2W95A

Structure of the discoidin i from dictyostelium discoideum in complex with galnac at 1.75 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
254
structure length
254
Chain Sequence
AMSTQGLVQLLANAQCHLRTSTNYNGVHTQFNSALNYKNNGTNTIDGSEAWCSSIVDTNQYIVAGCEVPRTFMCVALQGRGDADQWVTSYKIRYSLDNVSWFEYRNGAAVTGVTDRNTVVNHFFDTPIRARSIAIHPLTWNGHISLRCEFYTQPVQSSVTQVGADIYTGDNCALNTGSGKREVVVPVKFQFEFATLPKVALNFDQIDCTDATNQTRIGVQPRNITTKGFDCVFYTWNENKVYSLRADYIATALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Cell adhesion
molecule keywords DISCOIDIN-1 SUBUNIT A
total genus 61
structure length 254
sequence length 254
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
A PF09458 H_lectin H-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2w95A02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w95A01
2VZRA 2W5FA 4A3ZA 4CU6A 5DMYA 1UWWA 4OMCA 3MBWA 2VZTA 2JKXA 1OT5A 4DUXA 5JR2A 4XUPA 2Y6GA 4JKMA 2VM9A 3CDZB 3I3EA 4MOAA 2B9VA 3OB8A 4CU9A 3T0DA 2VMCA 3MO4A 3SKJE 1CZVA 2VZVA 2DCKA 4BK4A 1W0NA 2QQLA 3I2HA 1P8JA 3IAPA 2ORZA 4ZXEA 2X10A 1IQDC 4MGQA 4GZ9A 1GOGA 3K4AA 4L0PA 4OMDA 1UZ0A 1TG7A 5IFPA 5G05L 1LNSA 5B4XA 2E31A 4P02B 2WYSA 2L9LA 3LEIA 4RN5A 4A4AA 1PX3A 1O8PA 3K4ZA 1UMIA 2J1UA 2J22A 1XNTA 3HPNA 5HXMA 5IYYA 2VMFA 5F7UA 1UY3A 4XVHA 4P00B 4ZZ8A 4BDVB 2Y6HA 1UXZA 4TXWA 1PX4A 1ULPA 3CZUA 1R64A 3WQBA 3OGVA 4MADA 2ZEXA 5EJ1B 2EIEA 2QQMA 1UY1A 3F2ZA 1W8OA 1XC6A 3C7EA 1JYXA 2DCJA 2WZEA 3LPFA 3WMQA 1WCQA 3I3DA 2QBXA 3GM8A 4A6OA 1NUKA 1SG3A 2HLEA 1SHWB 1OH4A 3J7HA 3DYMA 1BHGA 2XOMA 4GWIA 2XHNA 4XUOA 4DEVA 2RV9A 2VZ1A 2CDOA 3LE0A 2VO5A 4UAPA 3WF3A 1UYXA 5LA1A 3AC0A 5C71A 2BBAA 4ARYA 3D3AA 1JYVA 1K45A 2VTFA 4XUQA 2BGPA 5JXIA 1US3A 4QB6A 3IIIA 3WEZA 4E8DA 3LPGA 2J1RA 2VJXA 3HEIA 5IJRA 4QB2A 1J83A 4BJ0A 1TVGA 3OEAA 4AG4A 4XZUG 2J1SA 5LA0A 2WO2A 4M4PA 2W1WA 2ZEZA 2R7EB 4JHZA 3VD7A 1XNAA 2XQXA 2EIDA 2LW8A 2V4VA 3P6BA 1I5PA 4AAXA 2VR4A 2CGZA 3C8XA 3IAQA 3MV11 2VMEA 2J1VA 2WBKA 3PUIA 2V72A 3LEKA 2KD7A 2Y6LA 3WNPA 2VZSA 1H6XA 3DECA 4OUEA 4CUBA 4ZZ5A 5IFTA 3ACGA 3SKVA 3HJRA 2VZOA 3DYPA 2VZ3A 1OF4A 3MUZ1 1KEXA 4YPJA 3LQCA 1GOFA 3SEEA 3WF4A 1JU3A 4P5YA 3WNOA 2W92A 1ULOA 3VD9A 1DP0A 3OGRA 1JU4A 4QX3A 5LA2A 3HNMA 4LQRA 3BGAA 3P1IA 3T09A 2YG0A 2WAAA 2B4KA 3U37A 3WF1A 3A22A 4MGSA 1NKGA 3WMPA 1GUIA 2WZ8A 4RYDA 1F4AA 4D8MA 5HPOA 2Y64A 2WAOA 3CIHA 4DUWA 1GMMA 2W47A 3OGSA 3NJVA 1L7RA 4QX1A 5DPNA 4ET7A 2WUHA 2C9KA 3WNNA 3WNKA 1HN1A 4QDRA 3HNBM 1UY2A 5JMOA 1GNYA 4LPLA 1GQPA 4JKKA 5J1XA 2VL4A 3A7QA 3T0BA 2W91A 1W9WA 3W5MA 3FHAA 2BERA 4LHSA 3CMGA 4CVUA 3VD4A 4KI5M 3DYOA 3NJXA 3I2IA 4M4RA 2QQJA 4W8JA 5JXJA 1UMHA 3ECQA 5I0DA 2VZQA 1UYYA 4DXRA 4KWUA 3ACIA 2LS6A 2E32A 1JZ4A 3WNLA 2HYXA 4GWJA 1UY4A 3ZM8A 3IB3A 4ZY9A 4A41A 2CCVA 3CKHA 2QQOA 4QB1A 3NRUA 2W1SA 2OKXA 1US2A 2W46A 4PT6A 3NQHA 3NNGA 3K46A 1K12A 2QQKA 4XUNA 4PQQA 2CE6A 2VQTA 1K42A 1H6YA 2J7MA 2ZXQA 2WDBA 3GXUA 1GOHA 3HOBA 3WF2A 5CYYA 2CDPA 1L7QA 1DYOA 5JUVA 4W50A 1D7PM 2W9XA 1T2XA 4XUTA 3BN6A 4QPWA 4QAWA 4TTGA 4PF1A 1J84A 1UY0A 5B4NA 4DXSA 3T08A 3WSOA 4BXSV 1PMJX 4HG6B 2QQIA 4E8CA 2J1TA 2Y6KA 3ACHA 1O8SA 5G04L 2XONA 1UYZA 3T2PA 4W4ZA 4A42A 1K3IA 1JZ7A 1JYWA 1JZ5A 2W95A 5C70A 2C4XA 3VDBA 2WQ8A 5DN2A 2E33A 1CIYA 3I2JA 1OF3A 3C7OA 3IDAA 3I2KA 1W9SA 2J1AA 3GDBA 1JZ2A 4Z2AA 2WO1A 1JI6A 2QQNA 4OZOA 2YC4A 3GGLA 4QDQA 2W87A 3K4DA 3FN9A 3A21A 3I97A 4QX2A 3T2QA 2VCAA 3CZJA 4JKLA 2PQSA 2WN2A 4KMQA 3VD5A 1NAEA 1RYYA 3MUY1 3FHQA 5CZKA 3CQOA 4DXTA 5FUIA 1JZ3A 4CUCA 3VDAA 4JX0A 3K77A 4DEQA 3ABZA 4ARXA 2V5DA 3K75B 2X09A 2WABA 3ACFA 5JXGA 2W94A 2Z4FA 1JHJA 3EB7A 3THDA 4CU7A 4A44A 1NX9A 2YFZA 5LCWL 4OYUA 2WO3A 3FL7A 3VDCA 3HN3A 3OBAA 2VQUA 3I2FA 3SEPA 3A23A 2RJ2A 2W1UA 2JDAA 1EUTA 3MV01 1EUUA 2VMDA 4IUGA 3VD3A 2ZEYA 3C7GA 5C7GA 2W1QA 3I3BA 1JZ6A 2ID4A 2CGYA 2VZUA 3LEGA 3UESA 2C26A 3PUHA 3C7HA 4D0QA 5EJZB 2RVAA 4P08A 1JYNA 1W9TA 4CU8A 2WN3A 1CZSA 2DDUA 5JXHA 2EICA 4BK5A 3T0AA 4LKSA 5IHRA 2VZPA 1KGYA 1GU3A 4Q56A 4XURA 1DLCA 3OG2A 1XPWA 3E1F1 2YC2A 1UXXX 1CX1A 1CZTA 2ORXA 2YB7A 4QX0A 5EIYB 2YFUA 3THCA 3WF0A 4CUAA 2ZEWA 2VCBA 3OEBA 1UX7A 3I2GA 2W3JA 4MO3M 2X05A 3W5NA 1YQ2A 3C7FA 2Y6JA 2VCCA 4DUVA 1MPXA 2JD9A 5DQ0A 4UOJA 1SDDB 3EYPA 3T2OA 2VC9A 1W99A 1WKYA 2BGOA 3WNMA 1O59A 2J1EA 4FI9A 1W8NA 2VOTA 1F4HA 3ETPA 3UETA 2E26A 2BZDA 1PMHX 4QDSA 2EIBA 4UI9L 5A1AA 1JZ8A 2JE8A 3UNPA 3HNYM 2Y8KA 1OD3A 4A45A 3JXSA
chains in the Genus database with same CATH superfamily
