2W9EL

Structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYFCHQWRSNPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTGGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MAJOR PRION PROTEIN
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eL01
3P9LA 3SGEI 4OLXH 1OD7A 3VH8B 5TQ0H 5HY9B 4X7CC 2XN9B 1J9CT 3VJ6A 1QLRA 5SWSA 5ANMA 3GBMH 4PRNB 5C0CA 4HCRA 3C60A 2PYEA 4U2ZA 3S3PA 1MJ7L 1EJ6A 2WBJB 3MRBB 4QO1A 4OZIB 2YEZB 5L2KA 5CSZB 1T20A 3MLWL 2ZOLB 1LO2H 1JWMA 4HKJB 4O2FB 5IHUH 1KC5H 4P57B 2D7TL 4YXKL 4P3CL 4JCLA 5KVGL 4XP6L 3BE1L 1IC4L 4Y5YC 3UMTA 1RIVH 3GEWB 3MACH 2DQFA 4RFEA 2FJFA 1ADQL 5F88A 1A7RL 1Z6JT 4U3XA 5FO8A 3FB5B 1WTGT 4ODTH 4D9RE 5EULV 3MXVL 3T8XB 4TVPL 4NCDA 2JJSA 4LCCB 3EYFA 4BYHA 1BVLA 5GGRY 4P9MH 3RVTC 1BZ9B 4BFIB 4PRPB 2I60L 2VXTL 3F7YA 5HYIA 3K4AA 1ZE3C 3VWJD 3E6FA 4FS0A 2F54A 3TGXA 1GRWA 4PJEE 3TWCL 1RUML 5T1KD 1C1EH 5A16B 4I5BB 4WGWB 1N7ML 2ZKHH 3GHEH 1A14H 4DZ8A 1U8JA 4J12A 3VXRD 4MHHI 5ALCH 3WXVL 5IMOA 3VFWB 1OF2B 1T04B 1MI5A 4YHIB 4C56D 1GC1C 4PJ5B 3QHFH 1KB9J 1QO3B 2X10A 5ECJE 1X5JA 1MCWW 2ADGA 5IW3A 3FQXA 3F5WA 5I1IH 5F7MC 5B3JF 3HFML 3NIGF 4NM8H 1VADB 2LAGB 3D3VE 3QO1B 3IJHA 3WHXA 1M7IA 4YGAB 2EXWC 3TH2T 1Q9OA 2GJ6A 2GW5A 1C08A 3FB7B 4FTVE 5FKPA 4Q9CA 4IRSB 3BIBX 3I6LD 4M7ZB 4M7LH 3G6DL 3UO1L 1JZ3A 1GZQB 3CGTA 5FF6A 4U49A 4N8CH 1BZ7B 1MQKH 4NRZB 4QRTA 3TBSB 2VZSA 1INQB 1JNNL 3QUYA 5J9PA 2OL3H 1H8NA 2Y5TB 1DQLL 4UTAH 4X5XA 4QGYA 5DVLA 3SGDH 2VDQL 3KWWA 4HZAA 5E2TH 1V5JA 2O5YL 1SHMA 3V0WH 3AXLA 4J3UA 1G7JA 3CFCL 3R1GH 4FXLA 3TZVD 3PHQB 1DUYA 3K74B 1KPVB 1RURL 4CVWA 2DMCA 3U2SB 1QSZA 4NO3A 2RCSL 1U0QA 2H26A 3VFRA 3QXDA 3V4VL 1CDYA 1RIUH 5JTWA 5A2LH 1RHFA 1EK3A 3IXTB 3EDDA 1DDHB 4RA0C 2FX7H 3H8NA 2DM2A 3QEUB 3BEWB 2QSCH 5CHNA 3IGAB 4G7YH 4XVUC 5ID0A 4PJ8A 1ZT7A 2FL5B 4AEIL 1VGEL 3PIQB 4L3EB 1U8PB 3HCVA 4G6JH 5H2BA 3QNYB 4PPTA 4KKNA 2RIKA 1IGCH 5EG6C 3QIWD 1BAFL 5K9JL 3KPSB 3T4YB 1QP1A 3C6LB 5IEKB 5H37H 4U1HB 4JGJA 5IMMA 4U1SA 2C1PA 1KN4H 4NKMB 4L4TA 3TA3C 1CLCA 2FO4B 1BFSA 4OAWA 3WNKA 2LABA 3EO1B 2VLRA 4CU7A 4QRPB 5KSBA 3OJMB 4IOFC 2R1WA 2W0KA 3ZSSA 4OLYL 4NRXB 4JFEE 1OCWL 3OBAA 2AEWA 4K3GA 1QVOA 4NO2A 4H20H 5GGQH 3CFDA 5HYQA 5E99L 5FUOH 2FEDD 3KYOA 4JPIA 4X9FA 5ITFA 1G9ML 3EYVA 1YYMH 3W5MA 1I3UA 4C54A 4NFDA 3FFCA 1WBZA 5FECB 3HZKA 4CMMB 1A4JB 4HIEA 1B4JL 5FB8B 1MAJA 4TTDD 4RBPH 5D1XC 1KCSH 3HS0B 1KC5L 3IS0X 4HKZA 1L6ZA 4QTHA 2H2PC 4ETQA 1W0YT 3G5ZA 4XCEB 2NY0B 4G6MH 1GPOL 3VFTA 4GKNA 3RJQB 2X2YA 1JRHH 5B8CC 2YPVL 5FYLE 4G3YL 1NGZA 1TIUA 3IU3B 2X5PA 3KJ6L 5HHXH 3OPZH 2R69L 5E70A 4LHUD 1F4AA 2CUMA 2RFXA 5DD3L 5KVFH 2APTA 2F58L 3OR6B 3PP4L 5GQBA 3QUZB 3UC0L 1T7ZA 4GMSH 4ZMAT 3WUWA 1U8LA 2BRRH 4JRYA 4HWZA 4OCNC 4YDLB 2RR3A 2YN5A 4L8SC 5JUEL 2B1HH 1RZGA 4ZS6D 3D2UB 5ESAA 1P7KA 5FA4A 4GRWF 2ZKHL 1A14L 3T1FB 4KK8C 1MFEL 1RK1A 1YUHA 2MMXA 1NUFA 2DYPA 2IAMC 3QHFL 1U8QB 2Z31D 2CKBB 5KVEH 4KGJA 1QLRB 5SWSB 1H5BC 4Y5XA 5DC4B 5EZJA 5ANMB 5C0CB 2W9DH 3WCYA 4JFHE 3GSWB 3CJJA 2AAVA 4BZ1H 4MD0B 2XKUA 4P2QB 1QSEB 3FL7A 1CGXA 2I5YH 3ISWA 2FWOA 2VABA 3QUMH 3RGHA 5L2KB 4XWOD 1FVDB 1T20B 3LKQA 3VE0B 2NTFA 5F97E 1KLGB 5MENE 3GFUA 3GSQA 4M7LL 2GFBA 1P1ZA 4GAYA 3M17A 3T0DA 1FYTA 4XMLH 3CMGA 5KSVA 4N8CL 4LK4A 1IVLA 1WEJL 2BHUA 3BESR 5LBSL 3CXDL 4OFIA 2DQFB 1TZIB 1MQKL 2FJFB 4FZEL 5BO1H 1ND0A 5F88B 4EUPG 5C08E 1I7TA 4Z7NE 1UXWA 4P49A 5FO8B 1L6XA 5IWLA 4GXUN 3HMXL 4PG9B 1U3HA 1N6UA 3EYFB 2C3GA 1BVLB 3V9FA 3QWRA 2DM3A 5EC1A 2OK0L 4XMKL 5C8JB 3OF6A 1KPRA 2PYFB 1ROWA 2F54B 5ERWA 3DVGA 1CLYH 3WL9A 4DJMA 1WC7A 3DXAD 2FX7L 3BPNB 4DZ8B 3I2CL 3V7AE 2QSCL 4N90E 4PJAE 5KS9F 4OGXH 1C12A 1TMCB 1HSBA 1AP2A 5GSRB 5MERB 1WCBA 4HMDA 2ADGB 5L6YH 3FQXB 4BH8A 2FBJL 1KTDA 3SDXB 4UILH 1U8KA 1T7WA 2MKWA 5DJDB 2XKSA 1NEZB 1IGCL 3AM8C 2DQHL 1KJ2A 1ZHKB 2AJXH 1QRNE 3B6SA 3K3QA 3MRGB 5DMGC 5DJ8A 4M9PA 5I66A 3JWDH 1JYVA 4MQ7A 4OKDA 4ERSL 1KGCD 3T1WA 5ID1A 4N5ED 4K7PX 1HQ4A 2WBJC 2DMKA 3RGVD 1FNHA 3IFNH 4WGVB 5D7IF 3WV0A 4PP2B 4QRTB 3UTPD 3QUYB 4X5LA 3TPUA 1PEWA 1JNLH 4ODSH 4J3XA 4NHUA 5CGYD 1BQUA 4UT9L 5JW4M 1O7SA 4PJ7F 4G5ZL 3KWWB 1NBZA 1D5IH 1FZMA 1A6TB 3AXLB 1IGFH 4M1CC 4KVNH 3SPVA 3KLHD 2CDEA 1DUYB 1C5DA 4ZPTA 3ARDD 4ZNEE 3I6GA 1YYML 1ZK9A 1ORQB 3PL6B 5JHDE 1N2RB 3VFRB 4DEPC 3QXDB 1U8IA 4RMRA 5T3XD 4HF5L 1CLOH 4ZODA 2ZG3A 1X5LA 5D7JA 4H26A 1GIGL 5HHPA 4XP5H 3Q2CA 3VGBA 1OTTC 1IZKA 2HN7B 2QBWA 1JRHL 4PS4L 1N5AA 4WW2C 5HHXL 3HCVB 1X5GA 5DUBA 1RJCA 4ODXA 4W70A 3DYMA 4WO4A 2W9EH 1V3LA 1LP9F 5A3ID 5GS0H 4OD1H 2AXHA 1A1NB 2JCCF 1MCLA 4PGDA 3MQIA 1P9MA 1NFDE 2B1HL 1KJMA 1U58B 5I8CA 1A6UL 1HNFA 5I8EA 3C09B 4OZFA 3S98A 5T5NG 3KPLA 2LAAA 3RVUD 4WEUD 3GMLA 1OQOA 2NXYB 4M00A 2HRPH 3RWDB 1CN4A 1PW3A 1Q94B 3FO0H 4M7ZC 1GJIA 5IROC 4POUB 1G0DA 1PSKH 1QVOB 4NO2B 3CFDB 2XWJA 3F7RA 3KLAA 5EA0L 1V8HA 5ITFB 5C0NC 3EYVB 3QDAA 2YK1H 2I5YL 3QUML 2I27N 3RWFB 2HLFD 1UZ6E 4XTRD 5FKAA 1BQLL 4HKZB 1N6QL 3OQ3B 2H6PA 2EKSB 2VDOH 4GKNB 3WDIA 5J11C 5D1QD 1BIIA 3MUJA 1KCVH 4RDQF 3CSYA 1TCMA 4FQJH 3B3IA 1LK3L 5D70L 5GJSL 1DQQA 5D72L 2VWEE 