2W96B

Crystal structure of cdk4 in complex with a d-type cyclin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
289
structure length
267
Chain Sequence
SRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGEEGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALDPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cdk4 in Complex with a D-Type Cyclin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords G1/S-SPECIFIC CYCLIN-D1
total genus 57
structure length 267
sequence length 289
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2w96B02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2w96B01
3DTWA 4GIHA 5GIPE 3WF6A 4MWIA 2BUJA 3V04A 1PXPA 4X2GA 2PE1A 3MVHA 4O0SA 3ZM4A 1YDRE 3E8NA 5C4KA 2QD9A 3Q2MA 4NL0A 5BPYA 2JDRA 2YLFA 5B2KA 4K11A 2YAAA 4FICA 3I60A 3MIAA 2GQGA 5H8EA 4K1BA 3Q53A 4FTMA 4MF1A 4MKCA 2WTIA 5DFPA 4DH8A 2ESMA 3IDCA 4L00A 2PZ5A 4D4YA 2YJSA 4O2PA 1VEBA 4IZ5A 4WSQA 2Y9QA 5E8UA 5DBXA 1O6KA 3CGFA 3VUHA 4Q2AA 4LL0A 4UZHA 3W2PA 4HGEA 4ZK5A 2B53A 4MCVA 5EI2A 3TKUA 3HDMA 3ZONA 4C3RA 3OXIA 1ZY4A 1X8BA 4D2VA 3ZZEA 2W96B 3PA5A 4GYGA 2RG5A 4AN9A 1SYKA 5C8MA 2CGVA 3W2CA 2O65A 4RIYB 3UPZA 4JI9A 4RFZA 3ZRLA 4KRDA 4M13A 3G0FA 5CS6A 3DBQA 2VO6A 3VHEA 4AXAA 1PRYA 4K18A 3UIXA 5IUGA 2ZM3A 3SXFA 2XS0A 4H58A 4NCTA 2RFEA 4N0SA 3D15A 3B8RA 4WRGA 1IA8A 3CJFA 2W4JA 3Q04A 2YERA 4FKJA 4L01A 5E91A 5HEZA 3BGZA 1M52A 4H3QA 4JS8A 2ETMA 2UZBA 4QTCA 3NUYA 2JIUA 3GGFA 4AU8A 4C33A 4C38A 3DBDA 1PMVA 2WTKB 3P78A 1SM2A 4FKVA 4ASEA 4CZTA 1AGWA 5JZNA 4D4VA 1KOAA 4NM7A 4QYGA 1M2QA 4BDIA 3AD6A 3R28A 4E1ZA 3ODZX 4O83A 4BCGA 4CMUA 3QRIA 4W8DA 3KXMA 3UTOA 1YOLA 3PY0A 4EHGA 4UX9A 5BNJA 3GEQA 3KKVA 3TNIA 3F5PA 4EH3A 1UNHA 4JBPA 4IZYA 4R1YA 3W1FA 2R3NA 3BEAA 4DBNA 2GHGA 2IVVA 4M66A 5CAQA 4CRLA 5KHWA 2Z7SA 4AA5A 2I1MA 5LXMA 4GJ3A 5CLPA 2REIA 2QU5A 2X8IA 5AP0A 4HVSA 2BALA 2VO3A 4FSQA 3TEIA 4O0XA 5B7VA 2R5TA 1YWNA 4DITA 1J7LA 3RAWA 3UNZA 5D41A 1URWA 5I9UA 4CYJA 2V7OA 4DE4A 4DEGA 4IWOA 3VBWA 3P4KA 2OFVA 4JG7A 3EYHA 4AZTA 4RA5A 3CBLA 5EFQA 5CNOA 3TIYA 5AP2A 4NKAA 1I44A 1OBDA 2AC5A 3LQ5A 4JG8A 4TYJA 5CASA 3VS4A 1YXXA 4WUNA 2CCHA 3RGFA 4L45A 5JFWA 3NYOA 2CCIA 1H0WA 1JWHA 1RE8A 3OS3A 5ETFA 3OY1A 3AMAA 5LMAA 4IX4A 3ZLSA 3ROCA 5HG9A 5A9UA 4EBVA 4NYEA 4E6CA 5HE3A 3MH2A 3NPCA 2BZHB 4LOPA 1YDSE 2VWXA 2W0JA 1Q3DA 1W83A 2UZWE 3ACKA 1YXTA 3F2NA 1VJYA 3UQGA 5IH6A 3ATSA 2VTIA 3ZMMA 1ZWSA 3QYZA 4Q9SA 3KRLA 3PIYA 3P86A 4Y8DA 3HP2A 5EW9A 1VYZA 3SRVB 1H24A 3UYSA 3BEGA 2I7QA 3ZEPA 3JYAA 4U7ZA 3E3BX 3FI3A 4PP7A 4FTLA 3ID6C 5HG8A 2V0DA 3MFUA 4FYOA 5A4CA 4C2WA 3WI6A 3R9NA 3E62A 5HX6A 3VUTA 4IB3A 1XO2B 3QQUA 4EJNA 5AUVA 2VRXA 2B9JA 3DOGA 4Q5EA 3KL8A 4FK6A 5IH5A 3OCBA 4JBOA 3RZFA 3TWJA 4FZDB 1R0EA 1UKIA 4F0IA 3EFJA 4PP9A 5HU3A 4Y85A 3R2YA 1TVOA 4MXAA 4TXCA 1JNKA 5DHJA 5CAOA 3U55A 2Z60A 4MAOA 3ZS5A 1R39A 4D2PA 4IJPA 5CF8A 5ETCA 2YM7A 3EQGA 3QTWA 4I22A 3HNGA 2GHLA 2VTSA 3NDMA 4TKSA 4YPSA 5A6OA 3NYNA 3RWPA 3LKMA 5LARA 3ZOSA 2HWOA 4ZSGA 3ENHA 4EOKA 3UPXA 1OBGA 4DBXA 2VWIA 4PPBA 4L3JA 4MNFA 4RWKA 5DPVA 2WTWA 3N51A 5AP6A 3S95A 5M06A 3RPYA 3OOGA 3LE6A 5AP4A 4HYUA 5GHVA 1OKYA 3UOJA 2VTJA 3LJ2A 3UG2A 4O96A 1XBBA 3KXNA 4N6YA 5C27A 5C9CA 2HY0A 4U45A 3DJ5A 4UMRA 3CY3A 1J91A 1REKA 2C6LA 4EOJA 1XH8A 3ZBFA 1BUHA 3OOMA 3WF8A 5J5SA 1PMUA 3R71A 3BGPA 4A9UA 1OM1A 4E8AA 2WIPA 4QTDA 1WCCA 3Q4CA 3CQEA 3Q32A 3Q6WA 3P23A 3QZIA 5E8ZA 3DCVA 4GEOA 2NRYA 3QC4A 3NVKI 3LQ3A 3I7BA 4FTKA 5DT0A 4BBFA 4PY1A 3CR0A 4JR7A 4UY9A 3EYGA 3RBWA 4OBQA 3TCPA 3DNDA 5EKNA 3E8DA 4L43A 4DT9A 4ZTHA 3QX4A 4TYHA 1Y6AA 3FY0A 3W2RA 3VUMA 4ZTQA 5FM3A 3T3VA 3R9DA 2HW7A 4XV1A 4FA2A 3O71A 5DG5A 2EU9A 3PVWA 4TW9A 3I6WA 4MQ1A 2WKMA 3PE1A 3IG7A 3HUCA 3QD4A 4E20A 2Q83A 4FNYA 4RJ4A 3BYMA 5AMNA 4EKLA 2UVXA 1P14A 3A7GA 3HZTA 2F49A 3L9PA 4J1RA 1KWPA 3U87A 5BVDA 2ZB0A 4PDPA 3F69A 2W9ZB 4FL3A 4QQCA 4GSBA 3UO6A 4FIJA 4BGHA 5HBEA 3LFEA 3QHWA 4NTSA 3KGAA 5EYDA 3C1XA 3UMWA 3F3UA 4AN2A 4EBWA 4WO5A 5CY3A 2ETKA 3P5KA 1UU7A 1U5RA 1GY3A 3DKGA 4OR5A 2IPXA 2XIYA 2VNWA 2O2UA 2GS6A 2VTRA 4XHKB 2WB8A 3U51A 3ZO2A 3Q5IA 2WMAA 3NMUF 1R1WA 3AGLA 2AYPA 3HYHA 2VGOA 2ETRA 2UVZA 3P7CA 5EM6A 5HCYA 4D2TA 3V5JA 4C59A 4FV4A 4C3PA 4BIDA 4ANQA 2VTQA 3RJCA 3CQWA 2XH5A 5IQAA 4UN0C 2DQ7X 4FSYA 2JDSA 1REJA 3LVPA 3GCSA 5CWZA 4ASDA 2B1PA 4QO9A 1RQQA 4I20A 4YC8A 2YIQA 4PDOA 3BX5A 3L8PA 4QNYA 2R7IA 4YBKA 1E1VA 1JVPP 1V0PA 3TTIA 3SOAA 3LFNA 4TY1A 3CLYA 1H0VA 5JGBA 4O7RA 4IAAA 1U54A 3F5UA 2G2HA 4I4FA 2ONLC 3HKOA 3BYSA 3MYGA 4PNIA 1ZXEA 5LMKC 3PG1A 3D5XA 4Y46A 4X3FB 3IW8A 5KBRA 3MFSA 3MVLA 3QX2A 5DOSA 2WMQA 4J52A 4LL5A 3SV0A 4F65A 2VX1A 5M56A 4BBEA 5BVWA 1ZZLA 1PYXA 3R1SA 2OXYA 4R5SA 1F5QA 1HCKA 4BR3A 5KMLA 2B54A 2ITXA 4QTEA 1JPAA 3CJGA 3OXTA 4DFBA 4JDIA 3DJ6A 4FIEA 3DV3A 5AM6A 4GS6A 3SKCA 3MJ2A 3R6XA 3P7BA 2YCQA 4YTCA 2J6MA 2J50A 4IDVA 3R7GA 3CEKA 3ORTA 4RIYA 4C02A 2YZLA 3FMDA 4FUXA 4ZTRA 4GK4A 4IVAA 3IDPA 5E8SA 3EN9A 3BQCA 3GCUA 2B0QA 3C4CA 5CSPA 3GOPA 3OHTA 4XNEA 3C4XA 4L3PA 4M15A 4XV3A 4L42A 4YR8A 4O81A 4EH2A 3WE8A 3AOXA 4CFVA 2EXCX 4NWMA 2ERKA 4RX8A 1YOMA 4HZRA 5BVEA 4MBIA 5AAGA 