2WA4A

Factor inhibiting hif-1 alpha with n,3-dihydroxybenzamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 99
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa4A01
5JWPA 4AI8A 3P3PA 1H2MA 2ILMA 3KCXA 4JAAA 4B7EA 4Z2WA 4Z1VA 1H2LA 1MZFA 2CGNA 2XUMA 1H2KA 2YDEA 3D8CA 1YCIA 4B7KA 2WA4A 4NR1A 2YC0A 3KCYA 2W0XA 4QU2A 4BIOA 2WA3A 2Y0IA 1H2NA 2CGOA 1MZEA 3OD4A 1IZ3A 3P3NA
chains in the Genus database with same CATH superfamily
3Q8FA 3F7YC 4KHPB 5FLHA 3ZXDA 4NIAA 2OUHA 1MSWD 1JYXA 5A1FA 4XUTA 2D44A 3KZIZ 5L3DA 2SLIA 2EILB 5A6XA 4DS0A 5C3PA 4IGQA 5ACA1 4DV7B 2OCCB 5IJ9B 4FPOB 5FZOA 2HWE2 1JFFB 1UYPA 2OIEA 1COV1 1KDMA 5CFDC 4OYUA 3ETQA 2HJIA 3O5SA 2Q67A 4A2UA 5B3SB 1AUYA 3H42B 2IJIA 4D6TH 1JZ3A 2ZHMA 4RS5C 4TWTA 2B9ZA 4GWIA 1VBB2 2P5BA 4D7TA 5I8YA 2YY1A 4A44A 2JG9A 2HH9A 2WLJA 4FJCC 1I3HA 2PAKA 2JDNA 4PF5A 3ST7A 1CESA 5FZ1A 2ENRA 1IBLO 2YXYA 3E5XA 1ZL8A 1CAUA 1NXD1 2VBBA 2QFEA 1HN1A 3POEA 2Z3YA 1DBNA 3TEYA 1PMJX 2YFUA 1IHMA 2VCAA 4BWOA 3BUCA 3JD73 4ZHNA 4AYUA 4CUCA 2QGNA 3POIA 4B4PA 2BE3A 2P4KA 3FX3A 5GONB 3E22A 4DMIA 4B1MA 4UUJC 2R0HA 1VRH1 1EPWA 2JGDA 1O4YA 3ABTA 3NV1A 3WB0A 4YJ2B 2HWF1 5LMNB 5FUNA 2YBSA 4D6QA 2VE1A 3G6EV 5FR3A 3IMNA 3GB7C 1W8OA 1S2KA 1IXBA 3ZJZA 5JQGB 1VMJA 4RHV2 4CS3A 3SH5A 1RB8G 2Y8KA 4HSLA 2A3YA 3B4SA 1CAVB 1XNRO 1U5YA 3THOA 3LAGA 4XOGA 3S3WA 3FUQA 4XETA 3AX4A 4AFBA 3LIGA 4DEVA 4Z2AA 3LDRA 2UWCA 5C8CA 4LO7A 2BW8A 3SH4A 2Y4TA 3FC0A 1K34A 3C7HA 2ZDIC 1W05A 2OW4A 2VMHA 4WV8A 3HPLC 3WHUA 4ZPIA 4X62O 4BQXA 2GH8A 4PJYA 3LSQA 3JARA 1S77D 2O0OA 1AB3A 3KT7A 3PVNA 4CDQA 3LDBA 3B8MA 4H7LA 4LC1A 1ZZ9A 2OT5A 1JTZX 2HWC3 3ZYJB 1XB9A 3O9OA 1KDKA 1S0EA 2PFWA 5FY8A 4L8JA 4LO5B 2IXCA 2QR4A 5BPXA 4AEJA 1BK1A 1EP0A 3E8GA 4J9ZB 4QX2A 1H0BA 5JQGA 4RUEA 4HPKB 1AYN2 1PNGA 4JI1B 5LGTA 2PLV2 2X6BA 1S0JA 1VBA3 2JIGA 2FCTA 1MQTB 4PDWC 3MW4A 5DAQA 2CH7A 3WG2A 4KL1A 1OPOA 2R32A 4XUQA 4YXWG 1R6KA 1H8EG 1ENVA 2JX9A 3OUJA 4AHYA 1LAJA 3OOXA 3WNOA 1U5XA 3ZPOA 5JMCA 2VTFA 4KI5M 4XQWA 3E83A 4M01A 1UOGA 1S5HC 4DK0A 1V70A 3NO8A 1G7YA 4GKKB 5JSPA 1ZBA3 2D7FA 1K3EA 2Q68A 3VBFA 3I59A 4JGYA 5EZYA 3K4ZA 2IJHA 2UYBA 4MGTA 3THDA 2YYOA 3A0NA 1V6MA 1N36O 1ULFA 1RUH1 4DR2O 4RHV1 2VUCA 4GUNA 1Y9QA 4QDQA 2O8QA 2NLRA 2D6KA 3D36A 3ZCCA 2LGQA 5EZYB 3C7FA 4GX5A 3ZIXA 4M0HA 1OBNA 1Z5WA 4JI2O 1GLHA 1OLRA 1Q5OA 1W6QA 1C3HA 4JYBA 1OURA 2AUYA 1K42A 2JDHA 5FPOA 1XSQA 2BFUS 1W3XA 3H8RA 5FMBA 5JXJA 2C9AA 3ZSEA 4RS5A 2JDIG 3AFGA 3THCA 2GN3A 3OGJA 3VKNA 3UNPA 4HLTA 1FOD1 3CMGA 2PYLA 3J7MA 5LEJA 1UW8A 1XL6A 3KWVA 1SQFA 4AAPA 2E63A 4O7XA 1NLQA 3DYMA 4AVAA 1JZ4A 4P9YA 5FZGA 3R0RA 2JG9B 3B7MA 3E1F1 4ZKTB 3LWCA 2GUZA 3ZIWA 1VBD2 4PQ9A 4NWVA 3RYIA 3C3TA 2RR11 4JTCB 1KMIZ 2LROA 4ZI7A 1VMFA 4B4QA 1AXZA 1HXS2 5I0RA 1MVQA 2X6CA 1PIV1 1OPMA 4CUGA 3HMYA 1VF7A 5IVCA 5LCWL 5LASA 5LMNO 1YIPA 3OG2A 3H3UA 4YFZA 3ZSLA 3I3EA 4UBHA 1A3KA 2W52A 1Z0HA 3UT5A 5D8AC 1VBD3 1JCHA 1WZXA 3UKTA 1UOBA 4YSFA 1R1A1 4OLLA 1G9BA 3I2KA 2WN3A 1VBE2 5IYZA 4OHXA 4R52A 2JECA 1F15A 3B93A 1HQNA 1QU7A 1AI5A 2EIEA 2Y0PA 2DJVA 3AP4A 2GMPA 2I74A 4LNUA 2V4VA 1DYKA 5LRRA 4JPRA 1RITA 5CFCA 1JXNA 3I55V 2ADPA 4BQWA 3ACLA 5FYHA 5IDJA 3APQA 5BNPB 3TEZA 3S5QA 3RYCA 1N47A 2UXBO 3FHQA 2QM4A 2HWB3 2O1QA 3P1IA 3ZX7A 4MSVA 3VDAA 4I55B 4Z2WA 1COV2 2JICA 2ZGUA 1M4UA 1SS3A 3O1PA 5FZEA 3ZMZA 1YO8A 4D69A 4ISRA 3FKSG 5C4WB 1WMFA 1OXCA 2DUOA 5IYBO 2Y6KA 1VBB1 3D3QA 1AL23 2CL2A 4CU8A 4LIVA 5HXMA 1ODNA 3ABLC 5GLUA 3IBMA 4MG2A 5LL6Y 2OX0A 1FX5A 3EBRA 4LF9B 1CJPA 4PA9A 1OUXA 3WG4A 4J10A 1EY2A 1N4CA 5CG9A 1XNQB 2IBZH 1QJFA 1ND2A 1ND3C 4B1LA 1G6NA 2HBUA 3P3NA 1OQ1A 4JGZB 1RUF2 3K79A 4B7EA 1O3QA 4B08A 3DCQA 5C3QA 2YI8A 3VZMA 1DCSA 1U96A 4QNHB 4JGYB 3WUDA 4FFKA 4WBNA 5IAXA 2ZIOA 4AFMA 1VBA2 3MIGA 1KQRA 3GGLA 1S0DA 2ES3A 3T2MA 2VL4A 1YNAA 1QH7A 4OGQB 3AYDA 3RPQA 4JDNA 4EV0A 2DBIA 2ZE6A 1WW4A 1LNSA 3PU3A 2HWC1 2A3XA 4Q4X2 5JWPA 2XKPA 4QX0A 4CP0A 1POV0 2A75A 4MLOA 2BJSA 3QG5A 2GMEA 1XE8A 1UZVA 3VD4A 4MTGA 1HIXA 4XILA 1SA0B 4AI2A 3S7IA 4LO4B 1RPRA 2EIKB 5M0TA 2L6LA 4OX9O 4YARA 4RWUA 4QT6A 1GAXA 3SPJA 4UCTA 5FYYA 1IKQA 1D4M3 3SQOA 3TOJA 4IL7A 3NVCA 3ZXFA 3WF1A 3H50A 2VUDA 3ZKUA 4R6ZA 4OXSA 4W4LA 1G1XB 4IGGA 3WDYA 1RIRA 1FJGO 4Y5TA 1NQTA 4L8QA 2P06A 1V54B 4JZ2A 4QE7A 2V5DA 1U5ZA 2EJ7A 1K5SA 2YICA 5I0UA 4H2AA 5IFPA 2PELA 2YSUB 4DV2O 3VQYA 2W2IA 3MEPA 1UU6A 2PHLA 3JASB 4C90A 1CPNA 1KECA 5HCFA 1NTKH 1JYVA 3O0WA 5B1BC 4PCRA 1HJGA 4AFDA 3ITQA 2FDHA 2WKKA 3OCPA 3WCSA 1N1YA 5GLVA 3AG2C 3KGLA 3VBOC 4JF3A 3AZVA 4GD4A 1SBDA 4UI9L 5D8AA 1HRI1 4PQQA 1WGPA 4XHXA 4CCOA 2OTJV 1I0HA 3LA3A 2E26A 2NM1A 5D2AA 3ZHQA 5K8SA 3JARB 2C0ZA 3BOPA 1JU3A 5LXTA 5LATA 2OCCC 2YI9A 1HNZO 2A0LA 1RXGA 4FFBB 3AM2A 3AC0A 1F4HA 3CCQV 1YXWA 3ZN4A 3DEMA 3AK2A 4LF6O 1O59A 3B01A 1W0KG 3GZAA 1M06G 1W8TA 2XAQA 4MXWA 1FFXB 3OGIB 2WSUA 1WA4A 1ACCA 1DYOA 4OMDA 5T50A 1Y76B 3OE7G 3OMIB 4TV8A 3CXHF 1XREA 5FZOB 2KQXA 1W9TA 4GYCB 4FM2A 2P4EA 3VZJA 4GMP3 1BXHA 2P3JA 1PK6C 3CRCA 1YQ5A 5KHKA 1Q90D 1OA4A 1VMHA 2PHWA 3F95A 4UXNA 5KA5A 4IEZA 3H1IH 4CA9A 4YY3O 