2WA4A

Factor inhibiting hif-1 alpha with n,3-dihydroxybenzamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 99
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa4A01
2ILMA 4Z1VA 4Z2WA 2XUMA 1H2NA 1MZFA 5JWPA 1IZ3A 4AI8A 1MZEA 4QU2A 4BIOA 1H2KA 3OD4A 2CGNA 2Y0IA 4B7EA 1YCIA 2WA3A 2CGOA 2WA4A 1H2MA 4B7KA 1H2LA 2YDEA 2W0XA 3KCXA 3D8CA 4JAAA 2YC0A 4NR1A 3P3NA 3P3PA 3KCYA
chains in the Genus database with same CATH superfamily
2ZGQA 5CA1A 3I3QA 1AILA 4QPWA 2ZA9A 4LHKA 4C90A 2WNVB 2EXHA 4XILA 3IAQA 1I5ZA 4K3AA 2JEXA 4LBLA 1CX4A 1LHOA 2NQYA 1DQ2A 3HB3B 1ULOA 3ZEDA 1I5XA 4AWDA 5L3DA 3T1YB 3RZLA 1R091 2XT9A 1AX1A 3OYWB 5JVVA 1SKVA 4LF6B 1UPGA 4KP4A 4WVMB 3K59A 5LA9A 4WM7C 1CN1A 3E35A 2RMU2 3V65A 3ZSLA 3RJRA 5T50A 2JICA 1F35A 2Q69A 3CSXA 2V4DA 2QQIA 2YFUA 4O4LB 3ZCCA 1N0NA 2WA3A 2C6SA 1H2LA 4YJ3A 3H9AA 2XASA 4WM8A 5GTHZ 1HRI3 3ETQA 5KHHA 3C7EA 4K3UA 3JAKB 2YGMA 3OOXA 3HN1A 2W39A 1LOGA 4JV5O 1VBE3 1XJAA 3FL7A 4XF4A 4IV1C 2QNKA 5LP6A 4OI2A 4A44A 4UF0B 3V64A 2GDSA 5FO7B 1DQ0A 4ASKA 1T2XA 3AYDA 1EM1A 4ISRA 5DUUA 3WP6A 4O2BB 3V56A 2OX0A 2CAVA 1UWWA 4L11A 1ZZ7A 4LBOA 3ZIXA 4JTDB 3DGEA 4JZGA 3AYAA 2WWUA 2UXBO 4AI8A 4FFFA 3HN3A 4GH4A 3OW2U 2YEVB 1HW5A 1YQ5A 4SBVA 4XEZA 4OI4A 5G05L 3TRSB 2MNGA 1HNXO 1YIJV 4KU7A 3BTZA 4D6TH 4QD2A 4UOJA 3ZYRA 1MPXA 2W87A 2HWE1 2G4IA 3UM7A 3J26N 2F4PA 4NHLA 1R092 1VF6C 5IVCA 2GZWA 2XJRA 4LORA 1RUH3 3BA9A 5EP9A 4CEYA 4HZFA 4I0XA 2P3JA 2QSAA 5JH7A 4FLXA 4XF3A 2Q67A 5FV3A 1JVMA 4YVWB 4HNAA 1I08A 2BVVA 1NH2B 1GQGA 4XIOA 1Y67A 2OKXA 5FBJA 1YYNA 2EINC 1LU1A 1HXS1 3ZHUA 1GAXA 1HV0A 1LHWA 4QE9A 3GBGA 1XSRA 4YVWA 1GYKA 5CISA 4CU6A 3ACIA 2Q7HA 1NQTA 1O9GA 2ZGMA 3SEPA 3GYDA 4AR2A 4UFJA 3KLSA 5A9GA 3MF9A 2XHBA 2M7WA 3T1CA 3QLQA 4YHHO 5C70A 3LEKA 2DWDC 3ZYHA 1SCRA 4LBKA 4LKDA 4PLOA 1GQHA 3I2DA 2VXJA 3MLKA 2YIDA 4JI0O 4Y1XA 5GM0A 1KU9A 5T5JA 4AQSA 3AP4A 1S55A 4Q4X1 1XNBA 2PQQA 1CIWA 3H3LA 1XILA 4NRMA 1WA8B 1UO9A 3PMEA 2JB4A 1UY0A 1S3JA 4KGQA 1PGL2 1PP9H 5A7PA 1UPSA 3RZJA 4YW4A 1W06A 1N1YA 1VBD3 3UKVA 4RHV3 1CZVA 2GN7A 3OEAA 4COZA 2VNOA 1AJKA 4CEWA 2ZX2A 1M57B 4OHWA 4JTCB 2BUKA 1BEV1 2ZR2A 3E83A 4BH9A 1AR63 4ZS2A 1H8EG 1Q90D 2PHXA 5KXCA 2X10A 1XNCA 4FCAA 3FWEA 3AJYA 3MYXA 4JZ2A 4UW6A 3JD4A 1Q3EA 4Q4V3 4JQTA 2ADPA 4DXZA 1W8ZA 3C7GA 2HG5C 3L72H 2LO1A 1JW6A 2J1RA 1GWKA 1Q8SA 4UFMA 2XJSA 4ZY9A 3IGAC 1W8OA 4OHZA 4WBNA 2PAMA 3KF5A 2GMPA 2DVBA 4AW7A 4DEVA 5L73A 2RS31 4B7EA 1CZTA 1ALYA 5IJRA 1F4AA 2EJRA 4FQ4A 2VZQA 3E1F1 1K7DA 5HV4A 3WQ1A 1JZ6A 2Q68A 1OQ1A 3JAWA 4GLXA 1FS0G 3A8TA 4N43A 2XKPA 1W8HA 4GX0A 1V6JA 4WF9V 5CFCA 2FMLA 1F9KA 1W6OA 3BU0A 3HMYA 3ZFGC 1AYM3 4ONUA 4OUSA 3CJIC 2NPIA 2QDRA 1NVPB 3ATGA 2E9QA 2VXRA 1JMUB 5FZBA 4FVVA 1K3EA 1LNSA 3GF6A 2UUAB 1GP5A 1AXYA 3PL0A 4HKOA 2HWF2 1GMGA 1BL8A 1VQPV 4XACA 2OPWA 3JAMN 1CAVA 2YROA 2ZHMA 2QGNA 3CHXA 1WMFA 3HR0A 4DRXA 4ZU7A 3T2MA 3IPVB 2XQRA 4IT5A 3ZN0A 1C8M1 4P30A 1GKBA 2JECA 4ORFA 2BTQA 3VKLA 1M56C 1CAXB 4GKYA 5C3QA 1QLNA 1G1XB 1NA1A 5FK8A 1JOPA 2YHJA 5B66Z 2YI8A 1VQ4V 5I0UA 4DINB 2A7AA 1AR73 1LTEA 3J8F1 4N21A 3ZOIA 2RE9A 1Q82W 2BEOA 1TVGA 4ZOLA 1JYXA 2WWJA 1LHNA 5CFDB 2UXBB 2Y6FA 4DV1B 2P6HA 2FTKA 3RWRD 2GH8A 5JOZA 1XSQA 2B5HA 5FP4A 3WFVA 2WS93 1J58A 1RSOB 3OB8A 1HKDA 2VOXA 3IC9A 1AI7A 2RDSA 4KQ7A 3E8BA 3LE0A 1WA4A 2W68A 4KBBA 4JVAA 1IZ3A 2X05A 2WNUC 4P9WA 1YTFD 2XONA 3VDDA 1LGBA 4FXGB 4LF7B 1QJU1 2DUOA 3OTOB 4META 3RFRA 1GNYA 3BGAA 1U5XA 3LF7A 2Q7EA 1YNAA 4PJ0Z 5F5AA 4TWKA 3BTAA 3B3QE 1WKYA 2ETNA 5EC2C 4UV9A 2QJ1A 3UYJA 4LIVA 2KG7A 1S0CA 3ZSEA 2HWC2 1LEDA 3BI3A 3NMBA 1KJLA 2DYSB 4LE3A 4LFBO 1XYNA 1OOPC 1NVPD 4Z8BA 1YHFA 4LC1A 4QQHA 1KEXA 2RM21 3ZN5A 4OMCA 5LA2A 4JGYC 3AK2A 1V6NA 4M0HA 1WPBA 2RN9A 5GW7A 3IDCB 4J11A 4AK3A 5A80A 4CDQB 1QVFU 5GLZA 2UYBA 5LYJB 1VARA 2UXXA 4BXFA 2F95B 2P3YA 3GB7C 2MEV3 2FQPA 1NR1A 1ENXA 1ENRA 4GALA 1EV12 1H0BA 1Q6HA 1FAFA 4AEKA 5CKNA 4F3JA 2VGDA 1XU1A 1QLEC 1H9PA 5DPNA 2QE7G 4Q1RA 5AFEA 1FATA 3EQEA 2JDZA 1K34A 3ABTA 2DYCA 1FXKC 2X53S 4R9CA 1M93A 3X29B 2DBIA 4UV8A 2VUAA 2UYAA 5AC91 1C3HA 1ZWIC 4WVVA 3GWKC 3POSA 2E51A 4ZPIA 3IDEA 3J7MA 3WNMA 2DCKA 2EA7A 1UMIA 3MI8A 2HWD3 1QJX3 4IEVA 1QXPA 1HJFA 3KM5A 3NV3A 1OF3A 1M06G 5JSRA 2Q9LA 5D21A 3W7SA 2OCCC 3E8HA 3I59B 1IVSA 4WBNB 5EJ3A 5EFUA 1N32O 4Y1YA 1SFNA 3VHPA 5FRAA 1HB3A 4AF9A 1AJQA 3JD2A 4NMIA 4V2VA 4GKJB 3C3VA 4YARA 5FREA 1JFFB 4DR6O 1RVF2 2ZS6B 3ZXDA 1XNAA 4IGOA 2Q6AA 4JDMA 4JASA 2E7TA 3RI9A 2P3IA 1KITA 5A7OA 4CP1A 4OX9O 3UNPA 1F8VA 3JASA 3K57A 4CU8A 2XPJA 3I2HA 2G19A 3NNMA 5FNVB 5FLXN 3NKTA 1TMF3 4KI5M 1RUF1 3E86A 4IHJA 4CDQA 4FFHA 2V4VA 5J36A 1PO12 2CGOA 3B8NA 1AI6A 2EX3A 2V1DA 1L0LH 2XBO3 2UY8A 3VBOC 5CB4A 4IE7A 1WGPA 3DXRA 1K5MC 4XFCA 3GM8A 1J5EO 3EO6A 2YSUB 3WNPA 2LGQA 5KWRA 4XDKA 3N4MA 3U78A 1HQNA 1S0BA 3NAPC 2K0GA 5TSWA 1RYYA 1R1A2 3AVRA 4HZ3A 5FXZA 3FX3A 4O2AA 1YIPA 4BQ4A 4YJ2B 1XNQB 1PO21 1DYOA 1NAEA 3DV8A 3FLTA 5F5CA 1F4NA 1Z5VA 2CTWA 1C1LA 2N74A 2AYHA 3H1MA 1Q8QA 1NCRA 3VB9A 1FXKA 5EJ1B 1BSMA 5FTTC 4DR4B 4N53C 4BQ1A 3K3WA 2R30A 4A2UA 4MGSA 3AYEA 