4AGDA 5FTQA 3UC3A 3PUPA 4G3FA 4RZWA 4TRLA 5K5NA 2VO7A 3PJ1A 4EZ7A 1M17A 1OL1A 4FUYA 4P5ZA 4UYAA 5AP5A 1MRUA 5I9YA 5J7HA 2JFMA 2OH0E 3FZ1A 4J96A 1JQHA 3HMPA 4WSYA 5DGZA 5EYKA 5BUJA 1XQZA 1Z57A 5KMMA 4DFUA 2ITPA 5HU9A 4IAFA 1WZYA 1XH4A 2FVDA 1PY5A 5D10A 3QTQA 3W55A 3ZLXA 4BHNA 3HA8A 1YQJA 3MB6A 2XIRA 1U59A 4LMNA 2AUHA 2A2AA 2GCDA 3EFLA 2VNYA 4FODA 3TZMA 4C35A 2YIYA 2EB3A 4ZJVA 3P0MA 4D5HA 4RX5A 2PZRA 4XUFA 4JT3A 4BDHA 3LPBA 3Q9YA 3EQRA 3OT8A 4KKGA 4FKRA 4L3LA 2OXDA 5AR7A 2P0CA 4FTAA 3ACJA 5T68A 4RZVA 3D2KA 4WOVA 3PLSA 3PIXA 3PJ8A 3QGWA 1IAJA 4HPTE 3E87A 1Q99A 2GNFA 1NVSA 4KWPA 4YJTA 2WMXA 3KRRA 4APPA 2R3QA 2XBJA 2UW5A 4MH7A 4EOLA 5ANJA 4LGGA 4BKJA 3SW4A 4YHJA 3O96A 4CCBA 5CNNA 3RPSA 3GCQA 1NT2A 4OTWA 4O0RA 4X0MA 5E8WA 2HK5A 2ZMCA 4V05A 4I21A 2XB7A 3FPMA 4F63A 1OVEA 4RLLA 4QMYA 4E4NA 1V1KA 5J9ZA 3IQ7A 3P7AA 5HTBA 5CAVA 5EQYA 2IN6A 2WELA 3NUUA 2VUWA 4I6QA 2BAJA 1WBSA 3OCTA 4IACA 4IADA 3QUPA 4UZDA 3LFAA 4BVUA 4E3CA 4WUAA 4FZ7A 3R8MA 2EB2A 2XCHA 4GG7A 4V0GB 5IU2A 4DF3A 5IKWA 4DGMA 3O17A 2PVJA 4WRSA 4B7TA 3TDWA 4DH5A 4U0IA 3HX4A 3VW6A 1J1CA 3FDNA 3TTJA 3PXZA 4EOMA 1KE6A 3P08A 4DCEA 3UQCA 3IOPA 3QCYA 4IE9A 3CQUA 2GFSA 1SMHA 4U9AA 4ID7A 3GQLA 4G1WA 1UU3A 4YTFA 2WTJA 5JK3A 1OIQA 2H96A 3NNWA 3Q6UA 4RVMA 1KE5A 3G90X 4KA3A 4ZSLA 4HCTA 2CSNA 3F61A 3ORZA 4RFYA 3MTFA 4MXOA 4L6QA 3F3ZA 4U80A 5ANOA 4HYIA 3EQPA 4RX9A 4FT9A 2BZKB 5AUZA 3TZ7A 4L67A 4ALVA 5M57A 1OITA 3DZQA 4V0GA 4HW7A 1IG1A 3PJ3A 4OTIA 2VAGA 3AC1A 3PSDA 4D0XA 4FYNA 4FSNA 3AC3A 3R01A 3EH9A 4XS2A 4EK8A 3R73A 2X7OA 5M07A 3OTUA 2X1NA 4C8BA 5IQCA 2RG6A 5AEPA 3PXQA 2PUIA 4DG3E 5IZFA 3QL8A 2WNTA 4YJRA 2OLCA 3H3CA 4MXCA 2X2MA 2CJMA 4DGGA 3VIDA 4DH7A 3BV2A 2C0OA 2HOGA 4M0ZA 4MXXA 3E8EA 3M2WA 3W2OA 4AGWA 5HLNA 4YSMA 3NGAA 5AR3A 4UV0A 4FZFB 4USEA 1WBVA 4XP3A 4JL9A 2UZOA 3TZ8A 2YCFA 4O6EA 4AW2A 5J79A 4OAVB 3GOKA 4YJUA 3ETAA 3LLTA 4F7LA 2OGVA 1H00A 1DS5A 2HXLA 3UE4A 4EUUA 1GZKA 4JRVA 3RZBA 4DTBA 3PA3A 2WHBA 1GZNA 1UWHA 4IB0A 4AFJA 3BCEA 5GZAA 5AWMA 3ROYA 4E6DA 4Y5HA 4BI2A 2XK9A 1GZOA 2Y4IB 4IVDA 4JG6A 4PTEA 3K3IA 4AA4A 2EWAA 5DEYA 4J8MA 1XHAA 2R3GA 3RNIA 4RPVA 2ZM4A 2VWBA 2CGXA 5HI2A 2BRBA 4H3PA 2A1AB 4RC4A 4E5BA 2ITOA 5JSMA 1ZAOA 4WT6A 2HY81 2JIIA 4MBLA 1O6YA 5A3XA 3TV6A 4PUZA 4WG3A 3BU3A 3FL5A 2R0UA 3BYOA 5FEEA 4Y83A 3WARA 5IH4A 4JX3A 1YXVA 3PSBA 3FPQA 2Y4IC 1YXSA 2YDIA 2ZYBA 5A4EA 5TO8A 4PX6A 5M4UA 4CGAA 4I0SA 5DT3A 3UZRA 3F9NA 5CQUA 1ZOEA 3WZJA 4CV9A 3SG8A 4G31A 1UWJA 4D55A 4FIIA 5DE2A 3TT0A 3V3VA 2W1IA 3SQQA 4E7WA 4N6ZA 4BIBA 1OKZA 4DFNA 4GT5A 2UZEA 2W1ZA 3W10A 3GQIA 2G1TA 2RIOA 3RAIA 4CT1A 2IW6A 4IXPA 2HZIA 4NEUA 3VVHA 4EUTA 4QYFA 2PZIA 4ZTMA 2Y4PA 5HVJA 3REPA 2SRCA 5HE2A 4JNWA 2OBJA 2QOBA 4QP3A 3QTIA 4RFMA 1S9JA 5DA3A 4RWLA 5HNGA 1Y8YA 4A9RA 3MIYA 5A14A 1SNUA 4LRMA 3FC2A 4FV9A 1J1BA 3EFWA 5IA5A 4GK3A 4ZLZA 3DB8A 5JQ8A 1UNGA 5KO1A 3EL7A 4ZTNA 5AUTA 3WZKA 5IQFA 5AR8A 4YSJA 4YLLA 4HNFA 1PXNA 4XH6A 3AT3A 4EZ3A 3BYUA 4KRCA 1R0PA 2BPMA 2PL0A 4TZRA 1FINA 2NO3A 3QALE 3VUDA 4C62A 3E5AA 1KUTA 4FSUA 3HRCA 3PXRA 5H2UA 2XEYA 3BRBA 2R2PA 3R9OA 4FIHA 4KABA 5AX9A 3W8QA 4PMTA 2YM6A 5CAPA 4II5A 3G15A 2PULA 4F1MA 2YACA 4PQNA 4M7IA 1KV2A 2BIKB 5HIBA 4F7JA 4B8MA 4PL5A 3TN8A 5HE1A 5L2WA 3CKWA 2E9NA 1H27A 2X81A 2YITA 2XK8A 4QYYA 2GTMA 2V22A 4A07A 5HQ0A 5FTOA 3UVQA 4QMXA 4EQUA 4EK4A 3R1NA 4YZMA 3C5IA 4U3YA 4CFWA 4L9IA 2O63A 3HV3A 3WF5A 4E5WA 4FMQA 4F6UA 2I0VA 2JD5A 2BDJA 2QOCA 4O38A 2AC3A 4L8MA 2C5YA 2BAKA 5E90A 3JPVA 4NM0A 3ZSHA 1I09A 2RGPA 2C1AA 3V5PA 1NVRA 4QPMA 3ET7A 4U97A 3QYWA 1JAMA 4LI5A 4YO6A 4AT3A 4BFMA 5BVOA 4BZDA 4FSMA 5IG1A 2ONLA 3EN4A 3V6SA 2ACXA 2ZV8A 5DIAA 3T9TA 4FVPA 2C6IA 3I5NA 5FP5A 4I5CA 4AE9A 2R3MA 5GJGA 4G3GA 4NFMA 5BVNA 2UZVA 3EQFA 4C36A 4X2NA 2JFLA 2ZOQA 5JGDA 4WA9A 2H6DA 3O8TA 1NW1A 4DEAA 4NSTA 3Q4UA 1SVHA 5CANA 4O7WA 4B9DA 5EG3A 4M8TA 1Q62A 3HV4A 5IUIA 4A4XA 3EKNA 1Y6BA 4O0VA 4QMOA 3VF8A 5KX8A 4EH4A 1H25A 2IZSA 4ZZNA 4O6LA 4TT7A 2C0TA 2X6DA 4WBOA 5JMSA 3Q2JA 2VZ6A 2H9VA 3QWJA 1XH6A 1Q61A 1O6LA 2QR7A 3UZTA 3DK6A 3MPTA 3OCSA 4W4WA 3ULIA 2W5AA 4MYGA 4YU2A 2XRWA 4G6OA 1OIYA 2ZM1A 3DFAA 4JAIA 2J2IB 4AWIA 4C0TA 3FZSA 3F7WA 4BDEA 4FIFA 4O0YA 4F64A 1OL7A 2ERZE 4FG7A 4QMTA 3QCQA 4NJ3A 2XM8A 4H1MA 5DI1A 5AUWA 2NNWB 4HGSA 3OMVA 1YXUA 2C30A 3TG1A 1DAYA 3WZDA 5J9LA 4WG5A 3PVGA 4FV8A 1QCFA 2R3HA 2G2IA 5BYLA 3FEGA 3DBFA 3KMUA 1IA9A 3OWLA 3MA6A 3GBZA 2X4ZA 3B2WA 5ITAA 3M42A 3VULA 2Q0NA 3F3VA 4IEBA 4FTUA 5JRSA 1GIIA 4Y72A 3NX8A 3VBVA 3IW6A 4GRBA 2X2KA 5G1XA 3KXXA 1G3NA 3RAHA 4FKQA 4OT5A 3CS9A 2I0EA 1LEZA 3QTUA 4KKHA 5DR9A 5AV0A 3RVGA 3QD0A 4Z7GA 3U54A 2F57A 2R0IA 4BRXA 4ENYA 3EOCA 2W5BA 4RIOA 1K2PA 4FT5A 4AOJA 5IMEA 4U5JA 2H8HA 4M14A 3MH3A 2JDVA 4IAKA 1QMZA 3FKLA 1TQPA 3WIKA 2GNHA 4XLIA 4U42A 5TR6A 1IAHA 2JBOA 3MTLA 4USDA 3RWQA 3MA3A 1ZARA 5AX3A 4J98A 4RIWB 4ACCA 3IPHA 4XG3A 4CVAA 3WBLA 3KU2A 3QRUA 4FKSA 4A7CA 1M14A 3ZXTA 3NWWA 4IWDA 2JDTA 4QTAA 3A8XA 3CGOA 2BHEA 4J53A 3WZEA 2CKPA 3EQHA 3MVJA 4AT5A 1KSWA 4GT3A 5K0XA 3FHIA 3G0EA 5HKMA 4FV1A 4DN5A 3BYVA 3O7LB 4MTAA 2BFXA 5J95A 3UMXA 1LP4A 2Z2WA 3NYVA 3KXZA 3QA0A 