2WA4A

Factor inhibiting hif-1 alpha with n,3-dihydroxybenzamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa4A01
4QU2A 3P3PA 5JWPA 2ILMA 2YDEA 4BIOA 2WA4A 3D8CA 4AI8A 1MZEA 4B7KA 2YC0A 1H2LA 1H2MA 3OD4A 2XUMA 1YCIA 1H2KA 4Z2WA 2CGOA 4Z1VA 2W0XA 4NR1A 1IZ3A 3KCXA 1MZFA 2WA3A 1H2NA 4B7EA 2Y0IA 3KCYA 4JAAA 3P3NA 2CGNA
chains in the Genus database with same CATH superfamily
1O3TA 1W2OA 4DRXA 4DR1O 3D4KA 1UPSA 2EVXA 4ZS3A 2Y38A 5B1AB 4DMIA 5B1OA 1QGLA 3FWEA 1XHXA 1LNQA 1MR5A 2E51A 1ND3B 2F4LA 4OQ9A 4P9OA 4CS4A 1R64A 3UKMA 2VW2A 1POV0 2ZIMA 1F35A 1VALA 1JJ2U 1QU7A 1OFSA 2HWF1 2IVIB 3LSSA 3CC7V 4MXVA 1HV0A 5DMYA 3ZYGA 3J7LA 3CWBH 3C8XA 4AVCA 3JUUA 2JEMA 3TWIA 1XUQA 2VNOA 1AZDA 4AHWA 3AYCA 1O5LA 2BVVA 2WIIB 3TYJA 4MX3A 4UF0A 3K0GA 2P67A 4ZU5A 4RQEA 1XB9A 3JBG2 5F1RA 4G4FA 1OD3A 1X50A 4JGZA 1ALYA 1GNHA 4JQTA 3FYIB 2AC1A 1ZL8A 5KHIA 1NBMG 1VMJA 4IW3A 2MNGA 3VBOA 2YS8A 5FV3A 5AC91 3OGCC 2ZKNA 4PDLA 1O3SA 2IJJA 2R073 4ZHQA 3JAKA 2BPA2 1B04A 2JWPA 2F4PA 2P3IA 4QXHA 3NAPA 4DUVA 1V54B 4C7UA 2JG9A 2XNDG 1AL23 1WB8A 4SLIA 4BLIA 4WM8B 5J09A 4NTWA 1EV12 1C8M2 3OEBA 2BERA 2ZKOA 2UWAA 3W5MA 4X8AA 3B02A 3CKHA 4K3AA 3RDIA 1PO13 4IYIA 1U97A 2A9HA 3B3QE 4OLLA 5ITZB 3SJQC 2XONA 1NR1A 5EWSA 3LD8A 4CPBD 1RPRA 1K5SA 4J1WA 4LF7B 2JICA 5BYNA 2ZX2A 1O3QA 1H8TB 2XB6C 1X8EA 4Q0QA 5DAWA 5LWBA 4N7UA 1ENQA 1E5HA 4HONA 3TB0A 2GSMB 2ZMLA 4L11A 3WNPA 4EN7B 1VARA 4H0LB 2P5OA 1VMFA 1GU3A 3FLRA 1AXKA 1SESA 1DF0A 4CDXC 2NMOA 2DYRB 2A3XA 5IVEA 4CDWA 5JSRA 5LGTA 2HWD3 5JQGB 3KMHA 3J8F1 4LULA 5L9VA 4KXRA 5IAXA 3DV8A 1C8NA 2D3OW 3M70A 1YQ8A 2R9AA 3AMQA 3ACLA 2L35A 5KHHA 2BSKA 3TEWA 1NLRA 5EK0A 1YJKA 3MW3A 1R083 1WWYA 5C5UA 4FLYA 3GZEA 3A22A 4CCMA 1OJHA 5LP6A 1CAWA 3K04A 1AB3A 2ATFA 3WW1A 3ASOB 5FUPA 2A3YA 1JI6A 3ENRA 3PIGA 2KG7B 3NNLA 2RJKA 1EAH1 4WM7A 3VDCA 3EFFK 4D6TH 2WJSA 5FP8A 4TQDA 3J80N 4UCSA 1DBNA 4JV5O 3RWRD 1EPWA 1IGOA 3VZOA 5A70A 4Z1VA 2WLMA 2J1SA 2R043 1IQAA 4BOWA 5TSWA 2OQ6A 4YZ1A 4PHZA 2WAAA 3MZHA 1S0JA 4FZ1A 1IKQA 2F95B 5LGNA 4MGZE 4MVUA 5EPAA 4ISQA 4Q26A 2QFEA 5FZ0A 3VBSA 4L8JA 1KDMA 4R8HA 4X89A 5IT6A 3IIAA 1R73A 1K3EA 2DF7A 5C4WA 2QDOA 1KP2A 5ABJC 