3VZLA 1QVGU 2RJLA 3Q8EA 1QJFA 4I09A 3SITA 1PNKA 3UQ8A 4JCKA 3Q8FA 5E89A 5CB4B 3WEZA 1UNBA 1OLQA 3T4HB 4ZOLB 5CBFA 4XDPA 1PGL1 5DZFA 3ZFEA 2A3QA 2JEUA 5IJ9B 1B09A 3OGSA 1ND2C 4BMBA 1JODA 4RUFA 5B4XA 1RUH2 2EIGA 4S2DA 4OQ8A 4JTNA 5KHGA 2BERA 4OZXA 3POBA 4XDJA 3N2GA 1ENQA 5LOVA 1SCSA 3VQWA 4O61A 1J59A 2XVGA 4DW0A 4H3WA 3BRCA 2ZXWB 3ECQA 1UX7A 4DNYA 2W9XA 1OLMA 2HEWF 3FHIB 5FYVA 1AHSA 2BGPA 3RZHA 4Y33A 3IPVA 1U5ZA 1Q5OA 3NW4A 4H33A 2VNVA 1Q8IA 2VM9A 3I56V 3WNKA 3VD9A 4XIKA 4HFSA 1MVQA 3EYPA 4GAZA 5FPVA 3RJ2X 4LBNA 2W0FC 5D5QA 5IVEA 2PLV1 1TUBB 4P9LA 4RA0A 3I2FA 4LR3A 3CCVV 4F83A 1QJY1 1UY1A 4GD4A 2CH7A 2YS8A 2EJ7A 1J95A 5FOJB 1S5HC 1HXS2 5BV6A 4QGLA 3FB7C 1LGCA 2GMMA 4DS0A 3I2KA 2YMZA 1ZNPA 5FZLA 1BBT1 5C4WC 5KLVH 1AR1B 3OPTA 2Z5UA 2ZIOA 1SQ4A 2XL7A 5JVDB 1OOPB 2PFWA 1QQCA 3SPHA 4WM8C 1SZXA 2KB1A 4DV6B 3AZZA 1MSDA 4BOWA 2NMOA 4G3YC 4NXMO 3E22A 4O4LA 3ZIWA 4XURA 5F3CA 5C93A 2BBVA 1CONA 4Y5TA 5HBAA 1AR62 3WP5A 1YJKA 4AOCA 1A8DA 3T30A 2CE4A 1UMHA 2IXHA 4LO6B 3OAAG 1JHNA 2PHDA 2UXDB 4Z82A 3B2EE 3KMHA 3ILNA 2XJPA 1PO11 2D93A 2ZHLA 5BYNA 3USUB 1BCXA 2D97A 3RQ0A 5LASA 2BOBC 4J7ZA 1S0IA 2WO2A 5B1AC 3MIGA 4JI8B 1PK6B 1O3QA 1W0JG 2VW1A 1S1AA 4GB32 1LOAA 5DABA 1P7GA 1SERA 3OG2A 4QPJA 2XHNA 4BLJA 3B94A 3S30A 1COV1 3JSNA 3S3XA 1YLLA 5L19A 2RDNA 1N1VA 3TXSA 3NNFA 4IE4A 2VOWA 1AROP 1SF9A 5FXXA 2Y69B 4BE3A 4BCUA 2WN2A 1TZOA 2EIMC 3BVCA 3KHBA 2ET1A 4P9GA 1CAWA 4ARYA 4Q4V2 2WBKA 4JI8O 1SQBH 5J37A 2TEPA 3A22A 3THOA 2R042 2LW8A 1HNZB 1XNDA 4K21A 4WVZA 4QPYA 4NUBA 5IE9A 4CUBA 4YM1A 3AK0A 3VBSA 1RUG1 2DQ0A 4MXWA 1XE0A 1M4WA 3ZFGA 1ND2B 5DMYA 4PELA 4UYBA 1NKGA 3SMHA 1REFA 1AZDA 1JJ2U 4P9OA 1WMEA 2A1XA 2PMWB 4LF4O 1KECA 1N34B 5A70A 2W6IG 3W7XA 1NT0A 4Q29A 5FZOA 4XETA 1S0EA 1FMD2 2CAZC 3CP1A 3D8CA 1SHWB 4QX2A 4OVEA 4V2WA 3W7UA 4DEQA 3BPZA 1QH6A 3RYIB 1FJGO 4DUYO 3LSQA 4QGPA 2GBOA 3VBUC 2NLJC 5FPRA 2WAOA 2Q73A 1SPPB 2AHYA 4AEDC 4FM0A 4BQYA 4EB6B 2VQEO 2C26A 1KD1W 3A4UA 3NAPA 4DV0B 4X64B 2A79B 3O1UA 1X9TA 4GMP3 3E8FA 1S0JA 5DG1A 4DV3O 2WNVC 2W1WA 2R0HA 4IV3B 3RWNA 4PDWB 3SYCA 1GBGA 3B7MA 3KV5A 4QKNA 4GULA 2J1SA 1XHZA 1XE8A 1QY4A 4BQXA 3M1HA 1IXBA 1MACA 1XOUA 1WNSA 1YJLA 1VPHA 1M90W 1UJWB 3GBWA 2WFPA 3MIHA 4W50A 4ASUG 4TV8A 3KVAA 1GP6A 2Q5ZA 3O1TA 1SA0A 5IVYA 2RS32 2OIIA 4LJHA 4FT8A 1G9BA 1PGW2 4YHHB 5GLUA 2OQ6A 2JIZG 3MHHC 1OBNA 1MS3A 1MNGA 3AL5A 4HSLA 5IWAO 4JGZB 1I3HA 3I2IA 1MG1A 2HWB1 2XUEA 2CTVA 4FXKB 2X6AA 3WG7B 4PV1B 4UVBA 1FPN3 4YVSA 1PIV2 3WF3A 3C2UA 1QJX2 1GOHA 4IIJA 4G9SB 4X66B 2E3CA 3J8F2 2E26A 2RCVA 3FYEB 2IFRA 4QPIB 2ZTNA 1SLLA 4AHCA 3IJ4A 3BA8A 4XUOA 2ZE8A 1OCZC 1APNA 1NZCA 3ABZA 5ACA2 2RQ6A 2Y33A 4XQ4A 2XB6C 3CJHA 3M3OA 3HQUA 3L73H 4DV6O 3VZNA 4MHUA 3JAWB 4XAAA 2ARBA 1GOGA 4NTWA 3OPZA 2ZMLA 3GZUC 3WDVA 5BY1A 3CEIA 5H2FZ 3VBFA 1NX9A 4FI9A 3G6BA 5LCWL 5IAVA 1BBT2 1IPKA 1CR7A 4XE9A 1JYWA 2VH9A 1O91A 2Y6GA 3LDEA 4FFBB 4QX7A 3OT7A 3CCUV 3JSLA 4QPGC 1G6NA 4JI7B 5A3PA 3ICXA 4LEJA 5GLWA 2F17A 3APOA 1GANA 1TG7A 1YI9A 3JD1A 1A6CA 3S3WA 1RUE3 1WMXA 1D4M2 1D0GA 5JI9A 1W2NA 3K08A 5FCCA 2BSKB 5LXTA 1ZA7A 3ABMC 5DUVA 3SJAC 4OHYA 4UCTA 4J42A 4FLTA 5FZAA 3BFRA 1ULFA 2OUJA 3U11A 1VBC1 2OVUA 4PBPA 1G9DA 5FMBA 2XVLA 1SZBA 3I5DA 1CZSA 4Q4X2 4DR2O 1D0HA 1YEWA 1OCRB 3ABKC 1WLDA 1ND3C 3WQ7A 4OZOA 1QMJA 1R1A1 2W6JG 3RZMA 1AYN2 1O4TA 4YW1A 1L7LA 1KKDA 4JAUA 2JG8A 3OEHG 3ZIAG 2E31A 2HHHO 1C5IA 5FWEA 3NSTA 4ZKTB 1LCLA 2CHHA 3ZXEA 3VDBA 1G9FA 2YFZA 1RPOA 3LOBA 2X6CA 4XAEA 1IXMA 4DR3B 1QDCA 1Y7BA 1V9U3 4JHTA 2O14A 2E33A 3B8MA 4XBNA 4IEUA 2IJJA 1NZ6A 1RHI2 1RPRA 2MW2B 2W52A 2WJSA 2JS5A 4HPKB 1YVWA 3CLPA 1SLBA 4NHYA 1YFXA 3W20A 5A3UA 4AGRA 3E6BA 2ADDA 1BCCH 1E1QG 3AG2C 1XEQA 2NNUA 4CP0A 1R3IC 2F1MA 5FMOL 2OUHA 1R1ZA 2YC2A 4LFAB 4N9IA 2EZPA 2JGDA 3KCXA 1YIFA 1Y66A 1XQNA 2G9FA 4E2GA 1CPNA 1HB4A 1QCEA 3PURA 4XJWA 3CE2A 1WW4A 3E6DA 1FFTB 5A1LA 4QKBA 1I1EA 3LPGA 1M4UA 1U0AA 3TNPB 1AXKA 2ZMKA 3O5SA 3PVBB 3NVCA 4G4FA 3B01A 3OY8B 2Q4SA 2BBAA 4HXCA 3WW3A 1S0FA 2EILC 2ZACA 3UT5A 2PI5A 4XJ9A 1MVEA 5DAWA 2ZM6O 2FZ1A 2VZVA 2V5YA 4YW7A 2X6BA 3E5QA 3ETEA 3N2KA 2DURA 2RS51 2YC0A 3P3NA 1AVBA 3NL1A 3HD8B 2PGGA 3ZM8A 1DLCA 4CCKA 1O6UA 4FZ0A 2CSGA 3OBRA 5FNVA 4J80A 4QPIA 2HJFC 3N9OA 3DGTA 4AFMA 2B1GA 4DRRA 2JX9A 2B9VA 2WINB 3VHRA 3ZSJA 4IGQA 3PUSA 5ANNA 1W6OB 2AH2A 4J1XA 2JS3A 1YRZA 3EHBB 3N27A 2ZKLA 1OCCC 3WB1A 2KM2A 5J48A 2PTMA 2VWKA 3ZX6A 4CSWA 3VBFB 1ASJ3 2JDAA 4E27A 2EVXA 1PVC1 5BR8O 3M3CA 4DK0A 2PY5A 3PIJA 3CO2A 3WSOA 3W5NA 4COWA 4AHWA 3D3QA 3UT5B 4B3TB 3ASIA 2JIGA 4PCRA 1BZKA 3VKFC 3E2EA 4XJ8A 2WNVA 1Y74B 4CH3A 1VBA3 1IQDC 4W6XA 3BKZA 5A7WB 2UXDO 4RGKA 4O7XA 4P14A 4O4IA 1E5SA 1EZVH 3MW2A 5F39A 2B42B 3HNMA 3G71V 3AC0A 5FIXA 1DBNA 1AP6A 2QWRB 4DMIA 4NPMA 3OUHA 4DXTA 4K0KB 4RR3B 4JYAO 2WZPP 4BIZA 5CA1B 2QQOA 3UCSC 1EZJA 2Q8EA 3UKTA 1AB3A 5HCFA 3C7FA 5L3EA 3UJOA 3AK1A 1XMOB 3GZAA 1WP7A 1JOJA 4U3FH 4LFCO 3ZSMA 3AKTA 4Y1VA 2GV9A 4PQQA 1ODMA 3K77A 3RYIA 1SRYA 4IL7A 1OPMA 3H1LH 3RW0A 4HK8A 4YGDA 3MICA 2GAUA 5IWFA 4M4RA 3H1JH 3JBG1 4FLZA 4B1LA 2QKAA 1TNRA 