2W9SA

Staphylococcus aureus s1:dhfr in complex with trimethoprim
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
TLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Comparison of Chromosomal and Exogenous Dihydrofolate Reductase from Staphylococcus Aureus in Complex with the Potent Inhibitor Trimethoprim.
pubmed doi rcsb
molecule keywords DIHYDROFOLATE REDUCTASE TYPE 1 FROM TN4003
molecule tags Oxidoreductase
source organism Staphylococcus aureus
total genus 39
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2009-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 2w9sA00
3ZPCA 1LUDA 5HPBA 3FY8X 3NXTA 1RX2A 4ELFA 3IA5A 4XT6A 3F0XX 1S3WA 4I13A 3LG4A 1DRHA 4XRBA 5HVBA 1CD2A 4FGHA 1DDSA 3S7AA 3QLRA 3QLXA 4QLEA 4X5JA 2JYBA 2FZHA 3DL6A 3F0BX 3QG2A 3QLSA 3NZ9X 3DATA 4KY4A 1J3KA 3NXRA 1PDBA 3TQ8A 1KMSA 4ELGA 4PSYA 3DAUA 3KJSA 1MVTA 2P4GA 2DRCA 2GD9A 4DP3A 2HQPA 3EX8A 2DHFA 4P68A 4HA7A 2BL9A 2ANOA 3EEMA 4Q67A 4RGCA 3NZBX 2D0KA 1DHFA 1S3VA 3OCHA 1RB3A 1U72A 4Q0EA 3D80A 1DRBA 1RX4A 1DAJA 3M08A 4X5FA 4DPDA 3DL5A 3EELA 1JOLA 1RB2A 4G95A 1RD7A 3NXVA 1LY3A 3TD8A 1DR7A 4EILA 3QLYA 3NZDA 1PD9A 5CCCA 1QZFA 1RX6A 4G3MA 4FHBA 3F0UX 1AI9A 2AZNA 4GH8A 2O7PA 3D84X 4QHVA 4XT7A 3NU0A 3EIGA 1TDRA 1E26A 3IX9A 1RH3A 4PTHA 3NRRA 4LEKX 8DFRA 1M78A 1IA1A 1MVSA 1DRFA 1DYIA 5HI6A 3NZAX 4PSTA 1RX3A 1AOEA 3I8AX 4DDRA 2CIGA 3GHWA 1RX7A 4QLFA 3DRCA 3KJRA 5HSRA 1HFPA 4KEBA 3NZ6X 2W9HA 2W3BA 5DFRA 4KL9A 2XW7A 5CC9A 3GI2A 1DR2A 2W3AA 3FS6A 3CSEA 4LAHX 4NX7A 3IROA 3QFXA 4M6LA 2H2QA 4PSSA 1DYRA 3HBBA 3JW5A 1S3UA 1VJ3A 3DG8A 3SH2A 3K2HA 4XE6X 3NXXA 4XECX 3QLZA 2C2SA 1RA9A 4H95A 4KM0A 4IXFX 4M7VA 1DDRA 3QGTA 1RX1A 6DFRA 1RA8A 1DLSA 4H98A 4IXED 3N0HA 3NZCX 2G6VA 3QL3A 4KAKA 1DG5A 1U70A 5HSUA 3F0SX 4P66A 4H97A 4ELEA 3VCOA 4OR7A 3FYWX 3F8ZA 1DR3A 3FRAX 3M09A 3Q1HA 5HVEA 5ECXA 3FL9A 2FZJA 5EAJA 4H96A 3SRWX 1KLKA 3K47A 3FQCA 5E8QA 4I1NA 5JA3A 3FL8A 3CLBA 4P3QA 2W3MA 5U26A 4Q6AA 1J3IA 1ZDRA 5HQYA 3I3RA 3E0BA 3SA2A 2OBCA 3CL9A 3NXYA 3K74A 5JG0X 2ANQA 2W9SA 4PDJA 1JUVA 4KNEA 4XT4A 3R33A 3ROAA 4CD2A 1HFRA 1RA3A 4FGGA 3FYVX 4OSGA 1DISA 2W9TA 1M79A 2BLCA 5U27A 3JWFA 1RC4A 5HUIA 3GHCA 3JWMA 3NXOA 4LAGX 3FRFX 3FQZA 3KGYA 1OHJA 4KFJA 4TU5X 3K45A 1DR6A 2ITHA 3GHVA 1AO8A 1LY4A 1DIUA 3DFRA 5HT5A 4PTJA 3IRNA 7DFRA 4M7UA 4NX6A 3SR5X 3ZPGA 1DR5A 4QLGA 3JVXA 3JTWA 1CZ3A 4DPHA 1DG8A 3UM6A 3GYFA 3F0VX 5DXVA 4EJ1A 1RX8A 4KM2A 3EEJA 1DR4A 2QK8A 4KJLA 4LAEX 1DHJA 3SRQX 2OIPA 1IA4A 4G8ZX 3SRSX 2ZZAA 4ELBA 4ELHA 3F8YA 5HF2X 4HA9A 4IXGX 1U71A 1VDRA 3F0QX 3JSUA 1DLRA 4EIGA 2B3ZA 4XT8A 2L28A 3FY9X 1DG7A 1RA2A 4KLXA 3S3VA 1DR1A 4M6JA 4DFRA 4HOGA 3SAIA 