2YC2A 4FVMA 5D8AC 2VOTA 1ZNPA 3ZRWA 2C26A 3QACA 2AUYA 4WBNA 1KXGA 2JVDA 4J10A 1OZ0A 4LFAO 4Q27A 4Q4Y2 4B4RA 4FM2A 5FO9B 5B66Z 4EFBA 1ND2C 1TVKB 3Q9OA 5CB7A 4ET7A 5CYYA 5BUVA 3LFMA 4LOSA 2UU9O 1FV3A 5EBMC 3I2OA 2OIIA 1OKQA 4FVVA 2UXBO 1XNRO 1IS6A 5J36A 5F2SA 2GC1A 3S7IA 4B3TB 3NJYA 2WNEA 5FPAA 4BA6A 1Q8QA 1O4YA 1MQTB 1AR4A 2E74B 2H8PC 2VAUA 3U4XA 4FOVA 2W92A 4HPKB 2BV4A 4WVMA 4FPCA 1R091 5FZ7A 4Y4RA 3GWKC 1OCCB 3E83A 5B3SB 2GMMA 3BIWE 4OFGA 1G9BA 1OVSA 2BW8A 2A3QA 2DV9A 1NS1A 3EYPA 4RGKA 4NXMB 1Q56A 2DBIA 5K0UC 3GVMA 4CCEA 1U12A 3GWOA 2JEUA 4XF1A 1R1A2 2HBTA 2EALA 4H7MA 2RR11 1NYWA 2IXLA 4WFHA 2WLPA 1SCSA 4IT5A 3SH3A 3V56A 1N47A 1PVC2 2GH8A 2Z69A 1A8MA 1RB8G 3LWCA 1UL9A 3ZFEC 1VBD2 3N9LA 3WVJA 1YRZA 3MV11 3G6EV 5BNPA 2ILMA 3MAQA 4XHXA 4AHZA 1VF6A 3I5DA 1RUC3 4MTOA 1D7PM 5IWFA 2VG9A 2WSUA 5CU1A 3T08A 1PIV2 4HKOA 4FPPA 5DG2A 1VBB3 1CR7A 5H9CA 3WXPA 2Y64A 2Q8OA 2VTXA 5CA3A 1COV2 4XCBA 5FKCA 2PQSA 5FPUA 3JSLA 4COZA 4ICGA 1SQQH 4OVEA 5A1LA 3DTUB 4O7XA 3OD0A 2ADPA 2DW4A 1W6OA 2YC0A 4LBOA 1NH2B 5L3FA 2AZ0A 5J98B 3VB9A 4W8JA 3ZN1A 4LF6O 2QCSB 2ZX4A 1ONAA 5LA6B 5FYUA 2BEOA 3VKLA 1W8WA 2OKXA 1OT5A 1O59A 3N9QA 4NWWA 4QXKA 1NA1C 1G6UA 2PAMA 2RS31 2XJVA 4UB8Z 5GJ6A 1O4TA 3O1UA 2W3JA 4JAAA 3IAPA 4QM8A 1KC8W 3FAVB 4YVWA 5BNOB 3FBYA 4ZXEA 1HKDA 5A3WA 5BNQA 1GM9A 5L7OC 4MGSA 4AAXA 3JD72 3GB7C 1SA0A 4GULA 1ROPA 1IZ3A 4AI3A 2D97A 2DVGA 1MZ6A 1VF7A 3NV2A 1IS3A 2ZE6A 2W1SA 3ZPOA 3CYOA 4NHKA 2RDNA 4JV4A 3OUSA 4IESA 4D7SA 2QQNA 3RS6A 5CG9A 4IE4A 1K97A 1VQNV 4IV3A 5KXDA 1W28A 2UXDO 4QT6A 1SFYA 1RUF3 2FYUH 4H13B 1YI7A 2BFUL 4O2BB 3ZSLA 1LEDA 3N4MA 5E89A 1YHQV 3F95A 2YIBD 2P7TC 1DCSA 4AG4A 3ZHVA 1JW6A 4RL7A 2MEV1 2LW8A 2RMU2 5FZMA 3WB1A 2QNKA 4QKBA 3I3EA 3B00A 5JH7A 3D36C 1RUJ2 1X8MA 2AEZA 4QX0A 3CL1A 3T4VA 4CCKA 1J5EB 4YM1A 2W95A 4QHZA 3LZZA 5A3OA 3N9MA 4TT3G 4RQPB 2Q1MA 4BQ1A 1W6PB 1GP5A 4UFJA 4Y24A 4XVHA 3PJQA 3DPRC 3WG2A 5J2TB 5JMOA 4L9BA 4L8QA 1K4CC 3C3SA 1EN4A 5A1AA 2WAMA 4BWAA 3W7SA 4ZONA 1JOBA 2ENRA 4P9GA 4FLWA 3CJHB 4CDQC 1UMZA 4Q4W1 4QPGC 5ACA1 2IXCA 3TETA 5KX5A 2R7EB 4OX9O 1NE6A 1MNGA 1R3KC 4LBKA 2WZR2 1GNZA 1B35A 4BJ0A 4H2AA 4LMFA 2YI8A 