4Q27A 1K97A 1VQ8V 1OCOB 2D6MA 1EAH1 4ES9A 3WU2Z 2F6BA 1QJU3 4R4ZA 1YQ6A 3R66A 1FNZA 4MVQA 1YTFB 2QQVA 4YVWC 1WB8A 2XG3A 4CCDA 2R1DA 3SPIA 2HHHB 1VQ7V 5FY7A 3RRDA 1RB8G 1NQDA 3M7MX 5CADA 2PELA 5EWSA 4QIWF 2YBPA 3ZMSA 3J9SA 1QNYA 4JYCA 3R4UA 3A21A 1D7PM 2VQTA 4LIUA 5FR3A 1YI2V 4B7KA 2R043 1HRV1 1VIWB 1VBC2 2RS52 2P2KA 2R9AA 1GNZA 3AVSA 3T4ZA 5FYTA 1AL0G 3N9QA 3H1IH 4LULA 5K8SA 1KC8W 1EUTA 2ZKNA 4FPCA 2VCAA 2CU5A 4GJYA 4CEYB 1RIRA 4Y3OA 4NYKA 4B3SB 1NA1C 1QXRA 1X33A 2BE3A 5FPBA 2WLLB 1BVP1 3JD73 3D3IA 5M0TA 1K33A 2VZOA 4HL0A 2XKOA 4N7UA 4TYSA 5JJJB 3PU3A 1OH4A 4UFIA 3TEZA 1BJQA 3BY6A 2PI4A 1NXD1 1OQEA 1W9SA 3T2OA 4PA4A 4ZONA 2A3YA 3O0XA 4RN5A 4D6RA 2YEVA 3PHMA 5J2UB 3O65A 1SDDB 3CMAV 1LJ7A 1D2DA 4IV1A 1E5IA 1PZ7A 3LIGA 1DK1A 3STZC 1J3QA 5EBLC 3D36C 1RHI1 2VQ0A 2R6QA 5KA5A 3GHMA 3FYIB 5F2SA 2WYSA 2R1BA 5BNPB 3K4AA 1IX9A 3LQCA 1P4RA 3PN1A 3U0ZA 1WAZA 1B3QA 5I8YA 1VE0A 3P5BA 1LOFC 5KA6A 5FZMA 2HFEC 5EBWC 4Q4W3 4QX8A 1NY71 4JDOA 4P9PA 5JCOA 1W9FA 5H9RA 4FPHA 4B08A 3D5OA 1ZX5A 3ZXLA 5LYJA 4P00B 1N36B 2CGPA 4MW8A 1I9RA 1RM1B 1H8TB 2QDOA 2YBSA 2F66C 2E7AA 1TUBA 4H14A 3P30A 3HOBA 2PA7A 3K9AA 5BR8B 5FMDA 2ZEYA 1SS3A 1RTVA 1O4ZA 1W6NB 3WW4A 2LQTA 5KUKA 4R9BA 1P84F 1PMHX 1NY72 4ET7A 3VV1A 4DR5B 4AVAA 2SBAA 2OTLV 2A71A 1YWKA 3O1SA 3ASOB 2OA2A 2B5UA 3TAYA 1WCDJ 5KHIA 5FKCA 2VR4A 5BMVA 4EFBA 3N36A 4JYYA 3LA2A 4D69A 3TETA 3N3HA 4CYDA 2Q4PA 1L3JA 3WDTA 2QM8A 2ZKOA 3WNOA 5ITZA 3SYQA 3D6EA 3AP5A 5LMUO 1AR72 2FDFA 1S0VA 3N35A 3IDBB 3SHRA 1LU2A 4E2QA 5CKQA 4JI1B 4AQYB 4G2KA 4EKWA 4NJ4A 3CC4V 3PU8A 3AG4B 4LHNA 3CCMV 4YPJA 4QU1A 3H9VA 4AVVA 3LOIA 3UGGA 1JYVA 4IEOA 1K5MB 2UURA 3NV1A 2VMGA 5K1PA 1HNZO 2JG8B 1EPZA 3DL3A 4Q0PA 4QKDA 5FJKA 1BK0A 2DYSC 4LH6A 3KZIZ 3ENRA 1OQDA 2KD7A 2NN4A 1KBHA 3AXDA 3FUQA 1Q43A 4PLNA 1VF5B 4Y20B 5L3GA 4P9YA 4DV2O 4P9XA 1PVC2 3M8AA 4BWOA 2B9UA 4CBCA 2D3RA 5JSOA 1WD3A 2JJ2G 1W9YA 2D44A 3GCXA 1UQXA 2GC3A 2Y6JA 5TISZ 3DXTA 2UWAA 4UW4A 5IJ0B 4P9JA 4DQAA 4QPKA 1FMD1 4UVAA 4XUTA 3FBYA 3G67A 4K20A 3WD5A 1ZBA3 1FOD3 2BQPA 3USUA 1ND3B 1NLQA 4PDWC 4Y1UA 3GVMA 2ZX3A 2WO3A 4Y22A 3J80N 5F2VO 1K4CC 4DPNA 3HPLC 4UBHA 3TCUA 4ZIBA 1OLME 1RUE2 2ARHA 4XBFA 1R093 3I3DA 4KG8A 2W08A 4QWNA 1YQ8A 4YW5A 2KXLA 2Y48A 4O9EA 1OHHG 4JGYA 3PVEA 4UCSA 1EYBA 5FZ8A 3A0BZ 2BP6A 5JZGA 4FP2A 1O7FA 2VMHA 3ZXFA 3HBKA 1XREA 5I0DA 1YF2A 1LODA 1KFXL 1TME1 1Q86W 1RXGA 4HN0A 4RS5A 3KQRA 4WV8A 4C1XA 5JR2A 3STLC 3JB4C 3ABLC 3L9JT 5KHKA 4JQRA 1VMFA 4B29A 1BHBA 1QH7A 4I0AA 5T54A 3WDYA 4QT6A 1DTOA 4FPGA 2Q0OC 2PUSA 4EFEA 2WAAA 2X7RB 3DYPA 3KQ4B 4P02B 3AMMA 4CEWB 3JB8A 1JZ7A 2ZJCA 5C9AC 5D5PA 2IJIA 2XLFA 1XYPA 3KT1A 1VQ5V 1SBFA 4Q26A 3LUTB 4IDZA 2JE7A 3BTYA 1B6QA 5EIYB 1WPXA 1X50A 2UWBA 1RUJ1 5DM6V 4FFKA 5L3FA 1YFYA 1TGOA 4X6QB 3O1MA 3VBHC 3PUHA 2DCYA 4GA9A 3DSQA 1MABG 1I5PA 5CYYA 4TWTA 3P3PA 1H1MA 2ZAHA 1IHMA 1H9WA 2ET7A 4Z1VA 3OYWA 4PDMA 3APQA 3RBZA 1V6OA 2QE3A 4GWIA 5FPLA 2VO5A 2WR9A 5A32B 2HKOA 5H5NA 5F5QA 3TYJA 5F3GA 2QCSB 1JU4A 4TT3G 2VOKA 3TN92 2RDRA 1ODNA 2YXHA 4PA7A 3I97A 4DV7O 4CCOA 1QDOA 4GZ9A 4LQRA 1FI2A 2Y60A 2V72A 5FUPA 5A3NA 4FJCC 4RR3C 3T2PA 2JDNA 2PHTA 5LHHA 4I0BA 1CJDA 4IYIA 2Y69C 2ZE5A 5FZEA 2UUAO 1VQKV 4P9IA 2VAUA 4DUXA 3BPSA 5LL6Y 3GWOA 5D8AC 3H0OA 4YVSC 4A6SA 4JI1O 1UZYA 2P4EA 4A45A 4JI2O 2HEPA 2LM3A 1VAVA 4CDQC 5L3CA 1A32A 4MVTA 5FDBA 1KFUL 3UGFA 4BK4A 4E8CA 3POYA 2CNAA 1FOD2 5AFBA 2OIGA 1VP6A 1WW7A 1WA6X 1J1LA 4GMP1 4MTXA 2XAFA 4XDLA 1QOTA 1JYIA 3W21A 1BMV2 2YUEA 3T3YA 3SKJE 1W0PA 4LUMA 3CCEV 1K3IA 2ARAA 1RUD1 1K5MA 4MGTA 3IKWA 1AR82 2W47A 3R6SA 2VQEB 5C3OA 3RWKX 3LWCA 1GM7A 3MO4A 4LP8A 4FM2A 3POWA 3OMAB 5EZWA 4CE8A 3ABUA 2N05A 3MW3A 4LBQD 1RUI3 5FZ9A 4EQVA 1YC61 4GH4B 5C33A 1ENSA 3BIEA 4IHJB 5T5OA 1RSOA 1J1TA 2GH2A 2R72A 2XWJB 3TB0A 3ZSKA 2P4KA 3HKEA 4L9BA 2IJHA 5EYPB 3SCGA 5I93A 4MW3A 1N3QA 1PIV1 5IVFA 1WW6A 4HONA 1Q8OA 1DU3D 2VBBA 3CRRA 3ZVXA 4DYLA 4RR3A 1XOYA 3ZPYA 4XHXA 4I50A 1OCCB 4NRQA 1DQ5A 3FHQA 3TNQA 1OVPA 2HWB3 4XCAA 3CS5A 3LGRA 1DQ1A 5L9BA 1K5SA 5JOXA 3MEPA 1H38A 2XTAA 4CS3A 2BTQB 4QQPA 4J10A 3IMNA 3WDUA 1S2KA 3RMXA 5EIBC 5B2GB 4YJ3B 1PZ9A 4W4ZA 2I45A 3U75A 4DUZO 2Y0OA 1ZRCA 3AMHA 3C90A 3POIA 1DGLA 2P6JA 1IPJA 2Q8CA 4KG0A 4LFAO 2LTNA 1XNRO 3RYCA 2P1BA 3VBSC 4FTSA 3I54A 4XXAA 3A2FA 5A3WA 5K0UB 5FLJA 3B77A 4K40A 1ZTEA 1GN6A 1SQPH 1ZBE1 2ZAAA 4NRPA 4IEPA 4H55A 3N9MA 4PIZA 1UU6A 1MQTC 1C5HA 5A7WA 1JYCA 2X5IB 2GTAA 4FTBA 3FZ3A 3N7KA 3CD6V 2DCTA 1S2BA 4FPEA 1G8MA 1SZTA 2X5IA 4L8QA 3UETA 5KMGA 1VRH3 5LGTA 1NCQC 4JI0B 1MS0A 2ZGRA 1SLTA 1Q8PA 2DV9A 2WFF3 1Q7YW 1F5JA 4E9KA 2IXLA 2YBKA 4O4HB 5BY5A 3RVYA 1UY4A 4FO9A 4KBZA 5KAIZ 1SA0B 1ND3A 1RUG2 1DFQA 2H3OA 1AP5A 4TV8B 2XOMA 2DU0A 5J09A 3M8LA 1F4HA 1WBFA 3L2YA 5FP3A 1AYM1 4QHBA 3ZFEB 2EZOA 4MUVA 2FB5A 4N9HA 3KT7A 1LENA 1VALA 1CJPA 4GIQA 3IDAA 3M3EA 3MUY1 1NCQA 5L9RA 2JDPA 2VZSA 1OD3A 5GZEA 1XNKA 3JUUA 5KMGB 1J83A 1FT9A 1MZFA 4GZRB 3E97A 4LWSB 3EXUA 2Z79A 2I74A 1XQ8A 3RYHB 1AYN3 4Y26A 1W28A 1GH6A 2ADEA 1U97A 3URFA 1PNFA 2A6XA 2XLAA 3BHPA 1X7NA 1JA8A 4YY3B 3PIGA 