2W95A

Structure of the discoidin i from dictyostelium discoideum in complex with galnac at 1.75 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
254
structure length
254
Chain Sequence
b'AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN-1 SUBUNIT A
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
total genus 61
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w95A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w95A01
3NJXA 3CDZB 1CIYA 1MPXA 2C4XA 5G05L 1T2XA 2CE6A 4LKSA 3WEZA 3ETPA 2YG0A 1J83A 5B4NA 3C8XA 3T08A 5F7UA 5IFPA 2VO5A 2W92A 2Y6GA 1UZ0A 4AAXA 2ORXA 2XQXA 3CMGA 1DLCA 4CU9A 3I2KA 4KWUA 2JE8A 1DP0A 2W95A 3T2QA 4LQRA 3J7HA 4PF1A 1F4AA 4CU6A 2W87A 4P5YA 4QB6A 3OBAA 1LNSA 2YB7A 3UNPA 4ARXA 5FUIA 2VL4A 3WF3A 3LQCA 4A44A 2EICA 2JKXA 1EUTA 3P6BA 2J1SA 3CZJA 2RV9A 4CUCA 3NQHA 1W8OA 2W3JA 1JZ5A 3WMQA 1PMJX 4UAPA 4DEVA 4OMDA 2WBKA 1UY1A 4RN5A 3SEPA 4CU7A 4AG4A 3U37A 3C7FA 3MBWA 5C70A 3EYPA 2J22A 1UY4A 2B9VA 2VMCA 3K46A 3VDCA 3LEIA 3VD9A 3D3AA 2VMDA 4DUXA 2LW8A 3A7QA 3HN3A 3DYPA 1CZVA 5JMOA 2V72A 2ID4A 2HLEA 3WNKA 2W1UA 2Y6HA 1W0NA 2DCKA 3DYMA 3ZM8A 1US3A 1H6YA 3GM8A 4IUGA 2VC9A 2QQKA 4KI5M 3VD5A 1H6XA 1UY3A 3CQOA 2W94A 4XURA 1F4HA 3A23A 2R7EB 3OEBA 2CCVA 2VTFA 1OF4A 3FL7A 3DECA 4JX0A 2WAOA 1JU4A 3IAQA 3ACIA 4W50A 4RYDA 3WQBA 5JXHA 1JHJA 3MUZ1 4BXSV 3T0DA 1EUUA 3LEGA 4QDQA 1WKYA 2W1WA 1R64A 1UXXX 5DQ0A 2KD7A 3IDAA 5CYYA 4DUWA 2WAAA 4BJ0A 3K4AA 2VCBA 5J1XA 5G04L 1JZ7A 2VZVA 5C71A 2C26A 4QAWA 1SG3A 4DXSA 1O59A 1KEXA 3NNGA 1GOFA 3T0AA 1NAEA 4JKMA 4QPWA 1IQDC 4ZZ5A 1ULOA 2Z4FA 2VOTA 2X09A 3WSOA 4ARYA 1UMIA 2E33A 5DPNA 2XONA 3WNNA 4A45A 3GGLA 2YFUA 2W1SA 3VD4A 2EIDA 3HJRA 2VZOA 3LPGA 2YC2A 5A1AA 2VZQA 5JXIA 2C9KA 5C7GA 3W5NA 3HEIA 2Y8KA 3WNOA 1O8SA 5LA1A 1W9WA 4W4ZA 1YQ2A 3P1IA 1KGYA 3EB7A 2ORZA 4XUTA 4BK5A 2J1VA 3K75B 4D0QA 4P08A 4ZY9A 2L9LA 5CZKA 1L7QA 1DYOA 3THDA 2WDBA 2LS6A 1GOHA 2BZDA 2VQUA 2QQOA 4MGSA 2DCJA 3PUHA 4YPJA 1UXZA 3OEAA 2CDPA 5EIYB 1W9TA 4MADA 3C7EA 3VDBA 3CIHA 2V4VA 2X05A 4CUBA 2CDOA 1D7PM 3CKHA 4CU8A 1TVGA 3ABZA 3MV11 3K77A 4BDVB 3VD7A 3K4ZA 2J1AA 3ACGA 1W99A 3VDAA 3BGAA 4Q56A 1NUKA 2BERA 3FN9A 4XUQA 3A22A 2E26A 4FI9A 3C7HA 4TXWA 2W1QA 5DN2A 3MV01 1OT5A 2VZRA 2VMFA 4CVUA 5I0DA 1JZ6A 2X10A 5EJ1B 5JUVA 4W8JA 3CZUA 1JYXA 2VM9A 2JDAA 3FHAA 1BHGA 5HPOA 1JYVA 2ZEXA 2E32A 3I2HA 5B4XA 1W9SA 2WQ8A 3I2JA 1XNAA 3T2PA 1GQPA 3OB8A 4XVHA 3T0BA 1PX3A 3AC0A 3I3DA 2QQJA 2W47A 1GOGA 5EJZB 3HOBA 5HXMA 1GMMA 1K42A 4QX1A 2VZSA 2BBAA 2B4KA 2XOMA 4DXTA 1WCQA 2V5DA 1UX7A 3WF1A 1K3IA 2HYXA 4QDRA 1JYWA 1OH4A 3GDBA 3UETA 2WABA 1CZSA 1US2A 4PT6A 2J1TA 2RVAA 2RJ2A 3ACHA 2EIEA 2QQMA 3HNBM 2VZ1A 1GUIA 1SDDB 5JR2A 4DEQA 3C7OA 2QBXA 1HN1A 3WNLA 1JZ4A 1UY0A 2QQNA 3OGRA 4DXRA 3T2OA 2VZPA 3IIIA 1JZ2A 4DUVA 3HNMA 2VZUA 2Y6KA 3HNYM 3I2FA 5JXGA 2WYSA 3I2IA 1JI6A 1RYYA 3IAPA 3WF2A 3WF0A 1NX9A 1K45A 4BK4A 2W9XA 3LE0A 3THCA 1JZ8A 2VR4A 1UYXA 3UESA 4TTGA 1P8JA 4QX0A 1I5PA 2W46A 2YFZA 3VD3A 4MGQA 2WO3A 4M4RA 4CUAA 3DYOA 4QX2A 2YC4A 3K4DA 2WUHA 2Y64A 2XHNA 3GXUA 4ET7A 2J1EA 2WN3A 1UYYA 2ZEZA 2CGZA 3I3BA 2WZ8A 5JXJA 2Y6LA 3OGVA 2VCAA 5LCWL 1J84A 3PUIA 4GWJA 2CGYA 3FHQA 1O8PA 3C7GA 4Z2AA 2VJXA 4QB1A 4E8CA 3W5MA 1GNYA 2J1UA 5IYYA 1PX4A 3WF4A 2QQIA 4LHSA 3JXSA 4GWIA 4P00B 1ULPA 4QDSA 3I2GA 1UY2A 1XPWA 2WZEA 4UOJA 3SKVA 1K12A 4UI9L 4XZUG 4M4PA 3WNMA 4MO3M 2ZEYA 4A4AA 4LPLA 3IB3A 1JU3A 3SEEA 3MUY1 2J1RA 4A41A 1CX1A 1UMHA 3ECQA 2VQTA 2W91A 4GZ9A 4A6OA 4P02B 1GU3A 2ZEWA 3T09A 4A3ZA 4HG6B 4OMCA 3F2ZA 3NRUA 1OF3A 4XUPA 3SKJE 2J7MA 1NKGA 1PMHX 5IHRA 3HPNA 1JYNA 4JHZA 2VZ3A 1TG7A 2ZXQA 3I97A 3MO4A 3OG2A 2WN2A 2VZTA 4QX3A 4ZXEA 5IFTA 3WMPA 2PQSA 4MOAA 4XUNA 2WO2A 2BGPA 1OD3A 3NJVA 4E8DA 5LA2A 5DMYA 3BN6A 2WO1A 4OUEA 4JKKA 2Y6JA 1UYZA 3WNPA 3LPFA 4XUOA 1W8NA 1L7RA 4D8MA 5LA0A 1XC6A 4OYUA 4JKLA 4PQQA 1CZTA 2E31A 2W5FA 3OGSA 2EIBA 2QQLA 4L0PA 2OKXA 1XNTA 2VCCA 2DDUA 1JZ3A 2VMEA 4KMQA 4A42A 4ZZ8A 3LEKA 2BGOA 3I3EA 3A21A 3E1F1 4OZOA 3ACFA 2JD9A 1SHWB 4QB2A 5IJRA 1UWWA
chains in the Genus database with same CATH superfamily
4LFHG 1A6AA 1A7OL 5HCAA 2COQA 4Z3TA 1TNFA 4XMTA 4PQ9A 4S10A 5CEHA 4WO4D 4BMBA 4JL1A 1ZRUA 1CAUA 3CZKA 2EVIA 1CE6A 2EEDA 3LEVH 3HFML 4B5ZA 4XCYA 1S5HA 4NRZB 2UY8A 1WTLA 3UPAA 4HK8A 15C8H 4JZNA 3ZXJA 4MJ2A 3S0MA 1X44A 3SCMA 3V6OE 2WLPA 1KJ2L 5HHXL 4KKBD 1Q0XL 3B5HA 2LTQC 3PYCA 4HJEA 5C09A 1DVTA 5EEYA 2OK0L 2MPFA 1HEZA 3IU4H 2CDEA 3MGOA 4ZFFA 4P57A 3HCVB 2ZGTA 2XUMA 4K23H 4QWNA 3U0PB 1RMU2 4LBJA 3SJVE 3ETQA 4P07A 4P5TC 3MRFA 3NCFB 4RMSA 4NHXA 2PAEA 4NO3A 4X9HA 4XOCA 1JXNA 5F5CA 2ET7A 1Q1PA 3QJUB 4FDWA 2R83A 1C4RA 4RGNC 1BOGB 5D4HA 3IJHB 4G6ML 4XP5H 1CFQB 5IK7A 5IM7B 3ARSA 5H35A 4DN4L 1QEWA 2BSED 2GZWA 2HT4C 1KB9K 3VFNA 1CZ8L 4XE9A 3QRGH 3SQBA 3BPCB 2VXTL 1W8OA 1MIML 5D1ZI 5AWNL 5I8KH 4JFYA 4RGAA 4FLSA 5IP4A 4PYGA 1RP8A 5ESAA 3F7YB 3PE9A 4UDUB 5BUGA 3E5XA 3P5BA 1RZFH 2CGRL 4NGHH 3DIVA 4L1BA 1XGTA 1WITA 2IXKA 5K9JH 1OOWA 5ID1A 1QTSA 5K9OB 1QYGL 4NQCA 3EYPA 3PJSB 1RHI1 5JI9A 5E0FA 4YSSA 2IGFH 1U8LB 4GUQA 4AMKL 3VNYA 3B94A 