3AFKA 4CUGA 1SERA 1HXS1 3ETQA 4YGEA 1DGWA 2VOKA 3RFRA 1S72V 1BLZA 2JJ6A 1S77D 4RUFA 1UZWA 2K1EA 1CX1A 5L3GA 2PFWA 4GA9A 1MACA 3BAAA 2BE3A 1XU2A 1TGOA 3G4SV 4NO4A 3UO3A 2AHYA 1DLLA 2UUBB 4AXOA 4LA2A 1UF2C 4LBNA 1UFIA 2FL4A 5EZYB 1K5QA 1SZTA 4AEDB 3AG2B 3WDYA 4DV6B 1A32A 2B9UA 3QVNA 4P14A 1QR8A 2Q4SA 4AILC 5EC1C 2C5DA 1VQMV 3U1XA 1AR63 2XL9A 2RM22 4BMEA 2EILB 2C24A 4RHV3 3PN1A 5J9PC 4WZFA 4AFMA 2W1QA 1NXMA 2GTSA 3FJSA 3ZN6B 5JCOC 3LGRA 3K03A 4X64B 3M3CA 1NVPB 5DUXA 4GZRB 1TQ5A 3JD3A 2BNNA 4P30A 4PQQA 3K5MA 3H3ZA 2GV9A 4F8AA 5GZCA 3ABTA 4LNUB 1Q6UA 5C8CB 2WNOA 5A7OA 4YG0A 1GM7A 4LKDA 5IDJA 3CRQA 3D3QA 1J95A 3NR7A 2VUDA 5J2UB 5IJ0B 3PL0A 1JPXA 4XFAA 2QWQB 4DR3B 4CUCA 1RVF3 4QPYA 4AGVA 2QM8A 4MW3A 3AK3A 5LHGA 5IYZB 1H38A 4M3CE 3TAYA 4ES8A 3W59A 4EB6A 4GCZA 1BZKA 3K51A 5F37A 3IGAC 4FXGB 5FR3A 2VQ0A 4N9HA 4CPBA 3CJIA 2SLIA 4Q1RA 1Q8VA 2JECA 4HK9A 4PA3A 2ZZJA 1GV9A 3APQA 4XDQA 1YI2V 1US6A 4RS5B 2FHRA 1TME3 2XLGA 3I3MA 4A7ZA 1URXA 1BHBA 2WPDG 4X65B 4DR5B 3NJXA 1NZ6A 1U96A 1H2NA 2LUWA 3S5QA 5T5LA 1D2SA 2IFRA 3WFVA 1QCEA 2ORXA 2VBPA 3OG2A 3TN92 3LDEA 2GALA 1VQOV 3TRSB 3GGLA 4KHPB 2CDYA 2QZ2A 5BNNC 2CH7A 1BCXA 3K58A 2RVAA 1TMF2 3N3HA 4MVMA 4H3WA 5C8YB 3BGAA 1O3RA 4I01A 3WNLA 5C3PA 4B4PA 1JXNA 2GMEA 4FO9A 2Q68A 3K59A 1DF4A 5A7WB 4HZ3A 2XAJA 3FB8C 2XMLA 4OHXA 3IC7A 2X6BA 1W05A 1ZREA 4LBQD 4Q4V3 5LXTB 2ZCEA 4R52A 1JYNA 3H7JA 4DV7B 4N43A 5EV7A 1SBDA 5CISA 1BXHA 1C28A 1E57A 1AI4A 3WW2A 5FYBA 2P17A 2WLIA 2YFZA 3SJAC 1NQTA 5T5PA 1SBEA 2H0BA 1W8FA 4O4IB 5JAXA 1VIWB 4IV1C 3UK9A 1W2AX 5TISZ 4E4HA 1EUTA 2ZE7A 5BV6A 2YUEA 1W6NA 2BP6A 2WNUA 3IM0A 1HRV1 4F4LA 2UWCA 2A6WA 1MS3A 1R081 2EXJA 3AKSA 4CRQA 1XSQA 4TWKA 2YC4A 1Y74A 1XRUA 5T5JA 2PXJA 5E79Z 4QX5A 1IPJA 4K6BA 3AG1C 2WNVC 3TOJA 2WO1A 1R3LC 1ZLZA 3PIJA 1NCQA 1WLEA 2C9KA 3H8XA 4MHRA 3CB2A 1SQPH 5B1AC 3VZMA 3OF1A 3AZYA 3AB0A 3H1WA 4JKMA 1ND3C 4NWVA 3ETGA 3KZ4C 3W20A 3KCXA 4FI9A 3KQRA 2HJDA 3K2OA 2HWB3 5C7GA 3ZRXA 1PKXA 2ZEWA 1W04A 4ZXKA 5HI0A 4PELA 1BHAA 2JG8A 1VBC1 3AG4B 3RJRA 5IK8A 1PMJX 3EXUA 5AVPA 2A79B 2VMEA 4QGNA 2XLFA 4AFCA 1QEXA 5FY0A 2FB5A 4JC1A 1F5JA 4XJ9A 1WLCA 1QQP2 3SPIA 1H9WA 1W6MA 