1D5NA 2ZMLA 1XSRA 4JTOA 3WU2Z 3HNBM 2Q8VA 3OFNG 1CZSA 1BBT3 1A6CA 1P84F 1TAEA 2CYFA 2WZR2 4N43B 1COV3 4K9SA 5BMVA 4QU2A 2PHFA 2RS32 3MV01 4BZ4A 1Q3EA 4MW8A 3ROUA 3PVEA 1W06A 3NJVA 4MTOA 4O4LB 1KD7A 2B46X 4QWNA 3WNPA 3GJBA 3SJBC 2A71A 5JIAA 1DU3D 4LFAO 3ZMNA 2DQ3A 3T4ZA 1ONAA 1AL0G 4HL0A 4FXGB 2W94A 1K4DC 1I7FA 3GNEA 1LHOA 5L7OA 1YHQV 2RMKB 3E8HA 1BYHA 3OT7A 3KVAA 3O1VA 4P9PA 5FV3A 2WLNA 1WW7A 3UK9A 3N9QA 2LGWA 2DUQA 1CPMA 4V1PA 2JD4A 4XJZA 4XF1A 5FYSA 1HX6A 4XDPA 2VQ0A 2QTWB 2JDPA 2G9GA 3TNPB 3N7KA 2F43G 2V4AA 3PJYA 2QQUA 2ZCEA 1KJLA 2CAVA 1W6PA 3IMMA 1S5LZ 1ND2B 2PMWB 1R3JC 2RJLA 2Q4PA 4IHJA 1BCXA 4TN7A 4OHWA 3OY8A 2R041 3C7OA 5C3OA 2WWJA 3MIFA 4Y33A 1IS6A 4JX0A 1N33B 5H6QA 1DF5A 3UJOA 3VBHB 5K9YA 3ENRA 3JALB 5ISLA 2VXJA 5AC92 1HRI2 3HPNA 3LDEA 4AK3A 1STMA 4LF9O 5CN0A 2YIBD 5F3GA 1GZWA 5IHRA 4X65B 1BQPA 4MS2A 1SQGA 4O4HB 2P7TC 1ZBE2 5IJ0B 4Z07A 3ETPA 3MLJA 4DXRA 1GN4A 2OCHA 1OLMA 3KZ4C 3J7NA 4HANA 2ZHKA 2VZ1A 5IK5A 4FBFA 3U14A 1JOPA 2DF7A 1J1LA 2ITCC 1KFUL 4XFGA 3VQXA 2WAAA 1DTOA 4JVAA 4QX1A 4LA3A 4HSJA 4IIJA 4XUOA 4F6EA 1W6NB 2VVDA 2VQEO 3IDEA 4LKFA 1VMGA 4ZS3A 5LK7B 3JALA 1AVBA 3CJXA 5A7QA 1KU9A 2H94A 3WUCA 4HN0A 1N3PA 2XLFA 4YIOA 4UCVA 2IU0A 4COVA 1RL3A 1W9SA 1OJHA 4DV2B 4LF6B 4DB5A 4FXKB 3WG3A 4E4HA 2HKXA 3VN4A 5CKQA 3E8FA 3ACGA 2XMLA 1OCRC 4DR6B 1K5MB 1QLEB 3TRSB 4QE9A 1QVFU 2GBOA 4N9IA 3SMHA 1GBGA 4DR3O 5A3MA 2WO7A 4AILC 1VRH2 1U5IA 2D43A 2BTVC 2FHRA 1H8TC 4DUWA 2VH9A 2XL7A 1CAWB 2OYQA 5FYVA 3ME2A 3IPVB 1V9U3 2X29A 4XFBA 2UYAA 1WLWA 4UFHA 3ASNB 3NL1A 4LHSA 1H8TA 1YFUA 3WB2A 4PHZA 4XFHA 2VMCA 1MR5A 2F4VO 1FPN2 2XUEA 1OLQA 4A7ZA 3JB4C 3NJYA 3NKGA 1SQPH 2ZGOA 2ZXQA 2YC4A 2XWJB 3VD3A 4R8HA 3CKHA 2XQXA 3ELNA 4OI1A 2FTKA 3W7SA 2N05A 4JC1A 5EJ1B 1KS5A 1ZBA1 2WLKA 1REEA 4DV7O 2VR4A 1DLLA 4RN5A 4I9WA 3LUTB 2ZA9A 4P9GA 4Q4V1 5AVAA 1NUKA 1CAXA 4ASMB 1MS5A 2VS0A 3RYCB 3OPWA 1OCZB 3JCUZ 1UWWA 2YXSA 1NY72 3OGRA 4J7KA 3A7QA 2GP3A 5A32B 1SLIA 4CTEA 2YC0A 5LP6B 2CAZC 5LEKA 3AVSA 2HWC2 5KHIA 4LNUB 2QJ1A 4XBFA 1UZWA 1VEWA 2QM8A 3JCIA 5DQ0A 5JMOA 4N21A 4AFCA 4IUGA 4NXNB 5CFCC 5IWAB 1EZVH 5TISZ 2EZOA 3N9LA 5CBLA 3AG3B 4YYOA 3FBMA 1UPGA 1W99A 2Y60A 4JQRA 3HEIA 1AF9A 3CLPA 5FWEA 1AJNA 3ABMB 3T4DA 1JYWA 1ZYBA 1BQZA 5CA1B 4CS4A 1ZZ8A 1JW6A 5J36A 1DGWA 4K3AA 4YZ5A 4B4RA 2XASA 4AFAA 3QH7A 1N36B 4OZXA 1SPPA 2F4LA 4JI0B 3VDDA 4BQ1A 1WN7A 1YJ9V 1IS5A 2Q1FA 2XNDG 4AL9A 3CCSV 4G3YC 2WDBA 3PURA 2WIIB 4J1WA 3GZEA 3KF5A 4J41A 4FLZA 1Q8SA 3LIHA 4CH5A 1HB1A 1SLBA 1H2LA 2FDGA 2ZJCA 4QPIA 3U0ZA 3AZZA 2E53A 3U1XA 2WWUA 3WLUA 2V7QG 3CSXA 4R9BA 4NVPA 2R9AA 4COYA 1O7FA 4GCZA 4IW3A 1DGRN 3SLIA 4KQ7A 1I6XA 4TSFG 2BP6A 4AHZA 5LMUB 2QA4V 3WEZA 4GA9A 1NQDA 4XCAA 3E5QA 1GZWB 3LSDA 5A3TA 5KA6A 3EVKA 1K92A 4R9AA 1K97A 3OF1A 1VE0A 4X8AA 3ZR6A 4AQYO 4JGYC 3AP9A 4GJYA 2E75B 4LKSA 4JI0O 1NLRA 1S1AA 2ZHLA 4QKDA 3ZX6A 4XFAA 3QCWA 2ZMKA 1NY71 2Q73A 3MYXA 1W2NA 1W2TA 1MQTC 1ZM1A 2GNTA 3A0BZ 4AEDC 2XBO2 3CJIA 4AQ6A 1KQSU 1ZZ6A 3B5LB 2LTNA 1DQ5A 1PNKA 1E1QG 4MADA 2QQWA 3DKWA 1SQBH 1X9PA 2R062 1NE4A 1IS4A 2UXDB 3THPA 1VBC3 3N36A 4M3CA 4I2OA 4GKYA 2P17A 1QHDA 2I07B 3ZIAG 1AJQA 2PLV1 4HVOA 3AP5A 1T5EA 3L75H 1OCZC 2DN9A 1UYXA 4XBLA 3MLLA 3MHHC 5JVDB 3AKRA 1R64A 5FMDA 4C1XA 1GOGA 3RI9A 3RYKA 2EIMB 1HLCA 3OEHG 4L99A 4NHMA 1N32B 3BVCA 4BJ0A 4CC5A 4N23A 1PL0A 2JKBA 2ARBA 4LMFA 2RJ2A 1M90W 4CH3A 1LOGA 3O0VA 4CP9A 2EILC 5I0DA 2ZT9B 2FQPA 2PGGA 4FSJA 1HXS3 2GNBA 2B8MA 3JD2A 5BR8B 4J1XA 4Y22B 1V6IA 5EC2C 1UZYA 2Z2SB 5FBZA 1OKQA 2GSMB 4WM7B 4DR7O 1PVXA 2Q1ZB 4W4KA 3N35A 1GK9A 2WFPA 4UAPA 4YZ1A 1ZNPA 3J8F3 4PA7A 4GB33 4DR4O 5L9VA 3KT1A 2WLQA 2WZR3 3K5NA 3ZYHA 4EFEA 3ZM8A 3SCFA 3D0JA 2ZS6B 5CEHA 4FPFA 1XE0A 4P5HA 5C8CB 5GLZA 2D6NA 2KD7A 5A7OA 4UT5A 1WLTA 1CVNA 3RJ2X 3CCRV 3L2YA 4LFCB 5IWFA 2DE0X 2LJ2A 4LBJA 2QWPB 4XF9A 1TG7A 1PGL2 5IYYA 5FZBA 3LPFA 3UGGA 3GF6A 2LP7A 3QTCA 5SV8A 1UJWB 2ZOEB 4JI5B 1F8VA 2P6CA 1H6YA 1Y43B 4XJUA 3OSDA 2UUAB 3TXQA 5KXBA 3O1MA 1YZBA 1O9HA 4XACA 2WBKA 5I8SA 5L7OC 4MGIE 4LBLA 1PZ8A 2QZ2A 1LULA 4I9QA 3FHIB 3L9JT 2XONA 4FOQA 4KWJA 1H1AA 4I09A 5FZ8A 1DGSA 1NCRA 4PIYA 1M93A 1CIYA 3VQWA 1IDSA 4XFIA 1V9U1 4AVTA 4RGAA 3NSTA 3K58A 5A7WB 3KV4A 4TOIA 3RWRD 1M57B 4ES8A 1ULGA 2R071 1WD4A 3RSJA 4XC9A 4MOAA 2B7YA 3VZLA 2ZX0A 3POBA 4X62B 2ADDA 2R073 2WWWA 3IDBB 1PGW2 3OEAA 3HVDA 3TETA 3RS6A 3BEHA 5J1XA 2PHDA 3FUOA 4OMCA 3POJA 4ZOLB 3ASIA 4P9XA 4TZDA 3Q9OA 4CDXB 4LK7A 2AZ5A 4CS2A 4NHXA 4L2NA 3G6BA 2CDYA 2K2SA 2LALA 4D94A 2F66C 4X1YA 1AYN3 2HYKA 2RS33 2XDVA 1URFA 5E8AA 5FRAA 4PDRA 2AZ2A 5DUWA 1PM7A 3TWIA 4MH0E 4AI9A 2W0FC 4DR1O 4R4ZA 4IV1C 2YBPA 1O6UA 2PYTA 2VG9A 1E1RG 4YW1A 2A6VA 2YS8A 1YFYA 4NIGA 1Q7YW 2HWD2 4G27B 5DUVA 3OY8B 1MZ5A 1AR71 3WNXA 1NCRB 1SESA 5CIRA 1R093 4OULA 1CN1A 5IVBA 5JJNB 2V1DA 4WM8A 4J9YB 2ET7A 2ATFA 3ZN1A 4WVVA 2CUGA 1OOPC 2XWBB 2BV4A 2DDUA 3KCXA 3LE0A 4LBEC 4QXKA 2BRTA 1G9FA 4X6RB 4B8EA 4JKMA 2BFUL 3V0BB 3PIGA 2KXLA 2ZPXA 4E2QA 1HB4A 3AG1C 1BJQA 2KM2A 3BCCH 5HPOA 4BPZA 1SCRA 1WA8A 2WR9A 3E5UA 4LLOA 4AGVA 4OI4A 3W21A 5IYCO 