1MFEH 3TOJA 2IQAA 3WXPA 1CL7L 4NQSB 5I93A 4XVTH 2WXHA 4ELMB 4UV4L 2VR6A 1R5VB 2ARJB 4G1MA 4X6DA 1BMGA 2HRPL 2ETEA 2IPKB 2BQPA 3BI3A 3QS3A 1AXSA 4FQCL 2ZUXA 5CJ5A 4N85A 2ID4A 4KMTH 2XJPA 3BU7A 2NPLX 4KKPA 4WHTB 1YO8A 2XQYA 3TLRA 1OVSA 5J1SC 4YXKL 4F7TA 2BVYA 2EIJB 3OLEA 2ATFA 3SXWA 3Q5TA 4I3SL 5GRVK 1WO2A 4AG4H 2E7QA 1SACA 4K7PH 4A7SA 4HKOA 2OA9A 1VJ2A 4ODSL 3CFEB 2YPLE 2W9EL 2YFNA 3DNKA 4OGAD 4UQBA 5GXBB 4XI5C 3JWOL 1YYNA 5JXHA 1BGXL 1H15B 1SLAA 3FO1A 4O02H 2IPTH 3L4UA 3PHQB 1UJ3B 5L0QB 1WKYA 2GSIA 4PRPB 5GIRA 2KD7A 3MOQA 3QHZH 5FZFA 2LABA 2R39A 3APFA 5CIPA 3FONB 4TKWA 2HJLA 2WAAA 3O6FB 1RC6A 5F88A 3T0EE 1FLRH 5B7EA 3FYIB 3L2LA 1KLUA 1TVHA 4OCWH 4RA0C 3ZHLA 4GXUN 2RM22 3WLUA 1K4CA 4QAWA 3FF7A 1QQP1 1G6RB 4GRLD 3VFRA 4DZ8A 4PS7A 2Y6SD 5D5ME 1WUVA 1N5AB 2BNOA 3MBWB 2P3YA 2QDRA 4Q4W2 4C56B 1T80A 2HWZH 2QSTA 1Q9KA 3SB3A 3HMWH 2VXSL 4LSQL 4Y4FB 4TLUA 4DJMA 5JZ7C 3EJZD 4GG6F 1FWXA 4JFWA 2DVGA 3F6LA 3WMSA 2WBWB 3R1GL 3MRDB 4RMTA 1KY7A 1RIHH 3G6AB 3L7FA 2ATPB 2WWKT 3KXFD 3N50A 4KKNA 1DJWA 4HPHA 3FK3A 2KUTA 1YFUA 1RINA 5TQ0H 3VSVA 4A45A 3RYRA 2F7PA 4LPWA 1DO6A 4FMKA 1BD2A 5L9VA 3UZEC 5L88H 1KFXL 2A6DB 1ZOXA 2AABH 5HI3D 1W6WA 3UZEA 2FJGA 2BRQA 1IFHH 2Q8BL 3Q5OA 2FNBA 4P99A 4U0RB 5DMIH 3BVNB 5KSVB 3VXUB 5LWBA 3GJFB 2C5DC 1OIOA 1DANT 2C5DA 3KL0A 2RS52 3BUIA 2ODIA 3QNFA 2OV0A 4YGVA 3N9PA 2PLTA 4A68A 1DF0A 3CMOL 5IK3A 3EJRA 3OC8A 3V0WL 4DP0X 3GZOA 1X3DA 4HHGA 1BXVA 1QJFA 2OJEB 5IHZB 4FQXC 1COV1 1CGWA 4FQXA 2LS6A 3O2WL 5BZWA 4Z7UF 3JCIA 5K9QG 5E88A 3RYPA 3D39A 4UQ3B 4NJAH 3POIA 1DLLA 2VQUA 4JK0D 1NZCA 2JQAA 4PY7A 1ULGA 4MGSA 1J1XH 3FB5B 4L37A 4HUWA 1JDCA 4HUUB 1DN0A 3O41A 5HDOA 2RG4A 4N8UA 4NNXB 3SCMD 4LVHB 1DLFH 3OEAA 3CNKA 5F5IA 3Q01A 1T1XB 3VM7A 1KIRB 3EUDA 1L9PA 2BLFA 1JK9A 1T3FB 2X9ZA 1D7PM 4HPKA 4DNYA 4A6YH 4OLZL 1TVGA 3KBPA 1W2AX 4L4VD 3ABZA 3RUGB 3VX0A 5CINL 3MO1A 4A7UA 1E5UI 3FB6A 3LOBA 5KAQG 1ASJ1 2JKJA 3OTTA 5SWSB 2ZNWA 1P7QB 2AZUA 1QMJA 1LGVA 2G75B 2WC7A 1JZJA 3NGBC 3QBTB 4Q56A 4ETQA 1NUKA 2MEJB 4I5BA 5KZCD 3PHSA 3QUYC 4JY6A 4PU2A 4XCFH 5FYKD 1OW0C 5E4AA 3FRUA 3RS6A 2XV2A 1CTNA 4CEYC 1OW0A 2XG3A 3H7JA 4X4XB 4CEYA 1NPNA 2AXWA 2BHYA 1ZT4B 5KSAD 3LIZA 4XPFL 5DN2A 1CG9B 1OMIA 3LEMA 2HT4D 2FWOB 1IILE 2UYAA 3RWIA 2BFVH 3I85A 1AY1L 4XQDA 2VN6A 3E6CC 3FRPB 4NPJA 3K7UA 2RE9A 5JUVA 1CD1A 3QDAA 3UZQA 2MHFA 2V5TA 4H14A 5IVXA 1LK2B 3T2NH 5DEFA 2WQ4A 1F5JA 2BP5M 4OQTH 4HV8B 3PTRB 5GRYA 4P46B 2VDOL 5E5LA 3L08A 2XWCA 1A4BA 5FOBA 3HR5A 5FYKH 3UPCA 3K8LA 4L9DA 4ICXA 1ZHBB 1QW9A 1A6WH 1MJ8L 4MXVE 2CWMA 3QWQB 3M17B 4UT6A 3TBDA 2V5RA 3M45A 3HNTL 3BZ4B 3TA4D 4AUYA 1B6UA 4PJEE 1P1ZB 4HBNA 1JTOA 5CU1A 3UJJH 4JPIA 4I1RA 3E5UA 4CN4A 1R33A 1JDAA 1MWOA 2YV8A 2PR9A 1GMMA 3DUUA 4FPLA 4FOYA 4M7JH 3LPOA 2FZ3B 1C5IA 1ZM1A 3NFNA 4AGMA 3MZHA 3QP3A 1NANH 5IG7A 5KVDH 1LJ7A 3N41F 4Y5VC 2FSEA 1TIUA 1VIWA 2GPZA 4Y5VA 2UZXA 4P04A 1KXGA 1MS4A 1ADQA 1IZKA 1CF8L 3CNAA 1T4WA 5TK4A 1LD9B 4QDGA 2Y2WA 5I66A 3I6KB 1KXTA 1MXGA 1NGXB 5JR1L 5IHWA 3Q8FA 2ZP0T 4XI5D 3AG2B 3K6IA 3BB6A 4NAQA 2IWGB 3LD8B 1T5XA 4AV0A 3LZNA 3BD4A 5HGAA 1JOJA 3JVGC 5MI0B 1N6UA 4X7EC 3KEDA 3VYOA 2GNBA 1Y07A 2HWC3 4QHKJ 4YDJA 5E9DD 2LUWA 1NC4B 5A32A 1J9TA 2YU2A 3PJLA 1JN6B 1WS7A 3P4OA 5CBEB 4YVSB 4DEQA 3I2OA 1TLMA 4DESA 1ETZA 1JJUA 2EYSB 4W9ZA 5HDQH 5JHLL 1QJY2 4ZHNA 1NBZB 4OV6F 1PK6B 4XXCA 1F4WL 4PPTA 3UYOD 3WEXB 3HT2A 1RUH1 3T2OA 5H9SA 4BQCA 3BAIA 3GS7A 4X98A 1ZRCA 1NEPA 1RZ8B 3G6JF 4RMUA 1JZ2A 1F58H 2ZWNA 2BSDA 2YA2A 1RURH 4XO9A 3D8CA 3I2FA 3H9SE 3MA9H 3PJNA 4K8RC 5F7MC 2WYSA 1DUZB 1FH2A 3WDYA 1RUI1 5J9PB 3AT9A 3RWJA 4EUPH 1CD9B 4Y33A 4K6BA 1UJTA 2WZPD 2W9XA 4QXHA 2EXKA 1IKPA 3QWOA 3OWEA 4JFZL 3OYWB 2A0LC 4OFDA 2W07B 3E6FA 1FV3A 3SYPA 3O8XB 5FGCB 4QRUB 1HCYA 4JFEB 2CZNA 2VR9A 4YHYC 1L3NA 1QLRB 2FHBA 5J12C 2X9WA 3K4DA 2ZXEB 4FRWA 1NM9A 1F6FB 3C6LB 4NZJA 4UYPA 5FPVA 2HX8A 4FGMA 4GRMB 5INCB 4YVUA 1MI5D 1M7UA 4GKZB 4BEIA 2Q87A 3BOPA 4X8NA 3T4AC 3KPPA 2V09A 3X12B 2ZUQB 4B96A 2CLVB 4YL9A 1F4XL 3ECBB 2BZCA 1E42A 3OJDB 4QRFA 3U79A 2QJDA 2JKSA 3BZ5A 5JIQA 1RUC3 4LKEA 3TRSB 4DS0A 3MRNA 1G9BA 1MN4A 2WNUB 1OP5K 5LCWL 2ZX6A 1OQOA 4IEXA 4EVNA 1E4HA 4LCWE 4ZW5A 1NLBH 3SJVA 4EDWH 3ZR5A 1PZUB 3O0XA 2R071 4FG6C 3QBQA 1DL7H 4FXKB 5C0AE 2QKIC 3OJVC 4NR1A 4UFHA 4X80L 3ROLA 2QKIA 3SE6A 1T1ZB 4YMPA 4BH9A 1P2CA 2QHRH 3X17A 5HV4A 5C3SA 3U2JA 3CWGA 3OZ9H 3EOTH 5FGBC 4YSDA 4D69A 4TLTA 2AQNA 5FGBA 4AL8H 5CMAB 2NXZB 3DJSA 3N35A 1KIUA 5BNPB 1FPTL 3UTSE 2PETA 5BVJA 1W72A 3G04B 4JVWA 4PJYA 3BIEA 4OUMA 3ECVA 3DUIA 3CN0A 3DSNB 4HVBA 4QX7A 3CHRA 5CKMA 2K1MA 1GYUA 4A4AA 5A7OA 4I0PD 3MNWB 2HMID 1G84A 2XA8L 3V0VA 1F18A 4HT1T 5I1LB 3OAZK 1F97A 3HB3D 4YUEL 1NCBL 3UL2A 4JM2B 3M1BB 3EBGA 2CRIA 4EN3C 1N8ZB 3IGFA 4EN3A 1KTDB 3UGFA 4JRFA 2ED9A 4ZX6A 3D18A 2BWDA 3MRRA 4NDMA 1SBFA 2W39A 3MJWA 2Y33A 4B4RA 4YWGH 2E6JA 1JBJA 1UD1A 1IVTA 2EUXA 2GMPA 4OF0A 3U4BL 1EV11 3UC0L 5KBMA 4BINA 5FIEA 3AKPA 3FLPA 4MHUA 5DAQA 3OSDA 4LOSA 5IVOA 3SQOH 5KBFA 4X8JB 2D3JA 4G43B 3DURB 3SHSA 5B38G 2VRQA 2Q76B 2VR8A 4U3XA 3ZKQD 1UXWB 5HVFB 3H42L 2O5XL 3VFMA 3PWJB 