3FQ0A 3HJ3A 3KY8A 4X5GA 3QYLA 4QJZD 3SA1A 3INVA 4HOFA 2LF1A 3FQOA 5FDAA 2HM9A 2W3WA 3JWCA 4KYAA 1YHOA 3IA4A 5HT4A 4HOEA 3QL0A 1M7AA 1D1GA 1DRAA 1RX5A 3JWKA 3L3RA 1J3JA 3F91A 2KGKA 3RO9A 4M2XA 3S9UA 3RG9A 5HF0X 3SRRX 3JW3A 3NTZA 1RE7A 4M6KA 3TQBA 3QLWA 3IRMA 1BZFA 4X5IA 4EIZA 3EEKA 4P3RA 1DYJA 1IA2A 1DYHA 1S3YA 3QYOA 2INQA 2W3VA 3KFYA 2W9GA 4XT5A 1IA3A 3UM5A 1RX9A 3TQ9A 2BLAA 1DF7A 3TQAA 2FZIA 3DGAA 4KJKA 1RG7A 1JOMA 1RF7A 5ECCA 1DREA 1HFQA 1KMVA 2CD2A 3CD2A 3FREX 3UM8A 1SEJA 4ECKA 4KBNA 1RA1A 2HXVA 3FRBX 3FRDX 4KD7A 2D5NA 4QJCA 2C2TA 4KJJA 4Q0DA 1BOZA 3FQVA 1OHKA 4X5HA 5HQZA 3OAFA 3FQFA 1PD8A 4QI9A 1DHIA 3SRUX 2BLBA 3SGYA 3SQYX 4KY8A
chains in the Genus database with same CATH superfamily
3ZPCA 1LUDA 5HPBA 3FY8X 3NXTA 1RX2A 4ELFA 3IA5A 4XT6A 3F0XX 1S3WA 4I13A 3LG4A 1DRHA 4XRBA 5HVBA 1CD2A 4FGHA 1DDSA 3S7AA 3QLRA 3QLXA 4QLEA 4X5JA 2JYBA 2FZHA 3DL6A 3F0BX 3QG2A 3QLSA 3NZ9X 3DATA 4KY4A 1J3KA 3NXRA 1PDBA 3TQ8A 1KMSA 4ELGA 4PSYA 3DAUA 3KJSA 1MVTA 2P4GA 2DRCA 2GD9A 4DP3A 2HQPA 3EX8A 2DHFA 4P68A 4HA7A 2BL9A 2ANOA 3EEMA 4Q67A 4RGCA 3NZBX 2D0KA 1DHFA 1S3VA 3OCHA 1RB3A 1U72A 4Q0EA 3D80A 1DRBA 1RX4A 1DAJA 3M08A 4X5FA 4DPDA 3DL5A 3EELA 1JOLA 1RB2A 4G95A 1RD7A 3NXVA 1LY3A 3TD8A 1DR7A 4EILA 3QLYA 3NZDA 1PD9A 5CCCA 1QZFA 1RX6A 4G3MA 4FHBA 3F0UX 1AI9A 2AZNA 4GH8A 2O7PA 3D84X 4QHVA 4XT7A 3NU0A 3EIGA 1TDRA 1E26A 3IX9A 1RH3A 4PTHA 3NRRA 4LEKX 8DFRA 1M78A 1IA1A 1MVSA 1DRFA 1DYIA 5HI6A 3NZAX 4PSTA 1RX3A 1AOEA 3I8AX 4DDRA 2CIGA 3GHWA 1RX7A 4QLFA 3DRCA 3KJRA 5HSRA 1HFPA 4KEBA 3NZ6X 2W9HA 2W3BA 5DFRA 4KL9A 2XW7A 5CC9A 3GI2A 1DR2A 2W3AA 3FS6A 3CSEA 4LAHX 4NX7A 3IROA 3QFXA 4M6LA 2H2QA 4PSSA 1DYRA 3HBBA 3JW5A 1S3UA 1VJ3A 3DG8A 3SH2A 3K2HA 4XE6X 3NXXA 4XECX 3QLZA 2C2SA 1RA9A 4H95A 4KM0A 4IXFX 4M7VA 1DDRA 3QGTA 1RX1A 6DFRA 1RA8A 1DLSA 4H98A 4IXED 3N0HA 3NZCX 2G6VA 3QL3A 4KAKA 1DG5A 1U70A 5HSUA 3F0SX 4P66A 4H97A 4ELEA 3VCOA 4OR7A 3FYWX 3F8ZA 1DR3A 3FRAX 3M09A 3Q1HA 5HVEA 5ECXA 3FL9A 2FZJA 5EAJA 4H96A 3SRWX 1KLKA 3K47A 3FQCA 5E8QA 4I1NA 5JA3A 3FL8A 3CLBA 4P3QA 2W3MA 5U26A 4Q6AA 1J3IA 1ZDRA 5HQYA 3I3RA 3E0BA 3SA2A 2OBCA 3CL9A 3NXYA 3K74A 5JG0X 2ANQA 2W9SA 4PDJA 1JUVA 4KNEA 4XT4A 3R33A 3ROAA 4CD2A 1HFRA 1RA3A 4FGGA 3FYVX 4OSGA 1DISA 2W9TA 1M79A 2BLCA 5U27A 3JWFA 1RC4A 5HUIA 3GHCA 3JWMA 3NXOA 4LAGX 3FRFX 3FQZA 3KGYA 1OHJA 4KFJA 4TU5X 3K45A 1DR6A 2ITHA 3GHVA 1AO8A 1LY4A 1DIUA 3DFRA 5HT5A 4PTJA 3IRNA 7DFRA 4M7UA 4NX6A 3SR5X 3ZPGA 1DR5A 4QLGA 3JVXA 3JTWA 1CZ3A 4DPHA 1DG8A 3UM6A 3GYFA 3F0VX 5DXVA 4EJ1A 1RX8A 4KM2A 3EEJA 1DR4A 2QK8A 4KJLA 4LAEX 1DHJA 3SRQX 2OIPA 1IA4A 4G8ZX 3SRSX 2ZZAA 4ELBA 4ELHA 3F8YA 5HF2X 4HA9A 4IXGX 1U71A 