2W9GA

Wild-type staphylococcus aureus dhfr in complex with nadph and trimethoprim
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
157
Chain Sequence
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of Chromosomal and Exogenous Dihydrofolate Reductase from Staphylococcus Aureus in Complex with the Potent Inhibitor Trimethoprim.
pubmed doi rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Staphylococcus aureus
total genus 42
structure length 157
sequence length 157
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 2w9gA00
2GD9A 1S3WA 3FYWX 1DAJA 1DHJA 4DP3A 3NXRA 1ZDRA 2W9TA 3JW3A 4X5HA 4M2XA 1S3UA 5HVEA 4HOFA 1IA2A 3FY8X 4M6JA 1OHKA 3ZPCA 1DISA 4H97A 5HT4A 3HBBA 3SQYX 3S7AA 1DYHA 1AOEA 3SRSX 3KJRA 3NZBX 4M6KA 1J3IA 3FQ0A 3CLBA 1PDBA 3DL6A 3SH2A 3QL3A 3ZPGA 1DHFA 3INVA 1DR2A 4KJJA 2W3BA 3JWKA 1AI9A 4LEKX 1HFQA 2QK8A 4G3MA 1RX7A 1RD7A 4X5GA 3GHVA 3R33A 3KGYA 4H96A 4DFRA 4DDRA 3EIGA 3M08A 2CD2A 4PTJA 3DGAA 2BLBA 4FHBA 5E8QA 2BL9A 3K47A 1DR3A 5HQZA 3FYVX 1LUDA 5JA3A 3FY9X 2KGKA 3SRWX 1DR5A 1CD2A 2W3VA 3NZ9X 3I3RA 1DYRA 1DDRA 3S3VA 4KD7A 7DFRA 8DFRA 1DRFA 3SR5X 3NXXA 1OHJA 4KLXA 2B3ZA 1RX5A 2W3WA 1DLRA 1RB3A 4HA7A 3JTWA 1J3KA 1U71A 4KAKA 3S9UA 5U26A 1DYJA 1IA4A 3QYOA 3F91A 2W9HA 3JVXA 1KMVA 1YHOA 4ECKA 4XT8A 1RX4A 3K2HA 3SAIA 3TQ9A 3F8YA 2C2SA 5HVBA 1LY4A 4LAEX 2W3MA 4PTHA 4P3RA 1MVTA 1E26A 1RA9A 3QLSA 3IRNA 3CL9A 1DIUA 5ECCA 1RB2A 4QI9A 4QJZD 1SEJA 1S3YA 4ELHA 3FREX 3DG8A 4QLGA 4CD2A 3JSUA 3QYLA 1MVSA 2LF1A 4KY4A 1IA3A 4HOEA 4DPDA 5HUIA 2W9SA 3NRRA 3F8ZA 3TQ8A 1U72A 1U70A 3FQFA 1DR4A 2BLAA 1DG5A 1RX9A 4G8ZX 3VCOA 3OAFA 4EILA 3SRUX 2XW7A 2OBCA 4ELFA 2ITHA 1RH3A 3IX9A 3IRMA 4P3QA 4XRBA 5HF0X 1KLKA 3FL9A 5CCCA 3JWFA 1RG7A 3L3RA 4M7UA 1DLSA 5HSUA 3TQAA 2D5NA 1TDRA 4I1NA 3UM6A 1RX2A 3NXTA 4P68A 3NZAX 3QG2A 1AO8A 4KYAA 5HF2X 4RGCA 2HM9A 4QJCA 4PSYA 3SGYA 4KY8A 3FQVA 4KBNA 3DAUA 3F0VX 1PD8A 1HFPA 1DDSA 3HJ3A 4IXED 1RA3A 2AZNA 3K45A 4ELEA 4IXFX 3QLYA 5HQYA 1JOLA 4XECX 5CC9A 3F0XX 3KY8A 3TD8A 4KM2A 1DYIA 3F0SX 1DREA 4KNEA 1D1GA 1CZ3A 2FZJA 3SRRX 3QLXA 1IA1A 4PDJA 1DG8A 4EJ1A 3EELA 1RA1A 3KJSA 5HPBA 3F0QX 1BOZA 3FRAX 1VDRA 3QLZA 4P66A 3CD2A 3TQBA 3SRQX 2ANQA 4Q0EA 2W3AA 3JWCA 4M6LA 1RX8A 4I13A 3SA2A 4X5FA 4XT5A 3FRDX 4NX6A 4GH8A 2OIPA 4HOGA 3FRBX 4LAGX 2D0KA 3EX8A 3UM5A 5JG0X 3LG4A 2FZHA 3Q1HA 4KEBA 3D80A 5HT5A 3IA5A 2ANOA 3NU0A 4QLFA 3I8AX 1PD9A 6DFRA 4G95A 3FRFX 3NZ6X 2INQA 3NZCX 4M7VA 4X5IA 1HFRA 5DFRA 1RA2A 4DPHA 4Q67A 3FQCA 3K74A 3RG9A 4LAHX 3FQZA 3CSEA 4PSTA 1M7AA 3IROA 4FGGA 2O7PA 2ZZAA 4X5JA 4ELGA 1DRBA 1DF7A 1KMSA 4XT4A 3JW5A 1RE7A 3GHCA 1RA8A 4XT6A 4OR7A 3QFXA 1RF7A 1QZFA 