3B01A 2DTYA 4HOOA 3J9SA 2WLLA 2VCAA 3NKGA 2EIJC 5H9PA 1OHFA 3K46A 4N8MA 1X82A 4XAAA 2R30A 4HT1T 4KU7A 3OEEG 4XBLA 3M3EA 3GF6A 2DVFA 1H2GA 1KQSU 3INAA 5IY5B 2VOVA 5IYYA 4E9KA 5C6CA 2J1VA 1RHI3 2P90A 1H6YA 3ZFFA 3FC0A 4C91A 3RZKA 5BR8B 4GMP1 2XAFA 4XDPA 3CS5A 5FRAA 4YW4A 1OCOC 1YNAA 5FOJB 3VBOB 5C5TA 3AKRA 5H9QA 3VBFB 3BTZA 4PA6A 5G04L 1FMD2 4KWUA 4TSFG 4LKSA 1Q7YW 4ZHQB 3MIBA 3QF7A 3JAKB 4DRVA 4LWSA 4N21A 4WM8C 2W1UA 1FX5A 2G9ZA 2E6VA 2ZDIC 1FXKA 2JG9B 3MHSC 4N90A 5FYHA 1MZEA 2JDKA 1VB2A 1RXFA 2XVKA 4DUWA 3B93A 1S5HC 3NNFA 3T1MA 4H55A 3OMAB 3MD0A 1WJZA 3HQRA 1ZBE2 1KD1W 1L1FA 3VQVA 4Q4X1 4GT1A 2DCJA 3BRCA 3RN4A 4LORA 4KWJA 5CVRA 1N36O 1H8TC 1N0NA 4GH4B 4I0XA 2WFF1 5F5CA 2DUQA 4E2LA 3OOXA 3OGVA 2GU9A 4ZOLB 1ZBA1 1FJGB 2IJHA 1OPOA 3SHRA 1WMFA 2K0GA 1RUD1 3CX5F 2B9ZA 1OI6A 4GKKO 2JK5C 3IMNA 2DYRC 1VRBA 1P7BA 3BEHA 4NRMA 2WR9A 1RUOA 2HVJC 3RYHB 1PZ7A 4M3CA 1S1AA 4QX3A 3OTOO 1E5RA 2HEYF 2YICA 4DW0A 1EBOA 1LHVA 4LF4B 3WG4A 4CZSA 3BTAA 4CDWB 3POWA 3VZNA 3QO5A 4LUMA 4FOQA 2E7AA 2AH2A 1AF9A 2ZE5A 2RJ2A 4FPOB 1EYBA 3N7MA 4IEQA 4ASLA 4QPIA 5B1NA 1PO22 2A71A 3HKBB 3X2QC 3X29B 1RMU2 2YXHA 1AI5A 4NIIA 1N1YA 4X6QB 1UY2A 3A21A 1PL4A 4XJ8A 1GN6A 4UUJC 4AR2A 4XFCA 5F39A 4AFAA 3FZ3A 5HFMA 1ASJ2 1VQPV 3ZJZA 3WDXA 2XWJB 3JD4A 4WM7B 1IS4A 4GWJA 5FY1A 4X88A 2B1GA 1RP3B 1CWPA 2CY6A 1GKBA 1G7YA 1N33O 1LTEA 2Y34A 4IGGA 1J59A 1UY4A 1OF3A 4FPKA 3GHMA 4Q0VA 5EXOA 1CZSA 4LHNA 5FYZA 1PM9A 1S5LZ 2YIBA 2LGWA 2FMDA 2BUKA 2D43A 4NXNB 1AYM2 1JYXA 3HKCA 4QDSA 3CXHF 1HRI2 3DEMA 4JGYC 1FOD2 2IH1C 5GONA 1LCLA 2PHXA 3UYJA 2ES3A 5LHHA 4BK5A 1CQ9A 3PHMA 3VBSB 4Z82A 4LE3A 5GKAC 5C4WB 4WBBA 1NCRA 4M0HA 3RYCA 3OY8A 5CN0A 2X5IA 3F2ZA 4FK5C 2IM9A 3KV6A 4DW1A 1DZRA 3ZRWB 3JAMN 4PJYA 2R72A 4K1ZA 4LBLA 1W59A 4U7NA 1POV1 4CVUA 4QX1A 5FQ0A 4J41A 4NE9A 2K9ZA 3ZXGA 3J4UH 4ZU7A 4LOTA 1QKQA 1I0HA 5AFEA 3SCHA 1HJFA 3O1TA 3IJ4A 4ISRA 4BW9A 1AXZA 2W0XA 3K3NA 5CA0A 4HVQA 2D98A 5JLVA 1SC5B 1DGRA 4JI7O 5DUVA 5IVBA 3JSNA 2QTOA 3O65A 4QU2A 5C3SA 1TE1B 2DWEC 4X1IB 3HJRA 4NOTA 5FUIA 3VL8A 4YPJA 3PDQA 4DXSA 1GANA 3AG3C 1JFFA 2VMCA 2YHJA 3BPSA 1F51A 5D2AA 1OCCC 2IXKA 1V9U3 3SNMA 4GYCB 3MV01 3RSJA 