1A21A 1S3KH 1F6LL 1KCUH 2P8PB 1X4YA 2VL5A 2RFXB 3BEVB 3E8UL 4LDLB 1KFAL 1M6OA 3PV6A 1QNZH 3MX0A 2JE8A 4HUVA 4E0RA 1KNOB 3N50A 4HAGA 2VDRL 1CDIA 1JV5A 1XCTA 1DL7H 4P23C 3L5HA 3RIFK 3MROA 4X6CE 3VFSA 5H37G 5CD3A 1P7KB 4MDIA 5FA4B 2P49B 5HHVH 3MXWH 4H8WL 3AGVA 4NQCD 3UBXA 4FABH 1YUHB 2NY1D 2XXMB 2DYPB 2NY3D 2Z4QA 2OI9B 1CK0L 1S7SA 1WBXA 3MLTA 4FFWD 2EDEA 3BRDA 2EDFA 2EE6A 2HT3C 2VLLB 5EZJB 4L9DA 4UILL 3IF1A 1KB5A 3HI5L 2ED7A 1F4XL 3T0VA 3E3QC 4S0TD 4L8DB 5IB2B 3S5LG 2PTUA 1KIPA 2HYMA 2VKWA 5J06A 2P5ED 2FWOB 2AJXL 3RIFF 4RGND 4UQ2A 4I1NB 4E41A 1SJEA 1IGIH 2DIJA 5C07A 3GSQB 2GFBB 4NQDB 1P1ZB 1CFNA 4GAYB 3M17B 1DQMH 4P2OC 1BD2E 1NGXA 5HYSA 2XICA 4BM7A 4ACPA 3WNMA 4PV8A 4X0KA 3NAAH 1ND0B 3MUGB 1D7FA 1R5WA 2UWEE 5JXAL 1S7UB 1JNLL 4OCRL 2ADJA 1V7ML 4LLMA 5CEYB 3IDYB 2IQ9L 1E6OH 3IAPA 2NY0C 3GJFK 5F9JA 1IGFL 1R3JB 3MLVH 1AO7A 3BPOC 3QQ9C 3SOBH 3C9NA 4Y19B 3BN3B 1KPRB 3WUZA 2W92A 2P8LB 4CN1A 4JO1H 1VB9A 5IVZA 4DW2H 2CH8A 1CE6A 3DVGB 2X9XA 1JGLL 4P46B 3J8F7 4MJ5A 3WL9B 4Q7DA 5I1DA 2XV6B 2VLJD 4M48H 1QFPA 4GXUM 1FL6B 4QOKA 2WBKA 3ZKXC 3MGOA 1T6VN 4RRPA 5IVOA 2CKBH 5DJXB 3ESUF 3VRJA 3UP1A 4YHKH 3BUTA 4BH8B 3RVXD 1T5XB 4M6OH 4XVSH 5E94A 2B1AH 4HCRH 3N0PB 1TQCC 2ZPKH 3SDDC 4OD1L 5C0JA 1FO0A 4U6TA 4I3SH 3QFJA 1KJ2B 3B6SB 4M93B 4E42B 4MNQD 3IXAA 1U95A 1KEGH 2NY5L 5I66B 1K4CA 2MTPA 1X5KA 4MQ7B 4MVBC 4NN7B 5DJZB 3SJVA 5ID1B 4G7VL 4Z7WA 4MGXA 4KK5C 4U0QB 5HYJD 1OOAA 1D5BA 3EOYG 2C4FU 4XGZA 3VXOB 3LQAL 1HQ4B 4ENEC 1Q9WB 2BDNH 3QZWA 3CDYA 1N0LA 2BSTB 4Q6IA 4PUBL 2VTFA 4WTZA 1EHXA 3EYSH 3HKFA 4NHUB 4OFDA 1AGFA 1XEDA 3FO0L 3LS4L 2CLVB 1PSKL 3MV9A 4OV5A 4HIXH 1YQ2A 2H32B 1ZLVK 5GJTL 5F3HB 3SPVB 1CICB 3X3FH 1ITBB 1C5DB 3UX9B 3AC0A 1DEEA 5J56B 4P9HC 3QIBD 2WM0A 1IT9H 1U8IB 4KHTL 1CYGA 3NABH 4XBPB 1XF4A 4X6DF 1EGJL 4KI1A 5D7JB 3QDHA 4XB8A 4LFHG 5HHPB 3MRMA 3JV6B 5CJOH 3L7FA 5D1XA 3BPLB 2ZSWA 3GB7B 3VH8G 1MRCL 1NLBL 4Z77A 5F6HI 3RWGA 4NQEE 4WO4B 4G42A 4FNLH 2OTWA 5DMYA 3AMKA 4JG0H 2H2SD 3OKDA 1RULH 3P77B 2BHYA 1IQDB 4PGDB 1NCAH 4IMKC 1S9XA 3ET9F 4JFYB 4XPHH 4Z78B 4OCMC 4KK6D 4ZOCA 1LE5A 1DL7L 2AV7B 5AWNH 5C3TA 4TSBH 4YPGA 3K2UL 4XAKD 3HG1A 1XF2A 4V1DA 4M7KH 1CXFA 1P4BL 4CJ0A 3RUGB 4XPTH 1NCNA 1JK8A 2X09A 5C6TH 3MR9B 5L0QB 4FABL 4MXWL 4WU7A 2A9NH 4HS6B 4X9IA 1QBML 2XTJD 1FJ1B 2VDLH 3EZ8A 5E6ID 5TDOA 3LD8C 5FO9A 5T3ZH 2IAMA 3KLAB 4HX1A 1AR1D 4O58H 4OZIE 4XCCL 1LGVA 2X1OA 4C83B 3QJHB 3MRJA 2X40A 1WBYA 3QCTL 5FKAB 3MBEB 2GTWA 4JDVB 4KXZH 2B4CH 4Z7VB 4LIQL 2R9HD 5DZOA 5T1DL 1BIIB 4J6RL 3IU4H 3PL6C 3MLZH 4MJIA 3CSYB 2KH2B 3OKKA 3B3IB 1DBAL 4MMZC 2Q6WB 1TPXB 1TJIL 3BGMA 3HAEA 4TUOA 2VL5B 5EORH 2NY6B 5T1LB 2Z35A 4JO3H 3QULA 4PRPE 3NGBC 1M6OB 3BDBA 4JQXC 3SOBL 4E0RB 4HV8A 2ARJA 2FECI 4QCIA 1I3RB 5EU3A 1JV5B 1BHGA 2L0DA 4KKLD 2OS7A 1ZSDB 4UIMA 4D0CB 3V0VB 5BS0A 1RY7B 2A0LD 3VFSB 3LH2L 4I77L 2J8UF 3B9KD 4Y1AD 3DSFL 1U2CA 3G08A 1KUMA 1UZ8A 1CL7H 1CF8H 4Q2ZB 3UBXB 4PJ5E 2BSRA 2YD9A 3RFZC 5K9QG 4JO2L 4R2GD 1J86A 4K71B 3RL2B 5I1HL 1WBXB 3MLTB 4WFGD 2L7JA 1MFDH 4NBZB 4L9LA 5I15L 4KZEH 3IF1B 3PGCA 4M5YL 4S1DD 4HCRL 2BNQB 2E6PA 1HCVA 5I30H 4JKLA 2EECA 4FQ1L 4I3SL 5K59F 1T83C 5SX5H 4BH7A 4YHZH 5DXWA 4UQ2B 1SJEB 4OBRA 4HS3A 1BIHA 1NC4D 4OIBA 1HKLH 5IVNA 1Q0YH 4M43H 1CFNB 2HG5B 3VXQA 5I1KL 3WKMH 1NGXB 4WHYH 5HYSB 1OGTB 3K4DA 1B6DA 3MRLA 4X0KB 1CQKA 3FOMB 3QAZC 1A2YB 1CZ8H 1B4RA 4WDIA 2P5WD 1GGIH 4JB9H 4KXZI 1B0GB 1FNFA 5EIVA 4WFFE 4LL9A 5F9JB 4G8EA 1AO7B 2CUIA 4WENB 4ZUSA 1ETZA 1IAKA 3IKCB 1JYWA 2IH3A 2G9HB 1T3FA 3B9DA 3PQYD 5IR1B 1PX3A 4PY7A 3NABL 3KLDA 1PQZA 3TIEA 4MJ5B 3GHBL 1RUKH 3Q5YA 5EOCJ 4E5XB 4NYLA 2ZWLT 2IBGA 3WLWD 3ARYA 2HJLA 1A3LH 4IRZH 2XY2A 1GGBH 1FIGH 1OM3H 4Y2DA 2Z91A 2R2BB 4HKXA 3AS0A 4L3EE 5DWUL 2P46B 1WGOA 3VRJB 3FQUA 3DX8A 2VZ1A 1X6LA 3IJSA 3G5XA 4X8JA 4JG0L 43C9A 4MQXD 2BOCA 3RBSA 1QZ1A 3QFJB 3KPSE 1H8OA 4J3TA 1H9VA 4B5EA 4U1KA 3IXAB 4XPHL 1JUFA 1H3WM 3OKMA 2AK4A 2O26U 4WIQA 1IAMA 3SJVB 3VXNA 3P2TA 4Z7WB 1CTNA 2R56L 2H1PL 5GGRA 2J6EA 3HNVL 4XGZB 1JYXA 3E3QE 5HHMD 1ZS8B 4QRPE 2ZUSA 3QZWB 3ULVF 4FMFA 5C6TL 4Q6IB 2CLRB 1ZGLP 3HUJF 4DZBA 3DUHA 2XNAB 4LEXH 1LD9B 4FQQA 5DJYA 4X7SH 3MBXH 3FO2A 3MV9B 3BXNB 5ESQB 3MRFA 5B38G 4PRDA 1D9KB 4WV1C 1M1SA 3EFFA 5DS8B 4WRLA 2F19L 3GM8A 3DVIA 4CMHB 1MNUL 2WIMA 3IDYC 3BSZL 5E2WH 1J1XH 2HT2C 4YXHL 1DN2A 2F53B 1HIML 4YHYB 3PJSA 3QEQA 3ARRA 3UEZA 1CDCA 3FT4A 2ERJB 2RB8A 4YR6B 2IALA 4EN3A 1T6WA 1X5ZA 2EE9A 4KJQC 4K8RL 5L9DH 1S9WB 3RWGB 3U46A 43CAA 4JRXA 4WTWA 2OTWB 4GS7C 5IFJB 4JO3L 5E00A 1RZ8A 4GMTL 1KJ2H 5H94B 1NJ9A 2UYLB 2F5AH 2AXFA 2IWGA 3ARDC 1AQKH 1IJ9A 4Z0BL 4YPGB 2A74A 5E5UB 4V1DB 3UTQA 1J1PH 4NC2B 4H0IA 4TVPD 3S8WA 3CX5K 3MJ7A 4OM1H 3BP7A 2WUCL 1CL7L 3REWA 3DROA 4JQIH 4QLRA 4HH8A 4WU7B 5SWSE 2AGJL 5ANME 5GISL 3TT3L 1E4WH 2X7LA 1FE8H 3PWVB 5C0CE 2HWZL 5TDOB 4AQOA 3UTZA 4P2QE 2HKFL 2H32H 1QSEE 1WFOA 4HX1B 4EEEA 5EU6A 1KCRH 2JLLA 5L2KE 1O5DT 4ZUUB 4JPVL 3EYUH 3EYOA 3ELAT 1IM9B 4KMQA 3IDMA 1N64L 3UJJH 2A83A 1I1AD 4GW5A 1UYWL 1YPZB 3FZUC 4JM4L 3ZE1E 1D5XA 3OKKB 4M61A 1F4YH 1AIFA 3EJZC 4O4YL 