2NP8A 1XH9A 2GPHA 2R64A 3MJ1A 4ONAA 2HCKA 3R9HA 4AQCA 4MD9E 1RW8A 2ZDTA 4IQ6A 4CKIA 3VBTA 3LOKA 4J8NA 4WIHA 3BU5A 4LRKA 4TPTA 4YJQA 4E26A 2VWUA 4QMNA 3OD6X 3BBTB 3KCFA 3DBEA 2Y6MA 2HZ0A 4FT3A 2B7AA 3SD0A 2W9FB 3QCSA 3POOA 5FWKK 3F3TA 3RM7A 5KUPA 5CU3A 2YCSA 3PDTA 4O91A 1PXMA 1JKSA 4R3RA 3K54A 4D0WA 2WQOA 4YJOA 4RBLA 3S4QA 2UW3A 2VGPA 3MPAA 3CTQA 5KZ0A 2X9EA 1Q8TA 3W8LA 2HYYA 4XG8A 2A4LA 1U4DA 4EH7A 4EORA 3MY5A 3LM5A 4I24A 2PYWA 4USFA 3RK9A 5J87A 2VX3A 4S2ZA 3KRXA 3O7LD 4ZY5A 2W4OA 3G6HA 4DYMA 3UBDA 2FSMX 1YHVA 2PE0A 3DS6A 2QOKA 3RM6A 3U8WA 3ZC6A 2GNLA 2ITQA 1WMKA 3CPBA 2QO2A 5EKOA 1YI4A 5DRDA 1XJDA 4AOTA 4BKYA 2P2IA 4WNKA 4X2KA 2J5FA 4BYJA 4M69B 4PMSA 4DTAA 2CNVA 5LWMA 2PMNX 3LCOA 2CLQA 3MBLA 3MVMA 3ORLA 4JVGA 3GB2A 3QZFA 2E9UA 4FNWA 2CN5A 2W7XA 4YHFA 1JOWB 2BR1A 3ZO4A 2YHVA 4DC2A 2PMLX 3FKOA 1FGKA 2QHMA 4ERKA 2XNEA 1BMKA 5BMSA 3FSFA 2WQBA 4A06A 5BYZA 5IDNA 4XCUA 2Z7LA 3KN6A 4FNXA 4AF3A 3I0QA 5EW3A 2UUEA 5HORA 5C8NA 4Z9LA 3R1QA 3W2QA 3ZUTA 4JLCA 3TIZA 1UA2A 3IOKA 3LJ0A 3DBCA 5EI6A 4YBJA 3R8UA 1H07A 4KB8A 5F20A 3N4TA 5FUTA 4BCIA 2PVMA 3CY2A 3OFMA 4WD5A 3BLRA 3FYJX 3TKIA 4TWNA 3HAVA 3H10A 4AGCA 1FGIA 4EK5A 4AUAA 2WEVA 4FKLA 4QRCA 3LCTA 4OTRA 4U6RA 3C0HA 4ZS0A 2QODA 5M53A 3R21A 4YHTA 1ZLTA 2CGUA 4JBVA 3OZ6A 2PVHA 3UNJA 2J51A 4KSPA 5CVGA 1OKWA 3S1HA 4CFXA 2XCKA 4QP1A 5FQDC 3HUBA 3SW7A 2J0JA 1BI8A 2YABA 4LV8A 1SVEA 1HCLA 2C6OA 5TF9A 1H1PA 3NUXA 4IAZA 3DAEA 3EN7A 3EZVA 2RFSA 3VHKA 1H08A 5HBJA 3EQDA 3GU6A 4IAIA 3ZU7A 4CLJA 3HAMA 2C47A 4O7NA 4B4LA 2ITUA 2C6EA 4ANMA 3KREA 5AFVA 4GH2A 3GT8A 2C69A 3ALNA 4RSSA 3UOHA 4EONA 2R3LA 2XK3A 2XYUA 3LMGA 4H36A 3F2RA 4OTDA 4KSQA 4EH9A 2YCRA 2IZTA 3DAKA 1ZOGA 4HVDA 2RFDA 5DR2A 4YC3A 4FSWA 5E7RA 1ZZ2A 3FYKX 2YEXA 3BKBA 4JQ7A 3NRMA 5EHOA 2CMWA 4HCVA 3CCNA 2LAVA 4F1TA 2ZB1A 1H1WA 1WVWA 3GVUA 5CTPA 5ANIA 5EHLA 5LWNA 3TNHA 5HCZA 2YM8A 1OIUA 1H1QA 3GC8A 3NUPA 5BUIA 3R2BA 1BYGA 5FG8A 1KOBA 5AIKA 4RJ6A 4W4VA 4D58A 4DAWA 4FKGA 5BX0A 5F4NA 5IDPA 4GKHA 1A9UA 3IO7A 3ORXA 3VS5A 3COIA 3S2PA 3EN5A 2JC6A 1F3MC 4YZBA 1XKKA 3C51A 3MW1A 4XV9A 1UU8A 4IFGA 2PE2A 3AGMA 4CCUA 3V51A 1H8FA 2YJRA 1MRVA 3RHXA 2XIZA 5BVKA 2OZOA 2C6DA 3E7OA 2W05A 3SHEA 5AA8A 3U9CA 1JSUA 3UOKA 1ERKA 1WBTA 1G8AA 2WMSA 1W82A 1PHKA 2HWPA 4UWBA 4HOKA 4R5YA 3GC9A 3Q96A 3NW5A 5CSXA 4I94A 3QRTA 1LPUA 4QMWA 4QPAA 5JN2A 4RMZA 2W99B 3QQJA 2OF4A 2WTKC 3TKHA 2J90A 3JUHA 1VZOA 4RC3A 3VS6A 4DLJA 4QMLA 4ZOGA 3BHYA 1LR4A 3G33A 2HAKA 3MSSA 4U8ZA 5E1EA 3R8ZA 3RHKA 1CDKA 2X2LA 1G5SA 3LW0A 3QXPA 4IZAA 1M2PA 3UP7A 3G5DA 5JZJA 2I40A 1TQIA 4FG8A 4G16A 4FEVA 2X39A 4GU6A 4OTQA 1U5QA 2WTVA 4TYIA 1XWSA 1OB3A 3CD8A 1YWRA 4R6VA 3FMJA 3ZRKA 4NH1A 2QKRA 3R9RA 4ZZMA 4IM2A 3HEGA 5CZHA 4ZMEA 4MBJA 3VRZA 3VBXA 3BHUA 3PZHA 4F0GA 4UMPA 5J9YA 4EYMA 4LV5A 5J7BA 4MD7E 3TL8A 3KY2A 3QD2B 2I6LA 4FSRA 5EYCA 3ZYAA 5EQPA 4HYSA 2X6EA 5FXQA 4WNOA 5FGKA 5AAEA 4F9BA 4A9SA 3SA0A 4FOBA 1YHSA 2OFUA 1S9IA 4IVCA 5D7AA 3RAKA 5ANEA 4FX3A 2WO6A 2VX0A 3BHTA 4EWQA 4F7NA 3RK7A 4XV2A 1BL6A 2PVKA 4FG9A 5FRIA 2XNMA 2XVDA 3FI8A 1JKLA 5H9BA 3PY1A 4XG7A 5CEMA 2A0CX 2B9IA 2E9VA 3NZ0A 3R63A 3I81A 4RQVA 5CF4A 2OH4A 3AMYA 3KRJA 4UMUA 2YN8A 2R7BA 5IA2A 3ORNA 4E73A 3R7YA 4XRJA 3WYYA 3L9NA 3A4PA 5A46A 1ZYLA 3QF9A 2JAVA 1FBNA 2JBPA 4AS0A 2JKKA 3R7VA 3CSVA 5HICA 4R7IA 3BV3A 3DZOA 4MX9A 4QMZA 4QMMA 4QQTA 2JLDA 3VQHA 3SXRA 4HVGA 4TWOA 4QT1A 2OZAA 4LM5A 3G9LX 2GMXA 1SZMA 4FTCA 4PWNA 2QHNA 3LFQA 4YLKA 2JDOA 3E7VA 5C03A 2PU8A 2R9SA 4BCNA 3DDQA 4AW0A 4O0TA 3KA0A 5L2QA 4RC2A 3QA8A 4ZY4A 4K77A 5L2IA 2XNBA 1QPJA 3DFCB 2C68A 3PZEA 4IB1A 2W1EA 5KZIA 4AZFA 5L2SA 5CX9A 5HVYA 3VC4A 1L3RE 1T46A 3ZC5A 1GIJA 5CEQA 2OIBA 2R3KA 3A4OX 5IA3A 2QLQA 3COMA 4C4EA 3Q3BA 2JGZA 2QOLA 3QLFA 1WVYA 4J95A 4S32A 1OUYA 1GJOA 4XG9A 4ASXA 4L53A 3UO5A 2BKKA 4Q5HA 3KFAA 4U41A 3H9FA 2GU8A 4RT7A 4O84A 2VTLA 4HGLA 1Q8UA 4YLJA 2WMRA 2OF2A 3M1SA 4FKIA 1PYEA 4EK3A 4YJPA 4FEUA 4R1VA 3BHHA 1EH4A 4XP2A 2XK4A 5AUUA 5FDPA 4BCMA 1FVRA 2R3RA 5I9VA 4L46A 3TXOA 1P5EA 4BCPA 1PXJA 4U44A 4EC8A 3OCGA 2UW0A 2QONA 2PZYA 3OTVA 3V6RA 3KXGA 3U6JA 4CXAA 2EXEA 2XA4A 5AUXA 1Q97A 4RJ5A 2WAJA 4YO4A 4PDYA 3C4EA 1H01A 3UVRA 4J7BA 5K0KA 4AZSA 5M4CA 3TM0A 2W1HA 2FB8A 3QKMA 3ZO1A 1IASA 4H39A 3PA4A 4PL4A 2QOIA 2OJIA 4UXLA 3G2FA 3NCGA 3EMGA 3DXNA 4GYIA 5J8IA 1B6CB 4ZJIA 3UNKA 5HO6A 1WFCA 3H0ZA 1UU9A 2OK1A 4E4LA 5CU0A 5CZIA 5ANKA 3ORPA 3CC6A 2BDWA 3OWPA 4KS7A 5I9WA 2O5KA 3JVRA 4ZEGA 4EC9A 4WNPA 4X2JA 4BDCA 5G6VA 3NNVA 5LCKA 4EOSA 2C4GA 2WMBA 3Q9ZA 1AQ1A 3LFFA 3AC4A 2RF9A 3Q4TA 3UDBA 3AC8A 3C0IA 4X3JA 4ZTLA 2QO9A 3D83A 3PVUA 2YIXA 4UMQA 3FZOA 3LXLA 4XMOA 3DLSA 3A61A 4HVHA 4WKQA 4A9TA 1URCA 5FBNC 4C7TA 1GIHA 3JY9A 5M55A 1BKXA 4AGUA 1OGUA 2BRGA 5I5ZA 2BZIB 3HECA 3HP5A 1TQMA 1BLXA 4QNAA 2OU7A 3GENA 3PLAE 3ZSGA 4D4RA 3D0EA 2BTSA 4ARKA 1HOWA 3HDNA 4LMUA 4FTQA 5IPJA 4FSZA 3ORIA 3H9RA 4D28A 4DEEA 4D1XA 5CEOA 1ZY5A 1Q8ZA 2E2BA 3PP1A 3V5TA 4I5HA 4JBQA 3ZFYA 3ZHPC 3K3JA 5FBOA 4ZJJA 3R8VA 4L44A 5TOZA 4I93A 4BI1A 1ZMWA 4DEBA 4AW5A 4DEHA 4ZZOA 4I1ZA 4DH1A 2VV9A 2OJGA 3OY3A 2P2HA 5CU2A 1J7UA 4O27B 1BX6A 4FOCA 1WBNA 