2WA4A

Factor inhibiting hif-1 alpha with n,3-dihydroxybenzamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa4A01
1MZFA 3P3PA 4B7KA 2WA4A 4QU2A 4Z1VA 2ILMA 1YCIA 3P3NA 2CGNA 2WA3A 4AI8A 2CGOA 1H2MA 2Y0IA 3KCYA 2W0XA 4Z2WA 1H2LA 3KCXA 2YC0A 2XUMA 1H2KA 3D8CA 1H2NA 1IZ3A 1MZEA 4B7EA 4BIOA 5JWPA 4NR1A 3OD4A 2YDEA 4JAAA
chains in the Genus database with same CATH superfamily
4LO7A 4XIKA 1DQ2A 2IJIA 1OHFA 4JYBA 1RJ7A 3PUIA 1NCRA 3SYOA 3PURA 2WYFA 2DCTA 2QDOA 2JGDB 2UXBO 3PVEA 3PTRB 4P2ZA 3DYMA 4K35A 4CDXC 3WF4A 1K12A 3ZIXA 4XILA 5FJKA 2WLMA 2OZ6A 3MF6A 3F2ZA 4LITA 1VQNV 3AL5A 5T3NA 4ATFA 3ZDVA 4YW5A 3UO2A 5T55A 2B46X 4OZOA 1D5NA 4YFWA 4Z2WA 2ETEA 4YW3A 1VMJA 3UGHA 2WO7A 2ITDC 2FD8A 4JI2O 3OB8A 3L9DA 1DHKB 2ZGSA 1BLZA 2JDYA 4CCDA 3VBBA 2PHFA 2FL4A 1HX6A 2VOKA 5BXXA 1WMFA 1VQMV 5C9AA 3FYEB 3ZPOA 3AKTA 2JG8B 1RM1C 4N53A 1EPWA 2YBKA 4FFGA 2BNOA 5B1AC 2H8PC 1IOAA 1GWMA 2FMDA 2QZ2A 4ARXA 3DC6A 5EV7A 2IH3C 4L9BA 3AEIA 1J3RA 4I55B 2LP7A 5L7OB 4FAHA 1C5IA 1X36A 4I9QA 1RUG3 3VHPA 4DV5O 2VQAA 1FAFA 4BK4A 3BYWA 4P02B 1US6A 4QE7A 2WLNA 4CRQA 5A33B 4P9GA 3N7LA 4XDLA 3VDCA 1QXPA 5L3FA 2ZE6A 1O4YA 1HXS3 4DEVA 3DXUA 2WWUA 2H0BA 2R062 4RO2A 4O4LA 5I8SA 4DFSA 4QX0A 3O0WA 4DV1O 3OUJA 3FHIB 2R0FA 1A8DA 3I3DA 2XVGA 2NQYA 1R3IC 5IK8A 5ERLA 1ZX5A 3APBA 1HRV2 5IYCO 2BQPA 1TGOA 2LFSA 3ES1A 3WDWA 2VNRA 4LQRA 2IBZH 1P49A 4DIQA 4O4IA 2FMYA 1KITA 1ZM1A 4RR3A 1S0DA 2DTYA 2HWB1 1UYXA 4XFIA 3M2MA 2JIJA 2ARBA 3IAPA 1PL4A 2ZPXA 3TBDA 4XJ9A 4DW0A 1W6MB 3A22A 3DF0A 3RYRA 4FPFA 4LKDA 5B1OA 1SC5B 3GXUA 1FD9A 4WF9V 3SH5A 3U37A 2W0FC 1N4CA 2RS51 3VDDB 2F4VO 4WBNB 5F5CA 2LFRA 1W8TA 1N3QA 2IUWA 4O4HB 3CHXA 3WXPA 3AG2B 1ULOA 3GBWA 1N8RW 4QDSA 4RD7A 5CFDB 1Q90D 4FZ0A 1Z2GA 1UYYA 4PELA 1W6NA 2VWJA 1A3KA 1LHNA 3W9AA 1TME1 4FVMA 3ZXFA 3MV01 3H9VA 1QQP3 3E83A 2W87A 2ARAA 1ULDA 2QDRA 5ACA1 4JAUA 2W39A 4AHYA 2RR11 1NQJA 1PK6B 3URFA 2QVSB 2ARCA 1YF2A 1JYIA 2YBPA 4Y5SA 2Y48A 1MVEA 4IEXA 3E5QA 2DU1A 3CZUA 3H0OA 1GM8A 1K34A 1T2XA 4NXMO 1MG1A 2OWOA 1QNMA 1VB2A 5AVPA 1JH5A 3LZZA 3ABMB 2ZMKA 1H6YA 1VJ2A 4J7JA 5L9RA 4LKEA 2WL1A 4QGLA 3VBSB 4I0XA 4JKLA 3BU7A 4ONUA 2RM21 4XJZA 5C3QA 3BTAA 4GZ9A 4QM8A 3NKGA 5FFOC 4GX1A 4Q6GA 4ZI7B 1AYM1 3OUSA 4IE5A 2FKXA 5EBWC 3JQWA 2B1IA 4Q4W3 4X1YA 5LA2A 4YGCA 5IWFA 1B09A 1R1ZA 2Y60A 5C4WB 3WCSA 3ZFGA 1R081 2ZT9B 4E4DX 5CB4A 1A8MA 3KKYA 3O1TA 1I94B 3VBUC 1QBZA 4J10A 2PYTA 4LIUA 2Q0OC 1CAVB 4EFBA 2ENRA 1K5MC 1H2SB 1G9AA 5HBAA 3OR7C 1POV1 1RUH2 4AVSA 4ZONA 4CDXA 2WZR1 1OH3A 4COUA 5FY1A 4DV6O 1BZWA 2AYHA 5FO8B 2MNGA 4FK5C 2ZX1A 1AYN3 4Y5Z0 2RDNA 2MHFA 4IE4A 1QVGU 3N9NA 2YFZA 1QCEA 3FLPA 1XOUA 3EO6A 1WA8A 3FYIB 2PLV1 1PNFA 1H8VA 2RS31 3ATGA 4G2KA 3AK1A 5GZGA 2JDAA 5LBFA 1AF9A 4R8CA 2HWF2 4K8FA 3MW2A 1A78A 3FUQA 5LK7B 2VR4A 3A4UA 2H94A 4KI5M 3UGGA 1GP4A 4Q4X2 1HNZO 1K3EA 2D43A 3NV1A 1MA1A 1AR71 1RUC2 1W9TA 4GWIA 1J1LA 1XU1A 1JFFB 4A45A 5JMCA 2UU8A 2QKAA 3AP9A 1VQ7V 5EBLC 4XF1A 4GUNA 1FOD1 4MGIE 3GF6A 1IZ3A 5CA6A 1OA2A 3RMYA 1GICA 3TK1A 4ZKTB 2UWAA 3CEWA 1SFYA 2VW2A 1YITV 4YG6A 1OPMA 5HI0A 3U0ZA 4UB6Z 3MHZA 1X82A 1UU5A 2WN3A 5EZWA 2VMGA 2H6CA 4FPLA 1M90W 4LF9O 2WJSA 1SBDA 5A7QA 3OPTA 1GM9A 4KHPB 1TVGA 4CU7A 3VD7A 1ENSA 1CZTA 5KUKA 1WLEA 3HKDA 1W0OA 5KXCA 2Z5UA 4TTGA 1VAKA 3H3LA 3I59B 2F6BA 2ZE8A 1Z0HA 1KJRA 2XLAA 1SQFA 4LLFA 1FXKB 4E8CA 4FQZA 1GZWA 1QY4A 5F5IA 3K48A 3S57A 2HKOA 2OW4A 2WABA 1O91A 4XMIA 4MGQA 5FUIA 2PZSA 2HEYF 4YJ3B 1VALA 3ZFFB 5B2GB 4AQ2A 1TUBB 3IFXA 5F2VO 3CJHB 2OQ6A 1OHHG 3M8LA 1J59A 2B1GA 1BK1A 1CAXA 3H8OA 5C3OA 1KBHA 2B9UA 5A3NA 1UQXA 3HNMA 5IVEA 1NH2B 2HFEC 5BNQA 1Z7S1 1KS4A 1OQ1A 2Q8OA 5IYDO 1MS1A 3RZJA 5IY5B 4RFT0 3H8XA 3IPVB 3WB2A 1RUE2 3OGVA 1IS6A 3MO4A 2J42A 2E32A 3GALA 4PLNA 1K9MW 3CRQA 2UUBB 3RYFA 5E79Z 5FZMA 1GV9A 4JZGA 2VQ0A 3ETPA 2P5OA 3FX7A 4RHV2 2LW8A 2VQEB 5I0DA 4LF4O 3ZMNA 3BI3A 4Q26A 2K1EA 4QX8A 1D4M2 1QJU3 3BRCA 1GK9A 4GIQA 2XQXA 1W8WA 2J1VA 2JRIA 1QR8A 5JH7B 2XOKG 2RDRA 2FCUA 4IXLA 1FNZA 1IPJA 2HWE1 4BR6A 3ACHA 5F5QA 4GT1A 2QR4A 2IVJA 1L0LH 3CMGA 3E35A 5IJ9A 2OUHA 2WLIB 1V55B 2IU0A 3LB9A 2VPVA 3CRAA 4EV0A 1AR1B 1I3HA 1QU7A 4URAA 3RVZA 2MEV1 3CF6E 4O4JA 2H3OA 4P9YA 4Y20A 2OCCB 4IGGA 1W6OA 2Y4UA 3EMRA 3L73H 4M0HA 1RUNA 3USUA 1KUQA 1H1AA 2PHTA 5FZCA 3SNMA 3V56A 1W2BU 1B6QA 4FPPA 4I4TA 1QXJA 4TQDA 3H50A 2RDCA 4YHHO 4XHXA 3JATB 4O61A 3NNLA 2JVDA 2GNBA 4KWUA 5LP6B 1WB7A 2WS93 4LFCO 3ZYHA 2WR9A 5BZBA 2N04A 4Q4Y1 2DYRC 1QJX3 2UURA 4Y4RA 1PM7A 2VECA 1QLEB 1YJKA 1G7YA 5FZ6A 1IKQA 5JOZA 5FO7B 4AWDA 5LGUA 4N43B 4IGOA 1XL6A 2PHLA 3VBUA 3ZMTA 2EJRA 1MZEA 2P6JA 4LBNA 3WP6A 1C8NA 2ZR3A 3MF9A 4ZHQA 1GQGA 4Q1PA 5SV5A 2WNUB 4KWLA 1K5MA 1TUEB 2X5IB 1FPOA 3ZXAC 5BNPB 2CTRA 3VBSC 4FTEA 2XAGA 5JSRA 4BAYA 1PNGA 5LRSA 3AG3B 1MZFA 2UXNA 4X66B 4ZPIA 3ZMOA 1RUF2 4WM8B 3N9OA 4CPBD 2JXAA 2KQXA 3I97A 4ZY9A 4GALA 4PA4A 2GU9A 1WCQA 3LD8A 4RA0A 3SJCC 4NIHA 1E5HA 2VCCA 4LC1A 3MFCA 2WLJA 1IBMO 4BWAA 2ZOEB 1F4AA 1FJGB 5DDJ1 1VBD2 2JECA 1C57A 3JSNA 3OAAG 5KC5A 1QDCA 4AEMA 4B08A 4MHRA 2EJ7A 3QH6A 1YDXA 2YUAA 