3SDCC 1XR9A 1I3GH 5T33H 3BGMB 3DMMB 4JB9L 3H9SB 3HAEB 2V6HA 1CWVA 4JM2F 2Z35B 1MAML 3QULB 4I2XA 2OM5A 1T1YA 1R3IL 4LBEB 4XRCA 3HR6A 2PXYD 3I6KA 5JDSA 4N0YL 2F54E 2ARJB 4QCIB 4NHCH 5EU3B 4NC0B 3DUSB 5D5MF 4Z5RA 4RAVA 2UZXB 3JV5A 4KTEH 4LLDB 3QEGH 4XTRC 2I9LA 3OGOE 1UZ8B 1A3LL 1I75A 1PDKA 3TV3L 2E7MA 2BSRB 1OM3L 3BZFA 3PP3H 1AKJA 3KHQA 3NZ8A 3SDXE 4L9LB 3PGCB 2GKIA 2NX5B 2WLYA 3C08L 4J1UA 4KH2A 4MA1B 2YRZA 4KUCF 3WNLA 2NYYD 5LKNA 5TE6H 1MCCA 4BH7B 5EBLA 4HS3B 3ULSB 2PTVA 3SDDA 2Y4SA 1JFQL 5JORA 1KN2H 4PRHD 4QTIL 4JKKA 3BJ91 3VWJA 1C16B 2JF1A 3Q1SH 3PF2A 4M6NL 3BVNB 5T1KA 4JHAL 4TVSa 3MBXL 3ETBF 2XQBH 5J57B 1A02N 5T3ZE 4XVTH 4G8EB 3VXRA 1IAKB 1Z2KA 4UU9A 1T3FB 4C56A 4OF6A 5F7KC 4PY7B 3GIVB 1BGXL 3JV4A 3BW9A 3SE8H 1PQZB 3TIEB 5EO9B 3T0EB 1LEIA 1J1XL 4MZ3A 1GYAA 5DGRA 1QFWH 4NYLB 5B39A 2OLDA 5F96L 4PJEF 3CFJA 5BJTA 3D0VB 3V4PL 4N1CA 4S1RL 4Y2DB 2R0KL 1QR1B 4G8GD 4HKXB 4OJFL 3UROR 1T03L 2J8OA 3F65A 1W8OA 3DX8B 4QRRB 5CLTA 3SO3B 4WEMB 3OV6A 3R8BB 1KB5H 3O2DL 1CD8A 43C9B 1RJLA 4LMQE 3LDBC 3VXPB 3OJ2C 1DVFD 3IFOB 4Z7QF 5CUSL 3DX9B 1E4XH 3OKMB 4XC1H 2MNUA 2AK4B 1KTLB 3MFFA 3L95B 4GBXD 4EQ2A 2B2XH 2ICWA 4YHMH 1UB5A 1G9NH 1G9EA 5F9WC 1J1PL 4TOYL 3TZVA 3QNXA 4WHYG 3RVVD 4FQLH 4I0PB 3ECBB 1OAZH 4X7TA 4DZBB 4S1QH 2VLKD 2DJSA 1UQSB 3C5ZD 3FO2B 2DIBA 4P5TD 5FYJE 1F11B 4GW4A 3TESA 1S5HA 3INUL 3GMNB 1KCRL 3KYKL 3WUWG 1HH6A 2QADB 5CILH 4S0SD 3ILQC 4MYWB 2ZOKA 4M62H 3UJJL 1PGRB 5DYOB 2WUBH 1RI8A 1CD9B 3QEQB 5GGVL 5EO1B 2X89D 1T7VA 3B5GA 3FT4B 8FABA 3SN6N 2FNBA 4EN3B 3QIWA 5TE4L 1A5FL 2AJVL 1F4YL 1XT5A 4YFLI 5I1GL 2HKHH 4YDKL 1QFWI 4Y4KC 3U46B 4MCZA 2QEJA 3LKRB 1ZKAA 2B5IB 2Z8VC 5DD1H 2NR6C 2EEAA 4P3DA 2V9TA 4CVXA 4LVNB 3UBXI 1J8KA 3GSNA 5E00B 1RZ8B 3H3PL 3GKWH 4OF0A 5DRZA 3IS1X 3DO7B 2GYSA 3FJTA 3O4OC 1R0AH 5ISZB 1A7NH 2ICEB 4JQXA 3GIZL 1NAMB 1Z5LA 2WIIA 4WI5A 1FVEA 4JO4H 3REWB 1JHTA 3DROB 2V2XA 4DCQA 4F9LC 1J0ZA 3J7HA 3MYJA 4LRNH 1SEQH 1KACB 2X7LB 3D48R 4Q9RL 3ULUH 4H1LA 4KI5E 1A7PL 2XWBB 5ETUA 5J6GA 5EU6B 5I73C 4F80A 3UJIL 1REIA 1AD9A 1H3VA 2ZCLH 1FH5H 5IIEA 4W6YB 3VGAB 4M1GL 5HJ3B 3ARFB 4DVBB 3BQUC 5D71L 3IDMB 4NQDE 3UPAA 1D9KC 4GW5B 5DRXB 1EEUA 1T83A 5DFWH 4YIQA 4AM0A 3EO9H 3UCRA 1URLA 1NMBH 4RX4D 5KZCB 4WJ5A 2HTKC 2Q76A 1QLFA 3OZ9H 3NCYP 4PJBA 5CZXC 1AIFB 1CFSB 1T80A 1NGWB 4EQ3A 1NBYA 1FN4B 1EJOH 5TDNA 3MRHA 3PE9A 4M5ZL 1A64A 2NMSA 1RK0B 4I2XB 4Y19E 3HZMA 2NY2C 5GZOC 1JTPA 1QKZH 5EDXA 3Q5TA 3I6KB 2XQYG 3WJLC 3M07A 2Z31A 4LKCA 3RTQD 4YDIH 4Z8FL 4HXBH 1CCZA 3S34L 5EOQH 1IRAY 4LSDA 2XRAH 1D5ZB 1NANH 1FZJB 4HBCH 3U36A 4GQ9H 3HTLX 2EO1A 5KS9B 3BZFB 2VKXA 4RMSA 5HGGS 2EIEA 3VRIB 5EU4A 3FRUB 2HFEB 3U4AA 1R3KB 4EOWL 4M6MH 1JZ5A 4YHLH 4JFZH 3LKNA 1EAPA 5CJ8A 1SJHA 1KB5L 2HA1A 4J1UB 4LAQL 1I8KB 1GC1L 3Q6FA 4APQD 1VGKB 5CEZL 1BBJB 4HLZH 4PB9H 5IM7B 3FHQA 3WE6A 1ACYH 1J8HE 4XC1L 1T21A 3HC0A 1IL1A 1J0IA 2VN4A 1LE9B 3QB7C 1J0HA 5JORB 3FB6A 2D2OA 4GJTB 2N4IA 4DN4L 2VE6B 3VWJB 4DAGL 5DHXB 5FGCB 3S4SB 1HILA 3RKPA 4YBQC 2FLRT 4PJ7B 3HAEH 1P5UA 3DXAA 2P48B 1PZ5A 2DWDA 5ESVA 1HQRB 3S3JA 2NY7H 3CLEH 2BVOA 3L5WA 1YNLH 4ZPVB 1BBDH 4LCYB 1KEMH 1X7QB 3QQNA 5MEPA 5IP4A 3KVQA 3DMMC 3BW9B 2CR3A 5TQ2L 3KYMB 1F6FB 4G6FD 3GDBA 1AXTH 4PY8I 4MCYA 1ZA6B 5TDPB 2NXZD 4OZFG 1FBIL 3FQWA 1K5NB 5ITBL 1XCQA 4PJAF 2BXYA 1YEEH 3GMRB 3RA7H 3ARBC 2OJEA 1JJUA 3STZB 5GRJH 4S11A 1F13A 3TYFA 1RJLB 3S37X 3RGVA 1FO0L 3UAJC 1FV1A 2X42A 5IB3B 4ODHL 5KN5B 2Q3ZA 3AVEA 2P7TA 5JO5B 5JQ6H 3L9RA 3BP4A 4HBQA 1OW0C 1YZZA 3O8XC 4EVNB 2ICWB 2YN3A 1G6RA 3QQ4A 3NIFF 3RUGE 3TZVB 3EHBC 4A6YB 5HHOB 3ARDA 4OI7A 5D6CB 2AK1L 1T66D 1ED3A 1S7TB 1P2CB 3C87A 3I50L 4R0LB 2YKLH 1SEQL 3ZDZE 1MLBB 3ZE2E 3QBTB 2VSCA 1LEKA 4DQOH 4GW4B 1GVIA 4LSUH 3TP4A 3HNSL 5B4MD 3ARGD 3MRPA 3MLXH 5I76A 4N0UE 5FYKD 5IK3A 1KCKA 1OAYL 25C8L 2ZOKB 3DUUA 3GSUA 4BA8A 1IAOB 3H0TB 4XNYL 4Z7VE 3VXUA 4XNZC 4NJ9H 2G2RA 3LPGA 1MVUA 2R0WL 4Q6YA 3OZ9L 1TJHH 3CDFA 4JHWH 3T0EC 3LHPL 1H3XA 5INDA 4G9FD 4GFTB 5I75C 1ZHLB 2IPTH 3VI4F 3IRZA 5IB4A 2FIRT 3EOTL 4XB7A 5HDBF 3RAJH 5IBLC 5F1IA 4XHJC 3E2HB 2A73B 1F2QA 4QHLA 3O9WD 2X4UA 4GAGH 4XCFH 3ZYJA 3CC5B 3VFPB 1YNTB 1I9RL 3N85L 4U3CA 1NFDF 5E6ZA 2FD6H 2J6EH 1FVEB 3KLSA 5HGAB 1QPPA 5HYSG 1FPTH 5D2LA 1JHTB 2J3SA 3TBVA 3VRLE 1JZ8A 1HHIB 4Z7OE 4R26H 1EO7A 3WDJA 5FAAA 3TJHC 4M6ML 2BNQE 4PJXA 5FO7B 1Q38A 2E6QA 1IFHH 4U6VL 4RAUA 1UWGL 4UOW0 1PY4A 3AROA 5HXMA 3T2OA 2H3NB 1Y6MR 1NCCL 4JE4B 1DBML 4XPAL 5MP6L 5J7CC 4HK3J 3SGKC 1I7RA 4DK3A 4LHUB 2ZUTA 1LNUA 4XNMA 5BW7C 4WI7A 1RZKH 5ADPL 1UZ6F 4YIQB 4AM0B 1RZJC 5T5NF 1CXLA 1JI2A 3OWEA 3TIDA 4WJ5B 2Q76B 3MMEB 1FSKC 5DJ2A 5IOPB 2ZG1A 3N1FC 4RRPG 1NBYB 4LRIC 1LDPH 4KY1L 4YHNA 2BC4A 2WINA 5E8DH 3KPPA 1JGUH 1AO7E 1CBVH 2IGFH 4RGMB 2NY7L 3BWUC 3CLEL 3PWJB 5DVKA 5JXEC 4NRYB 1A6AA 4NQCA 4Z0XB 4QWWC 4MA7L 2P42B 2Z31B 4LKCB 4P99A 2VUOA 1AQDA 3I3DA 4UQ3B 4KKBC 1OARL 2QQKH 1NAMH 3BI9X 1RZ7H 1S7VA 4N0FB 1A9BB 3U36B 1F42A 5JR1H 3PUCA 2WLZA 3QZWG 2G60H 1K4DB 4J8RB 1AHWB 4HIHA 3F7QA 4YE4L 2WQRA 5FA3A 4B53A 5IJKA 3QUXC 1HXYA 4R6UA 4WTZG 3I02A 3T2QA 