3H1LH 1Y3TA 4XTPA 4QQLA 1ZWIC 1DQ5A 3L9JT 3A0KA 5FJHA 5LMNB 3WDTA 1B06A 3KGLA 2A5ZA 3H1YA 2VBDA 1OPMA 3IMMA 1NOVA 1YFYA 3E5XA 2OIGA 2QA4V 1NT0A 2ZE8A 1PK6C 5GALA 3POBA 2FCUA 2XAGA 3C90A 2LRPA 1G9DA 2VZ1A 3CC2V 2G9FA 1XE7A 4DEQA 4PDMA 1FAFA 1CPYA 1QVGU 5F3CA 2OT7A 1G8WA 1LGBA 1ZA4A 3F7YC 4COVA 2WWSA 4QHBA 1AJPA 4LH6A 2Q7GA 1H8HG 3K48A 4ASKA 2JE9A 2DWDC 1XNQO 4AQYB 3QO7A 5IATA 4RR3A 2ZABA 4W6XA 2HYXA 1UXZA 5IWAO 3D6EA 4EZHA 4UV9A 1MS1A 1XE8A 4XF3A 4OHVA 4R6ZA 1RPOA 2GP3A 1HIXA 2J7MA 4FOWA 1FPN2 3NNMA 1QJX3 4B3MO 2RS53 2P4VA 3Q8EA 1HB2A 1BJQA 1R6NA 3DXRB 3QD6A 1I94O 5FZEA 1AR61 4GKXA 4DXRA 4GB33 3AYEA 3GCXA 2ZS6B 4PIYA 1W6OB 2MK3A 1MVQA 1QH6A 3PUSA 3CMAV 2G19A 2ADDA 3SDLA 1BQZA 1XBFA 5F6LB 5GZGA 1VAKA 2QQIA 5L9RA 3QBQA 2XVLA 2UU9B 2E33A 1W8OA 3OBRA 3TCUA 3K77A 4E27A 5IK4A 3WQ7A 1YYNA 3ABLB 4E2QA 5LASA 5BNOC 3GCWA 1PVXA 5C3RA 3FB6C 5FZBA 2D6MA 1IPSA 4LLOA 3K9SA 2G9GA 3WG7B 3EHKA 4B08A 4URTA 2HHHB 1H2MA 1EZJA 3WP6A 2BOIA 1AYN1 4PCRA 4JI0O 1QJY3 1WPXA 5LATA 3KVBA 1F7YA 2WT0A 3ZFGC 5I0SA 3J7AU 5FYSA 1EN5A 1LULA 1UNBA 3TEYA 1D2DA 4RYDA 1RUG1 4IV3B 4PDVA 2VS0A 2V09A 1S0GA 2NLJC 5CFDC 1OOPC 1YIPA 3UQ8A 4IETA 1MMMA 3IKWA 2VTXJ 4MVQA 1YFXA 2QTSA 1SLIA 1YEWA 4HMZA 3ABUA 4TZDA 3L73H 1SLBA 2EA7A 2V7QG 1P7GA 1F31A 5E1RA 3ZPYA 1YWKA 3R4SA 1AROP 2D3SA 4DK1A 4LT5A 1HNZB 1VQ4V 2W1WA 4H37A 1YTFB 1YLLA 3NV1A 3R66A 2W2IA 4JYCA 1DQ4A 1RUE1 4K1YA 1UN1A 2ZGRA 5KA5A 1D4M1 2O8OA 2QBXA 3DUIA 3NJVA 4TYSA 4B4QA 3JATB 3RNSA 4XUTA 1J83A 4D7YA 1DF5A 3NJZA 1GH6A 4JTDB 4BQ5A 1DHKB 5K4LA 3SKVA 3C3TA 5GLTA 5ERLA 2Q8DA 4D3WA 2YYOA 2WC2A 2BJSA 5FUNA 3O1RA 2QWPB 4Z92B 3LFIA 2P6JA 2VQEO 3OUIA 1OUXA 3ME2A 4F3JA 4EN9B 1K5MA 3NNJA 4HL0A 1ULGA 3UJOA 5JZGC 3FE5A 2LO1A 2JIGA 2OUHA 2ODMA 1LJ7A 1W8HA 3N7LA 2VOWA 2Y6JA 4V1PA 5FY7A 3S30A 2PN5A 2YBKA 2R1BA 2X10A 3E35A 4OPAA 3KT1A 1V6JA 1IX9A 4AEDC 3AG2C 1JZ4A 3P5BA 1YQCA 4MUVA 1GRJA 1P84F 1PNGA 4E4DX 4NAOA 2RJZA 1RM1B 3CCLV 1JOPA 1S0IA 4CUAA 1SF9A 2G38A 1THZA 2NMNA 1PNMA 3CRAA 1VRH3 2EILC 5A6YA 4AFBA 2WT1A 3V65A 1VBA2 4AVSA 4DUXA 1K5JA 2UXDB 2WO2A 1XMOO 4N53B 3ACHA 2P34A 5KUKA 3RYIB 5E6HA 1ULPA 4MSVA 2NYYA 4Y20A 3OPWA 1CAVA 