2J1AA 2EXIA 2Z4FA 1W2NA 1O8SA 5FMOS 1VARA 1ENRA 1UY4A 4JHTA 1R6KA 5B3SB 4PBPA 2NP0A 3BUCA 4MW3A 3I2KA 2R073 5JSPA 4CH3A 1VR3A 1CP9A 1PGW1 3J8F3 3DXRB 4AFBA 2V4DA 4XBNA 3GBGA 1PGL2 2YIAA 2VTXJ 2R9IA 3DGTA 2AH2A 5LCWL 4KNCA 2J7MA 5BUVA 5FYZA 2VBBA 3GM8A 1GP6A 4QDQA 3B02A 2HVKC 4FLVA 3B4SA 4O2AA 4OX9B 2VW1A 2DTWA 3RYPA 2UUCB 3AKSA 4MH0E 1DF0A 3OBTA 1I9RA 1U96A 3WQ7A 1YNAA 2VXJA 3ZMZA 4HL0A 1Y67A 2R041 4HN0A 2R063 3KGZA 1SLAA 4OPAA 2BOBC 5H5NA 4JTOA 3WB0A 4CXXA 3MLKA 1YFXA 3JBG2 3CL1A 2QE7G 4ISRA 3QH7A 4I55A 1F4HA 5D8AC 2AHYA 2Q7EA 1DG6A 3I54A 4CU9A 2W9XA 2ZKLA 3BAAA 2EICA 1HB2A 3NV4A 1HLCA 2P1BA 5FYMA 4F6EA 5H9RA 2VUJA 2XB6C 1K97A 4FFBB 3POGA 1FXKC 4XCAA 4J80A 1XNQO 3W58A 1H1IA 4AFAA 4MADA 3WDVA 4BJ0A 1W0PA 3MICA 4HYOA 4QXCA 4BQ3A 4B3SB 4QD2A 4JGZC 3BY6A 2W6JG 5FAXA 3HPLC 2P4KA 2LW1A 4XETA 1N1TA 3OY8A 4UFZA 4IV3B 2ZR2A 5FY7A 3EVKA 4LF5B 4CP9A 1SQVH 1COV1 3TYJA 1DGWX 4LHNA 3OD0A 5FXXA 1R1A2 2OIGA 1NT2B 5AC92 1H8HG 1UPIA 1KC8W 1JOYA 1MS4A 4UW6A 1F15A 3CCEV 3VZKA 2WAOA 4HLTA 1VF7A 1C4RA 5EYYA 4L8QA 3JXSA 5C5UA 4DR2O 3Q9OA 3NJZA 4CH5A 1K92A 1ZWIC 1YEWA 5K0UC 4I50B 4FOQA 1Q3EA 4OLLA 5FYHA 4G28B 1MOFA 3PIJA 4PQ9A 1PGSA 4WFGA 1WP8A 1N33O 2FCTA 1LB2A 1G9BA 4CDWB 3C7OA 1OVSA 4WM7C 4WBNA 5AG2A 3NNFA 2BGCA 1Y9GA 5CKQA 4O4HA 3T0AA 4NHXA 5FZLA 3EFFK 4PHZA 4TXWA 4XE9A 3LWCA 3H1WA 5FP3A 5AFBA 2IC1A 1XOYA 1OUSA 5DQ0A 4FM1A 4JI5B 4YLZA 4S2GA 2YEVB 1I5ZA 4Q4V2 4ES9A 2ZS6B 4D69A 4AEDB 5ANQA 2J1TA 3AZXA 5TSWA 4NIAA 1B06A 2OCCC 2E53A 4PLMA 2BP6A 2VOTA 1AR93 4JDOA 5HCBA 1O9HA 1N33B 5GLVA 3ZKUA 3A0NA 4AF9A 4DRXB 4RUFA 2ET7A 1H1MA 2TBVA 4E2SA 3KSCA 2A7WA 5C8CB 4HFSA 1AJNA 1N34B 4J1XA 4XFFA 2Q1ZB 3AK0A 1MEC3 4CDQB 3CX5F 3P30A 1SRYA 5LP6C 2JDZA 4NYKA 2WIIB 3Q4HB 3VN4A 2VD7A 1IKPA 2XBO1 4HK9A 4B3MO 2VCAA 2GTSA 1QLEC 3I2JA 3JCIA 2XGXA 1WMXA 4FPHA 4N43C 3B8NA 1I1EA 2UUAO 3N4MA 4FJCC 2WNUC 1BQ0A 2EA7A 3AG4B 2WO3A 4XF3A 4TWTA 1X8EA 2YU2A 1W0NA 4CTEA 3CSXA 5BNPC 2PHXA 2AC1A 1G86A 2EIMB 4IV1A 1WCKA 3ZOIA 5LY1A 3LE0A 4JTAB 4YZ2A 3SH4A 2WKKA 3NV3A 4WM8C 3CCQV 3WNXA 5L3CA 5J2UB 3H1MA 5A6ZA 4XYXA 5E6HA 4K7JA 2F95B 2R9RB 4QHBA 4GXLA 3E5XA 4B7KA 5EHDA 2LS6A 4ISQA 1HN0A 1AROP 4LOSA 1KECA 5LGNA 1REDA 4L99A 3U11A 4MGSA 3JD4A 3JARA 1LHVA 4J9ZB 3UKMA 1JJ2U 5CYYA 4R4ZA 4JDMA 2VMEA 1QOTA 4H55A 1BYHA 3WG4A 3A7QA 3E6CC 2W94A 4JTNA 2YV8A 2ZGQA 1IPSA 2R6QA 3UT5B 1V54C 5FPXA 3SC7X 5B3SC 1G9CA 1JVMA 3T0BA 2ORZA 2C26A 5L3BA 2BYVE 4QPIC 5T5LA 1XBLA 1VBB3 4XZUG 1YHFA 4OUEA 1CONA 1ZZ9A 2YGMA 4IEVA 4K9SA 1BMV1 1O3TA 3N3HA 3B40A 1VQOV 3T1LA 2TEPA 3JASB 2B5HA 1GNYA 5D8AA 2QQJA 3R65A 4O9GA 4PBOA 2PI5A 4GMP1 1PVC3 5IAXA 2A6YA 3J7AU 1WNSA 4OHWA 1XNAA 3ACIA 1DLLA 1F23A 1IS5A 1VBC3 4JASA 1VB4A 1EFRG 3IJ4A 1KU9A 5LA6A 2W91A 4MW8A 2LALA 4LR3A 1S5JA 3JALA 3WR0A 4LE4A 1GOGA 3O1RA 5A32B 1C1LA 1JZ2A 1FXKA 3K3WA 2RJKA 3MIBA 5ITZB 3LIGA 4W4ZA 2PAKA 2KXLA 1KQRA 2XAFA 4JGZA 5FKBA 1BEV3 1AI4A 3CLPA 1W6PA 4WFEA 3LSEA 1RC6A 1C8M1 2BOIA 3K5MA 4Y5TA 3ZXGA 1OVPA 4E4SA 1FNYA 3RZMA 5FYIA 2ZAHA 4P9WA 4UVAA 4A44A 4BIUA 3NAPB 4UV9A 4P9PA 4QGMA 2WLLA 2XL7A 2ERFA 1VP6A 1AL21 5GKAC 1FMD3 5GLZA 5FDBA 2LW7A 3MDSA 4NJ4A 5FPZA 2BTQB 4IDZA 4RGKA 1HQLA 2QA4V 4FQ4A 5K0UA 5CU1A 2DMXA 3N9QA 4Y1XA 2E74B 2D6NA 3HEIA 4FO9A 3B3QE 1S3JA 3LDEA 2R16A 4OXSA 4R9BA 1XMQB 1CPYA 4WBBA 4M4RA 3QBQA 4WM7A 2HBTA 1PIV1 3HQUA 3MGUA 3IDBB 3AXEA 3K06A 1AL0G 1OMIA 4HKWA 4L87A 1JCHA 2XJTA 1BBT2 2PUSA 3OTFA 1URFA 1RSOA 2C2AA 1LCLA 3AG1B 1YFUA 2JDHA 4FI9A 1JZ4A 1Q5OA 3WNPA 4LLOA 1Q8PA 3WZ1A 1SLBA 1GN4A 2F43G 3BPZA 4SLIA 3NQHA 4MVSA 3PJYA 2N7GA 4FLYA 3AKQA 4W50A 1QMJA 2DVBA 5K8SA 2ZE7A 5FZDA 4RL7A 4MLOA 4XF9A 5DAQA 1WLDA 4CP1A 1J84A 1TNRA 1RVF3 1VBE3 3GJBA 1XNBA 1EY2A 1OA4A 4CBCA 1ZNPA 1KEXA 4DR3B 4XMAA 4AR2A 5FR3A 3VDAA 1TME2 3UT0A 4KBZA 4XAAA 3JAMN 4D8MA 1XNRO 4NN0A 4Y1YA 3I2IA 4FPJA 3FLRA 4E2LA 1Q8VA 4UUJC 2R9AA 5LP6A 4XDOA 4LF6O 5C5TA 4P5YA 3AX4A 4LCUC 2D3RA 1ZL8B 1B04A 1GZTA 1AJPA 2VOWA 4AEDC 5FPVA 3IBMA 2AGAA 1W0JG 2RJ2A 2Y6JA 1L7LA 4LBJA 3CKHA 2PELA 4BW5A 4PIXA 2RJLA 4AXOA 2GUZA 5J96B 5EYPA 2RMU3 3JB4C 5JVDB 1HB1A 2E3CA 4QPKA 4JYAB 1ACCA 2WWSA 1AXKA 2WNUA 5F5AA 4KXRA 2VG9A 2HJDA 2RM22 1S2BA 4YRDA 5CFCA 5C8CC 4XDJA 4KH9A 5BNPA 1AYM2 5FTTC 5LBQA 3PN1A 5C33A 2IFRA 5FXWA 4DR1O 1LESA 5LYJA 3QNEA 1RTVA 3B93A 2GMEA 5I0TA 1HR0B 4RQEA 3K79A 3HQRA 1DQ1A 4URTA 1PL0A 4KQ7A 1LOGA 2R49A 4LF8B 3OPZA 1W03A 1WLTA 2ATFA 5HCHA 2WAMA 2KA3A 1SQXH 4LNUB 5FMOL 4Z07A 3VKNA 5ABJA 3T1CA 4DV0B 3CNAA 4HG6B 4IESA 4KGQA 2C9AA 5IUQA 1D5AA 4IL7A 3KHCA 2IVIB 2RVAA 2Y8KA 5DABA 4F3JA 2WAAA 4BW9A 2Q7HA 5IYZA 4Y33A 4I7ZB 2ZAAA 3ROUA 3QO5A 5IATA 4NUBA 3WQ1A 3W7SA 1UY3A 4GKXA 1WP7A 1WN7A 2TUNA 5FLHA 3ASOB 2ZGTA 2OYQA 2YPDA 5FK7A 4QPIA 5FZ3A 4HONA 4AHWA 3ZRWA 2OIEA 4HPKB 2OCHA 5SV8A 4XC9A 2PGGA 1IURA 1Q8SA 3HBKA 3SXWA 3HWJA 1GMGA 5FYTA 1HRV1 3L9JT 2DUOA 4X65O 5F9TA 4HNAB 2XJUA 5A1AA 5IDJA 5EJ1B 3KV9A 5BXZA 1R6TA 4D6TH 3ETQA 5KHKA 2W47A 1HQWA 3M3OA 2XLFA 2KB1A 1FOD2 3HKBA 2ZX0A 2GSMB 5KHHA 5KMGA 4PIYA 1DGWA 4UF0B 3VKFC 3DEMA 1JPXA 3K75B 