4OYUA 1D4M3 5IFPA 2GNTA 4GH4C 5T5PA 3T0AA 2RM22 3UKMA 1SG3A 2F23A 4XBLA 5F6LB 4FMTA 1MS8A 3DKWA 2AACA 2G9GA 3AB0A 4AAPA 3T08A 4RGGA 3HT1A 4MVSA 1JMKC 2W95A 2KSDA 1O3SA 4Q4Y1 3OM3B 4XXPA 5ANQA 1R1BA 4TUYB 2D3SA 1B04A 2WC2A 4NHMA 5CG8A 1XMOO 1MEC1 5FAXA 4NIIA 4QPIC 3ME2A 1N8RW 4GWMA 4NPRA 4RQEA 5CFDA 1F51A 1VB4A 1GZTA 2WZR3 4BIFA 5ITZB 4WBBA 3CEWA 2B1IA 1WW5A 4LNVA 3T1HO 2ZE7A 2YUAA 1GV9A 5FUNA 1NCRB 4I3GA 4EE2A 3ILRA 1ZVFA 2XQXA 1MOFA 3CCSV 4ATFA 2DUPA 1UOJA 3HT2A 3RSJA 3SQOA 5L3BA 4QX5A 3DUIA 2DMXA 1NJIW 4LXLA 4M01A 1Y6XA 4I0XB 3FLPA 1IBLO 2DVDA 3OGRA 3ELNA 4K8XA 1V54C 4OLLA 1XB9A 2E32A 2DYRC 2PHLA 3JYCA 1KRIA 1ZL8A 3FKSG 3MFCA 4EJRA 4GKKB 2B7YA 3ZRWB 3C3SA 3CMEV 2ZMNA 4A41A 3O1OA 1HW7A 4CS2A 4RWUA 2OZJA 2F4VB 4YRDA 1EN4A 1OD5A 5JIUA 3K9SA 4B3MO 3BEHA 4LO7A 2RDCA 1VBB1 2E5LB 1XHXA 4MSWC 2ZBJA 4QU2A 5LMNO 1XNTA 1FXVA 1HRI1 4AHZA 1FV2A 1K73W 4N8MA 5A6XA 3PTYA 1Z78A 2Q5TA 3VHNA 2ARXA 1UY3A 1OURA 1W2UA 4CUAA 1GP4A 1GNHA 2FBEA 1S76D 1F5FA 3CWBH 2ENRA 2XH6A 3ZN4A 3ZN6A 5E8AA 4COUA 4F6RB 5AC93 2I2SA 1DP0A 1N32B 1L0NH 3CX5F 1PNGA 5LY2A 4COVA 2YGLA 4LBJA 1QJX1 1RJ8A 2EILB 4XZPA 2CDPA 4IETA 2EIDA 4LF8B 4AEDB 1QR8A 5KC6A 4KWUA 3DCQA 2WUHA 4LLFA 3FAVA 2ETEA 1BLZA 3MZHA 1NOVA 1V0AA 1QU0A 3WG4A 5KHJA 4YW2A 3ZLIA 1FXHA 1VJ2A 1RMU3 2LW7A 3B00A 3CZJA 4BDVB 3RYCB 5F2WA 3OJBA 5IYYA 4MO3M 4MGIE 1IS6A 1EAH3 4NWVA 3E6CC 2VZUA 4QXHA 5SV8A 3O9OA 3IIIA 4BXSV 1VQOV 3VD7A 4GB33 3F95A 4QX0A 4DV7B 1N1SA 4MTOA 2WZEA 3AG1C 2R49A 5FQ0B 4MZUA 4Z92B 1THZA 3K79A 5KAFZ 5IDJA 4OFGA 3MBWA 2Y4TA 1HDJA 3GZEA 1ZREA 3VDDC 1XBLA 2NM1A 2ZX0A 5EC1C 4YJ2A 4J7JA 2JDKA 4DR5O 2PHRA 3E89A 2IU0A 1HRV2 5DAVA 4R9AA 3KCYA 4CCNA 4NXNO 5H9PA 1FYUA 4CCEA 3ETDA 1I7FA 3S5QA 1AUYA 3M7AA 4I0WB 1RUH1 2Y0IA 1M56B 4KFMA 5GONB 3FB8C 1FAYA 2N04A 4L2NA 4AI1A 3F5TA 5A2QN 1X4TA 4LKEA 2HLDG 5LB6A 2WSVA 1CAWB 4I9QA 3Q4HA 2OYQA 2VZ3A 2VOTA 3KKYA 4DV3B 2QQJA 5A6ZA 4Y22B 3I3EA 3MLJA 4Q4X3 2E53A 1H8VA 4E4HA 4LBQA 4X6RB 5JCOC 3FJSA 1YHQV 1OC1A 2DVAA 5HXVA 4Y24A 4MX3A 3K48A 3CBNA 1LOFA 2WLMA 3QH7A 4C7UA 3WNLA 1UXZA 2DW4A 3NWKA 3GCWA 4QQ2A 1GN2A 1H2SB 5FPUA 1Z7S3 5FZCA 2JJ1G 4MXWB 1V6LA 4QB1A 1UX6A 4QJFB 4DR4O 1JZ4A 5H9CA 1P49A 2AEYA 1OSGA 1VRH2 1UF2C 3IWZA 1HRI2 1LECA 3LFMA 5T3NA 1DQ6A 5FZ0A 5E16A 2HWF3 3WB2A 4E4EA 2WKKA 5CA3A 4HVRA 2QM7A 3BABA 2W2IA 2QWOB 2RMU3 5DZGA 4QQOA 4M3CE 4JX0A 1SDWA 2R071 1F7YA 2W1UA 3SJBC 1CD3G 5L9VA 1GR3A 1PM4A 4DK1A 3MUZ1 4YWAA 2AW9A 4CDUA 2EALA 3AZYA 1GMMA 1JFFA 1DF4A 2A6VA 5C8CB 1EP0A 4Q8KA 5LHGA 5FY5A 1AR61 4IUGA 5C8CA 1YXWA 2B39A 1AR93 4JF3A 4DY5A 2HVKC 3SPGA 2ZQMA 3I2GA 1VQ6V 3D3AA 2PAEA 1JI6A 1W03A 2Y4UA 2BCCH 5KBFA 2RR13 2WABA 1K42A 4CP9A 3CPWU 4Q8LA 5L7OC 1OV9A 1ROPA 4GT1A 4B1MA 5JXJA 4D8MA 1RM1C 3AG3C 4MG2A 4U3JA 4X66O 4MGYE 1AR83 1CPMA 5FZ4A 3VUOA 4XFIA 3GZTB 1HWYA 3R05A 2BW8A 5T5LA 1O59A 2A9HA 1ZBE2 3R0RA 4L92A 1JZ5A 2XAQA 3HKCA 3AL6A 5DUXA 4WVWA 2F43G 2IVJA 4JPRA 4BAYA 1N3PA 1LUWA 2Q1FA 2R063 1K9MW 3JATA 1XXNA 4NB5A 5LRRA 1W8NA 4FSJA 3FAVB 4NAOA 1VRBA 4NHXA 3H8OA 3RNSA 4K8RB 1BS3A 4UFZA 1EN6A 5BNNC 1H8TA 2Q30A 2GNBA 5FUIA 1V55B 4Q20A 3DC6A 1PX3A 3VZOA 4HMZA 2ZEXA 2QQMA 4DR1O 1V9U1 2OTJV 3WG3A 5A33A 5HCAA 2W92A 3Q4HB 3AP9A 5B3SC 3U14A 5K0UA 2WNOA 3OFNG 1L8DA 1QQP3 1W6PA 5ISLA 2W0XA 4EROA 4LLOA 5GONA 3CDZB 1VAKA 1LB2A 1SACA 4JGZA 4DW1A 2HWC1 4MYEA 1WCKA 1W90A 5LZ6A 4CCCA 4G27B 1QHTA 3BIWE 3IT8A 1SQVH 3KHCA 1Y9MA 1A34A 1OMIA 3T0BA 3ZFGB 3MHSC 5CA0B 1SBEA 4UI9L 3SPJA 3HWJA 3UV9A 2ADQB 2DWRA 5B1OA 5IK5A 2EIEA 2JG8C 2CGNA 1X82A 5EYXA 1O4YA 4BYYA 3O1VA 2D6NA 2AXTZ 4GJZA 1S5JA 3ZYBA 3MGUA 3ETPA 3DEMA 2LRPA 2QWPB 2P5OA 5B1NA 1RUD2 5FY1A 1OHFA 3SXWA 4Q0SA 2VMFA 4DUVA 1V00A 4FZ1A 3DYMA 3POEA 3GHNA 3N7JA 1BT8A 3MW4A 4KMQA 3WF1A 3FLRA 3SLIA 1QJY2 4WFGA 2ZCEA 3LEIA 4QXKA 4AI9A 2JRIA 3HKBB 1NLSA 1VQNV 1NE6A 3U37A 2ZDIA 4JI3B 4KL1A 4BW5A 4FP3A 5I0TA 2CDOA 4L97A 2J7MA 4YM3A 4NR1A 4TLGA 1Y4MA 4UF0A 1GK9A 1QJZA 5I8TA 5JIAA 4PF1A 2ITDC 5CFCB 4I5SA 1SQGA 5DZEA 3ZMNA 4NROA 1V6MA 4H2AA 3HNYM 4DV1O 2YXYA 2MEV2 2LS6A 4K1YA 2JDUA 1ULPA 2HWD1 3PUQA 2FDIA 3F2ZA 3FHAA 1OCZB 1VBD1 2MEV1 3K51A 5B1AB 1VQLV 1LOCA 3BVOA 5FP7A 4EEQA 5HV0A 3VLBB 3WG7C 3SYAA 4A5UB 1I94O 1A8MA 3SCFA 1JJOA 4LKSA 4Q6GA 1O5LA 3BN6A 4B4PA 5K1XA 3LD8A 3UGHA 2FL4A 5C3PA 3CCRV 3PMSA 5EBMC 4LBEC 4ZHQA 2GUZA 4NVPA 4DV4O 3RYKA 5GJ6A 5LK5A 1Y4WA 1D5NA 2VULA 4CXWA 1O3TA 2A3WA 2WNUB 3RYPA 4RO2A 4PQ9A 1W59A 5A7QA 4YZ5A 2QKDA 3E8GA 2ZXQA 4W8JA 1HB1A 1K92A 5IYDO 4DXSA 4ES8A 2EINB 3UO2A 4WFEA 2G9ZA 2Y64A 1WCUA 2WLJA 3AFGA 3P6BA 2VBDA 4M4PA 3VD4A 4IEWA 3MLLA 4HYOA 1ZZ6A 5FK7A 4CC6A 1BMV1 5KXBA 3ML0A 2ZPXA 3L70H 2OT5A 3BAAA 5A6QA 1OFNA 3UO3A 2VG9A 4FTEA 1QR9A 1FYJA 1Z0HA 2IH3C 2R32A 4JC1A 4YM2A 5IWAB 1NT2B 5J2UA 1ZRRA 1GOFA 4Y1ZA 4LH7A 4KHPO 5CAZA 3H1YA 1YUDA 4QDRA 1TMF1 5F1RA 5IHRA 4ZBMA 1DZQA 4AQ6A 3B93A 3K4ZA 4N7IA 3WW2A 1RUE1 3W5MA 5IY5B 4EN6B 5GZDA 1Z2GA 4CP9B 5LATA 3DTUB 3J7NA 2GC2A 1FX5A 3CRCA 3M3IA 4KXRA 2XGXA 2DVGA 2QVSB 2FMDA 4YFWA 1RUF3 4BJ0A 4OULA 1CPYA 2E63A 4A42A 2XDVA 5KX5A 2LJ2A 