1H38A 1QXRA 3ILNA 3CJHB 1V6NA 1K12A 1RUG3 2FZ1A 4PT6A 3APBA 2OVUA 3POGA 2EIKC 2BBVA 3CX5F 4R8CA 5KWRA 4UF0A 3SJAC 1FPN3 3ILRA 3HKDA 3FLRA 2R072 1CJDA 3WP4A 5DABA 2FMDA 4ES9A 4NIHA 1YFXA 1RINA 4H0LB 4Z1MG 5BR8O 4I7ZB 3OAAG 1NJIW 1IS3A 2RJZA 3CCEV 2VNOA 1V9U2 2PHRA 1JOBA 2BOBC 4HNAB 5T5OA 4LWSB 2VXRA 3WB1A 1XNTA 4LBMA 1N3OA 4L11A 4XDOA 4HXCA 2Y48A 4MYEA 1MEC1 1Y4MA 1N3QA 1CR7A 3KMHA 2J1AA 1I5XA 1W6OB 4IEOA 3WVJA 2WO3A 2BU9A 1NE6A 1RXFA 1NT2B 5HI0A 1KYOF 5E16A 4DK1A 4NIDA 3W20A 3RQ0A 4EYUA 3CEIA 1UPIA 1FAYA 1AR73 4EWEA 4YHHB 1WPXA 2A9HA 4DO2A 1AL21 4QB6A 1EN4A 3NMBA 4Q2FA 1YIFA 3SKVA 4GWJA 4JTNA 1XYNA 3T1LA 3OM3B 1SQXH 5JXIA 4AHXA 2DYSB 3I2OA 3JU9A 4FM1A 4IE7A 1YQ6A 5IVFA 2NR5A 3PVOA 1XILA 2DWDC 1VP7A 2W6IG 4E9KA 1ND3A 3CRMA 1US3A 1IBMB 1FATA 2HWE3 4PA6A 1X59A 3K57A 3K46A 4FLTA 3K3WA 3DF0A 1BK0A 3BHPA 4IE0A 3IJ4A 5H9RA 1LB2A 4KGQA 2FMYA 4K35A 3ETEA 4DV6O 5FY4A 2P2KA 2RS52 2GSYA 5DZEA 2AW9A 4JTAB 1AR61 5FK7A 1WBLA 4XXAA 4XUPA 3W7UA 2Y6JA 5FUIA 4JI3O 4YM1A 1CGPA 5AC93 2ZGLA 5T55A 1SFPA 1OSGA 3BTAA 1RVF2 2RJKA 4AI1A 1MS4A 4JI8O 4CCLA 1Q86W 1ULEA 3Q8CA 4I3GA 1OD5A 1Z5VA 5I8TA 1GZTA 2K0GA 3CCVV 4X8NA 4XF4A 1GSLA 3WW1A 5BV6A 4B3RB 3WQBA 4D0QA 5JJJB 1PK6B 2VW2A 3JYCA 3B9IA 1AX0A 4I02A 4I5SA 3BOWA 4IYIA 3CNAA 3FX7A 3SISA 3AJZA 3E97A 2JJ6A 4W4ZA 2WABA 4INDA 1K9MW 4YJ3B 4HG6B 1JMKC 5DAXA 5A70A 2VCBA 1X4TA 3I7DA 4MSWC 1YDXA 2Z5UA 3HB3B 5CB7A 5F6LB 2VPVA 3LA7A 1W8NA 3T1YB 4COUA 3BALA 3VLBB 1C1LA 3ZHSA 4CDUA 5LBQA 4CPBA 4WVMB 1XPWA 5FXXA 5CBGA 3WDUA 3RZJA 5IJ9A 1JZ8A 5FJKA 4X20B 2QWRB 5J37A 3CHXA 1M4WA 2DU1A 2Q9LA 3FB5C 1GZ9A 1VAVA 2A5ZA 1H2KA 2HLDG 4XMIA 2WFF3 4DUYO 3HKEA 4QQ2A 2HEWF 3NNLA 2ETNA 4CU7A 2W1WA 2RQ6A 4Q1PA 3IAPA 4JQTA 4QPGA 3DN7A 4RQPC 2GH2A 4LTAA 1D5AA 2VCCA 1VB4A 2QKSA 2PN5A 1WJZA 1YQCA 4J80A 2HKOA 5HCHA 2JGDB 1DQ6A 1J59A 1QR9A 3WG7B 5C70A 3K06A 2Y69C 1X36A 4PLOA 1LGCA 5IK7A 3EJKA 3PUQA 3RWNA 5ABJA 3H1LH 4LK6A 1LHNA 2Y6LA 5EXOA 5FFOC 5LA1A 1BBT1 1RVF3 4ZKIA 3BA8A 1SERA 5FL7G 3E6DA 1TME2 1J1TA 4J42A 1HXS1 4BK4A 3W5MA 3X2QC 3GYDA 5EYYA 2P1BA 1MS9A 1H9WA 5FUPA 2VZTA 2JDZA 3RW0A 2D3SA 3DYPA 2CWMA 1DZRA 4LORA 5LK5A 1H2NA 3RYPA 4JZGA 2H8PC 5LA9A 1NCQC 4CDWB 1EAH3 1JU4A 1US6A 3URFA 2ZGRA 3SJQC 2RN9A 2X7RB 2P67A 1XU1A 4UFMA 4WBBA 4BQ4A 5FK8A 1UL9A 2WUHA 3ALQA 1DQ0A 3OBTA 2D93A 1SLLA 3M3OA 3BYWA 3WNMA 2R9IA 2E31A 2FCVA 1KD1W 3WW4A 3D8CA 3ZN6B 5CA0A 1D0GA 1DGLA 2Q69A 2J7MA 4M0NA 1C5IA 2FDJA 4ZS2A 4EKWA 2XBO3 3VHRA 3AKQA 1BT8A 1AR81 3A21A 2DTWA 4CXYA 5FOBB 5L36A 1OA3A 1WB8A 5JH7A 3TN92 1FYJA 1G8MA 5JSRA 4YNIA 1S4CA 1WCDJ 2ATKC 1AI6A 2WZEA 3TN93 3AG2B 3VBOB 2XHBA 3BB6A 1N1VA 5A3LA 5EBMC 3VGIA 1GP6A 4D8MA 1UMZA 4Z92B 4LE3A 5EZWA 2ZKNA 2DMXA 3CIHA 3D3AA 3BTZA 1Y74A 4WFGA 1SDWA 5F2WA 1W6NA 1AR91 4E2LA 1HQWA 1TMF1 5C8CC 2QQNA 1R092 3PTYA 4ZBMA 3FFQA 1QGLA 1REFA 2JDAA 3X29B 4O9EA 1N0JA 2XJUA 1WLDA 4LFCO 2VULA 3GWKC 3ZRWA 2LRPA 2EULA 5C9AC 1RUC2 3SPCA 4F7ZA 1BVP1 4Y4YA 2CGNA 4LCUC 4EZ4A 4A41A 4YZ4A 4IEUA 3VHPA 2VO5A 3WF4A 4XF0A 4XIKA 2HG5C 1LHVA 5D21A 4CYDA 1YITV 2E6VA 1W9FA 2AEZA 2ARXA 2QJVA 1NR1A 4P9WA 5AG2A 3UCSC 3JD72 1R081 4PDWB 5C4WC 3OGGA 5KMGA 1W2UA 1XJAA 1G6UA 3AP6A 4KHPO 5GW7A 4JI7B 1W03A 5E1RA 1D4M2 1RUC3 3U78A 1WKYA 3O1UA 5FZLA 1VJ2A 4MXWB 4LEJA 4LFAB 1NZ6A 1W2AX 2RM23 4Q26A 1W8ZA 4TXWA 3N7MA 1WLCA 5F5CA 1ZAUA 2PTMA 4NKGB 2WNUA 2YDEA 2JG8A 5HV0A 2HHHB 4YVWC 2RS31 4C0HA 2PUSA 1YJNV 1SC5B 1JYTA 4UVAA 3SGIA 3KS7A 4CCEA 4BMBA 2XBO1 1F4MA 1FOD2 2AHYA 5EBWC 5C5UA 2RDNA 4EE2A 1ZTEA 3WFVA 1NT0A 1Q8VA 1O4ZA 3ZYIB 2R16A 4UW5A 1CZVA 4I50A 2MEV1 4XCBA 2HWF3 3SC7X 1UZZA 3WQ7A 2XJQA 3B02A 3OBZA 5ABJB 4A7KA 5BNNC 5CKNA 2VMDA 1W6MA 5HCAA 1ZSPA 3OBAA 4JKKA 5FZIA 3LOBA 3ZHRA 3NQHA 3PMSA 2VY0A 2PAMA 1PNFA 2VJXA 2XAFA 1BLZA 1R6NA 1SZTA 1AX2A 3MHSC 4PV1B 3SYAA 3VBSB 4DFSA 1VIBA 1J5EB 4C1WA 1VQ5V 5BXZA 1QU0A 2PQSA 5JXGA 3JCZA 5FY7A 1UIKA 3WDXA 4DYLA 2XAJA 3I3DA 3RYFB 2WAOA 3HKBB 2YFZA 4CDXC 5F2VO 2WSVA 1RUH3 3M1HA 4J25A 2ZZJA 3NW4A 1KGYA 1K5MC 5GTIZ 1YYNA 4GB32 2IXJA 3G7DA 1U97A 1RSOA 3R05A 5CVRA 3JAKA 3K5LA 4YGCA 4QHBA 2FZ2A 5FKBA 1ENQA 4CEYC 2W3JA 2ZMNA 5ABJC 4A6SA 1JH5A 3IZOA 3BTXA 4F3JA 1L8DA 1QKQA 5DG2A 2J1SA 3WR0A 4TV9B 4LULA 1RUC1 3BKZA 2QKDA 1RUF1 1YC61 2J1EA 1GM9A 4FO9A 3MIEA 1JYIA 5IW0A 1D2QA 2RVAA 2A79B 5HFMA 5ERLA 2RMU1 5JOXA 4WFHA 2XT9A 1QWRA 2ZINA 5FMCA 1N32O 2ZD9A 4XJ9A 2PI4A 1J5EO 1W2BU 3RBZA 3K51A 3J8F1 3AKSA 3H1HH 2E7TA 4M4RA 4D7YA 3VBRC 3VKLA 1S0VA 3K5MA 1PL4A 1KB9F 4DOUA 4I3PA 1HW7A 3ETDA 3T2TA 4Q1RA 2ILMA 4MXVA 1KXGA 4F6RB 2IH3C 1IURA 2H6CA 2ODMA 4UXAA 2O57A 3HJRA 5J7MA 3B94A 4LO6B 1VBC2 3N7JA 1XBFA 3VL9A 4S2FA 5EJZB 1RTVA 3OYWB 3N3HA 4X1IA 1IVSA 3IC9A 1CEZA 4IV1B 4PIXA 4F6RA 5B66Z 4Q0PA 4FK5C 4QM9A 4DRXB 3NXSA 1JZ7A 5IJ0A 3WW3A 5KX5A 1YFWA 1WNSA 3MI8A 3ZFEA 1JA8A 3KVBA 4GT1A 1DHKB 4OPAA 4XJ8A 2BNMA 5FQ0B 1F4AA 2RS13 4HNAA 2G38A 1TVKB 3R6SA 3O0XA 2QQMA 4BMEA 2JE9A 3N2KB 3K04A 4CU6A 3FN9A 3M3QA 3I2DA 4DV5O 3H9VA 3AG4B 4LH6A 2EXKA 4RQPB 2X5IC 3R4SA 5CNAA 1BSMA 2CNAA 4YGDA 2Z4FA 3ZFFA 2VC9A 3H1MA 