1H3TA 3GJFB 3FTGB 5JOFA 1NGPH 4R4BB 1W72A 5DJAB 4L4VD 2BERA 2NTSP 1ZTXL 3A0OA 4M7JH 4LKXA 2BCKA 3Q6FB 3QFJE 4UZGA 3Q3GA 1UCTA 1L0YA 1N59A 1NSNL 4EI6B 3WE6B 1C5CL 2YS4A 2YWZA 1MSPA 1YMMB 3WS3B 3QXUA 5HHQA 5GRVL 2EC9T 4N8VA 4ODWA 3FB6B 3TN0C 2DD8H 4RBPK 2KQNA 3O2VL 3V6BR 1UFUA 1DFBL 3ARFC 5KAQF 1HILB 4N0CC 3LEXA 1NMAH 4UMGA 2UWEF 3L3IA 3ULUE 3DXAB 5EPMA 2CGRH 5EH1A 1PZ5B 3DI2B 3QXWA 4TUKH 2PW2A 4LQ1A 2BVOB 4DQOL 3TO4C 3BDYL 2VLJA 1OY3B 4LSUL 3VXTA 1DLFL 3DV6B 5C0GB 5AZ2L 3L5XH 5MEPB 4LPVA 4RFNB 4TRPH 1NCUA 4LSRH 3LS5H 4AT6A 2F53E 2EIZA 4X6DB 3S7GA 3H7BA 3CX5J 5KSAB 1ZLSL 1YY9D 2ZCKL 1E28B 3AUVA 1JNHA 3FONA 1LO0H 3MOBL 1MFAH 4NJ9L 3FQWB 4QXUH 3U1SH 1XCQB 2ESVB 2DLTA 1JWSB 4CDHA 2EH7H 2VOTA 3WEXB 2OJEB 3M1BA 3ARQA 4UB0L 5F7DA 1G7IB 3DNKA 1JPSH 3VA2C 3WYRA 4NPYB 4XPBH 1Q72H 3BP4B 1UACH 4Y4KA 1YNKH 3UJTH 3FO9B 3BFOA 4M1DH 4V1DE 1Q1JH 5GGTA 3ROLA 4XPGH 5EOTA 1JGVH 3L3HA 2FD6L 2DQUL 1DUZA 2Q7YA 1EHLH 3EDEA 1PG7X 4LSTH 2O5XL 3JWOH 4EI5B 1ED3B 4HUUB 3QIBA 4KROD 1RHHA 4R26L 1FHGA 3SCMB 1AE6H 1IGJB 5F7UA 3H3KA 1I1CA 1AR2A 4HT1H 1SMAA 1N5YL 4H88L 3O6FD 4P5MA 4F9LA 3QDGD 4PJDB 1H3UA 2NCMA 3PHOA 1S78C 5IK3B 3BYTA 1OT1A 1B2WH 2AABH 2JKXA 3WSQL 2EXYC 3FQTA 2QL1A 3DUUB 1T4KB 3MRKB 4ZOEA 1Q0XH 5FUZL 1X5HA 3MNWB 3MNZA 1YPZE 2PO6C 5KTEH 2H9GA 2QKIA 3C60D 4JFQB 1EEZA 1HI6A 1U36A 5I1EH 3W81A 5MHSD 3H9SE 5CAYB 4DGVL 1OHQA 1MQ8A 3SQOH 4K3JH 2GK0A 3EW3B 4MS8C 5E6YA 5F1IB 5F44A 5KOVC 5JOPE 2XYCA 4OB5L 3OAUH 1R5IA 2D7QA 4QHLB 4X4YB 4AIXA 5A1AA 5GZND 5EU7C 2JELH 3ZO0A 1CIUA 1RQ5A 2HJFA 2YRPA 4ZUTA 1V3MA 5E6IA 3TJEH 1TVHA 1RMFH 5JLZA 1DQDH 4QHNA 3WJLA 1QEWA 4A6YH 1AY1H 4N0RA 4U6YA 1J05B 1U8NB 1TCRA 4AENA 1XR8B 1INEL 3QFDA 4NFBA 5B3JE 2A9ML 2NX5E 2ITCA 3P4NA 2R8SL 4RAUB 3VFOB 3MOAL 1CT8B 4PG2C 5D1QB 1RUAL 4LVHB 3HZYB 1BECA 1I7RB 1MI5D 4OZIF 2R1XA 2PF6A 5T5FH 4LGSB 3QDJA 4IDJH 4FG6C 2BNRA 4KDWA 4EDWL 3LMJL 1WQVT 1LO4H 5FHBH 1ULVA 3MOQA 1CU4L 1A3RL 1BJ1J 5DD6A 5DJ2B 1V05A 3I75A 4OCLC 2OQJA 3MRQA 4YHNB 2VDMH 2GJ6D 4QF1A 4Y1AA 5I1JH 3C2SA 2CGRL 4PJHB 5I0ZA 4K94C 4MLIA 2OMNA 4NQCB 4PTTA 2NY1B 4GRLB 3VD3A 1A7QL 5EFIA 3T0EE 5M7QA 3LIZL 4BSVA 1UKTA 4JKWA 4NNPH 4B7LA 3M8OH 2P5EB 3W2DL 1MFAL 4KKCD 1FAIH 2VAJA 4HIHB 4RGNB 3RDTC 3RKDD 5FA3B 3MUY1 4OBSA 4QRRE 3MA7B 5FOBB 3FMGL 3DECA 5LJYH 5E08H 4QT5A 1W72B 1JIBA 4G6AC 3EUUA 4JGMA 4D94A 4LKXB 3S88L 4Y5VA 3Q3GB 1N59B 4FZ8H 2CRZA 5CJQL 2JB6B 3ARBA 1YEGL 2VERN 1G0YR 4JFPA 2AK4E 4PJ8D 1F3DH 1T2XA 2R4SH 2V5TA 2P5WA 1JPFA 1ZT4A 4N8VB 4IRJB 4NT6B 5EIQA 4MJ6A 4K8RD 3FAXA 4TULL 1MLCA 2A38A 3BDXA 3U7YH 5BMFL 2Q8BL 3KPOA 2PW1A 3CXHJ 2HTLC 4EIZC 5IVXA 3PQYA 1XGPB 3TBTA 3EIFA 2DLFL 1ODAA 1BWWA 1TJGH 2OJZL 5HGBB 1QUNA 5C70A 4OZHA 5EPMB 2QQQA 3G04B 5DVMA 5C0AB 5EBWA 1IKFL 1JI1A 2VLJB 3DVNA 5TFSL 1L7IH 1RU9H 1IC7H 1VFAA 4J3VA 1YEIH 3O6KH 4QHKJ 2FHCA 4LSPL 4OKVA 2DAVA 1WWAX 2FGWH 1J87A 2X70A 2JIXA 3OKOA 4BUGA 3EJYC 4QXTB 3QEQE 1CGSL 3K46A 4LAJH 2A6JA 3HE6B 4HGMA 4NZUL 2IQAB 4YPJA 2XACC 2Y07H 4P9HL 5KTEL 1OL0A 2OP4L 3WLBB 3AU1B 2AS5M 4MQSB 1H3PH 4MNQB 2BNUA 4FTVD 3HLAA 3ZYZA 3FN0L 1AI1H 3M1BB 2FDBP 2ATPA 1U8MA 2W0FB 5HYJB 2CO7B 3QIUC 2BX5A 2FRGP 4K3JL 4HK3N 3ARSA 4PGEA 1S7QA 5DMJB 1DLHB 1AHWC 1T2QH 2R0ZH 4LU5L 2X4PA 3CDCA 1W2KT 5ISZE 2JELL 5D2NA 1NDGA 1B9ZA 2YPLB 5MEQA 5GGUB 2HVKA 1WFNA 3P30H 1FL5A 5DGQA 2WANA 1HYSC 4GUPA 4YHOL 1SVZA 4UDTB 1ZGLA 1YJDC 1DUZB 2FECL 1CFVH 2Q7YB 2R0LH 4JR9H 2UZIH 4GRMB 1D6EA 2GITB 3HE7D 3QIBB 3CDGA 4ODUB 4BZ2H 5D93C 4M8QA 1RHHB 5KW9H 5FOJA 2CK2A 1VEMA 3DGGA 1A9EB 2ZNXA 1QG3A 5CIPA 5EU6E 2DLEA 4K3DL 4KTDH 4LF3A 4P5MB 4G8FA 4JZOA 4W4OC 3GO1L 3EYQD 4WCYL 4Q0XL 4DKFH 4XC3H 3L1OH 1EEYA 3CIQA 4UAOB 4BSJA 4YBHA 2DQGH 4DGYL 3VI3F 4WI4A 5DJCA 1FNSH 5KG9A 3QG7H 4X7FC 2H9GB 1DBJL 1IGMH 1XH3A 4M7LT 2ZJSH 3C6SA 5EZOH 1KJ3H 3DURB 4LNRA 5JZ7D 1QR4A 2GIYA 1FFNA 5BW7A 4AMKL 2AEPH 1V3JA 1ZLVH 3MODH 3MRDA 5KSAC 4JM2B 3GI9H 3V5KB 1ITCA 2GCYB 3S36X 3DYOA 3GSNL 3BIAX 2K1MA 3ALPA 5AYQA 5EO0B 4ELKA 1R5IB 2RGSA 5C2UB 3HZVB 2Q86B 2NY4D 2CUHA 1LO3L 4YWGL 5C2BH 2XTJB 4J4PC 4ZUTB 4W68A 5E6IB 1JZ7A 1TVHB 4J3WA 4UV4H 4LQFL 5JLZB 1U3HD 4QHNB 1QEWB 5KS9E 1EERB 1WZLA 1QTYT 5LWYH 2D3VA 5I8OH 1TCRB 3NTCL 3OF6D 1FAIL 4AENB 2OXHA 3S6CA 4NUGL 1EH9A 3C8KB 2VR4A 3PDOB 4HGKC 2APVA 3B83A 4OCWH 5DURD 3V4UH 2NW3B 4WUUD 2J5LB 1I1AA 1MY5A 3ARZA 1I8MB 4EI5C 1EO8H 2YUXA 3QUXA 2H41A 2X4SA 4ELMA 4EXPX 2R1XB 3SCMC 5EIIB 4NZTL 2DMBA 1EMTH 4WWKD 2AKRA 4Y8DC 3X3GH 4TNWK 5B39G 1MPAH 2PXYA 2BY3A 2FX8H 3BKYL 5FGCE 4OUUB 3IETB 1T89C 1XGTA 2CSPA 1KPUA 4PJ7E 3I75B 2OQJB 3TN0A 2JK5A 3SBWC 3B9KB 3KR3H 4Y1AB 4M3JA 1MIMH 2C3VA 4KAQH 3HI1B 3U0TA 4R2GB 3FOLA 5DO2C 5EFIB 3QCUH 3CFBA 3LN4A 5EBGA 2V9RA 2FGWL 1HKFA 3CVIH 5CBEA 4TNWF 1L4IA 3NCMA 1T5WB 3HC3L 4MAYC 4LGRB 1MCOH 2ZSVA 2XPGB 3I6LE 3THML 1NC4B 2HT4D 3AS2A 5CCKH 1AI1L 1MCDA 4ONGH 3SDXF 2JCCE 4PRHA 4K9EC 4I48A 4MNGA 5DSCA 5C08D 1T2QL 2VB5A 1EVTC 1JPFB 4FFYL 3TVMD 4ZO9A 4MJ6B 4Y88A 2EYRA 1SM3L 5C7XL 1C5BL 4F33A 1T7YA 3BKMH 1CDJA 2VO5A 3KPOB 5HHOE 4S2SB 4XVJL 2R0LL 4U6HB 2UZIL 5IVXB 3PQYB 