4QD2A 1OVPA 4XMAA 4X8PA 3JD2A 1Y9MA 5KAIZ 1H2SB 2JGUA 1DGWX 5C8CC 3HKDB 1TUEB 1JYIA 4QDQA 5FZOA 4LBJA 5FPOA 2KQXA 1K73W 2XVGA 2B4KA 1HNXB 1HQLA 3USUB 2P22C 1RC6A 3HN3A 2WT2A 4DXTA 1CZTA 4MGIE 2Z4FA 3PNAA 1RUI2 2VULA 1WNSA 3QO8A 2VZ3A 2DOSA 3LSQA 1AR92 1LU1A 2WWUA 3MO4A 4UXAA 1Y76A 3TXQA 4OI0A 1AVBA 4HVRA 4Y4YA 1M06G 3S6PA 3OCPA 2PLV2 3PU8A 3MPBA 1GZTA 1BK1A 3DYPA 1S3JA 1Q3EA 2CYFA 5IK7A 3AC0A 4Q6GA 3HR9A 1U5XA 4RS5C 5FNVA 2D5FA 1GZ9A 3N2KB 1US2A 3HD8B 4UOJA 3UCSC 3ZYJB 1UD1A 3IDAA 4B3SO 3STLC 1OV9A 2JE8A 1POQA 1W3VA 5H6QA 5IFPA 3HNMA 5JOZA 4XUQA 4P2ZA 3R05A 4LITA 5FCCA 2XL7A 1YI9A 5LZ6A 3GZUC 4GKJO 5JDBA 4JI2O 1SDWA 4Y3OA 1Y7BA 5E1AC 2JIZG 1DGRN 2ARBA 2C4XA 1W0JG 1R6TA 2CTQA 5KMGB 3H9VA 4LEJA 5A6QA 4JX0A 5LOVA 3WF3A 2PHFA 1N3OA 1G86A 2P2KA 4NAMA 1BYHA 2XJSA 3D8CA 3CMEV 3CEIA 2ZX3A 1JHJA 5HCBA 3ZR6A 3R4UA 4Z8BA 4NXMO 3ZYPA 4N43B 2E5LB 1IVSA 1GKFA 2WABA 4XQDA 3FHQA 1ODNA 5DECA 4NPMA 3OYWA 2FTKA 4GX1A 5KXBA 1C3HA 2WS93 1Y9GA 4A41A 2DYCA 4CDXA 2IJKA 1BEV2 1UMIA 2B39A 4FIPC 2QKSA 2HWC2 5I8SA 3E5QA 1CVNA 4P5HA 2WNUB 1NXD1 4J11A 4PA9A 3ZRVA 5DXDA 1LNSA 1JA8A 3SISA 1LU2A 5JI9A 1G6NA 1WA8B 4MT8A 2HWF3 1Y74B 3OUJA 2BDRA 4ZKTB 1L8DA 3ZYHA 2IWGB 3N9PA 2YMZA 5FY8A 2YGLA 3THDA 1Q6HA 4MLOA 3IT8A 3ZMUA 1NCQB 2FCTA 1UZ0A 2BTVC 3I2DA 4DR4B 2OTLV 4E4EA 3T4ZA 4IGOA 4AEKA 3CHXA 5IVVA 2UY8A 3Q4HA 5JXIA 3BU0A 3RZMA 1I5YA 3NKTA 3VDDB 2Q9LA 3KS7A 1RUH1 4UFHA 5FK7A 3JASA 1SFPA 4GX5A 2Q7HA 3PMSA 3AG4C 3ZCCA 2NN8A 3DKWA 2JG8B 4KH9A 5A3PA 2A7WA 2D7FA 2EIMB 4OPHA 1XNKA 4YZ4A 3N7JA 2CGOA 4YIPA 5K1XA 4BU2A 5A6ZA 1SETA 1Y66A 2A75A 4X8NA 2TBVA 5DUUA 4FPFA 5AC93 1NQJA 1D5AA 4PI2A 2AYHA 1Y4WA 1P4RA 5BMVA 3LA3A 4LCUC 4MGYE 5FLIA 3H3UA 2ZAHA 2UU8A 3IB3A 2BTQA 1NLSA 4NPRA 2WLLB 1R1BA 3S57A 3H1MA 1BBT1 5IY5C 4XBFA 3VBUC 1HJGA 5ABJA 3ZYBA 2P37A 5F2VO 3OEHG 5D8AA 2OCCB 1NUKA 5A33A 4KUMA 1GOHA 1W2NA 3P32A 2JKXA 3ZFFB 2VXRA 1N34B 2YROA 3UV9A 3D5OA 1ZRRA 3VBFC 1BQPA 1ND2A 2ARAA 1AR82 4K3UA 2HWE2 1KU9A 2W39A 3UKTA 4BM8A 4XDLA 3WDUA 1L0NH 1XL4A 5EYXA 2QE3A 1CAUB 5CMUA 4GIQA 1JYCA 3G6JB 4GALA 4HBNA 3GJAA 4G3YC 2DQ3A 4TLGA 1Q6IA 4BIUA 1MS9A 2BBAA 5DQ0A 3LA7A 1HR0O 1BMV1 