4P9JA 2R042 1P7GA 4LR4A 1SCSA 4ONUA 1W6MB 3H1WA 4SBVA 4FPKA 3ZBHA 2XB6C 4ZU4A 3SYOA 4DR2B 2YV8A 2HR3A 1PO22 4NIIA 2ZE7A 4I50B 4X64O 4Y5Z0 4MVMA 1AI4A 2OPKA 2XOKG 3CRQA 2LS6A 2FD8A 3V56A 1BCCH 4YWAA 4NJ4A 3VBFC 4EFBA 3PMEA 3U10A 3U75A 5GTHZ 4L92A 3ZFEB 2VOWA 4EWAA 2I2SA 3H01A 2WO1A 4FPYA 2GN7A 3VBHC 4EZHA 4AQTA 4CDWA 1OHHG 3ZFGB 4EN0A 1PMHX 3I56V 2YMZA 3OGVA 4Y24A 3PDQA 2X6AA 3A0RA 1MEC3 3APOA 5JOZA 5BNNA 5SV5A 5A7NA 1IBMO 1BKZA 3AL6A 3E22B 1JYNA 5JZGB 4GKKO 5CFDA 3T09A 1FMD2 1PO11 4I01A 1XNCA 4AI8A 1RM1C 2ZKLA 2CDOA 5JDBA 4C8DA 4GKJO 2UXXA 1K8AW 3AK1A 3T1CA 3A8TA 4I0XA 2IVIB 4IEPA 2VQUA 3N2GB 5FYIA 3E35A 3OEBA 2JK5C 2IJKA 3S57A 2JE7A 3SYQA 2RM22 2W46A 4KBBA 4X1IB 3VBSA 3SEEA 1LU1A 5FP7A 3VBBA 4DINB 3SNMA 4UBGA 1QDCA 1XQ8A 1KC8W 2OTLV 4AQ2A 2BVVA 4NMIA 3BABA 3I2JA 2VBDA 4BQ3A 3RJRA 2EA7A 1XMOO 4R9CA 4TQFA 4FPPA 5DG1A 4UCSA 3RZLA 4MHRA 1SBFA 3HKEB 1Q82W 2FDIA 4PBPA 5FXVA 4E4DX 1QHTA 3KQ4B 4OQ9A 2JVDA 4BQ5A 4DUYB 4WFEA 3D3IA 4RL7A 4B3TB 1V6JA 4QQOA 4D6SA 2HJDA 3K9AA 3POSA 2VZUA 2VQEB 2H0VA 1JUIA 2QCSB 1MS3A 2BTQB 2ZGMA 1Y6XA 1UPSA 2F1MA 5FZHA 3ORJA 1VR3A 4I4TB 4UWDA 2CWSA 4JRAA 4CSWA 4WVWA 4Q4W1 3MICA 4WM8B 1AYM1 3I5DA 1O8SA 2NNUA 2XH6A 4YJ2A 1SQVH 1QOOA 1YJWV 1OF3A 4LH7A 4AGGA 4WCEV 1OLME 1Z7S3 3WF0A 1D2SA 3NV3A 1A32A 1QJU2 4YM3A 3Q8AA 1SFYA 2AGAA 3TNQA 3GHNA 2BOJA 5FDBA 3AG7A 3G67A 3ABKC 4N7UA 1VARA 2DVGA 4X88A 4IIJB 2W6JG 4IV3A 2XJPA 2ADQB 1W39A 1V0AA 2VWJA 3HN3A 4LIUA 2WA4A 4LF7O 4QMAA 4Q6GA 1P49A 1QNYA 4BW5A 5ANQA 1PKXA 1K5MA 4V2WA 1BGYH 5EYXA 1AR92 3K03A 4HT1T 5C8YA 3JD1A 4O4JB 5FNVB 4G2KA 2OS2A 4KH9A 4RR3B 5HBAA 1N8RW 4J7ZA 1V55C 4Q0VA 1IZ3A 2K9PA 3M8AA 5EC1C 1RVF1 3TB0A 1ZWIC 1VQ6V 1Y67A 1LODA 2XOMA 1K33A 1NG0A 2DBNA 3CO2A 2QDRA 4IV3C 1URXA 4QB1A 3L2HA 1ND3B 5FMOS 1GU3A 3ZS8C 1ULOA 1KKDA 5FP8A 1Q43A 4DUZB 2A3QA 5L3GA 1LOEA 2PHUA 4K21A 3UGHA 1ALYA 1A8MA 1K45A 5GZDA 3WG7C 2IU3A 4Q5OA 1NS1A 4UW3A 4XPVA 3M7AA 2JXAA 1NCQB 2RS11 5A9GA 1GUIA 4U7NA 1X8MA 4JDMA 3WOGA 1O5UA 2VOTA 2QUOA 4ATFA 4CUAA 2NMNA 3ZXAC 1YQ2A 5GZGA 4XZUG 5GKAC 5JCOA 1I1EA 2MW2B 2GU9A 4WVMA 2A6ZA 4IERA 5K1PA 2B9VA 2OYZA 2G9FA 3DYOA 3WCRA 4Q4W2 3CQOA 2NMOA 4NPRA 4AEKA 3FAVA 2QVSB 5LY1A 1FPN1 2A70A 2DV9A 5C4WA 3AEIA 3B77A 1CAXB 2CE4A 1EFRG 2JD9A 4Q4V3 3R66A 5A1LA 1HNWB 1OVPA 3O1TA 1Z7S1 2VWKA 3IDAA 4MX3A 4CEWB 1DF4A 3O65A 4B3SB 3AL5A 5LGNA 2ZR3A 2EIBA 4TUYB 1M57C 3ZEDA 2GDFA 1RUI1 3FAVB 3CP1A 3ZN0A 4AI3A 3CEWA 5F1RA 3QLQA 5G05L 1JOYA 4AI0A 4HFSA 2R061 5EBLC 1OFSA 1CX4A 1Q56A 3NV2A 1VQLV 4MUVA 4K1YA 5FXWA 5LBBA 2RS51 2YEVB 3LEIA 3OR6C 4U3FH 3OTOO 5A7SA 3EXUA 4XAAA 4AEDA 1ORQC 3ZPYA 4KBZA 2QQOA 2XUMA 4FFIA 2Y4UA 1JOJA 5CBHA 1NZIA 1OQDA 3QACA 2CY6A 4JYAO 4XDLA 2UWAA 5FPAA 1UOFA 4FM0A 5JCTA 4UYBA 1Q6IA 4IEWA 4CVUA 3MD0A 2Y0OA 1FXHA 2ZNIA 3CDZB 2ZM6B 1OI6A 2GV9A 1TA8A 2C26A 4S2HA 5AFBA 1W9YA 1IG3A 3E2EA 1X50A 2HVJC 4WFFA 4DV0B 2VAUA 2XHKA 4X64B 3PIJA 4IGOA 2P3IA 5HCBA 4UFJA 4FP3A 5KX5B 4OCTA 1QJY3 2VU9A 1GN6A 1QJZA 3AMMA 1TE1B 2MPFA 1ST8A 4RQFA 1NVPD 3AB0A 5JVVA 3AG1B 2XAHA 1AR82 5T3NA 1FXKC 1W28A 4LKEA 1NA1B 1XHXA 1RUOA 3EMRA 1O3SA 5B4XA 2YU1A 1TUBB 5KUMA 2YG0A 5AVPA 2XHNA 2DVDA 3LPGA 4JV4A 5FZCA 3ZHVA 3CPWU 3MFAA 5IATA 4W50A 1W90A 2NP0A 3OUHA 4LKDA 2WS92 3BU0A 2BWAA 2JEUA 1Y74B 3R65A 2E32A 4FLUA 1N33O 1JHJA 3AMHA 5JXHA 2IFRA 2TEPA 2PHXA 4BH9A 4LHKA 4RGGA 5CA1A 3OUFA 4X65O 3K4AA 1RUI2 1VAMA 5H9CA 2ZEXA 2Q0OC 4N53A 4W6XA 3WSOA 1UX6A 2OIIA 2R1DA 2ZBJA 1NLSA 3T3YA 4UW4A 4XDKA 3A23A 2RR12 4LXLA 1BHBA 1KFXL 4GZ9A 2UXBB 5FYBA 1WMDA 4QX5A 3T0BA 1GOFA 1UXXX 2JS5A 1RGSA 4P9OA 1LOFA 4XDJA 2P4VA 2EVXA 4LF8B 3ZYPA 1RMU2 5L3EA 2R1BA 4FVVA 3GM8A 4KMQA 1OA2A 1U12A 2DCKA 4H37A 1DLBA 3LDCA 1O8PA 2ZABA 4A3ZA 1HV1A 1NKDA 5IWAO 2P6JA 3CZJA 2Q5ZA 2UUBB 1QR8A 3WZ1A 2WPDG 5FPVA 3JATA 1FXVA 5JAXA 4AVCA 2A73B 1VRH3 2ORXA 3H8OA 2P5OA 4MVZA 3OEEG 1F23A 4L87A 3SPIA 1FMD3 3L73H 1LOAA 3J7LA 3LFIA 1WCSA 5CG8A 1QJU1 2D6PA 4MTFA 1TZOA 4Q4X1 4RFT0 4AG4A 1CAWA 4RFRB 3RYFA 4Y22A 1JJ2U 3KD4A 4OPHA 4C7UA 3HNMA 5DZFA 2F17A 4WM8C 3WG1A 4EB6A 1D4VB 5H9SA 1JODA 5JH7B 2GTAA 4JI3B 4FLXA 3VL8A 3U07A 1F7YA 4XZPA 3M8LA 2ZXWB 5EK0A 5BY5A 3UV9A 2YROA 3VD9A 2HYXA 1POV3 4RYDA 4X6QB 2TBVA 3BY6A 1WUVA 4IXLA 3T4VA 1FPOA 3W58A 2ZHNA 4LF5B 2RDRA 4DUXA 1VRBA 2N7GA 2QNKA 1BVVA 3OBRA 1WWYA 2J42A 4YZ2A 2BUKA 2DTYA 3AZYA 3LSEA 4E2GA 3NNJA 4MGSA 2VZ3A 4LBQD 2YB7A 4MTXA 2R72A 1SF9A 3G4SV 4IE5A 4RHV3 4J11A 4IYHA 2MHFA 2ETEA 4MGKE 4X1YB 4P02B 3SYPA 3KV9A 4H7MA 4NTXA 4CBCA 4I4TA 4HVQA 1AX1A 4OHZA 1PV0A 2JDMA 4LF7B 3VB9A 5DN6G 4P9LA 1ZRFA 1ASJ2 3DC6A 2UUCO 3MDSA 3WHTA 1MZFA 4TSVA 1PX3A 4IV3B 5T5LA 3AKTA 2IH1C 2OT7A 3WP6A 1EN5A 3K0GA 5EYPB 1OH3A 2HP8A 4DV3B 2HEYF 1GN2A 3B40A 4MW3A 3TXSA 1FXZA 2BBAA 3TEWA 4YVSC 1JZ6A 2ZNJA 1YIJV 5HXVA 1FI2A 4A7YA 3B2EE 3ZXKA 1YQ8A 4P08A 2RDCA 3OUIA 2OQ6A 1IOAA 1DZQA 5ACA2 2Z5WA 2DUPA 4RA0A 1VBB3 4Q0SA 2Q1MA 3T1YO 5L3BA 3PUIA 2QQVA 4A42A 3IIAA 2Y69B 1HJFA 3SKJE 3IAYA 1AL22 5AFEA 3ZR5A 1ZUQA 4NXMO 1DLCA 4TQDA 3EYPA 2B9UA 1BBT2 1Y76A 1ZX3A 4AEMA 1R1BA 5J48A 4PDWA 