3D69B 1U8OA 5F7EH 1G7PA 2EDWA 3TBTB 4F57H 3JWNC 5DEFA 3S9DB 3QA3B 4NN6C 4NP4H 4BKLB 3KXFE 3MUZ1 4R7DA 4P2CG 4F2MA 3BT2L 5HI3C 5JA8B 2LU3A 2Q20A 3DVNB 4KRPC 2VC2L 3G9AB 5TH2A 1G7QB 5IMLB 1RUQL 4N90D 5BV7C 1VFAB 3ROOB 4G8GA 1VFUA 4OKVB 3WN5A 1RZIA 1AGBA 4OF3A 2X70B 5D7IA 4YX2H 4OLUL 5I18L 5IHZA 2XKNA 3GK8L 1H15A 3TNMB 4HIIA 2G5BA 5D1ZD 1BQSA 4GRLC 1QRND 3BZ4A 5DLML 2BNUB 4ZFOB 4P48A 4EDXB 4IHOB 5F9OH 3H9ZA 5J89A 3HLAB 4WEBH 3X14A 3L3GA 5BRZA 2QTEA 1U8MB 3FO1B 3MODL 3LPWA 2EE3A 1W72H 4WUKH 5HHMB 5SWZA 4H1LG 1RV6X 1QBAA 2LVCA 3ARUA 3OKEA 4PGEB 1S7QB 1A7OL 3QWQB 4X6FA 4D8PA 4JPWL 4U1GC 1SJVA 2JJVA 2VLKA 5D2NB 1NDGB 5EZLA 3JV0A 5MEQB 5C2BL 2HVKB 3C5ZA 3JBG7 1ZLWH 3U6RA 2JB5H 1G6RL 4BFGA 4JKPH 4K7FA 2IC2A 1I1FB 2OR9H 3VD4A 1JHKH 3GUTB 1ZGLB 4DVRL 4MDJA 1D6EB 4PJGA 4H0GA 2XG4A 4KTYA 4U0RB 4BUHA 5JHDD 3IDXH 1LP9A 5T3XL 3GMPA 4M8QB 4IRJC 2GUOA 4L3AA 5ICXA 4RISH 3CD4A 4OCWL 2IG2H 3V4UL 5IEHA 2D9CA 4F7CB 1ORSB 2D7MA 1LEGB 3RVTD 4LF3B 3ULVC 1L7TH 3DVFA 2CIIA 2X89A 3T77B 3PDDA 3SDYH 4JY6B 2AEQL 4F7TB 4QY8B 1MHPH 4W6XB 3LN9A 1AH1A 1NCWH 2ORBL 1F4HA 4Q9QL 2EDOA 3LKSA 4PG2A 5DJCB 1TZHA 3HR5A 5E8PA 5KG9B 2QQNL 1XH3B 3MC0A 2FYYA 2FX8L 4RNRA 4YEFA 4MJ2A 4B0MM 4LNRB 3AREB 4PGBA 4WU5A 5J0BA 5CEZD 1B88A 1FFNB 1FL3A 3U7WH 4EKXA 2IADB 3MRDB 3HE6C 4E41D 1MIML 3HMXA 4U7KA 3UZEA 4YUEH 2BMKA 2EXWD 3B4NA 3PG2A 4L8CA 1YEKH 1EHAA 3CFEB 1KCLA 3QCUL 4JVUA 1MCRA 3K80A 3P11L 2J88H 4ZAKD 4ZTOH 3RZCC 5FDWB 1K9TA 1JYNA 2HMIC 2FX9H 1EPFA 3ALWA 4JHZA 4R90L 4HPYH 1F90L 2IMNA 2DDQL 1IAIM 1NAKL 1YEHH 2CR6A 4YC2C 4YEEA 4OCXL 1I1YA 2Y06L 4KHXH 4GXVH 3VG0H 5LVEA 4RWHA 3MLRL 2E9BA 2UUDH 3DV4A 1RIHL 1AXSB 1I1AB 2DLGA 3B9EA 4P5KB 4R96B 4RZCB 2YMXH 3W0WD 2E27L 5FHAL 5GGVY 1OAUL 4RX4A 3NFPB 5EC2A 5IT2L 5CJXC 4UT7H 1G7LA 4KI5F 2WQ8A 3FHAA 4YJZL 2VXQH 5ACZB 1YMME 4JCMA 4QOKD 2M1KA 3EFDL 1MF2L 1VACA 3QR2A 1TZGH 2ZCHH 2AKRB 5E2UH 4JZNA 3DX6A 1MFBL 4HEME 5JMOC 4XVUD 5J13C 2PXYB 3SE4A 4N5UA 3EO0A 4FQIL 4PJ9C 4K3EH 4UAOC 3RTQA 5BVJB 3O3BA 5AD0A 5E9DB 2JK5B 1HDMA 1HH9A 1YQVL 3NFSL 4OSUH 3X13A 1UA6H 3JVGC 2E5EA 2C3VB 3ZTNH 2KZ1B 3U0TB 2AQ2A 3CFBB 3NCJH 3ZKNC 4HPOL 4X6DE 4JM2C 5AAMA 2XXCB 3TA3D 4JDZA 3EOAB 3MGTA 3MNVB 3V5DA 2EIBA 4APQA 4OT1H 2WMPA 1BFVL 1KENH 4IOFD 2F9BT 2QQLL 3U0WH 4EUPB 4YDVB 2ESVE 4GAJL 4HG4K 1CVRA 2ZSVB 4MA3A 1KGCE 1UKQA 4NM4H 2CRYA 1WICA 2DQEH 5DEZA 4PREA 3SDAC 3SKMA 3P4OB 4PRHB 4WUKL 3UTPE 4P59H 1DN0A 2AXJA 4FP8H 3U7AA 1XGQB 4ODBD 4LP5A 1NKRA 1C7TA 1M71B 3QWOB 1AFVL 1IMHC 4NCC1 2VXVL 4PB0L 1R24A 3QIUA 1I9JL 5D1XD 1P7QD 2J5LC 3NZHL 5LQBL 2H2PD 5EU5B 1GHFH 1PD6A 2V7HA 4JKPL 1JHKL 3QO0A 4NGHL 4NJAH 1RUPL 2OTPA 5E8NB 1U8OB 2DQTH 2RQ8A 5FCSH 7FABH 5DEFB 1EDQA 3SE3C 3O2WL 3SGJC 2X4RB 3H7LA 1NGYA 2N56A 4FQ2L 2D4FA 4PJDE 4CNIA 2DQCH 1E6JL 5ICYA 4G8GB 2IMMA 2EDDA 2VN7A 3WN5B 1YEDA 1MHPL 1RZIB 1AGBB 4GW1A 3FAWA 4HC1A 4OLWL 5B21A 3JUZA 2C7UA 3C8HA 3T3MF 4P2RD 1VCAA 1H15B 4PJCB 3P9MA 2EDBA 1DVFB 4FQCH 2XWTA 2FIKB 3MLYH 4KK8D 2WP3T 4KK9D 5DUML 5C09B 3BZ4B 2IAMD 4G6KH 2EDLA 3CVHL 5IGXH 1ZHBA 4L3CA 2WSKA 1ZXQA 1TITA 4IOIA 3S37L 2X05A 4GBXB 4GKSB 3X14B 1T22A 3NA9H 3L3GB 4Z76B 3RPIB 1UWXK 3BJLA 5ABDE 3EGSA 2NLJB 1K6QH 1G7HA 1S7RB 4ZO8A 2BZDA 1EVUA 2AXGA 2E8ZA 4X6FB 1JP5A 4D8PB 1MCPH 5EBMA 3S96B 1BM3H 3QXAA 4ZSOE 3FQRB 5HDQL 5GGTL 3C5ZB 3U6RB 4P5TB 3BUYA 3KG5A 4K7FB 4Y16C 3GSRB 5LGKA 2V2WB 4MDJB 2ZUVA 4KQ3H 1BJ1H 4PJGB 5DMKB 3ARGA 4ZO6A 1TQBC 3F58H 3NIDE 4X99A 3ZE0E 5DD5L 5I17B 1YEFH 4GXVL 1A22B 1YY8A 1BJMA 2XIDA 5F9DC 5IEHB 4MWFA 3W9EA 5BS0D 1CXEA 5KVMC 1UJ3A 2N1KA 4RFOH 2YMXL 4ZOBA 1TTGA 2CIIB 5HD8C 1WV7T 2FJHA 2HFGH 4A2LA 2VXQL 5I16A 2DS4A 4G43A 1MJ8H 2PR4H 3WXWL 4CL7A 4JZJC 4ZDHA 2CMRH 1TZGL 5E8PB 4OQTA 1A6ZA 3ORJA 4AG4L 3TBWA 3T09A 1UVQA 5BCAA 5JOEA 1BP3B 2OSLB 3LEYH 1F8TH 2UY6A 4IJ3C 3IFPB 4XXDB 3O9WA 3QHZH 3TH4T 2V5RA 4J3SA 4K7PY 4F58L 4PJHE 3RRQA 4NNXB 1B0WA 3A6CL 1ZA3A 3GMOA 4D3CL 4NQCE 1JNJA 4YDJA 4ZFGH 2HFFA 1T89A 3MLUH 4YBLC 1NQBA 4L8CB 5TPWL 1OPGL 2XZCL 1BWMA 5DMGD 1VEOA 3NCJL 1GGTA 5GRXG 1OSZB 1BFTA 3B8SA 3LV3B 3MLSH 2BOBA 3O6ML 1R3HA 1ES0A 5FUCE 1JWUB 4OFPA 4NO5A 1QD0A 2WBJD 3H42H 5HVFB 2P5EE 4HKBA 4QXGH 4PJFA 3V5HA 1J5OH 1KENL 4RGNE 2AI0L 5A2JH 1BEYL 3STLB 3ZT5A 1HXMB 2W91A 3MZTA 4MAYA 3DV4B 3P4MA 4M1CD 4YHPA 4Y4HC 5DDHB 5CEXA 1ZWIA 4NUJA 2ZUQC 5IQ9B 2R23A 4ZXBB 5EC2B 4O2CB 1MJ7H 1A1MA 1EXUA 1KT2B 3V95A 4JVPA 5D8JL 2VH5L 1VACB 3MLWH 2CDFB 4CGTA 4PRPD 3DX6B 1GHFL 2D7TH 4F7MA 4P3CH 5KVGH 1GH7A 3MO1B 1OTTD 4XP6H 1A3QA 2EEDA 3BE1H 1IC4H 5GS1C 5HDOA 3MRRA 3LRHA 5ALBL 7FABL 4X5WA 3H9YA 3O3BB 1JGEA 1ADQH 3PWLB 1A7RH 3K8KA 4HK0A 1HH9B 3RWHA 4TUJA 2CK0L 3ZZ1A 5C0AE 3MXVH 4FQXC 3X13B 1HINL 2VLJE 4TVPH 3QQ3B 1IC5L 4KV5E 4LCWB 2HJKB 3S5LB 4PJ5D 3L5JA 1VKXA 3FT3B 3AREC 2I60H 2VXTH 2GEEA 2C4FT 1T0NA 1F58L 3BP6A 3TWCH 1RUMH 3MGTB 4L4VA 1K8DA 1EGJA 2D0HA 3V5DB 1N7MH 4WWKC 4APQB 1ZVSB 2BVUA 4I18C 3MLYL 4MNQE 3WO4B 5F71A 1Y18A 3WXVH 4KJPC 2B39A 3BGFC 1OWWA 5J12B 1WVZA 4MA3B 3R0MA 1TXKA 5HYJE 3QJFB 4PREB 3SKMB 4NNYA 4JFDA 1WAAA 3HFMH 1PX4A 4BSWA 1U2HA 