1U12A 3NR7A 3AM2A 1MS9A 2A6XA 3PJQA 4CUCA 2BPA2 5A2QN 1NAEA 2ATKC 3EJKA 1OJHA 4WCEV 2QM7A 4A4AA 2VQFB 1LENA 4BOWA 3FC0A 1XRUA 4LK6A 1NT0A 4AILC 3ZX6A 1HV0A 4FZ1A 4LFBO 5GZCA 3CJIB 5JZGB 2ZX2A 2CWMA 1F8VA 1IBKB 3ZYPA 1LKNA 5D2AA 4OUMA 4EZ4A 4FSJA 2ZEXA 5CA0A 3QCWA 3I49A 3NV2A 5H9CA 2CTVA 1U5ZA 5FOJB 1AP5A 1RJ8A 1TQ5A 2ZEWA 3D0JA 3D3IA 4NHLA 2ZHNA 3N9MA 4J25A 2W95A 3ZSJA 1PMJX 2R1BA 2WWJA 1SQBH 2GC0A 1EAH3 2XG3A 1QHDA 4Y1ZA 1O5LA 4LBKA 2Q8CA 4JRLA 3WDTA 1JHJA 1WBLA 3SYPA 1RHI1 3KQRA 4HVOA 3I2HA 1S0FA 1XE7A 1Z7S2 3GHNA 5LMNO 4RSUA 5H9PA 4QGNA 3VBHB 2R30A 1FKAO 2E33A 5KHIA 3NAPC 3CCMV 3POIA 1YQ5A 5JDBA 2HWD3 3E2EA 3O14A 3RI9A 2DBIA 1UOGA 4C0BA 4DRRA 1IQAA 1VIWB 4Q4V3 1HB3A 4CC6A 5I8YA 1IDSA 5IYBO 3WX5A 4YGDA 4MVOA 1YTFD 3AVSA 4YVWB 4OI0A 1XSRA 2DUPA 2ADPA 5A7NA 2VUAA 5A1FA 4TV8B 3FWEA 5EC1C 4A7KA 4CYDA 2WPDG 4J7ZA 2D3SA 2NNUA 3VZLA 2QJ1A 1YQ2A 3X2QB 1SA0A 4X20A 1JTZX 2B39A 4K1YA 2DJVA 2JE7A 1GSLA 4Y4YA 3RYCB 1ULPA 4UI9L 2ZMNA 1O5UA 3A2FA 5EJZB 5IAVA 5DG2A 4QQOA 1U5YA 4DV4O 3BVCA 4QQPA 4IGQA 2EVXA 1CZSA 2DWEC 4RN5A 1F9KA 1GO3F 1WGPA 4XDQA 4B3RO 2QEXV 2HLEA 1NCRB 1NBMG 1E57A 4IE7A 1MPXA 4NPMA 5D1IA 3CC4V 1V9U1 3KCCA 4X1IA 5ANNA 4CXWA 3G67A 3NNJA 2QUOA 4J9YB 2HWF1 2V5YA 5IHRA 4HN1A 3IAQA 4RAIA 5E1AC 2XJPA 4QDRA 3ZXDA 4Q4X1 5IK4A 2XAQA 2WFF3 4BXFA 1AR82 1X9TA 4NROA 1RUC1 4I30A 1J83A 4TZDA 4DK1A 1TMF1 3VL9A 3LDKA 5C8CA 4XUPA 3O9OA 1QJY3 2HR3A 4Q4Y2 3CWBH 5L19A 2EINB 4FLXA 3MEPA 4F4LA 1BE3H 3L71H 4B3RB 4YXWG 3NSTA 3K51A 2LO1A 1UZZA 4EROA 4QX5A 2WA4A 4ZU5A 3QD6A 5HV0A 4NAOA 4CUAA 2WLQA 1YVWA 4GX0A 3OGCC 1H6XA 5KX5A 2E9QA 3I8TA 4KUMA 2VO5A 1ZBA1 3J4UH 5E89A 5C9AB 5L3GA 3MHHC 5EJ3A 5FQ0A 2VVDA 1IQDC 1THZA 3UL2A 3OCPA 1S76D 1QGLA 2XLGA 2W3JA 3WUCA 5CKNA 3LEIA 5G04L 3AB0A 2ZD9A 2IZWA 5CISA 2TNFA 3MPBA 1I5PA 3CCJV 1ORQC 4C7UA 2ETNA 5J2UA 1Z78A 3U14A 5LBCA 1AR5A 4R9AA 2N05A 2G9ZA 1JN2P 3PUAA 2JICA 2WLHA 4AEKA 2FZ1A 1OFNA 5I8TA 2ZEYA 4E4ZA 1YJNV 5JOWA 2P3YA 2XKOA 2NMOA 1HNWB 2IXHA 1LJ7A 4CP2A 4HT1T 4O4LB 5F37A 2WNOA 5GONA 2AZ2A 3B09A 4DZGA 1RUE1 2QSAA 1PGW2 3UT5A 1QOSA 4CA9A 2BE3A 1TAEA 4AW7A 1YWKA 2HKXA 2A70A 1UU4A 1XU2A 4P14A 5CBGA 2CAVA 4OI4A 5FMBA 4KFMA 2BOCC 4B1LA 1Y4WA 4PF5A 5JPNB 2BJSA 4Z1MG 4PF1A 2YXSA 2WZPP 1J5EO 2FDHA 4HSLA 1HNXO 2B45X 3FX3A 1OURA 4CXYA 1VAMA 4XTMA 3I56V 1W04A 3RN4A 2Q8EA 1B35A 3ZS8C 1N1SA 1YI7A 1ULGA 4K1ZA 1JJOA 5FZ1A 1ODMA 1NLSA 2EIDA 1DGSA 1OCZC 2XWBB 3E86A 4K40A 5A7PA 2YXLA 4EN9B 1QEXA 1S0VA 5FZ0A 5HCAA 4X62B 1GTOA 1SQPH 5F39A 1UY0A 1UW8A 1RUI1 3GZAA 5JI9A 5FZFA 3VBFA 4DXSA 3SYCA 2D44A 1NE4A 5IVVA 2VVEA 4AK3A 2HWC1 4LBQA 2QQMA 3KCYA 2BVBA 1FPN1 4LK7A 3ME2A 1WW5A 4Q0QA 2B42B 5JLVA 2HWB3 2A7AA 1AILA 3QLQA 2W6IG 3MFAA 5JZGC 1UPSA 4IERA 4WFHA 3SLIA 4DO0A 1N0JA 4QIWF 3L2YA 1UYZA 4YM3A 1GP5A 3NAPA 4C1XA 3VGIA 1NU1H 2W68A 4PDVA 1EV12 1RUD1 4EQVA 5HXMA 4A42A 4CCMA 2QWQB 2RS53 4MXWB 2UY8A 3WQBA 3JCZA 1N32O 1AYN1 2WQZC 3ZN1A 1SZXA 4X8NA 4PV1B 1W59A 5C93A 4XFAA 2XONA 1Q8OA 3E5UA 5HPOA 3TOJA 2D6PA 3K0GA 4ZU4A 1OC1A 3BA9A 1BVP1 3VBHC 2E26A 5F7UA 4JI8O 3KHBA 4X1YB 3AYEA 4C1WA 5KXEA 5ACA3 4GKJB 2RR13 3ZFGB 4GULA 1OFSA 5CB4B 3LA7A 2CDOA 1RUF1 3AZWA 1LTEA 1C5HA 1QR9A 1LU2A 4BQ5A 4NIGA 2Q67A 3H1KH 4DPNA 4M0NA 2YROA 4I5SA 2W52A 4M3CA 2GP3A 5K9YA 4CDXB 3R0RA 5LWBA 1LOCA 2G9GA 4PA3A 3AK2A 1PZ8A 1VBD1 3FZ3A 4DQAA 4GJZA 1P7BA 4F83A 3G4SV 3UESA 2RM23 1SACA 3WVJA 4NXNO 3V0BA 2NLJC 1UZVA 1AYM3 2CU5A 1UCXA 4LOTA 2QCSB 1E1QG 1G9DA 3S6PA 4PI2A 1H8EG 1R083 3WV6A 1ROPA 4YFZA 2QFEA 3WW2A 1K73W 2XHNA 1V6KA 3FHQA 3PU3A 3EXUA 2A73B 1Q8IA 2AHZA 3THPA 4COYA 1L7QA 3VB9A 3N27A 4FP3A 2FZ2A 1UU6A 2WZR3 4JTDB 3E6BA 1ZREA 2F17A 2HBUA 4DV7O 3PLQA 4B3TB 5JVDA 3VQWA 1KMIZ 3TGUH 4L92A 2QQWA 2D3PA 5L3DA 4OGQB 1X4TA 2IM9A 1H9WA 1YCIA 2PLV3 2RS33 1LRHA 2WT2A 2Z69A 1YI9A 1HV1A 1SBFA 2UU9O 2DV9A 2VZ1A 1GZCA 2EINC 4XFCA 5FYBA 4GMP0 1L8DA 3WT3A 3JBG1 1YIJV 3SJBC 3ZEDA 3BODA 3TCUA 3BKZA 3SCGA 4Q8KA 4PT6A 3OJBA 5FUPA 2YC2A 3HKDB 3CXHF 2AGSA 4X9QA 1AR73 4LNUA 5FYUA 1NZCA 3PJSK 2XL9A 1CXZB 5B66Z 2CSGA 3ZXLA 3POSA 4XF0A 3ML0A 1GZWB 1CQ9A 2FDIA 2EIKC 2EZPA 1W90A 3BU0A 3WEZA 5BNNB 4YYOA 5EXOA 1D2QA 5JI7A 1FX5A 2HH9A 5FK8A 2PYLA 1I5XA 3O5SA 3C3VA 5T5JA 4CZZA 4DR7B 1ZZBA 2V09A 2Y69C 3RVYA 3IWZA 1O4TA 2LM3A 1CAXB 1TVKA 1W9WA 3RNSA 3TN92 1PNMA 3S3XA 1JA8A 2WNVA 3HT1A 2YYOA 2VW0A 5FWEA 2JGUA 3ZHQA 2XHBA 4IIJA 5C8WA 1FI2A 3VV1A 1IBLO 4L97A 2YBSA 4FFIA 1K45A 4LKSA 5JIUA 1JUHA 1UMIA 4EKWA 1R1A1 4CC5A 1KS5A 5AC91 2QQPA 2YI8A 2UXCO 4JKKA 2QNKA 1RMU1 1AR63 2A79B 3RYFB 1LU1A 4FLZA 1UAIA 4K0KO 1NE6A 1UFIA 4UF0A 4B8EA 1CIYA 1LHUA 2BWAA 1BK0A 1BMV2 4LF7B 2WDBA 4Z8BA 2ARXA 5J2TB 3POWA 1PO12 4PI0A 4B4PA 5JSOA 2R0HA 3NMBA 3H01A 3W59A 2JDPA 4E4HA 4QKFA 1NY72 1YTFB 3ACFA 5F3CA 4X1KB 3C2UA 2WUHA 1ASJ2 3WW4A 1H4HA 4FBFA 4H3WA 1OPOA 4MSVA 4N7IA 4N21A 1JR9A 4J1WA 4NTYA 4YW1A 2XMLA 4QB6A 1EBOA 1UXZA 4CEYB 4XOGA 4YSFA 1LEMA 4Y20B 2NYYA 1NH2D 1JZ8A 4K0KB 1W6OB 3IIIA 5CAZA 1ZA4A 4W6XA 1XNDA 1S5LZ 5IT6A 1SLIA 3USUB 3ABTA 3LDCA 1D0HA 2HYKA 4XUQA 3GVMA 1BQZA 