5JSOA 1JR9A 4IEQA 3CB2A 1FFXA 3FJSA 5FYTA 3QOPA 3AYEA 4FPCA 3RYHA 4IESA 2E51A 3JBG2 3C90A 3CCLV 5LHIA 2YXLA 5C8YB 3M4FA 4BHPA 4GALA 1JZ5A 3FBYA 5B2GB 2XLGA 3FFZA 2PHTA 4CH4A 4AQYB 2JG8B 3CCUV 2UXCB 5CB4A 2UXNA 2WNOA 4I0BA 1LR1A 3A2FA 4JZRA 2E3CA 1PVC2 4Q0QA 1AR62 3ZOIA 3I97A 2W5FA 5H2FZ 5FP9A 2GHYA 1YI7A 4P2ZA 4MO3M 3GXUA 2XJRA 3GBGA 3SPHA 1S0CA 1N1SA 1S0FA 1XOUA 1OZ0A 4GX0A 4MVTA 1C8M1 1WMEA 3LZZA 4CCJA 4NYKA 4UVBA 1V55B 4NR1A 4O4IA 1W2OA 2CK3G 3FYIB 1VQPV 1LEDA 3UESA 3TCUA 1Q6UA 1ZBE1 3GWOA 3HWJA 3OYWA 4Q0UA 2ZE8A 3ABKB 2XR4A 3FL7A 5AC91 3JSLA 4W6WA 3OD0A 3WNLA 3L74H 4QPGB 2HLEA 1QCEA 4EB6B 4QPWA 2IXKA 3J9SA 3B8NA 4JAVA 3M70A 1EV11 4H44B 4TWKA 1VPHA 1RJ8A 3ZMUA 2B5HA 4LBQB 1JBCA 1ZZ7A 2QDOA 4NPMA 5FY0A 5CU1A 1TMF2 3OGSA 4NB5A 1V54C 3GVMA 1O5LA 4O9GA 5LOVB 3FD9A 1SETA 2O8OA 4BXSV 3RZGA 3VBOA 2JG9C 2B5UA 5CA3A 1HNXO 3CC4V 2VOVA 3JUUA 1UY0A 1K73W 3PL0A 3CJIB 2D3OW 1NZCA 3MV11 3PJQA 3SCGA 4C91A 4XQDA 1YWKA 2LO1A 4LO8A 3BIEA 2HEVF 5EP9A 4DV0O 4DR7B 1EYBA 5LA6B 1QJX3 1QQP3 3S5AA 4DR6O 4KUMA 1D2DA 1X33A 2ZGTA 5L19A 4YG3A 5L9RA 1VAKA 5I0TA 1GANA 4LHLA 2GC2A 1AILA 3VD7A 3DKQA 1YF2A 1YTFD 1KRIA 3V0AA 1W8HA 4DR5B 1UU4A 2OIGA 5C9AB 4AE2A 1Y3TA 3KQRA 5CBFA 2C24A 1S55A 4O4JA 2N04A 4CE8A 1REDA 4CDQB 5IVJA 2CGPA 4YG0A 3UKVA 1H9PA 1RYYA 3RVZA 3V65A 1CP9A 3AZXA 5C6CA 2WT0A 2QQIA 2OZ6A 4JV5O 3MGUA 2D6LX 4W8JA 3RVYA 1AR4A 3DC5A 1ZRDA 4QDSA 4BIUA 3OMNB 1BMFG 2R70A 3GHMA 1J3PA 2Y64A 2RDQA 3CRAA 3D4KA 5LMUO 4BIZA 4NHKA 2IWGB 4YIPA 1RUF3 4Y3OA 5JLVA 1O9GA 2OWOA 4META 5JR2A 4LBQA 1QMJA 3V0AB 2WAMA 3NNMA 3DSQA 1HR0O 1QXPA 1NAEA 2YGMA 4DW1A 1RUG2 1B09A 1DQ4A 1PO12 3SXWA 3CU7A 3M3CA 4FP2A 3ZO0B 5KC6A 1J84A 4ICGA 1OFNA 4WFAV 2VBPA 5A1AA 1XYPA 2DYCA 2VW0A 3I49A 2VGDA 3KV6A 4BQYA 5BNPA 2BSKB 1GQHA 4O4IB 3STZC 5CISA 5A3NA 1FXKA 3VBUC 2RCVA 2NZ9A 3CC2V 1V00A 5IUQA 3MF6A 1MACA 1POQA 3K3NA 4CDWC 4LF5O 3LNNA 1ENXA 5DDJ2 4G4FA 2BYVE 2Y26A 3FMGA 4CP1A 1GP4A 2GMMA 2HWB2 1AJPA 3VDBA 1VF6C 4QX8A 4JI2B 3SPGA 4PI2A 1P4RA 1C57A 2HEPA 2FB5A 4GX1A 1KP3A 1M56B 1SKVA 2G9ZA 3RMYA 2ZXWC 4KP4A 3ILFA 5FZAA 5KHGA 3ATGA 4OUEA 3RI8A 1HB3A 2Q5TA 3WQ1A 3WX5A 4U3JA 3HBKA 2L35A 5EIBC 4CCKA 3KSCA 5BNQA 4AOCA 1XNQO 5I93A 3M7MX 5IAVA 4R7CA 4L97A 5IT9N 5KMGB 4NXNO 4YFWA 4X1KA 3NAPA 3T1MA 1SEFA 1MSDA 4QQLA 3THTA 2VOKA 4K3UA 4QHZA 3VBHA 4MGZE 1GMMA 1UXZA 1VLNA 1W0PA 1J83A 1XC6A 5FPUA 1UX7A 2UUAO 1TME3 3VKMA 5K4LA 2EXIA 5J9PC 4NAOA 4U3JB 3FB6C 4DIQA 1Q81W 2ARAA 1F9KA 4P30A 3H1KH 4BDVB 2W92A 2WNEA 3POFA 2XVKA 1JYCA 1V6OA 2WJSA 3OPTA 1GOHA 2ZACA 2JENA 5KHHA 3WD5A 3F7VC 2VQTA 4IEYA 3IGAC 3O7OA 4K8XA 2KG7B 3BU7A 2DFCA 4GULA 5KR7A 2EIJB 1HRV3 2NN4A 3QVNA 3GCWA 3RDIA 2R9RB 5BNOA 1S72V 3PJSK 2DCJA 3IPVA 2UWBA 4NRMA 3C2UA 3J7AU 1RUD2 1WMXA 4GAZA 1LHWA 2W39A 2B45X 3RYIB 2A6WA 1VBD1 1FXKB 4BK5A 2JJ2G 3O14A 3B9CA 3MIHA 1Y7BA 5J2UA 2VZSA 4BE3A 1VQ7V 4JGZC 4WZCA 4LP8A 5CB4B 3T1HB 3EQEA 2OPWA 1SQ4A 5I0SA 1FFTB 2OA2A 2J1UA 5J3UA 2E76B 1UNBA 4M00A 1R3LC 1GRJA 1EBOA 4Q4Y3 3CS5A 1J58A 5J2UB 2HVKC 2VZQA 1LR5A 1XOYA 2JDYA 4DR5O 1R091 2QDNA 5F5AA 3K4DA 4NRQA 1GV9A 3S7EA 2YGLA 1BEV3 1OOPA 5FYUA 3QO7A 1HR0B 4TT3G 2BPA2 2D40A 1BQ0A 4DW0A 4YHHO 3UT0A 1XE7A 4X1KB 2JRIA 3NAPB 2JS3A 4R50A 3KT4A 1A78A 4YGEA 3MPBA 3AP7A 1E57A 5CA6A 4V2VA 1R1A3 4QGLA 2B39A 3WXPA 3WP3A 2JIZG 2A7AA 3QF7A 1RUE3 5BNNB 1NI8A 2BVBA 3FZ3A 1SBEA 3SITA 2Q7HA 3EB7A 3W7XA 1AVMA 2QQPA 2ZX2A 2HWF2 3MBWA 1H8VA 2F23A 5F3EA 3S6PA 3Q8EA 5JZGC 5DAPA 5C3SA 1UOJA 4A5UB 1K5JA 1ROPA 4FPGA 2N74A 2RDSA 5CFCB 2DQ0A 3D82A 3CYOA 5C93A 1R3KC 2RS53 2RHPA 1QNWA 1NTMH 1GFF2 2D2CB 2JEXA 5BNOB 3ZFGC 4CEYA 2W47A 4QQHA 5GZEA 1LOBA 1EZJA 1HDJA 1HN0A 2AENA 2QKAA 1MZ6A 5IYZB 3LCPA 1KS4A 2A3WA 4GXLA 4EN9B 4BR6A 1GKBA 2IXHA 2W1SA 5CYYA 3T1HO 3H1YA 1YUDA 3H7YA 4OX9B 2G1MA 4U7OA 4B3RO 4GQ7A 1J3QA 2F4PA 2CSGA 1UQXA 5JI7A 5JOYA 2Q0AA 4FTSA 1F35A 4GKJB 3KCYA 4CH6A 1ASJ3 1L0LH 5LBCA 5BY1A 4QXCA 4N7IA 4Y1VA 4FI9A 3K5OA 1MMMA 4MVQA 1IX9A 3DPRC 4TUYA 3ZKYA 5LW9A 3BVOA 1E5IA 1RHI1 1ZZCA 5LWBA 1GNHA 3BPZA 5A7PA 1L7RA 5CFDB 2WA3A 3OB8A 1R3IC 4A3XA 1VQ9V 4ZU7A 1NXMA 2E9QA 4UCUA 2GALA 4A45A 4ZY9A 4QIWF 3D6EA 2A6XA 2ZTNA 5FZDA 1ZBA2 3B09A 3HKDB 1RJ7A 5T52A 2MK3A 1CQ9A 4GWNA 1OF4A 5KAFZ 2B42B 4TYSA 5L3FA 4HETA 4B3NA 5C9AA 4I0XB 2R7EB 3RVHA 2WLLA 3RMXA 4CP2A 4B7KA 3ZN6A 4L9BA 3QH6A 2VD7A 1CZTA 2CU5A 2QQJA 3GBFA 3KLSA 4MHUA 2W9XA 4XJAA 5EIBD 2AEYA 4UFIA 3V0BA 3VD5A 2KG7A 3STLC 3ZMOA 2PLV3 1EN6A 1B6QA 4O4LA 3SCHA 1PGL1 5L3CA 1L7QA 3L72H 4YW6A 3WP5A 3P30A 4NXMB 3B00A 5FBJA 4FFBA 5FY1A 2UY8A 4AHCA 5BMVB 3FLTA 4GWMA 2NLJC 2VM9A 2M6YA 1RFYA 1PNMA 3IN9A 2GNMA 4BLIA 1S3JA 3RN4A 3USSA 4J7JA 1W0NA 5DAWA 1JUHA 1ULCA 4UW6A 3K75B 1QQP1 4ITCA 3VHOA 4XTMA 4F8AA 5FY5A 4K8FA 3O1SA 2Q7EA 2Z0AA 2UUCB 1XL4A 1K3IA 3VOUA 5EHDA 2WNVC 1QEXA 3I54A 2FCUA 4O2AB 4ZHQB 2XQRA 4UVCA 2JB8A 2DU0A 3BFRA 4N43A 2BOCC 1SHWB 4GH4B 1C5HA 1SZXA 3MW3A 1MQTA 3AG3C 2W91A 5KXDA 1QJY1 2WINB 1GM8A 4CXWA 4HMZA 3J7HA 4Y1YA 4Y1ZA 4MT8A 1JHNA 1UMIA 2Z79A 1S2BA 1MABG 1EAH1 4IGPA 1GQGA 4NTWA 1I5YA 2DOSA 