2K4AA 2EKSB 3BW9B 3P4NA 3WUWG 1KY6A 4DNYA 4XE5B 3LPWA 4Q97A 3FKUS 1BWWA 1EZLA 5GSRB 1J5IA 1U91B 3VZOA 3WIIL 3PWPE 1OEZW 1XZ0B 4OM1H 1EPFA 1HOCA 4LARH 1Z7JA 4QY8A 4WY7L 4BSWA 3WE6A 4PJHF 1ZGLM 5F89B 4GJTB 3ENEA 5DC2A 4P3DA 2K3HA 1L7LA 3ZO0A 2DF7A 3MLTB 2EYRA 4G8EB 1A6ZB 3HG1A 4I1NB 2VZVA 4OKVB 4G1EA 2SODB 4P9HC 3WN6A 2C3VA 4JDZA 4L3CA 4WJ5B 2H3XC 2ZA9A 4UF0B 4BUHA 2CD0A 5DJDA 2D31A 1TVBB 1H3PL 1ASJ3 1J58A 1JYIA 1WLTA 5FV2A 3BP5B 1JS9A 5CNHA 3NSTA 2HWB1 2HVJB 1N3NB 1JHLL 2J72A 1R3LB 3CTTA 1IC7L 4YGCA 3TEXA 3IKCB 5G05L 3BHBA 5SV5A 3AACA 3ZYBA 2IQ9L 4IIQC 3US9A 3H42H 2H8PA 1YEIH 3C8KB 4UQ9A 2WT1A 2L9LA 5FW7A 1HKLL 3IBMA 3SDXE 4N53B 4QM8A 1JZFA 2EDHA 4PM1A 1ECYA 4CDQB 4JK0D 3F6LA 5DFTA 1XB8A 3C60D 4YW6A 3HC3H 4DZ8A 3VXNA 5DJAB 4LPWA 1JMUB 2J1UA 3T1FB 4XN4A 1QSFA 1RUH2 3GMPB 2XXFA 3KR3L 1U8MB 4KOCA 4YDKL 5I6XB 1CD9B 1AAJA 1BBJA 5B7FA 4UAOB 1CDCA 4X7DC 4CMHC 1F4WH 3JTTB 4DOHE 4DQOL 4ZNCD 5LJYH 2D43A 2TEPA 3BQUD 2KM2A 1CG9B 4YW3A 4TYUA 1AS7A 1WF5A 2CYFA 3C87A 4J3OD 5DXWA 1INEL 2V17H 3EFDH 5ECGA 4WFHE 1G7LA 4AF9A 1ODAA 1QEXA 5CUSH 1OKEA 4GO8A 4KRPC 2GN7A 3QC5X 3NESA 4CA9A 1YWKA 2OPWA 2X2UA 5D7IF 2IXHA 3NFSH 1X5JA 2EDEA 1WBXB 1XC6A 4PAZA 2A9ML 4HCRL 4AW7A 4C91A 4ZMAT 2I07B 3MX0A 2XI9A 5DZ9A 3MFGB 3UJTL 2VH5L 2HLFC 2NT1A 2R4RH 2YRPA 4AOCA 3G5VA 2V9UA 1N59B 1H1MA 2C0ZA 1EV13 3BVNB 4M8UA 4YHKL 2LUWA 1MFDL 4A6OA 4CUGA 3QEGL 3P77B 2IG2H 2PWEA 4JKPH 4PRPA 1HB3A 1SHWB 3JB8A 1QYGH 5IFAH 2N7GA 4JN2A 1XYNA 1EK3A 3POJA 4NQDD 4HXBL 5D4IA 1QKZL 3ZK0A 1J5OL 4AEHL 4GWIA 1VEMA 3CBKB 4OLWH 4INDA 4XPTH 4FBFA 1YY8A 4RQPC 3UBGA 2LRPA 2ZJCA 4LSSH 2Q8EA 1TJMA 3FTVA 3A4AA 4TS6A 5I0XA 3B69A 3OD4A 4QXCA 5J36A 2BBVA 3LS5L 3AJ7A 3LE0A 1RUH3 2E9GA 3D6GA 3RVTC 2J8HA 1Y18B 1KXVC 1RY7B 3AS0A 3TO2A 1A6AB 1QRNB 5JQ6L 2NPLX 2RH0A 2H47C 2ZPXA 1T2JA 4I02A 2JELL 3ULUC 2BBAA 3G6JA 4OF8A 3RBSA 2ZHNA 4QKDA 3LEVL 1YJDH 4O5LH 5E8PA 4X4YA 4IKIA 3MJGX 3VFTA 5CEXA 1UOWA 3BKMH 4XUQA 1GZWB 2B46X 1YNKH 4MDRA 4KK9D 4DETA 2FX7H 3IPVB 3PWLB 4AH2B 5JSRA 4JGNA 4DP9X 5C1MB 3IIIA 3NSCA 5DRZA 4KWKA 5KSBF 3HEIA 4WW2C 1GBGA 3ERXA 1JG9A 4U6YA 1E9OA 3T6VA 4NHXA 4LGRB 3SCMB 4NZUH 5E1HB 5FMBA 2P4EA 1QEWB 4BGLA 1E5RA 2IH1A 3CHQA 3CVDA 3MREB 5DEJA 3TLRA 2J1SA 3MUHL 2ESVA 4P9WA 2WFF1 1W8EA 2XT1B 2H1PH 1O6VA 2Y7NA 3K1KC 4PGBA 3BQVA 4X4KA 4YL9A 4KZ0A 4WHTA 2V4VA 3HR6A 5BUGA 5I8TA 5IB1B 5FBJA 3ILRA 1O6TA 4YDLB 3T0EB 2VL5A 5B1JC 4GRMB 3HI5L 3VTMA 4F9PA 1IS5A 3TOJA 4KJPD 3SGEH 3EJTA 4TQ8A 3FQRB 1IGYA 3MLXL 4FLRA 4RFNB 4RGNB 5IOKA 3F65A 4GQRA 4IS6B 1RUF2 3I3QA 3TJEL 2GNTA 3NGBC 3MMEA 5DDJ3 5E1AA 3GSXA 4YGAB 5GRJL 3ZDYF 4EZJA 4CUBA 2HP4A 1F42A 5MENE 5FGCB 1CAWA 3SKVA 3IFNH 3WJMA 1AMYA 1ETZB 4WNQA 2O61B 1HIXA 2A6XA 5J96B 3D4GA 4LO7A 2V8MA 1KB5H 4NO0B 4QAMB 1TEIA 3F5WB 5F2FA 3C09B 3L1FA 1FZKA 1MLCA 2P5WB 4WUUB 2F58L 4XO3A 1VAVA 3NV1A 3B4NA 3WNOA 4L9BA 4UTAL 1DEEB 1AR72 2VWEE 5BRZD 5FXVA 1MHPH 1FDLH 1N9PA 2LV4A 5DJZA 3WCSA 3OC8A 3L95A 4UI2A 1JERA 3D2UA 3PRZA 3ULVE 1CAUB 2P5BA 3T3PE 1H15B 4A2LA 4WWPA 4J2QA 3RJRA 5HYSB 3RU8L 3M88A 2B4KA 2GC3A 3NCEB 3JWOL 4JQIL 4MA1B 4X83A 5CJBA 3JWNE 5TE4L 1Q8QA 2ATFA 5DZEA 4NHUB 3V0HA 1VBE3 2XXCB 3CVIL 4FMVA 1S7QB 3QFGA 4LSUH 1GGUA 2J73A 1OI6A 4PQXA 1G9FA 1MJJA 4PWFA 4IEUA 2E0PA 1JJUA 1YC61 3HUJF 3FFCA 5AZ2H 1W04A 2H0VA 3BVXA 1H6EA 1I3RA 4OGAD 2XQYG 4XNUH 1REFA 3CLWA 3QNYA 1IGTB 5C2UB 3EBIA 4A68A 4NOTA 4PJFE 1Q43A 2C9KA 3MV8B 1E65A 1GP5A 2JJSC 2AK4E 1U21A 4H40A 4NSKB 4PJ5E 5E8OB 5EUOA 3VFRA 1WFJA 4F3FA 3HFFA 1V3KA 1SMDA 4N0RA 1GQPA 2GALA 2APWA 5GGVY 1OWWA 3SOBL 2W91A 1BF2A 4LP8A 5AL0A 5DO8A 3C5SB 3MPCA 2BCKA 4CVUA 3D33A 4HS8H 4GAAA 3LA2A 1IJNA 3UTTA 4WM7A 2CJ3A 1I9JH 1FFNB 1PD6A 2LT9A 2R2BB 2BHUA 3UG3A 4ZTPL 5I18L 2DOCA 1DQLH 4PN6A 2IAMB 4AE2A 1VBA2 4DXRA 4XWOD 2Q8BH 3ACIA 3QUYA 2LS6A 3AP5A 2BOCB 2DBNA 4UM9D 4HMCA 4XRCB 8PAZA 2NY3C 2OP4L 3G08A 4TUKL 3LHAA 1O7FA 3FTZA 3HZ3A 1G7HA 5I1LA 4GUPB 5ENWA 5TDPA 1MSPA 4NKIH 1S1AA 2Y5TA 4YHLH 1TENA 5EPMA 1A6VL 3ZFGA 4JM2A 1PAMA 1E28A 32C2A 4N2MA 1VBB2 4M7KH 5AZUA 5BVPL 4PBXA 1YMMD 1OZTG 1AX2A 5DJ2B 1CD1B 2EKSA 3BW9A 1ZLSL 1K12A 2O1AA 4HN1A 1HHJA 2F1AA 5ADPL 1UACL 4G7YH 3CJIC 3CN4A 1RTVA 2CKBL 3EKCA 5AVYB 1F3DH 4PRAA 1DVXA 5L2KE 4KDTC 3TIEB 4ZS7H 3OKNB 2IDUA 4K2UH 2J7MA 3PNAA 1RZ8A 1J11A 3ZGIA 3OAYH 4FNTA 3WF2A 3LPOA 4ODWB 1IAOB 3CDYA 3IFOB 3VV1A 4RFEB 4U6HB 5EU5A 4Z18A 1JTZX 1OF2B 1LEDA 5AC93 5C0GA 4FO9A 2Y06H 4XBQA 1NCBH 1TJGH 1C8NA 1CONA 3E3QC 3NCFB 1SEFA 4LIVA 1STMA 3HOGA 4HZAA 2VBPA 4PWJA 1U95B 3CXDL 4JDEA 4AQ8C 4Z3FA 2E63A 4XHBA 3PIJA 4R7LA 3TBDA 3P30H 4FXGC 1UCTA 1NFIA 1LNUB 4NZ8A 4ZW8A 1YFUA 4AGOA 2AUYA 3A5VA 1U58A 3DARA 1WAAE 3NJYA 4O02H 3KGLA 4TNGA 5D2NE 2K7PA 4JQXA 1KEGL 5GS3A 2VUJA 1LEGA 1SY6L 4WHDA 1S7SB 3MYZA 5DD3L 4ZD3L 4LOVA 3L4UA 4PJCE 1HHGB 4ZONA 3UGGA 1Q9WA 3GGWA 2ZWNA 4KROB 4F33B 1OCWH 3FFCD 2GSGA 1CIYA 3L5XL 4ODHL 1W2UA 2IFFH 4OAWA 4H7LA 4Y4HB 1ZNPA 2IBZY 3GDBA 3LA7A 5D2LF 5AOJA 3S0PA 1J5CA 5IUQA 4OQTH 3F7VB 5CMAB 4PTTB 2R9HD 4NOBA 3PQYD 3AQZA 4XMVA 4HS6B 1A3LH 3C8HA 3I2OA 3B34A 4YQXL 4JO5A 3NV3A 1MF2L 8FABA 5KVDH 3POHA 4FFGA 1C5BH 5F96H 4OZIA 2WQWA 2D40A 2WS93 1ED3A 2IC2A 3L3GB 4YM0A 4BQYA 1IAMA 1NJ9A 2ZWYA 2QMKA 4LL4A 4MMXC 5M95B 4JVPA 1MQTB 3PUQA 3S8FB 2CPCA 1IBYA 5FPXA 1MI5D 2VJ0A 2VLRE 3GXNA 1JXFA 3BPZA 2CK0H 4W93A 3IU3B 3DEMA 3BFQG 4CDWB 4NIAA 3MUY1 3RNKB 4ONUA 2WZR1 3SISA 5LWYL 3T2TA 2Z1PA 1TTUA 1FE8H 3V0AB 4NQXA 4R4FL 5E2TL 4MRBA 1PO13 3DKHA 4ZMNA 1WE5A 4CN1A 3LS4L 3IGUA 3D85A 3QO1B 2VY0A 1JF1A 3MJ8B 3Q5YA 3Q2WA 3FMGA 4QPYA 2OZ6A 2V7NA 2WYIA 3M2MA 3U4BH 3O14A 2AV1A 2NY7L 1MVUB 2BNQD 3EF4A 3H54A 2WTRA 2J5LB 3WHE0 3NUKA 4MAYD 5I0TA 3THDA 2F8XC 3IE4A 3RIFK 1LK3L 2XFXB 4N2IA 5FZFA 4NZJA 4Q9QL 3NJLA 4COVA 4WV1B 3EH1A 5C97A 1BG1A 2L8AA 3MV8E 1CGSH 2DQGL 