4QKDA 3PUQA 2QGNA 2EULA 4I4TB 1R6NA 3TWIA 2YS8A 3CXCU 3W21A 1ODNA 1N1VA 5LZ6A 2HWE3 3DCQA 3OOXA 3GWOA 1H4GA 1UKRA 5K4LA 1HJGA 3KM5A 2GMPA 3VBHA 2O57A 1O8PA 4CCCA 1YXWA 3WNNA 4DUYO 1GYKA 2MEV3 4I09A 1D2SA 2CAUA 1AB3A 4S2HA 1JYCA 4C0HA 1VBA3 1M56B 2RDQA 3VBUB 3KVAA 5I0SA 2D3OW 3VZMA 2NN8A 1UOFA 1KB9F 4ZHQB 2JDUA 4KG8A 2CDPA 4BQWA 4W65A 4DR5B 1K5MB 1G8MA 1OD3A 2R071 1PIV2 2RS11 3OEEG 3UNPA 4QKBA 1ZVFA 2V5DA 4QXKA 2V7QG 1UOJA 2PHRA 2QBXA 4OULA 5LXTA 3AP5A 2VS0A 1AVBA 3OD4A 3RYCA 5DAWA 3POEA 4EZHA 4X6RB 4XQDA 3N2GB 3PTYA 4JZRA 4Q4Y3 5FPUA 4OVEA 1KP3A 2P2KA 2FDFA 3IGAC 2WO2A 3PUSA 4JI4B 3UO3A 2VMIA 2H0VA 1BJQA 2WZ8A 3RZZA 3ZSEA 4JI6B 4R7CA 4BPZA 4EFEA 4YVSB 2JDMA 1UJWB 3H9AA 1RXGA 3A8TA 5IFTA 3E1F1 3IC7A 1AP6A 2X0LA 1OD5A 3HBZA 1L3JA 2Q68A 2AUYA 2YICA 1X50A 5A3PA 2RV9A 2QM4A 3VUOA 3OBAA 3FHAA 3DSQA 1SQGA 1RGSA 5C71A 4YM0A 5LOVB 3K4AA 1YJ9V 2DWRA 3AMPA 4NVPA 4CUBA 4XDPA 2VL4A 4ASLA 1H2NA 2VBPA 3CQOA 4LJHA 1ND2C 3CCUV 5GLTA 2VH9A 3H7YA 1UF2C 4GB32 3JD72 5DDJ3 1SESA 4IQPA 4O2AB 2VJXA 3I3BA 3PVNA 3ZN0A 3F5WC 4Q5OA 4FXKB 2QQVA 3OFNG 1PVXA 3H7JA 2Z3YA 1BSMA 2F4PA 2R7EB 5BY1A 2XASA 4D7TA 4LORA 2VZSA 4CDUB 5A3LA 1JYNA 1E1RG 2FTKA 1ZZ6A 2VZPA 1GWLA 4J41A 3I55V 5GTIZ 1TA8A 1O9GA 2OS2A 3JD2A 5F6KA 1GN6A 1UKGA 3J7MA 3Q8BA 5FMDA 1BKZA 5CBHA 1HIXA 3M8AA 3U4XA 4DUZB 1W3XA 5FY5A 1R092 1K5JA 4R8HA 2YMZA 3HB3B 2PFWA 1P84F 4U3JA 3JD0A 2ZE5A 2ZGRA 4QKNA 1UIJA 3RDIA 2FCVA 2OUJA 1PM9A 4DV3B 4GD4A 2GAUA 2GTAA 1FAYA 2OYZA 2JD4A 4XHBA 1RUJ1 1SG3A 1BQPA 1LUWA 2J1SA 3E8HA 4ZBMA 4LXLA 3LFMA 2R043 2VWKA 2IFWA 5JJEB 2CHHA 3LOBA 1CAWA 4D6SA 5BNNC 1YJWV 1XQNA 2OKXA 1OCCC 2GNDA 1SETA 1YRZA 3OY8B 4QNHB 2ZINA 1HQNA 3DYPA 3BCCH 2XAHA 5F2SA 5JQGB 4CP9B 5B1BB 2JKBA 4MOAA 1N0NA 3PDQA 2A6VA 1DYOA 2DQ0A 4J7KA 1YIPA 1G6NA 3FJSA 3L74H 2CGPA 3M4FA 3LCPA 2FDKA 3G71V 2CGNA 2O14A 1XBFA 1WBFA 3ON7A 2DCYA 4AE2A 4PLOA 3ZIAG 4DR4B 3T1HB 5EIBC 4JI7B 3IC9A 2VMFA 4PA9A 1SLCA 2OQ7A 1BBT1 2HP8A 1SCSA 3KVBA 2UYAA 1LAJA 2DDUA 1H30A 3VHOA 4OUSA 3JAWA 4YJ2A 3HNYM 3AP6A 2VZTA 1QHTA 1DU3D 1COV3 1Y74A 4P5HA 2P4EA 4NHYA 4LPLA 1YFWA 1NTZH 3SEPA 3S3WA 5L36A 1FXHA 2VZUA 3BTZA 1RFYA 3S5QA 5FIXA 4DW1A 5BY5A 1JW6A 1JOBA 4UCOA 3SJQC 4FPOB 4MO3M 5TISZ 5ISLA 2OTJV 1NJIW 3A0HZ 2VUDA 4P30A 4YGEA 2E5LB 5KUMA 1RL3A 5FNVA 4QPJA 2DYRB 4CEYC 2R70A 1NZIA 3KMHA 3WG3A 1S77D 2KR2A 5B4NA 3CJXA 3VD9A 1Y4MA 2CH7A 1I94O 5JCTA 1HKDA 2JDKA 2ZIOA 1PMHX 3DUIA 2WSVA 3WF0A 4QX2A 4C8DA 1RHI2 4MXWA 3UV9A 4B29A 5H9SA 4QX3A 2QWRB 2PN5A 5I93A 1W2TA 1KDKA 1Y66A 2RG4A 4NRQA 3POBA 3VLBB 2X09A 2Y0OA 5LA9A 2JEMA 4K8RB 3ETDA 2ZDIC 4BH9A 1D2DA 4HBNA 1XE0A 2GALA 2GMMA 4TOIA 1XILA 2J1RA 3BOPA 1F2NA 3RJRA 4FMTA 3IT8A 4ASKA 3BEHA 2P3IA 2I07B 2DN9A 1M56C 3ZSMA 2Q7GA 3T2TA 1AUYA 1PHMA 1DQ6A 1OCRC 4FFHA 2DWDC 5LMUB 5JJNB 5JVVA 1CR7A 4LH6A 3IMNA 4PIZA 4BM8A 1H8TC 1ST8A 2ODMA 5CEHA 2Z79A 2DF7A 2ZJCA 2WSUA 4INDA 3WU2Z 3GCWA 1VE0A 5FBJA 4LUKA 4XQ4A 1JMKC 4IV1B 2Q0AA 5GM0A 1IX9A 3VBOB 4A7YA 3T0DA 1ENVA 2XBO3 4NKGB 3ZSKA 4HVQA 1E5IA 5JR2A 3H1HH 4D7YA 1ND2A 2D6OX 3T1YO 2XVKA 1VBC1 3WF2A 3APQA 2B5UA 4JTCB 3OMIB 3WUDA 4LWSA 4E2QA 4FM2A 1QQCA 2IXJA 4IW3A 3B00A 2K0GA 4TUYA 1V9U2 4KU7A 2GV9A 4MVRA 4KHPO 4P08A 4YIPA 4YVSC 3AK3A 3T2QA 3JARB 2ADDA 2OX0A 3RMXA 1DIWA 3SPJA 4CCLA 4JAVA 2RNBA 1VAVA 1C3HA 2Z2SB 1XMOB 4AAXA 3ZXKA 1H2GA 2IXCA 3KGLA 1JZ6A 2XQRA 2AEYA 2Y26A 1RUG2 3DKWA 3BABA 1TMF2 5FYVA 5CB7A 1H9PA 2BDRA 5IK7A 4M3CF 3SCHA 4XUOA 4WVZA 2V4AA 2ZBJA 3ENRA 4GH4B 1JUIA 4AVBA 4XACA 3T1YB 1HXS2 4NTWA 1HDKA 5D8AB 3FB6C 1SDWA 3T4DA 2BGPA 3LA3A 4NRMA 3B8MA 2ZM6B 4XABA 4GKKB 3AMMA 3AC0A 3TJTA 1KQSU 4HETA 4LT5A 2P34A 1DCSA 2ZCEA 1WAZA 1BXHA 1ZBA2 5LA6B 3LPFA 2R32A 2GC2A 5CG9A 3JALB 2GNMA 1W9SA 4CDUC 1DZQA 2ZA9A 4HOOA 1V0AA 2A6ZA 1IG0A 4BQXA 4R9CA 3MIHA 3ZM8A 4JGYC 1GBGA 1AX2A 2UUBO 1HN1A 5DZEA 4JGZB 3LEMA 1GOHA 5BNNA 3AG7A 1W6PB 1EUUA 1S0BA 1ONAA 2BNMA 2VQEO 3TEZA 3OMAB 4LNVA 2D97A 1V6MA 3P32A 3UYJA 1QWRA 4GMP3 3MPPG 4FOVA 4Q2FA 4BHPA 1ZRRA 4XEZA 3TXQA 3JCUZ 2ZABA 1QDOA 1UX6A 2ZGKA 1R1BA 5GTHZ 1CN1A 5FREA 2WLLB 3INAA 3KV6A 4UYBA 3DKQA 1VIBA 4YARA 4Y22A 4AVVA 3MI8A 2QQNA 4FPKA 1WCDJ 1YZBA 2E76B 2F1MA 4DXRA 3VD3A 1Y7BA 3OR6C 1REFA 1UY2A 1DF4A 5K0UB 1C8M3 1VBE1 3ILFA 1NLQA 4YPJA 2HJFC 2A6WA 2VBDA 1CGPA 2RQ6A 3C8XA 3UK9A 5B1BC 1QQP2 3SPGA 4WM7B 1KKDA 1O6UA 3ZKYA 2G38A 2R72A 3LDBA 5J2TA 1GWKA 1Q81W 4P9XA 2DOSA 4DRVA 2NZ9A 2L9LA 4LBQD 1Q6HA 3WDUA 2GBOA 4BA6A 1AL23 3AMNA 4AOCA 1PO21 1KRIA 5K1XA 1RSOB 1BCCH 4ORFA 4X1KA 2L35A 4QPYA 3CMEV 3ILRA 1JZ3A 1A34A 4RQFA 5DXDA 4R9DA 1AZDA 2RMU1 4QPWA 4YZ3A 1RUI2 3EHBB 4JF3A 2EAAA 4CEYA 3LDRA 3J81N 2Y6HA 3FB5C 3ZYGA 2HWC2 3HAGA 4GZRB 4QGPA 5APAA 5HXVA 2CTPA 1FPN2 1Y3TA 2Z42A 3AZVA 5KC6A 4MVMA 4Q4W2 1PIV3 2WA3A 2D5HA 5C70A 4ZOLB 3P5BA 3ZPYA 4H7MA 5I0UA 5EP9A 1VF5B 4AG4A 2QTWB 3H42B 4YZ5A 1HW7A 3HVDA 3RZHA 1AR81 2A3WA 4EE2A 4X66O 4XF4A 3OTOO 2V72A 5FPLA 1SMVA 2EXHA 1RUD2 5J09A 2ZDIA 2JB4A 3RYIA 3M3IA 4CP0A 4DR6B 3BTYA 4AGVA 1AYN2 4LHKA 3ASNB 4BE3A 4JV5B 2GUZB 1DQ4A 2YGLA 1FJGO 4EEQA 