1VDRA 3F0QX 3JSUA 1DLRA 4EIGA 2B3ZA 4XT8A 2L28A 3FY9X 1DG7A 1RA2A 4KLXA 3S3VA 1DR1A 4M6JA 4DFRA 4HOGA 3SAIA 3FQ0A 3HJ3A 3KY8A 4X5GA 3QYLA 4QJZD 3SA1A 3INVA 4HOFA 2LF1A 3FQOA 5FDAA 2HM9A 2W3WA 3JWCA 4KYAA 1YHOA 3IA4A 5HT4A 4HOEA 3QL0A 1M7AA 1D1GA 1DRAA 1RX5A 3JWKA 3L3RA 1J3JA 3F91A 2KGKA 3RO9A 4M2XA 3S9UA 3RG9A 5HF0X 3SRRX 3JW3A 3NTZA 1RE7A 4M6KA 3TQBA 3QLWA 3IRMA 1BZFA 4X5IA 4EIZA 3EEKA 4P3RA 1DYJA 1IA2A 1DYHA 1S3YA 3QYOA 2INQA 2W3VA 3KFYA 2W9GA 4XT5A 1IA3A 3UM5A 1RX9A 3TQ9A 2BLAA 1DF7A 3TQAA 2FZIA 3DGAA 4KJKA 1RG7A 1JOMA 1RF7A 5ECCA 1DREA 1HFQA 1KMVA 2CD2A 3CD2A 3FREX 3UM8A 1SEJA 4ECKA 4KBNA 1RA1A 2HXVA 3FRBX 3FRDX 4KD7A 2D5NA 4QJCA 2C2TA 4KJJA 4Q0DA 1BOZA 3FQVA 1OHKA 4X5HA 5HQZA 3OAFA 3FQFA 1PD8A 4QI9A 1DHIA 3SRUX 2BLBA 3SGYA 3SQYX 4KY8A
chains in the Genus database with same CATH topology
3ZPCA 1LUDA 5HPBA 3FY8X 3NXTA 1RX2A 4ELFA 3IA5A 4XT6A 3F0XX 1S3WA 4I13A 3LG4A 1DRHA 4XRBA 5HVBA 1CD2A 4FGHA 1DDSA 3S7AA 3QLRA 3QLXA 4QLEA 4X5JA 2JYBA 2FZHA 3DL6A 3F0BX 3QG2A 3QLSA 3NZ9X 3DATA 4KY4A 1J3KA 3NXRA 1PDBA 3TQ8A 1KMSA 4ELGA 4PSYA 3DAUA 3KJSA 1MVTA 2P4GA 2DRCA 2GD9A 4DP3A 2HQPA 3EX8A 2DHFA 4P68A 4HA7A 2BL9A 2ANOA 3EEMA 4Q67A 4RGCA 3NZBX 2D0KA 1DHFA 1S3VA 3OCHA 1RB3A 1U72A 4Q0EA 3D80A 1DRBA 1RX4A 1DAJA 3M08A 4X5FA 4DPDA 3DL5A 3EELA 1JOLA 1RB2A 4G95A 1RD7A 3NXVA 1LY3A 3TD8A 1DR7A 4EILA 3QLYA 3NZDA 1PD9A 5CCCA 1QZFA 1RX6A 4G3MA 4FHBA 3F0UX 1AI9A 2AZNA 4GH8A 2O7PA 3D84X 4QHVA 4XT7A 3NU0A 3EIGA 1TDRA 1E26A 3IX9A 1RH3A 4PTHA 3NRRA 4LEKX 8DFRA 1M78A 1IA1A 1MVSA 1DRFA 1DYIA 5HI6A 3NZAX 4PSTA 1RX3A 1AOEA 3I8AX 4DDRA 2CIGA 3GHWA 1RX7A 4QLFA 3DRCA 3KJRA 5HSRA 1HFPA 4KEBA 3NZ6X 2W9HA 2W3BA 5DFRA 4KL9A 2XW7A 5CC9A 3GI2A 1DR2A 2W3AA 3FS6A 3CSEA 4LAHX 4NX7A 3IROA 3QFXA 4M6LA 2H2QA 4PSSA 1DYRA 3HBBA 3JW5A 1S3UA 1VJ3A 3DG8A 3SH2A 3K2HA 4XE6X 3NXXA 4XECX 3QLZA 2C2SA 1RA9A 4H95A 4KM0A 4IXFX 4M7VA 1DDRA 3QGTA 1RX1A 6DFRA 1RA8A 1DLSA 4H98A 4IXED 3N0HA 3NZCX 2G6VA 3QL3A 4KAKA 1DG5A 1U70A 5HSUA 3F0SX 4P66A 4H97A 4ELEA 3VCOA 4OR7A 3FYWX 3F8ZA 1DR3A 3FRAX 3M09A 3Q1HA 5HVEA 5ECXA 3FL9A 2FZJA 5EAJA 4H96A 3SRWX 1KLKA 3K47A 3FQCA 5E8QA 4I1NA 5JA3A 3FL8A 3CLBA 4P3QA 2W3MA 5U26A 4Q6AA 1J3IA 1ZDRA 5HQYA 3I3RA 3E0BA 3SA2A 2OBCA 3CL9A 3NXYA 3K74A 5JG0X 2ANQA 2W9SA 4PDJA 1JUVA 4KNEA 4XT4A 3R33A 3ROAA 4CD2A 1HFRA 1RA3A 4FGGA 3FYVX 4OSGA 1DISA 2W9TA 1M79A 2BLCA 5U27A 3JWFA 1RC4A 5HUIA 3GHCA 3JWMA 3NXOA 4LAGX 3FRFX 3FQZA 3KGYA 1OHJA 4KFJA 4TU5X 3K45A 1DR6A 2ITHA 3GHVA 1AO8A 1LY4A 1DIUA 3DFRA 5HT5A 4PTJA 3IRNA 7DFRA 4M7UA 4NX6A 3SR5X 3ZPGA 1DR5A 4QLGA 3JVXA 3JTWA 1CZ3A 4DPHA 1DG8A 3UM6A 3GYFA 3F0VX 5DXVA 4EJ1A 1RX8A 4KM2A 3EEJA 1DR4A 2QK8A 