4HT1T 2A6KA 3TYGL 5IFHH 5L7XL 2AI0L 4YHML 4WWKC 4PSRA 5DUUA 2FJFB 2QQLH 2ZX2A 4CYDA 2KKQA 1USZA 2X4UB 1UL9A 5LAXB 5IJKC 2ARJA 2VTXA 4LHUG 4V1DB 2CL2A 5LGJB 5CP3A 4YSRA 3AG4B 5CO1A 2BC4A 4YS4A 4JRXB 3LB9A 1RKRA 1ES0A 5TH2A 5E9DE 2XVBA 1RZGB 2ID4A 3FRUB 1BVKB 3MR9B 5KG9B 3F6IA 1DGWX 3VBUB 4YXLH 5C3OA 4OU3A 4YFLF 5I8EA 4AQOA 4YSQA 3INUH 3I02B 3RIAF 2IH1B 4Z7AA 2XDVA 5L19A 3I85A 4K7PX 1BAGA 4FEIA 4X4XA 4PGBB 1CBVH 3DIFB 4JBSA 5ALBL 1KBWA 4AAPA 1JGLL 5DT1H 4Z7NF 1VIWB 1LQBC 3RZMA 1G7PB 4LKSA 3L4TA 2DTMH 4XVTL 4JFQA 3BPOB 4TLTA 4WY7H 1FN4B 3HG2A 2NXYC 3MUUA 1RMFL 3S37H 2JKSA 1XPWA 4RL7A 3R6SA 5BVJA 1PK6C 4HV8B 5CLZA 3BQUB 4Z7NB 3QQ3B 4QX0A 1DBKL 5DURB 2VDLB 4ZZKA 1UKSA 4JREB 4AIOA 3MPPG 2R0LL 5LG1A 3OL2A 3LHPL 4UNVA 2JDNA 3CFKB 2VCCA 1TNNA 1KBGH 1S0GA 1IAII 2JD9A 1CDHA 5FYKU 2R69L 2X6CA 4JZNB 3RG1C 3SGJC 3T2OA 2ADDA 1MPAL 2XBTA 3QXVA 4TQEL 4HPHA 4G82A 2ZHKA 4M1GH 4FG6D 1IC7H 4E36A 4IGPA 3LFMA 3K2IA 5T3NA 1FZMA 2JJTA 3GSRB 3POWA 5KW9L 1WW7A 1TZIB 3JV6B 3WP4A 3ZYJB 4YR6A 4XODA 2WWMC 2RQ8A 1EEQA 5C08E 1QSFD 2Y4SA 1R091 4O7XA 2P49B 4ASKA 3RHWK 1OE2A 2YN3A 2AHIA 1H8VA 1I6XA 2PNDA 2Q87A 4DZBA 5JOFA 5FYSA 5DUPL 5B3JE 1G1KA 3TA4D 5D1QA 1B35B 1V3LA 3TN0C 1C12A 4CU6A 1NPJA 1ONQB 3PNRB 2MNGA 3P4OA 3KD4A 2NSQA 1UWWA 3LKRB 4WSJA 1EGJA 1SJHB 2ARCA 3OC5A 2F19L 1XR9B 3BWAA 4MXWL 4ITCA 2NNAA 1EPZA 4ONFL 3AMHA 4G8GA 3SE9L 1FPN3 4L4TE 4MOAA 1PL3A 1HL5A 1MCOH 3D06A 3GK8L 4FQHB 4HBQA 2Q86A 4IEPA 4WCYH 4LDOB 5GJSH 4NNPL 2A6VA 3AADB 3NDZE 2DAVA 2HRHA 2PCFA 4FXTA 3TA3A 4B97A 1MNNA 1T7XA 5SWSD 2GBTA 4MAUH 3MF6A 4H55A 3QSKB 2YUVA 2FRGP 5IBLD 4FOWA 1G7IA 1SUJA 1QHQA 1PZDA 2JEMA 2N01B 1T0NA 1UNBA 3OBRA 3GMNB 4P4RB 3CH8A 2UY6A 2YD3A 1YFWA 5AG9A 4I0AA 1W6OA 1BX2A 2BLFA 5F0LB 3RTLA 4AM0A 1L3JA 3VBOA 1C5DA 2VDKB 1QI5A 3AS1A 3BUBA 4MD5A 5CD5C 4BCZA 5AUMA 1OC1A 2GABA 5HHQA 2AQ1A 2XV6B 4JJOA 1FOD2 3FUDA 4HXBH 5LRRA 4N0CD 1SYVB 1NMBL 4AEHH 2DIBA 2AEZA 1PX3A 4R2GB 4BQ4A 1OY3B 4XPTL 1CFSA 3L3HB 1AYRA 4JCWA 1HLCA 2DDQL 4RFOH 4QKNA 4HK0B 2OSYA 3OR6B 4YBQC 4UDTA 3NKTA 1WD3A 3QRGH 4XQ4A 3V9CA 1OZUA 3MLYL 1KJ3L 4EWAA 3VRLE 4LIUA 4JM2B 4LULA 2ZD0A 3CLPA 1W2TA 4XGZB 5IFJB 2Q7YA 1NEZA 3CIQA 2XZCH 4WVWA 2SEBA 4RDQG 4X6DB 1EAPB 2BVTA 4XPFL 1OSGA 5EJ1B 1GAFL 3Q48A 3WFEL 5CZVL 1L0QA 1PO21 1PY9A 5EBMB 1JMZA 1VGKB 2QQMA 4WVMA 2VDRB 3V5KB 4EROA 1NM4A 1NAKL 3S36L 1NGQL 3QAZC 1VPOH 4QKBA 1KZQA 3CUPB 3PWPA 1O9VA 4MA3A 4H1LA 1NCRB 4XDPA 4CRQA 2C1PB 4AVAA 3PHOB 4HISA 3ZPDA 4X7CC 3RURA 3PV6A 4NNYA 1D6EB 4N53C 4PGCA 1U0AA 1T4WA 1WS8A 2ZONA 2QBXA 3PIQB 2TNFA 2H1PL 1KV7A 1XGPB 2H0FA 3C6EA 3CK0H 4P46C 4A7SA 3D4ZA 4K8RH 1XEDA 4N25A 1J9RA 1KNOA 4DP5X 5LVEA 1CPUA 4HEPG 4Z7IA 1DQQA 4KKCC 1N1SA 2A73B 2AS5M 1NANH 4FPFA 5CB7A 2WLIA 4GXLA 3ZMOA 4A6SA 4GEIA 4XBGA 3BWUF 2NY5H 5I1EH 1IUZA 1M3JA 2QVFB 3PXLA 1U8CA 2ZIDA 2CDOA 1BBDH 1FVCA 3MLXH 3QUXA 4I77H 4G6MH 4X6FB 4AC4A 4IRSB 4DN4H 1FAIL 3POYA 4O2EA 1ZE3H 1UYXA 2FEJA 3JWNC 3OPTA 3JQWA 4Q74A 2WB7A 4R9DA 2Z31B 1R3KB 1GZPB 1P2CA 2IXLA 4LORA 1TYRA 1FFOA 1WEJH 4XWOC 4I1PA 5F3IA 2QSVA 1L5GA 5F8QC 1PZUB 4ZOBA 4NPYB 1SNRA 1F3DJ 2AW2A 4XJUA 1F02I 3OHXB 4DKFH 3H3ZA 3GGWB 2ROXA 2H3NA 4F33A 5KS9E 1IKFL 3W2DL 4XMTA 5D9SB 1I8LC 3T4YB 4QB6A 2XVLA 3QULB 4Y16A 4JVUA 1S7WA 3UGEA 2OUHA 4LCYB 5AD0A 1V6LA 5BW7A 2VJXA 4JQIA 2ENJA 2NXZB 3HR9A 4K8RC 3NPSB 4JQIH 5FFLA 3B9KD 2RMU3 4Z7WB 1NUFA 3QWOA 4PJ9A 1ND0A 4RQQB 3HNVH 5SWSE 2B8MA 4F57H 4LSUL 2XQXA 4N87A 3ZLIA 4XTRC 1RV6X 4N8PA 2HCZX 3X14A 2LW8A 1HINH 1KN4L 4XC9A 4OKVA 5C07E 4XXDB 3VG0L 3IM1A 4ZMLA 2KL6A 3BZ4A 3ZMEA 4IGOA 3S34H 4JFDD 1E40A 3GCWA 2I60L 4LEOB 3BCWA 4A2HA 2B1HH 1Z0HA 4IQHA 1YQ8A 2VISB 2DQUL 1RI8A 4HMDA 3F12A 2Y6LA 5I19L 3M1HA 2GY7B 1B0GB 1A5FH 1UB5B 1WWBX 3PTRB 5EU6D 1TSRA 1XF3B 3F85A 4FQIL 1NDMB 4NQSB 4PBOA 2X2HA 4QX7A 5LKNA 4AI2A 2EEXA 3AU1B 5IHHA 4GOSA 1G9EA 5DSCA 1BECA 2CWMA 3GLDA 4ZAKD 2YU1A 1LLAA 2JKLA 4P23D 4WWNA 3AJZA 3MGAA 3IDCB 1GXEA 5DJ6A 3V9EA 1RXFA 4D6RA 3AKSA 4NQVB 5GGRB 3ZN6B 2QHRL 5HDQH 4KUZL 4X7TB 3HNMA 3BGAA 4XI5D 5T1DH 2ZG2A 3NSDA 1CBJA 3G6DL 3ZHKA 4BFEA 1SM3H 3T09A 4ZFFB 1LOCA 2PELA 1Z32X 2X6VA 3D8MA 2OV0A 4LQFH 2Y3NA 5LAXA 4XT1C 4D7YA 3IB4A 1GW0A 3CFMA 2K45A 5I9QB 3U0PB 2AK1H 5FJKA 3OV6A 1I1CA 5AKVA 3MLJA 2L7QA 1MRDH 3Q6FB 4P2RE 4E9WA 2AK4A 4HFUL 3ARDA 4PJ5A 5D7LB 3N44F 1ZZ6A 4UOW1 3EYQD 4DUWA 1HRI1 2FD6L 2UY7A 2IPUK 2OW6A 4DKEH 1H2MA 4I0CC 1R9FA 1X5MA 1QG3A 5DPNA 3RWIA 1HHKB 2BO0A 3I75B 5EEYA 2ZG1A 2R8SH 5IQMA 4FG4A 3HC2A 4M3JA 1ZLSH 2VJ8A 1EANA 4CN6A 2W59A 2W60A 1ILUA 1C16A 1LMIA 2XUWA 3ETBF 4AQAB 5ADPH 1WC7B 4FQ4A 4EN7B 1U8HB 1S4IA 4XFHA 2FX9L 4QDRA 5KXCA 1IOAA 3U14A 3KL0A 1FORH 1KDIA 1A14L 1FO0B 3QPQC 4L8DA 4BUQA 1U93A 3GHEH 2PTMA 3K2OA 1G6RB 4OCYL 5HVGB 2QDRA 1KYFA 3BOPA 1TNMA 5F88A 4Y4HD 3CMGA 1BM3H 3IPEA 3VQMA 3ZSKA 3H8NA 5CA6A 1WGOA 4M4RA 3WY4A 4YPGA 4IMLA 3PTYA 1RUJ1 4HIIA 3ABLB 3U6XA 1GCYA 1P5UB 3ZN4A 4N9OB 1AL22 3G6JB 3ACLA 3BKCL 2BMKA 4MAYC 4LHQB 2BVQA 3FAWA 4TXVB 4KFZC 4N2DA 4PJ9C 5ABJB 4DCQA 1R1A3 5F1IB 2R4SL 2BK8A 1NC4D 2YEVB 2P4AB 3EOTH 1SZBA 3WKML 3IPVA 2DVDA 2WXPA 3IDUA 2Y38A 1T7ZA 3AS2A 1OKOA 4O02L 3ZDWA 