5EYPB 3ECQA 3ZSLA 2ZXWC 3MZHA 1H8TA 2A3XA 3WD5A 4AQTA 2HHHB 3LOIA 3V65A 5CFCB 5BPXA 4R52A 2D6KA 5BYNA 4XCBA 2FDGA 3K9SA 5LYJB 3KT4A 1SS3A 2BCCH 2WWWA 4JDNA 5FOBB 3OTOB 4HSJA 3N2GA 3GDBA 4C91A 4JI3B 3IAYA 2LJ2A 2X29A 1KFXL 4AFMA 5FZHA 3D82A 5ABJB 2BGOA 1G4YB 4Q0UA 4YZ4A 1LGBA 4OX9O 2ZNIA 5IJRA 4YVSA 1M57C 3U75A 2UUCO 4IHJA 2KKWA 5IYZB 5FMCA 4FFFA 4UB8Z 1DFQA 1FFTB 5CBLA 1S0CA 2XXZA 5KA6A 4MG2A 3O7OA 4IV1C 4WVWA 4AFCA 4CEWC 1UX7A 1V54B 2G9FA 1JMUB 3VBOC 5LOVA 4WV8A 1O3SA 4B3NA 3CB2A 4RQPC 5EK0A 3T2MA 4Q20A 1APNA 3U10A 4QPIB 2A0LA 4XURA 2J1EA 3ZRWB 5FLIA 5F1RA 2Z0AA 1XYNA 1Q82W 1IS3A 1N36B 1IXBA 2QKCA 1CIWA 2BVVA 5EYXA 4XZPA 3T09A 1VQ8V 4I3PA 1UWWA 2AEZA 4O65A 4K21A 4BK5A 4H14A 3ZYRA 3WY6A 3HPNA 2JIGA 3HKBB 2VVFA 4DUVA 3E97A 5KMGB 4UVBA 4CDUA 3APOA 4QPGC 2XNDG 3N7JA 2HYXA 3M7MX 1CVNA 4MVQA 5LHHA 3ZN5A 5A6QA 4LHSA 4TSVA 1SLTA 2NM1A 2HVJC 4B3SO 4MTFA 4LFAB 2UWCA 4JGYA 1HW5A 5IWAB 4GH4C 1UD1A 4UXNA 4JI1B 4G3YC 3OBRA 1HRV3 1CEZA 4LF5O 3RYHA 4X64B 1OKQA 3WCRA 5LA0A 4H0LB 4DY5A 2QTOA 1V6LA 4AHZA 3RRDA 3K5NA 5KA5A 1QJFA 2XJSA 1K4DC 3OUFA 2Q1FA 5F2WA 4JYCA 3SJAC 4PJ0Z 5CA0B 1W05A 4NMIA 1GNZA 1QJU2 2O0OA 1RUOA 5A3TA 4UCTA 3MUZ1 3UCSC 2EILB 3L72H 3K3NA 1WA6X 4DV2B 5FZAA 2DVFA 1UMZA 1EV11 1DLBA 3STZC 2GZWA 1LNQA 1H2LA 2AENA 3S30A 4AZZA 3E6DA 2BTOA 4FXGB 4LHLA 3MAQA 5JQGA 2XWJB 3KD4A 5GZDA 1F35A 5FP4A 1S0IA 3O1OA 2BSKA 3R4UA 3DL3A 3M3CA 1OLME 3B2EE 4AI0A 1RMU2 1Z5VA 2XKPA 1ALYA 4COVA 2WYSA 4JI5O 1YUDA 1QNWA 3OEAA 1RYYA 3TRSB 3FMGA 3LAGA 3X29B 1G6UA 3JAKA 4AEJA 4AQYO 2RHPA 3OGRA 3RZGA 2BNNA 1UYPA 4J11A 1ZZ8A 1S0JA 2JS3A 1Q7YW 4FPYA 1FXVA 4M4PA 2QQIA 3D6EA 1JU3A 2KM2A 2ITCC 1SA0B 4X20B 2WS92 1QJY1 1QJX2 2CE4A 1MQTC 3DPRB 1AX1A 4NHMA 1XYPA 2BBVA 2ZCWA 2Y4TA 3ELNA 1N34O 2WSSG 4XTPA 2VMCA 5BNOC 3UM7A 1S55A 4UXAA 3B7MA 4B4QA 3SKJE 5A9GA 3NO8A 3DN7A 5FV3A 3VHNA 2BW8A 1UZYA 2D93A 3SGIA 1QF3A 5BV6A 5JPMB 4AQYB 2VNOA 3USSA 4A3XA 4Y1VA 4X1IB 1VLNA 2FYUH 2UXDB 4P9OA 4W6YA 1XE8A 4MHUA 1DZRA 3H8RA 4BMEA 5C3PA 5FZOA 2WN2A 1RUH3 4DO2A 3KQ4B 3AYCA 4MX3A 4A7ZA 1IPKA 4FCAA 3NJXA 3E89A 1QH6A 1J3PA 4RS5C 2OT7A 2OZJA 2CY6A 1E5SA 4I9WA 2UXBB 2GDSA 4DB5A 3WDYA 4QAWA 3AZYA 1JQ0A 2DE0X 2XH6A 3CCRV 2IU3A 2ZHLA 4LA2A 4NE9A 3U78A 2VRZA 3ZMVA 2C24A 3I5DA 1UO9A 1NLRA 1BCXA 2GP5A 1OCOB 1NXD1 2BRTA 4DMIA 3ABLC 5FRAA 5FBZA 1V9U3 1CAUA 3ASNC 4DUXA 1S2EA 5KX5B 1T6BX 3VHRA 1RB8G 2HWF3 1B3QA 3BFRA 3CRCA 3R6SA 2UYBA 4J6GA 2X7RB 2XUMA 2R072 4Q4X3 2RS12 3KT7A 3J8F2 2YDEA 5FQ0B 4OQ8A 3OYWB 3FFQA 1RUC3 3DXTA 4IETA 3IM0A 1DLCA 1REEA 1S2KA 5CFCC 4UCUA 1TMF3 1UPGA 1IVSA 4IYIA 1V6IA 2VE1A 5LRRA 1UOBA 4JI2B 3SHRA 2RCVA 4JZ2A 4CEWA 4GYCB 2A9HA 3ZMSA 3FE5A 3VBOA 4BLIA 2PF4E 4RQPA 5IT9N 3O1VA 2Q5TA 4BB3A 3OGJA 5F3EA 4V1PA 4OHZA 4A2UA 4XXAA 3A0RA 4WFAV 1OOPB 3VL8A 5ABJC 1LGCA 1KKCA 2VUCA 1W8FA 1VRH1 1O4ZA 1ZBA3 3WG2A 3TN91 2C1FA 4MSWC 1JYTA 2VNGA 2WO1A 2XUEA 1R64A 3KS7A 1W6QA 3I7DA 1DZTA 2Y6FA 3N9LA 4DV5B 2J1UA 2KG7A 5GONB 5HFMA 2BUKA 1YQ8A 5A1LA 3OUIA 4QPGA 1AI7A 1H2MA 2MW2B 2QDNA 3I3EA 4IEWA 3AP4A 1LECA 4S2DA 5LEKA 1URXA 4KMQA 4GH4A 1V9PA 1FT9A 3WNMA 5CKMA 2VZVA 2EIEA 2A1XA 4LMFA 3ZRSA 1KD1W 3IIAA 3RYKA 1PO11 4MT8A 4DV1B 2BZDA 1Q56A 4TLFA 3WG7C 2UWBA 1B35B 4A3ZA 4H37A 4C90A 2AZ0A 2W1UA 2JIZG 3ZCCA 1NY71 1UZ0A 4TV9B 3I3MA 1OXCA 2HEVF 1ASJ1 1OA3A 1RUE3 2M6YA 3WLUA 4GLXA 3FB7C 1RIRA 4UFKA 3A0KA 1OUXA 4OZXA 3MLLA 2QQLA 3ZYBA 1VQLV 4GX5A 3VBFB 4PDLA 4XBLA 1EP0A 5G05L 5H9QA 4RHV3 5C8YB 4IEOA 4LBQB 2EF6A 4D94A 1ENXA 2PQSA 3ZR5A 3CMAV 1D4M3 2JS5A 4FVVA 5JXIA 2IJJA 1NCQA 4IEUA 4Z92B 1XMQO 1G9FA 1SF9A 1QNYA 2ID4A 1XXNA 2XJVA 3P3NA 1RUJ2 1EN4A 3AFKA 5FXZA 3JUUA 1PNLA 3AYDA 2O8QA 3PMEA 1TZOA 2LGQA 4UCSA 2F4VB 4BIZA 2YUEA 4MGZE 4BQYA 3T2PA 4ZIBA 1K4CC 5EIYB 3JYCA 2ZGNA 3OE7G 1JZ7A 4JRAA 2OPKA 1RUI3 1L7RA 4IEPA 2EILC 3WFVA 2EAKA 3WNLA 1SHWB 3M70A 2AACA 4OYUA 1KFUL 2HWC3 5FY4A 3FAVB 1FPN3 1IG3A 2QKSA 5IJ0A 2W1SA 2LQTA 2D40A 4XXPA 3POFA 4OHXA 3HR0A 5HV4A 2P37A 4OI1A 2JEXA 5BMVB 3SR2C 4M3CE 1MQTA 3CBNA 5FY0A 4DR3O 1FFXB 2NMNA 3G6EV 1AR92 3CRMA 2VTFA 5BNOA 4UVCA 3S5AA 1RUD3 3UKVA 1XC6A 4NXMB 4PDRA 4IUGA 4CVUA 2EIJC 1GANA 2CYFA 3C7FA 5FZ9A 2QJVA 4FOYA 4GJYA 3POYA 1NR1A 4M3CB 1MEC2 3E22A 4DOUA 3QG5A 1POV0 4BIFA 5KBFA 4YG0A 2HEPA 3AMQA 4H13B 2GH2A 1W2OA 2ZKNA 3Q8FA 4JYAO 2BEOA 2W5FA 5GLWA 3V0BB 3DPRC 4LKFA 4ZOLA 1QU0A 4G4FA 1UZWA 1BT8A 4QQLA 1GZ9A 4QT6A 3ZVXA 2YPJA 4RS5A 1GM7A 5L9VA 5FZ7A 4COZA 1RUF3 4HZ3A 2FBEA 5E1RA 1YFYA 1HR0O 1QOOA 5J48A 2Y6GA 1UMHA 4Q0VA 2P6HA 4TLGA 1WWYA 4DV6B 5CZKA 3CCSV 4LF8O 2VC9A 4GB31 3JD71 2VQUA 3T30A 3P3PA 4CH6A 4DV0O 1MSDA 1VBD3 4IL6Z 3M1HA 3MIEA 4ZU7A 2W1WA 3VZNA 4CS3A 3ZMUA 4YM1A 4B7EA 1RXFA 3MW4A 5GJ6A 5B4XA 1ND3B 2VTXA 5FXVA 5CA3A 5T50A 3UETA 4CUGA 3W7TA 3J7NA 5C6CA 4NB5A 1YSCA 1R3LC 3IMMA 1GFF2 4FP2A 1HNZB 3LSDA 3B01A 3MDPA 4F8AA 4NO4A 3LEKA 5EPAA 3MHSC 4PJYA 1I6XA 2M7WA 4LIVA 4HK8A 2JG8C 4N9HA 1OCOC 1QH7A 1R091 2PHWA 5LASA 3QTCA 3THTA 5IVFA 4LUMA 1AR61 1PM4A 2A06H 3V0AA 3Q8EA 5I91A 2EALA 1XQ8A 3WQ0A 4QMAA 1VBB2 2YXHA 1XNKA 3NNGA 