3GGLA 5JZGC 3HNBM 4BU2A 4F8AA 5LRSA 3X2QC 3TN91 3VBOB 4PBOA 1KMIZ 3THTA 3VD3A 4N43C 1R64A 5CBGA 1N3OA 4WZCA 2W91A 4BIOA 2JDHA 2C24A 1IBKO 1DF5A 2HWE3 4JGZC 2FDHA 1Y76B 4Z1MG 1SLIA 3NNLA 3VBRA 4FQZA 3T2QA 1XU2A 1NS1A 5LGNA 3ZFFA 2MK3A 5FPOA 1DQ4A 4I55A 3W58A 3CJIB 5JOYA 1ZL8B 3T1MA 2WQ8A 4AFBA 4XDOA 3VBUA 4I55B 1KGYA 4X8PA 4GCZA 1NTKH 1G9CA 3HKDA 3TGUH 1HXS3 1OH3A 1GZWA 1N1TA 4IEXA 1R3JC 5IK7A 2WS91 3SISA 1O3RA 3D0SA 1JBCA 1FPN2 4D6SA 1RGSA 5A7NA 3HAGA 4TV9A 1C57A 3KT4A 5FZHA 5IJ0A 3VBSB 1UW8A 5DDJ3 4EN8B 4XZUG 3WNXA 2RS13 1FNYA 2PHWA 1EPWA 1HJGA 5ACA3 4OGQB 3S57A 1H1IA 5IATA 3RN4A 2VVEA 4X89A 3SH4A 2JDMA 4X20B 4BQWA 3ZXKA 2ID4A 4FFBA 5JSPA 2YIBD 1JHJA 2CYFA 3ZYIB 2VUCA 5FQ0A 1NU1H 4TOIA 2ZOEB 5A1AA 2R9IA 3JD72 5CEHA 4QB6A 4XUPA 1N4CA 4MGZE 3NKGA 4B3RB 3JALA 2A75A 3ZXJA 4M3CB 4DB5A 4XHBA 2YI9A 3E22B 4LA3A 3OR7C 1LESA 2ES3A 3VGIA 3KG2A 5FFOC 3PJYA 3MIBA 4X9QA 5DEDA 3E5UA 1M1KW 4WM8B 4XFHA 1XL6A 4DO2A 1HX6A 4AVCA 3D36A 4AL9A 1OA2A 1YFWA 4AXOA 1BEV3 5FZ1A 4NN0A 1AI4A 2GNDA 4TQDA 1JR9A 2VWJA 3IC7A 1UYXA 3ASNB 1CEZA 2ZHKA 2PLV3 2VVFA 5EHDA 3DN7A 4QPGB 3IMMA 1V6KA 1RUI2 3W9AA 5EPAA 2AREA 2ZGPA 3C7OA 2IWGB 3CC7V 3IB3A 5JMCA 3V0AB 4DR7O 4LOSA 3AMPA 3FBMA 3MDPA 3JXSA 1KKCA 3NJYA 2D6LX 4UUJC 5C5UA 3RYFA 1QQP2 4RYDA 1DGWA 1L7RA 3P32A 5DQ0A 5AG2A 5KR7A 1GSLA 3VL8A 2WLNA 1HV1A 1K5QA 3H1HH 1RVF3 2TUNA 3CNAA 3KGZA 3KS7A 2D43A 5C8YA 1D4M1 1UN1A 4QMAA 4BMEA 4WFFA 1IURA 4EN0A 4UXNA 2VQFO 4LBMA 5K9YA 1IOAA 2W1SA 2Y6KA 4FOVA 5LBQA 1HN1A 2J42A 2GN3A 2QJVA 4NXMB 1URXA 4DOUA 3USSA 3N2KB 5FP9A 1CGPA 3AMQA 1AR92 3I55V 1Y43B 1WD4A 1A3KA 4R7CA 3OF1A 3O0WA 4JI7O 2VZTA 4DR2B 1BHGA 2ZE6A 2VUDA 3O12A 5FLHA 1RFYA 4XPVA 2V7QG 2GSMB 3K5NA 5DUWA 3G6EV 4RAIA 5A1FA 2XWBB 1OT5A 3ZHSA 4CDUB 3Q8AA 2YDEA 5CN0A 3FMGA 4RGAA 1QNWA 3LFIA 2OZ6A 3MV01 3K3NA 5FPZA 1Q6IA 4EB6A 5I8SA 2PQSA 1VMJA 2YXSA 2VBPA 3ZYFA 4XTMA 3WCSA 5JQGA 1TNFA 2C5DA 2ZEZA 2PYJA 3WT3A 1VBE1 3H3UA 3I4IA 2OS2A 3CQOA 3GNEA 4TSVA 3AP6A 4PIXA 4AYUA 1XI1A 3LDDA 4AQYO 1IBMB 4EZHA 2WFF2 4BIUA 2EULA 3EXAA 3PVNA 4UWDA 5FY0A 1RITA 3WF0A 1HNXB 1R083 3B9IA 1UOFA 2VS0A 3IM0A 4XF0A 4FAGA 3DYOA 3WX5A 2EXKA 3MPPG 1RP3B 1J5EB 1V6IA 5EZYA 1NBMG 2RR12 1HR0B 4ZI7B 3PNAA 2DDUA 3OTOO 4BPZA 4BQ2A 1I0HA 2HVJC 1GUIA 1KS4A 1HRV3 4FPJA 5J3UA 2VJXA 2FDKA 2BOCC 3UESA 1H4HA 2WT2A 5JH7B 3E5XA 1UYYA 4X8NA 3V0BB 2ZGLA 1IS3A 3N9NA 5EV7A 3VBHB 3BCCH 1JCHA 4YXWG 4X1IA 3MV11 4Q1PA 2D7FA 1IBKB 2GC1A 1PMJX 4H7LA 2FDGA 4I7ZB 1COWG 3QH6A 4CPBD 3IAYA 4ZU5A 4JAAA 4YGEA 4GX1A 1JZ2A 3MHZA 4OQ9A 1BHAA 2DYRB 4RQPA 3WQBA 4DZGA 3SDLA 2DBNA 3SPCA 3A7QA 2R9RB 1ULEA 1RHI3 2KQXA 1DZRA 3CIHA 3AXEA 4ZXKA 4FK5C 1W04A 1YQCA 4RSUA 1CESA 3ACLA 3GXUA 1AR5A 3OEBA 3RT3C 1M5IA 4ZHQB 2D2CB 2J22A 3TEWA 2FKXA 5CFDC 1UL9A 2JG9C 1XE7A 5GZCA 3M99B 3QO7A 4HVOA 2Q1MA 1J84A 4LNUB 1L7QA 3K75B 5DAPA 4K6BA 2RM23 3ILFA 1X8EA 5JUVA 3AZXA 4DUZB 1TE1B 1Z5WA 2Z5WA 4BB3A 5KXEA 1POQA 1SESA 5IT6A 2BPA2 2XJTA 5CG9A 4P5HA 2RJZA 5JVDA 1WJZA 1KXGA 4FPOB 4RD7A 1MZ5A 2FCVA 2TNFA 1W0KG 3JQXA 1TAEA 1LR1A 1MS9A 3ES1A 4J7KA 3OE7G 1KUQA 4I9WA 5J98B 3RYFB 4OI1A 4E2SA 3LA3A 3S0MA 1OA3A 5JJEB 3D4KA 1CAUA 3QBQA 3WOGA 3VL9A 1IS4A 1OKQA 2BGOA 4ABMA 1K12A 2BTVC 2YIAA 3HEIA 4FPKA 5D8AA 3NO8A 1URFA 4Q4V1 3J7AU 2HYKA 1JUHA 2F4VO 2PN5A 3LDBA 2GMEA 1S0GA 2WLHA 1MZEA 1R6KA 2IFWA 5GKAC 5GTIZ 2IXIA 2GTSA 2EXIA 4DR6B 2KG7B 2CDYA 1EV11 2NMNA 4JI5O 4BM8A 4YW3A 4UXAA 1UMZA 1E1RG 2RMKB 3BUCA 2LP7A 3RZGA 1UKRA 4OHVA 3OGGA 4AI3A 5LA6A 2VTXA 1AJNA 1VMHA 1RC6A 4LF6O 4DV5B 1Q6UA 4F6RA 2DQ3A 4QXBA 1W2TA 4UFHA 4AGVA 2UXNA 1OF4A 2BGCA 1FXZA 5L7OB 1I5YA 1OKOA 3V0AA 3A0RA 1R6NA 2AEZA 1H8HG 2UUBO 5LOVB 3M4FA 4PI2A 2IZWA 2DCZA 3ZJZA 4AI2A 2ARCA 3WHUA 1VEWA 2BFUS 4CDUC 2ORXA 4JRAA 2ITCC 3SCHA 3HBZA 1SETA 1O8PA 2VMIA 2B45X 4XJAA 4EN7B 2WRAA 2GSYA 4K8ZA 1BQPA 4LHLA 4YZ2A 4R8CA 2WLQA 2LUWA 1YFUA 2RJKA 2R16A 3OGCC 1ND2A 2DU1A 1AL23 5IFTA 2WDBA 2H6BA 2WYFA 4K8FA 2QDNA 4KH9A 4TV9B 4CU9A 3WQ0A 2UU8A 2YC4A 1CP9A 2OCHA 2QZ3A 1CAXA 2DTYA 3LZZA 2BNNA 1Q81W 4X1KA 1SQFA 1QOSA 2YPDA 4B4QA 3H8XA 4CU7A 4JKMA 3B9CA 2Z3YA 3NRUA 1CXZB 3H42B 1C8M3 5FY8A 5LBEA 5CFCC 3MIDA 2ZEWA 2UXCO 1W6QA 3G7DA 3ACFA 4NIDA 2XL9A 1NG0A 5A33B 2JK5C 5HFMA 2IJKA 1MS4A 3WV6A 2BZDA 3RYHA 4PIYA 3JQWA 1LUVA 2IU3A 2XUMA 1FJGB 3V0BA 4XCBA 4MVUA 3VBRB 4N53B 3B02A 4E4SA 2QWNB 2Z2SB 3I7DA 4L99A 2JDYA 3IIAA 3A23A 3BYWA 2X09A 5H6QA 1ZRDA 1NCQB 3LB9A 4N23A 3Q8BA 2KR2A 4I4TA 4UCOA 1R3KC 1F4MA 3AYCA 1QIQA 4XVHA 2AENA 2O0OA 4HANA 2FD8A 4IV3A 4X65B 1UYPA 4F7ZA 4INDA 1W9WA 3JASB 3B09A 1E79G 4UW3A 2A7WA 1UIJA 5IW0A 4AI0A 2E75B 1OPOA 4BW9A 5A3OA 5C4WA 4XC9A 4NIGA 1NZIA 1GLHA 1ENVA 1W99A 4XW3A 3J8F3 4YSFA 4LFBB 2HKXA 4JHZA 3BODA 1LHVA 1VAMA 3ZKYA 4LMFA 3SC7X 2H8PC 3PTRB 2XJQA 4D7TA 1YJNV 1W8FA 1ZRIA 4BQ3A 2N7GA 1CWPA 5FPXA 5LWBA 4IERA 4QAWA 1PK6A 3CCLV 5FXWA 3L71H 3C7HA 1XL4A 5JXIA 1P8JA 2HEYF 1POV1 1M9NA 4CCLA 5HCHA 1HB2A 1NH2D 1ASJ2 3NNJA 4MVOA 2IUWA 1PL0A 5L36A 1VBA1 4RQFA 2VU9A 2ZXWC 5IYZA 1AJOA 4XF1A 1PHMA 3N9LA 4MVZA 5FZ6A 5FZKA 5CMUA 4RL7A 