4J8RA 4A66A 2DMBA 1UN1A 4NQXA 2VL5B 3TV3L 3V6BR 2J5WA 1JGDA 4HIXH 3WCRA 2YPLA 3EYUH 5FJKA 4OSUL 2O93L 2PQSA 1KBGH 4HF5H 5GLZA 4K3GA 3BPOC 4O2CA 1QUNB 5FP3A 4I30A 3L5IA 4CCNA 4Q6YA 1OD3A 4DEWA 2GAUA 1XU2A 5LA9A 4FJYA 2KQNA 4UOQA 3BN6A 2XFGB 4QXVA 3EYOB 4NO0A 1UOFA 3OXSB 3ZUNC 4QOKB 1I8AA 3O45B 3T0EC 1AHSA 3MLTA 3CPLA 3VMNA 4IGQA 3T0EA 1LXMA 4D8MA 2KR2A 1TME2 3TGXA 3KPMB 1G1KA 3BT0A 5HY9B 5AC92 1O4ZA 3OD0A 2K6WA 4BZ1H 2P8PB 5GGTL 1XF2B 2OM5A 4IE0A 4L0PA 4OF5A 5D5MA 2DQMA 2NMSA 4JFHD 4X7FC 3AYCA 3L4YA 4X5WB 4HCGA 4LIQL 3LEKA 1FCGA 1YUKB 2QQNL 1FBIH 3RWCB 4OZFH 5I15H 3I02A 4LSRH 4J1WA 1A7QL 3A21A 3CGTA 4HKJA 3WN5C 1SFDA 1CDIA 4Z95H 3PXLA 2XXFA 3NJXA 3N44F 3WN5A 2Y24A 2PR4L 1I8LC 3NJJA 3VE0B 2WNVC 1TQBB 3NRQA 2ZMNA 1LQSR 2B5IB 1I8LA 3DGCR 3LN4A 4MNGE 3TPUA 2WNVA 5JDSB 1AGDA 3SD5A 3QIUC 2OMVA 1OGAB 4WWNA 1G9NC 2CBMA 2QPDB 3QIUA 3RY6C 3C8XA 1BYHA 3RY6A 3IMMA 1VKXB 5A43C 3DCQA 2JCCB 5E95B 4NUMA 4MA7H 3FT4A 1ODNA 4JANA 1TZAA 3L9RB 5KOMC 2CJSA 4NP4L 4B60A 3NZSA 4Z23A 1MNUL 1C08B 4LP8A 4QQPA 2R30A 3BU0A 2J1XA 2YR3A 4ZUVB 3NCJH 4DZGA 3VXSB 2Q3ZA 1LNSA 3V0BB 1TQTA 4HPYL 4AMXA 2VXQA 2DQ6A 4ANVA 4FXGC 4B9JA 1QHOA 2A38A 3QI9D 4FXGA 3WGVB 1ZV5A 3F7VB 3QAZC 4S1QL 3MV9B 4CAGA 2P1YA 2WKOF 3TBTA 2A6KA 1WGPA 4ZTOH 2CM6A 4HXAL 1OWRM 3KYKH 1QRNE 4LBAA 1S9KC 1U36A 3OMAB 1WMDA 2IGTA 5DJCA 1YG9A 1A02N 5FK9A 1MVEA 1OPOA 2X89D 1CU4L 1JH5A 2X4PA 2EABA 5LO7A 4NUJB 1PMJX 4HUCA 3QZOA 5JQIB 1OSEA 3BIAX 4TQHA 4NO5A 3QQ3A 3FTXA 3S0PA 4YR6B 4NZTL 5T5FL 3VFUA 2IDUA 4TPRH 3GKZA 3HC3L 5IFAL 2RIKA 2DQJL 2OMUB 2OX5B 3SJVD 1Q8PA 1EJOH 4FFZA 2FIRT 3UG4A 4HLZG 1Q38A 3QUXC 3UAFA 3GBLA 3K46A 2B20A 4FG6D 3QUXA 4FQ1H 5E6ZA 4NWUL 1U8HB 3BCWA 1GYCA 5DQJA 2V5SA 2LE9A 2HT2D 2LW8A 1OB0A 1ZPLA 1XGRA 1VBD3 4O58H 3MRBB 3NSXA 2APBA 2Z35A 3KV4A 1NCAL 3U30C 2ZOTA 1QBAA 5CVRA 4HD9A 2WXKA 1E4WL 1TQVA 3OKNA 1PVC2 3VH8B 2DYSB 4JZOA 3FQ1A 4Y1TA 5DD1L 3K71B 4KWKA 3K51A 1DYZA 1HIML 5DDJ1 5HYSB 1ULDA 2YBSA 5FMOL 5IHUH 2VC2B 4F3FB 4PJIB 4P59H 5BQDA 5IMOB 1B09A 1AJKA 3TNQA 5E2VH 5F9TA 4JX0A 2OL3A 1C16A 1U92B 4PCTA 1QOSA 1XF5A 2P1BA 3QJHB 1MREL 5K59E 4P00B 5F1NB 3WO4C 4L3EE 1NZIA 1PG7W 3AWFA 4F7MB 4FFVC 5C3TA 5ETUA 1N4XH 2NXYB 1WP6A 4HGKC 3ZE0E 4MXVA 1S4CA 3NP4A 3V5KA 2G5BB 2PLV1 4YHZL 1HB2A 4X5XA 2F53B 3PP3K 1FIGL 4BFNA 1J0JA 4BIKA 4EN2A 3S88H 4PJEA 3MIBA 1TU2A 4B9IA 4Y1AB 2D0GA 4M02A 4J3VA 3EXUA 3P30L 4UILL 5IY5B 1ULCA 1E3ZA 1DEEB 4F7CB 1OHQA 1SCSA 2C26A 1CD0A 5EZPA 3N43B 1SG3A 1C12A 1MLBB 2ZCKH 1F6AA 3TA3B 5E4EB 1GOFA 5DQ9A 4JQTA 3STBA 3T3ME 1H19A 3PUCA 1TZGL 2WSUA 5LBVA 3GMQA 2P4AB 4LB8A 3W57A 5KBLA 1KMGA 1BBT1 2ED7A 3D05A 4LZKA 4ZTEA 1EPWA 3Q44A 4ORGB 3N6YA 4G70B 1S9YB 4X50A 4JDTH 2DI7A 3MLVL 4FTDA 4X9GA 1PNGA 1XSOA 3X3FH 2Z91A 4IDJH 4LLWA 2J4WL 1WD3A 4WW1B 2NN8A 2AP2A 2BHZA 3BT2H 2O6PA 4NO0D 4PGDB 4ZO9A 5D96B 1NY71 1XSRA 2WW8A 4IEOA 4RGOH 1H6TA 3M6DA 3T0ED 3BGMB 2COVD 5T33H 1QJU3 1CAWB 8PAZA 2APFA 4PLJD 5F3CA 4DKFH 1FZOA 1GQGA 4FP8H 5GRZA 3TNMA 5A3UA 4BQ6A 3QG6A 4I77H 1OARH 2AEOA 2BWCA 5GZOD 1QWUA 1DJHA 1GAFL 5BNNB 3V0EA 4L11A 4P8QA 3JWDH 2EH8H 3EGXB 4OI8A 1XAKA 1MZYA 4JGNA 2EDLA 3WU1A 4LULA 3H9SA 3H3PH 3KBHE 4ORZC 2EDKA 5JA8B 3DXAB 3IVKA 3O3UN 3N4MA 2O5ZH 3SKUD 2PTTA 1SRDA 4M43L 5AB0A 1F90H 1KJRA 4Z76A 2WUBH 1T7WA 1X5KA 4JQIH 1TE1B 3DSFL 5IVVA 5K0UC 3CO2A 5EO1B 4AFDA 2O6FA 5K0UA 5GZND 4H1LG 5F8QC 3OQRA 4KTYA 4Q4V3 4IV1C 3ZDXF 2QQOA 5B7FA 4Y8DC 2DCJA 1UWYA 1WVZA 5PAZA 2PHUA 4IV1A 4KVNL 1Q9LA 4ADJA 1IG3A 2C9QA 4OUUB 5D8JH 1AYM2 5HHNB 2PCFA 4BGLA 2R0ZH 4UDTB 3WO3B 1KY6A 1S7SA 1U8QB 4POZC 4G8AC 2J1KA 3DRQB 1MJ7H 1WFTA 4ZFOA 35C8L 1CFNB 3LIGA 1HXMA 1FVDA 1KEGH 4JHAL 1LO0H 3VD7A 1JMUB 3SPGA 3LRMA 5G5DB 2V2XB 4XCEB 5DD0H 5DHXB 3VI4F 4RFNC 2GVYA 1PY0A 2ZAIA 5KTEH 2ZZQA 2O26U 3UAJC 2WWSA 4XC9A 2VN3A 3UAJA 1HS6A 3ERXA 4M3CE 4I0BA 3N9GH 3QO0B 1SF5A 4QHNB 1FL6B 2BERA 1KCLA 3OXRA 2NW3B 1KPVA 3AY2A 4LCWA 4L23A 4JREB 3RVVD 2YU1A 3V4LA 2F68X 4G8GD 3CSTA 3VRLF 2QVFB 4ZFGL 1URIA 5C0AA 1A0QL 2IAAC 1INQB 5JTWA 1MZEA 3BMVA 5C0BB 2P7TA 5T1DL 4XMKL 4AVIA 3FX3A 3GI8H 3FSZA 4N6RB 3NMEA 1HHGA 3FCSA 1WMXA 5FHBH 5DXWA 2RR11 4B53A 4UBDD 1OCWH 4LNRB 4PG9B 4Q7DA 2WVSA 1JVLA 2ZUUA 3ETSA 4KTEH 4AI7A 1QFUH 4HOOA 3T1MA 2AXFA 4JRXB 5BPPA 4F57L 1A7RH 1FL5A 3GSOB 3EYQD 4OGZA 3UTSA 5IK4A 5J5EA 2FWSA 3V4VH 5FDYA 3TCTA 5MENB 1UZ8B 1RJ7A 2VR7A 4K0OA 5DI8A 4JLRB 5EUOB 1MFCL 2FATH 5DD6A 3BPZA 5FLHA 3GSWA 4WM8B 3WY6A 4S2SA 1KUMA 1RVFH 3D9AL 3ACLA 2P46B 1LDPL 3ZDZE 2I25N 1KJLA 3HVDA 3TCLA 5I8CA 1VRH2 3E6DA 3EO0A 1AOHA 4PRIE 2NSXA 1RJLA 4LSPH 3L7EA 3HAEG 4PJXB 4PUBL 2AVGA 1QQP2 4GB31 1JP5A 3IE9A 4ZW3A 2BO0A 2WUCH 1E4XL 2CJUL 2QQJA 5DFWH 4D8OA 4BELD 2LHAA 3TB0A 5G04L 1EANA 1QRKA 4DGWC 2D6LX 4N2LA 3MLSL 5EEWA 4RS5B 1AG6A 3URFA 5A3MA 2CKBL 3GJBA 2ENYA 2VLLA 3BZFA 1TPXC 4M9OA 5G4MA 1C1LA 3LKQB 3RUGF 1B4JL 1F5FA 1UX7A 4M1DH 4AQEB 4XJWA 5J4MA 1KEML 2F8IA 1ZJBA 5CWSA 4QHUA 3T4HB 4NAJA 3VZKA 4QDRA 2Y72A 1FC1A 1J5OH 4UT5A 2D5HA 5HYFA 3MRMB 2BVOA 1M71B 1WF5A 5DJXB 4QXGL 1AH1A 1NE4A 2WNEA 2OJ1A 1S1AA 2QQMA 1I7RA 3QSKB 3B9KB 1CXLA 