4BQ2A 5L7OC 4Z1VA 2VXRA 1WPBA 4LF9B 4FPCA 2W08A 4IE0A 4MUVA 1GKFA 2F23A 2Q4SA 2ET1A 3DECA 1M1KW 5FP8A 3AKPA 2HEWF 4X8PA 4I3GA 1PVC2 3UQ8A 3W7UA 4UFLA 2DYSB 3FUOA 4UAPA 4P00B 3ZHTA 1L1FA 1AR4A 4GQ7A 1VBC2 3AP7A 5A7SA 5FLJA 1SFNA 4YGBA 3JBG3 2K2SA 1HRI1 3G7DA 2VQFO 1TVKB 1QJEA 4A6SA 2WNVB 4A6OA 1OOPC 4IIJB 1NKGA 3HOBA 3CS5A 1O3RA 3JU9A 2E6VA 2Q9LA 2WT1A 3Q8AA 4QX7A 4WZFA 4UBHA 4BU2A 1BEV2 1K3IA 1P8JA 1WCUA 1IBKO 2YY1A 3AKRA 2FHRA 2ZNJA 3IDCB 3ACLA 1M93A 1GLHA 3HN1A 1OCZB 5LHGA 1MS0A 3GCXA 3LF7A 1WD3A 5B5EZ 4IT5A 1Y76A 4RWUA 4ZKIA 4GWMA 2WRAA 4M01A 2C9KA 4FLWA 3OT7A 3S0MA 2FB5A 3GZTB 4F6RB 1DF5A 1OKOA 1FMD2 3WDXA 2ARHA 2CDYA 3K3OA 2IJKA 2VM9A 2JDNA 3TEXA 1R1A3 3PVBB 4EN6B 5AC93 3UJQA 1VBA1 2PMWB 2ZX3A 3KG2A 4LF4B 1EN6A 2C6SA 3VDDC 1B35C 1RMU3 4MTOA 2SLIA 1WD4A 2NR5A 3W5NA 4L0PA 4QB1A 2OPWA 1XB9A 4KWJA 3HKEA 3AG2C 2WQ8A 5IVYA 4L8JA 5LK5A 4JC1A 2ZIMA 2VMHA 1XDCA 3SH3A 5CFDC 3VBFC 1ZBE1 4W6WA 2OTLV 1V6JA 2QTSA 5EIBD 3TNPB 3HKCA 3TEYA 1SQ4A 3PUHA 3LGRA 1SZBA 2NLRA 4H44B 5KXDA 3GYDA 2YIBA 1PK6C 5DM6V 3KWVA 4XAEA 2Q4PA 1X59A 4OMDA 4E4EA 3J80N 4QU1A 3E8BA 3O1MA 1NYWA 3ABMC 1XHXA 1EM1A 3S7IA 4DK0A 5IVCA 3H1JH 2P4VA 1VBE2 1RVF2 2PQQA 2XT9A 1YYNA 4WVMB 2LGWA 1C1FA 3W7WA 4YHHB 3T3YA 1MABG 2ZTNA 2Q73A 1XEQA 4NWWA 1FV3A 1DBNA 1BMFG 4JKMA 4AI8A 2YIDA 4LFCB 5FZ8A 5DUXA 1OLMA 1R3JC 5EC2C 3F95A 5C4WC 5A70A 1OLQA 4LO6B 4AL9A 1ZZ7A 5LXTB 5CA1A 4QE9A 3N35A 5KLVH 4AI9A 1PO22 3DPRA 3BPSA 3VKOA 3NWKA 2CGOA 4ZZ8A 4PCRA 4ZS2A 4LO8A 2JGDA 4V2VA 2RMU2 5EZYB 3CYOA 1JS9A 3LUTB 1PD3A 3T4VA 2ILMA 5D21A 1UN1A 5DUUA 4X6QB 3JB8A 1PX4A 4D7SA 4JYYA 4YW6A 4K3AA 3S7EA 3T1MA 5FPRA 2RS13 3VKMA 1F5JA 3LA2A 1BS3A 3JD3A 1JOJA 5A3UA 4XBQA 3R4DB 1WW7A 1COWG 4K8XA 5GW7A 4XPVA 3U4SA 3ZHRA 1RUG1 1Y9QA 1IBMB 2DBNA 1S0EA 3I3QA 1IGOA 2AR6A 2ZZQA 1R73A 1FATA 3H1LH 1ULCA 4XUNA 5JIAA 2KD7A 1ZAUA 2DFCA 1D7PM 3OEBA 1DK1A 5LW9A 1YQ6A 2ZQMA 1PKXA 3F7VC 3B9CA 4CU6A 3MW3A 1HXS1 2JG8A 1TEIA 1Q6UA 2Q8VA 4HVRA 1PMIA 1GQPA 1RP3B 5FL7G 2P06A 4MVZA 4I2OA 3UKTA 4FIPC 4U7OA 1F4NA 1DYKA 3ZN6B 4Y24A 2JB8A 1NS1A 5LBBA 4ASMB 5FY9A 1I7FA 1HNWO 5L7OA 4I0AA 5FPOA 3OYWA 1Y6XA 2EIKB 3RBZA 1ND3C 1M06G 4MGTA 4HMZA 3FKSG 1U5IA 1KDMA 4K20A 1SPPB 1T6GC 5A33A 1JHNA 4RYDA 5E16A 4YY3O 2BERA 4CCNA 4U3JB 3O12A 1KGYA 3ZLIA 2Y69B 4UCVA 2Y64A 1S5HC 3WSOA 1WLWA 3SKVA 1TNFA 1MS8A 1ENQA 4XW3A 4PQQA 3NW4A 5KR7A 1AI5A 2DQ3A 4UW5A 4NOTA 1OOPA 1WMEA 4JCKA 1ZLZA 3K5LA 3U07A 3D3QA 1FYJA 5J37A 1GU3A 4HKLA 5FPBA 3HD8B 4PA7A 1J95A 2JJ6A 2DVDA 3ZFFC 2E75B 3HR9A 1CAWB 4LBMA 3RG0A 4UFMA 3GNEA 1P7GA 1MS5A 4PA6A 4X89A 3GWKC 4X62O 2DYSC 3CU7A 5H6QA 2ZGPA 1W06A 1XI1A 4AVAA 2E63A 2W46A 4I0WB 1NOVA 5IY5C 4YY3B 3RQ0A 4PDWB 3VQYA 3T08A 4G27B 1K7DA 3UJOA 1CPMA 4TYSA 1XNQB 5K1PA 4FM0A 2WNVC 4E8DA 5F8PA 2X6CA 4TQFA 3ALQA 1QQP1 1W6MA 3ZBHA 1RUJ3 2V73A 2OIIA 1MMMA 1VQ5V 4BISA 1STMA 4NPLA 1OF4A 3AVRA 2Y0PA 1EZVH 1EAH2 4Q0SA 5FP7A 3R4SA 5CG8A 2LRPA 4EWDA 3VDDA 2XHKA 2IXIA 4TWKA 1GN3A 3SCFA 2A71A 1NKDA 4M00A 4TV9A 4FPEA 2VQTA 2Y0IA 3VDBA 3JAWB 4YJ2B 2EIBA 2JG9B 5DN6G 3STLC 3KF5A 1W28A 1JZ5A 3J7HA 5CFDA 1Y74B 3HIFA 4O9EA 2HWD2 1Q43A 5C8YA 2SBAA 3TETA 2XPJA 1V55C 4E2GA 2EIGA 1S0GA 1AXYA 3RSJA 3B9IA 3DC5A 4HZFA 3OGIB 4DR2B 4Q4W1 2ADEA 3BVOA 3ETEA 1EPZA 1GH6A 2A3YA 4NR1A 3H1YA 4ZXEA 4UBGA 3BCWA 2GN7A 3KF3A 2CTWA 1PK6A 1CD3G 3LSSA 1WLCA 4ZXKA 3CP1A 4FPGA 1BBT3 5FNVB 4GKJO 3OBZA 1WJZA 4EN7B 1KP2A 2CH7B 5CIRA 4EB6B 2VNVA 1VPHA 1F51A 2EXKA 3LQCA 3VBSA 3BA8A 3IDEA 1Q6IA 4EWAA 4GAZA 1W3VA 2XOMA 4ZI7A 3FAVA 5J1XA 3ZHVA 1W39A 1L0NH 5GZFA 4BQ1A 4IEYA 5C4WA 2DCKA 4R4XA 5BMVA 2MK3A 1TME3 2ZHKA 4LR4A 1FFXA 1XUQA 3FB8C 4RFRB 1CAVA 3KB5A 5LA1A 1V70A 3LIHA 3WG1A 2X5IC 5IE9A 4Y3OA 1DQ5A 1E5RA 3PIGA 2WFF2 4UFIA 2X53S 4TT3G 3T2OA 5LEJA 1EYBA 4Q0PA 4NIDA 4CZSA 4OI2A 4WVVA 4KG0A 4ITCA 3D3AA 3AG3C 2DCZA 5IFPA 1QJY2 1XNCA 3SPCA 4HXCA 2ZZJA 3WNOA 4XVHA 3SEEA 1SQQH 4YM2A 2EX3A 4B3TO 4B3MB 1JODA 4MTXA 3ST7A 2ZHMA 4DXZA 5DEDA 3SDLA 1HJFA 1LODA 4ES8A 2UUAB 3C3TA 1ND2B 1H2KA 4R6ZA 5J7MA 2QQUA 3BALA 4XJWA 4LWSB 4LH7A 5A7WB 2XJRA 2WZEA 4TUYB 5BR8O 3OMNB 3Q8CA 4BWOA 1XYOA 1JFFA 4DXWA 2DUQA 1H0BA 4AI2A 1YIFA 3D0SA 3TAYA 1X8MA 4JV4A 1H38A 5LATA 1POV3 3MV11 3VBRB 1NQDA 3VZJA 1NTMH 3KZIZ 4N9IA 5DUWA 2Y34A 5J9PC 3PHMA 3BHPA 3THOA 3J9SA 1N3OA 3ACGA 3R05A 2P67A 2DU0A 1BHBA 2PHUA 1Z5WA 4K3UA 1ND3A 1DDLA 3CCVV 1VMFA 4LP8A 4SBVA 2BU9A 1DTOA 3A0BZ 1ULEA 4BXSV 1NR7A 4ICGA 3I59A 5L3EA 4DR7O 4EN0A 4BZ4A 5BR8B 2BFUS 3CPWU 3K5OA 3QO8A 5CADA 4UFJA 2LROA 1NI8A 3RZKA 5F6LB 4Y1UA 4K6BA 4ASUG 2B4KA 2OVUA 4YNIA 5A6YA 3NKTA 1SBEA 3ABUA 4O2BB 2KSDA 4OQ9A 1E79G 1G8WA 1M4WA 1FOD3 4ET7A 1VQ6V 3WP4A 4COWA 4RUEA 5EWSA 4YJ3A 2JE8A 3ZFFA 3ZRXA 4E9KA 1AJQA 1TUBA 1QJU1 4A5UB 4AAPA 3CJHA 1VP7A 4JHZA 5A6XA 2HLDG 1VQKV 3FBMA 1OCCB 1EZJA 4CCJA 3HNBM 1VMHA 4DNYA 3W20A 4LF7O 4DYLA 3I2FA 1PX3A 2A75A 4MYEA 1HP8A 1SZTA 3F7YC 3IPVA 1VRH2 2DURA 3VD4A 4AVTA 2CAZC 1UNBA 3N2KB 4DS0A 2E7QA 1TE1B 3AMHA 4Y22B 4LO4B 4XFHA 5LBEA 4IV3C 1A6CA 1XHZA 3G6JB 2PI4A 4UFHA 3EXAA 3KT1A 5I0RA 