5LBFA 4EWEA 5AVPA 1KD7A 3AG1B 1PK6C 1UFIA 4TQFA 2R061 2PF4E 4MVMA 1QWRA 1MS5A 2C2AA 4WZFA 3JCUZ 3WHTA 4DIQA 3NJXA 4CUGA 1V55C 1I94B 4LF5O 1H30A 2WWSA 3THCA 4B3TO 3AG7A 3T09A 1ASJ1 1OJHA 2IW5A 5LA6B 1MS1A 1S4CA 3OGJA 4FIPC 4LO4B 4OCTA 4A6OA 1D2QA 2ZINA 5A3LA 2QQNA 5F3IA 3CYOA 4GKJO 2YPJA 2C1FA 5F6KA 4CDWA 1LRHA 2ZNJA 1GRJA 3ZYPA 5EQUA 2JGUA 1GWLA 4UCUA 5FYYA 4JYAB 5C8CC 1OI6A 1KP3A 4AE2A 1IKPA 2P37A 4UFKA 3OTFA 1QQP1 4RS5B 4JGSA 5FP8A 2UU9B 3RZZA 1NTMH 4CC5A 2BV4A 2HWC3 3K03A 3OD0A 3DXUA 4QDQA 5FZIA 3CMGA 5T52A 1Y74A 3OMNB 5IYZB 3JU9A 3U07A 4LCUC 3U4XA 3ZN6B 4X62O 1MEC3 3SEEA 3OEEG 1YQ2A 4PDRA 1UOGA 2W5FA 2ZNIA 2VRZA 1JQ0A 2XJUA 2VPVA 1XPWA 3SJCC 4LT5A 1NUKA 4D6QA 5CNAA 2WZR1 5A7SA 4Z07A 1S0DA 1BKZA 4WVMA 3HKBA 1N47A 4NKGB 5BPXA 3JBG2 1K8AW 2X8KA 4LTAA 5FO8B 3B4SA 4BA6A 2YZ4A 4I4TB 1DYPA 1W8UA 1MSWD 3Q8CA 4X62B 2CWMA 2XBO1 4CPBA 2A6WA 4I50B 1SLAA 1QEXA 5FYHA 2WLIB 4LHSA 3ABLB 1KP2A 3KGLA 1BYHA 2AHZA 4MLOA 2BJSA 4DR3O 1AXZA 4BR6A 3M2MA 4JYBA 1ORQC 1X8MA 3N7LA 1PGW1 3HQRA 3ZMOA 3LSEA 2BRTA 2WQZC 2QQUA 3OPWA 4QX1A 2PYLA 4R8HA 2VTXJ 1NYWA 2QTOA 4L0PA 4O65A 3I2JA 3FN9A 4OMDA 4MTFA 4OXSA 2VE1A 1U96A 2FMYA 1RUJ2 2WS92 4HT1T 1XMQB 4Z2WA 3QF7A 2OCCB 3KV9A 2JD9A 2VTFA 3BTXA 1MEC2 4IYHA 4Q4W2 5EZYB 1Y76A 1PKXA 2GC0A 3CZUA 5ABJA 4GKXA 1YDXA 4HOOA 1KQSU 1QHDA 2VCBA 2CY6A 3EMRA 3ZX7A 2ZGSA 2JENA 4ARXA 2EAKA 5LHIA 3J7LA 2OPKA 3I59A 1W39A 2OXBA 4QKFA 4IEQA 3B5LB 4QE7A 3NR7A 5LXTB 3F7YC 2IM9A 2QQWA 2E5LO 1C28A 1WZXA 4NTXA 2K9ZA 4MT8A 2ZGNA 1WLTA 4UW5A 1V9U2 1EY2A 4PD4F 2A06H 2HBUA 1LR5A 5BMVB 3LSUA 1NR7A 2Y6LA 5JQGB 3AKPA 4HVQA 1VRH1 2B9ZA 1EN5A 3VDCA 4LF9B 2FCUA 2ZD9A 1UU4A 2WSUA 2CTPA 4AGGA 2JE8A 3B69A 4D7YA 3EBRA 1MQTA 1VQ9V 4B3MB 1G86A 4CTEA 5FZDA 2ZCWA 2RS53 5BXZA 5IAXA 1AYM2 1E57A 3L75H 3VN4A 1UCXA 1AVMA 2AZ2A 2RDQA 4MGQA 4WM7A 4NAMA 3JAKA 4XBQA 2DTWA 4WFHA 3NNGA 4Q4W1 5HI0A 3FFZA 3THDA 2JG9A 4LF8O 1R082 4QM9A 3WUCA 5E79Z 2GDFA 5BNPC 2XAJA 1N33B 2VQFB 5F3EA 2BYVE 2VOVA 3ZXGA 4IW3A 2C0ZA 4B8EA 3PLQA 1ZZ8A 1BBT3 2W3JA 3EHKA 1RUC3 5C8YB 5LY1A 3OUFA 5F5IA 4AG4A 1VBD2 2WNUA 3RDIA 1RINA 1W0OA 1JOYA 3EJKA 5A3MA 5FZ3A 4RHV1 4JV5B 3ASNC 3QO5A 4P5YA 4DV4B 2RS33 5E6HA 3HKCB 4MOAA 1SLCA 4G28B 3KV4A 4I2OA 4JZRA 3BB6A 5C3RA 1ZA4A 3H1KH 4FOQA 2JE9A 3ABKB 3AG2B 2A3XA 1SQXH 3AKRA 1GN3A 4IV1B 1QJY3 2C9AA 5I91A 3SKVA 2E74B 5BXXA 5GZFA 3WG2A 3K3OA 3CCJV 1BQ0A 2XAGA 3CL1A 4GYCB 2YB7A 2UUBB 2L9LA 3OUJA 4NIHA 3Q9OA 1PO13 2EIJC 3T4DA 4IEZA 1IPSA 4GX2A 2QM4A 2OYZA 5GALA 5DN2A 4RUEA 1VF7A 2JJ6A 3TEYA 3IZOA 3ZMVA 4TSFG 1ZBA2 5H6RA 1AF9A 4LNUA 4RQPB 4ICGA 4NO4A 3OGIB 1AYN1 5LK7B 1N36O 1JZ8A 4MGKE 2DF7A 5LA0A 3ZO0B 4CXXA 4ZZ8A 1COV3 5LA1A 1H8TC 2PAKA 1S72V 4Q0VA 2WNEA 4XOGA 1F31A 4X1YB 3ZPOA 2IXJA 4IE6A 4X88A 2XLGA 4H44B 5IK4A 3AZVA 2JB8A 2VZPA 3U10A 1OCRC 3GDBA 4AQ2A 4EWDA 2RV9A 5K4LA 2LROA 4LF4B 2GP3A 3BOWA 4Q4Y3 4Q0UA 3WNNA 3T2TA 3LA7A 1VB2A 1Y9QA 5F7UA 1FFXB 1T6BX 3LCPA 2PLV2 3VBBA 5FZOB 3CRMA 4FOYA 5D1IA 2SLIA 1F23A 4TN7A 5JXGA 1NXMA 3ROUA 1OCOC 1QBZA 1POV0 4MVRA 2EBOA 4UCVA 1WLCA 3GBFA 4ZZ5A 1KJRA 4LR4A 1OUSA 5FY4A 4QGMA 1PO22 4NIAA 5IYCO 3UKNA 4Y4YA 2QEXV 3BOPA 4CVUA 3KZ4C 2CUGA 2O57A 4GKKO 3CCQV 3PJQA 3SH5A 4CDXA 4F6EA 3H50A 1VQMV 3VQVA 4E2LA 3CU7A 3RMYA 5FKBA 1V54B 4CRQA 1AR91 3DECA 1JN2P 4J6GA 1FXKB 1YXBA 4QQLA 2QUOA 3ZRVA 4FPLA 4HN1A 5JDBA 1V70A 3LSSA 5IVBA 1R3LC 2VNRA 4J9YB 3SNMA 4XFGA 2C4XA 2Z42A 5FYSA 5FZFA 5AVAA 3WVJA 1PZ8A 1JOBA 2JKBA 1I6XA 3TK1A 4XQWA 5B5EZ 5BNOA 4I01A 4BZ4A 3O1PA 5CBLA 5HCBA 1YJWV 2OWOA 5JR7B 2WAMA 1FKAO 3OGVA 3J81N 2FYUH 1H2MA 5F8PA 1TME3 1US3A 2P67A 3DXRB 1RVF1 3H7YA 2RNBA 2F4LA 1MR5A 5DN6G 1PD3A 4O4IB 5KXDA 5DG2A 3WP3A 4AVBA 4DY3A 3ZHTA 2CAUA 3FD9A 5FOBB 3A0HZ 3QO8A 2WL1A 4R4XA 1Z7S2 3AZWA 4QHOA 4QX3A 1FPN1 2X5IC 3OBZA 1GZ9A 4GX5A 1W3VA 3DKQA 3LAGA 2VZ1A 2NLRA 4HKLA 3WR0A 1U12A 3VQXA 3OUSA 4U7OA 2HYXA 3ZHRA 1AJPA 2YY1A 4FM1A 2WO7A 4WM7B 3NV4A 3VZJA 1JUIA 5FYZA 4XTPA 5BNOB 3MDSA 4W4KA 1W2OA 2YIBA 2HWB2 1W8TA 4CA9A 3JD0A 2NZ9A 4W4LA 3VKOA 1PNLA 5C6CA 1RUJ3 1ZUQA 2QTWB 2UUCB 4URTA 3O7OA 3CJHB 1LOEA 2AZ0A 2Z4FA 4P08A 2ZX4A 2P7TC 1BK1A 4Q5OA 5FYBA 4E8DA 2IVIB 3TJTA 4CCJA 4YY3O 3VQYA 1BMFG 3KV6A 5GLVA 5BNNB 2EIKB 2EIJB 1UYZA 2BNMA 4C1WA 1R081 3ZRSA 3I3MA 4WCEV 3DC5A 4HETA 1NKDA 1MA1A 3TOJA 5B3SB 1KB9F 5ABJC 3LNNA 3GJBA 4COYA 3HVDA 3C8XA 3X2QB 4J9ZB 5AC92 1PM7A 2E7QA 3AEIA 2ZHNA 1AX0A 1W2BU 5FMCA 2WPDG 3ACGA 3H3ZA 4CUCA 3T0DA 2ODMA 1QF3A 4XUQA 5ABJB 3JBG3 2QBXA 4PF5A 4H7MA 5I0SA 2H94A 1ULGA 3VKNA 2D98A 3FE5A 2VD7A 3KCCA 1OZ0A 5FZ7A 4QM8A 2VUJA 4CH4A 4OPAA 3D82A 3M70A 3WUDA 1JX9A 1N34O 1O5UA 4AEMA 2YYOA 1WBLA 4L8JA 4YLZA 4DR1B 1LKNA 5IUQA 4C8DA 1XYOA 2MPFA 4YM0A 3S7EA 1NLRA 5C5TA 4DUYB 3CB2A 4BLIA 4O2BA 2XBO2 4ZI7A 1DG6A 1GQPA 3UK9A 1GM9A 2R041 1RL3A 3WINE 5JOWA 2IXKA 3AP7A 1GICA 4F4LA 5J96B 3H8RA 2WT1A 1Z7S1 3UL2A 3AG4C 2DFCA 1TA8A 4Q4Y2 2BWAA 5LEKA 4AHXA 4N53A 4CDWC 2ZZJA 1TMF2 3LDKA 4QNHB 4D3WA 4DV2B 1R1A3 2P5BA 4DO0A 4ASLA 1ULDA 1QJU2 3KF3A 4NXNB 5CZKA 5LMNB 1J3RA 5EK0A 1P7BA 1QJEA 4JI4B 4NE9A 