3FH5A 4MCYB 2ZJSL 1EZSA 4IRZL 1IPKA 3QNYB 3S5LB 3Q7JA 4P2RB 1M06G 5AOIA 4MZ2A 2HKFL 2AJUH 2HLFC 4O51A 4F92B 1C8M2 3WHXA 5BYNA 3ZSSA 3VXQB 4EZKA 3DRTA 4KH9A 5F71A 2QQWA 5SWQB 4YAQA 1KGYE 1UYPA 5ABJB 4LMFA 2R4RH 2G0KA 3NVCA 3NIGE 1KCBA 1W0PA 2IH3A 2VH5H 4DUVA 5L4IA 2DS4A 1ZLWH 4QNPE 1CLOH 3BVDB 1D6EA 3B9AA 2NY6C 2Y36H 4YFEA 1G7LB 2QFRA 4QTIH 4C0HA 3MRKB 2XR4A 2C9PA 3Q06A 4JFFD 1VFMA 4O65A 4APQA 1AQHA 1OSPH 4U1HB 1UGKA 4K1YA 4G80A 1MFDL 3U4EA 4XB8A 1IC4L 1YECL 5DHVH 5I6XC 2WYTA 1LEIA 3TX4A 1XU1A 2EEXA 2AQPA 3BUTA 1RZKC 3OSKA 4UAOC 5A2CA 5D21A 4GT0A 3VD3A 1U8IA 1G5AA 4MMZC 4MNGA 3N3HA 3UL4A 4MMZA 3SKNA 1IGTA 3C8KA 1E6JH 5LATA 1CYXA 2IAMD 1VBA2 4YARA 4YSCA 4J1XA 1FFPA 4DVRL 2YQ2A 1S0CA 1LO3H 2OSYA 3HZVB 2VE6B 3DMMD 5ISZB 4GUCA 2ZOEB 4LE4A 2WN3A 2FIKB 1N0XH 2QT6A 4FZEL 3LQAH 3WG2A 2HFGH 4XCNB 3X29B 4N2MA 3KV5A 4N8VA 4A2UA 4RMQA 1EFXA 1U2YA 2VLJB 5HDBE 3QDJD 4OJCA 1MNNA 1GA2A 1SN0A 2CDGA 1WIPA 3PUIA 5I76A 1NSNH 2N0MA 5DAVA 3BKML 4TSVA 5DTFB 5CFCC 4RVBA 2DOCA 2XJQA 5HHMD 2GUYA 5CFCA 2Y69B 3IDNA 3TBCA 4AT6B 3D87B 4FQQB 4XNXH 1SMVA 5IYYA 2PPAA 2KLSA 1HWWA 1W0WA 2CK0L 4ACPA 2V73A 5KVEE 1NIAA 4F20A 3KV9A 1XGYL 3VZLA 1CS6A 2F18A 3O3EA 2GC2A 4X6BA 3VD1A 1YC7A 1QRNA 2H2SC 4LPXA 2E6VA 4MAYC 1H1AA 3LNGA 5EIIG 5FYHA 5CA6A 1LOBA 2DM3A 4MAYA 2K9FB 3MRCA 5C8JB 3D2UB 5CEXB 2BYVE 2JG8C 1VFAA 5C0JB 2X7LB 1PFOA 5AW0B 5IFJB 3K72B 5DJAB 2JG8A 2XL7A 4XFBA 5E7BA 3GSRA 1A8MA 3RGBA 4JO3L 1MCRA 5KN5A 2OTUA 4KZCA 4LPLA 2NY3C 3V6FA 1LGNA 3SBPA 1BXAA 3PWUB 3FB7B 3L4WA 5DT1L 5FR3A 4R5XA 2R0FA 5I8OL 4LCWD 5DDHB 1KPUA 4H7LA 3JQWA 2EXTA 1GJUA 1KB3A 1JHNA 3KYOB 3OWRA 2V9TA 3KLKA 4S2DA 4AGQA 4HWZB 3DK0A 3RWEB 5E51A 3H50A 4WEMB 1A6VH 1R6VA 1AXKA 5FP4A 4D7SA 5A3NA 1NCQC 1ZV9A 2V9UA 4TULH 5IT2H 3BPSA 4ISQA 3IJSA 1NCQA 3JYBA 2XWDA 2HWF3 3V7AG 1E5YA 2CDFB 2Y2TA 5DHYB 3W3BA 2CXKA 5HCBA 5LAXB 2YMXH 4JAAA 4W93A 1LO4H 4NKOB 2MPAH 1NUNB 2PHFA 2N7BA 2Z3FA 3EZ8A 2EKJA 2Y5EA 1PNCA 4DO4A 1NKRA 3R0NA 1PCXA 2XWJB 3NRFA 1LE9A 3DX8B 5IHRA 5CSZB 3ELQA 5LG1A 1V27A 2GJZA 2HWB2 1L9TA 2CRYA 5BMFL 3VLBB 2J57A 2J88L 3L95A 3NWKA 5GRVL 1A4KB 3FCBA 4HU2A 5CFDC 1YEJL 5CFDA 3L4TA 3N1MC 4JAMA 4L3EA 3GMNA 1FNEA 5J09A 4M0NA 4HHWA 4ANXA 2YSSB 1YYLH 4KK8D 1OT4A 3TURA 5CLXA 1J9QA 1RUH2 1DDHA 3W82A 2EXWD 1CGTA 1N59B 1ZT1B 1KS5A 5E00B 5I1EH 2OUJA 2QDNA 3FU6A 4OFVA 5LUMA 1BVKA 2GI0A 4D0DB 2LFEA 1JHKL 2WQXA 4XN2A 1U6AH 1XIWD 4WRLA 3TJHC 5FYCA 4KO6A 2IVJA 4JV4A 4IE6A 2XN1A 2ICWI 1MCSA 4AQ1C 4WDIA 4UBGA 2X4SB 4K94C 2ZKNA 4AQ1A 3CC1A 4IRJB 3JD73 3PURA 2XKOA 1JGUL 4PD4K 2D8KA 4R96B 2J73A 4HIIA 5I5IA 3B37A 1B90A 3FUHA 4JM2F 2X28A 4K7FB 2HEWF 3BTZA 3WFHB 4F7PB 1BZWA 1ZZ9A 1LGCA 1NAKL 3KL3A 4I9WE 4WWID 3GF6A 3VJ6A 3ISRA 4ZAKD 4KRPC 3VQMA 4AJYV 5LQBL 2OS7A 3I59B 4HCRH 5C7ZA 3NJNA 2PXYB 1DBML 1AL22 1OC1A 1R9FA 4E2GA 4NNYB 5IT6A 1WIUA 2PHWA 3OHXC 5E6ID 2H7WA 3CFJA 5FKCA 2EUWA 3OHXA 3QIBC 2GIXA 4R2GD 3CJIB 3WDUA 4R5TA 3HMXL 4Y4HC 1J83A 3B1TA 3QIBA 4LVEA 1OHFA 5DYFA 3KHCA 5D7SL 4MD5B 4TQIA 3HE7B 2W92A 3WLWD 3KCPB 2H41A 3WNJA 4Z78A 4AYFA 2PO6C 3INOA 4M6OH 1OAJA 3W2DH 1IAKA 5F1IA 3GJEA 2PO6A 4LHUB 1IAMA 2MFNA 2JTYA 3AABA 3TF7C 2XQXA 1E6OH 3DGGA 4X0NA 1AOZA 4DGVL 1OOPC 3JV4A 5GS2D 1OOPA 2W87A 3VBOB 4P5YA 3I84A 5JW4R 2R2EB 3QFJB 2DEYX 5AVZB 3PWPB 4ZUUA 4APQD 4OHWA 3CL1A 4LASL 2FWUA 5H37G 1BXXA 1MKFA 3FFCE 1VENA 2X4RA 1RIVL 3EKCA 1S0IA 1QBLH 3PAVA 1EHKB 1DZRA 5FTTC 3EYFB 2RS13 2AUYA 3FRPG 1U95A 1HFUA 3GBNH 4P9GA 5DLLA 2JI3A 4GRWH 5J11B 4IEZA 3U4KA 5EG6C 3IJEA 3VI3B 2WINB 1DVYA 1U2HA 3ZT5A 1C8NA 3ZFFB 3B3IA 2W3JA 4QKDA 4TNGA 1ZT7B 3Q6FB 5CJQH 5FX3A 1G7IA 5AZEL 5FB8B 1OK8A 1RLWA 4H4NA 3O3AA 2H3XC 2X5IB 1NGPH 2G60H 4DEVA 5JWPA 3HW7A 3DDFA 1PZ9A 2Q7YA 4CU7A 2PHTA 5ICYB 2YUEA 3WJMB 3WG3A 1EFXD 5BV7C 2P24A 1XQNA 2F9BT 2LW3A 1UKSA 1M4WA 2ZOKB 5I8SA 1WEJL 2VLME 1E9OA 3GIVA 3QDMD 2DLTA 2XQBL 1NUGA 2LRPA 4L4TB 4M3CA 4Z2WA 1JHTA 1WZKA 1SPPA 4PY8I 2W65A 5JMOC 1LVEA 5DSCB 4MB5A 5JMOA 5D1QC 4L8BA 1IL1A 1RUJ2 2VPVA 1QRND 3O12A 1QJX3 5D1QA 5ACMA 1H4HA 4PHXA 4O9HL 3J8F2 2JCCF 2CD0A 2V33A 1P6WA 3FTGB 1RKRA 1A3RH 1ILUA 4M8UA 4X4YB 1PO13 1VBE2 2TEPA 5EU4B 4L1LA 2EDRA 3REVB 4P2YA 3MC0A 4CZSA 2DWEA 4H2CA 1KGUA 3KVPA 3HLKA 4GFXA 1TF4A 1T1WA 1R0AH 2NYYC 1QSFD 2ZKMX 3EFDH 5EBLA 2NYYA 3B2VL 1UWFA 3ZHNA 4E4HA 4XMLL 3MBXL 3IK2A 5BQ7B 3F58H 2AJZA 3IJ8A 3Q2LA 1ODMA 4MJ5A 5D1XD 4RYDA 2BNNA 1G4RA 1IGJA 3RZZA 2DM7A 1YYMH 2CMRL 4WFFE 4XX1G 3OAYH 4AGNA 4YE4H 2JKBA 1ONAA 1H1IA 2R041 3AAZA 1U41A 1TMQA 4FYQA 4HT1L 3RTQD 2W1WA 5DQ0A 4PRIA 5DD5L 3BQUB 2FJSA 4FCHA 3OPZL 2JKLA 2ZUYA 4HHAA 2VDNH 2JE9A 5AUMA 4XVUD 3I75A 2G3MA 4KQ4H 5GRJL 2K4WA 5LCVL 4DO0A 3TXAA 3ZN5A 2P5WE 1NBVL 2DW5A 3AY4C 4Y4KD 1HCVA 3AY4A 2HVJA 4E9XA 1DO5A 3GZQA 1MCBA 3L3JB 1Q0YL 3ES6B 4LJHA 1XL4A 3KJ6H 2G19A 3JTBA 1W8UA 2Z31C 1E8WA 2Y06H 3A6CH 3O3BB 4S1SL 2JDYA 4YM0A 5FP9A 4OFYA 2JQZA 4L3ED 3ZE2F 4GG6E 3W9EA 1D0HA 4QWWD 2MQGA 5EWIL 5DPNA 1LO5A 1RJZB 5IJCC 5GSVB 4LOFA 3X1FA 1EDQA 3Q0HA 2NDFA 1FRGL 1IAII 1ID2A 5DJ6B 1U93A 2CUMA 5IJDC 3LPGA 3BEVB 2VZQA 3DROA 4IS6B 1SEBA 1UIKA 4NHLA 