2HQPA 3FQOA 1RX1A 1JOMA 2C2TA 5U27A 1VJ3A 5HI6A 3EEMA 3EEJA 2HXVA 4NX7A 3DATA 3NZDA 3IA4A 3F0BX 3OCHA 4QLEA 3GHWA 3JWMA 1DRAA 3NXYA 2H2QA 5ECXA 1DR6A 3UM8A 3KFYA 3GI2A 3E0BA 1LY3A 3NXVA 3QL0A 1M78A 1S3VA 3EEKA 1JUVA 3DFRA 2W9GA 4KJLA 1BZFA 1DR1A 3FL8A 4Q0DA 4ELBA 3NTZA 3SA1A 3RO9A 1RX6A 3NXOA 3ROAA 3QLRA 4H98A 2FZIA 3DL5A 1J3JA 1RC4A 3GYFA 4QHVA 2P4GA 3D84X 4XE6X 2CIGA 2L28A 2DHFA 5HSRA 2DRCA 5EAJA 3M09A 4KJKA 1DG7A 1RX3A 3FS6A 3N0HA 1M79A 3QGTA 2BLCA 4KFJA 2JYBA 2G6VA 4XT7A 4PSSA 1DR7A 4Q6AA 1DRHA 4KL9A 5FDAA 4EIGA 3F0UX 5DXVA 3QLWA 4OSGA 1DHIA 4TU5X 4EIZA 4HA9A 4H95A 3DRCA 4KM0A 4IXGX 4FGHA
chains in the Genus database with same CATH superfamily
2GD9A 1S3WA 3FYWX 1DAJA 1DHJA 4DP3A 3NXRA 1ZDRA 2W9TA 3JW3A 4X5HA 4M2XA 1S3UA 5HVEA 4HOFA 1IA2A 3FY8X 4M6JA 1OHKA 3ZPCA 1DISA 4H97A 5HT4A 3HBBA 3SQYX 3S7AA 1DYHA 1AOEA 3SRSX 3KJRA 3NZBX 4M6KA 1J3IA 3FQ0A 3CLBA 1PDBA 3DL6A 3SH2A 3QL3A 3ZPGA 1DHFA 3INVA 1DR2A 4KJJA 2W3BA 3JWKA 1AI9A 4LEKX 1HFQA 2QK8A 4G3MA 1RX7A 1RD7A 4X5GA 3GHVA 3R33A 3KGYA 4H96A 4DFRA 4DDRA 3EIGA 3M08A 2CD2A 4PTJA 3DGAA 2BLBA 4FHBA 5E8QA 2BL9A 3K47A 1DR3A 5HQZA 3FYVX 1LUDA 5JA3A 3FY9X 2KGKA 3SRWX 1DR5A 1CD2A 2W3VA 3NZ9X 3I3RA 1DYRA 1DDRA 3S3VA 4KD7A 7DFRA 8DFRA 1DRFA 3SR5X 3NXXA 1OHJA 4KLXA 2B3ZA 1RX5A 2W3WA 1DLRA 1RB3A 4HA7A 3JTWA 1J3KA 1U71A 4KAKA 3S9UA 5U26A 1DYJA 1IA4A 3QYOA 3F91A 2W9HA 3JVXA 1KMVA 1YHOA 4ECKA 4XT8A 1RX4A 3K2HA 3SAIA 3TQ9A 3F8YA 2C2SA 5HVBA 1LY4A 4LAEX 2W3MA 4PTHA 4P3RA 1MVTA 1E26A 1RA9A 3QLSA 3IRNA 3CL9A 1DIUA 5ECCA 1RB2A 4QI9A 4QJZD 1SEJA 1S3YA 4ELHA 3FREX 3DG8A 4QLGA 4CD2A 3JSUA 3QYLA 1MVSA 2LF1A 4KY4A 1IA3A 4HOEA 4DPDA 5HUIA 2W9SA 3NRRA 3F8ZA 3TQ8A 1U72A 1U70A 3FQFA 1DR4A 2BLAA 1DG5A 1RX9A 4G8ZX 3VCOA 3OAFA 4EILA 3SRUX 2XW7A 2OBCA 4ELFA 2ITHA 1RH3A 3IX9A 3IRMA 4P3QA 4XRBA 5HF0X 1KLKA 3FL9A 5CCCA 3JWFA 1RG7A 3L3RA 4M7UA 1DLSA 5HSUA 3TQAA 2D5NA 1TDRA 4I1NA 3UM6A 1RX2A 3NXTA 4P68A 3NZAX 3QG2A 1AO8A 4KYAA 5HF2X 4RGCA 2HM9A 4QJCA 4PSYA 3SGYA 4KY8A 3FQVA 4KBNA 3DAUA 3F0VX 1PD8A 1HFPA 1DDSA 3HJ3A 4IXED 1RA3A 2AZNA 3K45A 4ELEA 4IXFX 3QLYA 5HQYA 1JOLA 4XECX 5CC9A 3F0XX 3KY8A 3TD8A 4KM2A 1DYIA 3F0SX 1DREA 4KNEA 1D1GA 1CZ3A 2FZJA 3SRRX 3QLXA 1IA1A 4PDJA 1DG8A 4EJ1A 3EELA 1RA1A 3KJSA 5HPBA 3F0QX 1BOZA 3FRAX 1VDRA 3QLZA 4P66A 3CD2A 3TQBA 3SRQX 2ANQA 4Q0EA 2W3AA 3JWCA 4M6LA 1RX8A 4I13A 3SA2A 4X5FA 4XT5A 3FRDX 4NX6A 4GH8A 2OIPA 4HOGA 3FRBX 4LAGX 2D0KA 3EX8A 3UM5A 5JG0X 3LG4A 2FZHA 3Q1HA 4KEBA 3D80A 5HT5A 3IA5A 2ANOA 3NU0A 4QLFA 3I8AX 1PD9A 6DFRA 4G95A 3FRFX 3NZ6X 2INQA 3NZCX 4M7VA 4X5IA 1HFRA 5DFRA 1RA2A 4DPHA 4Q67A 3FQCA 3K74A 3RG9A 4LAHX 3FQZA 3CSEA 4PSTA 1M7AA 3IROA 