5JW4N 5BNPA 3KLDA 4ZY9A 4LLYA 1KCRL 4M7JL 2GN3A 2PLTA 4ILDA 3RGVD 4HZLB 5JZ7D 4AC2A 3WXVL 2NRDA 2OYMA 5AW2B 4ZOEA 4LLQB 3UYRH 3DX9A 3GF6A 1LVEA 5T1MB 3C08H 1JGDB 1T03H 5GM0A 2XTJD 2WKOF 4KO9A 2K78A 5E6ZA 3ZKXC 5I66B 1OPMA 1OT4A 4PLKC 2CIKB 5FCCA 2HLFD 3OR7B 1GGCL 4B4PA 1TMQA 1K5WA 2Z91B 5HDWA 1UF2C 3T0EA 4H8UA 3CSGA 4P2QE 1DCEA 1BLZA 2LVEA 3PHQB 3X12B 5F5CA 3MCG1 2N7BA 4B60A 2I5YL 2FWOB 2VSDA 3I2CH 2A1XA 3B9EA 4P3CL 3EYVB 5K0UA 4BSVA 4XB8A 3W37A 5J12C 4KKLC 3QO0B 4Q2ZA 3MIGA 5FP7A 1ETZA 4Q4X1 3HMXH 1MNUH 1M71B 3WSOA 3UAJA 1UA3A 1HX6A 1T0NB 4M7LT 4OJCA 4V1DE 5KHHA 4K7FB 4ZAKC 4QIRA 5HHMD 5T3XD 3ZRFC 5J6HA 2VVEA 4X9FA 4XJAA 2BRRH 3ZSMA 5HHME 3HRZC 1OOWA 1QPKA 4X5PA 2DKUA 4KHTH 1N1TA 1P1VA 3NCXA 5FZOA 1UYZA 4U49A 4W4ZA 4EVNB 3LD8B 1AYM2 3O6FA 4G59C 1JYWA 2P6CA 4XN1A 1JZ5A 5ACZB 4JDTL 5A7BA 4IEVA 4HVQA 2IDCA 4LK6A 2IDSA 1A21A 2VDMB 4EQ3A 4L29A 5GISL 3TBYA 5ISZD 3VNYA 4Q9QH 2QDVA 1Q1JL 4HSLA 4YZFF 2D6NA 1EJOH 3NCYS 4A04A 1WSST 4WFED 4DPCX 4Y2NA 3B2PA 4RR3C 4C8XA 1YQVH 2BY2A 2KYIA 5IW1A 3QE5A 1YPZB 5GXBB 4F7EA 1CS6A 2NY3D 4NUJB 1WDAA 4KQ4H 4PFEA 1RIHH 3FN9A 4HJ0C 4XJWA 4FNLH 4PG9A 4QRTA 4ZMPA 3QA3B 1NMAL 3TRSB 1JGVL 5E8NB 5KR7A 4BSWB 4KJPC 3RTQA 3ENRA 3R06B 4YXLL 1ID2A 1BGXH 4J6RH 4A2FA 4LHLA 4JGJA 1D6EA 5CN2A 5J4MA 5DUBB 3WD5L 4CDUA 4WKZB 3HPJB 1ORSA 4HANA 3E2HC 3EQEA 4LT7A 4X6CA 1L7IL 3D7PA 4G8EA 3LSEA 3HG1B 3KYNA 3OAYK 4NUGL 5DRNB 1KCUL 2RJKA 1V55B 1JGLH 1ML0A 1ZRUA 5DT1L 1LD9B 4BQCA 4HUMB 3W0WB 2XY2A 4XVTH 4YW2A 4HEMA 3FN0H 1IZKA 4KRNA 3S37L 1JP5A 4HIEB 4GFTB 5A7NA 1IIKA 1P9MA 3WTXA 3N2JA 2VG9A 4FNPA 2X9YA 1TFPA 5A6QA 3TVMB 3WFZA 2IZWA 2Q9OA 3WLBB 2AEQH 2QSTA 3NZHL 3HN3A 4F27A 3CHRA 1WCKA 4QX8A 5DD5H 3H1WA 3OPZA 1YECL 5B7EA 4PLJC 1BYHA 3QCTL 4KKPA 1EBPA 2GITB 4XP5L 4JFZH 4TOYL 3QG6A 3DPRB 1O5UA 4DN3L 3IFPA 5JW4M 1COV1 4JFXA 1V0AA 2K4WA 3T1FA 2X5IC 3EJKA 5FZ1A 1UVQA 3CN2A 2IAMD 2QQNH 4OI9A 4Y5XC 3KYOB 3WR0A 1U6AH 2BZ7A 3CN1A 5D70L 2VDLH 1K8DB 2JJ6A 1F4XH 1EIBA 5A16B 2HAZA 1DJZA 3DVGA 4A63A 2ZX0A 1QNZL 2X4RB 3NABL 4LLDB 4YW5A 2A3YA 5GZCA 4KQ0A 3WY3A 4XCEB 2QADD 4Z7WA 4AV4A 1VRH1 1W8ZA 4HKXB 5JO5A 4PP2A 4CU8A 4BWOA 4MQ7B 1RU9L 2J1KA 5FR3A 1WD4A 4IE7A 4FQZA 4FJYA 4DP4X 1CDYA 7CGTA 3IDMA 3MOAH 4LK4A 5HVFB 3V0WL 3B9CA 4AMXA 3POGA 3DDFA 4NQDB 3IN9A 5JHDA 3VE0A 3V5DA 4OJDH 2F19H 1ZDQA 2R1WB 2E9JA 4X9YA 3GSVA 4CGUB 1LEMA 5FZGA 3PFUA 4FQJH 1MCOL 3UO1H 3DTUB 3P77A 3PWNA 5EIYB 2J1WA 1FPTH 4IMKA 4JM2D 3HCVB 4Z7QB 5IW6B 3SE4A 1RC6A 5JMCA 1HN0A 4NNPH 3WG4A 5CAYB 1QX1A 4AYMC 4AZUA 5F7KC 1UYWH 2AERT 1JRHH 4BQ3A 3ABKB 4NRZB 3HG5A 4JPWL 5IVNA 4UF0A 3ON7A 5TDNA 3VSUA 4J3WA 3AREC 1JVKA 4WW2A 4HJ1A 4K23H 2HLAB 5TTRA 2OMYA 2VDRL 3LKSA 3PDOA 4ZUTB 2EP6A 3QH3B 5F5QA 1X7NA 2Z7WA 3WS6A 3VFVA 4F7TA 2EVXA 5JORB 1S78C 2OXHB 4KXCA 1I3VA 2G2NA 3HE7A 3IDIA 4ZFOL 1JZ8A 1T22A 5M7QA 4I09A 1D2SA 4JTOA 4I2XB 1ROCA 4IOFD 4EAEA 3GZAA 5G2NA 3HNYM 2Y9RT 2ITDB 1QSED 2BP6A 4WTZG 2DDQH 3ZR5A 2JCCF 5LBFA 2YA0A 1XAUA 1IBBA 4FXKC 4JZJC 1DR9A 5IHBA 2WNWA 3A0NA 5FZBA 1HHIB 3VNZA 3HI6H 4O4YL 3MLYH 1KJ3H 1DL7H 3SODB 2UWEA 2ZWKA 3TJPA 3MA9L 4RMTA 2XLLA 1F5FA 3LA3A 2W0FB 2YSSA 2QV2A 2VM9A 3UTQA 1GYAA 4CU9A 1A8JH 3APCA 1E4WH 1TVHB 2XKSA 3MBEA 4JCMA 4JO4H 4Y0GA 1OGAA 3U7AA 1GFF2 4OGAC 4KL1A 1AHWC 3LIHA 3P4MA 4OBSA 4S1SH 4PJ7F 5EC2B 4F92B 1PU0A 2C9PA 4MH0E 3I3MA 3EDFA 3QXTA 1MLBB 4OFYD 2WJ7A 4JCLA 5GLTA 2OMUA 1R1ZA 1OHFA 4R5TA 5T3XE 1M06G 2YFNA 4Y4FD 2W2IA 4WVVA 2HWZL 4U4IA 3AYEA 3STZA 1U3HC 2ZUSA 3T0VA 4K3EL 4UTBA 3IMNA 1HZLA 1AXIB 2W39A 4CNIB 2VBBA 4LBNA 4WSGA 4MQXD 2CO7A 4YSSA 2AJYH 1P84J 3M17A 3IU4H 3VBFC 1PZCA 3NPSC 3RKPA 1XNBA 3L3IA 4A2EA 3ZYGA 3QXAB 2YR3A 2LLLA 1EDHA 3AZUA 5GZEA 2XPGB 1U5XA 1HXS3 4DCQB 1NE6A 1W28A 4LLUB 1G6RL 3T4AA 2AC0A 1VFOA 4B9IA 3KNBB 5T1LD 1RVF3 5C5TA 3TT3L 2BDNH 2VW1A 4NQEE 1ULEA 3LX9A 3N42F 2D7TL 1LO5B 2BXYA 4MDIA 2X41A 3JWDH 3OG4B 5EUKB 3L4ZA 5KJ7E 2IH9A 2E7BA 3QIUB 1BDYA 3N35A 5J3HC 2NY3B 3CFBA 4URKA 2P2KA 4FG6C 3BO8B 1S7QA 2VC2L 4DKFL 2LVCA 2ZEXA 5BNNA 2HFFB 2EDJA 4G1MB 3LQZB 2DQJH 1CB4A 1T6VN 1ZTXH 4JRYA 3F2ZA 3MRMA 3SGEI 2RS53 1YJLA 4M7LH 4F8PA 1RUG1 5FYJU 3KVAA 4V1PA 1NA1B 1MXGA 5F3BA 1ZVSA 3WMQA 3VXRE 3SOTA 1JN6B 2HT2C 4RS5A 2ARXA 3W9DB 1FUNA 5I0SA 3ZE1B 1YMHB 4AZ8B 2FWOA 3RDTB 2JDPA 2IQ9H 5INCB 1DBBL 5G5DB 1WZ1H 3ARBA 1QFPA 3P69A 4OCWL 2ADYA 4Z78B 1D2OA 1RP9A 4CSZA 4FYSA 4M56A 1KENH 1FFRA 3BWZA 4OCMC 2EXWD 3VXSA 1MFBH 2UV3A 3C5SA 3QDAA 4H88L 3S34L 3UOAB 4B95C 5D8JL 3MLRL 1OTUD 1ET7A 3TV8A 2OJEA 4QHOA 4Q29A 1RUNA 2IDTA 5DRXA 1D4M2 3AXLB 4XCYB 5I19H 1FLRH 5D2AA 1OM3L 5KVDE 1V7ML 2R56H 4ANXA 4UFJA 3QH6A 4OLZH 3WN5B 1RQ5A 4P23A 3RZWA 1M7DB 3D3AA 3CDGB 4Y5VA 3CVHL 1VHPA 4NUPA 3D07A 1EBAA 4HG4K 1FPN1 4P2OD 1KTLA 4OSUH 3VXMD 5LDSA 5EP9A 1BKZA 1WHPA 1K5NA 3MO1B 4FQQA 4XZ4A 3GXTA 3Q2VA 2BGPA 3NZUA 3MFCA 2XN0A 5C0BE 4TSCH 4N90D 1AZNA 1Z9SA 2IXQB 1CVSC 1P1ZB 4XVUC 1BD2D 1E9QB 5EIIG 2OTWB 2CKBA 3KPRD 1FIEA 3FB8B 4QCIA 3KHBA 4BJ0A 4CEYC 4KTYA 1T0MB 4AIEA 2IVJA 5HYSA 4OLXH 2W68A 3LIUA 1RZJL 3WTYA 5FYTA 5FDWB 1J1PL 2XYBA 4YBLC 4GBXA 4LA3A 5D1XB 2FYYB 3U36A 2OZ4L 4IKLA 1SYSA 4WAFA 3V8OA 