4NN7C 5D71L 1KDMA 2Z69A 2ZKWA 3TJHD 1LHZA 4ONHB 2Y8KA 4UFJA 4PJIF 4GY4A 1GWKA 1YQ2A 4M3HA 1X5GA 3I74A 1KGYA 4BQ5A 1QZNA 2ZSWB 4M6NL 5JW5B 2ORZA 1EX0A 5F2SA 1T22B 4OGYH 1S0GA 4XFHA 3MCLL 3K75B 4PJBB 1HHIB 5DFVD 3IYLW 3FOLA 4CMHB 4M8VA 5E2TL 4UV7H 4XP1L 4KRPD 4FQHB 1F11A 5KS9B 4YFLF 3IDCB 2DEXX 2OCJA 3BH9B 3IFPA 1L9SA 2VC2L 4U05A 2EIZB 3GMPB 2A9AA 3L3KB 1N64H 2NTSP 3QIBD 2UXTA 4ENED 3QZNA 2PQQA 4HIHB 4Z7UE 1UXZA 4TNVK 2WBJB 1X6NA 3N43F 2I74A 4YIQA 1BZEA 4W9IC 5GZEA 4UNUA 3SH5A 3QQ9C 4U1JB 1W9TA 4LAJH 5ACA1 3KAAA 4KXZI 3TZVB 3GSXA 4XPAL 3EQEA 3W39A 1Y1UA 5DR5L 3FQNB 5BRZE 4BKLB 4PG2C 2H1LM 4KROC 1IOAA 1IS3A 2HH0L 2X29A 3I9PA 4PG2A 1M6OB 5C3IA 4KC3B 3FW6A 3QQ4B 3ARDD 5F7DA 1E5HA 2YQBA 4DAGH 4Q9BA 4Q4Y3 4YZFF 1FATA 2Y0OA 1JV5A 1YJDH 4M5YL 4PJAE 4WO4B 3WNIA 2IWKA 3GSNH 3FN9A 1A9EA 4MJIE 4QHLB 5A6XA 1HQWA 3CBKB 3VBRB 3KPNA 4I48B 1INEH 1OUSA 3P77A 4X0KB 3C09C 3SKOA 1AJOA 5DDJ2 1BVVA 1CI3M 1VA9A 4NUPA 4FFYL 4P5MB 2HXAA 4JFDE 3VBHB 2R29A 1Z78A 3GTVA 2PW2A 4KNTA 4EDXA 3FQ4A 3FUJA 4Q2ZB 3ESVF 4LBQA 5A3IC 3U9UB 1HEJC 1RUE3 4MQ7B 3C5SA 3ENRA 2CO6B 3CZUA 4X6EA 1JYXA 4Q9RL 4BRJA 3QYNA 2VM9A 4LLDA 2ES3A 1ZMYA 1BHGA 1PLAA 5BVPL 1FE8H 1SBSH 1JYVA 4A7ZA 2G2RA 5DUMH 4AVHA 1DSYA 1BW8A 1OT2A 4RAUA 4DP9X 2RMU1 4QRRE 4A6SA 1IIIA 3C08L 1YRKA 4PTTA 5DZAA 2XLAA 2NUTB 2QQKL 3LPPA 4LBLA 4B9GA 1R5WA 3G3LA 3IDUA 4PB0L 3HS0C 2JVUA 3PL0A 2C9RA 3HS0A 4ODVL 4PJ8D 4WNQA 1RL1A 4HFSA 3TBVA 1NPUA 4HX1B 2HAZA 4LSVL 3FB8B 4U1LA 2WWMC 5KBPA 3WAJA 1FYHB 1YFXA 3LXUX 3S98A 2W47A 2B9UA 1LWHA 2Q5BA 4YXHL 3SOTA 3S9DB 1WW6A 3LMJH 5C3RA 1ST8A 1MW2A 1II4E 1K9TA 2EDJA 2FT8A 4Y89A 1WWYA 2BS9A 3VWKC 3ZPOA 2EE3A 1BZ7B 3SGDH 3VWKA 4ZNCD 3DX7A 1J88A 4R5VA 3B9IA 1KCRL 4XPHL 1FNSH 4WSGA 2AV7A 2WV3A 4TNFA 3CBRA 5JXEC 5FPIA 1GP6A 2A83B 4HOWA 4M7KL 5FP7A 2CAKA 1DBJH 5JQ6L 2Q5TA 1T20A 3F5WB 4WEBH 4P3WA 4DPBX 4JGYB 3NFPB 5F7EL 4UBHA 2I26N 4JPVL 1CMOA 1ZVNA 4QPGB 4IHOB 5E1GA 2IF7A 2BIPA 3ZTNH 4A7QA 2CGPA 5FJHA 4P3DA 1IGYB 2J1TA 5IB3A 4MNHA 3LNDA 1H6FA 1MEXL 4RIRA 4B41A 2JDZA 2R9HD 4XW3A 3UKVA 4WEEA 3LRSB 3UTPD 1CQYA 1J8RA 3WS3A 4HXBH 4YO0A 2VVDA 3F6IA 3GF8A 5CHNB 2J6EH 4PWIA 1FFTB 5FW6A 3WNLA 3RRQA 2XZQL 3NA4A 4EIUA 5IF0A 5GISL 3PUUA 2F19L 3APNA 1XEUA 3NNJA 4ZDHA 1KF9B 4DB5A 3WXWL 3LZLA 1NFAA 3VXNA 4HW6A 3SZKC 2DQDH 4P9XA 4NERA 2WVVB 3I50L 1FZMB 1MDAA 1GICA 2DQUL 1JIBA 2AJSL 3CZGA 5T50A 3KM2A 4ZG1A 3PWVB 4IEFB 4LLMA 3RL2A 5C2BH 3IAPA 1RK1B 3C5ZC 3S8GB 3G6JE 2ARAA 4GEJA 3WF0A 3C5ZA 4N0CD 4COWA 1DJYA 4WU7A 3CN4A 3DV4B 3QJVB 4YQXH 4HVQA 2AJYH 4FOMA 2E7MA 1MJJA 1SOQA 3P9LA 3S5ZA 1U91B 3T8VA 2ZGOA 5FY8A 4KRNA 1HRV1 2D7TH 2RS32 5E2UL 1I5PA 4XMIA 4OM1H 2R27A 2XQRA 4L9LC 4UTBL 4XBEH 3V4UH 2LU7A 3DVIA 1YFYA 1BV8A 1EBAA 4L9LA 3MA7B 4LBEA 1DVQA 3CF6E 3IKWA 5JR7B 3ZDSA 1AZDA 3A67L 1ASQA 3IS0X 4MV2A 4XTRC 2CPCA 1QASA 5FZOA 5EC1B 1A6UH 4ZONA 1R1A1 1VESA 4DFIA 1NMAH 2J1EA 1ND3C 1MFVA 5ANNA 4HIPA 2AENA 1J1PL 4E4SA 1ND3A 1M42A 3NDZE 1EJ6A 3GSUB 3U36B 3TYJA 1OCZB 2GP5A 2Z6FA 3BISA 5J3HD 5HPMA 2R062 1CDHA 5CJOH 1NLRA 1J84A 4RD7A 1V54B 2BDNH 2B7DT 2Y7QA 4N2EA 2RR12 1IU1A 5C07E 1BM3L 1WPCA 3OR6A 4LRIC 4QB1A 2HG5A 3GRWL 3MUGA 4BCUA 4L3AA 4LRIA 1U5ZA 1AYRA 4L0YA 3FFCA 2R69H 1KTJA 2XKNB 4MLSA 2EYRB 5I19H 1QFWH 1RI8A 3CUPA 3ECUA 5E0QA 1MS8A 3POYA 3CU7A 4KKZA 2WXGA 4C91A 1WZ1H 1CICC 3P9WB 4ONUA 5BNOC 1XXNA 5BNOA 1CICA 1MWAB 2FEJA 1JI1A 4M7ZB 1MCLA 4AQ8C 5J7MA 5BUAA 5IV2B 4JFVA 4AQ8A 3GBMH 1BLNA 1SN2A 3H8OA 1TETL 1GYVA 1XT5A 3DBSA 3GZAA 4MO3M 3I49A 3PWNA 5JOPE 4G8IA 4QO1B 4P2OD 4WVMA 2A6XA 3MIGA 2ENSA 2XXCB 1KPRA 3N85L 4FHBD 3SQRA 3VG0H 3SEEA 3ZXDA 2Z9TA 4AVTA 1A7PL 2J1RA 4LBNA 5DVLA 2L4OA 5K5YA 1LMIA 2IIJA 3WFDL 2V9QA 1RHI3 4FCAA 1CTMA 2OP4H 3NP3A 4GAJH 4GG8A 3PLQA 1VE0A 3ABLB 1HYSC 2AREA 2XNAA 3OQ3B 3O1OA 4LBQD 1HTYA 3AP5A 4JKNA 2A3TA 2KS0A 4LKXB 4CRQA 2E6PA 1GWMA 3R8BB 1RZ7H 4G59C 4L4VB 4W9EC 5ITBH 5I71B 3QULA 4M61B 2ZCHL 1FYTE 1BVNT 2J43A 1V05A 5E6YA 5E99H 4N3TA 4V11A 5C6TL 1KCSH 5L2JB 2E9JA 4NWWA 5KZCB 5HV0A 1JF1B 4OLYH 4M8QA 1UD4A 1HQ4B 2BMKB 5GGQH 1BF2A 4TV3A 5KSAB 3WMPA 3KG5A 2WLHA 1TENA 4BFEA 5C7XL 1FG9C 2ENJA 5ALBL 1DUYA 1PVHA 1PMIA 1DIWA 4B0MB 1AGFA 1QVOA 1UWGH 1XGUA 1A78A 5IQNA 2X4OB 4XNMB 3BEWA 4U1SA 5FKAA 5DJYB 1XE8A 4GJYA 1AGCB 2RQEA 2LALA 1IAOB 1JYTA 3N40P 4PS8A 1IEHA 3O1UA 1HINL 1AO7E 4XUOA 4JGMA 4XVJH 4ZRGA 1IEBA 1V3LA 3FT0A 3H6AA 3NEXA 4JPWH 5K39A 1AUYA 4JKLA 1A1MA 5DUJA 3T8XA 1IO4C 4RWYL 4YX2H 2P5WA 3KGSA 3O2DA 4LSUH 1ZBE1 3L3IA 3UK9A 1YEKL 2DB8A 1UGNA 4MZIA 1GZHC 2LR4A 2O14A 1FNLA 1GZHA 4LCVA 1LHUA 3U1SL 3AJZA 1REFA 2Q3AA 1FV1A 4UXAA 1YUDA 3P3NA 1HHKB 2MEV2 4TWTA 4GG6A 1A5FL 5D1ZD 4AVAA 4TZDA 4Y4YA 1L9MA 1ZJAA 3B83A 1JPSH 3SC7X 3WP3A 1N1TA 1T2XA 2NQCA 4N90E 1GZQB 2CE6A 4Y2NA 4S11A 2J5LB 4AH2B 5B1CA 2Q8OA 1AR1C 1I8MB 2XX0A 1KYOJ 4JO1L 4DT2A 1MQTB 4F1ZA 1BEYH 1DVSA 4U3SB 43C9B 1D9KD 2EVXA 4CCKA 1SOKA 2ATKB 3UX9B 1KSRA 1HSBB 3IT8D 5EFIB 3OKOA 3DJZA 3QUZC 3OKEB 2IWFA 4LLAA 4MAUH 5EOCJ 1PQZA 1I75A 3QUZA 2BUKA 4LITA 3LNEA 1ZS8B 3NW4A 1YQVH 2WLYA 3C5ZD 4S0TD 5EZOH 5B1KA 4B9CA 4QB6A 4ABQA 