2Z7QA 5FXSA 4FEQA 3ANRA 5EM8A 4IB5A 2XK7A 3CTHA 2UW9A 4I5MA 3VNTA 2QR8A 2R3JA 3FZRA 3KVWA 4BDBA 4F4PA 3ATTA 3IW4A 3ZEWA 5CYIA 2PUNA 4X3FC 3VS0A 5JFSA 2Z8CA 4R77A 1NVQA 2WQEA 5HE0A 4MD8E 2JAMA 2ZVAA 3OEZA 3U4UA 2BAQA 5JEBA 2I0YA 1WAKA 1CKJA 1M7QA 1JSTA 1DI9A 5ANDA 3W18A 3ODYX 2BKZA 5F1ZA 4Z3VA 5CF5A 5HZNA 1CTPE 4FVRA 2BCJA 2V7AA 4NIFB 5CENA 4FTNA 4QP9A 3IDBA 3V01A 3TNWA 4C61A 5K9IA 1JBPE 4PPAA 5E1SA 3TV7A 2P33A 5EHYA 3FMLA 2GNJA 3ULZA 3R7UA 2FUMA 3VS2A 3U6HA 5L6WL 4HPUE 3OG7A 3ANQA 4NM3A 3I1AA 5KNJA 5M4FA 5ACBC 3Q52A 3ZRMA 4KAOA 3D9VA 4FKWA 1J7IA 3DDPA 2J0MB 3EFKA 3QUDA 4C4FA 4BTJA 3SVVA 3ORMA 1IEPA 5H8BA 2ZDUA 5FXRA 1GAGA 2R4BA 5CEKA 1STCE 5KKRB 2JIVA 2QQ7A 2C6TA 5HOAA 2IW9A 2JKMA 5GZ8A 4UB7A 2XM9A 2J7TA 3R02A 4O1OA 1WBOA 4R7BA 3E3PA 4G17A 5IEYA 4G3EA 2OKRA 5CVFA 3DPKA 4O22A 2PPQA 5EDRA 3RINA 4QYEA 4ANSA 3D5VA 3OW4A 2HW6A 5AA9A 4JAJA 2WQNA 2DS1A 2UW7A 3AG9A 4CD0A 4S30A 3I4BA 3G6GA 2ZMDA 2XUUA 3KN5A 3O51A 4FSTA 3DY7A 4FF8A 4JIKA 4QQ5A 5A54A 5IISA 4RIWA 3RI1A 1BI7A 4HJOA 5M4IA 3PIZA 4LQMA 4DFYA 2OW3A 3CP9A 3PPJA 4YJNA 2W1CA 2DUVA 3DGKA 4ZTSA 3ZSIA 2WU6A 5T6KA 2RSVA 4CLIA 5FEQA 2PMOX 5HHWA 4K8AA 3CTJA 4KBAA 5IQGA 2R3OA 2WZJA 1R3CA 5KKRC 5AUYA 3DK3A 2VU3A 4KNBA 3MESA 4YNEA 4TYGA 4M84A 3ZUVA 5CU4A 5HIDA 3LM0A 4CG8A 4BCQA 4I41A 2WPAA 4DEDA 4E6AA 3QQLA 5JRQA 2IO6A 4NFNA 4BCJA 3CE3A 4BI0A 5IQHA 3S00A 3IS5A 4FL1A 3D7ZA 5D11A 3L8XA 3NUNA 4RJ8A 5DN3A 5DR6A 2HENA 3VS7A 3VJNA 3HMOA 4DGOA 3NW6A 2OZAB 3ZFXA 5LMKA 4KUJA 5JFVA 3KK9A 3R00A 3SOCA 4IFCA 4DGLC 3Q60A 5LMBA 3BZ3A 1W84A 3QTRA 2WFYA 3R8LA 3BE9A 3O2MA 3AQVA 2QC6A 1ZMUA 4G2FA 4JJRA 4CSVA 3BWFA 2WMTA 3A8WA 2YA9A 3QU0A 3PFQA 4F7SA 4XYFA 5JGAA 3FLWA 4B99A 4LOOA 3TUDA 5I0BA 2C3JA 3FLZA 2WMWA 3JXWA 2G2FA 3LFCA 3ORKA 3VJOA 5HGIA 1JSVA 3BWJA 5IQEA 2Q0BA 3GU7A 5CSVA 1Q24A 3FBVA 4OUCA 2VD5A 4EH6A 5GNKA 5GJDA 2C5NA 3PJCA 4BZOA 5L2TA 3G51A 3QQGA 3MH0A 3TUCA 2Z02A 3BPRA 5B2LA 1W98A 4YMJA 5EM7A 4OTGA 5IEVA 1LUFA 3EQIA 3AT2A 3D94A 5LCJA 5HCXA 2ITZA 4PMPA 5FDXA 1WBPA 3D2IA 1OL2A 4D5KA 4KIQA 4M3QA 4XG4A 4U40A 2DWBA 2QG5A 3RP9A 4E93A 1ND4A 3DXPA 4D9UA 5BVFA 3PXKA 4ZAUA 4GU9A 4C4IA 2ZAZA 1FOTA 5CXZA 3QQFA 4GJ2A 2PUPA 3CKXA 4M97A 5AIRA 2EUFB 2HELA 4CFNA 2CKOA 2CNQA 5ANGA 2FA2A 2OICA 3A2CA 4EOIA 4ZLYA 2OJ9A 4GW8A 3UZPA 4QTBA 4BTFA 3DKCA 3KC3A 3NNUA 4TYHB 4F9YA 4RWIA 2J0IA 2P3GX 3PJ2A 4JOAA 3CXWA 4GKIA 1Y91A 2J0KA 3ELJA 3QD3A 4XEYA 4CEGA 2R3IA 1CMKE 3MGYA 3QXOA 3IGOA 1QL6A 3FMEA 3VUKA 3E64A 2W06A 1NY3A 3PE2A 4M69A 3F3WA 4P2KA 4APCA 2XEZA 4N57A 4GG5A 4G5JA 3HGKA 4R3PA 2C5OA 2VTHA 3O8UA 4D1ZA 3L9LA 4YUQA 3KRWA 3HV6A 4QD6A 4F6SA 3BHVA 2VWWA 4ZS4A 4RGJA 2NRUA 2PY3A 4O7LA 1YDTE 4P4CA 3BIZA 4FTTA 5IA1A 2IWIA 2FO0A 2QCSA 4TWPA 2QOFA 3OUKA 4AP7A 4NJDA 3VS1A 4ASZA 5M44A 3NIEA 5EQEA 2O8YA 2B9FA 4I92A 4GFMA 5D12A 3IECA 4IJ9A 3OBJA 1Q4LA 3N9XA 5CI6A 5FLFA 3JS2A 3FMKA 4PPCA 4EHZA 1Q5KA 3NW7A 5E8XA 5EM5A 4RJ7A 2ZV2A 1PXLA 3MV5A 4IM3A 4Y5QA 4BTMA 2HZNA 4BHZA 5CF6A 4YTIA 2C1BA 4RG0A 5CU6A 4AACA 5B0XA 5HD7A 2PVFA 2H34A 3FZPA 1B39A 4A4OA 4C58A 4ZMFA 1W7HA 5KBQA 3TNQB 3N4UA 3PXYA 3V5WA 1DAWA 3R7OA 5K4IA 1MRYA 3QFVA 2Z7RA 3NNXA 1XBCA 2YWVA 4FKOA 4P5QA 5AP7A 4QMUA 2E9OA 4FEWA 4OT6A 3E8CA 3OROA 4JR3A 4PV0A 3DKFA 4NIFA 3RALA 3Q5ZA 4AW1A 4HVIA 2OJJA 4QP4A 2UZDA 3GU8A 4I5PA 3HV7A 4IX3A 3I79A 5JFXA 4NCTC 5HVKA 4E6QA 3LLAA 4G5PA 3E93A 3FQSA 4C3FA 3HA6A 3R1YA 3QRJA 4L68A 3MH1A 2OSCA 3OW3A 4WHZA 3W16A 3FZTA 2YIWA 4PMMA 3JR1A 2UW4A 4BC6A 3FXXA 3DK7A 3GNIB 1AD5A 5TT7A 4ANNA 2VTMA 2DYLA 1V0BA 2G15A 4EI4A 2QU6A 5H3QA 1M2RA 1CKPA 5KMOA 3ZDIA 3DLZA 1KE7A 4K2RA 3HV5A 5I3RA 2OJFE 5A4QA 4AZVA 5IQIA 4GUEA 3ITZA 3KVXA 4PDSA 1APME 4YZDA 4CRSA 1DM2A 2FH9A 4XP0A 4JDKA 4U79A 4X2FA 3B8QA 3O23A 5LVOA 4XBRA 1KV1A 5E9EA 3AD5A 1YVJA 4JIAA 2PHKA 4RIXB 4EL9A 3FLNC 5AP1A 3VRYA 4BCHA 4W4XA 3WOWA 4RA4A 3RTPA 1OI9A 3LXNA 3R22A 5C8KA 3V8TA 5M09A 4EWHA 5IUHA 5K3YA 1QPDA 3I7CA 4I4EA 3KMMA 5D1JA 2NPQA 4N4SA 3ZBXA 5LJJA 5L8LA 3MI9A 2GFCA 2BILB 4ERWA 2XKDA 4GMYA 4O7TA 2GTNA 5CSHA 4ACHA 4AZWA 3AC2A 3K2LA 4ITJA 1JKTA 5A4LA 4I6HA 4NW5A 5EK7A 3KQ7A 5IA4A 4U3ZA 2X8EA 4ZP5A 3V5QA 4XOYA 1PXKA 3R7IA 3TNPC 4PNKA 3O50A 3E88A 4IWQA 3WF9A 1WVXA 4ANOA 5LVPA 4KS8A 4O0WA 4H3BA 4ENXA 4YZCA 5HO8A 4AAAA 1FPUA 3SC1A 3ZM9A 5B2MA 3FKNA 5L6OA 4IDTA 5IMXA 2QO7A 3VAPA 3BE2A 3UC4A 5H8GA 3KCKA 3LAUA 5ETAA 4DLIA 1OUKA 3QWKA 4DEIA 3L9MA 3GP0A 2CN8A 4MVFA 4R3CA 3DT1A 5HIEA 1H28A 2WEIA 4P90A 2J5EA 3L8SA 1Q8YA 2YM5A 3OWJA 3H4JA 2VN9A 2F9GA 3F5XA 2GNGA 1UVRA 1T45A 3Q9WA 4XX9A 3ZH8A 4FV7A 5KMJA 4UWYA 4DFXE 3EHAA 2YWPA 2XNGA 1E1XA 3EWHA 3AMBA 4BWPA 3UO4A 4IANA 3HLLA 2C3LA 2XNOA 3A62A 3QZGA 4GCJA 4IIRA 3EL8A 4E4XA 4AFEA 3NYXA 2FYSA 3VUGA 3G9NA 2F7XE 3DQXA 3FQEA 3OP5A 5FP6A 3VO3A 4FGRA 1A48A 1SNXA 5AV1A 3C9WA 2XJ1A 3THBA 2C3KA 3A7IA 2XYNA 3PPKA 3LJ1A 3GXLA 3PXFA 4EKKA 4W4YA 5AAFA 2BMCA 4BWKA 4OTPA 3PWDA 4CFFA 5CAUA 4FVQA 2Y8OA 3ZCLA 5EW8A 3ZLWA 4DHFA 4PL3A 3E92A 5DRBA 2VWYA 2PWLA 4EH5A 3L1SA 2W1DA 5DNRA 2GNIA 2UZNA 4Q9ZA 4V04A 3RPVA 4IHPA 3PTGA 4F99A 4EOOA 3HMIA 4IW0A 4R8QA 3UQFA 3B2TA 3GCVA 5EI8A 3IONA 2CHLA 