4KJLA 4LAEX 1DHJA 3SRQX 2OIPA 1IA4A 4G8ZX 3SRSX 2ZZAA 4ELBA 4ELHA 3F8YA 5HF2X 4HA9A 4IXGX 1U71A 1VDRA 3F0QX 3JSUA 1DLRA 4EIGA 2B3ZA 4XT8A 2L28A 3FY9X 1DG7A 1RA2A 4KLXA 3S3VA 1DR1A 4M6JA 4DFRA 4HOGA 3SAIA 3FQ0A 3HJ3A 3KY8A 4X5GA 3QYLA 4QJZD 3SA1A 3INVA 4HOFA 2LF1A 3FQOA 5FDAA 2HM9A 2W3WA 3JWCA 4KYAA 1YHOA 3IA4A 5HT4A 4HOEA 3QL0A 1M7AA 1D1GA 1DRAA 1RX5A 3JWKA 3L3RA 1J3JA 3F91A 2KGKA 3RO9A 4M2XA 3S9UA 3RG9A 5HF0X 3SRRX 3JW3A 3NTZA 1RE7A 4M6KA 3TQBA 3QLWA 3IRMA 1BZFA 4X5IA 4EIZA 3EEKA 4P3RA 1DYJA 1IA2A 1DYHA 1S3YA 3QYOA 2INQA 2W3VA 3KFYA 2W9GA 4XT5A 1IA3A 3UM5A 1RX9A 3TQ9A 2BLAA 1DF7A 3TQAA 2FZIA 3DGAA 4KJKA 1RG7A 1JOMA 1RF7A 5ECCA 1DREA 1HFQA 1KMVA 2CD2A 3CD2A 3FREX 3UM8A 1SEJA 4ECKA 4KBNA 1RA1A 2HXVA 3FRBX 3FRDX 4KD7A 2D5NA 4QJCA 2C2TA 4KJJA 4Q0DA 1BOZA 3FQVA 1OHKA 4X5HA 5HQZA 3OAFA 3FQFA 1PD8A 4QI9A 1DHIA 3SRUX 2BLBA 3SGYA 3SQYX 4KY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPC A;  1LUD A;  5HPB A;  3FY8 X;  3NXT A;  1RX2 A;  4ELF A;  3IA5 A;  4XT6 A;  3F0X X;  1S3W A;  4I13 A;  3LG4 A;  1DRH A;  4XRB A;  5HVB A;  1CD2 A;  4FGH A;  1DDS A;  3S7A A;  3QLR A;  3QLX A;  4QLE A;  4X5J A;  2JYB A;  2FZH A;  3DL6 A;  3F0B X;  3QG2 A;  3QLS A;  3NZ9 X;  3DAT A;  4KY4 A;  1J3K A;  3NXR A;  1PDB A;  3TQ8 A;  1KMS A;  4ELG A;  4PSY A;  3DAU A;  3KJS A;  1MVT A;  2P4G A;  2DRC A;  2GD9 A;  4DP3 A;  2HQP A;  3EX8 A;  2DHF A;  4P68 A;  4HA7 A;  2BL9 A;  2ANO A;  3EEM A;  4Q67 A;  4RGC A;  3NZB X;  2D0K A;  1DHF A;  1S3V A;  3OCH A;  1RB3 A;  1U72 A;  4Q0E A;  3D80 A;  1DRB A;  1RX4 A;  1DAJ A;  3M08 A;  4X5F A;  4DPD A;  3DL5 A;  3EEL A;  1JOL A;  1RB2 A;  4G95 A;  1RD7 A;  3NXV A;  1LY3 A;  3TD8 A;  1DR7 A;  4EIL A;  3QLY A;  3NZD A;  1PD9 A;  5CCC A;  1QZF A;  1RX6 A;  4G3M A;  4FHB A;  3F0U X;  1AI9 A;  2AZN A;  4GH8 A;  2O7P A;  3D84 X;  4QHV A;  4XT7 A;  3NU0 A;  3EIG A;  1TDR A;  1E26 A;  3IX9 A;  1RH3 A;  4PTH A;  3NRR A;  4LEK X;  8DFR A;  1M78 A;  1IA1 A;  1MVS A;  1DRF A;  1DYI A;  5HI6 A;  3NZA X;  4PST A;  1RX3 A;  1AOE A;  3I8A X;  4DDR A;  2CIG A;  3GHW A;  1RX7 A;  4QLF A;  3DRC A;  3KJR A;  5HSR A;  1HFP A;  4KEB A;  3NZ6 X;  2W9H A;  2W3B A;  5DFR A;  4KL9 A;  2XW7 A;  5CC9 A;  3GI2 A;  1DR2 A;  2W3A A;  3FS6 A;  3CSE A;  4LAH X;  4NX7 A;  3IRO A;  3QFX A;  4M6L A;  2H2Q A;  4PSS A;  1DYR A;  3HBB A;  3JW5 A;  1S3U A;  1VJ3 A;  3DG8 A;  3SH2 A;  3K2H A;  4XE6 X;  3NXX A;  4XEC X;  3QLZ A;  2C2S A;  1RA9 A;  4H95 A;  4KM0 A;  4IXF X;  4M7V A;  1DDR A;  3QGT A;  1RX1 A;  6DFR A;  1RA8 A;  1DLS A;  4H98 A;  4IXE D;  3N0H A;  3NZC X;  2G6V A;  3QL3 A;  4KAK A;  1DG5 A;  1U70 A;  5HSU