4B3TO 2DCZA 1R082 2HJFC 1M56C 1KEXA 4FOYA 1OCCB 4YM0A 1RHI2 4FQ4A 1RC6A 3HKCA 2R6QA 4NHLA 2DFBA 1L3JA 1BEV1 2Y6FA 2FYUH 1DF0A 1L1FA 3LOIA 4UF0B 2ZEZA 4KNCA 2D6MA 2KR2A 1WD3A 1PZ7A 3FB7C 4GKXA 1LU2A 4CEWC 2DCTA 4LBOA 1H8HG 5KLVH 2GTSA 3RYHB 3L71H 3H9AA 2V73A 1JJOA 1RUJ1 5LRSA 1AYM3 2GC3A 4K20A 1BS3A 1JVMA 3CXCU 3MUY1 4OHYA 3VZKA 1F2NA 1RUD3 4QHOA 5BNPC 3HQXA 3PUAA 1U0AA 3TEXA 4YZ3A 2WFF1 4EN7B 1DZTA 1N1TA 4F4LA 3OTOB 3JAMN 3ZYFA 3M2MA 1VF5B 3DGTA 3ZN5A 3FE5A 4XUNA 2YUEA 3N9PA 4RR3A 4Q4Y1 1WB7A 2BGPA 1SLCA 2P34A 4FOWA 1MA1A 5GM0A 5CADA 3UKNA 1XUQA 3ZRSA 2K1EA 5DEDA 1NTZH 4H55A 4DXWA 5EWSA 4JI7O 1NKGA 3K3OA 4O2AA 1X7NA 3MF9A 4DXSA 4SLIA 5F32A 4FFGA 5FJHA 4Y5SA 3I3MA 2WNVB 3KF3A 5DUUA 3AXEA 5F5IA 5FZ4A 1UD1A 4FFHA 2W1QA 4K1ZA 2Y38A 5GJ6A 3JSNA 1F31A 2VOXA 1IPKA 2C9KA 3RNSA 3H8UA 3L70H 1BZWA 1AR1B 3EHBB 5F5QA 4LFBO 2C1FA 3J81N 1W3VA 2P3YA 4BOWA 3AMQA 1KP2A 2ZGPA 2PY5A 4ZXKA 2WZPP 5FP4A 3QNEA 5J09A 3V64A 5K0UB 3TJTA 1OT5A 3H3LA 4Z8BA 4JYCA 4JHTA 3UL2A 1JN2P 1CD3G 4XF3A 5FYZA 1H6XA 1RUH2 1PP9H 1UYZA 4LF4B 3EXAA 5FYMA 1MNGA 4OI0A 5TSWA 3IKWA 4FQZA 5FO9B 3SHRA 4DPNA 3UQ8A 4FIPC 1AR93 3WF3A 1WP8A 3U4XA 1F51A 1VQMV 2YEVA 2GP5A 1RPOA 1H8TB 4EJRA 3ACFA 4LUKA 1RSOB 1B35A 4XW3A 3HT2A 4LITA 4JI4O 1NX9A 5IVYA 3T2OA 4YLZA 2BSKA 3A0HZ 2YU2A 1LOCA 4U2AA 3AJYA 1EV13 2VNVA 2CAUA 3R4DB 1DIWA 2BCCH 4YJ3A 1HW5A 3KV5A 3Q8BA 3JAWA 2VW1A 4UFZA 1GWLA 5E79Z 5LYJB 3L9DA 4ASKA 2MEV2 2DWEC 1VBC1 4FZ1A 3I59B 1VB2A 4OZOA 1PGSA 4I55A 5FLXN 1THZA 4UFKA 4Y4RA 4ZU5A 1C8M3 3RT3C 5C71A 3Q4HB 5IY5C 3CRRA 5DZGA 3RFRA 4ZONA 2WT2A 3OD4A 4XTPA 2CHHA 2XL9A 2AACA 3BCWA 2YIDA 2A06H 3QBQA 5ANNA 5FKCA 4IT5A 1FYUA 1ULDA 4HONA 1I5PA 2G4IA 1XDCA 4QKFA 2F95B 4KWKA 1T6GC 2EINC 4MVUA 2E33A 5H5NA 3SDLA 4FZ0A 4DO0A 4AZZA 1Q8OA 3ZXEA 2EZPA 3DXRB 1HB2A 3GALA 4HPKA 4JI5O 2BTQA 3C7GA 2BZDA 4KWLA 4GZRB 4ARXA 3HNYM 3CE2A 1OCRB 5LBEA 5F2SA 4I0AA 4M4PA 1AXKA 1R1ZA 1WCKA 5HFLA 5FPLA 4CC6A 2BNNA 4QU1A 4GB31 4UOJA 1ZA7A 2P22C 4MZUA 5IK8A 3N27A 4LQRA 2EXHA 1UN1A 2WS93 1SDDB 3JZVA 1XXNA 3JQXA 2RMU2 4YGBA 2NYYA 4MGQA 1XNKA 1VP6A 4AEDB 3SR2C 1TGOA 5B1OA 3W7TA 2LFSA 2Q6AA 4LR3A 4EQVA 2Q8OA 2WC2A 2PZSA 1JZ2A 1GKFA 4PDMA 4COZA 4RO2A 2WLHA 1XMOB 2GAUA 1W0JG 3T08A 3LEKA 1PIV3 3G6JB 3F2ZA 4P5YA 1A34A 5HV4A 2OQ7A 4UFLA 3ZSKA 1LGBA 3HN1A 3UO2A 3ASOB 4AVBA 2BERA 2X53S 2KSDA 1MEC2 3IIIA 2VMIA 1S5JA 4KFMA 4W65A 1V9PA 5IVVA 5KBFA 4HK9A 3C3SA 4PF1A 5IJRA 4BYYA 1ZRCA 2ZE5A 2WQ4A 4EWDA 3HOBA 4ASLA 2ZKOA 5FOJB 1SFNA 1ND2C 1MOFA 4RUFA 4KXRA 2DVBA 4CEWA 2V5YA 3RGBA 1RUJ3 5LHGA 1BMV2 4N53B 3RRDA 2CTPA 4QX7A 1QOSA 1I94B 4IHJB 4S2DA 3K0DA 4GLXA 5CZKA 2VECA 2P3KA 5JJEB 4DR1B 4Y1UA 3EO6A 5LY2A 2BGOA 5C5TA 1C4RA 1ASJ1 4QGMA 1UAIA 4JASA 4ASUG 4ZOLA 3JD4A 3E8BA 3ES1A 3E6BA 3ZXJA 1W8UA 5FIXA 2IVJA 4AGRA 2RE9A 2WYFA 4C0BA 2ZIMA 2ZZQA 5LHHA 5FCCA 3RWKX 3NAPC 2X05A 5B3SC 4DRXA 4YVSB 3LB9A 4PJ0Z 5D5QA 4UB6Z 4LF4O 4Z1VA 4BW9A 4HBNA 4ZIBA 3ON7A 2B1IA 4FAHA 3USUB 3ZLIA 5L73A 5F3CA 3FB8C 1R1A2 4E8DA 4PBOA 1B35C 1D7PM 4OI2A 4BQ2A 1XHZA 1OD3A 2W68A 1XNDA 4BXFA 1RUG1 4LT5A 2PXJA 1XMQO 2IXIA 3JBG3 3N9OA 2Y6HA 4ISQA 3VBFB 4BLJA 3F5TA 3KHCA 2LUWA 1BEV2 3T2QA 3CCMV 5FZMA 5B4NA 4WM7A 1L0NH 2WLLB 1MS0A 1IXMA 3CMAV 3A0KA 4QPIC 3W5NA 2Y0IA 3RZKA 5FNVA 1FKAO 3HIFA 5IT6A 4FTBA 3IC7A 4FPJA 3GZUC 4XABA 4H13B 4LBNA 5B1AC 1SRYA 2WLPA 4OVEA 3TN91 5BZBA 3H0OA 4K0KO 3N7LA 4ZZ5A 4ZHQA 4LOSA 4LE4A 1HRI3 1F5FA 2QE7G 2JE8A 3AYAA 3WINE 5GONA 4YPJA 1SLAA 5C8WA 1GICA 3PVBB 1I5ZA 3O12A 5H6RA 2F6BA 1VQNV 1S2EA 3UM7A 2WWSA 1FV2A 3NNGA 1V6LA 2YC2A 3H8XA 2FBEA 2KA3A 3J4UH 5A3WA 5B1BB 4PIZA 3RYRA 3U11A 3MZHA 1ZZBA 1QF3A 2XG3A 1AJKA 3AG4C 3TBDA 3UJQA 4B29A 3AFKA 4NPLA 4XXPA 4IE4A 2JDUA 1Q8PA 3WY6A 1ENSA 3BA9A 5A3PA 1DK1A 1FAFA 3JAWB 2EBOA 3T30A 5J2TA 4B3SO 2QSAA 1RHI3 1WP7A 5FPZA 2HFEC 1NH2D 4DQAA 1TNRA 4DXTA 4K6BA 3DECA 4HOOA 3ZYRA 4CDQC 1DQ1A 2GNDA 3AYCA 3HKCB 2QTSA 3T0DA 4KGGA 1RMU1 2DURA 2BWCA 3NKTA 4YVSA 4XURA 2MNGA 3DL3A 3UYJA 4QXBA 3VDDB 1LGNA 1DDLA 1TNFA 1AP5A 2RG4A 5FQ0A 3TYJA 4O2BB 2XVLA 2P90A 3WT3A 1SA0A 3J80N 4PA4A 1G4YB 3PUSA 1KBHA 1R6TA 4CXXA 3UT5B 2AGSA 1EPZA 4TV9A 2W08A 1AYM2 1BHAA 2LM3A 2EALA 1VALA 1X8EA 1OCCC 1FOD3 1NA1A 1O91A 5KXCA 2E5LB 2Y6GA 3ZMVA 2X8KA 5DAVA 2NQYA 3VDCA 5B1AB 3I2IA 4GMP1 3QO8A 2ZM6O 1HV0A 3AK3A 1AJOA 4I0WB 3K77A 1NA1C 3D5OA 4LF8O 4ET7A 3VQVA 1SMVA 4ATEA 1H1MA 5FPRA 4ZXEA 1A8DA 4XBQA 2W95A 5D1IA 3N4MA 4LNVA 1R083 3JD0A 2UU8A 2UUBO 4TV8B 3WDWA 4XYXA 5BYNA 4JI4B 3S3XA 2XVGA 1UZ0A 5LZ6A 4E27A 2GC1A 2IFWA 4DV1B 4CPBD 5FPXA 4MGYE 1H4GA 2VZVA 2JIJA 3MO4A 2DCYA 2E5LO 5FZ7A 1PZ9A 1ZREA 2HWB1 1AR5A 2WO2A 4W6YA 1OVSA 1DYPA 1H30A 3W7WA 3I3QA 4U36A 3D0SA 5LP6C 2JJ1G 3IT8A 2FDKA 4QGPA 4MVSA 5K7PA 3TK1A 3G71V 1JFFA 2WYSA 1IQAA 1YJKA 1RM1B 1IPJA 3BN6A 3T4HB 5CMUA 3PUHA 3HR9A 4M3CF 5F9TA 2GDSA 1X9TA 3ZHUA 4CZZA 4XVHA 1K7DA 4LWSA 1UCXA 1FV3A 2X5IA 4S2GA 3CWBH 4NAMA 4QPYA 1LKNA 4YG6A 5J2TB 3VDDC 3LFMA 3DXRA 1QJEA 1O3TA 1RUI3 4CU9A 1G86A 2TNFA 2X09A 3B69A 5JPMB 1CWPA 3LF7A 1CPYA 2CV6A 4IL6Z 4D7SA 3LNMB 3H3ZA 