5C0ND 1FG2B 1VPOL 3V0AC 1CR9L 3CZJA 2APWA 4P4KB 3RNKA 1BM3L 4U6XA 3FT2A 2YPLE 4DFHA 2VIRA 4HH9A 3KNBB 4WFHD 3G6DH 4Z7WF 3UO1H 3QO0B 4JRXD 2C1OA 4QHKI 5F6HJ 5F1NB 5C9JA 5C9KA 1HSAB 3WFDL 3WNOA 3IDIA 3O41B 1IGTA 2QSQA 1DQLH 3O3AB 3JTTB 1TVBA 2R2EB 4X4XA 3UTSB 4YQXL 2VDQH 4RMUA 4WHTA 2O5YH 4LVOB 3ULUF 4TPRH 2NXZB 3CFCH 4AQ1B 2OZ4A 1JPGA 4L3ED 1YEDB 3PXJA 4P23D 3VFNB 2O93L 1CD1A 3QUMB 2RCSH 2PR4L 5JDJA 4JDTL 5L2JB 2BVQA 4IIQC 3V4VH 2CIKB 4LLUB 4XP1H 3MRCA 4CRPA 1GZPB 5JPMA 2V7NA 4EUPH 3QSKB 4R8WL 4L3CB 3QHZL 1VGEH 4AEIH 2O61A 4O5LL 2HT3D 5JNYA 3UYRL 3UPRA 3E1F1 1Y0LB 35C8L 1G7HB 4QRPD 1MH5A 3EJJX 3DX7B 5EBMB 5D5ME 3GBNL 1BAFH 4I13B 5K9JH 2XTJE 3ARPA 1P4IL 3VMOA 3L3JA 1PG7L 3BUYB 1P7HL 5HVHC 3DRTA 3G9VA 1MVFA 4P2OD 5J8OA 4S1SH 4Z7UB 4HUXB 1GGCL 1OLLA 3O6FA 4OZGB 1JTTA 3ARGB 4HLJA 1J5OL 1FRGH 3UTTD 3O0RL 3T4AB 3PWUA 4OLYH 2NY0D 3W9EB 1UJ3B 2H8PA 5LAXB 3QQ9D 1OCWH 2EZ0C 4FQHA 3X12A 1UEYA 2FJHB 5E99H 1SY6A 1MHHB 3WIIL 1G9MH 1XGUA 3QH3A 4G43B 1AKJD 4OI9A 1LO5A 4G9FB 1VERA 4P0DA 1CLZL 1B4JH 1BOYA 1NC2A 3D0LA 5FK9B 3VXSD 3MREB 5TF0A 3BRGC 1XFPA 1MCNA 3RP1A 4OQ1A 4G9DA 3QCVH 4BK5A 3ARXA 3TBWB 3JTSB 5IMKB 1GPOH 1UVQB 4XNQB 1YPZF 3RVWC 3QDME 3IDGA 2YPVH 3O9WB 4G3YH 3CMOL 3D2UD 1A6WL 4Y1AE 1PG7W 3O4LA 3KJ6H 5D96B 2R69H 1RZJL 3GMOB 1X6NA 3SDDD 1E27A 1EBAA 1YMHB 4YDJB 5DD3H 1DQTA 4PJ9A 4I4WB 4KMTH 2F58H 3PP4H 4OD2A 1FZOA 4FFVC 3UC0H 4WFGE 3D39B 5I1LA 1ZVYA 3TC9A 4Y4FB 1QSFB 1IILE 1V7NL 4MVBD 5M94B 5DRNA 4JFOB 2P43B 2Q7NA 1R3HB 3OX8B 5JUEH 5BXFA 2FBOJ 2DQDL 2YOCA 4KK5D 4P2QD 5SV4A 5IQ7H 1J1OL 1QSED 2I24N 3CK0L 4ENED 1WZMA 4N9GA 5DJ0B 4HKBB 5HHNB 2P8MB 4AIZA 5K9KA 1OWRM 3SHSA 4C55A 3T2PA 5F3BA 4IMLA 3T65A 1MFEH 2YRLA 1FLTX 1ZEAL 2IH1A 2DTMH 3P0VL 4YNYA 5CMAB 4YHPB 5CEXB 1ZWIB 3MJ9L 3NPZB 3NFNB 4Z7QE 1NH6A 1K8IA 5IB5A 1EXUB 1XIWB 5EUOA 5FM8A 3LKPB 1T1WA 3QI9C 3SDAA 2DL2A 4NZRL 4XX1G 4YLQT 5JPNB 1OTSC 1S8DA 2GSIA 4ZAKC 4F7MB 5IVXE 3PQYE 4UDUB 1IEAA 1OP3H 1WEJH 4OUOA 5LBSH 4X5WB 3CXDH 4FZEH 3AY4C 2Y7QA 4KQ4H 2ZUYA 2K7QA 4LLAA 4HWBA 5SWQA 3I9GL 3HMXH 4ALAL 2YD5A 3FB8A 5KOMC 2OK0H 4TPRL 1VKXB 1MY7A 3QHTC 4XMKH 1DANU 1FGVL 3K4ZA 2F8VA 1KG0A 3IFLH 3U30B 4GH7B 3G5VB 4WY7L 3HB3C 3BP6B 5I8KL 2VWEC 3G5YB 4QRUA 1K8DB 4XP1L 3VFUB 1IGYA 3TEUA 3I2CH 4OV6F 3VWKC 2DWEB 3B5TA 5E5MB 4OCYL 2LTQB 4LLQA 3BH8A 5HHME 1F00I 4K23L 3L6FA 2BSSB 2N7BA 2FBJH 4NNYB 4R3SA 5TGBB 4BSWB 4PBXA 1CG9B 4ZFZB 1FC2D 1A1OB 5DD0H 2AW2A 2DQHH 4P3WA 4PJEA 4U6XB 2AV1A 1LWRA 3L7EB 4PV9A 3UPCA 2E7LC 3LKOA 5T3ZD 4ERSH 1A8JH 3STBA 4S1SL 3RY4A 2C1OB 1Q9KA 4ZXBC 5DHYA 2NW2B 5C9JB 4HHAA 3PL6D 4Q74A 3O81A 5IKCA 1FRGL 3NACL 3IDIB 1IGTB 3BWAB 3DYPA 3HNTH 5I19L 2EIDA 5JW3L 1MJUH 1LK2B 3EOBA 5CLWA 3FQNA 3B2UC 1HHJA 1TVBB 4UT9H 1UJTA 5GS2H 1PKOA 4KC3B 4G5ZH 1RJZA 5A40E 1YN7A 2FB4L 3D3VA 1E0OB 8CGTA 3V6ZB 4MNHA 4PYGA 5I6XC 3OXSB 15C8L 1CD1B 4FTVA 4U1LA 4HF5H 3SGDI 2DBJA 2J1KA 3NH7L 1JZ2A 3WFZA 3QCVL 2XZQL 1GIGH 3MRCB 5IW1B 2V7NB 1NEUA 4MA8L 2W1NA 4JZJA 3QPXL 4KKAC 4PS4H 2XA8L 1FGNL 1FNLA 4JREB 4JQVA 5BZDB 4NOFA 4X7DC 4TVPE 4H25B 4WNQA 3UPRB 3IJYB 5FYKU 2VITA 5B38B 1DSFL 1MH5B 4KMTL 1OTUC 3HE7A 5H35A 1KBGL 5J12C 1SBSL 3WS6C 4ORGB 1FP5A 4LLYA 2PNDA 2YD3A 2HH0L 4PRID 5FYJD 1EHNA 2DF3A 2UVEA 5IQ7L 5AUMB 2IANB 3O3EB 3O6FB 1A6UH 2V5YA 1YECL 2Y72A 3QDGB 4X6EA 1XGRB 3OGCB 5E7FA 4P4KC 3P9LB 5E8OA 1P6FA 4KK9C 1I85C 3N9GL 2PCPA 5E2JA 3F8UB 4Y89A 2DTML 3ZTJH 3VJ6B 3V6OC 3BZEA 1FORL 3C60B 1FG9C 2PYEB 4FQHB 1ZLUH 3CUPA 5MEOA 5EA0H 3QH3B 1K85A 4IOSD 4NKQB 4Y4HA 4UINL 4YAQA 3BIKA 1JWMB 1BQLH 4JY5L 1N6QH 4G9DB 5GIRA 1E4JA 5FM4A 5IB1A 2EDHA 4HG4J 3IDGB 4RFEB 5E9DE 4F7EA 1FZKA 4RQQA 3OB0K 1KIRA 1LK3H 4JFEA 5D70H 4KQ4L 5GJSH 5D72H 3S36L 3TBYA 3L3KA 4FA8A 1X4ZA 1E27B 3TO2A 1M05A 3E8UH 1NPUA 5DI8A 1KFAH 2HLAA 1I8IA 4JJ5A 1JRHI 2Y36H 4X83A 2FR4A 3F7YB 4XH2A 3H3BC 5EUKA 3E6FB 5JHLL 2B0SH 2VDRH 3IFLL 5DRNB 4TSAL 4UV7L 4K94L 3RL1A 3OJDA 4WI6A 3DIFA 4WUUA 3CNKA 2J4WL 3MRIA 4H8WH 1OAXL 5K9KB 1U8JB 1SYVA 4MAUL 5IMOB 3T65B 3T2NL 1MI5B 2IH1B 1CK0H 3HN3A 4O02L 4YNYB 4WWKA 3HA0A 4ONHA 3ZL4L 4PRHE 3F5WB 3O2DA 3HI5H 1Z0MA 4OGYL 1F4XH 1U3JA 1K8IB 3IJHB 5DK0A 3WHXB 1M7IB 5DD0L 1UWEL 5HI4C 1Q9OB 3RWCA 3VG9B 1FDLL 4CW1A 2GJ6B 4NSKA 1C08B 2HT2D 3NIFE 3KPRD 5FKPB 4B50A 1S8DB 2VZUA 3KPMA 3WKNA 1KF9B 5FF6B 3ZKSD 3NCYS 4KJQD 3HNTL 3PWNA 5GXBB 5J9PB 4OD3L 1MIEL 4LSVL 5JXAH 1MJUL 1QFHA 3IDJA 3JWDC 4OCRH 1N6VA 1V7MH 4X5XB 4PLKC 4QEGA 2IQ9H 1OAQL 3FB8B 4U1IA 1F3JA 1H3GA 5HVGB 4G8GE 1G7JB 4U1MA 4YK4B 3IVKA 2D7OA 1KG0B 4LLWA 4NO3B 3B2VL 2H26B 5MENA 4PJCE 1JGLH 1QFOA 4LCCC 4QRUB 1G1YA 1QA9A 3AS1A 5C09E 5CHNB 5C08A 1AJ7H 1T1XA 5ID0B 4PJ8B 3SKNA 4Y4FC 2ARJQ 4IIQA 1J8HD 1HHKA 1ZT7B 2AP2A 1QSVA 3TVMA 4OIIL 3VI4E 1CGYA 1NL0L 4LLQB 5HDBE 3KJ4B 5E5RB 5H2BB 2QV2A 1JN6A 3L6FB 5JIKA 4KRMB 3VXUD 3V79C 4KZDH 4CVZA 2FSEA 3IYLW 1IEBA 2AV1B 2BK8A 2NY5H 4XI5C 5IMMB 4U1SB 2C1PB 2BJML 4G7VH 4JPKL 4L4TB 2IFFH 3FZUD 5GS0C 4PJGE 1U42A 2R15A 1VFOA 1AGCA 4HHAB 2V17L 4JN1L 3LQAH 5IKCB 4OAWB 1XIWC 2VLRB 3EJZD 5KSBB 4PUBH 2P44B 2R1WB 3K8LA 