A;  3F0S X;  4P66 A;  4H97 A;  4ELE A;  3VCO A;  4OR7 A;  3FYW X;  3F8Z A;  1DR3 A;  3FRA X;  3M09 A;  3Q1H A;  5HVE A;  5ECX A;  3FL9 A;  2FZJ A;  5EAJ A;  4H96 A;  3SRW X;  1KLK A;  3K47 A;  3FQC A;  5E8Q A;  4I1N A;  5JA3 A;  3FL8 A;  3CLB A;  4P3Q A;  2W3M A;  5U26 A;  4Q6A A;  1J3I A;  1ZDR A;  5HQY A;  3I3R A;  3E0B A;  3SA2 A;  2OBC A;  3CL9 A;  3NXY A;  3K74 A;  5JG0 X;  2ANQ A;  2W9S A;  4PDJ A;  1JUV A;  4KNE A;  4XT4 A;  3R33 A;  3ROA A;  4CD2 A;  1HFR A;  1RA3 A;  4FGG A;  3FYV X;  4OSG A;  1DIS A;  2W9T A;  1M79 A;  2BLC A;  5U27 A;  3JWF A;  1RC4 A;  5HUI A;  3GHC A;  3JWM A;  3NXO A;  4LAG X;  3FRF X;  3FQZ A;  3KGY A;  1OHJ A;  4KFJ A;  4TU5 X;  3K45 A;  1DR6 A;  2ITH A;  3GHV A;  1AO8 A;  1LY4 A;  1DIU A;  3DFR A;  5HT5 A;  4PTJ A;  3IRN A;  7DFR A;  4M7U A;  4NX6 A;  3SR5 X;  3ZPG A;  1DR5 A;  4QLG A;  3JVX A;  3JTW A;  1CZ3 A;  4DPH A;  1DG8 A;  3UM6 A;  3GYF A;  3F0V X;  5DXV A;  4EJ1 A;  1RX8 A;  4KM2 A;  3EEJ A;  1DR4 A;  2QK8 A;  4KJL A;  4LAE X;  1DHJ A;  3SRQ X;  2OIP A;  1IA4 A;  4G8Z X;  3SRS X;  2ZZA A;  4ELB A;  4ELH A;  3F8Y A;  5HF2 X;  4HA9 A;  4IXG X;  1U71 A;  1VDR A;  3F0Q X;  3JSU A;  1DLR A;  4EIG A;  2B3Z A;  4XT8 A;  2L28 A;  3FY9 X;  1DG7 A;  1RA2 A;  4KLX A;  3S3V A;  1DR1 A;  4M6J A;  4DFR A;  4HOG A;  3SAI A;  3FQ0 A;  3HJ3 A;  3KY8 A;  4X5G A;  3QYL A;  4QJZ D;  3SA1 A;  3INV A;  4HOF A;  2LF1 A;  3FQO A;  5FDA A;  2HM9 A;  2W3W A;  3JWC A;  4KYA A;  1YHO A;  3IA4 A;  5HT4 A;  4HOE A;  3QL0 A;  1M7A A;  1D1G A;  1DRA A;  1RX5 A;  3JWK A;  3L3R A;  1J3J A;  3F91 A;  2KGK A;  3RO9 A;  4M2X A;  3S9U A;  3RG9 A;  5HF0 X;  3SRR X;  3JW3 A;  3NTZ A;  1RE7 A;  4M6K A;  3TQB A;  3QLW A;  3IRM A;  1BZF A;  4X5I A;  4EIZ A;  3EEK A;  4P3R A;  1DYJ A;  1IA2 A;  1DYH A;  1S3Y A;  3QYO A;  2INQ A;  2W3V A;  3KFY A;  2W9G A;  4XT5 A;  1IA3 A;  3UM5 A;  1RX9 A;  3TQ9 A;  2BLA A;  1DF7 A;  3TQA A;  2FZI A;  3DGA A;  4KJK A;  1RG7 A;  1JOM A;  1RF7 A;  5ECC A;  1DRE A;  1HFQ A;  1KMV A;  2CD2 A;  3CD2 A;  3FRE X;  3UM8 A;  1SEJ A;  4ECK A;  4KBN A;  1RA1 A;  2HXV A;  3FRB X;  3FRD X;  4KD7 A;  2D5N A;  4QJC A;  2C2T A;  4KJJ A;  4Q0D A;  1BOZ A;  3FQV A;  1OHK A;  4X5H A;  5HQZ A;  3OAF A;  3FQF A;  1PD8 A;  4QI9 A;  1DHI A;  3SRU X;  2BLB A;  3SGY A;  3SQY X;  4KY8 A; 
#chains in the Genus database with same CATH topology