4N9HA 3M3EA 1WPBA 1OMIA 1I9RA 5JUVA 5A33B 1VQKV 5CA0B 5LBFA 4KWUA 4URAA 2D98A 4GMP0 4AAXA 3HD8B 3PNAA 4QKNA 1XBLA 4RS5B 4L0PA 2NPIA 1FT9A 5LP6A 5FZ0A 4YW7A 1K5QA 2WT1A 3MHZA 5KAIZ 1D0HA 4IETA 1HNZB 3VKOA 1MVEA 5JIUA 3GBWA 2VRZA 4ZZ8A 3HBZA 4IE6A 1SLTA 2XJVA 2DWRA 1ZVFA 2V72A 1DGRA 1BMV1 1J3RA 1GQPA 4CDXA 1SACA 1B04A 1Q8IA 2YIBA 2WS91 1B06A 1Q8QA 4CRQA 3ABMC 1YI2V 1SZBA 1QOTA 3BRCA 1WW6A 2ZGKA 4QPIB 1S0BA 1GNZA 4LA2A 4DV3O 3PU8A 4X9QA 5LA2A 1EUTA 1QLEC 1LNQA 4XE9A 1GM7A 1FS0G 2QQLA 3JBG1 3SYCA 4CEYB 3CMEV 3DTUB 4R9DA 3ZMTA 5F6KA 1FNYA 4A6OA 2VNGA 4HAMA 3K9SA 2ZQMA 2ARCA 2RV9A 4QDRA 1F4NA 1IKPA 3WDVA 1TEIA 2BTOA 3JD71 1UYYA 4K8ZA 4JYYA 2Q8CA 5A3UA 3NV4A 2RR13 2EIJC 2WQ8A 5JVDA 1VIWB 3FYEB 3NRUA 3ZYBA 1JQ0A 3K08A 4CUBA 2WN2A 1E79G 3JAKB 3NNFA 4XDQA 1PK6A 1UMHA 1QJX2 4KU8A 4QGNA 1NYWA 2QWNB 1PPJH 5K0UA 1HWYA 1ODMA 3I2GA 1UY4A 3P5BA 5K0UC 5I91A 1W0OA 5A32A 4PA3A 3VZNA 4XFFA 2GZWA 2ARHA 1WCUA 4FPEA 3P3PA 1L7LA 2V09A 4D6RA 1MS8A 2OKXA 4GX2A 2JWPA 2CTWA 4XHBA 4HK8A 4Q4Y2 4X66O 2P6HA 4H33A 2PAEA 4NN0A 1LCLA 4GH4A 1ULPA 1UKGA 1IGOA 3ZFFB 2DYSC 3JATB 1XRUA 2MEV3 4EN6B 2IW5A 5JOWA 3ICXA 4Y1XA 2C6SA 5C7GA 4GIQA 1EM1A 3CCJV 1LJ7A 4LLFA 5FZFA 1MS1A 2YZ4A 1PM4A 4AHWA 2EF6A 4DEQA 4Q20A 2JDKA 3DUIA 1QH6A 3B3QE 5IE9A 4LHNA 5BUVA 1LEMA 4DRVA 2EINB 4O2BA 1EUUA 3CF6E 2VZRA 1VBE3 1AXYA 5IK4A 1COWG 2F93B 4PDVA 2HHHO 2JEMA 1WCQA 5T54A 4JHZA 2AHZA 2XTAA 3OGCC 3LSSA 2DYRB 3ASOC 3UGFA 2W87A 4E4ZA 2DVAA 1PNLA 2A7WA 2C5DA 2AR6A 1W6QB 1H2MA 2ID4A 2LW1A 2QQKA 2VQAA 5GLTA 2PYJA 1ZL8B 1CAUB 4WZFA 2VVEA 1TQ5A 1GO3F 4LJHA 4WVZA 1DGWX 1NH2B 1H4HA 4COWA 2UU9O 3MAQA 3EFFK 5FYCA 2EICA 4DUZO 4Q8KA 4BIFA 5APAA 4RAIA 3PHMA 4Q8LA 5FZ3A 5A3OA 2UXCO 4FT8A 2Q8EA 3RZZA 1GH6A 2ERFA 1W6OA 4Q27A 1E5RA 2ET1A 2YHJA 1N34B 1BZKA 4AW7A 5EQUA 5E89A 3UO3A 3PN1A 4JV5B 2EIGA 3E86A 1H2SB 1XMQB 3FWEA 2XKOA 2GC0A 3MW2A 3TAYA 4WM7C 3WDTA 1G9AA 3ZRXA 4O65A 5G04L 3HAGA 1C1FA 1D4M1 1TUBA 4HYOA 3BAAA 2ZR2A 2KB1A 4DV6B 3WNNA 2Y33A 3IFXA 4QJFB 1UY2A 2VVFA 1H2GA 4CCDA 1UY3A 2YXHA 4KU7A 1WW5A 2J22A 4JTDB 2Q4SA 3IB3A 1AR72 4P9IA 1JI6A 5DDJ3 4G9SB 3ZFFC 2ITDC 2VQFO 5EYPA 2FL4A 4DNYA 4FOVA 3O1OA 1O4TA 1I94O 2VMEA 5E88A 3M3IA 4M3CB 5E6HA 5T5PA 2R49A 2VUAA 3ZXGA 1RUD1 3J26N 4BB3A 2HBTA 1XEQA 3KB5A 3DGEA 1V6KA 2WNUC 2E74B 3KG2A 1YI9A 4E4EA 2BNOA 3P6BA 1POV1 1E5HA 5B1NA 4NOTA 4QB2A 1ZLZA 3ASNC 5J96B 4LPLA 3MFCA 2WLIB 1I08A 2WSSG 4CCMA 5KHJA 3KKYA 2ORZA 3CJIC 2VZPA 5CKMA 3ES4A 2LFRA 5FAXA 2WLMA 5FWJA 4RQPA 1S76D 4FLWA 2VMGA 4QM8A 5DUXA 5A6YA 1VQOV 1PM9A 3W59A 1TUEB 4DR3B 4X89A 3BODA 3HQRA 4JYAB 2CTVA 4KG8A 4J6GA 1GR3A 1Y9GA 1IBLB 4R4XA 5L9BA 3OR7C 1QLNA 4DZGA 3ZVXA 2JB4A 3TGUH 1LESA 2D97A 1YVWA 4QKBA 1F5JA 3VZOA 5GZCA 4PD4F 4FPLA 2Y34A 3RZHA 4BISA 2UY9A 1UF2C 2YPJA 1WBFA 3ACHA 3C7EA 3ZRWB 2ZAHA 4DXZA 2UXDO 2WRAA 4PDLA 4NTYA 3VBRB 3SJCC 2WQZC 4AVSA 2AYHA 1Y66A 4MVOA 4O4HA 2CH7B 4JAUA 2Z42A 1OCOB 4IQPA 4JRLA 4UB8Z 1Y9MA 4QPJA 4OUSA 2QM7A 3EHKA 4IEXA 1OKOA 4JI6B 4CCCA 3ECQA 1QQP2 2OUJA 4XBNA 2VQFB 3M99B 2CDPA 1DP0A 4UV9A 2WZ8A 2R0FA 4EN8B 2PA7A 1HRV1 4YW4A 4RD7A 4NUBA 2P37A 4YRDA 1C8NA 1LTEA 3VBRA 4XEZA 4JGSA 1NQJA 2BEOA 3POYA 1KKCA 1W6PB 4AXOA 1QJU3 4RR3C 1B3QA 2OZJA 2QTOA 1QY4A 2J1VA 5H9PA 4E2SA 2VUJA 1AI7A 3ABUA 1T6BX 4XAEA 4B3MO 1QJY2 2FDFA 4Z82A 2ZGQA 3ABZA 2M7WA 4OHVA 2IM9A 4GJZA 3ZXLA 4TLFA 2XJSA 3OTFA 4DV5B 3U37A 1XYOA 2IC1A 1WA8B 1BHGA 1US2A 2X0LA 1G8WA 2XGXA 5LA0A 2A6YA 2FMLA 4NHYA 2B1GA 4FLVA 4XIOA 2XLAA 1KITA 4FMTA 1AR83 2PQQA 2K46A 4NWWA 2D6OX 3HKBA 3AVRA 2VTXJ 1EAH2 1QNMA 3ZSMA 1AHSA 1DQ2A 4UCRA 3MIBA 5IVEA 4K40A 2RMU3 5A33A 2EX3A 1J95A 5KC5A 2XJTA 2VMFA 3DPRB 2D5FA 2D3RA 5ITZB 4XQ4A 1M1KW 2G19A 1N34O 3KCCA 2EAAA 4NRPA 5KUKA 3G80A 3P32A 3FLPA 3LSUA 3ZHTA 1PMIA 1LRHA 2ZGSA 2AREA 3AMNA 4HZ3A 1SG3A 4G28B 1GNYA 1UKRA 1K4CC 2Z69A 3JXSA 3MUZ1 5FP3A 1JMUB 2QKCA 3D36C 1VQ8V 2WFF2 4YVWA 1PVC3 2JG8C 2PF4E 1XQNA 5GZFA 3GJAA 5FO8B 1XU2A 3Q4HA 1C8M2 4FCAA 1NOVA 5FZ6A 3ACIA 3S30A 4I30A 5F3IA 1W04A 1UY1A 1CIWA 5F7UA 4QPKA 4Y20A 1N0NA 3GDBA 1ZRRA 2HWD3 4YM2A 4YY3B 3JB8A 5LYJA 5IFTA 2CTRA 3WV6A 5FY9A 4YW3A 2AH2A 2HWD1 3K59A 3KHBA 1EV12 1GTOA 1OHFA 4Y26A 1ZA4A 2ZGNA 4CDUC 1HRV2 1M9NA 3KGZA 4Q4W3 3WF2A 3I2FA 4MVRA 1APNA 4WFBV 3MDPA 5LB6A 3J8F2 1B35B 5D8AB 4WBNB 5C33A 4AF9A 4QAWA 2BOIA 4FVMA 3IM0A 3IWZA 3CD6V 5ACA3 5A6QA 1LECA 2EIMC 1OCOC 3N9MA 1OQEA 5DXDA 2Q8DA 5LA6A 3NJXA 2H6BA 3HR0A 4MV2A 1UIJA 4N90A 4QPGC 1WLEA 2GUZB 2WNVA 2BQPA 5J98B 1YJLA 1HDKA 5A80A 5DPNA 4NE9A 1CXZB 3ETGA 4X66B 2R30A 4BA6A 2C2AA 2IZWA 4ORFA 5FPBA 3I8TA 2RNBA 2QEXV 4XJWA 4JGZA 4OQ8A 1TME1 2EIDA 1JPXA 4Y20B 3ZDVA 1P7BA 2QWOB 5LOVA 5FZ9A 5EV7A 2UURA 5DECA 2LQTA 1BL8A 1TVKA 2ADEA 2WL1A 1G9DA 1SQQH 5KXEA 1OUSA 3W9AA 3IAQA 5JI9A 1LUWA 1Q6HA 1VBA1 1PGW1 4HKWA 5FTTC 1YXBA 2B4KA 5FMOL 1WA6X 5JPNB 1HNWO 2F4VB 3AXDA 4FFFA 4F83A 4ARYA 1YRZA 3WW2A 5GALA 5A7WA 1ZRIA 2JGUA 4EEQA 4QD2A 2YUAA 2J1RA 4DY5A 1O3RA 5DM6V 3ZMSA 2HWE1 3WQ0A 3ZRVA 3NJZA 5A2QN 3OW2U 3GZTB 1YHFA 3C3VA 4JKLA 1QBZA 1W8WA 3NR7A 4RGKA 1NBMG 3USUA 