1S3KL 3BPCA 3M8OL 4GUOA 3TA3B 3D2TA 4RMQA 2FDJA 1XSKA 3RTQB 1W9FA 1DVUA 2OA2A 2UUDH 4KUCD 2Q0ZX 3L3DB 3NK4A 4JHVA 2Z9TA 4OZHF 2IWGA 4ODWA 3WINE 3IJSB 4PRIE 1JXNA 4XNYH 4AIXA 5B3SB 2V72A 1ND3C 1IRAY 3S2CA 3GYRA 4PHXA 4WF7A 1CJDA 1UWEH 1PIV1 1E3FA 3ARQA 1MWAB 2BNRA 3DBXB 3PP4H 2PHDA 2G75B 5LA9A 1DQMH 1U9KA 2GEEA 2V7HA 1IZ3A 2PW2A 4GXUM 1EXGA 2N0MA 1MFCH 2PTTB 5C9KA 1U8OB 1YJDL 5FZ6A 1CFTB 4MYPA 1A14H 3MUZ1 3S4SA 3WLWC 1U8JA 5IB5B 4ZTOL 1IGCL 3OJBA 1UU5A 3HMYA 1G9NL 3GHEL 5IR1A 1GSMA 2YPLA 5SWZA 3FCUB 4OCYH 2RR3A 3P02A 4YDJA 4AGNA 3QIBA 2ROYA 1BM3L 5C9JB 2DWYA 2DJMA 2XLGA 1ULFA 2VNRA 4JGZB 5D72H 4RISL 2UZIH 3DHJA 4YSUA 4F5CE 1KXTB 1FG2A 3N9MA 2UX6A 1A78A 2JKNA 4O2CB 4A7TA 5FQ0A 2CZNA 2EACA 4TPRL 2ZMNA 4WNSA 3KVBA 2UZXB 3U37A 4Z76B 4P59L 4ZMYA 4JO8A 3ZTCC 4JFXB 1GQHA 1SMAA 3D39A 1ND2A 5IK4A 1LGVA 4R2GD 1JK9A 1BM7A 3ISWA 1GUIA 5E7BA 2X5IA 5KHGA 3N9PA 4HIQA 2GJ6A 2UUDK 5A2IH 5GSRA 4BH8B 5TE6H 3AM2A 1RJZB 1XZ0A 3GJEA 2XC8A 3HB3D 1N0XH 4LLDA 1TTCA 1BBT2 1QGLA 2PO6C 5I17A 2Y5TB 3QBTB 3EBRA 3G5XB 3PU8A 4JMNA 3KS0H 5E5LA 3ULVL 1MCNA 2E74C 4PJAF 4TVPD 1HN1A 1T03L 2A74B 2OZJA 2XBO3 2VR5A 3FFCE 4FZ8L 4ACTA 1BK0A 5C4WC 4IOSA 4YX2L 2VLME 3DUSB 1UY2A 4J6IA 5D1QD 3F3HA 5LUMA 5J1XA 1NLRA 1KB5L 2VAUA 5FBZA 4FHKA 2YA2A 4JFFD 1EERB 4PBDA 5C0EB 2BNQB 3LIGA 4YZ2A 3AGVA 4LSVH 4ZX3A 4UTAH 5FPZA 4KI5M 1EX0A 3KGSA 1LDSA 1ZYBA 4KVNH 3WTTA 4W9DC 3UP6A 4IYKA 5D1XD 2SLIA 4XIOA 3HG1E 2YXVA 4FFIA 1QJY1 2W5PA 1QFUL 1PLGL 4G9SB 3RU8H 5E56A 1TMF1 1BVNT 2CLVA 3HMXL 3ZDZF 5ACA2 3UTOA 2V9RA 4Y1UA 4TUOA 2E59A 3FT3B 1BD2E 5B3JF 4OFVA 2V9QA 4XFFA 4AUJA 1JUHA 4LLWA 1X5LA 1QUPA 5DZLA 2NN8A 3W11D 2ZTNA 3T4YA 3VG9B 5DUML 3U2JA 4GWJA 2WS91 2EUZA 3WIFB 1I1AA 3QBQA 3FQTA 4NR1A 1HI6B 3FRPB 4W6XB 3MIBA 3WDYA 4GS7C 4NAMA 3N04A 4KHXL 3ESVF 3O6KL 1HQWA 1BEYH 3MV7B 4U2YA 3AG1B 3NRUA 1WA0X 3B2XA 5FFGA 2RR13 2BNUB 4PT6A 2RTTA 4JDTH 2OPKA 4OCSL 2ZCLL 3PDGA 4E2OA 4OLLA 4LMQE 4RRPA 2OQJB 2Q4SA 4Y22B 5ERWB 2X4SA 4QHUB 3TWYA 3VXQB 3ZL4H 1QH7A 4XI5C 1NH6A 3WFDL 2WRAA 1Q56A 1T7VA 3UEZA 3QZPA 4HGWA 3GXUA 2ICCA 3N1FC 1YQVL 3P0VH 2XXMB 2ICES 3QNZA 5JQIB 4UIKL 2ED7A 3R1GL 2EDDA 3UJQA 2DWEA 4KQ4L 2RMNA 1CR7A 4UOW0 5DQJA 1X3DA 2HJIA 4FNLL 4PIBA 1K8IA 5F93C 4QRRB 3BZFB 1RITA 3WTVA 3Q01A 2ZGOA 2JJTC 1OP5H 5CIPA 4RGNE 2OYPA 1G43A 2BXZA 2EIKB 4ZTEA 5B2GB 2NR6A 4X8JA 3NEOA 4JM2C 2JDYA 2WIMA 3HZMA 3SPCA 5FMOL 4R52A 3QIWC 5A43C 1YYNA 3N91A 4TUKH 3ACHA 1ZLVH 2WXRA 1SJMA 3DOSA 3GSNB 4Y1AE 1LHNA 1L3NA 1R5VB 1KCUH 1QDOA 4GPVA 4U36A 4PV8B 1G7MA 2HH0H 4AGGA 2QE3A 2NY6D 3PS6A 3MKGA 1F97A 2AABL 4FPKA 3MJ8A 1BBT1 1F3JB 1U8IB 3ABGA 4GJYA 4LVOB 3QNXB 3BPOC 2WUBL 3TV3L 2VB5A 4KJQC 4MGXA 5SV8A 1VADB 5HGHA 4RAVA 4PRIB 4YHPB 4WLCA 3UZQA 5CGMA 2Z7ZA 2M26A 4X8CA 1A65A 5IMLB 1NA1C 5IWLC 2XFXA 1U5YA 1YXWA 2RDSA 4K2UL 4OHYA 3RIKA 5DD5L 4XBEL 5JXED 1E9OB 4DZBB 3FJSA 1EZVX 4HAFA 2QUOA 5D4QA 2DYPB 4C58B 4QYAA 3LRHA 3GSUB 4FJZA 5TPWL 3ARFC 4Z7QE 5FDYA 4AVKA 1GGBH 2ZF9A 5H35A 2EYTA 5D70H 2VDLL 3B2UC 4UM8B 3EO6A 3TF7C 2F6AA 4FYTA 3KDMB 3HUJA 2W38A 1LRHA 1W05A 4KG0A 5IB1A 1IM9A 2JENA 1QNZH 4QXWA 1R3JA 3MJ9A 5GGUA 1CL7L 3KWTA 3ZRCC 4OT1H 2Y7MA 4DGIL 1V6OA 5CBAB 3V6OA 4G7VH 5F9OL 5HYJE 1H4GA 3CQOA 5IV2B 4IV3C 4Q8LA 5F88B 3SKMA 3VSVA 1WFIA 4HLJA 5KYNA 1RU9H 1GZTA 4FQXC 1NCWH 1VB4A 2CGOA 1PKQB 5K33A 3MOAL 3CG8A 4KKAC 4ELKB 2D5FA 1SY6H 1XB6A 3K75B 1OD9A 4N6RA 3QCVH 2DURA 3ACFA 3P3PA 1U3HD 1YYML 4NI3A 5D7KE 1I9RA 3OUIA 5DUXA 5GZGA 1ZT1A 4UWDA 1GY2A 5LBVA 4JFQB 5EYXA 4MQXC 5KS9F 1ONAA 1E6JH 2WIIA 3DK2A 5HD8D 2CIIA 1WCSA 4XQDA 5ESAA 5E00A 3DUIA 1TUPA 2DQIL 2VLJA 3TX4A 3WN5A 4NM8H 3RVTD 2LAAA 1XX9C 4OQTL 2A9DA 1HXYB 1PVHA 5GS0H 4C8DA 3F7YB 4RAUB 1H8SA 4XFAA 1HW5A 2C9AA 1UJ3B 1YC7A 1EUTA 4XNXH 4YQXH 3B94A 5J5EA 2KUTA 2CWSA 4AXOA 1AYN3 4HXAL 2D0GA 1B3JA 2ZX1A 5SX4H 1UD5A 5FUCE 2BVUA 5MEOA 1GGYA 2WUCH 5I66A 1XYPA 5FP8A 1ZEAL 2CGYA 1PD0A 4HC1H 2FR4A 1C3HA 3U4AA 3NNMA 3NFNB 1FPN2 1MR5A 4ZOCA 2Q7YB 4BZ4A 3QJRB 1P7BA 5IFHL 4JZRA 2LLGA 1QU0A 4R4FH 5KN5A 2PYEB 3H3LA 1C1EL 2C3HA 3CFCL 5ID1B 1BP3B 3W3BA 5ALCL 1F6LL 3QPKA 4GW5B 4PJFB 3PYCA 4Y9GA 5T1KD 2YQBA 2GB2A 1AQDA 5E8OA 1ACZA 3CSYA 3HC4H 3VCLB 3ARGB 2VZPA 2J71A 2HT3C 2E7DA 2UYBA 4W9KC 2X9ZA 2GTWB 1A7QH 4IRJA 4CCEA 1DL7L 4ADJA 1KGCD 4KNSA 2A4ZA 2XVKA 5IQ7H 5CCHE 5AAMA 1CZTA 2C9XA 1B4TA 2P46B 1S5IL 4P46A 4R0LB 3AMQA 3VHOA 4AEDA 2YPKB 4MFHA 2ZXEB 1IGIL 3EGDB 5FB8A 2YD1A 4F5CA 3O7OA 1TQTA 5AVPA 5DAVA 4M48H 4F1SA 3I2GA 2DUPA 1IHMA 3DKWA 3USUA 3W59A 4YXHL 1U3ZA 1QO3A 1UC6A 4R3SA 4Y16C 3M70A 5DMIH 1KJVA 1W2KT 4U3XA 2VXUH 5D96B 5A2CA 1MCPL 4M8QB 5EORH 5DJYA 3SGDH 4V11A 3CZNA 1AVAA 2GJ6E 2RGSA 1ZSDB 2R29L 3G08B 4NJ9L 3V0AC 1Q72H 2BFVH 1IEBB 3IU4L 3KGZA 4M5ZL 2UWAA 5T1JA 4O9GA 2WFF3 5IB3A 4Y1ZA 1TF4A 1YUHA 1PD1A 3Q1SL 2YS4A 5HHQB 2Y8KA 3GJFH 5IMOB 2DIEA 2B2XH 1G6RH 3DXAD 5EEXA 2ZXBA 5CFDC 2W5FA 1JHNA 1EZSA 1CBVL 4A3ZA 3MNVB 2XJLA 4PJGB 3ZE0E 5HVWA 3TT3H 4Y24A 3OR6A 3GPEA 5DMYA 4CSTA 4IETA 4DEPB 4W6WA 3Q2LA 1SPPA 3UTZA 1CLOH 3ZQXA 5TF0A 4XUPA 1AOHA 5T5NF 2Y6GA 3SY0A 3I3EA 3VXPA 4AYFA 2B9VA 1EFXA 5D1QE 5F3HA 4AI0A 1O7DC 5TDOA 1LEIA 4IK6A 