4D6QA 4FTBA 1KD7A 5DECA 3I2OA 1Y43B 2HWB2 1LOEA 4TSFG 3JD1A 4N23A 5JH7A 3CE2A 4AI1A 5LHIA 1OH4A 4H2AA 2Z5WA 2WINB 2DCJA 5LGTA 1N1YA 4GWNA 4PDWC 1IHMA 1NZ6A 2FMLA 4I01A 3AYAA 2C5DA 4HKOA 1CESA 4LEJA 4BMBA 2WLIA 3PL0A 1EUTA 2WS91 4F6RA 3ETGA 2RS52 3CC7V 1QJX1 1Z7S3 3N7MA 4BIOA 4AYUA 1G1XB 5FKCA 4AFDA 4CDWC 1DGRA 1J58A 3J7LA 1S1AA 4IYHA 5J3UA 2E31A 1XPWA 4XDKA 2QE3A 3T4ZA 3OW2U 1UIKA 4U3FH 1DGRN 1YQCA 3K9AA 4RGAA 3JZVA 2JG9C 4AHXA 5FWJA 4DEQA 5L9BA 2VOVA 3RWNA 4NHKA 3M3EA 2D2CB 4OFGA 3JATA 5ACA2 1ZUQA 1QIQA 4DR5O 3OGSA 5K7PA 2RR12 3OUHA 2BV4A 1U97A 1JXNA 3HJRA 3NVCA 1LR1A 1AX0A 3J26N 4MGYE 5C7GA 3IDAA 4D3WA 1PO23 4IGPA 3OM3B 2VCBA 3WHTA 3H3UA 2Q6AA 4CE8A 4OCTA 3MIFA 2WFPA 3D5OA 2ZKOA 3AL6A 4N43A 3VOUA 2DFBA 3AJYA 1U5XA 2I2SA 3RYIB 3VQXA 3L75H 4QHZA 3TNQA 4FFKA 4JI4O 1GRJA 4OPHA 5E88A 1V6OA 2ZEZA 2CUGA 2DW4A 3C7HA 2X5IA 1T5EA 2PAEA 4YW4A 4JI6O 3PU8A 1XSQA 3MIGA 4CDQC 4WVMA 1OCRB 1XNRB 1W99A 3D36C 4HAMA 5H6RA 2WT0A 4Q27A 1H8TB 2WC2A 1R082 4CCEA 4WM8A 3BB6A 4LF6B 1LHOA 1QJZA 3J8F1 1C28A 1AR83 3O0VA 4D0QA 1BL8A 3OPWA 4MS2A 1SLLA 2WLPA 5A3OA 3AFGA 4D6RA 1LHWA 5L73A 2AW9A 3LNMB 3ZIWA 2WZR2 4ATEA 2YFUA 3ZXJA 3NJVA 3ZX7A 2X8KA 3AG4C 4NPRA 1CX1A 1DQ0A 2XDVA 3BGAA 5EZYA 5DN2A 4O7XA 3ZFEB 1M4UA 2RMKB 5HFLA 2EIMC 2PYJA 4WFFA 2YZ4A 4IHJB 2PLV2 4EWEA 2RS32 4DR1B 2JK5C 3NXSA 2R061 1UXXX 3MD0A 5FYYA 4IEZA 1D0GA 3WP3A 5DUVA 5FZKA 3K04A 4N7UA 3O65A 4MTGA 3DXRA 5DG1A 1S4CA 4KWKA 1MR5A 3DYOA 1YC61 3ZJZA 3NRUA 2RE9A 3ASIA 5JAXA 4LO5B 2F93B 1DGLA 2I74A 1US3A 1AR72 2V4VA 5JMOA 4KU8A 5FY8A 1PV0A 3WW1A 4DUZO 2Q8DA 4JGSA 4CS4A 5LL6Y 1GOFA 1Y9MA 2WBKA 3QACA 2J22A 3KLSA 4QU2A 5FZBA 2PA7A 2VZQA 3N7KA 5F32A 5JUVA 3DV8A 1FV2A 2CTQA 4OHYA 1NG0A 1LGNA 4FT8A 3H3ZA 1AJOA 3OSDA 3RJ2X 4X8AA 4QHOA 1J3QA 3SITA 3ZO0B 4DV3O 3VZOA 3OEHG 3VBRC 5A3WA 1KXGA 1RPRA 1BHGA 2GSYA 2D7FA 4F7ZA 2YB7A 4Z2AA 3ZN6A 5C3SA 2ZX4A 1M9NA 1QKQA 3QOPA 3SPIA 3K03A 4EN8B 5GLUA 1ZZCA 4JGYB 4X65B 2E7TA 3FFZA 2W2IA 1EN5A 1SPPA 2EXJA 2B7YA 2JKXA 1NXMA 3JSLA 3GHMA 4WFBV 5CVRA 5DAPA 3T4HB 3RPQA 4JQTA 4CCKA 3RYHB 2RN9A 4FFBA 1AR62 1BZKA 5T52A 1JYWA 2P17A 4UOJA 1POQA 3A21A 2P3KA 2W0XA 3MLJA 3IZOA 3RGBA 2JD9A 3FLTA 1OZ0A 3B69A 1YHQV 2GN3A 3RWRD 4DR4O 4CSWA 3NL1A 3T1HO 2CK3G 4IV3A 4JI7O 1GUIA 2GHYA 4META 1UY1A 4LFBB 1P4RA 1F4MA 3CD6V 1I5YA 5IVJA 3SQOA 1ZRDA 5DMYA 4UV8A 4ARYA 1HRI2 1LNSA 4XIOA 4WZCA 4PDMA 1ZX3A 4W8JA 2RJZA 4DUWA 1KYOF 1F7YA 1O3QA 4ZS3A 4FLUA 4PDWA 1LUVA 1LULA 2R1DA 2BSKB 2JX9A 3UGFA 4N8MA 2H6BA 5T5OA 2NPIA 2RDSA 3N9PA 5IK5A 3GZUC 1SEFA 2DVAA 4U7NA 3THDA 1OV9A 4I50A 1RINA 3U1XA 3ZN4A 1YXBA 2ZGMA 3CZJA 2GC1A 3G6BA 1NQTA 4DXTA 3JAKB 1NA1B 2E5LO 1AR91 3MUY1 5FCCA 4CDWA 1EV13 2EBOA 2HWE2 1RUH1 3FL7A 5LMNB 2QWPB 1UL9A 1BHAA 2JG9A 1PZ7A 1SFPA 5KHGA 1MEC1 4LBOA 5DZGA 4TN7A 4UW3A 2MEV2 5FZIA 3AG1C 5F3IA 5J98B 5LB6A 1WZXA 2YEVA 3L2HA 1W8OA 2QKDA 1OSGA 4U36A 1VBA2 2CV6A 4AEDA 4GWJA 1CX4A 1CWPA 4FAGA 2ZGLA 4OMCA 4P9IA 5FP9A 3M99B 1IS4A 2YIBD 4UT5A 4DY3A 3LDDA 1VMGA 4L2NA 4MGKE 1GQHA 4DRXA 1V00A 2C0ZA 3HMYA 1ZBE2 3VKLA 2K46A 1JYVA 3O1SA 2P6CA 5JWPA 1IXMA 1W9YA 2VOXA 5KAFZ 3RT3C 3ZYIB 1SDDB 4EB6A 1ZA7A 4QX1A 5LMUO 4DV4B 5JR7B 5FZOB 1NUKA 1S72V 4GKYA 4CDQA 3SPHA 1LOFC 2ZXWB 4YW7A 3D36A 2F4LA 3QF7A 2AREA 3CIHA 2YC4A 4AQSA 3Q4HA 1SKVA 3CEIA 3K4ZA 4XQWA 2PHDA 1KJLA 1NVPD 4GX2A 2HJIA 2FQPA 3LNNA 2JEUA 4QQ2A 3RS6A 1MZ6A 5JCOC 3LSUA 2D98A 1OBNA 3WB1A 1J1TA 2IW5A 3ICXA 4N53B 5A80A 3RFRA 1CAUB 4YWAA 3V64A 1PZ9A 2YI9A 5FYCA 2ORXA 1QXRA 1JI6A 2GDFA 1F31A 5EFUA 4LULA 4QXBA 1R3KC 4JPRA 1PP9H 3O0XA 4H7LA 1M57B 1WW6A 4KL1A 1I08A 4FLTA 4AGRA 1XMOO 2D6LX 1WPXA 2XTAA 1FXZA 1VBB1 1GKBA 5GZEA 1YJLA 2C4XA 2K9PA 3LPGA 5DDJ2 4LE3A 1O59A 3D4KA 1VQ4V 4CEWB 1AHSA 4NRPA 4MVTA 2XJQA 1VQPV 4S2FA 4RQPB 1PVC1 4AVCA 2QWOB 1W8NA 3K0DA 3I2GA 4IEQA 3K4DA 3RWKX 3H8UA 1XJAA 1W2AX 2AZ5A 3K58A 3ZFEC 4KP4A 2ZM6O 3K57A 4P9JA 5A7WA 5KAIZ 4GKKO 1CPNA 3ABKB 5HCFA 1HWYA 4JI0O 1W8HA 2EZOA 3ASOC 1W6QB 1X9PA 4MVUA 4A41A 3FN9A 3POJA 4XFBA 3E8FA 3BIWE 4AGGA 3WNKA 4K8ZA 3VBRA 1BEV1 4RHV1 3LEGA 2KG7B 1VF6C 4BCUA 3EYPA 2B9ZA 2CL2A 4QPGB 1D4M1 4O4IB 5J36A 2Q69A 3FBYA 3JASA 5JJJB 2BFUL 2VAUA 4RR3B 1K5QA 4FTSA 2YG0A 2MPFA 2PAMA 4PD4F 4GCZA 1US2A 4YZ1A 4YW2A 1LOBA 4UCRA 3BOWA 3HT2A 4Q1RA 2R042 3THCA 3K77A 3KZ4C 1OLRA 3ILNA 2CWSA 2VMDA 1VRH3 5FPAA 3P1IA 1JBCA 3TN93 1D4VB 5A32A 4HANA 4P9LA 1SERA 3MYXA 1Q86W 1FMD1 5ITZA 4JI0B 4CH4A 3LKJA 3MBWA 3DGEA 3R66A 5DPNA 4O2BA 5T5PA 1VQ9V 2NN4A 5FZ4A 1N47A 3ZHSA 2IXKA 5FO9B 2E51A 1A32A 1ZRCA 2OA2A 2ZACA 5IVBA 1J5EB 3CJIC 1HNXB 5CNAA 1W6NB 1W9FA 2N74A 3M3QA 5JXJA 1GMMA 3GGLA 1QVFU 1CJPA 2PTMA 1NCQB 3F5TA 4QM9A 4JAAA 2LUWA 2JWPA 2LTNA 1MSWD 3H1IH 1PO13 3NJYA 1MNGA 2YXYA 1FS0G 4L11A 5A3MA 4DINB 2P7TC 2YC0A 2Y33A 2XVLA 4XFGA 3L70H 4NTXA 3K46A 2Y6LA 2BTQA 4YIOA 1DYPA 3N2KA 1BVVA 1ASJ3 1COV2 3TXSA 1CJDA 2X6AA 1V6NA 1AVMA 3ZDSA 5E8AA 1W0KG 2K9ZA 4I0XB 5DAVA 4Q8LA 4JX0A 4LTAA 2PXJA 4QWNA 1K8AW 3ZYJB 3QVNA 4XBFA 2X05A 5IJ0B 1RVF1 5FYSA 3TB0A 4CS2A 1HB4A 5JXHA 1MACA 4RGGA 4W4LA 2X6BA 