 3ZPC A;  1LUD A;  5HPB A;  3FY8 X;  3NXT A;  1RX2 A;  4ELF A;  3IA5 A;  4XT6 A;  3F0X X;  1S3W A;  4I13 A;  3LG4 A;  1DRH A;  4XRB A;  5HVB A;  1CD2 A;  4FGH A;  1DDS A;  3S7A A;  3QLR A;  3QLX A;  4QLE A;  4X5J A;  2JYB A;  2FZH A;  3DL6 A;  3F0B X;  3QG2 A;  3QLS A;  3NZ9 X;  3DAT A;  4KY4 A;  1J3K A;  3NXR A;  1PDB A;  3TQ8 A;  1KMS A;  4ELG A;  4PSY A;  3DAU A;  3KJS A;  1MVT A;  2P4G A;  2DRC A;  2GD9 A;  4DP3 A;  2HQP A;  3EX8 A;  2DHF A;  4P68 A;  4HA7 A;  2BL9 A;  2ANO A;  3EEM A;  4Q67 A;  4RGC A;  3NZB X;  2D0K A;  1DHF A;  1S3V A;  3OCH A;  1RB3 A;  1U72 A;  4Q0E A;  3D80 A;  1DRB A;  1RX4 A;  1DAJ A;  3M08 A;  4X5F A;  4DPD A;  3DL5 A;  3EEL A;  1JOL A;  1RB2 A;  4G95 A;  1RD7 A;  3NXV A;  1LY3 A;  3TD8 A;  1DR7 A;  4EIL A;  3QLY A;  3NZD A;  1PD9 A;  5CCC A;  1QZF A;  1RX6 A;  4G3M A;  4FHB A;  3F0U X;  1AI9 A;  2AZN A;  4GH8 A;  2O7P A;  3D84 X;  4QHV A;  4XT7 A;  3NU0 A;  3EIG A;  1TDR A;  1E26 A;  3IX9 A;  1RH3 A;  4PTH A;  3NRR A;  4LEK X;  8DFR A;  1M78 A;  1IA1 A;  1MVS A;  1DRF A;  1DYI A;  5HI6 A;  3NZA X;  4PST A;  1RX3 A;  1AOE A;  3I8A X;  4DDR A;  2CIG A;  3GHW A;  1RX7 A;  4QLF A;  3DRC A;  3KJR A;  5HSR A;  1HFP A;  4KEB A;  3NZ6 X;  2W9H A;  2W3B A;  5DFR A;  4KL9 A;  2XW7 A;  5CC9 A;  3GI2 A;  1DR2 A;  2W3A A;  3FS6 A;  3CSE A;  4LAH X;  4NX7 A;  3IRO A;  3QFX A;  4M6L A;  2H2Q A;  4PSS A;  1DYR A;  3HBB A;  3JW5 A;  1S3U A;  1VJ3 A;  3DG8 A;  3SH2 A;  3K2H A;  4XE6 X;  3NXX A;  4XEC X;  3QLZ A;  2C2S A;  1RA9 A;  4H95 A;  4KM0 A;  4IXF X;  4M7V A;  1DDR A;  3QGT A;  1RX1 A;  6DFR A;  1RA8 A;  1DLS A;  4H98 A;  4IXE D;  3N0H A;  3NZC X;  2G6V A;  3QL3 A;  4KAK A;  1DG5 A;  1U70 A;  5HSU A;  3F0S X;  4P66 A;  4H97 A;  4ELE A;  3VCO A;  4OR7 A;  3FYW X;  3F8Z A;  1DR3 A;  3FRA X;  3M09 A;  3Q1H A;  5HVE A;  5ECX A;  3FL9 A;  2FZJ A;  5EAJ A;  4H96 A;  3SRW X;  1KLK A;  3K47 A;  3FQC A;  5E8Q A;  4I1N A;  5JA3 A;  3FL8 A;  3CLB A;  4P3Q A;  2W3M A;  5U26 A;  4Q6A A;  1J3I A;  1ZDR A;  5HQY A;  3I3R A;  3E0B A;  3SA2 A;  2OBC A;  3CL9 A;  3NXY A;  3K74 A;  5JG0 X;  2ANQ A;  2W9S A;  4PDJ A;  1JUV A;  4KNE A;  4XT4 A;  3R33 A;  3ROA A;  4CD2 A;  1HFR A;  1RA3 A;  4FGG A;  3FYV X;  4OSG A;  1DIS A;  2W9T A;  1M79 A;  2BLC A;  5U27 A;  3JWF A;  1RC4 A;  5HUI A;  3GHC A;  3JWM A;  3NXO A;  4LAG X;  3FRF X;  3FQZ A;  3KGY A;  1OHJ A;  4KFJ A;  4TU5 X;  3K45 A;  1DR6 A;  2ITH A;  3GHV A;  1AO8 A;  1LY4 A;  1DIU A;  3DFR A;  5HT5 A;  4PTJ A;  3IRN A;  7DFR A;  4M7U A;  4NX6 A;  3SR5 X;  3ZPG A;  1DR5 A;  4QLG A;  3JVX A;  3JTW A;  1CZ3 A;  4DPH A;  1DG8 A;  3UM6 A;  3GYF A;  3F0V X;  5DXV A;  4EJ1 A;  1RX8 A;  4KM2 A;  3EEJ A;  1DR4 A;  2QK8 A;  4KJL A;  4LAE X;  1DHJ A;  3SRQ X;  2OIP A;  1IA4 A;  4G8Z X;  3SRS X;  2ZZA A;  4ELB A;  4ELH A;  3F8Y A;  5HF2 X;  4HA9 A;  4IXG X;  1U71 A;  1VDR A;  3F0Q X;  3JSU A;  1DLR