3H0TB 1W6PB 2DQJL 2HJFA 1QJU1 1ZTXL 4IXLA 2AEOA 2B59B 3C5ZD 1FMD1 2RS52 3MFAA 4Y2LA 3LHPH 2VW4A 1P8JA 2WZ5A 4M7LL 2BRQA 4ECNA 4GYBA 1BZ8A 4G8AC 4EEEA 2R061 1WISA 1QBMH 4LU5L 3TM6A 5CP7A 3R7QA 5HYQA 4XPHH 1COV2 1I7ZB 4M0NA 4U1HB 3CVHA 1DFXA 4IK7A 4M1GL 4QOKB 3SDDC 2VR7A 4GSDH 4PGCB 1A1NB 5E9AA 4Q26A 3HHRB 3PY9A 3TONA 1URLA 1DBBH 3DV6B 1ZGLB 3KM1A 1R3HA 4H8VA 1YAIA 5C8JA 4Y9FA 3TNPB 5K7PA 1LEGB 4A4AA 2MH4A 3IGLA 3G9AB 3H42B 3VACA 5E99L 4BWWA 1KENL 1O8PA 3ITQA 3TEYA 3WTUA 4KJWD 2A73A 1YQCA 4RGAA 3ZY7A 5D8JH 4YE4H 1ACYH 5D1XE 3WHXA 1FL5B 4X99A 4AI7A 4IBQA 3Q9PA 4UU9B 4N2BA 4OIIL 3UPRA 3JYCA 3FUJA 5C09E 4Q4W2 3IEAA 2ZPKL 5LCVA 5DI8B 4AQ6A 4LRNL 4M1CD 4DZGA 1OCRB 2WWNA 3PAZA 3QR0A 5A6XA 1F4YL 4FI6A 4EZKA 5FYKL 3FE5A 1R3KA 3DJSA 4AEDC 3CVHH 2O93L 4UIMA 2F9BT 4XPAH 3SE9H 1BW8A 3GK8H 3OGVA 1VAMA 5HY9B 1V9U2 1FL3B 1XGUA 2V0AA 4JGYA 4U6XA 4YDLC 1I8MB 2CM5A 4ATFA 1XT5A 4TSCL 2WQVA 1S9WA 1MUJA 2FGZA 2VDQH 3MRCB 1DVFA 3L81A 3AYDA 1U8LB 1G0YR 1W91A 3VXUD 4RNRA 4JM4H 4PEEA 4PJFF 4MHUA 5C5UA 4MMYB 2HWE3 4OFQA 1OLRA 2YAPA 4BELD 4PJIE 1DQDH 3LZFH 4LLMA 5DEFB 1AZVA 3QAQA 1QAWA 3HE6A 4XF1A 4NQXB 3GM8A 3G5YB 3NIFF 2QSCH 5FM4A 1TJHH 1HOCB 4QY8B 3VUAA 3ZE2E 4LOUD 3IN2A 5CADA 3MNWA 3WEXB 1E8ZA 4MVBD 1QA9B 4IERA 3Q7JA 1Q9KB 3BESR 2D97A 1QY4A 2MPVA 1KYOJ 1XOYA 2AV1B 1SHXA 2J42A 2RV9A 1G6RA 3PMEA 1S2KA 3DROB 3MV9B 4AYID 2VXQH 4A2UA 4AENB 3K48A 3ILQC 4XNYL 2F53B 3QRGL 2OMYB 1E5UI 3ZRSA 4CBPA 2DMKA 3RZJA 1JPTL 5EC1A 1BJ1J 4XTMA 3RWKX 4ORGB 1SVBA 1UWEL 3H9AA 3PP4L 3JU9A 5FF6B 3ZQ9A 1RGSA 4L3EE 2H2PC 1N5AB 3H9ZA 1H9PA 2XZCL 1IGCH 4BFNA 3UBXI 1OAKH 2C9SA 3RP1A 5I71C 5JLVA 5JZGC 4IIZA 2EF6A 4IGBD 5A80A 2JB6A 5JLZB 1EVTC 4N53A 1KYOK 5D7HA 3CX5K 3HUJE 1G4RA 3VFSB 4MWFA 2B08A 2EDRA 1DYZA 2UZIL 4FLHA 3NWKA 2ZGTA 4AEIH 1QZNA 2F54A 1GZ9A 2EE9A 4Q4W1 2QADC 2E86A 3HBZA 1J8HB 4K94C 2UWEB 1BF5A 1PO12 4ABWA 2GJZA 2G5BA 4NN7C 2XG4B 4W4OA 1IQWH 2FEDC 4MMZA 2P3KA 1NGYB 2XSKA 4XAEA 1E6OH 4LRIC 2WLKA 1Y1UA 3CD4A 4AGPA 1WAEA 2Y0SA 2IH8A 2VN7A 2VR4A 3FO2B 4HUXA 3Q6FA 5J3HD 1JPEA 4I8DA 4AV0A 4Z5RB 2VOKA 3KCCA 4LF3A 3I9GL 1A7BA 3PURA 5BVJB 4PCYA 4HV8A 1CZ8L 2VLJE 3CZGA 1QEWA 3UBXG 4DK6A 4CSSA 3UC0H 2Q3AA 2YD2A 2VE6A 1QFWM 1CICC 2C5DC 4KVPA 4PRBB 1L9QA 1N0LB 2VLRB 3WCYA 1FV2A 1QJU2 4QHPA 3ACGA 3FUMA 4EZMA 3I59A 1RCYA 1Z5HA 4I9XA 2GK0B 2MCPL 5FZ3A 1HH9B 1HX0A 2W0KA 4HN0A 2XJVA 4TVPH 3NVQA 1Q38A 1XGYH 3VWJD 4GP5B 4I1RA 1R6VA 2NLJB 4KGGA 1MCFA 5GRUH 4CJ1A 2HWC1 2AZAA 3Q9QA 4RQPA 2W92A 3T0WA 4NROA 2AVGA 4JEGB 3TZVB 4ZAKA 3DSNB 4PJCF 2MTAA 1DP0A 4GW1B 1JU4A 4AI1A 1HS6A 2P8LB 1N1VA 4YC2B 3RE0A 2PWGA 4C0BA 1CAVB 2RR12 3SKOB 5E6SB 3P1IA 2YRBA 1F31A 3K2MC 3L9EA 4BWTA 2F5BL 3EDKA 5GLWA 4CP1A 4FQCH 4WFGE 2I24N 3CLFL 4XO4A 1M4KA 4QR7A 2WCGA 1LO3H 3LYRA 2J2ZB 1VFAB 4KRPD 1J12A 1ZT4B 2AF2A 4FYQA 3P4OB 3BRFA 3D39D 4GFXA 2LALA 5TSWA 4R90H 1THCA 1AOZA 3UCQA 3G04A 3Q44A 5DGRA 5KJRH 2Z31C 2EUXA 3O6KH 4E41D 4J23A 1AZCA 1YEGL 1GMMA 2VXSL 3KGRA 3N1QC 3NJVA 4G6AD 4XH2A 3V0FA 3RPIA 3VZMA 1LP9B 3B2VL 4H8WL 3F6JA 3CZFA 3GBNL 1A5FL 1H6UA 4GIAA 4PG9B 4PY7A 3M45A 4QRTB 1X5YA 3QA3A 2ZAHA 4LSTL 3G6AB 1ZRCA 4PW3A 3SCMA 3A67H 4A1RA 5G5DA 4HXCA 3BGFC 1OUSA 4G7RB 3FCTB 1QXPA 1IG0A 2P5EB 2FCTA 4B3EA 5FZDA 1WBYA 4AXWA 4AEJA 5IVXF 5JNYA 1USQA 4EWDA 4X0NA 2VL4A 1F1DA 3QQXA 3BVVA 4QT6A 1JPSL 2ISDA 4I9WD 2CHXA 3FZUD 3B6SB 3DX8B 1X5ZA 3GMNA 3HMWH 3LIZH 4P4RA 4WHTB 1UB6B 1A3RL 1DG6A 3E5XA 3R1GH 4I0KA 5AAMC 3VW3H 2QVIA 1JXKA 4RMWA 5BV7L 2AJUH 2FB4H 5E6IC 4N8VA 5LBCA 5C7XH 1LO2H 1SM3L 1SYVA 4C4KT 4IS6A 4DWHA 2B3IA 5I1JL 4IE0A 1HCVA 2DQ6A 2P24A 4MMZC 5EO1A 4IE5A 2ZGMA 5ICYB 1O7VA 3JVFC 4MS8C 5IEHB 3CC5B 4KMTL 3KWUA 4GQ9H 3RZCA 2AK1L 5D7JC 2E6QA 1WGVA 1MCQA 1U41A 2A6DB 2YQ3A 4WUKH 2ZKHH 5EG6C 1Z9SB 3O1RA 2VKWA 3ZSTA 2DQTH 3OKEB 5D2LB 1HJFA 1K5JA 2A6IB 3KPLB 2BU9A 2HH0L 4QRFA 4A41A 4E27A 5HHNB 4OV5A 1QTYT 1BAFH 3QG6B 3MGOB 4K9EH 3T8XA 4P9JA 3WD5A 4AHZA 3DHUA 2R8SL 4L8SB 4MYWB 1H9DA 3RG0A 3OJ2C 4K3DH 2VRAA 4P07A 5C0IA 1EAH3 2WM0A 4E41A 3U6XS 1QZ1A 4F3JA 1UO9A 2HPOA 3FB7B 2FX9H 3LWCA 4H5SB 2RS11 5AOMA 4AZZA 5F7YC 3U82B 4HOXA 1MZ5A 5BCAA 4LBQB 2JMRA 1SF3A 2QQQA 2R0KL 4GUPA 1CD0A 1HNGA 2PYFA 1J8RA 4EKJA 3FU8A 2XQRA 1DSFH 4R9CA 5HCBA 1NDGB 2O5ZH 3HZYB 3D0AA 1X9QA 2DMGA 4BKSC 3K0WA 5IW3A 4HJGA 2YYOA 5IOPB 1GGBL 4QAWA 2O6CA 2VKXA 2BIPA 2IPTL 4N0YH 1QSEE 4PGDB 1WHOA 5A2JH 3RZZA 4YH6A 4AFCA 2CALA 1U8OA 4Q0SA 1CL7H 1H5BA 3T08A 4DGIH 5B8CB 2O5YL 2QVKA 3SDDA 5TGBB 5EUOB 3WO4B 3EOTL 2NUTB 3WKMH 4RFRB 2JJUA 4KQ3L 3AMNA 1IAOA 3IFOA 4I0PD 2PA7A 2XV0A 2ATPB 4NKMA 2VNOA 2ZUQC 3IMRA 1O8SA 2O8QA 5FUPA 4F8AA 4KRMB 1BCIA 2B0SL 2FSEA 2N1TE 4P2OC 4WSKA 3UKVA 5FUOH 5FPLA 1KTDA 3J8F3 3ARVA 1JZJA 1YYMH 2ZX6A 3HAEG 3U1SH 5JOXA 1YI9A 3CFDB 4PJXB 1RVF2 3AUVA 4YDIH 4IOIB 2WNOA 3ZHNA 1WZAA 3C08L 5BV7B 4ABVA 4XP1H 4ZG1A 5JSPA 4JL1A 3C7OA 4OCNC 4EI5A 3WS3A 1Q0XH 1ZM1A 1AD0B 1R082 1NQDA 4NJ4A 2LOEA 2ZOWA 1T22B 3MGTB 1JV5B 5FP3A 3BUCA 3S5LG 3ATGA 3UADA 5FC9A 3VAEA 4WO4D 4POZD 3MRBA 2B5IB 7FABL 1KFAL 3ROUA 3EOYG 1ZBE3 3CV5A 3KYMA 1WH0A 3H3PL 4KI5E 2EXSA 2P8PA 4NGHL 4F7PB 2YD6A 2H6OA 1ZRDA 1Q9WB 