4TN6A 4KIOA 4W9XA 4FR4A 3MFTA 5KMIA 5AV4A 3H0YA 2VTOA 2C6MA 4CMTA 4QMPA 4TNBA 4KD1A 3LFSA 2BROA 4LG4A 2ITWA 2XKEA 4XBUA 3ZFMA 4EK6A 4G34A 5HLWA 3LXPA 3ZTXA 2E9PA 3A99A 4JDHA 3MS9A 4BL1A 3V8WA 3KMWA 4FZAB 3VBYA 3D7TA 4O7ZA 3OEFX 4F9AA 4DT8A 4M0YA 3UGCA 4FTRA 5BUEA 1RDQE 4BDKA 3HRBA 3PRIA 3FI4A 3TDVA 4YZNA 3V5LA 3LFDA 1QPEA 2VWZA 2BRHA 3JY0A 3VWAA 4BDFA 2XRUA 4BDAA 1CSNA 3RNYA 2Y7JA 3AD4A 3FLYA 3WZUA 4F9CA 2JITA 3SGCA 2PUUA 2BRNA 2J9MA 4MWHA 4MF0A 4E5AX 2QOQA 2VTPA 4DGNA 1XH5A 3UIBA 1FVTA 4O21A 3FJQE 4A9YA 1YKRA 4C4GA 4UBAA 2XZSA 3MPMA 5KE0A 2VTTA 3P79A 4RRVA 4CTCA 4CKJA 3D5WA 4S33A 3VW8A 3DA6A 3KULB 1ZYCA 3P1AA 4RVLA 2PVLA 3AXWA 1Z5MA 2YIRA 1H1SA 4QMQA 3BQRA 4BZNA 2ITVA 1GNGA 5DH3A 5DVRA 4DH3A 5I4NA 2WMUA 2W4KA 4LOQA 5CEPA 4IMYA 4LUEA 1K9AA 4TNDA 3D14A 4GVJA 4JQ8A 3GCPA 5IF1A 5L6PA 1OPLA 4DFLA 1P2AA 2CPKE 1KE8A 2WU7A 5TE0A 4FBXA 4FZ6A 1OL6A 3TJCA 5IA0A 2PVYA 5E8YA 2WMVA 3T9IA 3GC7A 4QPSA 4H05A 3PP0A 3F6XA 1VR2A 3EIDA 4YPDA 5HTIA 3OBGA 4FEXA 2WOUA 4FGBA 2C5XA 2W1FA 2X0GA 3IK3A 4KIKA 4X7QA 3KULA 4GK2A 5F9EA 3GC0A 5LVNA 2XJ2A 4KIPA 5LOHA 2ITTA 5GINE 3R7EA 2X8DA 3CIKA 2KTYA 4YJVA 3O8PA 3QQKA 5C1QB 3COKA 1ATPE 3S0OA 4ANLA 3SG9A 4O7YA 3K5UA 3QTSA 3D4QA 4F70A 3VQUA 5LVMA 2GQSA 5J5TA 3DJ7A 4G6LA 3QHRA 3WYXA 3KXHA 5EH0A 5GIOE 5IEXA 1PKDA 4LGDA 3UG1A 4G3DA 2XIKA 1YI6A 3KB7A 4JX7A 2OG8A 4M67A 5BYYA 4FT7A 5HNBA 5A6NA 1PJKA 1O9UA 3HVCA 2J0LA 2P4IA 4FV6A 2B4SB 2VTNA 2XBAA 2XMYA 3F88A 4QQJA 3BELA 3SLSA 5JT2A 5CVHA 1OL5A 4O1PA 4FK3A 1YI3A 5AR5A 3T3UA 2ITNA 2XIXA 3COHA 4QP7A 3PWYA 2WOTA 4O0UA 4GIIA 3MB7A 1CKIA 4JQEA 4YP8A 3BLQA 2BRMA 3U4WA 3ZO3A 4BN1A 4PF4A 4X6QC 3VBQA 4C57A 3A7JA 5LQFA 4FKUA 2YFXA 1YW2A 4IX6A 5CQWA 5E4HA 3GU5A 2XF0A 3FE3A 4FV3A 3RK5A 3ZXZA 2UZLA 2P55A 4O7VA 5DYJA 5HO7A 4DCAA 2UZUE 5AM7A 2IVUA 1OMWA 3SX9A 5DT4A 2QKWB 4LFIA 2YM3A 2XNPA 4OBPA 5AV3A 4EOPA 2PSQA 5EDPA 2QG7A 3FC1X 2ZJWA 4RLKA 2UVYA 2KULA 3C50A 4FV2A 4KBKA 4FV0A 4ZSEA 4L7FA 4PTCA 4ACDA 1UV5A 3IGGA 2HIWA 2V62A 3FSKA 4GVAA 4I6BA 4BIEA 1ZOHA 3QZHA 4EEVA 3QC9A 2VTAA 4RQKA 4OGRA 4BWXA 4F1OA 2OIDA 3Q9XA 4FT0A 4AG8A 2RKUA 3C0GA 3C4FA 5HNIX 5C4LA 3OUNB 3P9JA 4QMVA 3FY2A 2GSFA 4DFZE 4Z16A 2HXQA 3ERKA 4I3ZA 3RMFA 4CKRA 3ALOA 3MY1A 5HLPA 3QAME 2FSLX 5AJQA 3HMMA 4M12A 4MXZA 3EB0A 3OXZA 3SAYA 4AZEA 5M51A 1R78A 3QQHA 4BF2A 5E8VA 3QGYA 2QNJA 1OPKA 4ITIA 5L8KA 3NUSA 3MWUA 1YHWA 3FI2A 4CYIA 5KCVA 1A06A 2YDKA 2QLUA 3MDYA 2G9XA 1Z9XA 3A60A 3FQHA 3IW7A 1RJBA 3RKBA 1ZYJA 4MHAA 3T8OA 3N4VA 4P7EA 4BKZA 3AC5A 3DAJA 4JXFA 2QOOA 4GL9A 1BL7A 2UW8A 4CNHA 1U54B 2O0UA 4QP8A 4QOXA 4NW6A 3FMHA 3KEXA 4HCUA 4JRNA 4OTHA 2XK6A 3FV8A 2RL5A 3TI1A 2QI8A 2WIHA 3LHJA 2BIYA 5J1WA 4AX8A 2PK9A 1Y57A 3FXWA 2YISA 4C4HA 4DG2E 3KF4A 5KHXA 4MQ2A 2GHMA 3NUAA 4Z55A 1ZYDA 4CTBA 3C5UA 3LIJA 2OO8X 5BMMA 4B0GA 4C4JA 5KMNA 4J71A 5CT7A 3V8SA 4LRJA 5C26A 4K6ZA 2B55A 3SDJA 4EQMA 4I0TA 2IVTA 3H30A 4DTKA 1MQBA 4IC8A 4EZ5A 3F66A 4FE2A 3DXQA 4R78A 3QCXA 1YWVA 2FGIA 4NZWB 3DKOA 4WG4A 4HYHA 4G3CA 4MXYA 4S34A 2B9HA 2F7EE 4UWCA 3VUIA 2C6KA 1WBWA 3C13A 2B52A 3RCDA 4CFMA 5K5XA 2W1GA 5M08A 3NVMB 4UMTA 3WIGA 4BB4A 2X7GA 3BI6A 3KK8A 4WBBB 3FMMA 4XG2A 1PW2A 2O64A 2R3FA 4MNEB 3UJGA 4C34A 4CV8A 4TL0A 1PF8A 3FWQA 4DINA 4FV5A 1Y8GA 2GQRA 3LCSA 4FC0A 4RWJA 4M68A 2XKFA 4EHVA 4IAYA 4EHEA 4IX5A 4KBCA 5GJFA 5D7VA 1MQ4A 3F2AA 3TV4A 4CG9A 5LVLA 1OZ1A 4NM5A 4XOZA 1JKKA 4CZUA 4N70A 3LMIA 2GDOA 3C4WA 4ZIMA 2PMIA 1PMNA 4YC6A 4W8EA 4F08A 1VYWA 4G6NA 3TJDA 4YZ9A 4MEDA 2LGCA 3UVPA 5HTCA 3HRFA 5ICPA 4DA5A 4EYJA 3O0GA 3FLSA 3LCKA 4G9RA 4WNMA 3RPRA 2JKOA 5CALA 4F09A 4RVTA 4C37A 1Q8WA 3NEWA 4OW8A 4Y95A 5CT0A 2C0IA 1G8SA 2WGJA 3QRKA 4FTOA 1OECA 4NTTA 3SXSA 4ACGA 3NLBA 3UP2A 4D2SA 4AT4A 2GS7A 2BZJA 4FTJA 3MN3A 5DEWA 5J1VA 3PRFA 3PY3A 5KMKA 2IW8A 4I0RA 2PVRA 4NU1A 4IZ7A 5D9HA 2X7FA 2J4ZA 3GI3A 4NKSA 4D1SA 1UNLA 4LYNA 3ZUUA 4KIKB 3BGQA 4FL2A 4IH8A 2EVAA 1H1RA 3TZ9A 1FQ1B 3F5GA 1YRPA 2CKEA 4X6RA 2A27A 3QKKA 4BGGA 4CFUA 5JQ5A 3HL7A 2GS2A 4TTHB 4IC7A 3U9NA 3VF9A 5EDQA 1XR1A 5E92A 4LUDA 4UXQA 3ZLYA 3UOLA 3TUBA 4O2ZA 5GZ9A 2UW6A 5T3QA 3EQBA 4ACMA 3F82A 5FEDA 4OBOA 3VS3A 4BDJA 3R83A 2F2UA 5I9ZA 3UYTA 4BBMA 2XNNA 4F6WA 4HNIA 4IBMA 2F7ZE 3A7FA 4D2WA 2YM4A 1FMOE 3DB6A 4V01A 4X3FA 4ALUA 3BLHA 4GT4A 4CQEA 4OTFA 3ZDUA 5CXHA 2EXMA 5DWRA 2R3PA 2HZ4A 2QURA 3K5VA 4E4MA 4CT2A 2V5QA 4W9WA 5L8JA 1YOJA 4ANBA 3BBWA 5HG5A 4UEUA 1H26A 2CDZA 3GUBA 5FD2A 3M11A 3MFRA 3NCZA 4TYEA 4XJ0A 5F95A 3RPOA 5HG7A 4AA0A 3EKKA 3CD3A 3LQ8A 4CZYB 4IVBA 4IM0A 4C2VA 2PZPA 2WQMA 4FI1A 3I0OA 1FVVA 2I0HA 3FL4A 2UZTA 4QYHA 2UV2A 4F9WA 2W17A 3LMHA 2O3PA 2FSOX 2JKQA 3Q4ZA 2C3IB 4RJ3A 5ACKA 4I23A 1E9HA 5AR4A 1F0QA 2IVSA 4AE6A 2OI4X 2OWBA 3W33A 4YTHA 4HZSA 2C5VA 2V55A 4U81A 3H9OA 3PYYA 5AV2A 1OIRA 1ZMVA 4K9YA 5F94A 3W32A 4GV1A 5A4TA 2Y0AA 4KINA 4H1JA 4EOQA 5FTGA 3NAXA 5DLSA 4PTGA 2JEDA 3FUPA 4EQCA 1SVGA 3GFEA 2VWVA 4IWPA 2G01A 3DTCA 3R30A 4BY9E 1P4OA 3VN9A 2BTRA 3FMNA 4O7SA 3GU4A 3R04A 5BQ0A 3WILA 4OAUC 4X21A 4YURA 3EZRA 3NS9A 2ITYA 2XP2A 5CEIA 5I9XA 1W0XC 2YZAA 2XKCA 3QUEA 5HBHA 5DMZA 4J99A 3RCJA 3WF7A 4ALWA 4Z7HA 5EYMA 