A;  4EIG A;  2B3Z A;  4XT8 A;  2L28 A;  3FY9 X;  1DG7 A;  1RA2 A;  4KLX A;  3S3V A;  1DR1 A;  4M6J A;  4DFR A;  4HOG A;  3SAI A;  3FQ0 A;  3HJ3 A;  3KY8 A;  4X5G A;  3QYL A;  4QJZ D;  3SA1 A;  3INV A;  4HOF A;  2LF1 A;  3FQO A;  5FDA A;  2HM9 A;  2W3W A;  3JWC A;  4KYA A;  1YHO A;  3IA4 A;  5HT4 A;  4HOE A;  3QL0 A;  1M7A A;  1D1G A;  1DRA A;  1RX5 A;  3JWK A;  3L3R A;  1J3J A;  3F91 A;  2KGK A;  3RO9 A;  4M2X A;  3S9U A;  3RG9 A;  5HF0 X;  3SRR X;  3JW3 A;  3NTZ A;  1RE7 A;  4M6K A;  3TQB A;  3QLW A;  3IRM A;  1BZF A;  4X5I A;  4EIZ A;  3EEK A;  4P3R A;  1DYJ A;  1IA2 A;  1DYH A;  1S3Y A;  3QYO A;  2INQ A;  2W3V A;  3KFY A;  2W9G A;  4XT5 A;  1IA3 A;  3UM5 A;  1RX9 A;  3TQ9 A;  2BLA A;  1DF7 A;  3TQA A;  2FZI A;  3DGA A;  4KJK A;  1RG7 A;  1JOM A;  1RF7 A;  5ECC A;  1DRE A;  1HFQ A;  1KMV A;  2CD2 A;  3CD2 A;  3FRE X;  3UM8 A;  1SEJ A;  4ECK A;  4KBN A;  1RA1 A;  2HXV A;  3FRB X;  3FRD X;  4KD7 A;  2D5N A;  4QJC A;  2C2T A;  4KJJ A;  4Q0D A;  1BOZ A;  3FQV A;  1OHK A;  4X5H A;  5HQZ A;  3OAF A;  3FQF A;  1PD8 A;  4QI9 A;  1DHI A;  3SRU X;  2BLB A;  3SGY A;  3SQY X;  4KY8 A; 
#chains in the Genus database with same CATH homology
 3ZPC A;  1LUD A;  5HPB A;  3FY8 X;  3NXT A;  1RX2 A;  4ELF A;  3IA5 A;  4XT6 A;  3F0X X;  1S3W A;  4I13 A;  3LG4 A;  1DRH A;  4XRB A;  5HVB A;  1CD2 A;  4FGH A;  1DDS A;  3S7A A;  3QLR A;  3QLX A;  4QLE A;  4X5J A;  2JYB A;  2FZH A;  3DL6 A;  3F0B X;  3QG2 A;  3QLS A;  3NZ9 X;  3DAT A;  4KY4 A;  1J3K A;  3NXR A;  1PDB A;  3TQ8 A;  1KMS A;  4ELG A;  4PSY A;  3DAU A;  3KJS A;  1MVT A;  2P4G A;  2DRC A;  2GD9 A;  4DP3 A;  2HQP A;  3EX8 A;  2DHF A;  4P68 A;  4HA7 A;  2BL9 A;  2ANO A;  3EEM A;  4Q67 A;  4RGC A;  3NZB X;  2D0K A;  1DHF A;  1S3V A;  3OCH A;  1RB3 A;  1U72 A;  4Q0E A;  3D80 A;  1DRB A;  1RX4 A;  1DAJ A;  3M08 A;  4X5F A;  4DPD A;  3DL5 A;  3EEL A;  1JOL A;  1RB2 A;  4G95 A;  1RD7 A;  3NXV A;  1LY3 A;  3TD8 A;  1DR7 A;  4EIL A;  3QLY A;  3NZD A;  1PD9 A;  5CCC A;  1QZF A;  1RX6 A;  4G3M A;  4FHB A;  3F0U X;  1AI9 A;  2AZN A;  4GH8 A;  2O7P A;  3D84 X;  4QHV A;  4XT7 A;  3NU0 A;  3EIG A;  1TDR A;  1E26 A;  3IX9 A;  1RH3 A;  4PTH A;  3NRR A;  4LEK X;  8DFR A;  1M78 A;  1IA1 A;  1MVS A;  1DRF A;  1DYI A;  5HI6 A;  3NZA X;  4PST A;  1RX3 A;  1AOE A;  3I8A X;  4DDR A;  2CIG A;  3GHW A;  1RX7 A;  4QLF A;  3DRC A;  3KJR A;  5HSR A;  1HFP A;  4KEB A;  3NZ6 X;  2W9H A;  2W3B A;  5DFR A;  4KL9 A;  2XW7 A;  5CC9 A;  3GI2 A;  1DR2 A;  2W3A A;  3FS6 A;  3CSE A;  4LAH X;  4NX7 A;  3IRO A;  3QFX A;  4M6L A;  2H2Q A;  4PSS A;  1DYR A;  3HBB A;  3JW5 A;  1S3U A;  1VJ3 A;  3DG8 