4XYXA 3VGAC 3GRBA 4EUPB 2BNQE 2HTLD 4I9WD 1YY8A 2WKLA 1PZ5A 2HJLB 5E9DB 5JUEL 3ZT6A 1LULA 4I3PA 4EJRA 2F17A 3GEWB 4KJWD 3JTTA 4M7LH 2DH3A 4LBQB 3HC2A 3HG5A 1JWSA 1COV3 3KNBB 1MY5A 1CQ9A 3HC0A 1IGCL 3EJUA 2RV9A 3ZYJB 5C0RL 2I5YL 1O7DE 3AMLA 2H6CA 1YMME 3RP1A 3WFCH 3I6SA 1N0LB 1U5XA 4XTRD 3JZ7A 4Z7UA 4JQRA 2WY3B 5F89A 1F6LL 3PNWA 4QTHA 3WG7B 5EO0A 3VHOA 4N0YL 5CKGA 1AI1H 3A3YB 3B9VA 4LCUB 3T4YA 1PZ7A 3RZHA 5IGXL 1I4FB 1CWPA 3RWDA 2DDQH 3O11B 5BRZA 1VAHA 2B3IA 2BSRA 2DZEA 2C3VB 2RTTA 1UADC 3A4UA 1QFHA 1BZOA 4N0UB 1XX9C 4MKTA 3UDWC 2FBJH 4DEPC 1ASJ3 1QDOA 4TVPE 2J22A 2VBPA 4NC2B 3UDWA 5B38A 1CURA 1S9WA 4OD1L 4OD2B 4PJAA 4LARH 1DBBH 1DFBL 2ADJA 5C0CD 3O6ML 4MJIA 5CGBA 3NJIA 4UNTA 2CBOA 2ZF8A 5K33A 1K5MC 4ZXBC 4G5ZH 2ADDA 4MA1B 1JCVA 1OPGH 4ZXBA 4JFDA 1P4IH 1MI5B 2ADGA 2DCKA 1HT6A 1L0YA 2GBAA 4W9HC 3N9OA 1OAYH 1XGQB 2ICEC 4JM4H 4NYLA 2WLQA 3GM8A 4WV1C 4JBSA 1WK0A 1OE1A 2ICEA 1YMHB 3VGEA 5BJTA 4WV1A 1NMCB 1JZEA 3BCDA 1HL4A 3RAJH 1J10A 1UO9A 2CCVA 2LVCA 1EVTC 4JEGB 4UQ2B 4AI9A 1U42A 2GT9B 1H30A 2VXTH 2Q3XA 2CAVA 3CH8A 5E4OA 2NY5L 4XNAA 3ZYIA 5GZFA 4QRRA 2VLMD 5HYQB 2IXJA 3ZXGA 5ACZB 4B95C 5DQDL 1F4YL 1KLFB 4OFKA 2DQEL 3S5LG 3VTAA 5LXGL 4FAGA 5K9YA 3QH6A 3ARPA 3MLUH 3SY0B 5LWYH 2XJKA 1X4ZA 3KBFA 3SKJL 2ZBJA 4GQ7A 4YHOH 5IKCA 1N5YL 3ULUF 2DYPA 1J18A 1JFQL 4XWOD 3KW8A 4HPOH 5IJKC 2WMPB 4PJ9B 2Q1FA 4XETA 5IJKA 1ORQA 4OJYA 1QW8A 1N7ML 1NBCA 4LK6A 5CILH 1J0IA 1W6OB 1M1XA 4M93C 4R7NB 1V9U1 2E53A 4NM4H 2F8OA 4I0PB 1AS8A 1JXGA 3IXTA 3T0AA 4IBVA 2M1KA 5FK7A 1UZ6E 2YN3A 1CFVH 3EOAB 3LB6C 5C9AC 4QPWA 5IMMB 3VZJA 5C9AA 4NIDA 4WFHD 5KUMA 3PS6A 1FDLL 2QGCA 4LEOB 3D0VA 4KU8A 2DQTH 2R0WH 3NTCL 4QRPD 1X9UA 4Y7MA 4FOWA 1VBB1 3WSOA 3KYNB 1XBRA 4H40A 2NY2C 1DQ5A 5F9OL 1CWVA 2OR8A 3UZVB 3RFZC 1Q8SA 4AQAA 3DJTA 1I5ZA 3WL9B 3RFZA 2FX8L 3LH2L 2DWXA 3PV6B 4ELME 4F2FA 4Z3EA 1NIEA 3PIQA 1EY2A 2WLIA 2A9NH 4HAKA 4FLRA 4PJFE 4HWEH 2LVEA 1MUJB 1EAPB 3BHBA 4TXVB 2FO4B 2V2TA 4N4YB 4X6CF 4ATTA 2BY0A 2YD9A 4HLTA 2UXVA 1DFXA 1KB5A 5DEGA 5G2NA 2F5AL 4B9KC 1A3LH 4UTAL 4P9LA 3NZUA 3PY9A 5FY1A 3QZMA 5IESH 2HJFB 3PGCA 4BSWA 2P5WD 1T21A 2EAEA 1IGFH 4HUXB 1UACH 4KNCA 3IPEA 5E1AA 4CP0A 3EBIA 4RRPG 1K8DB 1S7UA 1JZHA 2F1BA 5DS1A 4D0QA 3VKLA 3WW2A 5C4WB 2QVIA 4OZFB 5E8DH 3S35L 4ZY9A 4HK0A 4LP4A 3CXDL 4JPIB 3G6JA 3LCPA 3QR2A 4XEZA 1RUI3 3THDA 2VDQL 1IBDA 4IIZA 5D8AC 2VDKL 4JO8A 1GOHA 1IKOP 2VOWA 5D8AA 2FDKA 4PRPE 5D7LD 4RH4A 2XXZA 5SV5A 1GVIA 2Q8AL 3O1TA 3WDIA 1P4LB 5JORA 3DWTA 4PMFA 4O9EA 3PMSA 3W11D 1NAEA 4JFPB 4D9LH 1UURA 3CBNA 3QCVH 4OIIL 5IEKB 4A7YA 5M95B 4JHWL 1E4KC 3F65A 4J6IA 3QCUL 3TBWB 3MV11 1E4KA 1NA1C 3K77A 3LA2A 4FMVA 3V7AE 1NA1A 1TEIA 3V55A 1GTNA 1UUNA 2K3HA 3QNXB 5CN1A 4C56E 3S3JA 3AP6A 1Q9WB 2DTML 2BP8A 2ZXBA 4KK5D 3U11A 5JXAL 2RHEA 1VPOH 5A32B 5FO9A 1KG0A 2VXVH 3LS4H 2FJHA 2I69A 3EJTA 4P4RA 3UAEA 3ZW3A 1I3HA 2JKNA 5A80A 3NJFA 2YXWA 5CADA 1MG2C 4ZMTA 4SBVA 3QQDB 1KCUH 5C07A 1TEYA 1JOBA 2YD5A 2R073 4EZ4A 1A4AA 3QW9A 3FLTA 3MV01 3RWGA 2OMWA 3EMRA 1F1GA 4Y7OC 3HG0A 3UO8B 3WDJA 4P9HL 1XB9A 4RR3B 3L4CA 3N7LA 3GJAA 2K6YA 3TIDB 2A77L 1A6ZB 5ADPL 1AR81 3EH3B 5EJ1B 2GEQA 2P6HA 2DJMA 4D7BA 4GBXD 4PH8A 1VEOA 5KYUA 3VXUE 4LO5B 1XFPA 4AQZA 3HLAA 5B1AB 2YAFA 3H2PA 4KUCD 5BRZD 1SGKA 1KNOA 3L16A 1UM4H 4E5XB 3PMEA 2ZEXA 4UF0A 3KPOB 1X9PA 2BIQA 4FG4A 3QI9B 5DZEA 5CEYA 4ELKA 1JWUB 4J39A 1AQDA 4RDQF 4ZI8A 3LB9A 4ZT1A 1ZLWK 1I3RA 3RZCD 4FSJA 4MRCA 1DJSA 2P80D 1BQHB 4FYTA 3LSOB 4MJID 5I17A 1KZQA 3LIZH 1GV9A 1A4JB 4U1KB 1KBKA 1KFAL 2DWSA 4PWKA 2I7SA 5FZEA 1IM3A 2OMTA 2ZX3A 1OGPA 5B4MC 1A9BB 4ZXBD 3STLA 3SY6A 32C2B 1KFUL 5EU3B 3H54A 4HK3J 1IGIH 2TUNA 4AI0A 2NNCA 5FXWA 1QHQA 5B2GB 2XKPA 1EV13 2W0FA 1X7QB 2TSBA 4JJ5B 4W4NA 4FQJH 2HPTA 4EPSA 2AHIA 3AXLB 2BBAA 4OZXA 2YZ1A 1L4IA 4X8XA 5JO5A 1FNZA 1UA6H 2NQYA 3UIZA 1CDGA 1SY6A 2J1YA 3ILPA 1FYTA 4U1GC 4CSZA 1MAKA 1B3JA 5D93C 5A6ZA 1F2QA 4QRRD 2E3VA 2V2WA 3IM0A 4RZCA 3LEVL 1FO0L 4GKSA 5DRNA 4PRDB 5SWSE 1V00A 1TKWB 15C8L 3GO1H 3K6OA 4MA8H 2PCPA 2PP9A 4UT6H 4WWKB 3LN9A 2RVAA 4AK1A 1SBEA 1R34A 4V2WA 3N0PB 4YHIB 4ZW7A 2EIEA 2XSKA 4HBCH 4RFT0 3IU4L 3PDDA 4HETA 2WT1A 4OKDA 3D34A 2FUQA 3MNZA 3DGTA 5EXOA 2TRHA 5GGTA 1GS6X 1QLFA 4K23L 4AENB 3CSGA 4RSUA 1K6QH 1S5IH 1H9DA 4MDJB 3LXCA 2QQNA 1AO7A 4Z7QB 4R7DA 2CYFA 2ZYIA 3GMRB 3VD0A 3M7OA 3MREB 2WFF2 3IIIA 3WDHA 4XP5L 4XH2A 1Y4WA 4WVVA 1RPQA 4BM8A 1H3GA 4YHLH 3MJGX 3SDDC 3QRGL 3SDDA 1O91A 4PIZA 5HDLA 1T6VN 2NY2D 3AT8A 4NPYB 3NSCA 5I8KL 1BYPA 3OR7B 5IMKA 4A2FA 4TTGA 1L3JA 4GD4A 3NIFE 2BIMA 4Y5Z0 4GPVA 2QPFA 4F91B 3B2DC 1T83C 4ES8A 4EOWH 3MROB 2MCPH 4L4JA 1RZFL 4N90A 1G9MH 4NGHL 1T83A 1VFUA 1T0PB 5K9JL 3BD3A 4J3TA 5LEJA 4HKBB 2VUJA 2ZG1A 3WGUB 1ODUA 2NTFA 5I8TA 3VFOA 2VTXA 3P0VH 1MFEL 4J4PD 5I1DA 3FJSA 4XVTL 1DG6A 3BWAB 4PR5B 3R0MA 3TBSA 2KYIA 3S36X 4K8RH 2VM4A 5TDNB 4Y3OA 3L6FB 5FZCA 1DSWA 1QP1A 2Q1EA 4KMTL 3H0TA 3N9NA 3CXHK 5DJ0B 5KW9H 3PIGA 3ARVA 3CFKA 1U33A 1ZVSB 4E2SA 4MD0A 4PJGB 3WIFB 2ZWSA 4A2EA 2BNQA 1G94A 3F12B 4E8CA 1CFSB 2WKKA 4Y2DD 3HG1B 4FOQA 1NICA 3I9AA 1PX4A 3T2LA 4AG4L 2QQIA 5J96B 