4BCFA 4L52A 2Y6OA 4ORKA 2PVNA 1XH7A 4G9CA 4ZSAA 1W8CA 2WTCA 3BU6A 3HMNA 3OF0A 4UALA 3NIZA 4AN3A 4NUSA 4FKPA 1PXOA 1K3AA 5HD4A 1U46A 2WTDA 2CLXA 3C4ZA 2CNUA 3TACA 5EOLA 4ITHA 3LXKA 1CM8A 1Q41A 4ZY6A 1XBAA 3FHRA 3I5ZA 5TKDA 3IW5A 4OLIA 4S31A 5EOBA 4L7SA 2IJMA 3F7ZA 1IRKA 4UYNA 4XRLA 3GFWA 3L8VA 2PTKA 2QOHA 4MK0A 4D9TA 3DU8A 5L4QA 4RIXA 1V0OA 1GZ8A 2QVSE 1MUOA 2WD1A 3ZZWA 5AADA 2CGWA 2W5HA 4JDJA 4B8LA 3R8PA 3LFBA 1JLUE 3WE4A 3UODA 4B6LA 5L3AA 1QPCA 4ZSJA 3NSZA 1ZRZA 3LZBA 3OWKA 3PVBA 4BDDA 1H4LA 5HX8A 5JH6A 4EJ7A 1FMKA 3AT4A 4QP6A 1P4FA 2YLEA 3FLQA 2IZUA 2YAKA 3EJ1A 4EH8A 5FM2A 2IG7A 3NR9A 2A19B 5IQDA 1OKVA 4YNOA 4U43A 5AP3A 1UKHA 3II5A 1J3HA 4MNEA 2BFYA 3DNEA 2BVAA 3QBNA 3LCDA 3QKLA 1L8TA 4NT4A 4QMSA 3UIUA 4J97A 4K0YA 3I6UA 4F0FA 1DI8A 3E63A 1PXIA 4BCKA 4CQGA 3QLGA 3POZA 1M7NA 3A7HA 3PSCA 3OT3A 5HESA 4Y73A 4A4LA 3KF7A 4AOIA 1NA7A 1KE9A 2XJ0A 3IKAA 3OC1A 4BCOA 3U6IA 1IR3A 1ZYSA 2CKQA 2BDFA 3PPZA 5IQBA 4DG0E 3C7QA 3OVVA 2VO0A 4FKTA 4RVKA 2ZV7A 4CMOA 1GOLA 3MY0A 4HGTA 5CI7A 4YJSA 4K33A 2RFNA 4I6FA 2OXXA 3ENMA 4TWCA 4R7HA 4GUBA 4D4SA 3DQWA 3R0TA 4O82A 4D2RA 1NXKA 5ETIA 3CPCA 3SRVA 3FAAA 4QP2A 2WXVA 4GFOA 4FTIA 5CSWA 4ZXTA 3S3IA 1Q3WA 5I3OA 4BDGA 5JKGA 3PG3A 4BYIA 4O86A 4RX7A 1LEWA 3W2SA 2IZRA 4ZLOA 5AR2A 3QTZA 4LGHA 2F4JA 2BHHA 1B38A 1PMEA 2OIQA 3EN6A 4FNZA 4XG6A 5C01A 4PRJA 2X9FA 4FIGA 4BGQA 1TKIA 4XLVA 2YDJA 3JVSA 4KKEA 1OPJA 3QTXA 4NK9A 5E8TA 1PKGA 3EQCA 3UIMA 2FSTX 3D7TB 2F2CB 3NAYA 3FXZA 4BTKA 5K4JA 3D5UA 4GFGA 4YGAA 1MP8A 2ZV9A 2X4FA 4BICA
chains in the Genus database with same CATH superfamily
3DTWA 4GIHA 5GIPE 3WF6A 4MWIA 2BUJA 3V04A 1PXPA 4X2GA 2PE1A 3MVHA 4O0SA 3ZM4A 1YDRE 3E8NA 5C4KA 2QD9A 3Q2MA 4NL0A 5BPYA 2JDRA 2YLFA 5B2KA 4K11A 2YAAA 4FICA 3I60A 3MIAA 2GQGA 5H8EA 4K1BA 3Q53A 4FTMA 4MF1A 4MKCA 2WTIA 5DFPA 4DH8A 2ESMA 3IDCA 4L00A 2PZ5A 4D4YA 2YJSA 4O2PA 1VEBA 4IZ5A 4WSQA 2Y9QA 5E8UA 5DBXA 1O6KA 3CGFA 3VUHA 4Q2AA 4LL0A 4UZHA 3W2PA 4HGEA 4ZK5A 2X0PA 2B53A 4MCVA 5EI2A 3TKUA 3HDMA 3ZONA 4C3RA 3OXIA 1ZY4A 1X8BA 4D2VA 3ZZEA 2W96B 3PA5A 4GYGA 2RG5A 4AN9A 1SYKA 5C8MA 2CGVA 3W2CA 2O65A 4RIYB 3UPZA 4JI9A 4RFZA 3ZRLA 4KRDA 4M13A 3G0FA 5CS6A 3DBQA 2VO6A 3VHEA 4AXAA 1PRYA 4K18A 3UIXA 5IUGA 2ZM3A 3SXFA 2XS0A 4H58A 4NCTA 2RFEA 4N0SA 3D15A 3B8RA 4WRGA 1IA8A 3CJFA 2W4JA 3Q04A 2YERA 4FKJA 4L01A 5E91A 5HEZA 3BGZA 1M52A 4H3QA 4JS8A 2ETMA 2UZBA 4QTCA 3NUYA 2JIUA 3GGFA 4AU8A 4C33A 4C38A 3DBDA 1PMVA 2WTKB 3P78A 1SM2A 4FKVA 4ASEA 4CZTA 1AGWA 5JZNA 4D4VA 1KOAA 4NM7A 4QYGA 1M2QA 4BDIA 3AD6A 3R28A 4E1ZA 3ODZX 4O83A 4BCGA 4CMUA 3QRIA 4W8DA 3KXMA 4F78A 3UTOA 1YOLA 3PY0A 4EHGA 4UX9A 5BNJA 3GEQA 3KKVA 3TNIA 3F5PA 4EH3A 1XMLA 1UNHA 4JBPA 4IZYA 4R1YA 3W1FA 2R3NA 3BEAA 4DBNA 2GHGA 2IVVA 4M66A 5CAQA 4CRLA 5KHWA 2Z7SA 4AA5A 2I1MA 5LXMA 4GJ3A 5CLPA 2REIA 2QU5A 2X8IA 5AP0A 4HVSA 2BALA 2VO3A 1XMMA 4FSQA 3TEIA 4O0XA 5B7VA 2R5TA 1YWNA 4DITA 1J7LA 3RAWA 3UNZA 5D41A 1URWA 5I9UA 4CYJA 2V7OA 4DE4A 4DEGA 4IWOA 3VBWA 3P4KA 2OFVA 4JG7A 3EYHA 4AZTA 4RA5A 3CBLA 5EFQA 5CNOA 3TIYA 5AP2A 4NKAA 1I44A 1OBDA 2AC5A 3LQ5A 4JG8A 4TYJA 5CASA 3VS4A 1YXXA 4WUNA 2CCHA 3RGFA 4L45A 5JFWA 3NYOA 2CCIA 1H0WA 1JWHA 1RE8A 3OS3A 5ETFA 3OY1A 3AMAA 5LMAA 4IX4A 3ZLSA 3ROCA 5HG9A 5A9UA 4EBVA 4NYEA 4E6CA 5HE3A 3MH2A 3NPCA 2BZHB 4LOPA 1YDSE 2VWXA 2W0JA 1Q3DA 1W83A 2UZWE 3ACKA 1YXTA 3F2NA 1VJYA 3UQGA 5IH6A 3ATSA 2VTIA 3ZMMA 1ZWSA 3QYZA 4Q9SA 3KRLA 3PIYA 3P86A 4Y8DA 3HP2A 5EW9A 1VYZA 3SRVB 1H24A 3UYSA 3BEGA 2I7QA 3ZEPA 3JYAA 4U7ZA 3E3BX 3FI3A 4PP7A 4FTLA 3ID6C 5HG8A 2V0DA 3MFUA 4FYOA 5A4CA 4LDTA 4C2WA 3WI6A 3R9NA 3E62A 5HX6A 3VUTA 2XALA 4IB3A 1XO2B 3QQUA 4EJNA 5AUVA 2VRXA 2B9JA 3DOGA 4Q5EA 3KL8A 4FK6A 5IH5A 3OCBA 4JBOA 3RZFA 3TWJA 4FZDB 1R0EA 1UKIA 4F0IA 3EFJA 4PP9A 5HU3A 4Y85A 3R2YA 1TVOA 4MXAA 4TXCA 1JNKA 5DHJA 5CAOA 3U55A 2Z60A 4MAOA 3ZS5A 1R39A 4D2PA 4IJPA 5CF8A 5ETCA 2YM7A 3EQGA 3QTWA 4I22A 3HNGA 2GHLA 2VTSA 3NDMA 4TKSA 4YPSA 5A6OA 3NYNA 3RWPA 3LKMA 5LARA 3ZOSA 2HWOA 4ZSGA 3ENHA 4EOKA 3UPXA 1OBGA 4DBXA 2VWIA 4PPBA 4L3JA 4MNFA 4RWKA 5DPVA 2WTWA 3N51A 5AP6A 3S95A 5M06A 3RPYA 3OOGA 3LE6A 5AP4A 4HYUA 5GHVA 1OKYA 3UOJA 2VTJA 3LJ2A 3UG2A 4O96A 1XBBA 3KXNA 4N6YA 5C27A 5C9CA 2HY0A 4U45A 3DJ5A 4UMRA 3CY3A 1J91A 1REKA 2C6LA 4EOJA 1XH8A 3ZBFA 1BUHA 3OOMA 3WF8A 5J5SA 1PMUA 3R71A 3BGPA 4A9UA 1OM1A 4E8AA 2WIPA 4QTDA 1WCCA 3Q4CA 3CQEA 3Q32A 3Q6WA 3P23A 3QZIA 5E8ZA 3DCVA 4GEOA 2NRYA 3QC4A 3NVKI 3LQ3A 3I7BA 4FTKA 5DT0A 4BBFA 4PY1A 3CR0A 4JR7A 4UY9A 3O5AA 3EYGA 3RBWA 4OBQA 3TCPA 3DNDA 5EKNA 3E8DA 4L43A 4DT9A 4ZTHA 3QX4A 4TYHA 1Y6AA 3FY0A 3W2RA 3VUMA 4ZTQA 5FM3A 3T3VA 4LV7A 3R9DA 2HW7A 4XV1A 4FA2A 3O71A 5DG5A 2EU9A 3PVWA 4TW9A 3I6WA 4MQ1A 2WKMA 3PE1A 3IG7A 3HUCA 3QD4A 4E20A 2Q83A 4FNYA 4RJ4A 3BYMA 5AMNA 4EKLA 2UVXA 1P14A 3A7GA 3HZTA 2F49A 3L9PA 4J1RA 1KWPA 3U87A 5BVDA 2ZB0A 4PDPA 3F69A 2W9ZB 4FL3A 4QQCA 4GSBA 3UO6A 4FIJA 4BGHA 5HBEA 3LFEA 3QHWA 4NTSA 3KGAA 5EYDA 3C1XA 3UMWA 3F3UA 4AN2A 4EBWA 4WO5A 5CY3A 2ETKA 3P5KA 1UU7A 1U5RA 1GY3A 3DKGA 4OR5A 2IPXA 2XIYA 2VNWA 2O2UA 2GS6A 2VTRA 4XHKB 2WB8A 3U51A 3ZO2A 3Q5IA 2WMAA 3W0RA 