4FGGA 2O7PA 2ZZAA 4X5JA 4ELGA 1DRBA 1DF7A 1KMSA 4XT4A 3JW5A 1RE7A 3GHCA 1RA8A 4XT6A 4OR7A 3QFXA 1RF7A 1QZFA 2HQPA 3FQOA 1RX1A 1JOMA 2C2TA 5U27A 1VJ3A 5HI6A 3EEMA 3EEJA 2HXVA 4NX7A 3DATA 3NZDA 3IA4A 3F0BX 3OCHA 4QLEA 3GHWA 3JWMA 1DRAA 3NXYA 2H2QA 5ECXA 1DR6A 3UM8A 3KFYA 3GI2A 3E0BA 1LY3A 3NXVA 3QL0A 1M78A 1S3VA 3EEKA 1JUVA 3DFRA 2W9GA 4KJLA 1BZFA 1DR1A 3FL8A 4Q0DA 4ELBA 3NTZA 3SA1A 3RO9A 1RX6A 3NXOA 3ROAA 3QLRA 4H98A 2FZIA 3DL5A 1J3JA 1RC4A 3GYFA 4QHVA 2P4GA 3D84X 4XE6X 2CIGA 2L28A 2DHFA 5HSRA 2DRCA 5EAJA 3M09A 4KJKA 1DG7A 1RX3A 3FS6A 3N0HA 1M79A 3QGTA 2BLCA 4KFJA 2JYBA 2G6VA 4XT7A 4PSSA 1DR7A 4Q6AA 1DRHA 4KL9A 5FDAA 4EIGA 3F0UX 5DXVA 3QLWA 4OSGA 1DHIA 4TU5X 4EIZA 4HA9A 4H95A 3DRCA 4KM0A 4IXGX 4FGHA
chains in the Genus database with same CATH topology
2GD9A 1S3WA 3FYWX 1DAJA 1DHJA 4DP3A 3NXRA 1ZDRA 2W9TA 3JW3A 4X5HA 4M2XA 1S3UA 5HVEA 4HOFA 1IA2A 3FY8X 4M6JA 1OHKA 3ZPCA 1DISA 4H97A 5HT4A 3HBBA 3SQYX 3S7AA 1DYHA 1AOEA 3SRSX 3KJRA 3NZBX 4M6KA 1J3IA 3FQ0A 3CLBA 1PDBA 3DL6A 3SH2A 3QL3A 3ZPGA 1DHFA 3INVA 1DR2A 4KJJA 2W3BA 3JWKA 1AI9A 4LEKX 1HFQA 2QK8A 4G3MA 1RX7A 1RD7A 4X5GA 3GHVA 3R33A 3KGYA 4H96A 4DFRA 4DDRA 3EIGA 3M08A 2CD2A 4PTJA 3DGAA 2BLBA 4FHBA 5E8QA 2BL9A 3K47A 1DR3A 5HQZA 3FYVX 1LUDA 5JA3A 3FY9X 2KGKA 3SRWX 1DR5A 1CD2A 2W3VA 3NZ9X 3I3RA 1DYRA 1DDRA 3S3VA 4KD7A 7DFRA 8DFRA 1DRFA 3SR5X 3NXXA 1OHJA 4KLXA 2B3ZA 1RX5A 2W3WA 1DLRA 1RB3A 4HA7A 3JTWA 1J3KA 1U71A 4KAKA 3S9UA 5U26A 1DYJA 1IA4A 3QYOA 3F91A 2W9HA 3JVXA 1KMVA 1YHOA 4ECKA 4XT8A 1RX4A 3K2HA 3SAIA 3TQ9A 3F8YA 2C2SA 5HVBA 1LY4A 4LAEX 2W3MA 4PTHA 4P3RA 1MVTA 1E26A 1RA9A 3QLSA 3IRNA 3CL9A 1DIUA 5ECCA 1RB2A 4QI9A 4QJZD 1SEJA 1S3YA 4ELHA 3FREX 3DG8A 4QLGA 4CD2A 3JSUA 3QYLA 1MVSA 2LF1A 4KY4A 1IA3A 4HOEA 4DPDA 5HUIA 2W9SA 3NRRA 3F8ZA 3TQ8A 1U72A 1U70A 3FQFA 1DR4A 2BLAA 1DG5A 1RX9A 4G8ZX 3VCOA 3OAFA 4EILA 3SRUX 2XW7A 2OBCA 4ELFA 2ITHA 1RH3A 3IX9A 3IRMA 4P3QA 4XRBA 5HF0X 1KLKA 3FL9A 5CCCA 3JWFA 1RG7A 3L3RA 4M7UA 1DLSA 5HSUA 3TQAA 2D5NA 1TDRA 4I1NA 3UM6A 1RX2A 3NXTA 4P68A 3NZAX 3QG2A 1AO8A 4KYAA 5HF2X 4RGCA 2HM9A 4QJCA 4PSYA 3SGYA 4KY8A 3FQVA 4KBNA 3DAUA 3F0VX 1PD8A 1HFPA 1DDSA 3HJ3A 4IXED 1RA3A 2AZNA 3K45A 4ELEA 4IXFX 3QLYA 5HQYA 1JOLA 4XECX 5CC9A 3F0XX 3KY8A 3TD8A 4KM2A 1DYIA 3F0SX 1DREA 4KNEA 1D1GA 1CZ3A 2FZJA 3SRRX 3QLXA 1IA1A 4PDJA 1DG8A 4EJ1A 3EELA 1RA1A 3KJSA 5HPBA 3F0QX 1BOZA 3FRAX 1VDRA 3QLZA 4P66A 3CD2A 3TQBA 3SRQX 2ANQA 4Q0EA 2W3AA 3JWCA 4M6LA 1RX8A 4I13A 3SA2A 4X5FA 4XT5A 3FRDX 4NX6A 4GH8A 2OIPA 4HOGA 3FRBX 4LAGX 2D0KA 3EX8A 3UM5A 5JG0X 3LG4A 2FZHA 3Q1HA 4KEBA 3D80A 5HT5A 3IA5A 2ANOA 3NU0A 4QLFA 3I8AX 1PD9A 6DFRA 4G95A 3FRFX 3NZ6X 