A;  3SH2 A;  3K2H A;  4XE6 X;  3NXX A;  4XEC X;  3QLZ A;  2C2S A;  1RA9 A;  4H95 A;  4KM0 A;  4IXF X;  4M7V A;  1DDR A;  3QGT A;  1RX1 A;  6DFR A;  1RA8 A;  1DLS A;  4H98 A;  4IXE D;  3N0H A;  3NZC X;  2G6V A;  3QL3 A;  4KAK A;  1DG5 A;  1U70 A;  5HSU A;  3F0S X;  4P66 A;  4H97 A;  4ELE A;  3VCO A;  4OR7 A;  3FYW X;  3F8Z A;  1DR3 A;  3FRA X;  3M09 A;  3Q1H A;  5HVE A;  5ECX A;  3FL9 A;  2FZJ A;  5EAJ A;  4H96 A;  3SRW X;  1KLK A;  3K47 A;  3FQC A;  5E8Q A;  4I1N A;  5JA3 A;  3FL8 A;  3CLB A;  4P3Q A;  2W3M A;  5U26 A;  4Q6A A;  1J3I A;  1ZDR A;  5HQY A;  3I3R A;  3E0B A;  3SA2 A;  2OBC A;  3CL9 A;  3NXY A;  3K74 A;  5JG0 X;  2ANQ A;  2W9S A;  4PDJ A;  1JUV A;  4KNE A;  4XT4 A;  3R33 A;  3ROA A;  4CD2 A;  1HFR A;  1RA3 A;  4FGG A;  3FYV X;  4OSG A;  1DIS A;  2W9T A;  1M79 A;  2BLC A;  5U27 A;  3JWF A;  1RC4 A;  5HUI A;  3GHC A;  3JWM A;  3NXO A;  4LAG X;  3FRF X;  3FQZ A;  3KGY A;  1OHJ A;  4KFJ A;  4TU5 X;  3K45 A;  1DR6 A;  2ITH A;  3GHV A;  1AO8 A;  1LY4 A;  1DIU A;  3DFR A;  5HT5 A;  4PTJ A;  3IRN A;  7DFR A;  4M7U A;  4NX6 A;  3SR5 X;  3ZPG A;  1DR5 A;  4QLG A;  3JVX A;  3JTW A;  1CZ3 A;  4DPH A;  1DG8 A;  3UM6 A;  3GYF A;  3F0V X;  5DXV A;  4EJ1 A;  1RX8 A;  4KM2 A;  3EEJ A;  1DR4 A;  2QK8 A;  4KJL A;  4LAE X;  1DHJ A;  3SRQ X;  2OIP A;  1IA4 A;  4G8Z X;  3SRS X;  2ZZA A;  4ELB A;  4ELH A;  3F8Y A;  5HF2 X;  4HA9 A;  4IXG X;  1U71 A;  1VDR A;  3F0Q X;  3JSU A;  1DLR A;  4EIG A;  2B3Z A;  4XT8 A;  2L28 A;  3FY9 X;  1DG7 A;  1RA2 A;  4KLX A;  3S3V A;  1DR1 A;  4M6J A;  4DFR A;  4HOG A;  3SAI A;  3FQ0 A;  3HJ3 A;  3KY8 A;  4X5G A;  3QYL A;  4QJZ D;  3SA1 A;  3INV A;  4HOF A;  2LF1 A;  3FQO A;  5FDA A;  2HM9 A;  2W3W A;  3JWC A;  4KYA A;  1YHO A;  3IA4 A;  5HT4 A;  4HOE A;  3QL0 A;  1M7A A;  1D1G A;  1DRA A;  1RX5 A;  3JWK A;  3L3R A;  1J3J A;  3F91 A;  2KGK A;  3RO9 A;  4M2X A;  3S9U A;  3RG9 A;  5HF0 X;  3SRR X;  3JW3 A;  3NTZ A;  1RE7 A;  4M6K A;  3TQB A;  3QLW A;  3IRM A;  1BZF A;  4X5I A;  4EIZ A;  3EEK A;  4P3R A;  1DYJ A;  1IA2 A;  1DYH A;  1S3Y A;  3QYO A;  2INQ A;  2W3V A;  3KFY A;  2W9G A;  4XT5 A;  1IA3 A;  3UM5 A;  1RX9 A;  3TQ9 A;  2BLA A;  1DF7 A;  3TQA A;  2FZI A;  3DGA A;  4KJK A;  1RG7 A;  1JOM A;  1RF7 A;  5ECC A;  1DRE A;  1HFQ A;  1KMV A;  2CD2 A;  3CD2 A;  3FRE X;  3UM8 A;  1SEJ A;  4ECK A;  4KBN A;  1RA1 A;  2HXV A;  3FRB X;  3FRD X;  4KD7 A;  2D5N A;  4QJC A;  2C2T A;  4KJJ A;  4Q0D A;  1BOZ A;  3FQV A;  1OHK A;  4X5H A;  5HQZ A;  3OAF A;  3FQF A;  1PD8 A;  4QI9 A;  1DHI A;  3SRU X;  2BLB A;  3SGY A;  3SQY X;  4KY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...