3ZIXA 5JSOA 5JCTA 3LKJA 4DO0A 3ECQA 3HQUA 4LO7A 4AOCA 1NE4A 2OW4A 3I2FA 4QAWA 1MEC2 1J5EO 3DGTA 2IVJA 3RYFA 1VQ9V 1ZZ9A 2F1MA 2RS12 5IJ9B 1YXBA 5LHIA 3J8F3 4X20A 4GH4C 2DU0A 5H6RA 1OMIA 4DY3A 3FHIB 2X0LA 2KKWA 3APOA 3FX7A 2VBBA 5FXZA 2QWRB 5LBEA 5K0UA 1LRHA 4EFEA 2NZ9A 2J1AA 5IVCA 1WLDA 4UW4A 3FFZA 5BXZA 3E6DA 4FTBA 2VY0A 3RVHA 3RZJA 1K4DC 1ZM1A 4JCKA 4CDWC 5L36A 2MEV2 4RO2A 4M3CB 3TEXA 3ZFEA 4KBBA 3CCMV 2CV6A 5KXEA 1K33A 1Z7S2 4Q29A 4CC6A 1TAEA 1HW5A 4L99A 1EAH3 5LMUB 1YFUA 4MXWA 1ULFA 4NHXA 3O1MA 2VMGA 2JGDA 1IBLO 1XNAA 2E32A 5FJKA 3WNOA 2X6AA 3ABMB 3ICXA 4A42A 3WCRA 1YO8A 1H9PA 3JAWB 3OPZA 2XASA 4JPRA 3I2GA 1PGL2 3JBG1 1MS5A 2ZGOA 4R9CA 4XF0A 2E9QA 2HEWF 2GNBA 1KS4A 4WM7C 3CZUA 5GLWA 2N7GA 4YW2A 3THPA 5FZCA 1VBE2 4NIHA 4XURA 1DQ6A 3L71H 1OCRB 3JALA 4X1KA 1PNLA 3IN9A 4AK3A 1NA1A 2BRTA 1TG7A 3DF0A 4GJYA 3CRCA 2HEVF 3AL5A 3H1HH 1OC1A 4C1XA 3I56V 1W6QB 4X64O 4K9SA 4AGRA 1QJU3 2W47A 4KWLA 3KV4A 3HKCB 3L70H 1EV11 4A7KA 1C8M1 5FZLA 2DMXA 1LOEA 4DUZO 4ZIBA 5FP7A 3ACGA 3G71V 5L7OA 1PZ9A 2IBZH 2ZTNA 1OUSA 4YZ3A 3VD3A 4DXZA 1QJFA 5LA9A 4F6RA 3SEPA 2PHTA 1NG0A 3AKQA 3FN9A 1OFNA 4CC5A 4DR3O 1CD3G 5HV4A 3OY8B 2X5IB 1YJWV 2DUPA 3I59A 1NY72 2KB1A 3VBRC 1N36B 3ZMOA 3WNNA 5IK5A 2QZ3A 2ETNA 1VP6A 1OLRA 3T1HB 3ALQA 4UW5A 4I09A 4UFKA 1R093 2Z79A 2A7AA 2BWAA 3WINE 3CPWU 2RE9A 2F4VB 1STMA 4P9WA 2YGMA 4BW5A 4YGDA 4CE8A 4H33A 1SQGA 4CP2A 1KRIA 1S0FA 5A32B 1COWG 1DTOA 2DCKA 1LB2A 5EYYA 1ENXA 4LK7A 3UKVA 4X65O 3MHZA 4DR5O 5HCAA 2RR13 1RIRA 3D36A 4O4LB 3ZBHA 1QDOA 1V6KA 3PTYA 3RI9A 3PLQA 4MHUA 4HK8A 3K5OA 5IW0A 2W6IG 1OKOA 1SS3A 4P08A 1VQ6V 3OGJA 1XXNA 5DDJ3 1ENRA 3DPRA 2WLHA 4QWNA 1S0EA 4XUPA 2UXNA 1FAYA 4FFIA 4QXBA 1AVMA 3LEIA 3L2YA 1XJAA 3C7HA 3PVEA 2YBPA 2R072 1L3JA 2ZEXA 4IEWA 4CDQA 5A1FA 4QPGA 3E86A 4QQHA 3SJBC 3B7MA 1G9AA 1UU6A 2K2SA 1H1MA 1VQ5V 4B3NA 4XOGA 5CZKA 3U75A 4AE2A 4DV7O 1HB1A 1KYOF 4YW7A 1QQCA 1AL22 5D1IA 3BIEA 5KHKA 4YARA 1MSWD 3GBWA 5IHRA 2QM4A 1L7QA 4P9JA 1J3RA 1PO12 5L3CA 4GMP0 3SITA 1GMMA 3FUOA 3GBFA 1WW4A 2EINB 1N1VA 1GWKA 4WFGA 4NJ4A 4ATEA 4OI2A 1UX7A 1REDA 5CNAA 4X6RB 4FPGA 5LW9A 1WKYA 4PF5A 2RS33 5EHDA 2VR4A 1X9PA 5DN6G 