2INQA 3NZCX 4M7VA 4X5IA 1HFRA 5DFRA 1RA2A 4DPHA 4Q67A 3FQCA 3K74A 3RG9A 4LAHX 3FQZA 3CSEA 4PSTA 1M7AA 3IROA 4FGGA 2O7PA 2ZZAA 4X5JA 4ELGA 1DRBA 1DF7A 1KMSA 4XT4A 3JW5A 1RE7A 3GHCA 1RA8A 4XT6A 4OR7A 3QFXA 1RF7A 1QZFA 2HQPA 3FQOA 1RX1A 1JOMA 2C2TA 5U27A 1VJ3A 5HI6A 3EEMA 3EEJA 2HXVA 4NX7A 3DATA 3NZDA 3IA4A 3F0BX 3OCHA 4QLEA 3GHWA 3JWMA 1DRAA 3NXYA 2H2QA 5ECXA 1DR6A 3UM8A 3KFYA 3GI2A 3E0BA 1LY3A 3NXVA 3QL0A 1M78A 1S3VA 3EEKA 1JUVA 3DFRA 2W9GA 4KJLA 1BZFA 1DR1A 3FL8A 4Q0DA 4ELBA 3NTZA 3SA1A 3RO9A 1RX6A 3NXOA 3ROAA 3QLRA 4H98A 2FZIA 3DL5A 1J3JA 1RC4A 3GYFA 4QHVA 2P4GA 3D84X 4XE6X 2CIGA 2L28A 2DHFA 5HSRA 2DRCA 5EAJA 3M09A 4KJKA 1DG7A 1RX3A 3FS6A 3N0HA 1M79A 3QGTA 2BLCA 4KFJA 2JYBA 2G6VA 4XT7A 4PSSA 1DR7A 4Q6AA 1DRHA 4KL9A 5FDAA 4EIGA 3F0UX 5DXVA 3QLWA 4OSGA 1DHIA 4TU5X 4EIZA 4HA9A 4H95A 3DRCA 4KM0A 4IXGX 4FGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GD9 A;  1S3W A;  3FYW X;  1DAJ A;  1DHJ A;  4DP3 A;  3NXR A;  1ZDR A;  2W9T A;  3JW3 A;  4X5H A;  4M2X A;  1S3U A;  5HVE A;  4HOF A;  1IA2 A;  3FY8 X;  4M6J A;  1OHK A;  3ZPC A;  1DIS A;  4H97 A;  5HT4 A;  3HBB A;  3SQY X;  3S7A A;  1DYH A;  1AOE A;  3SRS X;  3KJR A;  3NZB X;  4M6K A;  1J3I A;  3FQ0 A;  3CLB A;  1PDB A;  3DL6 A;  3SH2 A;  3QL3 A;  3ZPG A;  1DHF A;  3INV A;  1DR2 A;  4KJJ A;  2W3B A;  3JWK A;  1AI9 A;  4LEK X;  1HFQ A;  2QK8 A;  4G3M A;  1RX7 A;  1RD7 A;  4X5G A;  3GHV A;  3R33 A;  3KGY A;  4H96 A;  4DFR A;  4DDR A;  3EIG A;  3M08 A;  2CD2 A;  4PTJ A;  3DGA A;  2BLB A;  4FHB A;  5E8Q A;  2BL9 A;  3K47 A;  1DR3 A;  5HQZ A;  3FYV X;  1LUD A;  5JA3 A;  3FY9 X;  2KGK A;  3SRW X;  1DR5 A;  1CD2 A;  2W3V A;  3NZ9 X;  3I3R A;  1DYR A;  1DDR A;  3S3V A;  4KD7 A;  7DFR A;  8DFR A;  1DRF A;  3SR5 X;  3NXX A;  1OHJ A;  4KLX A;  2B3Z A;  1RX5 A;  2W3W A;  1DLR A;  1RB3 A;  4HA7 A;  3JTW A;  1J3K A;  1U71 A;  4KAK A;  3S9U A;  5U26 A;  1DYJ A;  1IA4 A;  3QYO A;  3F91 A;  2W9H A;  3JVX A;  1KMV A;  1YHO A;  4ECK A;  4XT8 A;  1RX4 A;  3K2H A;  3SAI A;  3TQ9 A;  3F8Y A;  2C2S A;  5HVB A;  1LY4 A;  4LAE X;  2W3M A;  4PTH A;  4P3R A;  1MVT A;  1E26 A;  1RA9 A;  3QLS A;  3IRN A;  3CL9 A;  1DIU A;  5ECC A;  1RB2 A;  4QI9 A;  4QJZ D;  1SEJ A;  1S3Y A;  4ELH A;  3FRE X;  3DG8 A;  4QLG A;  4CD2 A;  3JSU A;  3QYL A;  1MVS A;  2LF1 A;  4KY4 A;  1IA3 A;  4HOE A;  4DPD A;  5HUI A;  2W9S A;  3NRR A;  3F8Z A;  3TQ8 A;  1U72 A;  1U70 A;  3FQF A;  1DR4 A;  2BLA A;  1DG5 A;  1RX9 A;  4G8Z X;  3VCO A;  3OAF A;  4EIL A;  3SRU X;  2XW7 A;  2OBC A;  4ELF A;  2ITH A;  1RH3 A;  3IX9 A;  3IRM A;  4P3Q A;  4XRB A;  5HF0 X;  1KLK A;  3FL9 A;  5CCC A;  3JWF A;  1RG7 