1ZYBA 3O1UA 5C3RA 3I2DA 3G80A 3QO7A 1MQTB 5FLXN 1XL4A 1GNHA 3A23A 5DAXA 3I4IA 3WOGA 3AJZA 5CBFA 4YVWC 5KWRA 3VD5A 2XAJA 1WB8A 4IE6A 1N32B 1GN2A 1JX9A 5BNOB 3SMHA 1ZRFA 2BWCA 1N3PA 3P6BA 2ZXQA 4XJAA 4BLJA 2FDJA 1WCSA 4JQRA 5FZEA 2JDIG 2YSUB 3WHUA 2W92A 1MZ5A 3X2QC 1X7NA 1XREA 1NA1C 2W1QA 1CZVA 3BTXA 4LA3A 2B9VA 4OHVA 2D6MA 1MS3A 5D5QA 4DR6O 4CPBA 3E22B 5LY2A 3ABZA 4JV5O 3B94A 1WA8B 2DYCA 1PNKA 4JI8B 5KXBA 3WP5A 1LOFA 2HHHO 3TEWA 1YO8A 2A3QA 3W7XA 1NCRC 2ES3A 3UKNA 3D8CA 1PGL1 1ZL8A 3K2OA 2IJHA 1W2UA 4RS5B 1JU4A 1ZTEA 3C7GA 1K5SA 3GB7C 5AVAA 2L6LA 3IKWA 5FJHA 5JCOA 4JI3O 4X88A 4R50A 4I02A 4LBEC 3ZRVA 4QJFB 5IW0A 1RM1B 5F3GA 3ABLB 4NXNB 1SCRA 2B8MA 3WW3A 5EQUA 1F5FA 3SISA 5B1AB 1O7FA 2P3JA 2Q1MA 1NX9A 2G1MA 2XBO2 5B1NA 3RZLA 5JXGA 2ADQB 1WUVA 2A5ZA 2QM8A 2P5BA 3CRRA 3ZXEA 3HN3A 3ES4A 5AFEA 2P22C 1LR5A 3VQVA 2IH1C 5H2FZ 1WA4A 2G4IA 1VRBA 1W8ZA 4UWDA 2X10A 4NWVA 3PNAA 2YHJA 4AI3A 3AZZA 3WINE 4NAMA 4Z82A 4BQ4A 5C9AC 2VY0A 4DV7B 4H33A 2GNTA 4MV2A 1M5IA 4V2WA 4GB33 2GC3A 2Y6KA 4N53C 3JD73 4QXHA 1NTKH 2ZGOA 2UY9A 2HG5C 1OI6A 1VEWA 1N36O 4AQ6A 3V0AB 3ZFEA 3EBRA 4FOWA 3IB3A 3E8GA 1JOPA 4I0BA 2BOJA 3ZHUA 2BBAA 3N36A 4ABMA 3CCLV 2UU9B 2WQ4A 5M0TA 4KGGA 3ZR6A 1TG7A 3K08A 2OXBA 3EHKA 1WW4A 5JOXA 2XR4A 1K33A 1RITA 3M7AA 4HPKA 2JJ1G 4NIIA 1PPJH 1VF6A 1ULFA 3ZYFA 1MVQA 3EQEA 2VCMA 1OT5A 3GJAA 5CMUA 2VULA 4LFAO 1ZSPA 5D5PA 2E7AA 3GBFA 5IWAO 2PY5A 4HNAA 2CNAA 3ORJA 2G19A 4JI1O 1R093 3HQXA 4EYUA 1WMDA 1FYUA 2I45A 2Q5ZA 3PVOA 2O1QA 2IWGB 3BN6A 4XUTA 4X64O 4EJRA 3EB7A 4J42A 2IXLA 4CU8A 3ABKC 4Q29A 2VZRA 2QWNB 2JE9A 3OGGA 2VGDA 5T54A 1OF3A 5IYYA 2DVGA 3GZEA 3WG7B 2ZMLA 4XJUA 1WKYA 3WF3A 3NNMA 4U2AA 2VU9A 1HDJA 3SYAA 1EAH1 1OQDA 3PMSA 4Y26A 1Y76B 4RR3C 1RPOA 4DV2O 3LSQA 2Q30A 1X33A 2D5FA 1IBLB 4ZZ5A 2V1DA 1HRI3 3CJIA 5JZGA 5IJ9B 2F66C 4GA9A 3W5MA 2WLKA 2QQKA 5EBMC 2JJ2G 1U0AA 1AJKA 3BIEA 4MXVA 2UXCB 3IN9A 2OT5A 5CN0A 3OG2A 1W8UA 2HWD1 1YLLA 2P90A 4O4JB 3FD9A 4B1MA 2BTVC 4Q4V1 5GALA 2VZOA 4KBBA 1C8M2 2AXTZ 1DP0A 4XJ8A 2O8OA 2UXXA 1LOAA 3RW0A 1LEDA 1XNTA 3KCXA 3HKEB 3WF1A 4CCOA 4JVAA 2JENA 3RVHA 3B5LB 2YU1A 2Y38A 4ZHNA 4E27A 3CO2A 5FUNA 3O1PA 4YG3A 1AL22 4MZUA 3B77A 3C90A 3AXDA 5DZFA 3HKCB 1Q8QA 3C3SA 3LFIA 4UW4A 4QB2A 2VZ3A 3OF1A 1NCQC 3K59A 4G9SB 3CC2V 3C7EA 2GH8A 1QLNA 3JQXA 3KV4A 1K42A 1YI2V 5JOYA 3ITQA 5KHJA 3CDZB 1I0HA 4YVWA 4N90A 4W4KA 1GR3A 3KV5A 4TV8A 1ZRIA 4BDVB 2EIJB 1NA1A 1ZBE3 4B4RA 1JYXA 5A7OA 3SYQA 1AXZA 2ZGUA 2WFF1 3DTUB 4QQHA 4BYYA 3MIDA 2UXDO 1BGYH 4LBLA 1NVPB 1OQEA 1AI6A 3RI8A 2WNEA 1RHI3 1GAXA 4DUYB 3ZFGC 2QQOA 5CA1B 2QZ3A 4AHCA 5FZGA
chains in the Genus database with same CATH topology
2A6ZA 4LO7A 5IUQA 3HIFA 4XIKA 4O9EA 2HWD2 1DQ2A 4IL7A 1OHFA 4R9CA 3MIHA 4JGYC 1GBGA 4F3JA 1Q43A 1AX2A 2SBAA 1RJ7A 2XPJA 5DZEA 4JGZB 4E2GA 1NCRA 2EIGA 5BNNA 2ZAAA 1S0GA 1AXYA 1W6PB 3RSJA 3B9IA 1S0BA 1ONAA 3ROUA 4HZFA 2BNMA 2DCTA 3PVEA 4Q4W1 4C8RA 1EPZA 2A3YA 4LNVA 2D97A 3WQ1A 4CDXC 1V6MA 4NR1A 3H1YA 3ZIXA 4XILA 1QWRA 4GMP3 4UBGA 4GKXA 2OZ6A 2GN7A 3BCWA 3MF6A 1PK6A 3MPPG 1CD3G 2TUNA 4FOVA 1WLCA 4ZXKA 4Q2FA 4BHPA 1ZRRA 5FLHA 4FPGA 2ZGTA 1BBT3 4XEZA 5T3NA 4QPIA 2ZABA 1QDOA 4ATFA 4AHWA 4HPKB 1UX6A 5SV8A 2ZGKA 4YW5A 1CN1A 1Q8SA 5FREA 3INAA 5T55A 3SXWA 3HWJA 4EN7B 2B46X 5CIRA 4YARA 1HRV1 3L9JT 4Y22A 2EXKA 2DUOA 3MI8A 4AVVA 4BG1A 5F9TA 4FPKA 1WCDJ 2XJUA 3VBSA 3IDEA 4YFWA 4Z2WA 2ETEA 4YW3A 4EWAA 1Y7BA 1REFA 3ETQA 5KHKA 1HQWA 3M3OA 2XLFA 1FOD2 2ZX0A 5K0UB 1W39A 1C8M3 5KHHA 1DHKB 1VBE1 3ILFA 2ZGSA 5GZFA 4PIYA 4BQ1A 4IEYA 1DGWA 2A6WA 3VKFC 5C4WA 2PHFA 2DCKA 1CGPA 4R4XA 1HX6A 2VOKA 3UK9A 5BXXA 1NX8A 1U12A 1QQP2 1WMFA 3AM2A 1MS9A 2A6XA 3PJQA 4WM7B 1TME3 5C9AA 2BPA2 2ZHKA 3AKTA 2JG8B 1OTJA 4LR4A 3EJKA 4N53A 1EPWA 1CAVA 3KB5A 2BNOA 4P9XA 4DRVA 2NZ9A 1V70A 1IOAA 1LENA 2QZ2A 2FMDA 4BOWA 3WG1A 2X5IC 4LBQD 3WDUA 1DQ5A 4BA6A 3FC0A 5EV7A 1XRUA 1AL23 4L9BA 2WFF2 3AMNA 2X53S 1PO21 1J3RA 1KRIA 5LEJA 1EYBA 4Q0PA 4CZSA 4ORFA 5L7OB 4OI2A 1HV0A 4QPYA 4WVVA 4KG0A 5GZCA 3CJIB 4FAHA 1C5IA 4ITCA 3ILRA 5JZGB 2ZX2A 2CWMA 5DXDA 1X36A 1F8VA 1RUG3 4R9DA 3VHPA 2VQAA 1AZDA 2DCZA 2RMU1 1QJY2 4YZ3A 3ZYPA 1LKNA 1RUI2 1XNCA 4OUMA 2EAAA 2ZZJA 4FSJA 4CEYA 3QCWA 3NV2A 3N6WA 4YM2A 3ZYGA 4CRQA 5A33B 2HWC2 3HAGA 4P9GA 2CTVA 1U5ZA 5HXVA 5FOJB 1FPN2 1Y3TA 2Z42A 3AZVA 3ST7A 3N7LA 1GQWA 2ZHMA 5KC6A 4DXZA 4Q4W2 1RJ8A 1QXPA 1TQ5A 1O4YA 3D0JA 1HXS3 1PIV3 2WA3A 2D5HA 4NHLA 1LODA 2ZHNA 3ZPYA 4ES8A 1OIJB 3ZSJA 1ND2B 2R1BA 4H7MA 1H2KA 2GC0A 2H0BA 1EAH3 2XG3A 5J7MA 5I0UA 2R062 1QHDA 5I8SA 4Y1ZA 1O5LA 4LBKA 3BALA 4XJWA 4AG4A 4DFSA 4JRLA 4YZ5A 3O0WA 3WDTA 1AR81 1WBLA 2XJRA 2A3WA 1RHI1 3FHIB 2R0FA 1A8DA 3KQRA 4HVOA 1XYOA 4BWOA 4XF4A 2XVGA 2NQYA 2DUQA 1S0FA 1SMVA 1XE7A 2EXHA 1H0BA 1RUD2 1Z7S2 5J09A 3GHNA 4RSUA 5H9PA 5IK8A 4AI2A 4QGNA 1YIFA 3D0SA 1ZX5A 3APBA 3M3IA 3TAYA 2R30A 3VBHB 1HRV2 1X8MA 4CP0A 2BQPA 4JV4A 5KHIA 3NAPC 1POV3 3ES1A 5JDBA 3WDWA 3VBRB 1NQDA 2HWD3 2VNRA 3VZJA 3O14A 3RI9A 4AGVA 1AYN2 4LHKA 4N9IA 4BE3A 5DUWA 4C0BA 3PHMA 4DRRA 1IQAA 2FMYA 1KITA 1ZM1A 4RR3A