1EJFA 4K7PL 3OCPA 1PGW2 4LLFA 1YUHB 4GAYB 1M56B 5JVVA 1VBC2 1HWHB 2RMU2 5EBMA 1O7DC 4XX1E 4DIQA 2R0LH 5C0GA 5T5FA 5AW5B 1YMMA 1W9XA 1PW3A 2WKOA 3SOBH 4YZ1A 2W0KA 1LENA 4UI9L 1ZWIA 3HAEA 1ZKAA 5IBLC 5JW4M 4Y1ZA 4O02L 5FOJA 2IPTL 3VHRA 5I26A 2QVTA 1HH9A 3ILQC 4D3CH 3AZYA 4PGJA 3OZLA 1SJMA 1HRI1 3QHZL 3ATEA 1M57B 1B0GA 4GXFA 4Q4EA 4AGLA 1PSKH 1HB1A 3L2YA 1FLRL 5FPLA 3LKRA 3MODH 4A41A 4HSCX 3I6LE 2GJ6B 4OCWL 2OMVB 3THTA 3LSDA 5JSPA 3H7BB 4PSRA 3NOIA 5C07D 5FDWB 1TVBA 4V33A 3HG2A 3OKLA 1N2RB 2CR6A 3FTUA 5AYQA 2HG0A 3TBYA 4TUOA 3I54A 4J5VA 2EINB 2HWZL 3HMWL 3WENA 2XVBA 5E7FA 3BRDA 5HCHA 2C3XA 2CIIB 3M86A 3NJHA 3NCEB 5FGCE 3BP4B 3M3OA 4JFEE 2A71A 1WCKA 4FPJA 4LO7A 5KWRA 1MCDA 1AKPA 2X53S 1GGYA 1RIHL 3K5RA 1W72H 2JXMB 4NRZA 2YUVA 3QJSB 4KZEH 3Q1SH 2J7MA 2WIIB 1EEQA 5EOCH 2CG9X 5TQ0L 5JMCA 5I9QB 5AAMC 5DRZB 3VG9B 5CGYC 3BVCA 4HN0A 5AAMA 2VZ3A 3VA6A 5L88L 2AABL 4G8GB 3V8OA 4GQQA 1IFHL 3EJKA 3AL6A 3HCVA 1H8VA 1PX8A 3RIFK 3SDXB 5E6RB 3U0PA 2I27N 3KDMB 4CCEA 3M1CA 2OW4A 4KXCA 2EVFA 1TJXA 5C97A 1MFBH 3FO9B 1KXHA 2P5ED 5B4MD 2BFUS 2ZX4A 3MDJA 2MOGA 4YUEH 2PLV3 3IDMB 1BOGA 3IJHA 5AW9B 1WLCA 1CFQA 7PCYA 1UYZA 5IM7A 2XWRA 1BJQA 2LLNA 2ZHLA 3BWUF 4YSTA 2FR4B 1L7RA 4HK3N 4K3UA 4UYBA 2GFBB 3BPCA 4BFKA 2W5FA 4RDBA 1JMXA 1IUZA 3D69B 3KGTA 4YDVB 3RPIB 3TTSA 1XNTA 1YJLA 4Q2FA 4NJAL 3BDYH 1MVUB 1UKGA 5DQJB 5E16A 1FF5A 1J1XL 3F7YA 4UDUA 4HIJB 1W80A 2YBKA 2D5FA 1BBT3 1I8KB 1DLFL 5C9JB 1OH3A 2F6BA 1SQ2N 3BDXA 4YNYB 5K9OA 2OYMA 2QBWA 3NSFA 3PJSA 2R1DA 5T3XD 3F04A 3BTXA 2H2PC 2YOAA 3QVAA 4A6YL 3ESMA 1U8LA 2W60B 4YGAB 5F3IA 4GO8A 4OD3H 2QV2A 1TITA 2QR0B 4NQSA 3T3PB 4FN0A 4JPKH 4ELMA 1R5VA 2ARJA 2QL1A 1LOEA 3ILNA 2I60H 4PJFA 5F7UA 3KCCA 2IPKA 1AO7D 4ISVB 2OL3B 4Y1UA 2D9CA 4JY4B 4XCFL 1RTVA 4WHTA 2OA2A 3FUQA 3K6FA 3SBWC 3LVEA 1JUFB 4L8DB 1IM9B 1KTRL 3NFSH 3SBWA 2W68A 4A67A 2FCVA 1UOKA 3GXMA 5LN8A 1TMCB 3SDDD 1B4TA 2EUVA 3O9WD 5IBUB 4H3WA 4CDWB 5T3XH 3U83A 2YC0A 3FBYA 2BFVL 3VCLB 1J9CT 3CFEA 1SZNA 3QPQC 1KJ3H 3RTLA 1HDMB 4GQRA 1JMZA 1D2SA 1F13A 3CFDB 3RHWK 3SPCA 3T2NL 2JICA 3LSEA 2ICWJ 3ZZSA 5IQOA 4OQTL 1H15A 3OLGA 1PIV1 4K3HA 1XJAA 1UJ3C 4AE0A 2X3CA 3FU8A 3PHQA 2ZX5A 3OAYK 5L0QC 1A7QH 1UJ3A 4PRPA 5FYKL 3BVVA 2KZ1B 2F7OA 2WCPA 2XZCH 1CD3G 2GP3A 1R4XA 3O6FC 1I3GH 3FONA 4QOKE 1C7SA 3O6FA 4ABUA 5AAWC 1A6WL 4U3CA 3HKFA 3A4DA 4GMTH 4UZGA 5AAWA 4HUVB 3VRIB 1ZS2A 3LKOB 5SX4I 3NKTA 5LBSA 3ET9F 4LLUB 4E9QA 5HGDB 4YXLH 2LAGB 2YPJA 4X6DF 1G6RA 3U37A 2C9VA 4JFFB 5MEQB 2NR6C 3LN5B 3UJJL 1KGWA 1N5AA 3MBWA 3ECWA 2VCOA 2NR6A 5C70A 4LUKA 2J71A 2VXQH 2GSGB 2XIDA 3LQMA 4Y4FC 3CSYB 3U6XS 4C56A 2WL1A 4Y4FA 5FUPA 4L0ZA 2BNQD 2BSTB 5BW7A 1QTYT 1X50A 3UPRB 3UAAA 1H2KA 4KX7A 4NC1E 4DCQB 5KVDL 3MRDA 3VD9A 2KM2A 1K5NA 3G6AA 1RUF1 3NKGA 1XGPB 2ATPA 2IAMB 3RRDA 5I74B 3ABMB 1FMD2 1AYOA 1L5GB 3DMMB 2DWDB 1LTEA 3ZM8A 2A6DA 4HJGB 1H8LA 4RBPH 3P1VA 4OM0H 4GW1B 3U48A 1BF5A 4U0RC 1UZZA 3B7MA 4XURA 1TVDA 2JCCE 3QDJB 3BVNA 3ILQD 4JRYD 3VXUA 5KSVA 2JLPA 3GJFA 4URTB 3OEBA 4NMIA 2Y23A 3DI3B 2CHNA 4R97B 4JVAA 1M4KA 5IJBC 4N68A 4XZUB 1MFUA 1V8HA 4KOCA 2HRHA 5HHMB 3CQPA 5FMDA 3WVJA 4MHRA 5HDQL 1BAWA 1BECA 2X44D 3BKYH 3ZZQA 5FZAA 5ICXB 1U8OB 1SXSA 3RLSA 3VXSE 3MCYA 1MS0A 3M7AA 1JZGA 2DQJH 2E86A 3OMZA 3SODB 2OJEA 5IHZA 5LN4A 2CNYA 1F58L 2GTQA 1GQHA 1IIKA 4GB33 4KGGA 1RURL 3BAYA 4Y8AA 4KNSA 3NJZA 3MA9L 3WW4A 2B9AA 4BPZA 5EEUA 1HXMB 4UQ3A 5BS0A 3B00A 5J1XA 3BVUA 5EOTB 1V3MA 1WG3A 5D2LB 1C5CH 3FB5A 4S2HA 4LVHC 3FQUB 2WYIA 4HUUA 3S3CB 3UP6A 2UY9A 4NNXA 3LKSB 2SLIA 1HEHC 2PCXA 2ZMKA 3HS9A 4DPNA 1T1XA 5C5TA 3DDGA 3GNMH 1OV8A 1RZIB 1KIRA 5A7SA 1T3FA 3KL5A 4GA9A 3LHPH 4HJUA 5HDRA 3RUGA 4IRZA 4YLQT 4FQZA 3M3QA 1N9PA 5T3ZE 3FDWA 1H6EA 5SWSA 4KTDH 4Y1YA 3T0WA 3ZSLA 4PJ5E 1NOLA 2FSDA 1P7QA 2XWBB 1OQ1A 2G75A 1KN2H 3IDIB 2HLEB 2YPVA 5LGYA 1WSST 4S1DC 3GGLA 5F3EA 5AQ0A 1UU6A 3RBSA 4X4XA 5CS7A 3W20A 1ZT4A 2JD4A 2YC2A 4ZSOB 4Q0UA 5ABZA 2WD0A 3S36H 3T04D 2OX0A 1CG9A 4HEME 3G5ZB 4NCC1 1NLBL 4KGQA 2FWOA 4EDWL 4XO3A 1DL7L 3R8QA 4E9VA 3VHPA 4AVBA 3P1IA 3FRPA 1Q9OB 3ZOIA 2CK2A 4MLIA 4XUTA 1LK2A 2FGWH 1KYFA 1RHHB 2QHRL 5ENWB 4PJIE 4N25A 1RZQA 1W2KT 2CHZA 2YGLA 2QSCH 3RG0A 4HV8A 4P46C 4L05A 2FEDD 4KDVA 4P46A 3EOTL 5H9QA 3F3HA 5TTRA 3DETC 3MV7B 5E8OB 4AL8L 4Z7NB 5M0TA 1I85C 3QS2A 1DDLA 1MAMH 1I85A 1ZHBA 4GIQA 3NCYS 2IZWA 3M17A 5F7YC 4LCCB 2XJSA 1XIWB 1WW5A 2RDQA 2F53E 3NIDB 3BZ4A 5GGSB 4CCDA 1P1ZA 3TO2B 3ZLIA 4LXLA 4Y1AE 3HG4A 4Z7OB 1H2LA 4YBLB 3AZWA 1YY9C 2V4VA 2YD1A 3D5OA 3A47A 2O4EA 4CDQB 2VDRH 2FZ3A 3D3VD 4BUQA 3OLIA 4JRWA 2R1BA 2RALA 3U7WH 4K2UH 3QK0A 4YWGL 4BZ2A 3D25B 4ZAKB 3PXHA 1MCOH 2ZZJA 2QFEA 2AH2A 1FJ1B 2NRDA 1LD9A 2R8SL 1X7NA 3I6KA 5J48A 2JKTM 4UWQB 5E6IB 2O30A 4OKVB 3MXVH 4E4DX 4R2GB 1NGXA 5EU6D 5LZ6A 4W70A 3EZJB 2FQGA 3LD8C 2IWGA 1RVF2 3H4FA 3U0TB 3LD8A 3UV9A 5MI0C 4GRWB 4YE0A 3VN4A 1MW3A 3MRIB 1QFOA 3ZMOA 5CKNA 1NC4A 4GUPB 5DHDA 4BKTC 2VLKE 4YVSC 1WZLA 4HIXL 1JN6A 5CBEA 3EYUL 4AM0Q 4YVSA 2R51A 3Q8AA 2EYSA 1GGIH 1Y6NR 1XSJA 4HF5L 1NBZA 1PK6C 1LEGB 5AKSA 1PK6A 5IREA 3O14A 1Z5HA 2YQGA 3BVTA 4APQB 3WEXA 5HDWA 