3MFAA 1BZWA 3R65A 1WN7A 2HJIA 3PVOA 1MZ6A 3R4DB 4XFBA 1X59A 4JTOA 1AR71 2A73B 1ST8A 1B06A 3QVNA 5C3SA 3VKMA 1SQQH 4B3SO 3RG0A 2JEMA 1QXJA 4J1WA 4X64O 1VLNA 4DR7B 2W1QA 3VHOA 3ABMB 2XR4A 3OMIB 5A32A 2YV8A 4XFFA 4X65O 4OI0A 3RVHA 3VBOA 2EF6A 2ORZA 3F5WC 3ZDVA 3FB5C 2LGWA 1RXFA 4XMIA 4FFIA 4MH0E 2CK3G 3LKJA 4XMAA 3K0GA 1F15A 1BGYH 5FYMA 3WLUA 1DCSA 2X0LA 4AVSA 1REDA 1CX1A 5FLIA 3J4UH 2QKSA 4A4AA 1SFYA 3OCPA 3CJXA 1QGLA 2CL2A 1UY2A 5D8AB 1K4DC 3K06A 1MMMA 1B35A 1SC5B 4TLFA 3AX4A 3ZDSA 1ZZ9A 5B1BB 2R062 4JRLA 3OY8A 1DF0A 5FZGA 5A6YA 4PT6A 3QCWA 1RJ7A 2HWD2 4JKLA 2WQ4A 4IIJB 1HNWB 4CH5A 4AEJA 3GALA 4HAMA 1Y9GA 4MTGA 4AHYA 5JAXA 4MADA 1FD9A 3NAPB 4Q0QA 3K5MA 3ORJA 3AKSA 1AL21 1PX4A 4OUMA 4D0QA 3I3BA 3SYOA 3LDRA 4P2ZA 1UXXX 2D5FA 3KB5A 1W0NA 4CXYA 4PA6A 1WLEA 2J1TA 5LP6B 2WA4A 1GO3F 4NTYA 2D3PA 3ZFEC 1R73A 2TBVA 4YG6A 1PM9A 4OX9B 1ZM1A 5JCTA 2P17A 2FCTA 3SGIA 4BHPA 4HPKA 4LK6A 2QFEA 1X36A 1DHKB 4LUKA 2AC1A 3ZMTA 2E76B 5APAA 1RUNA 1KYOF 2HR3A 2ZIMA 5FBZA 2H6CA 5CA6A 2JKXA 4MS2A 5LGUA 3K2OA 4O4JB 2O8OA 3NV2A 2XNDG 4XQDA 3WB0A 3VBHA 2WLPA 4NWWA 3KWVA 2WIIB 1UD1A 4CEWC 5EXOA 3RVZA 1ZZBA 2ZR3A 5EYPA 2QZ2A 3RI8A 3U4SA 1HR0O 4LITA 3KVBA 1H6XA 4KNCA 4IE0A 5E88A 2AUYA 4YIPA 4QXCA 5ACA1 4CZZA 3QD6A 2BVBA 1M57C 5G04L 3RS6A 5JXHA 3H7JA 1R6TA 1J3PA 2GU9A 5FMOS 3MIEA 4UB6Z 2WT0A 4E4DX 3WY6A 5DXDA 2WLLA 3I49A 3OSDA 3DPRC 2JGDB 3K5LA 4C0HA 1US6A 5IYBO 4XF9A 5KC5A 3TWIA 1CQ9A 1PMIA 5EJZB 1D4VB 3FC0A 2PXJA 1KDKA 4YW6A 3HKDB 4DFSA 2RJ2A 3ZKUA 3KD4A 5J7MA 2Q8DA 4FAHA 1FFXA 4RFRB 2FDJA 2VNGA 4QGNA 3S6PA 2D6PA 1AI5A 3LPFA 3LEGA 4S2FA 5H9SA 4NHKA 4DUWA 3T1HB 3LIHA 3G6JB 3VDDB 5C8WA 1ZBA1 3CJIA 4M0NA 1XC6A 2B4KA 2XJVA 4IXLA 2VECA 5FXVA 3QTCA 4IV3C 1U5YA 4LF9O 2WLIA 2WLKA 3U1XA 2K46A 3K46A 2UXCB 2BOIA 2XHKA 3H1WA 1PPJH 1W6PB 2VQUA 4FPPA 1DGSA 3W7TA 3K4DA 4AFCA 3JD71 3RZKA 4PI0A 2P6CA 5JWPA 3QNEA 5J1XA 4U36A 4CDXC 4LOTA 2CH7B 2YXLA 4UCRA 3ACHA 3OBAA 2CTRA 3VOUA 4TZDA 5JPMB 2V5DA 4RHV2 1WB7A 3BU7A 1NQJA 3FUOA 4EWAA 4U7NA 4YZ3A 4JI6O 2G1MA 4M3CF 2LFRA 1WCSA 5LW9A 1W6NA 5K0UC 4ZXEA 3ZS8C 2NR5A 3POFA 1V9PA 3NQHA 4FFGA 5CVRA 1FPOA 2E6VA 3ZBHA 5A3TA 1CAVB 2YG0A 1UZWA 1W2AX 2B46X 4S2HA 2UU9O 4GWNA 3AM2A 3D0JA 1QU7A 4O4HA 3OR6C 2JVDA 2VY0A 2XAHA 3ZR6A 4LE4A 3UT0A 1ONAA 3MAQA 1OFSA 1DDLA 4HKWA 5EYYA 3HR9A 4QHZA 3RYRA 4CDWB 2JG9B 1Q8VA 3M3QA 4URAA 3ZXAC 4ITCA 1CAUB 3ON7A 4HLTA 3WF4A 2LFSA 3AKQA 4B4RA 3JALB 2KKWA 3ZYJB 3TN93 4KUMA 4JTAB 1COV2 2L6LA 4QB2A 1TEIA 1LNQA 3SJQC 4DV5O 3ZR5A 4XDQA 4PJYA 2NYYA 2Y26A 4C91A 2EAAA 4GB31 5LMUB 1PVXA 4XYXA 2VZRA 4RQPC 4LKFA 4IGPA 4PLMA 5LBCA 5F32A 2DN9A 1WMDA 4MHRA 1WLWA 2QWQB 1YI7A 4HNAB 4BISA 2O1QA 2I07B 3TXQA 2B8MA 3A0KA 4DXRA 1H2NA 1IG3A 3SR2C 5E1RA 3PUIA 2K1EA 3S5AA 4CDXB 2LALA 2GHYA 2EIBA 2P4VA 4KWJA 2O8QA 1HP8A 1HLCA 2VMDA 1EBOA 1KQRA 1KS5A 4K1ZA 5DAQA 5B4NA 4AAXA 3ZRXA 3S7IA 2XXZA 4K9SA 1DIWA 3INAA 4R50A 3K58A 1UAIA 1WWYA 3VBRC 1VBC3 4MV2A 2AGSA 3CXHF 4B3NA 1HDKA 2A5ZA 4BK5A 5HFLA 4YZ1A 4SLIA 4AQTA 3TEXA 2J1UA 1GZWB 2H0VA 4JV4A 3ZMUA 4YYOA 2L35A 3FB6C 5JI7A 1W6MB 2V09A 1IDSA 2R0FA 4LBQB 3RPQA 2DFBA 3ZRWA 2K9PA 2Y0PA 3T4VA 4MXVA 3O1RA 4D94A 2D3OW 3J7HA 1F2NA 5SV5A 2ZX1A 2VCCA 4JDNA 5GZGA 4ZU4A 4LPLA 1WA8A 2GALA 2D5HA 2P22C 1NTZH 5JJNB 3BALA 1SEFA 4FLUA 4FBFA 3TBDA 1W6MA 4GXLA 4Z2AA 2ZGKA 3JCZA 4FLVA 2RMU1 1SPPA 4DXWA 4IE5A 1OA4A 1UOBA 3VZMA 3R4SA 3O0VA 1TVKB 1YSCA 1RUC2 4RFT0 3HQXA 4ASMB 1WP8A 1C8M2 1IBLB 4A7KA 5HPOA 1X9PA 3C3TA 4UFLA 3ETGA 2AGAA 1PIV3 2P34A 1BE3H 2W46A 5BNOC 1G4YB 4IESA 5EIBD 1PL4A 5KX5B 4H37A 4PA3A 4V1PA 1IBMO 4N43B 3L9DA 5D2AA 1W6QB 1XNQO 3POGA 2R7EB 2J1EA 5CA0A 1DGRN 3W7WA 4B3RO 2Y38A 4LK7A 5CIRA 2QR4A 2ZDIC 3ZFFB 4TXWA 2HWF1 2VL4A 1XUQA 1DLBA 2K2SA 1JZ3A 1H2GA 3MF6A 1WUVA 3H01A 2ERFA 3G4SV 3B40A 5IY5C 1VBB2 1YITV 4CH6A 2DCJA 4O4JA 4AILC 1RUOA 3O14A 3FFQA 4LF7O 1VBE2 2Q8OA 3ZHVA 5F37A 5J2TB 2DJVA 4YIOA 4DV0O 1BEV2 3PJSK 1PGSA 1NCRC 1HIXA 4LO5B 1W9TA 1N33O 3POJA 1SBDA 4JAVA 4TTGA 1HNWO 2W94A 2C9KA 1XRUA 3JCIA 1YZBA 2MHFA 2UY9A 1ZSPA 2BSKA 4Y4RA 3BCWA 1OVSA 4AFAA 1ZBE3 2BTOA 1O9HA 1C1FA 4NPLA 5C7GA 2D6KA 2YICA 3K0DA 2RR11 2RS12 4PHZA 1YCIA 4N90A 4JI5B 3EB7A 1QLEB 4IQPA 2WZ8A 1ZX3A 2Y6HA 2OQ7A 2BDRA 2UUCO 1HQWA 2V4AA 4UB8Z 1QKQA 3OD4A 2VQAA 1Y3TA 3WF2A 4CP2A 2HWE2 1JTZX 2WFF1 3SH3A 5BZBA 4UAPA 2KA3A 1UIKA 2CTQA 5B1BC 2BWCA 5CB7A 1BVVA 1PVC3 1SMVA 1AR4A 5FPAA 5C71A 2BFUL 3CXCU 2BNOA 2Z0AA 4GUNA 4KGGA 5K7PA 2QQPA 2BU9A 3GJAA 1DGRA 1US2A 4JI2B 3RGBA 1IKQA 1W8WA 2A6ZA 4L87A 4XUNA 3ASOC 3WXPA 2IXCA 4HK9A 2Y34A 4M3CA 2HLEA 1GM8A 5FYUA 5IVVA 2CWSA 4O9GA 1VP7A 3ES4A 4AZZA 4KWLA 1MQTB 2QTSA 3ZFFC 2ZGOA 2RG4A 3AFKA 2ZABA 1B35C 2D40A 2WO1A 4I3PA 4R52A 2LW1A 4ZKIA 1VBA2 2PZSA 1ULCA 5CKMA 1G6UA 1NE4A 4I30A 4JGYB 1T6GC 3FX7A 3APBA 3JARB 4X1IB 2ATFA 1C4RA 4YG0A 1E5RA 1JPXA 1BQZA 1JXNA 5F9TA 2DE0X 2Q1ZB 4UVCA 1HN0A 1PV0A 3OBTA 3VZKA 2A70A 2NN8A 1GFF2 4YFZA 2GP5A 1XBFA 2ZT9B 1KDMA 2JDIG 4CZSA 4DRXB 5GLTA 1RUF2 2V73A 2DVFA 3MIFA 3AMNA 4X20A 2R70A 1IQAA 3P1IA 1S77D 4AFDA 2PHUA 2ATKC 2VC9A 