4FFFA 4IBQA 2IH3A 2QVTA 3GLDA 1EJ6A 3QQ4A 2O5XH 4IGBB 5C0DB 2HRLA 3CCHB 2CIKB 3EH4B 5AZ2H 5K69A 4PJ5A 1YQ5A 12E8H 1ZJBA 2Z2SB 4BZ2H 1A7PL 5DAWA 5SV3A 3QXUA 2CBTA 4EIZC 1IQWH 1RMU1 3DBXA 2YBPA 5FDWA 3BKZA 2X6CA 3LEYH 2HJLA 3LEYL 3Q44A 3VMNA 5F7DA 4OI4A 4O65A 3HI6L 5K9OB 5TSWA 2VLKE 5D93B 3RGVB 5AC92 1QUNA 1ZLUK 3SQOH 4CEYB 2BZ7A 3S0MA 3OL2A 1CB4A 1MFUA 2BSSA 3FCGA 3OEBA 2BQPA 5D7JC 5CJXA 1IM9D 1SMDA 4HUUB 1NBYA 5L9DH 4OU3A 3U37A 2WW8A 2HLEA 3D25B 3RYKA 5BRZB 4NN5C 4DKFH 1HINH 1K8IA 3WKYA 5DJXA 4ANUA 2WLKA 1L9TA 4HWUA 4C57C 1IMHC 1ASJ2 5F3GA 2J1YA 1PMYA 1WA2X 4FLHA 5FZLA 4ONUA 4P2AA 3UG3A 1QH6A 1KBGL 3IJEB 1KRIA 3H0OA 1GUIA 2ZA9A 1I3RA 5FF6A 5T1KA 2RJKA 2AXGB 2V72A 1DBAH 3CHRA 4ZMWA 2J8UA 1I9EA 4XUNA 1HL5A 2X88A 2W46A 2C3WA 2QPSA 3LN4A 2NY4B 2PPCA 3HPJA 3QDJA 4R2GB 3PAYA 3WSQH 4J1XA 5JVVA 5F72S 5C0BA 4R96A 5T3NA 2QDRA 4L1SA 2V09A 1R9FA 3VTTA 3QRLA 1ZHNB 5JPNB 2DMBA 2WXPA 4QUOA 5L0QC 2OZ6A 1OEZW 1JRHL 2AXFB 2WCSA 5DJ8A 3V4PL 3ZX1A 3SD2A 1L0PA 2X9WA 3L13A 4LCCC 4ZXBB 1RHI1 2CDGA 5IWFA 3DDGA 4IE7A 2BVQA 2WRAA 4QRAA 1TU2A 4H1LG 4AMWA 2W0XA 1NOAA 4GIQA 1Z1WA 3W39B 1WH0A 3UZEA 4FTDA 4F9LC 4UV7L 4X50A 3LZQA 5CSGA 1UT9A 4OZFB 2YD6A 2E8ZA 1QOTA 4N20A 3JSSA 1HB3A 1CPMA 1DSFH 3P3SA 1RUAH 1H3UA 3EYFA 3GPSA 4UI9L 2VOTA 2GHWB 4ZFFB 1W0PA 1FZMB 1PD1A 1NBVH 5CAYB 3HR6A 3KV4A 4JO4H 4UU9A 1YEIL 5HCAA 1RUH1 4PHZA 4XCFL 1CAUB 4NRZB 1MQTC 3BD5A 4H20L 3PXHA 4Q0VA 1I53A 5LHDA 1PZ5B 5E08L 1N0XL 1PG7X 1KC5H 2CIIB 3MOBH 1BP3B 1E6OH 3QUKB 1QNZL 1RUD3 4B97A 2IANB 3DRQA 3MJ8B 4X9HA 2AI0H 2YXVA 1ZAGA 2XJPA 2H6OA 4HVOA 1ET7A 1KPUA 2VC2L 1IQDC 4BKSC 1ZOXA 3RYMA 3WFHA 3C5SB 1QLRB 4J4PD 3TO2B 2R1WB 5C3PA 2EDMA 3GI8L 5CMAB 1HWHB 4KO5A 5ALBH 4RSUA 2H9GA 4R5XA 1ES0A 3EH5B 3OZ9L 1FNAA 4F8PA 4J39A 2P3IA 1ZY9A 2HJKA 3F5WB 4KJYB 4YZ4A 3OB0K 