2G9KA 4G9DA 5F7DA 4DKAA 3BYWA 3UKNA 4LBLA 2WUCL 5FFOA 3RX8A 2WN2A 3FH7A 4BYHA 3MQIA 1VPHA 1UT1A 1ZEAH 3H9SA 1YHFA 4LSRH 1KXGA 3IDBB 3PLQA 4OAWB 1FO0H 4CP9A 2ITCA 5JHBA 1XF2B 2X4RA 3WDJA 4XILA 2MNWA 3RWNA 1DFBH 1T21B 3L3OA 4NERA 2AJXL 4ENED 4NC0B 2X6BA 2Y1YA 4GNKB 1R24A 4IIQA 4JY5H 3MA7B 1B0WA 5B4MC 5JPMB 5K8SA 1J5HA 2Y1VA 4H20L 5EC2A 3TBSB 3QDJA 3NAPA 3MRPA 4BMEA 1HNFA 3B7UX 1WLDA 1DTUA 1E2VA 2F7OA 1ND2C 4Q4Y2 3S35X 1CCZA 1HAUA 2CLVB 4JPKH 4Y1YA 1SJEB 5ACMA 1NC2D 4P99A 3MZHA 1O5LA 1NEZG 3PHAA 2EVHA 5FO2A 1ZA3B 4MB1A 5J13C 5GISH 3KPTA 4DIQA 2QKIA 2O30A 3UTSD 4Q6IC 5GGRA 2Q8AH 3ZN6A 4Z77B 4M48L 5FF6A 2WKGA 2R1YB 5IF0A 2GSIA 4HEME 4JZOB 4RGKA 3HW7A 1EV2E 5G4MA 1MACA 3T71A 3A23A 3RUGF 3A6BH 2ZP0T 4XO9A 4APXA 3WW2A 1WUNT 2HFTA 1MHEB 1J05B 5DMIL 1H2NA 1UXSB 3LSOB 2RCSL 2WLNA 3SO3C 1MCPH 2HJLB 5EORL 3UBXA 5KYYA 1RIHL 2BIOA 3EH3B 1I3UA 2XBDA 2H6PB 3I3BA 2B42B 1NMAH 1OD7A 1S9XA 3MCYA 4C57C 1VDGA 1AR81 2LTQC 3ETSA 3KPPA 1BZ7B 1ET5A 2GUYA 5FM5O 2VZUA 3SJVA 1JZ6A 3ATFA 2R072 1BXAA 1JHKH 3F2LA 3LEGA 4B4QA 5JSOA 4LMFA 4P5TA 3Q1SH 2GSGB 12E8L 1AIFA 4JFEB 5EBGA 3BH4A 4NKOB 5BXFB 3BLPX 1I82A 2HFEB 4PU2A 2AKRB 2QV4A 3QDGB 1IGJA 1WC7A 2X4PB 5KSUB 4QU2A 1P4BH 4CADB 3VDDA 2XBO2 4OLVH 2ADGB 4CRPA 5F9WC 4QHMA 3RWEA 1AGEA 1JYTA 3NAPB 4AOFA 3S0MA 3ILPB 3GXMA 4JRYD 1DN2A 1D9KB 2WBWB 5G4OA 2ZAIA 3EHKA 3HZMB 4FQLH 3THCA 1MQKH 2EDQA 1F11B 2ENQA 3IJHA 3MOQA 5ANMA 4AYGA 4NOFA 5INCA 3BCFA 4GRLD 4KXZI 2F4LA 1MY5A 3D30A 3RZGA 4UQBA 4Q9RH 2ZNWA 4WM8C 2DTSA 3DJRA 4QRRD 1HV1A 5CJOH 3ASIA 3GMQA 1I8IB 4OTXH 2ZZQA 1NSNL 4OIBA 1KC5H 4FFYL 1MAML 1L7TL 1TQWA 3WNMA 2NSXA 2BOBB 4CGTA 4XFIA 1H8TA 3GCXA 2ZCWA 4KKAD 1FBIL 1PF3A 4FPHA 5SWSB 1QSEA 2BZDA 4RCAA 5DZAA 1NC2B 4Y9EA 3B9KB 4ZPIA 4R7DA 3GLZA 5HCAA 1L9MA 5C0ND 3N7MA 3VI3B 4P9ML 4YGBA 2BJML 4WW1B 4Y5VC 4I85A 3BKYH 1CLZH 3L2NA 5JW3L 3M4FA 1HIMH 2WLYA 5GJ6A 4NN7B 1PM4A 4YIQB 3AKRA 5FXCH 4RX4D 3L3KB 3D8CA 3T4AB 3BVWA 2IGFL 3O4LB 4DPRA 3OAZK 2W0PA 5FZMA 2BNMA 2YXSA 1OHQA 3HUJB 4IGBA 2FHRA 2FJHB 2WZPA 4J8RA 2J1YA 2PN5A 3EMRA 2C7UA 5AVRB 2F53D 5AW1B 3RVUD 4A7GF 1DBNA 4KGQA 4WK0B 4ZUWB 2VUCA 3QIWA 2BC4B 2F8IA 2YZ8A 4OFYA 4PQ9A 2WXNA 2D5HA 4TRPH 1PTZA 1LEKB 2NDGA 3CZFB 3SKJE 2ITFA 5E8AA 2DYPD 1H2LA 4Y5YB 1CESA 1KJ2A 2O6PA 3QIBC 5L2JA 1N7MH 1A4AA 3QACA 3S8WA 1M3IA 5C3IA 3NSYA 1RK1A 4ANKA 1VCBC 3GHNA 3BAKA 3DX7B 5FM5M 4WZ9A 1ZHKB 2JDAA 4NFCA 5JWPA 2OTPA 4P5MA 1VACA 3D3VB 5EUOF 3OTFA 3S7EA 2QSCL 1JN6A 4DVRL 4C47A 1KXQA 3BLKA 1VALA 2DBLH 2E31A 2G75A 2KC0A 4F9LC 3PL6A 2WXQA 3EYOA 3FONA 1KG0B 5F97E 4LXFA 1YNTF 2CHHA 2J20A 4MRCA 2YU2A 4FTVD 3SKNB 4LASL 3ARBB 1AHSA 3K6DA 1A4JA 2FECI 3CJIB 1JTPA 4ZI8A 2HWE1 4M0HA 3AUWB 1NLBH 3GBEA 3VX0A 1W8UA 3M6DA 4H1LG 3L4XA 1G9BA 3TBYB 2IFRA 3V7AE 4BZ1A 2I2SA 3HI6L 3ARZA 3VBOB 2CJUH 4OJAA 1NPNA 1MIML 5D5MB 5DU7A 2GTZA 3PGFH 2CLRB 3X11A 1ZV2A 2F5AL 5FYLD 3VWKA 3D82A 2PPFA 2Y0IA 1E4WL 5IW1B 3MIHA 3H55A 3D39B 2WZR2 1ZZCA 2ADIB 4M62L 4P4KC 1JK9B 4LGPB 5DQDH 2VDKH 5E4OA 3MN8A 2XLAA 2EE2A 4GP4B 5JIUA 3CAFA 1BZEA 1JZEA 1T66C 3VFWA 3KM5A 1XIWA 2XKOA 2BIQA 4Y9CA 2YROA 4NJAL 4BD4A 3CSYB 2QELA 1I3GH 2DI7A 4ZPTB 1DGRA 5FYYA 3F7LA 1P1ZA 4HT1L 4PYGA 1AJKA 5D1QB 4LPYA 5D71H 2XZQL 3IJ9A 4MAZA 3UAFA 1FNEA 3HFML 5EO0A 4AVTA 4BZYA 2AFNA 2HUHA 4K3EH 1IQWL 1LWRA 3L9BA 4HJGB 5HI3C 2EA7A 1U4EA 5IOPA 2ATKB 1K3ZA 5A7WA 4MDJB 1BHGA 3REWA 5J1AA 1QXJA 2P5WD 4WUUD 3ES6B 2WBJB 2R2CA 3N1GC 3S88L 2QT6A 4R4NC 1KT2A 4FJ6A 2EH7H 1KWKA 5DDJ2 1C4RA 1PHMA 2FBOJ 3EJRA 4RBPH 1OAYL 4CXXA 4KGJA 4P9YA 4ES9A 1SGKA 5JIPA 3C5ZC 2BWIA 4NO3B 2CO4A 3EXLA 4PJHB 1IPKA 1QJU3 2ZHLA 5IM7B 5C2BL 2D7TH 1ULGA 1RH8A 3FHEA 4U3SB 4BIOA 4WHYH 2A3WA 3RI8A 2GAZB 4HULB 3STBA 1H3WM 4Y19D 3S96B 2WWMD 4R4BB 1C28A 1OP4A 2HA1A 4RMBA 1M1SA 1SXZA 2XNAB 1US3A 1X5FA 1J9CT 3FSAA 3GD1C 3QUXB 2NOYA 3VWKD 4Y88A 3Q8FA 3HE6D 4QU1A 3TN0D 4DK3A 1U92A 4QRPE 3GRBA 2QPUA 2G60H 3BD3A 3M07A 1LJMA 2IGLA 1GTFA 1GP6A 1LOEA 4U1KB 1GNZA 2WO2A 3UBFA 2O8OA 2ZACA 2FJGA 2F5BH 4JKWA 5LQBH 2ZEZA 5EULV 3U30B 2EIDA 2H41A 1ULDA 3PUUA 1LO3L 4RLDA 1BVP1 3ST7A 1WZ1L 2HJFB 1NEZB 2B59A 5MEQB 2XX1A 3KW8A 1OLMA 1M56B 1YUDA 1KLFA 5C07B 4N8VG 4LCYA 4RBPK 5AD0B 3MLRH 3MDJA 4KZCA 2A83A 2XRAL 3JVGA 3PUIA 4BFFA 3B2VH 1T7WA 3MA7A 3PWNB 1KEMH 2IWKA 5FZ7A 3KPNB 1ZLDA 1OM3H 1HQLA 3F62A 1V7MH 2R56L 1KIRA 1H0DB 4EN3D 4OLZL 5HGDB 4M01A 5ACA3 2JDUA 3HJRA 1FQ9C 2R23A 2OXBA 4Q5OA 4RH4A 1EZUA 2FQDA 1MFVA 3RVVC 3QS2A 3AMPA 2WGNB 1RLBA 4UCFA 2IVIB 4I0PC 2IQAA 1BEV1 1A7NH 1A3RH 4L5FE 4XCCH 4YNYA 4YVUA 3NZ8A 3PJSB 2D31B 5F0JB 3TYFB 4DP8X 4Z3EA 3L8QA 4PPTA 3UPRB 5F2WA 3ZYHA 5E95B 3FWEA 3GTTA 2XWTA 5BV7H 2AJUL 2FB4L 3KT4A 3TFKD 1ASQA 1W6WA 2XPYA 5C7XL 2FAUA 4Y33A 4R97B 1AX1A 5J1TC 3EOAA 4O2EB 4XW3A 3A22A 3JZVA 4A6YL 2YXFA 4A66A 1UXSA 5IK7A 3T0EC 3WELA 4KMTH 4RWHA 4XCNB 5JDJA 2ZGQA 1VB9A 3T3ME 2AACA 5GGQH 5BNPC 4FE9A 2L7EA 4TL4A 4I13B 3VGFA 2PXYD 2DQTL 3I6KA 3S2AA 3OHXA 3U4EA 1AHMA 1II4E 35C8L 4QHLB 3CIHA 4AVCA 4P5TB 2YAOA 3GMRB 5CG9A 2JCWA 2KQNA 4L3ED 4Q1PA 3HE6B 5FWRA 3EJYC 3CO2A 3FQNB 1AR61 4U05A 3SDAC 2XWEA 1UOJA 2TAAA 4MVTA 3X1FA 4LO4B 1HYSD 2FT7A 