3DPRA 1GWMA 1RP3B 2JKXA 3IDCB 4H3WA 5EFUA 4BCUA 4TTGA 2PI5A 4CCNA 2YPDA 3AKPA 4Q4V2 2H0BA 3C8XA 3JD3A 4IEVA 3LDKA 4X20A 1GYKA 1FD9A 2X10A 1GN3A 3ZYGA 3E89A 3I2HA 5C3RA 1SPPB 1TVGA 1BE3H 5L7OB 4CDUB 4DUVA 1CX1A 1MG1A 4E8CA 1GWKA 3QO5A 1NU1H 1RUNA 3SEPA 1PO13 3CC7V 4NO4A 5DDJ1 3VV1A 1XNBA 1FNZA 3KM5A 4PI0A 3DXTA 3K48A 4HKOA 3A4UA 4DY3A 1HP8A 1IG0A 2XAGA 4TLGA 1MPXA 3LQCA 3A22A 3RG0A 3BGAA 5FXZA 3S0MA 4AQSA 4M3CE 4DV1O 2Q7GA 1YLLA 2UU9B 5GLWA 3LD8A 2J1TA 3K2OA 3PLQA 1X82A 1WAZA 4ABMA 1HQLA 3AMPA 1S0IA 2TUNA 3LEGA 3RZMA 3N2GA 4PELA 2ZAAA 3DXUA 2VCMA 2DW4A 3HQUA 1PO21 4DRRA 3QD6A 3PTRB 2O14A 1OV9A 5K1XA 5FO7B 5FREA 1YEWA 4CP9B 1RMU3 1G9CA 3SH3A 2E7QA 1Z78A 3JQWA 2X5IB 3BIWE 3ZFGA 1KUQA 1GZCA 3CBNA 4FAGA 2V4DA 4H14A 5F8PA 2SBAA 4N53C 2FKXA 4JCKA 2ZX3A 1QDOA 2NN8A 2H3OA 2VNRA 5DN2A 4DR4B 3CL1A 3FHAA 1IBKB 1OOPB 4O61A 1LHUA 1FMD1 4NROA 1C28A 1DFQA 3R4UA 2E7AA 1PHMA 3VKFC 3AZWA 4JI6O 3OMAB 2WLIA 3OJBA 5E1AC 4PLMA 2EJRA 5D5PA 1RUJ2 4E4SA 3ZDSA 1Z7S2 1E5SA 1LOFC 3VHNA 4LFBB 1YTFB 3JASA 2ZEYA 1UU5A 3X2QB 5IYDO 2IXLA 2XPJA 2KKWA 2QWQB 1TMF3 4Q29A 2ZCWA 3BI3A 4Q4X3 4YW5A 4DV4B 1PD3A 4OUMA 5LXTB 3DV8A 3E6CC 4DV4O 4QQPA 4OFGA 1YCIA 3GCXA 5FLJA 2LW8A 3T0AA 1VQ4V 1M5IA 1CAVA 3WNKA 2Q30A 2A1XA 3H1JH 3UETA 4LUMA 1AYN1 1Y4WA 1YSCA 4PLNA 1JS9A 1XNRB 3LDDA 1PIV2 2QZ3A 1GP5A 3MLKA 1PVC1 3VBSC 4WF9V 4HZFA 5BXXA 4K7JA 2C4XA 4LBKA 4FLYA 2ZX1A 1QVGU 4RSUA 2R043 2CGOA 4HVRA 1HNXB 4HN1A 5T5JA 5JR7B 4P00B 1AP6A 1IPSA 1AZDA 1QQCA 3VUOA 3BTYA 1ENRA 2IUWA 4AWDA 2DYRC 1CONA 1XNAA 2W1UA 1FJGB 2ZDIA 5H9QA 5F39A 3NWKA 1PO23 4HKLA 2CTQA 5FLIA 4BWAA 4AVVA 4N8MA 2ZX4A 1RUE1 4N43C 2DVFA 3H7JA 1S0GA 5JZGA 1NVPB 3ZSJA 4GH4C 3UKMA 1RUE2 4URTA 2L9LA 1W8FA 4FTEA 4BM8A 2D5HA 1NCQA 1HKDA 1UFIA 2VZOA 4EROA 2QBXA 1MZEA 2XXZA 3ABLB 1Z2GA 3ML0A 4BAYA 1UO9A 2WNUB 2RS12 2EXJA 3LKJA 5IY5B 1NR7A 1OH4A 1QIQA 1OC1A 4XMAA 1DG6A 3VBUA 3I3BA 1ZBE3 5LGUA 2K9ZA 4KG0A 2WZR1 4ZI7B 4YW2A 3O1RA 1IQDC 4JAAA 4LOTA 3LEMA 4QXHA 3INAA 3CZUA 5DMYA 2BDRA 2D3PA 2W0XA 2YIAA 3AK0A 3OUSA 4XFCA 1ZX5A 4K0KB 1PX4A 1AROP 1LENA 1H1IA 4RQEA 1GMGA 1KJRA 2OXBA 4BU2A 5EIYB 3HT1A 5B5EZ 4CZSA 5EJ3A 1NCRC 3T2PA 1R73A 5ITZA 5F37A 1IBKO 1W9WA 1LUVA 2AXTZ 3N2KA 1VF6A 4QX3A 4A4AA 2ZEWA 5A6ZA 3F5WC 4P14A 3ZFEC 4IDZA 4D3WA 3POWA 2QE3A 2EAKA 4JI8B 4FPHA 5BNOC 3CJHA 3MIDA 2RM21 3U4SA 3LA2A 5CAZA 4UCOA 4YVWB 1QXJA 2AZ0A 5FZKA 3N9NA 2I45A 1VBE1 1JX9A 1T2XA 1QJX1 2YBKA 2BGCA 4K8RB 4IV1A 2IJJA 2VTXA 4UV8A 4X8PA 4AR2A 3VBUB 1AR63 5EPAA 2AC1A 1XI1A 3OPZA 4B3MB 2R063 2LW7A 1P8JA 1W59A 4BIOA 3LGRA 3I4IA 3MPPG 3BPSA 5JCOC 4JI1O 4JDOA
chains in the Genus database with same CATH topology
1R1A2 4PBOA 1B35C 2AZ5A 4OI2A 3WZ1A 5JAXA 4L2NA 2W68A 5FLHA 3ZXDA 1XNDA 4AVCA 2A73B 2K2SA 2LALA 1RUG1 1VRH3 4LT5A 2OUHA 2IXIA 4D94A 3JBG3 2D44A 1AYN3 2SLIA 1FMD3 2HYKA 2RS33 4ISQA 3VBFB 4BLJA 5E8AA 1LOAA 4DS0A 5FRAA 5ACA1 2LUWA 1WCSA 1BEV2 5DUWA 1PM7A 4FPOB 4WM7A 5CG8A 3TWIA 4MH0E 2HWE2 1QJU1 2D6PA 1COV1 4R4ZA 1KDMA 4IV1C 5CFDC 1MS0A 4Q4X1 3ETQA 4RFT0 2PYTA 2VG9A 4YW1A 3A0KA 4QPIC 4AG4A 2A6VA 1CAWA 2HJIA 3O5SA 1YFYA 2Y0IA 2HWD2 3HIFA 5DUVA 4Y22A 4A2UA 3OY8B 5IT6A 1AUYA 3KD4A 4FTBA 1MZ5A 1AR71 3WNXA 5DZFA 2ZHMA 4FPJA 3GZUC 4RS5C 4TWTA 1NCRB 4WM8C 1OS7A 5CIRA 1VBB2 3WG1A 1R093 4LBNA 1D4VB 4D7TA 4OULA 5H9SA 1CN1A 5I8YA 2WLPA 4OVEA 2YY1A 4WM8A 2JG9A 3TN91 2ET7A 3VL8A 2ATFA 3H0OA 3U07A 3N7LA 4XZPA 3M8LA 1I3HA 2PAKA 4PF5A 3ST7A 4LE4A 4WVVA 5BY5A 1HRI3 3UV9A 1F5FA 1CESA 2ENRA 1OOPC 2XWBB 3E5XA 1CAUA 2YROA 1NXD1 3AYAA 3WINE 3KCXA 1POV3 2QFEA 4QXKA 1SLAA 5C8WA 1DS1A 1G9FA 4X6QB 2TBVA 1GICA 4X6RB 4B8EA 3PVBB 1I5ZA 3O12A 2BFUL 1WUVA 3V0BB 4IXLA 2F6BA 1DBNA 3W58A 4M23A 2KXLA 2ZPXA 2ZHNA 4E2QA 2WWSA 1BJQA 1IHMA 2KM2A 2N7GA 2QNKA 1BVVA 1FV2A 4BWOA 3OBRA 1V6LA 4YZ2A 4BPZA 1SCRA 3E5UA 2FBEA 2KA3A 3J4UH 3JD73 2BUKA 2DTYA 3AZYA 3LSEA 4LLOA 4AGVA 4OI4A 4AYUA 4E2GA 4PIZA 4LBQD 4B4PA 3RYRA 1QXRA 3U11A 3MZHA 1ZZBA 1QF3A 3ILNA 3R1JA 2XG3A 1AJKA 4RHV3 3TBDA 3FX3A 3UJQA 2MHFA 4B29A 3AFKA 1V6NA 4XXPA 2ETEA 4MGKE 4DMIA 2R0HA 1RUG3 1VRH1 1Q8PA 1EPWA 2FZ1A 3WY6A 3APBA 1ENSA 2OVUA 1O4YA 4H7MA 3NV1A 2BBVA 5KWRA 1OIJC 1FPN3 2HWF1 4HVQA 3ILRA 3FLRA 1AX1A 2R072 1CJDA 4OHZA 3WP4A 2FMDA 1RHI3 4ES9A 5FPZA 1YFXA 1RINA 4P9LA 4DQAA 1TNRA 1ZRFA 4K6BA 1ASJ2 3ZYRA 3IMNA 4CDQC 1IS3A 1S2KA 2VNOA 1V9U2 1DQ1A 2GNDA 3AYCA 2PHRA 5T5OA 3WHTA 4RHV2 1MZFA 3SH5A 2VXRA 4KGGA 4TSVA 1RMU1 2DURA 4IV3B 4LBMA 1N3OA 2BWCA 5T5LA 3AKTA 3NKTA 4L11A 4YVSA 1RB8G 3WP6A 2MNGA 3DL3A 4BG1A 4HSLA 2A3YA 1CAVB 3VDDB 4MYEA 1U5YA 1LGNA 1DDLA 2HEYF 1TNFA 3LAGA 1MEC1 1N3QA 1FXZA 1CR7A 3KMHA 5FQ0A 1W6OB 4YVSC 3TYJA 4XOGA 3FUQA 2XVLA 3WT3A 4IEOA 3WVJA 1NE6A 4XETA 5HXVA 5HI0A 1FI2A 3AX4A 4A7YA 4AFBA 3ZXKA 5E16A 3PVJA 3RQ0A 2UWCA 5C8CA 2AGSA 1EPZA 4LO7A 1IOAA 2BW8A 2W08A 1AYM2 1DZQA 3SH4A 5ACA2 3FC0A 1UPIA 1FAYA 2LM3A 2DUPA 2Z5WA 2EALA 5KEUA 1VALA 4RA0A 1AR73 1X8EA 4EWEA 2OW4A 1FOD3 1NA1A 1O91A 1VBB3 5KXCA 2VMHA 1AL21 4WV8A 4Q0SA 2Q1MA 3WHUA 2X8KA 4Q2FA 1YIFA 2NQYA 3IIAA 4CVYA 2GH8A 4GMP1