3AK3A 2M6YA 2G38A 3ITQA 2ZZQA 1WCQA 2F93B 1G7YA 1LEMA 1LOBA 5JPNB 2QA4V 2Q7GA 1RUD3 4UBGA 3WP4A 1UKGA 4X8AA 1VMGA 4MSVA 4KWKA 4YNIA 3L74H 1RUI1 4X1KB 4FPYA 1GKFA 3T1LA 4TUYA 3DPRA 4R9DA 3QG5A 4LO8A 3VBUB 3CRAA 1TQ5A 4ZS3A 1HQLA 2WN3A 4H0LB 2Q8VA 1EAH2 3ZYGA 2VW0A 1XDCA 1IG0A 3IN9A 4X1YA 5FYCA 5L7OA 1DZTA 5BNNA 2CV6A 2YU1A 3N7MA 1JYTA 4LWSA 3NXSA 3IBMA 2XOKG 4OPHA 4YGCA 4JI4O 4BWAA 2ZM6B 1PO23 2D6OX 3ST7A 3MPBA 2R072 4HG6B 2VMCA 3WW1A 4W6YA 1K5JA 1O8SA 2HBTA 4ZHNA 1ACCA 2WWWA 3JATB 4JI3O 4U2AA 2PYTA 1E5HA 4YVSB 3HIFA 2R073 1JS9A 4J25A 2ILMA 4AEDA 3JD3A 5CBHA 1VF6A 3EFFK 1STMA 3WDWA 2A6YA 4YZ4A 3DF0A 5LEJA 2EIMB 2JXAA 4A7YA 1ZAUA 1C8NA 4CEYC 2FZ2A 1NI8A 4U3JB 1UPIA 1S2EA 5HXMA 4GQ7A 4J41A 1UZVA 1AX2A 1ZYBA 4DRVA 2VMEA 2JIJA 2QQLA 4QPGA 4ATEA 1YJ9V 1GTOA 2ZGTA 2WSSG 1UZ0A 2DUQA 2VVDA 1A78A 1OOPA 1JH5A 4XJUA 1VIBA 3CRQA 1XNRB 3MD0A 3LDCA 1QNMA 2J1VA 1VR3A 5DAXA 4ISQA 5J9PC 4XABA 1H4GA 3H8UA 4HSJA 2FHRA 4LF5B 1EV13 3ZMZA 4FLWA 1AR81 5BNPA 2ZGUA 5FL7G 2IC1A 2IH1C 3WZ1A 5BUVA 1LAJA 2HH9A 3LNMB 2EICA 2VW2A 4UT5A 3I2OA 4KHPB 1OUXA 1RMU1 5C9AB 5FWJA 1IGOA 4RS5C 4GWJA 2XVKA 5KUMA 2DOSA 4CCMA 3QOPA 1W05A 2P3KA 1OXCA 4WFAV 3KSCA 4OUEA 4PDLA 3ALQA 1BXHA 3DPRB 3SYPA 2Y8KA 4Q2FA 5C4WB 2P90A 1G8WA 2NP0A 4Y5SA 2JD4A 1ZRFA 1SFPA 3UJQA 1GN4A 2GNMA 4YG3A 3N2GB 3ZHQA 1DGWX 2EXJA 4LFCB 5JMOA 1JYNA 4R6ZA 4M00A 4Y5Z0 2WZR2 4C0BA 4EYUA 1AL22 4I02A 1B35B 4CS4A 4W65A 2X29A 1DLLA 5ERLA 3QACA 2VCMA 1EUUA 3NJVA 4IGGA 5JZGB 4KU8A 3L2HA 4K0KO 1T5EA 5LP6C 2A0LA 3CC2V 1GZCA 1PNMA 4FOWA 3VBFC 5FY9A 4PA9A 4PDWA 4EV0A 2PHFA 4S2GA 3LSDA 2Q0AA 5LBBA 4HBNA 5IT9N 3WCRA 4K7JA 3OUIA 5CU1A 3HKEB 2RHPA 2BOJA 4E4ZA 2RS11 2HJDA 1EFRG 1H2KA 2Z69A 4K35A 4D7SA 2OT7A 5J2TA 1UU5A 3HJRA 3PUAA 3F7VC 5DDJ2 1G9AA 2XMLA 3JARA 1CVNA 1XMQO 1IS5A 4A3ZA 3IAPA 1LULA 4IL6Z 4EN9B 5DECA 4EZ4A 4PDVA 5I0RA 2HEVF 1OLRA 1H6YA 4FPFA 4JKKA 3HPNA 4O2AB 4XFAA 1K45A 4BQ5A 5IJ9A 2JWPA 1H1AA 1TUEB 3VDAA 3ZN1A 2H0BA 1L1FA 2DWEC 1UZZA 1QOOA 5JLVA 5H9QA 4AVTA 4FLYA 1YO8A 5DDJ1 1ZLZA 2OIEA 1ZZCA 3LEMA 4A7ZA 2IBZH 5FJHA 3PDQA 4FVMA 3W59A 2YU2A 3K5OA 1LGNA 4IEYA 3VD5A 1Q56A 1D2SA 4XJZA 5T55A 1TVKA 3IFXA 4Y20A 2QQKA 4YGBA 1JU3A 1REEA 3K04A 1RUG3 1TME2 5C9AA 2J1AA 1FOD1 3EVKA 2AR6A 1N0JA 3A0NA 2EIKC 1GWMA 1NA1B 1W3XA 1S5LZ 4JI6B 2UWCA 4GMP0 1CIYA 3CKHA 1D5AA 3WG1A 5BNQA 2QKCA 3THPA 1GU3A 4NOTA 3CF6E 1RUC1 4OHXA 3N9PA 5FYIA 2HP8A 2OW4A 2RVAA 4LA2A 3AJZA 1VBB3 3G80A 5IVJA 4WFBV 3T1YO 1LHUA 4H13B 1U5IA 3AG3B 3I8TA 1POV3 2P06A 5E1AC 1FMD3 3NJZA 1DYKA 3JZVA 5FO9B 2AZ5A 4W6WA 1RMU2 3WDXA 4QDSA 2GUZB 1FV3A 4A3XA 5IK8A
chains in the Genus database with same CATH topology
1SACA 4P14A 4JGZA 2ZGQA 2HWC1 2ZA9A 4MYEA 4LHKA 4C90A 1DRYA 2WNVB 3MW2A 1WCKA 2EXHA 2B42B 4XILA 4CRQA 1I5ZA 1AR91 1Y0ZA 1OIKA 4LBLA 1CX4A 1DBNA 1JN2P 3BIWE 3IT8A 4DMIA 4J6GA 1LHOA 1OMIA 4RR3B 2NQYA 1DQ2A 3ZFGB 4QQLA 1SBEA 2QUOA 4FPLA 2WZPP 4HN1A 5JDBA 3HWJA 4AWDA 1V70A 3UV9A 3UKTA 2DWRA 2VNRA 1R091 3SNMA 4XFGA 1AX1A 5IK5A 2JG8C 3OYWB 5HCFA 2CGNA 1X82A 5JVVA 2Z42A 5EYXA 3UJOA 4WVMB 1O4YA 4BYYA 2D6NA 4WM7C 3GZAA 5AVAA 3WVJA 1JOJA 1CN1A 1PZ8A 2JKBA 2RMU2 3MGUA 3V65A 3ZSMA 3ZSLA 3AKTA 1I6XA 4Y1VA 3RJRA 5T50A 4XQWA 5BNOA 4NE0A 2JICA 4I01A 4BZ4A 1RUD2 5CBLA 5HCBA 1OHFA 3SXWA 5JR7B 4Q0SA 4IL7A 2WA3A 1OPMA 1H2MA 1H2LA 1V00A 3H9AA 1TME3 1RVF1 4WM8A 3H7YA 3GHNA 1HRI3 4HK8A 4YGDA 3MICA 3ETQA 5KHHA 3N7JA 4K3UA 2GAUA 3MW4A 2YGMA 1MR5A 3HN1A 3JBG1 3FLRA 3SLIA 1QJY2 2W39A 5KXDA 1LOGA 1TNRA 4Q27A 1VBE3 4QXKA 5DG2A 3WP3A 4AVBA 1NLSA 4XF4A 2D6MA 1EAH1 1NE6A 2QNKA 4IV1C 2F6BA 4ES9A 4DY3A 2CAUA 4OI2A 4CWDA 1QJU3 4KL1A 4R4ZA 5FOBB 1DS0A 4FP3A 3V64A 5I0TA 1FNZA 4L97A 2WL1A 4YM3A 5FO7B 1DQ0A 4NR1A 4R4XA 4YVWC 1Z7S2 2XG3A 3AZWA 3AYDA 4ISRA 5DUUA 3WP6A 1FPN1 3V56A 2R1DA 2X5IC 2CAVA 3RRDA 1QJZA 5I8TA 1GZ9A 4L11A 1RB8G 1NQDA 5JIAA 1ZZ7A 2Q4AA 3LAGA 5CFCB 4LBOA 5DZEA 3ZIXA 3ZMNA 2NLRA 4HKLA 2PELA 1U12A 5EWSA 3WR0A 5CADA 1V6MA 3AYAA 3J9SA 1QNYA 2YY1A 3R4UA 4AI8A 4WM7B 3NV4A 3VZJA 1JUIA 2MEV2 4K1YA 4XTPA 2HWD1 4BG1A 4GH4A 5BNOB 1HW5A 4B7KA 4SBVA 4XEZA 2R043 1HRV1 1VIWB 1VBC2 4OI4A 2HWB2 1VBD1 2MEV1 2RS52 2P2KA 2NZ9A 3TRSB 1GNZA 2MNGA 3K51A 4KU7A 3VKOA 5C6CA 1LOCA 1RUJ3 1AL0G 4QD2A 4URTA 4LULA 5K8SA 3ZYRA 2ZKNA 4FPCA 3O7OA 1LOEA 2HWE1 3VLBB 2G4IA 1A8MA 3SCFA 2ZX4A 1BK1A 3J26N 2F4PA 4NHLA 1R092 4CEYB 1RIRA 5GLVA 1NA1C 5BNNB 1O5LA 1QXRA 1X33A 2GZWA 2BNMA 1BVP1 2XJRA 4B4PA 3JD73 4C1WA 1RUH3 4HL0A 2XKOA 1R081 4N7UA 4CEYA 4HZFA 2P3JA 4TYSA 3PMSA 4XF3A 4YVWB 4HETA 4NVPA 3RYKA 3TOJA 2BVVA 5GJ6A 1GQGA 4FFAA 4XIOA 5LK5A 5ABJC 4M2EA 1BJQA 4COYA 2VULA 1YYNA 1LU1A 1NXD1 1O3TA 1OQEA 1HXS1 2A3WA 2WNUB 3RYPA 4PQ9A 5AC92 1HV0A 1LHWA 4YZ5A 2A3YA 3O0XA 1PM7A 2QKDA 2E7QA 3GBGA 4YVWA 3PHMA 2ZHNA 1AX0A 4ES8A 4BHGA 1GYKA 4M25A 4C8RA 3H3ZA 3AFGA 1QF3A 2ZGMA 5ABJB 3JBG3 1LJ7A 1NX8A 3GYDA 4IEWA 3MLLA 4PF5A 1ZZ6A 4IV1A 4H7MA 1PZ7A 1BMV1 5I0SA 3KLSA 1ULGA 3MF9A 3VKNA 5KXBA 2D98A 2ZPXA 3QLQA 1J3QA 3FE5A 1OFNA 2VG9A 4FTEA 1RHI1 1Z0HA 3KCCA 2R32A 4JC1A 2VQ0A 2R6QA 3GHMA