4GWMA 4Q0PA 2ICWJ 2DQDL 3KPPB 2X4TA 3SBPA 3VG0L 5ID0A 3U4EB 1DGRN 5ANNA 2CCLA 3OGGA 2YHGA 2AQ3A 1XIWA 3ULUH 1H0DB 2GBTA 1IE5A 4OUEA 4MJ6A 2YPVA 4LLMA 3W20A 3X1GA 2QELA 1CX4A 4ISRA 5I8OL 1YJDL 3O1UA 1NZIA 4IW3A 1NBVL 1HEZA 5DJCB 2V2TB 5FZ1A 1I9RA 3WKMH 3CPLB 1Q9WA 4AOCA 3EDEA 1F41A 4JDZA 3C09B 5BV7B 3HR9A 5HCHA 1JDAA 2BRTA 4AZ8A 4MNQA 1FG2B 4B9PA 1FZKA 1WC7B 2YD5A 4GZ9A 5DRWB 2IDFA 1V3LA 4KWJA 1KIRB 2BYVE 1JU4A 1KYUA 4OLZL 4E5XA 4A6OA 2FECL 3QUKA 4GO8A 4XPGL 4JV4A 3CSPA 1X82A 4YXLL 1Z0NA 1MNUH 1Z9LA 3FQXB 3KWWB 1N1VA 1U12A 4DPNA 1LTEA 2I9LB 2BNMA 3G5ZA 1A8JH 1HCVA 5EIIG 3MO4A 5EDXA 1QFUH 3AXIA 4I09A 3UGFA 3MW4A 3ES4A 1D6VH 1V7MH 1L4IA 4Z7UB 2AJXL 1BECA 4Q9QL 3Q2NA 4MMXB 3X14A 2VN4A 4PD4K 3GJBA 5IEKA 4NQDE 5FO8B 1G9AA 2O61A 3V9FA 2Y23A 5D1QC 4LHLA 2JDPA 2XA8H 3KCWA 2Q8BH 2K6YA 2X44D 1NUNB 4YHOL 2F7PA 1MZZA 2A9BA 3BKMH 4EZHA 4YVUA 3M4FA 5EOCH 3LKSB 3QUXD 4P46D 3HB3D 4K5OA 4DP1X 3QIBD 3FCTB 2IDSA 1ND2A 4DGIL 4KDTC 4EJ1C 1CZ8L 1Q8PA 2DLHA 1CAXA 2DTML 4GMTL 3TBVB 2Y7NA 3QUXA 4DO6A 4EDXA 3MUZ1 2JDHA 1CIDA 2OKMA 3GBMH 3VXME 3PVBB 2DUQA 4O51A 1BXAA 4UT7L 2QQOA 5GRVK 1MZYA 4V1DB 4BOWA 3B9KC 1NIDA 4OIIL 5I9QC 2PLV1 3P2TA 2E74C 3ZO0A 5EU6B 3FO1B 3P3RA 1NCRC 4OHVA 3QQXA 1TVHB 1CVNA 2D9QB 1CTNA 2CJSA 4HQQL 1ZX5A 3N1PC 2FWLB 4X6RB 1DZRA 3CH1B 3QNYA 4LU5L 3S8WA 2OYKA 2VZOA 2CU9A 4PGDA 4ZUVA 3K77A 1WISA 3HIFA 4WGWB 1Y6MR 3I2KA 4AQ1B 1WWYA 4XX1G 4X98A 1UUNA 1CGTA 5DFVD 4KUZH 1E4XH 1PO12 2PYTA 1AL0G 4AENA 1RLBA 3Q9OA 1X4ZA 1R1A2 1B4LA 1A6PA 3LQCA 5C0AE 2RV9A 4GIOA 4IGBC 5HP5A 3RU8H 4V33A 2FLBT 5CLYA 4M5TA 1R24A 3SXWA 2QSCH 5CJQH 1CDGA 1QUNB 3CLFL 2CY6A 1M7DB 1QAWA 5DAPA 2IGFL 1B09A 5B38B 4Q4Y3 1U8CA 5E2VH 2JDNA 4BLJA 3QACA 3S37L 5GS3A 2O93L 3RAJL 5EHDA 2A4CA 4AK1A 1P5UB 4QOKE 3UPAA 1V55B 2XKSA 1UY3A 2VMIA 4FCHA 1J0IA 