3NMUF 1R1WA 3AGLA 2AYPA 3HYHA 2VGOA 2ETRA 2UVZA 3P7CA 5EM6A 5HCYA 4D2TA 3V5JA 4C59A 4FV4A 4C3PA 4BIDA 4ANQA 2VTQA 3RJCA 3CQWA 2XH5A 5IQAA 4UN0C 2DQ7X 4FSYA 2JDSA 1REJA 3LVPA 3GCSA 5CWZA 4ASDA 2B1PA 4QO9A 1RQQA 4I20A 4YC8A 2YIQA 4PDOA 3BX5A 3L8PA 3BL9A 4QNYA 2R7IA 4YBKA 1E1VA 1JVPP 1V0PA 3TTIA 3SOAA 3LFNA 4TY1A 3CLYA 1H0VA 5JGBA 4O7RA 4IAAA 1U54A 3F5UA 2G2HA 4I4FA 2ONLC 3HKOA 3BYSA 3MYGA 4PNIA 1ZXEA 5LMKC 3PG1A 3D5XA 4Y46A 4X3FB 3IW8A 5KBRA 3MFSA 3MVLA 3QX2A 5DOSA 2WMQA 4J52A 4LL5A 3SV0A 4F65A 4AAYA 2VX1A 5M56A 4BBEA 5BVWA 1ZZLA 1PYXA 3R1SA 2OXYA 4R5SA 1F5QA 1HCKA 4BR3A 5KMLA 2B54A 2ITXA 4QTEA 1JPAA 3CJGA 3OXTA 4DFBA 4JDIA 3DJ6A 4FIEA 3DV3A 5AM6A 4GS6A 3SKCA 3MJ2A 3R6XA 3PUFC 3P7BA 2YCQA 4YTCA 2J6MA 2J50A 4IDVA 3R7GA 3CEKA 3ORTA 4RIYA 4C02A 2YZLA 3FMDA 4FUXA 4ZTRA 4GK4A 4IVAA 3IDPA 5E8SA 3EN9A 3BQCA 3GCUA 2B0QA 3C4CA 5CSPA 3GOPA 3OHTA 4XNEA 3C4XA 4L3PA 4M15A 4XV3A 4L42A 4YR8A 4O81A 4EH2A 3WE8A 3AOXA 4CFVA 2EXCX 4NWMA 2ERKA 4RX8A 1YOMA 4HZRA 5BVEA 4MBIA 5AAGA 4AGDA 5FTQA 3UC3A 3PUPA 4G3FA 4RZWA 4TRLA 5K5NA 2VO7A 3PJ1A 4EZ7A 1M17A 1OL1A 4FUYA 4P5ZA 4UYAA 5AP5A 1MRUA 5I9YA 5J7HA 2JFMA 2OH0E 3FZ1A 4J96A 1JQHA 3HMPA 4WSYA 5DGZA 5EYKA 5BUJA 1XQZA 1Z57A 5KMMA 4DFUA 2ITPA 5HU9A 4IAFA 1WZYA 1XH4A 2FVDA 1PY5A 5D10A 4MUQA 3QTQA 3W55A 3ZLXA 4BHNA 3HA8A 1YQJA 3MB6A 3BL7A 2XIRA 1U59A 4LMNA 2AUHA 2A2AA 2GCDA 3EFLA 2VNYA 4FODA 3TZMA 4C35A 2YIYA 2EB3A 4ZJVA 3P0MA 4D5HA 4RX5A 2PZRA 4XUFA 4JT3A 4BDHA 3W0MA 3LPBA 3Q9YA 3EQRA 3OT8A 4KKGA 4FKRA 4L3LA 2OXDA 5AR7A 2P0CA 2XAOA 4FTAA 3ACJA 5T68A 4RZVA 3D2KA 4WOVA 3PLSA 3PIXA 3PJ8A 3QGWA 1IAJA 4HPTE 3E87A 1Q99A 2GNFA 1NVSA 4KWPA 4YJTA 2WMXA 3KRRA 4APPA 2R3QA 2XBJA 2UW5A 4MH7A 4EOLA 5ANJA 4LGGA 4BKJA 3SW4A 4YHJA 3O96A 4CCBA 5CNNA 3RPSA 3GCQA 1NT2A 4OTWA 4O0RA 4X0MA 5E8WA 2HK5A 2ZMCA 4V05A 4I21A 2XB7A 3FPMA 4F63A 1OVEA 4RLLA 4QMYA 4E4NA 1V1KA 5J9ZA 3IQ7A 3P7AA 5HTBA 5CAVA 5EQYA 2IN6A 2WELA 3NUUA 2VUWA 4I6QA 2BAJA 1WBSA 3OCTA 4IACA 4IADA 3QUPA 4UZDA 3LFAA 4BVUA 4E3CA 4WUAA 4FZ7A 3R8MA 2EB2A 2XCHA 4GG7A 4V0GB 5IU2A 4DF3A 2A98A 5IKWA 4DGMA 3O17A 2PVJA 4WRSA 4B7TA 3TDWA 4DH5A 4U0IA 3HX4A 3VW6A 1J1CA 3FDNA 3TTJA 3PXZA 4EOMA 1KE6A 3P08A 4DCEA 3UQCA 3IOPA 3QCYA 4IE9A 3CQUA 2GFSA 1SMHA 4U9AA 4ID7A 3GQLA 4G1WA 1UU3A 4YTFA 2WTJA 5JK3A 1OIQA 2H96A 3NNWA 3Q6UA 4RVMA 1KE5A 3G90X 4KA3A 4ZSLA 1W2FA 2CSNA 3F61A 3ORZA 4HCTA 4RFYA 3MTFA 4MXOA 4L6QA 3F3ZA 4U80A 5ANOA 4HYIA 3EQPA 4RX9A 4FT9A 2BZKB 5AUZA 3TZ7A 2IF8A 4L67A 4ALVA 5M57A 1OITA 3DZQA 4V0GA 4HW7A 1IG1A 3PJ3A 4OTIA 2VAGA 3AC1A 3PSDA 4D0XA 4FYNA 4FSNA 3AC3A 3R01A 3EH9A 4XS2A 4EK8A 3R73A 2X7OA 5M07A 3OTUA 2X1NA 4C8BA 5IQCA 2RG6A 5AEPA 3PXQA 2PUIA 4DG3E 5IZFA 3QL8A 2WNTA 4YJRA 2OLCA 3H3CA 4MXCA 2X2MA 2CJMA 4DGGA 3VIDA 4DH7A 3BV2A 2C0OA 2HOGA 4M0ZA 4MXXA 3E8EA 3M2WA 3W2OA 4AGWA 5HLNA 4YSMA 3NGAA 5AR3A 4UV0A 4FZFB 4O4DA 4USEA 1WBVA 4XP3A 4JL9A 2UZOA 3TZ8A 2YCFA 4O6EA 4AW2A 5J79A 4OAVB 3GOKA 4YJUA 3ETAA 3LLTA 4F7LA 2OGVA 1VLRA 1H00A 1DS5A 2HXLA 3UE4A 4EUUA 1GZKA 4JRVA 3RZBA 4DTBA 3PA3A 2WHBA 1GZNA 1UWHA 4IB0A 4AFJA 3BCEA 5GZAA 5AWMA 3ROYA 4E6DA 4Y5HA 4BI2A 2XK9A 1GZOA 2Y4IB 4IVDA 4JG6A 4PTEA 3K3IA 4AA4A 2EWAA 5DEYA 4J8MA 1XHAA 2R3GA 3RNIA 4RPVA 2ZM4A 2VWBA 2CGXA 5HI2A 2BRBA 4H3PA 2A1AB 4RC4A 4E5BA 2ITOA 5JSMA 1ZAOA 4WT6A 2HY81 2JIIA 4MBLA 1O6YA 5A3XA 3TV6A 4PUZA 4WG3A 3BU3A 3FL5A 2R0UA 3BYOA 5FEEA 4Y83A 3WARA 5IH4A 4AQKA 4JX3A 1YXVA 3PSBA 3FPQA 2Y4IC 1YXSA 2YDIA 2ZYBA 5A4EA 5TO8A 4PX6A 5M4UA 4CGAA 4I0SA 5DT3A 3ML1A 3F9NA 5CQUA 1ZOEA 3WZJA 4CV9A 3SG8A 4G31A 1UWJA 4D55A 4FIIA 5DE2A 3TT0A 3V3VA 2W1IA 3SQQA 4E7WA 4N6ZA 4BIBA 1OKZA 4DFNA 4GT5A 2UZEA 2W1ZA 3W10A 3GQIA 3W0QA 2G1TA 2RIOA 3RAIA 4CT1A 2IW6A 4IXPA 2HZIA 4NEUA 3VVHA 4EUTA 4QYFA 2PZIA 4ZTMA 2Y4PA 5HVJA 3REPA 2SRCA 5HE2A 4JNWA 2OBJA 2QOBA 4QP3A 3QTIA 4RFMA 4QDEA 1S9JA 5DA3A 4RWLA 5HNGA 1Y8YA 4A9RA 3MIYA 5A14A 1SNUA 4LRMA 3FC2A 4FV9A 1J1BA 3EFWA 5IA5A 4GK3A 3KIOC 4ZLZA 3DB8A 5JQ8A 1UNGA 5KO1A 3EL7A 4ZTNA 5AUTA 3WZKA 5IQFA 5AR8A 4YSJA 4YLLA 4HNFA 1PXNA 4XH6A 3AT3A 4EZ3A 3BYUA 4KRCA 1R0PA 2BPMA 2PL0A 4TZRA 1FINA 2NO3A 3QALE 3VUDA 4C62A 3E5AA 1KUTA 4FSUA 3HRCA 3PXRA 5H2UA 2XEYA 3BRBA 2R2PA 3R9OA 4FIHA 4KABA 5AX9A 3W8QA 4PMTA 2YM6A 5CAPA 4II5A 3G15A 2PULA 4F1MA 2YACA 4PQNA 4M7IA 1KV2A 2BIKB 5HIBA 4F7JA 4B8MA 4PL5A 3TN8A 5HE1A 5L2WA 3CKWA 2E9NA 1H27A 2X81A 2YITA 2XK8A 4QYYA 2GTMA 2V22A 4A07A 5HQ0A 5FTOA 3UVQA 4QMXA 4EQUA 4EK4A 3R1NA 4YZMA 3C5IA 4U3YA 4CFWA 4L9IA 2O63A 3HV3A 3WF5A 4E5WA 4FMQA 4F6UA 2I0VA 2JD5A 2BDJA 2QOCA 4O38A 2AC3A 4L8MA 2C5YA 2BAKA 5E90A 3JPVA 4NM0A 3ZSHA 1I09A 2RGPA 2C1AA 3V5PA 1NVRA 4QPMA 3ET7A 4U97A 3QYWA 1JAMA 4LI5A 4YO6A 4AT3A 4BFMA 5BVOA 4BZDA 4FSMA 5IG1A 2ONLA 3EN4A 3V6SA 2ACXA 2ZV8A 5DIAA 3T9TA 3W0PA 4FVPA 2C6IA 3I5NA 5FP5A 4I5CA 4AE9A 2R3MA 5GJGA 4G3GA 4NFMA 5BVNA 2UZVA 3EQFA 4C36A 4X2NA 2JFLA 2ZOQA 5JGDA 4WA9A 2H6DA 3O8TA 1NW1A 1OGYA 4DEAA 4NSTA 3Q4UA 1SVHA 5CANA 4O7WA 4B9DA 5EG3A 4M8TA 1Q62A 3HV4A 5IUIA 4A4XA 2NYAA 3EKNA 1Y6BA 4O0VA 4QMOA 3VF8A 5KX8A 4EH4A 1H25A 2IZSA 4ZZNA 4O6LA 4TT7A 2C0TA 2X6DA 4WBOA 5JMSA 