1YEHH 3VXQA 1TZHA 1Q9KA 3AM8C 2VM4A 3H4FA 3MJWA 4NCC2 5HYSG 1CK0L 4WU5A 2ZTBA 1G9NH 3ARDB 5D7LA 1KS4A 3RRQA 3N50A 5BV7C 8CGTA 1A9BA 3P3TA 5HGBB 3F84A 5IV2A 5SX4I 3HHSB 4DQAA 3DX6A 4TM9A 1CN1A 3IJHB 5ANMB 1A02N 1Z7S2 2JDKA 2QQJA 2CA3A 2XICA 1QFOA 5DK3A 3OXSB 5EWSA 5EJ3A 1NC4A 2AQ2A 2KQMA 1OOPB 2EDKA 3VBHB 1L6PA 5GRXG 4K7PL 3V9FA 4ZNEA 3OZKA 4OVUA 5EZIH 5I75B 3GJAA 4J3UA 1ZT1B 1RUJ3 5IHZB 1UXMA 4OUMA 4BE6A 2XMLA 2PO6A 2I9LB 2GJRA 4YHIB 1LHOA 2DKMA 2Z35B 1LTEA 4D0BB 3FK3A 2WANA 4KQ3H 2K9ZA 4OCLC 4Z82A 2WYHA 4GAJL 1DJGA 5HPMB 1RK7A 4MWFB 3UAJD 4GKYA 3N4MA 1WAPA 1J18A 5IBLC 5DCCA 3K3NA 1EEYA 5JPNC 5FUOL 4H26A 1VB2A 4PCSA 1NIBA 3BOVA 4U33A 4XNMB 2BJSA 2XG4A 1HQRB 2W46A 4PYHA 3S8GB 5IK5A 3OKLB 3EBHA 3S7IA 5LBSH 3SZKC 1PLBA 4B5ZA 2GEQA 4YDIL 3B7SA 1SDWA 2HH9A 1Y6KR 3FO9B 4PMFA 2JJWA 4NO5B 4MJIA 1QD0A 3ATEA 2NW3A 3BJ91 3QK0A 4JFED 4QRQB 4QOKE 5T1KB 4EN8B 1U2YA 1NLDL 4F8TA 3INOA 4BGDA 1VBC2 4IBTA 4J8RB 1KITA 2OAAA 2CRIA 2FL5B 3IFLH 1LHZA 3LV3B 3PWLA 4AKQA 4ZYKA 3PVNA 2EIZB 4DPBX 3HOBA 1IILE 3OLIA 3U46B 2XKNA 5CBEB 3SO5A 3Q0HA 3POBA 1MCRA 4XCFL 1E5YA 5DRZB 2OK0H 3L5IA 3MODH 1D7PM 1JOIA 5FECB 3FS9A 4PJFA 4U1GB 1KCVL 4JRAA 1UM5L 4TKWA 4P5TD 1MRCH 1JWMA 4XP9H 1NFDE 4AITA 3ULAB 4ERSL 1QFUH 1KJRA 1T5XB 5I0WA 5FPVA 4QRPA 1HH9A 5I15L 3HAEH 5I30L 1UMZA 1LODA 3LIZA 4HLZG 1UZ8A 5ADOL 2YBSA 4BFOA 4LK7A 5FRAA 4BXSV 1BMZA 3KL3A 1U8HA 4ZU4A 5CGTA 2O14A 1DQJB 1ZV9A 1W80A 4QGNA 4GRLC 1S8DB 4C56A 2CDEB 3GNMH 2PPDA 5FZAA 3NIGB 3PNWB 1OAXL 3X17A 2ZZUT 4N2LA 3SDDD 4HFWA 3DCQA 4AM0Q 3NIDE 3EYOB 1BYPA 3FQRA 4IBYA 4V1DD 2EDWA 3IMBA 4FZEL 4YG0A 3AZVA 4PRPD 1XZWA 3EFOB 1EHNA 4ELKA 5CKQA 3PPSA 3FF8A 4OCSH 5DJYB 2A9NL 5E23A 4KJWC 4DTGL 1QJX1 3WX5A 4G70B 4AIZA 2J2ZA 4PTUB 1BQUA 2IADA 5F71A 3OSKA 4ZMXA 3IVKA 4OHVA 5KVGE 3ZE2B 4Z2AA 3FNKA 2OCFD 4RRPG 4B3VA 3QYMA 1JI6A 4BYYA 2X4OA 3O3AA 1OT2A 1NWOA 4PVMA 1UXWB 1BXUA 2Y24A 4QDQA 2W87A 4YVSC 1MS8A 3MV9E 1DUZB 3VFWB 2VGDA 5A33A 2IPKA 1PZBA 5C0BA 2JWPA 4WM8B 2CRZA 4TZDA 2VN3A 3E3QE 3UTZB 4Q9CA 3LXAA 2FGWL 4FQ1H 1IL1B 1VZGA 1UCBH 3AMLA 1FNSL 2MPAL 3FTXA 3HAEB 4OLUL 4MCYA 3KL5A 4OLYH 3MGUA 5EO0B 1Y43B 4QF1B 4LEXL 5IHLB 3NFNA 3B6SA 3DX8A 1BQLH 1HDKA 2MJWA 3IGFA 1XSJA 3H0TA 4NP4L 3P3RA 3EFFB 1BOGA 3PWJB 2V73A 5FY1A 1CF8L 1F15A 3O0RH 3TIDB 4B9CA 2H7WA 1RZIB 2WVUA 4ICWA 3VXRB 4K71C 2DW5A 5L9DH 2TRHA 4CCLA 1GKOA 5K0UC 1OB1A 1QLFB 5JXGA 3ARGA 1KT2B 1LGCA 3WG1A 3S57A 2GTWA 4IRJB 5K0UB 3VH8G 1WUVA 2Z42A 5DLML 1JDDA 2BQPA 5MP6H 5C9JA 3KCPB 4Q2ZB 3KW7A 3C60B 3EYFB 2J6EL 2DM7A 3GB7A 4Q4Y3 1WAAA 4CC0A 3JV4A 1QUNA 3ZXGA 1YY9D 4XP4L 2NZIA 5IVXA 1GGIL 2ZSVB 2A6IA 3KPLA 4FXKA 2BCKB 3QZNA 4JZJA 4FRWA 5HHXH 3IYLW 5AEAA 4BA8A 1C5CH 1LD9A 3T8MA 2WTPA 1IGOA 3QAZB 5EZWA 2W1UA 3WKYA 3ZSJA 2H2PD 2WNGA 3GZQA 3OWRA 1OWRM 5TPWH 1JVOA 1FL5A 2JTDA 1AY1L 4ZUUB 5EF0A 5I8KL 4CBZA 3BPNC 4JKNA 3LN4B 1M7XA 2ICWA 1YDPA 5C7GA 1IC0A 4JFDA 4ZDHB 4XMPL 2YSTA 4UBDD 4OZFH 1QOTA 2VUOA 3GI9H 1F6AA 4ZUSB 3RWGA 2A3XA 1SDYA 2EAKA 1XF5A 3T77A 1OV8A 5IKCB 1FJ1A 4AL9A 4PLKD 3OQRA 1RHI2 1NDTA 3CZUB 4QXUH 1IKPA 3HG4A 3ZUNC 1IM3B 1E0OB 4G9FA 2OR9H 3DIDA 2G4GA 3MUGB 5ECJE 1XE0A 1NOLA 5D8AA 4CA4A 3VN4A 2X4NA 1LB2A 2IGFH 1TT6A 2A74A 4OVVA 3SPGA 5JOEA 2BS9A 3N7JA 4G6JL 3OYWB 2PLV1 4RNRB 4X5WA 4DKTA 1UXXX 4W6WB 4D9LL 3VI3E 1LESA 1DJXA 2D93A 5JR1L 2ORXA 1I1AD 5BPPA 2NUTA 3VD0A 1E6JL 1PZ8A 1O3QA 2VR8A 3AZWA 4AMWA 4XN7A 5GS0C 3K3QA 4LVNC 3VXPB 5E6ID 1AXKA 1EHKB 3CXHJ 2GP5A 1J8SA 2UYLA 4NM8L 1PIV3 4MO3M 3OZ9L 3A6CH 5DAXA 4C83A 1RHI1 3T4VA 1YQ2A 1F18A 4U6HA 4R4XA 5H9QA 3GXDA 1ASPA 2KI6A 4MLSA 4TLKA 4D9RE 1JW6A 5CIPH 2Y22A 4XNXL 4LDLB 5FYVA 2D03H 1S7UA 2ZG3A 1EXUA 3GIVA 4XNQB 5I1AB 1K4CB 1LE5B 3TCTA 3FH5A 1AKJD 3GSQA 4G42B 4JE0A 5DS2A 3FSVA 2QDWA 2VDPH 3QR1A 2EE3A 4JM2F 1CX4A 3QPQD 1FHGA 3F01A 4HC1L 3HZVB 5GRZA 2O72A 3U0WH 1NFIB 4YSCA 3X1BA 4HLZH 1DQ2A 3MLLA 3TCLB 3ML8A 3EOAB 3PG2A 2AZUA 1AVBA 1Z66A 1IKNC 3TWIA 2BNUA 3ZYFA 4COYA 4P2QB 1DBMH 2NY4B 4OGZA 2JB6B 5TJWK 1Q9OA 5JLZA 3P9LB 5HGAA 3IGKA 4D0DA 2JXAA 5J3UA 4COUA 2MHAB 3BSZH 4NB7A 2E7LC 2H32A 3JD71 4OUUB 2COQA 3EHBD 3IJ7A 3HC4L 1AIZA 4YBHA 4PIYA 1UW8A 4LKXB 1EMTH 1W3VA 2VOVA 3BP7A 2X12A 5AW5B 1T7YA 4HJ0D 5K93A 1U3JA 2YD7A 4KZEH 1MIEH 4BQ6A 4MXQC 4JFEE 3GKZA 1FYTB 1AH1A 4F8NA 5EU4A 3WDWA 2HUEA 4GKSB 4JQTA 5CKGA 2VMCA 4XPGL 5L8JB 3FQNA 4WI0B 5DQDL 1CZVA 1PZ9A 5DAPA 6TAAA 3VM7A 4AMKL 3I2HA 1N68A 1MW3A 1W0WB 2JF1A 3TS8A 2OX0A 4NRYB 3N7LA 2CV6A 1XF1A 1IKOP 2ADJB 3S3DB 4G7QB 1NJ9B 4F80A 3L6FB 3D39E 3J4UH 3CPLB 1I5ZA 1YEFH 3QQ9D 2FX8H 1O6SB 3B7YA 5DEFA 1UCXA 5JIIA 1Q72L 3LKOA 2ORBL 4N5EC 4WZCA 3OKDB 1JWUB 1IGFH 1PY4A 2AJZA 5FLVA 2J8UB 4M5ZH 1AG0A 5IMMA 4H0HB 5GS1A 2XGXA 4UOQA 1IPJA 4RD7A 2OULB 3MLZL 3BX7C 3VYOA 3ORJA 3S5QA 4ZMQA 1QBLL 5FWEA 4AW4A 1FNHA 2DFCA 3N1MC 1VBD1 4U3HA 3K8KA 5IQOA 3PP3H 5F0PB 1FOD3 1KTRL 4L3AA 4S2SB 1OAYH 2ZOUA 2K0RA 1Y6NR 4JFPB 4RAVB 4YHPA 5LXVA 1H30A 5H8DA 3VBRC 3DSFH 1R75A 1QWHA 1NQBA 1UWXH 3D6EA 4XXCA 4CNIA 5I5JA 5LY1A 1AR1C 1Q94A 4UWQB 4A7GA 4YL4A 1UXZA 4POZC 3A4FA 4N1EA 1Q8SA 1MZZA 1FRGL 1IFGA 3VRLF 4OJFH 3JWNH 4UT6H 2QQVA 4WV1A 4JHBA 3DHMA