1GAFH 3FTVA 4H8HA 3VWJD 1VJSA 2AQPA 3GGWA 4LOUD 1LEMA 4MD4A 4H88H 4X80H 4IE5A 1FL3B 2DRUA 4OSUL 1URXA 4ZT1A 4HJTA 5F6HI 3VFVA 1S9VB 4MQXC 4YFLF 4Z7QF 4YXKL 2HA1A 5C8CC 3VDCA 3BIEA 4QF1A 3AG4B 1MRDH 4KZ0A 3LXBA 1U2YA 1PNCA 1Z5YD 4ONGH 1JF5A 5HI5C 3MF6A 4RQQA 1V6MA 1LXMA 2GSIB 3OX8A 2P5PA 4L8QA 3OMZA 1LHOA 1DEDA 2J1WA 4APQD 4FFYA 6CGTA 2VH5L 3HKZA 1JXDA 3V4PH 4B1LA 5LCWL 4PLNA 2OS7A 2YKLL 4HU2A 3AZWA 1H19A 4K4KA 2BSSB 3LRKA 5LWYL 2CSPA 3ABMB 4W6XA 3LOBA 4PJEA 4AEHL 3KPNA 4BK8A 4LASH 3ULSB 5CGYD 3GSOB 4Q0SA 1OHZA 4WI0B 5DMYA 3C08L 2DVFA 5FFOA 2CRYA 2PWHA 5TPWH 5KTEH 1P7KA 2HEYF 4WEEA 5E51A 5C8CB 4LJHA 1SPDA 3H53A 1OPMA 1WHPA 5DGQA 1B88A 5I0SA 4XE0A 3ULAB 1IAIM 4AIEA 5A70A 2VLLB 4GW1A 1DQ2A 1O3RA 1L9MA 4AVIA 2VLME 4WNQB 1RUE3 1D5XB 1IGCL 5ICXB 4IQPA 3B4NA 3QEQD 4AEEA 3UO1H 2R1YA 9CGTA 1L3WA 4WHDA 3VNYA 2SODB 3UMNA 5B4MC 1Y9MA 3G9AB 1S5IH 3IMVA 1ECZA 1GSKA 2V9TA 3GEWB 2DQFB 4N9GA 2HBUA 3FB6A 3G6AB 3K0YA 3RA7L 3MV8A 2A9NL 1LHUA 4EN3B 3ULUD 2W2IA 5T55A 3OLGA 2BOCA 4L29B 1MUJA 3HZMB 2YSSB 3RJQB 3B8YA 2EKSA 3SZ6A 3C9NB 2ZWNA 2AACA 4X8NA 1AI1L 2CDFB 4WNJA 5C9AC 1U30A 2Z92B 4HGWB 1C28A 5TQ2H 3T71A 3IF1B 4TS6A 5GS1A 2G2NA 2BHFA 1UJ3B 4RX4A 3MRNA 1JG9A 4BZ2A 4M3JA 1GSMA 4I5BB 2P44B 4J8RB 5TGBB 2SEBB 2YBGA 1ALYA 4KO7A 3S88H 5CZXC 4A7YA 4FPGA 2WYIA 5FYJL 4YHLL 3MGOB 5BZXA 3FAXA 4Q4IA 3KM2A 2OJZH 2VE6B 3WE1A 1RIHL 2IBGA 4NAOA 1YUHB 2O5YH 3IWVA 1U42A 2E7LA 1JPGB 3HZ3A 4MAZA 1UD1A 1OT1A 4H1LH 3FQRA 5AW5B 1T83A 1DO5A 3ATEA 2AC1A 1LGCA 4MDJB 1ONQB 2DKUA 2FBOJ 4R0LB 3IDYB 3UTZA 3IDBB 4RQQB 4JFDE 1BZOA 1SY6H 1Z78A 4AJVA 4XPTL 3T5WA 3INAA 2LABA 4GUQA 3KV5A 1G7LA 5IHZA 1CICD 3L54A 1DVFB 2H6PB 4PWJA 3GIVA 3WFCL 5I91A 1GHFH 1N2RB 1UWEL 3WZ1A 5D21A 1I3GL 1ERNA 1FFPB 5DGRA 1NLSA 4HFWA 1OB1B 5C2BL 4RFNC 4V2BA 4Y33A 2Q3XA 4X5QA 