4UTCA 5BZDB 4EZHA 1ZE3H 3IMWA 2VQ4A 2FD6H 3JYCA 3T8MA 1RZ8A 4C56D 8CGTA 2ZGPA 3GBWA 3EJYD 1SCRA 1Z9OA 1U8IB 4WW2B 5AW2B 3GC3A 3GLAA 2VD7A 4RFRB 1JD7A 3DXAE 1DUZA 4X4ME 3UJTH 1T66D 5J9PA 4XHJD 2A99A 2CCLA 3RBGA 4AYEC 2R6QA 4BZ1L 1RIRA 4C0BA 1CE1L 3UGEA 1RK0B 2AYHA 3ROOB 4WTZG 1Z32X 5E8EA 3OYWA 5EJZB 3APBA 5I15L 3ISWA 1FBIL 3U1XA 3O8XC 1EHXA 1F45A 3CVHB 4EXKA 4LSRL 2PP8A 3O8XA 4QRUA 2H0BA 2AVFA 1EFXB 4JFEA 1T6BX 5CG9A 2XOMA 4Z95L 3VXUD 1QLRA 3C6LC 2FBOJ 3C6LA 4R4NC 4I1NB 1G6NA 2OYKA 1AX0A 4GRMA 1UZGA 1GZWB 1VF5C 3HC4H 3BSZH 1X5JA 3QDMB 4NIKB 5INCA 4OZIB 4G6AC 5L9DL 1VRSA 4RNRB 4GKZA 3TM6A 2Q8CA 1DVFB 2ZUQC 4OQ1A 2WZ6A 3RB5A 3X12A 4XCCH 4MWFB 2CLVA 5ANHA 2HWC1 3ECBA 3CC5B 3OJDA 4WGVB 5DEJA 4HZAA 5J57B 2WNUC 4PT6A 8FABB 2VVEA 4KHTH 5FYTA 2WNUA 5F9JB 3M8LA 1QRNB 4JFUA 4MA7L 2ZUWA 4R3SB 1MFCH 2A9MH 1CVSC 1DCLA 1KBPA 4FXKC 4KKLC 4Y9CA 1AMXA 4OZHB 4FXKA 1QNIA 4KJPC 3OY8B 4M3KB 1RSFA 4NKIL 1TZ8A 1T1ZA 5C0BE 4WSJA 1NKOA 1Z5YD 4KG8A 1JZ4A 4G9DB 2JFCA 3KLLA 1AZUA 5GJTH 2VDNB 3WQ1A 5EUKB 2NXZC 1QSFB 3SYQA 2EF6A 1CAXB 5CMAA 5BNPC 1JPFB 2VABB 4JRXE 4QJ3B 4R7XA 4EUPG 5BNPA 5D1XB 5I0TA 2F7QA 2J20A 3HZYB 4ZTOL 4H8WL 4E42B 2JKWA 3G04A 4FJ6A 1M2VB 4MQXC 1SNRA 5TJWK 5MENE 5EF3A 3TAYA 5EUOE 4KKAC 3DSNA 1U8KA 4LSSH 5SWSD 3RTQB 3HNSH 1KELH 1JERA 4IQHA 1P7QD 3MNWA 2ZX8A 4LA3A 3QGVA 5LGKA 1MIEH 3V0AB 1OM3H 3LE0A 5I1LA 4AVVA 5TGBB 4JM2C 1NCUA 3V2AR 2ENPA 3M1BA 4JM2A 2ODHA 4S1DD 4NKQB 1N8ZA 4PJXE 3L5XH 1KTDA 2EDMA 4UT7H 4WHCA 3UACA 2A7AA 2YD0A 1QG3A 2DMHA 2E46A 4IOFD 4TPRL 4Z9KB 2J7LA 2XBO1 3NVQA 4IV3B 3M46A 4Y4KB 1EJOL 2VXJA 4QX5A 2TAAA 1RUC1 2AXGB 2KMWA 4CSPA 3USUB 2ZOOA 4FQ1L 4RESB 1O9WA 2E7LC 1MW0A 3AXEA 1NIDA 1GZPB 1GW0A 2ZTBA 4IRSB 4X8JA 3KLHC 2E7LA 3FYEB 1EGJH 2M83A 4G43A 3DURA 2CGZA 2Q76A 1TQ5A 4O58L 1UXWA 4P46D 2Y6LA 1D5IH 1FNGB 3GMLB 4QRAA 1ZANH 1J1LA 1BOYA 3LRGA 3PWJA 4JFSA 3AITA 2AEPH 2VL5A 2YSTA 3K1KC 3K80A 1XCQB 3NEOA 1W6LA 4M5ZH 1JW6A 4F1SA 3N9LA 4JC1A 3Q9QA 4TUUA 5IHUL 4N43B 3D30A 4P59L 3EJCA 3LZQA 4IM8A 1QUNA 3IXAB 3Q6GH 5EN2B 4Q9QH 3UTOA 1RUOA 2GG1A 2WXMA 4P2RE 4Z7QF 4AMWA 1NCCH 4ZPVB 4DW2H 4HIIB 5JDJA 1MEC1 1YY9D 3EYOA 4AFAA 3OXSA 1LKNA 4QOKA 1OA2A 3O45A 1N4XL 4UM8B 3SE3C 4F8TA 1W90A 1C5DB 1KJVB 3SE3A 2Q86B 2ZEYA 5FYBA 3KPMA 3IB3A 2OXGB 4G6KH 5HY9A 2FE0A 3TEYA 3S88L 4C8DA 2P8PA 2EDYA 3EO6A 3WUZA 1XF2A 2ZGKA 4IEWA 1AZBA 4LAQH 4X5WA 3ZL2A 3ARYA 4AE2A 3RWCA 2WO3B 1HZLA 1X5XA 2Y26A 2ZCKL 4NC1C 1UF2C 1P5UB 1HNFA 3A6OA 2X42A 3REWB 2RDNA 1AS6A 2B5IC 3QUGA 3VE0A 4GZ9A 1NC4D 5HI4D 1TZIB 3DUHA 3FZUD 2VW2A 5IVZB 5JDSA 2P4EA 4W6YB 3GXUB 2YD6A 3WT3A 4JDTL 3N91A 5I16B 1B35A 1OGAA 2YO3A 1MZFA 2ILMA 4R90H 4C4UA 3X3FL 3IU3B 3NA9H 3ARDB 4IDJL 3CE1A 4PW9A 1VKXA 2R2CA 1RSYA 2JCCA 3KEHA 5ISZE 2KBGA 1XWVA 2X4RB 3BT2L 4JB9H 2JWYA 1NGYB 5HI5C 3C2SA 3L9RA 1AYN2 5BO1H 1D4M2 2DU0A 3D08A 4H0LC 4RGOL 4F8NA 3WEMA 2VLJE 3DHMA 3C9NB 5T33L 4LO8A 2E75C 1C08A 4AC2A 5FXCH 1G8WA 1OFSA 2KZKA 4XMXA 2BOCB 3TU6A 3OPZA 5LEKA 1AR71 4AL9A 2YBRB 4DKFL 4XUNA 1TTBA 4FP8L 4ZUVA 3S5YA 3VXSA 3V0BA 3WDWA 4I77L 1S7QB 1OARL 3ATFA 5LCVA 3ZFGB 1U30A 3PU8A 3FTZA 1C7TA 2R043 1EZVX 5J89A 5GSRB 3G9AB 5D5MF 5I8OH 3F7VA 2ID5A 3JWDL 3M4FA 5LRSA 3MV9A 4CBZA 2FAUA 3JSSA 3DUSB 1E5AA 2XBDA 3WNPA 3H3PL 3D4GA 2PHXA 3WUCA 3FF8A 5KR7A 5JW3H 3ZXEA 5JZGC 2CHHA 4IJ3B 2O5ZL 4P23D 5LA0A 4YM2A 3H55A 4OYUA 4AHZA 5ES4B 1CONA 3O0WA 1F90L 1CX4A 4OZFG 1Q94B 2XTSA 3OGSA 4NUJA 2WUBL 1NDGB 4JQIL 4TQEH 4XE0A 1OA3A 5K7PA 5EFUA 4IEUA 4G6AD 4L8CB 4H0GA 2D7MA 4PJ8B 4YR6A 3BFQG 3WTUA 2E8ZA 4FYSA 2ADFH 3EO1A 4B6ZA 4GI8A 5D8JL 1M3JA 5C08B 4CSTA 2OMUA 4BSVB 2ZT9C 3OOXA 4QB2A 5EPMB 2R0ZL 2OX5A 4LQ1A 3CEWA 4AJWA 4PJ5A 1MJ7L 4NKMB 4ADGA 1V7MH 5BMFH 4JCKA 4M01A 1KEGL 2OJZH 4LKSA 1LO0L 5JHBA 4ZZKA 1U8HA 5DD0L 5KTEL 2WZPP 1HH6B 3US1A 2CSPA 2FX9H 1DCEA 5HP5A 3NNMA 3NO8A 3MRBA 2BOBB 4FC3E 4I3GA 1YNAA 2HP4A 4XFIA 1YQ8A 3N9GL 3QARA 1IPSA 4AYID 2E7AA 5BUVA 4HEMA 4TYUA 4QT5B 3MF6A 3ULVH 2C4FU 2BY3A 4AYDC 4D9QD 2ZABA 3NMBA 3VH8A 2CO7B 2HLAB 2PP7A 3LPWA 3K71A 1UXSB 5IWLC 4I9XA 2F6AA 4MQXD 3UBXB 4A7GF 4CU6A 5IWLA 3GI8L 5I18H 1H5BB 4PJIA 4F3FA 3SDXF 5IMOA 3GRGA 2F5BH 5FHBL 1SMAA 4QQ2A 1FHNA 1OCWL 4E27A 1U92A 4AGPA 3CSBA 3MCG1 3QJHA 2Y3AA 5FYSA 1WAAE 4KTEL 1QFUL 5F1NA 1X8MA 4XO8A 2CUAA 3QJZA 2XJRA 2VL4A 1A7RL 2NXYC 4IU3B 4PBDA 3AL5A 5CP3A 4F7MA 4A44A 2Y6TE 3V4VL 5LASA 4LHNA 2R4SH 3NV3A 1Z0HA 3MYJB 4M00A 4MXWB 2FATL 2G5BA 4NFCA 5T5JA 5K1JA 2F53A 1IGMH 2DUQA 3QEUB 4E5XG 1WCBA 2HKAA 3DV8A 1MJUH 2EDOA 2XQYK 4PB9H 4Y1AA 4HULB 3ALQA 1FZKB 1HKFA 4FE9A 5J37A 2RHPA 1YEWA 4LSPL 4F7CA 1DEEA 1ZRFA 1G7PB 4ZMPA 5ACA3 1WLHA 2V7NB 2A9CA 1FSKB 5E4EC 1MLBA 3TA3C 2QVSB 2WUCL 4B7LA 4XNUH 3TA3A 1QHPA 3TF4A 3WX5A 1ZAGA 1MACA 3AJ7A 2XJVA 2CIKB 3U14A 1QACA 3PUQA 3B01A 1VBD1 3DN7A 4K55A 4U6HB 4ORGA 4LHJB 1EYBA 3AT0A 1S9YA 3JUZA 4N2HA 3TH4T 1GSKA 3P4NB 3T3PF 4K5NA 4M1DL 1ML0A 4GQZA 1WE5A 4NENB 3C3VA 1ORSB 2XZAH 1R1ZA 3DXUA 2E5EA 3F6JA 1BKZA 1UZWA 4YL4A 2YRLA 3RG1C 3NV4A 5D96C 1J5OL 1KBVA 4WW1A 4BQ8A 4PGDA 2XCMC 3UMTA 5IB2B 5GS3A 3MICA 2CY6A 2C1FA 2TNFA