3SDCD 3EOBB 3WJJC 5IESH 4JFFD 4IRSC 1YJDL 3LS4H 1YN7B 5D1ZA 1TFHA 4NQSA 4R97B 4MNHB 4MXQC 5GJTH 3WIFA 5F6IB 5HYQB 1XF1A 1QRNA 3KYOB 4JPIB 5I1CL 4JANA 5JQHC 1KIQA 4HC1L 5IFAH 3FFCB 4KHTH 1WBZB 3HZKB 4U1JA 4HIEB 1IKNC 2D03L 1EGJH 4POZC 3CCHA 4RDQG 4M4RA 4QTHB 4NN5B 4ETQB 3G5ZB 4FXKA 3BHBA 3VFTB 1N4XH 1WIPA 1WCQA 3LZFH 5HPMA 1NGZB 3GRWL 1MRCH 1NLBH 3GSVA 2MQ0A 1LQSR 2VITB 4Y5YA 3VU2A 4ZNEA 3HE7B 5JHDA 2Y36L 3DBXA 3WUWB 3U4EA 1U8LB 3JUYA 2LTQC 2B0SL 4JRYB 4HWZB 2YD4A 1U92A 1B6UA 4NZDA 1A6VL 1RZGB 3K2UH 2ZUUA 5ESAB 1P4BH 4LCUA 4X6EB 2E9WA 2EYTA 1PJ9A 5FYKL 1M7DA 1RK1B 1MREH 3C6LC 5DR5L 4MXWH 1LMKA 3KDMA 3HI6L 1NGQL 4Y5XB 1QBMH 2BFVL 1MFNA 1A0QL 5A2FA 5K9QI 2OZ4H 4HS8L 3IT8D 5E0QA 4M4PA 4XCCH 4G8IA 5KJRL 2VABB 1EAJA 3MV8D 3LKQB 2NTFB 4YAQB 3SEPA 3QCTH 3BIKB 3QUKA 4OQTL 2X4NA 5DQ9A 1FYTB 2UV3A 5KSVB 4LIQH 3OKLA 4ZFFA 5T1DH 4J6RH 2F5BL 2NY4B 4F7EB 1I7TB 1UXWB 4RQQB 1DBAH 3AMLA 4F15B 4ZAKA 1XAUA 5LGHH 3B8YA 3GSOA 1F3RB 1TJIH 2GHWB 4HJ0D 4LP4A 1U3HB 4LCWE 1M05B 4Z18A 5EC1B 3AY4A 4JJ5B 3NA4A 2FR4B 3GI8L 1QBLH 1I8LC 4QRQA 4ZUWA 3C5JA 3OJDB 3U9PH 5ERWB 2BNQD 5DURB 5CD5D 3DIFB 4WUUB 3LH2H 4I77H 1EFQA 3LQMA 3W0WA 1WC7B 3DSFH 1KSRA 3QUZC 1I7UA 2VXSL 3ZLQC 1AJ7L 2Q87A 3B9AA 4JO2H 1C12B 4YDLC 5I1HH 1HSBB 1HOCA 1AP2B 1WCBB 2JJTC 4XMPH 5I15H 2Y6SC 5KANG 1KTDB 3ZTJG 4M5YH 4QYOA 1U8KB 4I9WE 1BX2A 4KZDL 3L3OA 3RWIA 4TSCL 4FQ1H 2W38A 1ZANL 4PY8J 3RWCB 2IPUG 1G7MA 4CW1B 3ILQD 4X6CA 2QHRH 4NSKB 5DJ8B 4NDMA 5F1KC 3F12A 3V6OE 3VDAA 1CE1L 3HRZA 2DQIL 2IFFL 4X8XA 5I1KH 2R1YA 4OGAC 5GGSY 4XZUA 2EDYA 3PWNB 2KQMA 3DSNA 3TPUB 5IESL 4Y4KD 3UTSE 1JF6A 1KOAA 3TA3A 2NR6D 4WI3A 1NBZB 1FZMB 3DPBA 5HSFA 1F3JB 3BN9C 5KVDH 4U1MB 5FM5M 1J0KA 5C92A 2CDEB 1S9KC 4ZPTB 4NC1E 3I6GB 4XP4L 2EE2A 5E2VL 5IFAL 3QG6A 1H8SA 1NCDL 2Z93A 5BV7L 5BZWA 3GHBH 3ZT6A 1QA9B 1MOEA 2WWKO 4H26B 4QHUA 2DBLH 5D6DC 4PRAA 3CFIC 3GNML 3LB6C 1N4XL 3LEVL 2FJGA 3LZFL 5CWSA 1N5AB 3TVMB 5DWUH 1P7QA 5IJVA 1MCIA 1P84K 2AJYL 2MOVA 1U8HA 4PP1C 5DUBB 1JN6B 4HFUL 4ODXB 4HZLA 1IBGH 3BPNC 5B8CA 3L5IA 5E4EB 2MPAL 1D6VL 1FNEA 2VR9A 3BQUD 5E4IA 2AERT 5I0DA 1CFQA 5FEBA 1K3IA 2APBA 2EC9U 4EBQL 1I4FA 1MWAL 5D9SA 1D9KD 4Z7UE 1KJMB 2SEBA 2RJMA 4OZGE 3CU7A 1F02I 2H1PH 2R56H 5I8CB 4YZFE 3HNVH 1I9EA 5I8EB 2HTKD 4OZFB 3WS6A 3IDUA 3KPLB 5CZXD 1RFDH 3GMLB 4ZS7L 3VG9C 1DQJA 2XN9E 1MREL 4L8SA 3VD5A 1UM5L 3MRNA 3WFCL 4GG8A 2V2TA 1XMWA 4P2RA 5LGJA 2NY2D 2QHLA 5GZOD 1TTUA 1AGDA 5LCVL 2OZ4L 2YPKA 1QRNB 2XWJB 1W0WA 5EWIL 3QUYC 5KSUA 1CXHA 1KIQB 1IQWL 4G9FE 4I3GA 2F19H 4PJDF 3WIHL 4I0KA 1H5BA 2VYRE 2H45A 3L3DA 1MNUH 3ULVL 2WW8A 3BSZH 3Q6GL 4CU6A 3LN5A 3CCHB 2DL9A 2H6PB 4YXHH 1HIMH 4YK4C 2PTTA 5CP7A 3BHBB 1R5VA 3FKUS 4LEOA 3QNZA 32C2A 5HPMB 1MEXL 4K8RH 3FN3A 3T08A 1DQQB 3UZQA 3WFBL 5LGHL 4O9HL 3GSVB 4UUJA 5K9OA 1V3KA 3QDJD 1HYRC 2B4CC 5ENWA 2BNRD 4OI8A 3PV6B 3D39E 3IRPX 5LXGL 4HUVB 1QBLL 1QSFE 3VFGH 3PGFH 3CAFA 4GMTH 2D9QB 1CTOA 1NKOA 3GMQA 1XCTB 3U9PL 4Z0BH 1IM3A 3ES6A 2NNAA 3MROB 1NBVH 1WUNT 5CD3B 5J3HC 4MDIB 3DTXA 4GLRH 4LCUB 4XPFL 2EYTB 2VNCA 1FFQA 4LPCA 1RJYA 2WUCH 2E7HA 1M7DB 3PGDA 2FATL 4YBQD 4LGPB 2Z4QB 1IAIL 1S7SB 4NQEA 2D7PA 3NIDF 3ZE0F 2AGJH 3TT3H 5GISH 4XMPL 2HWZH 3AB0B 1KLUA 1KB5B 4PJXF 5EZIL 3C09C 2HKFH 3O11A 1VHPA 4NWTL 4L5FL 1BQHA 1SY6L 2NXYC 1KIPB 1JPST 3HPLA 4G8IB 3DMMD 4AH2A 2QHRL 4JPVH 4XAWH 4UT6L 4NQXA 4E41B 1BLNA 5GRYA 1N64H 5C07B 4XP9L 3CLFL 4OF7A 5F6IC 5DQ9B 2KPNA 4LARH 5JOPD 3AM8A 4XNXL 1UYWH 5HY9A 4ZFFB 4JM4H 2GY5A 2JJUA 2VRAA 4PV8B 2GTZA 1R5WB 3ARBD 4LDOB 4HQQL 1QFUL 2ADJB 2YR3A 3DO3A 4O4YH 3N1GC 5F7WC 3W11C 4LLMB 2PETA 4TQEH 3MPCA 3VGGA 3KS0H 2GQHA 2WBJA 3MRBA 1X44A 1MAMH 4PJHF 3UAJD 4OZIA 5KVDL 2YEZA 2VDKH 5CSZA 1R3IH 3C9NB 4P4RA 3VW3L 3V52H 4N0YH 2ZOLA 1SYSA 4HKJA 4O2FA 3O8XD 5IVZB 4ZUWB 3C5JB 1CE6B 2NX5D 5HYEA 2WBWB 5E7BA 4FQPA 3W0WB 3EHBD 3LSOA 5I1DB 1U41A 4Q58C 3BO8A 3FN9A 2DBLL 4LMQI 4ONFL 1ZLWK 3FB5A 3TV3H 4QOKB 3RNQA 3MGOB 2VDNL 1AC0A 3BPCA 4F8TA 2CKNA 4HUMB 3BP5A 1BZ9A 2YZ8A 4BFIA 4PRPA 2JIXD 1N0XH 4GLRI 4XBGA 3U4BH 1IBGL 4DKEH 5E94B 4QYOB 1YEJH 4YGVA 2M8XA 1BX2B 3C08H 1CL7I 5C0JB 1FO0B 1NLDL 5DC0A 4WW2A 3O6LH 2OI9C 3GGWA 5A16A 1S7XA 1U95B 4NDMB 1K4CB 3ZYOA 1Z3GH 1JFQH 3HRZB 2A77H 3TYGL 3HC4L 4YHIA 1D5BB 1OT2A 2JJWA 2R1YB 4KI5C 4NWUL 4PJ5A 1QO3A 1OB1A 5DFVC 4QTIH 3KGRA 1RFDL 4OLZL 3T0ED 2XG5A 2VZTA 4M6NH 1DP0A 3TA3B 4HWBL 1AGFB 1U6AH 3QO1A 4JHAH 5IBLD 4LCIL 4OV5B 4UBDD 4XHJD 5BOPA 2E7BA 3HMWL 1BF8A 4NO0D 4AJ0A 3WJJA 1DZBA 3BGAA 4KV5F 1DEEB 1D3CA 2VJXA 5IROA 5IWLC 3QG6B 1IZJA 1CDHA 3VI3E 1BGXH 1AC6A 2Z93B 4OM0L 1XF4B 4XBEL 1BZ7A 4NRZA 3TBSA 1H0DA 5F96H 1INQA 4LIQE 1SMOA 4PRAB 1DEDA 3T0WA 2Y5TA 5CKGA 2CJUL 3V4PH 3MRMB 4S1RH 2R0KH 4HW6A 2FJGB 1UM4L 3L7FB 4KGLA 4OJFH 3H6JA 3TJHD 4RMQA 5D1XB 3S35L 1P7QB 2ZSWB 3QP3A 1T03H 4P46C 2P45B 1U8HB 1D5MA 3MA9H 4AIOA 4Z77B 2BY1A 5DT1L 1KPVA 4G42B 3O2DH 1RZFL 5D7LD 4I0PD 5CJ5A 5B8CB 4O51A 2UUDK 3OKDB 4FRWA 5CUSH 3VFGL 3PGFL 1S9XB 3IXTA 1DDHA 2A6DA 3C8DA 3QEUA 1LE5B 3BEWA 2VSDA 1I4FB 3ZT7A 2IANE 3IGAA 2LE9A 1NBVL 4JG1L 3HG1B 1XF2B 