4BSWB 2GSGB 3D05A 3VKLA 4CNIA 4E9RA 4F7ZA 1UFGA 4TZDA 1KJMB 3HFMH 1X33A 3BDYH 3J7MA 1TJGH 3L3HA 2A3WA 4XW3A 3D3AA 5ERWB 5AZUA 1HX0A 4D7PA 1YJLA 4UT6A 3X12A 5LG6A 1CTOA 4Z7VA 2CR6A 2ADFL 1BOYA 4JO2H 1N5AA 1I9IL 4OGAC 1JWMA 3TH2T 2YGQA 4LK4A 1ZMYA 3KPRA 1H8NA 3PGDA 1AD0A 1OQ1A 3NAPB 5AWNL 2X40A 2WYZA 4WEBL 4X98B 2NQYA 3PUAA 5J6GB 2Q1MA 3UTTA 2G0KA 1EA9C 5JSRA 3SIKA 3VXMD 4Y2DC 3ZKUA 4IBTA 1MFEH 3O1MA 1AAJA 3EDFA 1S0JA 4HKLA 1YY8B 5LGHH 1XU2A 5EU6A 1PVXA 3EKCA 1BREA 5CEZL 1NGZB 5IJVA 4L2LA 1XMEB 5GRVL 2P6CA 3LQZA 4HOZA 3PU7A 1H9PA 1WWAX 3OBZA 3CX2A 4HPKB 4J3OD 1KDJA 1J48A 2VT0A 3BVWA 1CMOA 4LBLA 3GWJA 4P2OC 1P69B 3SDCD 4PCSA 5KWRA 3WGUB 3L3OA 2I60L 1B0RB 1LKNA 1QSFB 3VKMA 1WITA 5HHMB 2F17A 3EXJA 4HPKA 5E6IC 4ELMF 2VE1A 3IT8A 2Z64C 3BPNB 3II3A 2WWOA 1ZLDA 3OYWB 2QNKA 3RZHA 1I82A 2YRLA 3DARA 4G8GE 4NENA 4A67A 1AC0A 4LFHG 3CJIB 3VXUA 4W6WA 3D4ZA 5DUMH 5FO8A 3RQ3A 4ZFOA 5EIVA 4F91B 3MI6A 2BINA 2W91A 1D2QA 4B9ZA 2H2PC 2OM5A 3L4ZA 2VDLH 3FSAA 4NZTH 1H4HA 5EORL 4H3WA 2DEWX 2E32A 3HHMA 4OULA 3ZM8A 1VENA 5GGTH 4RFOL 1MWOA 4P9MH 3T08A 2EH8L 1A1MB 2ZGTA 4BKLA 3GZTB 5IVJA 1UXLA 2IADB 2XGXA 2QQKL 4HBNA 1TPXC 4HF5L 4BINA 5F71A 4FPCA 2AABL 3MLSH 5FY8A 5EPMA 4MA8L 1T1WB 1FH5H 2WQ4A 1N0LB 4WEBH 3BO8B 1YEKH 2HWF2 1I1FB 4FTVE 5JXED 3LQAH 4Q29A 4W9FC 3MACH 4XMXA 1AGBB 3WHUA 3ZFFA 5I1IL 4D3CH 5FB8A 4HA1A 2EDRA 2CM6A 2QZ5A 3RU8L 4P9XA 1NFDF 2QKIA 1BVLA 4P04A 3NJZA 1CQKA 4INDA 2WZPA 3M17A 3QHZL 1FMD3 2A6WA 4YK4C 3NJMA 1RUD1 4F37K 5ISZD 4MB1A 4FI9A 1RZGA 4A3XA 4GSUA 3T3PF 1AR2A 3BH8B 4M48L 4WM8B 5E16A 3AB0B 1TO4A 2IF7A 3JZ7A 5BCAA 4FBFA 1XQNA 1B35A 2VKXA 2NCEA 1TMF1 2XDHA 1JGEB 3ETTA 4L8CA 1OO2A 1GFF2 5HYJE 4DKTA 4TN7A 4AEDC 4O4YL 1XXDC 2DQFA 3H3PH 2PW1B 2W60A 3CVIH 3EBIA 1JTTA 5FUZL 4JG0L 3WY6A 1Z5HA 3L7FB 4QPIB 4GMP0 4PJXA 