A;  3L3R A;  4M7U A;  1DLS A;  5HSU A;  3TQA A;  2D5N A;  1TDR A;  4I1N A;  3UM6 A;  1RX2 A;  3NXT A;  4P68 A;  3NZA X;  3QG2 A;  1AO8 A;  4KYA A;  5HF2 X;  4RGC A;  2HM9 A;  4QJC A;  4PSY A;  3SGY A;  4KY8 A;  3FQV A;  4KBN A;  3DAU A;  3F0V X;  1PD8 A;  1HFP A;  1DDS A;  3HJ3 A;  4IXE D;  1RA3 A;  2AZN A;  3K45 A;  4ELE A;  4IXF X;  3QLY A;  5HQY A;  1JOL A;  4XEC X;  5CC9 A;  3F0X X;  3KY8 A;  3TD8 A;  4KM2 A;  1DYI A;  3F0S X;  1DRE A;  4KNE A;  1D1G A;  1CZ3 A;  2FZJ A;  3SRR X;  3QLX A;  1IA1 A;  4PDJ A;  1DG8 A;  4EJ1 A;  3EEL A;  1RA1 A;  3KJS A;  5HPB A;  3F0Q X;  1BOZ A;  3FRA X;  1VDR A;  3QLZ A;  4P66 A;  3CD2 A;  3TQB A;  3SRQ X;  2ANQ A;  4Q0E A;  2W3A A;  3JWC A;  4M6L A;  1RX8 A;  4I13 A;  3SA2 A;  4X5F A;  4XT5 A;  3FRD X;  4NX6 A;  4GH8 A;  2OIP A;  4HOG A;  3FRB X;  4LAG X;  2D0K A;  3EX8 A;  3UM5 A;  5JG0 X;  3LG4 A;  2FZH A;  3Q1H A;  4KEB A;  3D80 A;  5HT5 A;  3IA5 A;  2ANO A;  3NU0 A;  4QLF A;  3I8A X;  1PD9 A;  6DFR A;  4G95 A;  3FRF X;  3NZ6 X;  2INQ A;  3NZC X;  4M7V A;  4X5I A;  1HFR A;  5DFR A;  1RA2 A;  4DPH A;  4Q67 A;  3FQC A;  3K74 A;  3RG9 A;  4LAH X;  3FQZ A;  3CSE A;  4PST A;  1M7A A;  3IRO A;  4FGG A;  2O7P A;  2ZZA A;  4X5J A;  4ELG A;  1DRB A;  1DF7 A;  1KMS A;  4XT4 A;  3JW5 A;  1RE7 A;  3GHC A;  1RA8 A;  4XT6 A;  4OR7 A;  3QFX A;  1RF7 A;  1QZF A;  2HQP A;  3FQO A;  1RX1 A;  1JOM A;  2C2T A;  5U27 A;  1VJ3 A;  5HI6 A;  3EEM A;  3EEJ A;  2HXV A;  4NX7 A;  3DAT A;  3NZD A;  3IA4 A;  3F0B X;  3OCH A;  4QLE A;  3GHW A;  3JWM A;  1DRA A;  3NXY A;  2H2Q A;  5ECX A;  1DR6 A;  3UM8 A;  3KFY A;  3GI2 A;  3E0B A;  1LY3 A;  3NXV A;  3QL0 A;  1M78 A;  1S3V A;  3EEK A;  1JUV A;  3DFR A;  2W9G A;  4KJL A;  1BZF A;  1DR1 A;  3FL8 A;  4Q0D A;  4ELB A;  3NTZ A;  3SA1 A;  3RO9 A;  1RX6 A;  3NXO A;  3ROA A;  3QLR A;  4H98 A;  2FZI A;  3DL5 A;  1J3J A;  1RC4 A;  3GYF A;  4QHV A;  2P4G A;  3D84 X;  4XE6 X;  2CIG A;  2L28 A;  2DHF A;  5HSR A;  2DRC A;  5EAJ A;  3M09 A;  4KJK A;  1DG7 A;  1RX3 A;  3FS6 A;  3N0H A;  1M79 A;  3QGT A;  2BLC A;  4KFJ A;  2JYB A;  2G6V A;  4XT7 A;  4PSS A;  1DR7 A;  4Q6A A;  1DRH A;  4KL9 A;  5FDA A;  4EIG A;  3F0U X;  5DXV A;  3QLW A;  4OSG A;  1DHI A;  4TU5 X;  4EIZ A;  4HA9 A;  4H95 A;  3DRC A;  4KM0 A;  4IXG X;  4FGH A; 
#chains in the Genus database with same CATH topology