3QDGE 4TOYH 2Y5EA 4YO0A 1JK8B 2AJUL 4L3EA 4M93C 4P23A 3I84A 4L8SB 5GRUL 4HEPG 1INDH 3NN8A 4GG8B 5GS3A 1JPTL 1WZ1H 4OFKA 2C3HA 4NN7C 5JIHA 2P4AB 4P2RB 1PY9A 4ZYKA 3OG4B 5JXED 1AGDB 2PYEE 4KJWC 3ZSTA 1CIDA 4XNUH 4QWWD 3SGEH 5FO9B 3INUH 2IAMB 2VMFA 5MHSE 2MQCA 5KSUB 3KYKH 4NKIL 2OR8A 3I3BA 4KKBD 3ME0A 4NKMA 4HMCA 1VESA 1B0RA 4XAWL 2FO4A 3MRJB 1WBYB 1TDQA 1OAKL 2GTWB 3EO1A 4QRPA 1ZT1A 5GGVH 1CICC 4LARL 2B8OT 4RGOL 1TVDA 4UTBL 1I9IL 4LEOB 4OTXL 1MFCL 1TETL 4MJIB 3QUXD 4DKDC 5ISZD 5TE4H 4F37K 1A5FH 2AJVH 5EB9A 2XA3A 1X5FA 1JGDA 5I1GH 1U93A 4YDKH 3BAEL 4UUJB 4AZ8A 4P2OA 3EZJB 4TQEL 4TUOB 5D7JC 5ENWB 4DN3H 1CI5A 1G0XA 5IHLB 4C4KT 2VDKL 3RU8L 5DC9B 5FECA 4M9OA 3UTTA 4HV8B 3V52L 4CMMA 1FLRL 3H3PH 1LDSA 3BPLC 3JSSA 4UIMB 1IM3B 4XCEA 4WO4C 5BS0B 3TN0D 3GIZH 3RWEA 3QRGH 1OGAD 3DTXB 5E4EC 3G08B 3IU3A 4OZFH 1MAKA 3NCCB 3ARFD 1MI5E 3PGDB 4F37F 4N0CD 1P9MC 2X6MA 3UZVB 3KYNA 2Z9TA 4UNTA 3BD4A 1UWXH 4N1HB 2NPLX 1JMZA 3VXSA 3QUZA 1OSPL 1N0XL 3TO4D 3U4BL 4DKEL 4PR5A 4U33A 4Q9RH 3D1MC 2DIAA 1YEJL 1A7PH 3O11B 3EBAA 5L0QC 3HPLB 3DOSA 3O6LL 3O3UN 1F4WH 3UJIH 1HZHH 2GJ6E 4AH2B 3D2UA 3MJ6A 4M1GH 4NQXB 5D71H 1Z3GL 1BLNB 2A77L 3T1FA 2ICWJ 3VXQB 1ZVHA 4H5SA 1U8QA 2VZ3A 3PDGA 2CKBA 3MRLB 4OCSL 2GTZB 3D9AL 2YXFA 3GSWA 2Z8RA 3MBEC 4WDIB 2YXMA 4MD0A 2FH6A 4P2QA 1U6AL 2KBGA 1QSEA 1CXKA 4M5ZH 1FIEA 2EKJA 2ZUXA 1FVDA 3VE0A 1OD9A 4P4RB 4ZUSB 1ETZB 5CJBA 1KLGA 2IH3B 1SYSB 3OKYA 4GKZA 4WHDA 3DETC 4Z8FH 1S5IL 1Q8MA 5F7FA 1B90A 1TPXC 3S34H 5CZVL 2NY6C 1TZIA 3LSOB 3MLPA 2DTSA 3BO8B 1FFRA 2HJLB 5FYLL 4DEPB 1A4KA 3RNQB 2Z91B 4PG9A 3BPCB 3BP5B 4EOWH 3FQUB 3MA9L 5D6DA 4XBGB 3MCLL 5C8JA 2FEEI 5CINL 2F74A 2PYFA 3BKJH 3IJSB 4YGVB 3G5XB 4HJ0C 4LAQH 4X8JB 1GC1H 1S78D 2BOCB 1QFWM 4WW2B 5GRWA 2Q8AL 3P0YL 4OIAA 5CEZH 2AJSL 3GGWB 4K71C 2EXYD 4XWGL 1BVZA 1S7XB 4U1KB 1JUFB 5BVPL 2WWMC 4HMEA 1MHCA 2R2CA 3AB0C 3A67L 4L4TE 3OMZA 3VXNB 2PO6D 5BRZD 5CD5C 4AEHL 5GGRB 2VLRE 5SWZD 4R9HA 2OTUA 1OB1B 4IMKA 5KSBE 5F9AC 2FHFA 5GSRA 1KTKE 4DN4H 5MERA 5IVXF 5C6PB 4DAGH 4DWHA 3CSPA 1INDL 1PLGL 3SDXA 3GM0A 1WZ1L 4FQQB 4OLVL 5DJDA 2R4RH 1UH2A 5CKAA 5JW4N 1G9NC 5DJYB 1NEZA 4OZHF 4MS8D 1UB6A 3AS3A 1ZHKA 4XNUL 1WIUA 3MRFB 3MRGA 4PRDB 2YA2A 3EFFB 1HWHB 3FFCE 2VZVA 1YYLH 2VXUL 5TQ2H 1F3DJ 4PP2A 2ADFL 3RPKA 1H0DB 1LHZA 3PJSB 3P0GB 4WHCA 4D9QE 3MV11 2IALB 1FBIH 5GHWH 5ITBH 1A6TA 1AXIB 5FCUL 1D5MB 5CSGA 1YA5A 4X80L 43CAB 4JRXB 5HHOD 5E03A 5J11B 4NBYB 4DN3L 1ORQA 3PL6A 4DTGL 1N2RA 4O51B 1FO0H 4ODHH 3F62A 4HUKB 4JRYE 1ZMYA 3KXFD 1NJ9B 2NZIA 2A6DB 2AXFB 4K7PH 4FG6D 3W5NA 2A74B 2HN7A 3UTQB 3QRGL 5AZEL 4HSQA 1FCCA 3NCBB 3MJ7B 4YO0B 3BP7B 2AK1H 4P23B 1RVFH 2ITDA 4HJJL 1E4XI 3NN8B 3I50H 4ZYKB 1KULA 3X17A 5HPOA 4NIKB 1A1NA 1MCHA 3UTZB 4KVCL 4Q6IC 3HNSH 1F4WL 1HZHL 1U58A 3EKCA 1B0RB 1OAYH 4ZNCD 3EYOB 25C8H 4R4FH 4MB4A 5E95B 2A83B 3ULUC 4FFZH 4XNYH 1FYTE 3IAQA 1ZT1B 4OLXL 2QR0A 3UTOA 3EAKA 5TQ0L 3RWDA 1Q94A 3RDTD 1D5XB 2R0WH 4CMHC 4M61B 1R3LA 1JGDB 3GBML 1U93B 3LHPH 1XR9B 4PRIA 4P2OB 4G6AD 3RX5A 4YHYC 4CN4A 2DJ4A 3EOTH 2ERJC 1T1YB 3E0GA 2Z8WC 4XRCB 3UTTB 5FV1L 3RWFA 5JDSB 1LO2L 2V5SA 4F9PC 5IHUL 3HPJA 2EKSA 1NUNB 4WUUE 2YZ1A 4JN2A 4Z5RB 2KKQA 4RAVB 1RIVL 3BPOB 3RWEB 4HIJA 1I9RH 3MACL 1DR9A 3N85H 4HDIA 2HTLD 2I9LB 5HGDA 2VISA 2OYPA 4ODTL 4ZOAA 3KYNB 2ADIA 1AKJB 4I3RH 2P8PA 3BEVA 3P3YA 3NZ8B 4P9ML 3VXSB 2QSVA 4PGZA 1KNOA 4PR5B 3BKJL 4U6VH 1QLEH 3ZKXB 1UWGH 2X1XR 1C1EL 1NCCH 5EBLB 1DBMH 2WP3O 4XPAH 5MP6H 3EJYD 4ELMF 1QQDA 3GHEL 1TQCB 4V2CB 3SDDB 4BELD 5ALCL 4NZJA 4H5SB 1WISA 4JVWA 1KELH 5ADPH 3Q0HA 2R2HA 4XCYA 2VLLA 5DTFA 5I1IL 1P84J 4NM8L 1HNGA 4KY1H 3QIUD 2R4RL 4L8DA 5T1KB 5IB2A 4IM8A 3CH1A 1KV3A 3VGEA 4LOUC 3D25A 3VXRB 1NBQA 4RMWA 1JVKA 3OB8A 1U3ZA 4GQPH 4UU9B 4GKZB 3VXMD 4MA7H 4C56B 1C7SA 5J1AA 3T3ME 4NQDA 1WJ3A 3JV4B 1WF5A 3U9UA 1EIBA 1YYLL 1HYSD 1OARH 4GT7A 2WAHA 1LEIB 4HWUA 4WV1A 3ZKMC 5B39B 3MUGA 2OL3L 3V7AG 1E4KC 3CFJB 5BJTB 4UTAL 1S7UA 1PFCA 1A4KB 1YMMD 3RHWK 2FO1A 5CEYA 3VMPA 5E2TL 5MI0B 5GHWL 4YE4H 3V0WL 1R3JA 3KPRA 3R1GL 4IS6A 4Y19A 4GG6A 1NANI 2F74B 2ZG2A 2P8LA 5IBUG 1EZVX 5DRWA 2NQCA 1ZTXH 4MHHG 3D87B 3VA6A 1RIUL 4P46A 1NSNH 5FM5O 5D4QA 1C5CH 4K7PL 3QPQC 4L9LC 1MHCB 3MFFB 1JF1A 4G7YL 1YDPA 1UB5B 1FL6A 4MD4A 4MA1C 2EDJA 1WFTA 3RHWF 1M7XA 3QNXB 1Q9LA 2OTUB 2C4XA 5DJXA 1CFTA 4G6JL 3O2VH 1DFBH 1RVFL 1T5XA 4X7TB 2Z92A 5KSAD 1I7ZA 3EDFA 5FFLA 1GAFH 4QHMA 1UB6B 2O5ZH 4ZQKA 3H9HA 4E42A 4UI2A 1S5HB 3BDYH 4C57C 1OP5H 2ESVD 1DLFH 5IUSA 1PZUB 4KPHH 1J8HA 5DJZA 5AZ2H 2AJ3A 2BVYA 1HH6B 1KN4L 4J4PD 2W0PA 2Y1VA 3VXOA 4R4FL 1Q9WA 3KAAA 3LD8B 6FABH 4U2YA 2OX5A 2BSTA 4FFZL 4PJCF 1ZLSH 4CBPA 2ZCKH 8FABB 1Y6NR 4X9GA 3MOBH 3QIWB 5FGSA 2CD0A 2CLVA 2H32A 5F3HA 4H20L 5GGQL 1CICA 4G80A 5FUOL 3MV7D 2HRLA 4UB0H 4MCZB 4EI5D 1MRDH 3BOVA 4P3DB 4CVXB 3GSNB 4PBWD 4Y2DC 1EV2E 4UBDC 5GGSA 2A1WH 3SCMD 3SDCA 4XBPA 1KCSL 5DRZB 4JFFA 4LPWA 2I9TA 2OMBA 3WD5H 3SO3C 4G6ML 3NGBB 3BD5A 3JV6A 5J6HA 1Z5LB 2WIIB 4D0DA 2XOTA 2DQUH 3CFKA 3GB7A 2O5XH 3OPZL 3F6LA 4JGUA 4PJGF 2ITDB 2V2XB 4I3RL 4DCQB 1OP3K 5KVFL 3MYJB 5F7NC