1ENXA 1HS6A 3TBBA 1J1XH 1MCJA 4PLKD 4XF0A 1XGQA 1FUNA 1NOVA 1YYCA 4MA1C 3EFOB 1MW0A 5C97A 1MR5A 2DDQL 1UJ3A 2CKBL 4UIKL 1RHI3 5FY9A 3HNSL 3CVHB 4HUVB 1E5CA 4OGZA 2FUTA 2Q0ZX 3HE6D 4PQXA 2VXVL 4ZX4A 4DKEH 4UFKA 1WO2A 3ILDA 4ES9A 5BS0D 1ZDQA 1S0EA 4YG6A 3AACA 3FU5A 4YARA 2XPJA 3THML 3NUKA 1RUH2 3EYFB 3NL1A 4KK9D 2BNOA 3ZN5A 3P4MA 3UGXA 1KBGH 5C0JA 3HE6A 4KUZL 3ULVF 4X6CB 1W8FA 1XT5A 2CYFA 2XJQA 2VLJD 3QEQE 1A3KA 1YRKA 3S37X 2G9HA 3BAYA 3N9PA 3C6SB 3D0LA 1WCQA 3UP6A 2YY1A 3H7YA 3CN3A 1DIWA 4KK5D 4QHMA 2VDPB 1RH8A 5FS5A 2WA3A 5JZGB 3CXHJ 3E1ZA 3UGEA 3K8KA 4G6JH 1HDKA 3BSZH 3QYMA 4ISQA 1AKJA 5BNNB 3NCYP 4XCAA 1INEL 3ETBJ 4A7ZA 3PE9A 4LCVA 4XC1H 5F1KC 4O9EA 3VGAC 3PLQA 2C8NA 2CDEA 1S7TA 4JRYD 3S2CA 3LEIA 1TQTA 3RWHA 3VFTB 5K1VA 2BDNL 2C9SA 4FFZL 4K9SA 5JR2A 2XWZA 5L2KB 1H4GA 1JZ6A 2PTTA 4EO5A 5DYOA 4CCNA 1JGVH 1KGYA 1G9MH 5CEXB 3MVSA 4KK8D 4PRNA 4JDEB 4QDGA 3ROLA 3L9JT 4M3CA 1REEA 2WT2A 5HGBA 5C0CB 5DQ0A 1A6VL 3LDRA 3ZSLA 1D7BA 2A7BA 3O6FD 3GSWA 3RVXD 1QF3A 3FHQA 2XWJB 4UT9A 4PV9A 3BP5B 3GK8L 3AZXA 3V5DA 4N9GB 2UY7B 2IPKA 3EOAA 4UT6L 4JR9H 4X99B 3TA3C 5LA9A 5CVRA 4N9OB 4QHOA 5F1IB 3S96A 4DXRA 1EFQA 4OVVA 3ZE0B 4TXWA 4TUUA 4FTBA 1J0YA 5I17A 4PS3A 4XMAA 1YEJH 2RJMA 3BUIA 3AZUA 5CG8A 3SDAD 4FTEA 4ZOAA 1JNNL 3BE1H 3IFOB 5T5JA 1I8UA 2F5BH 1FJ1B 4LHJB 1Q0XH 1PX8A 2HZHA 3I9AA 3Q9PA 4NJAL 4OQTA 3RTLA 5A7BA 3KVBA 3VXMA 4F7EB 2DV9A 4L4VB 2BK8A 1G4RA 2F74B 3CBKB 2HTLD 1UA7A 3FSWA 1JFQL 4ZUTB 1DHKA 5B8CC 1QJX1 2VGLM 3VFUB 1SLTA 4Y5SA 1EFXB 5CIPA 3RIKA 4LOSA 1CT8A 5ISLA 3NFSL 4W4OC 4FQLL 4X8JA 2I85A 4BHUA 3AXEA 5M7QA 1CDUA 4B9CA 5JOXA 1GP5A 5GRUH 1HL4A 2YAEA 4J6RH 2LVCA 1F6AB 3GI9H 3UFIA 5L4JA 3O1TA 4FQLH 5C5TA 5EUKB 3DV6A 1S5HA 5E4EC 5J12B 2MH4A 1EXHA 3NWKA 4B5EA 1V9U2 5C07E 2CHXA 2FYYA 2Z42A 3I4IA 4Q4EA 1YYLH 1KLFB