 2GD9 A;  1S3W A;  3FYW X;  1DAJ A;  1DHJ A;  4DP3 A;  3NXR A;  1ZDR A;  2W9T A;  3JW3 A;  4X5H A;  4M2X A;  1S3U A;  5HVE A;  4HOF A;  1IA2 A;  3FY8 X;  4M6J A;  1OHK A;  3ZPC A;  1DIS A;  4H97 A;  5HT4 A;  3HBB A;  3SQY X;  3S7A A;  1DYH A;  1AOE A;  3SRS X;  3KJR A;  3NZB X;  4M6K A;  1J3I A;  3FQ0 A;  3CLB A;  1PDB A;  3DL6 A;  3SH2 A;  3QL3 A;  3ZPG A;  1DHF A;  3INV A;  1DR2 A;  4KJJ A;  2W3B A;  3JWK A;  1AI9 A;  4LEK X;  1HFQ A;  2QK8 A;  4G3M A;  1RX7 A;  1RD7 A;  4X5G A;  3GHV A;  3R33 A;  3KGY A;  4H96 A;  4DFR A;  4DDR A;  3EIG A;  3M08 A;  2CD2 A;  4PTJ A;  3DGA A;  2BLB A;  4FHB A;  5E8Q A;  2BL9 A;  3K47 A;  1DR3 A;  5HQZ A;  3FYV X;  1LUD A;  5JA3 A;  3FY9 X;  2KGK A;  3SRW X;  1DR5 A;  1CD2 A;  2W3V A;  3NZ9 X;  3I3R A;  1DYR A;  1DDR A;  3S3V A;  4KD7 A;  7DFR A;  8DFR A;  1DRF A;  3SR5 X;  3NXX A;  1OHJ A;  4KLX A;  2B3Z A;  1RX5 A;  2W3W A;  1DLR A;  1RB3 A;  4HA7 A;  3JTW A;  1J3K A;  1U71 A;  4KAK A;  3S9U A;  5U26 A;  1DYJ A;  1IA4 A;  3QYO A;  3F91 A;  2W9H A;  3JVX A;  1KMV A;  1YHO A;  4ECK A;  4XT8 A;  1RX4 A;  3K2H A;  3SAI A;  3TQ9 A;  3F8Y A;  2C2S A;  5HVB A;  1LY4 A;  4LAE X;  2W3M A;  4PTH A;  4P3R A;  1MVT A;  1E26 A;  1RA9 A;  3QLS A;  3IRN A;  3CL9 A;  1DIU A;  5ECC A;  1RB2 A;  4QI9 A;  4QJZ D;  1SEJ A;  1S3Y A;  4ELH A;  3FRE X;  3DG8 A;  4QLG A;  4CD2 A;  3JSU A;  3QYL A;  1MVS A;  2LF1 A;  4KY4 A;  1IA3 A;  4HOE A;  4DPD A;  5HUI A;  2W9S A;  3NRR A;  3F8Z A;  3TQ8 A;  1U72 A;  1U70 A;  3FQF A;  1DR4 A;  2BLA A;  1DG5 A;  1RX9 A;  4G8Z X;  3VCO A;  3OAF A;  4EIL A;  3SRU X;  2XW7 A;  2OBC A;  4ELF A;  2ITH A;  1RH3 A;  3IX9 A;  3IRM A;  4P3Q A;  4XRB A;  5HF0 X;  1KLK A;  3FL9 A;  5CCC A;  3JWF A;  1RG7 A;  3L3R A;  4M7U A;  1DLS A;  5HSU A;  3TQA A;  2D5N A;  1TDR A;  4I1N A;  3UM6 A;  1RX2 A;  3NXT A;  4P68 A;  3NZA X;  3QG2 A;  1AO8 A;  4KYA A;  5HF2 X;  4RGC A;  2HM9 A;  4QJC A;  4PSY A;  3SGY A;  4KY8 A;  3FQV A;  4KBN A;  3DAU A;  3F0V X;  1PD8 A;  1HFP A;  1DDS A;  3HJ3 A;  4IXE D;  1RA3 A;  2AZN A;  3K45 A;  4ELE A;  4IXF X;  3QLY A;  5HQY A;  1JOL A;  4XEC X;  5CC9 A;  3F0X X;  3KY8 A;  3TD8 A;  4KM2 A;  1DYI A;  3F0S X;  1DRE A;  4KNE A;  1D1G A;  1CZ3 A;  2FZJ A;  3SRR X;  3QLX A;  1IA1 A;  4PDJ A;  1DG8 A;  4EJ1 A;  3EEL A;  1RA1 A;  3KJS A;  5HPB A;  3F0Q X;  1BOZ A;  3FRA X;  1VDR A;  3QLZ A;  4P66 A;  3CD2 A;  3TQB A;  3SRQ X;  2ANQ A;  4Q0E A;  2W3A A;  3JWC A;  4M6L A;  1RX8 A;  4I13 A;  3SA2 A;  4X5F A;  4XT5 A;  3FRD X;  4NX6 A;  4GH8 A;  2OIP A;  4HOG A;  3FRB X;  4LAG X;  2D0K A;  3EX8 A;  3UM5 A;  5JG0 X;  3LG4 A;  2FZH A;  3Q1H A;  4KEB A;  3D80 A;  5HT5 A;  3IA5 A;  2ANO A;  3NU0 A;  4QLF A;  3I8A X;  1PD9 A;  6DFR A;  4G95 A;  3FRF X;  3NZ6 X;  2INQ A;  3NZC X;  4M7V A;  4X5I A;  1HFR A;  5DFR A;  1RA2 A;  4DPH A;  4Q67 A;  3FQC A;  3K74 A;  3RG9 A;  4LAH X;  3FQZ A;  3CSE A;  4PST A;  