3Q2JA 2VZ6A 2H9VA 3QWJA 1XH6A 1Q61A 1O6LA 2QR7A 3UZTA 3DK6A 3MPTA 3OCSA 4W4WA 3ULIA 2W5AA 4MYGA 4YU2A 2XRWA 4G6OA 1OIYA 2ZM1A 3DFAA 4JAIA 2J2IB 4AWIA 4C0TA 3FZSA 3F7WA 4BDEA 4FIFA 4O0YA 4F64A 1OL7A 2ERZE 4FG7A 4QMTA 3QCQA 4NJ3A 2XM8A 4H1MA 5DI1A 5AUWA 2NNWB 4HGSA 3OMVA 1YXUA 2C30A 3TG1A 1DAYA 3WZDA 5J9LA 4WG5A 3VONA 3PVGA 4FV8A 1QCFA 2R3HA 2G2IA 5BYLA 3FEGA 3DBFA 3KMUA 1IA9A 3OWLA 3MA6A 3GBZA 2X4ZA 3B2WA 5ITAA 3M42A 3VULA 2Q0NA 3F3VA 4IEBA 4FTUA 5JRSA 1GIIA 4Y72A 3NX8A 3VBVA 3IW6A 4GRBA 2X2KA 5G1XA 3KXXA 1G3NA 3RAHA 4FKQA 4OT5A 3CS9A 2I0EA 1LEZA 3QTUA 4KKHA 5DR9A 5AV0A 3RVGA 3QD0A 4Z7GA 3U54A 2F57A 2R0IA 4BRXA 4ENYA 3EOCA 2W5BA 4RIOA 1K2PA 4FT5A 4AOJA 5IMEA 4U5JA 2H8HA 4M14A 3MH3A 2JDVA 4IAKA 1QMZA 3FKLA 1TQPA 3WIKA 2GNHA 4XLIA 4U42A 5TR6A 1IAHA 2JBOA 3MTLA 4USDA 3RWQA 3MA3A 1ZARA 5AX3A 4J98A 4RIWB 4ACCA 3IPHA 4XG3A 4CVAA 3WBLA 3KU2A 3QRUA 4FKSA 4A7CA 1M14A 3ZXTA 3NWWA 4IWDA 2JDTA 4QTAA 3A8XA 3CGOA 2BHEA 4J53A 3WZEA 2CKPA 3EQHA 3MVJA 4AT5A 1KSWA 4GT3A 5K0XA 3FHIA 3G0EA 5HKMA 4FV1A 4DN5A 3BYVA 3O7LB 4MTAA 2BFXA 5J95A 3UMXA 1LP4A 2Z2WA 3NYVA 3KXZA 3QA0A 2NP8A 1XH9A 2GPHA 2R64A 3MJ1A 4ONAA 2HCKA 3R9HA 4AQCA 4MD9E 1RW8A 2ZDTA 4IQ6A 4CKIA 3VBTA 3W0OA 3LOKA 4J8NA 4WIHA 3BU5A 4LRKA 4TPTA 4YJQA 4E26A 2VWUA 4QMNA 3OD6X 3BBTB 3KCFA 3DBEA 2Y6MA 2HZ0A 4FT3A 2B7AA 3SD0A 2W9FB 3QCSA 3POOA 5FWKK 3F3TA 3RM7A 5KUPA 5CU3A 2YCSA 3PDTA 4O91A 1PXMA 1JKSA 4R3RA 3K54A 4D0WA 2WQOA 4YJOA 4RBLA 3S4QA 2UW3A 2VGPA 3MPAA 3CTQA 5KZ0A 2X9EA 1Q8TA 3W8LA 2HYYA 4XG8A 2A4LA 1U4DA 4EH7A 4EORA 3TYKA 3MY5A 3LM5A 4I24A 2PYWA 4USFA 3RK9A 5J87A 2VX3A 4S2ZA 3KRXA 3O7LD 4ZY5A 2W4OA 3G6HA 4DYMA 3UBDA 2FSMX 1YHVA 2PE0A 3DS6A 2QOKA 3RM6A 3U8WA 3ZC6A 2GNLA 2ITQA 1WMKA 3CPBA 2QO2A 5EKOA 1YI4A 5DRDA 1XJDA 4AOTA 4BKYA 2P2IA 4WNKA 4X2KA 2J5FA 4BYJA 4M69B 4PMSA 4DTAA 2CNVA 5LWMA 4O4FA 2PMNX 3LCOA 2CLQA 3MBLA 3MVMA 3ORLA 4JVGA 3GB2A 3QZFA 2E9UA 4FNWA 2CN5A 2W7XA 4YHFA 1JOWB 2BR1A 3ZO4A 2YHVA 4DC2A 2PMLX 3FKOA 1FGKA 2QHMA 4ERKA 2XNEA 1BMKA 5BMSA 3FSFA 2WQBA 4A06A 5BYZA 5IDNA 4XCUA 2Z7LA 3KN6A 4FNXA 4AF3A 3I0QA 5EW3A 2UUEA 5HORA 5C8NA 4Z9LA 3R1QA 3W2QA 3ZUTA 4JLCA 3TIZA 1UA2A 3IOKA 3LJ0A 3DBCA 5EI6A 4YBJA 3R8UA 1H07A 4KB8A 5F20A 3N4TA 5FUTA 4BCIA 2PVMA 3CY2A 3OFMA 4WD5A 3BLRA 3FYJX 3UDSA 3TKIA 4TWNA 3HAVA 3H10A 4AGCA 1FGIA 4EK5A 4AUAA 2WEVA 4FKLA 4QRCA 3LCTA 4OTRA 4U6RA 3C0HA 4ZS0A 2QODA 5M53A 3R21A 4YHTA 1ZLTA 2CGUA 4JBVA 3OZ6A 2PVHA 3UNJA 2J51A 4KSPA 5CVGA 1OKWA 3S1HA 4CFXA 2XCKA 4QP1A 5FQDC 3HUBA 3SW7A 2J0JA 1BI8A 2YABA 4LV8A 1SVEA 1HCLA 2C6OA 5TF9A 1H1PA 3NUXA 4IAZA 3DAEA 3EN7A 3EZVA 2RFSA 3UZRA 3VHKA 1H08A 5HBJA 3EQDA 3GU6A 4IAIA 3ZU7A 4CLJA 3HAMA 2C47A 4O7NA 4B4LA 2ITUA 2C6EA 4ANMA 3KREA 5AFVA 4GH2A 3GT8A 2C69A 3ALNA 4RSSA 3UOHA 4EONA 2R3LA 2XK3A 2XYUA 3LMGA 4H36A 3F2RA 4OTDA 4KSQA 4EH9A 2YCRA 2IZTA 3DAKA 1ZOGA 4HVDA 2RFDA 5DR2A 4YC3A 4FSWA 5E7RA 1ZZ2A 3FYKX 2YEXA 3BKBA 4JQ7A 3NRMA 5EHOA 2CMWA 4HCVA 3CCNA 2LAVA 4F1TA 2ZB1A 1H1WA 1WVWA 3GVUA 5CTPA 5ANIA 5EHLA 5LWNA 3TNHA 5HCZA 2YM8A 4AXDA 1OIUA 1H1QA 3GC8A 3NUPA 5BUIA 3R2BA 1BYGA 5FG8A 1KOBA 5AIKA 4RJ6A 4W4VA 4D58A 4DAWA 4FKGA 5BX0A 5F4NA 5IDPA 4GKHA 1A9UA 3IO7A 3ORXA 3VS5A 3COIA 3S2PA 3EN5A 2JC6A 1F3MC 4YZBA 1XKKA 3C51A 3MW1A 4XV9A 1UU8A 4IFGA 2PE2A 3AGMA 1ST0A 4CCUA 3V51A 4AXEA 1H8FA 2YJRA 1MRVA 3RHXA 2XIZA 5BVKA 2OZOA 2C6DA 3E7OA 2W05A 3SHEA 5AA8A 3U9CA 1JSUA 3UOKA 1ERKA 1WBTA 1G8AA 2WMSA 1W82A 1PHKA 2HWPA 4UWBA 4HOKA 4R5YA 3GC9A 3Q96A 3NW5A 5CSXA 4I94A 3QRTA 1LPUA 4QMWA 4QPAA 5JN2A 4RMZA 2W99B 3QQJA 2OF4A 2WTKC 3TKHA 2J90A 3JUHA 1VZOA 4RC3A 3VS6A 4DLJA 4QMLA 4ZOGA 3BHYA 1LR4A 3G33A 2HAKA 3MSSA 4U8ZA 5E1EA 3R8ZA 3RHKA 1CDKA 2X2LA 1G5SA 3LW0A 3QXPA 4IZAA 1M2PA 3UP7A 3G5DA 5JZJA 2I40A 1TQIA 4FG8A 4G16A 4FEVA 2X39A 4GU6A 4OTQA 1U5QA 2WTVA 4TYIA 1XWSA 1OB3A 3CD8A 1YWRA 4R6VA 3FMJA 3ZRKA 4NH1A 2QKRA 3R9RA 4ZZMA 4IM2A 3HEGA 5CZHA 4ZMEA 4MBJA 3VRZA 3VBXA 3BHUA 3PZHA 4F0GA 4UMPA 5J9YA 4EYMA 4LV5A 5J7BA 4MD7E 3TL8A 3KY2A 3QD2B 2I6LA 4FSRA 5EYCA 3ZYAA 5EQPA 4HYSA 4FJVA 2X6EA 5FXQA 4WNOA 5FGKA 5AAEA 4F9BA 4O4BB 4A9SA 4FOBA 1YHSA 3SA0A 2OFUA 1S9IA 4IVCA 5D7AA 3RAKA 5ANEA 4FX3A 2WO6A 2VX0A 3BHTA 4EWQA 4F7NA 3RK7A 4XV2A 1BL6A 2PVKA 4FG9A 5FRIA 2XNMA 2XVDA 3FI8A 1JKLA 5H9BA 3PY1A 4XG7A 5CEMA 2IEWA 2A0CX 2B9IA 2E9VA 3NZ0A 3R63A 3I81A 4RQVA 5CF4A 2OH4A 3AMYA 3KRJA 4UMUA 2YN8A 2R7BA 5IA2A 3ORNA 4E73A 3R7YA 4XRJA 3WYYA 3L9NA 3A4PA 5A46A 1ZYLA 3QF9A 2JAVA 1FBNA 2JBPA 4AS0A 2JKKA 3R7VA 3CSVA 5HICA 4R7IA 3BV3A 3DZOA 4MX9A 4QMZA 4QMMA 4QQTA 2JLDA 3VQHA 3SXRA 4HVGA 4TWOA 4QT1A 2OZAA 4LM5A 3G9LX 2GMXA 1SZMA 4FTCA 4PWNA 2QHNA 3LFQA 4YLKA 2JDOA 3E7VA 5C03A 2PU8A 2R9SA 4BCNA 3DDQA 4AW0A 4O0TA 3KA0A 5L2QA 4RC2A 3QA8A 4ZY4A 4K77A 5L2IA 2XNBA 1QPJA 3DFCB 2C68A 3PZEA 4IB1A 2W1EA 5KZIA 4AZFA 5L2SA 5CX9A 5HVYA 3VC4A 1L3RE 1T46A 3ZC5A 1GIJA 5CEQA 2OIBA 2R3KA 3A4OX 5IA3A 2QLQA 3COMA 4C4EA 3Q3BA 2JGZA 2QOLA 3QLFA 1WVYA 4J95A 4S32A 1OUYA 1GJOA 4XG9A 4ASXA 4L53A 3UO5A 2BKKA 4Q5HA 3KFAA 4U41A 3H9FA 2GU8A 4RT7A 4O84A 2VTLA 4HGLA 1Q8UA 4YLJA 2WMRA 2OF2A 3M1SA 4FKIA 1PYEA