1M7A A;  3IRO A;  4FGG A;  2O7P A;  2ZZA A;  4X5J A;  4ELG A;  1DRB A;  1DF7 A;  1KMS A;  4XT4 A;  3JW5 A;  1RE7 A;  3GHC A;  1RA8 A;  4XT6 A;  4OR7 A;  3QFX A;  1RF7 A;  1QZF A;  2HQP A;  3FQO A;  1RX1 A;  1JOM A;  2C2T A;  5U27 A;  1VJ3 A;  5HI6 A;  3EEM A;  3EEJ A;  2HXV A;  4NX7 A;  3DAT A;  3NZD A;  3IA4 A;  3F0B X;  3OCH A;  4QLE A;  3GHW A;  3JWM A;  1DRA A;  3NXY A;  2H2Q A;  5ECX A;  1DR6 A;  3UM8 A;  3KFY A;  3GI2 A;  3E0B A;  1LY3 A;  3NXV A;  3QL0 A;  1M78 A;  1S3V A;  3EEK A;  1JUV A;  3DFR A;  2W9G A;  4KJL A;  1BZF A;  1DR1 A;  3FL8 A;  4Q0D A;  4ELB A;  3NTZ A;  3SA1 A;  3RO9 A;  1RX6 A;  3NXO A;  3ROA A;  3QLR A;  4H98 A;  2FZI A;  3DL5 A;  1J3J A;  1RC4 A;  3GYF A;  4QHV A;  2P4G A;  3D84 X;  4XE6 X;  2CIG A;  2L28 A;  2DHF A;  5HSR A;  2DRC A;  5EAJ A;  3M09 A;  4KJK A;  1DG7 A;  1RX3 A;  3FS6 A;  3N0H A;  1M79 A;  3QGT A;  2BLC A;  4KFJ A;  2JYB A;  2G6V A;  4XT7 A;  4PSS A;  1DR7 A;  4Q6A A;  1DRH A;  4KL9 A;  5FDA A;  4EIG A;  3F0U X;  5DXV A;  3QLW A;  4OSG A;  1DHI A;  4TU5 X;  4EIZ A;  4HA9 A;  4H95 A;  3DRC A;  4KM0 A;  4IXG X;  4FGH A; 
#chains in the Genus database with same CATH homology
 2GD9 A;  1S3W A;  3FYW X;  1DAJ A;  1DHJ A;  4DP3 A;  3NXR A;  1ZDR A;  2W9T A;  3JW3 A;  4X5H A;  4M2X A;  1S3U A;  5HVE A;  4HOF A;  1IA2 A;  3FY8 X;  4M6J A;  1OHK A;  3ZPC A;  1DIS A;  4H97 A;  5HT4 A;  3HBB A;  3SQY X;  3S7A A;  1DYH A;  1AOE A;  3SRS X;  3KJR A;  3NZB X;  4M6K A;  1J3I A;  3FQ0 A;  3CLB A;  1PDB A;  3DL6 A;  3SH2 A;  3QL3 A;  3ZPG A;  1DHF A;  3INV A;  1DR2 A;  4KJJ A;  2W3B A;  3JWK A;  1AI9 A;  4LEK X;  1HFQ A;  2QK8 A;  4G3M A;  1RX7 A;  1RD7 A;  4X5G A;  3GHV A;  3R33 A;  3KGY A;  4H96 A;  4DFR A;  4DDR A;  3EIG A;  3M08 A;  2CD2 A;  4PTJ A;  3DGA A;  2BLB A;  4FHB A;  5E8Q A;  2BL9 A;  3K47 A;  1DR3 A;  5HQZ A;  3FYV X;  1LUD A;  5JA3 A;  3FY9 X;  2KGK A;  3SRW X;  1DR5 A;  1CD2 A;  2W3V A;  3NZ9 X;  3I3R A;  1DYR A;  1DDR A;  3S3V A;  4KD7 A;  7DFR A;  8DFR A;  1DRF A;  3SR5 X;  3NXX A;  1OHJ A;  4KLX A;  2B3Z A;  1RX5 A;  2W3W A;  1DLR A;  1RB3 A;  4HA7 A;  3JTW A;  1J3K A;  1U71 A;  4KAK A;  3S9U A;  5U26 A;  1DYJ A;  1IA4 A;  3QYO A;  3F91 A;  2W9H A;  3JVX A;  1KMV A;  1YHO A;  4ECK A;  4XT8 A;  1RX4 A;  3K2H A;  3SAI A;  3TQ9 A;  3F8Y A;  2C2S A;  5HVB A;  1LY4 A;  4LAE X;  2W3M A;  4PTH A;  4P3R A;  1MVT A;  1E26 A;  1RA9 A;  3QLS A;  3IRN A;  3CL9 A;  1DIU A;  5ECC A;  1RB2 A;  4QI9 A;  4QJZ D;  1SEJ A;  1S3Y A;  4ELH A;  3FRE X;  3DG8 A;  4QLG A;  4CD2 A;  3JSU A;  3QYL A;  1MVS A;  2LF1 A;  4KY4 A;  1IA3 A;  4HOE A;  4DPD A;  5HUI A;  2W9S A;  3NRR A;  3F8Z A;  3TQ8 A;  1U72 A;  1U70 A;  3FQF A;  1DR4 A;  2BLA A;  1DG5 A;  1RX9 A;  4G8Z X;  3VCO A;  3OAF A;  4EIL A;  3SRU X;  2XW7 A;  2OBC A;  4ELF A;  2ITH A;  1RH3 A;  3IX9 A;  3IRM A;  4P3Q A;  4XRB A;  5HF0 X;  1KLK A;  3FL9 A;  5CCC A;  3JWF A;  1RG7 A;  3L3R A;  4M7U A;  1DLS A;  5HSU A;  3TQA A;  2D5N A;  1TDR A;  4I1N A;  3UM6 A;  1RX2 A;  3NXT A;  4P68 A;  3NZA X;  3QG2 A;  1AO8 A;  4KYA A;  5HF2 X;  4RGC A;  2HM9 A;  4QJC A;  4PSY A;  3SGY A;  4KY8 A;  3FQV A;  4KBN A;  3DAU A;  3F0V X;  1PD8 A;  1HFP A;  1DDS A;  3HJ3 A;  4IXE D;  1RA3 A;  2AZN A;  3K45 A;  4ELE A;  4IXF X;  3QLY A;  5HQY A;  1JOL A;  4XEC X;  5CC9 A;  3F0X X;  3KY8 A;  3TD8 A;  4KM2 A;  1DYI A;  3F0S X;  1DRE A;  4KNE A;  1D1G A;  1CZ3 A;  2FZJ A;  3SRR X;  3QLX A;  1IA1 A;  4PDJ A;  1DG8 A;  4EJ1 A;  3EEL A;  1RA1 A;  3KJS A;  5HPB A;  3F0Q X;  1BOZ A;  3FRA X;  1VDR A;  3QLZ A;  4P66 A;  3CD2 A;  3TQB A;  3SRQ X;  2ANQ A;  4Q0E A;  2W3A A;  3JWC A;  4M6L A;  1RX8 A;  4I13 A;  3SA2 A;  4X5F A;  4XT5 A;  3FRD X;  4NX6 A;  4GH8 A;  2OIP A;  4HOG A;  3FRB X;  4LAG X;  2D0K A;  3EX8 A;  3UM5 A;  5JG0 X;  3LG4 A;  2FZH A;  3Q1H A;  4KEB A;  3D80 A;  5HT5 A;  3IA5 A;  2ANO A;  3NU0 A;  4QLF A;  3I8A X;  1PD9 A;  6DFR A;  4G95 A;  3FRF X;  3NZ6 X;  2INQ A;  3NZC X;  4M7V A;  4X5I A;  1HFR A;  5DFR A;  1RA2 A;  4DPH A;  4Q67 A;  3FQC A;  3K74 A;  3RG9 A;  4LAH X;  3FQZ A;  3CSE A;  4PST A;  1M7A A;  3IRO A;  4FGG A;  2O7P A;  2ZZA A;  4X5J A;  4ELG A;  1DRB A;  1DF7 A;  1KMS A;  4XT4 A;  3JW5 A;  1RE7 A;  3GHC A;  1RA8 A;  4XT6 A;  4OR7 A;  3QFX A;  1RF7 A;  1QZF A;  2HQP A;  3FQO A;  1RX1 A;  1JOM A;  2C2T A;  5U27 A;  1VJ3 A;  5HI6 A;  3EEM A;  3EEJ A;  2HXV A;  4NX7 A;  3DAT A;  3NZD A;  3IA4 A;  3F0B X;  3OCH A;  4QLE A;  3GHW A;  3JWM A;  1DRA A;  3NXY A;  2H2Q A;  5ECX A;  1DR6 A;  3UM8 A;  3KFY A;  3GI2 A;  3E0B A;  1LY3 A;  3NXV A;  3QL0 A;  1M78 A;  1S3V A;  3EEK A;  1JUV A;  3DFR A;  2W9G A;  4KJL A;  1BZF A;  1DR1 A;  3FL8 A;  4Q0D A;  4ELB A;  3NTZ A;  3SA1 A;  3RO9 A;  1RX6 A;  3NXO A;  3ROA A;  3QLR A;  4H98 A;  2FZI A;  3DL5 A;  1J3J A;  1RC4 A;  3GYF A;  4QHV A;  2P4G A;  3D84 X;  4XE6 X;  2CIG A;  2L28 A;  2DHF A;  5HSR A;  2DRC A;  5EAJ A;  3M09 A;  4KJK A;  1DG7 A;  1RX3 A;  3FS6 A;  3N0H A;  1M79 A;  3QGT A;  2BLC A;  4KFJ A;  2JYB A;  2G6V A;  4XT7 A;  4PSS A;  1DR7 A;  4Q6A A;  1DRH A;  4KL9 A;  5FDA A;  4EIG A;  3F0U X;  5DXV A;  3QLW A;  4OSG A;  1DHI A;  4TU5 X;  4EIZ A;  4HA9 A;  4H95 A;  3DRC A;  4KM0 A;  4IXG X;  4FGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...