2VVFA 3T2TA 3VQXA 1F4HA 1GBGA 4K8ZA 2P3KA 4LBMA 1WCQA 2VECA 1VRH1 4XDOA 2O8QA 2JDNA 1IXMA 5FZ6A 1W0KG 2NP0A 3WU2Z 4Q4Y1 1QIQA 3WNMA 2HWD2 1CESA 2H6BA 1V0AA 2ADEA 2Q73A 4XTMA 3JQXA 4U3JB 2D44A 1OHHG 5JCOA 4XJUA 3K4ZA 1FFTB 4P9LA 2JKBA 1S55A 5LA1A 4DQAA 3PURA 4NROA 4MG2A 3VKOA 2JJ1G 3WG7C 2VZSA 4ZZ5A 5FYMA 1HWYA 3CRRA 5A3NA 5LB6A 1Z5WA 3VHPA 1PGSA 3DCQA 4W6WA 1BQ0A 1Q8IA 2VWKA 3KLSA 4LC1A 3I2KA 4YJ3A 1YQ2A 4QDRA 4IV3C 3EJKA 3MW4A 4LF9O 3FYEB 4Q2FA 3E6BA 4LA3A 1OBNA 4Q5OA 2JDHA 5LBCA 1R1A1 2JD9A 1NTMH 3WF2A 4HKLA 4P02B 5KUMA 4X1YA 4DR7O 1QLEB 2R042 2Q1FA 1XREA 4LBQB 3U4SA 2WWJA 2PTMA 2QQJA 1PVC1 1MSDA 3N9OA 2XHNA 4LH7A 4XMIA 4I7ZB 1VBD1 1ULCA 1MABG 4OUMA 2ARCA 5JVVA 3WDVA 1JTZX 2JDMA 4Q4W3 5ACA3 2WZEA 5FYIA 4QX8A 1OCZB 3JD0A 2ZR2A 5FMBA 4ZI7A 3ASNB 3MPPG 5CBHA 4TN7A 5IVJA 1LENA 2AEYA 1PIV1 2TUNA 4UAPA 5BNNA 1JJOA 4HN0A 4YW1A 3GHNA 2VC9A 3FLPA 1HXS3 3I2JA 1COV1 3ZMNA 3CDZB 4I55B 3IC9A 5EC2C 5JI7A 3D82A 4IEOA 4B3MB 1I6XA 2Y48A 3U78A 5C9AC 2LJ2A 3OW2U 4CCOA 4K20A 3V0AA 1JCHA 3HN1A 1YDXA 4A2UA 4O4JB 3IPVB 2IFWA 1JHNA 3SGIA 1IG3A 5JWPA 3ZN4A 4K8XA 3WP4A 1FJGO 4A5UB 4QQ2A 1URFA 2WDBA 3Q8BA 3TBDA 3PJSK 4IV1A 3PUQA 4YHHO 4LO4B 3EBRA 4YG6A 4B1LA 1K5MB 4UFIA 4W6YA 3EO6A 2XG3A 1D5NA 4LF5O 4UCOA 1DIWA 1ZVFA 4LF4O 4UVAA 5L3BA 1V6LA 2C9AA 1RSOA 4LHLA 3WDWA 4JAVA 3B4SA 3N35A 4OZXA 5DPNA 4YY3B 1YZBA 1OQEA 4MW8A 2E76B 4QNHB 2JS3A 5E16A 2ETEA 1L0LH 4JTAB 3ILFA 4DOUA 3RVZA 2WNVA 3JD71 1FXHA 2OZJA 1RM1C 5D5QA 3MLJA 5EJZB 2GUZB 2OQ7A 2VUCA 4JI0B 4O9EA 1IXBA 3MICA 1DLBA 3SYCA 5LY1A 2X05A 4N53C 5C71A 2X8KA 3RPQA 2Q8EA 1U0AA 1RTVA 2DURA 1SZXA 4IE6A 1RUC2 3CCQV 1LUVA 4GKYA 5B2GB 1UOJA 2H3OA 2VMFA 4F6EA 4EWDA 3KHCA 2RDCA 2CTRA 3B9IA 1CAVB 4QB2A 1VBB2 2BZDA 1GUIA 3O9OA 1RGSA 2RMU1 5BXXA 3DXTA 1RUJ1 5FZOB 3VQYA 3ZOIA 3EXAA 3AMNA 1OQDA 1KS5A 2RCVA 4DB5A 4NXNO 5AG2A 1JYTA 4QE7A 5FXVA 4ORFA 4COUA 2E31A 1TA8A 1S0BA 1GZCA 1Y76B 4JKLA 2DN9A 2J1TA 1JS9A 2HJFC 3HR0A 4JRLA 2XUEA 4BR6A 1LHNA 3SCFA 5EBLC 2PAEA 3ZR5A 5FL7G 4ZKIA 1ZZ8A 1SBFA 3RZHA 1F15A 2YPJA 4AVTA 3BN6A 2WZR1 3O7OA 2VUAA 2PHWA 5L3EA 3B9CA 2BGOA 2VQEB 2JB4A 3AKPA 5LL6Y 3HT2A 4HSLA 2ZGUA 1FD9A 2PI4A 1W0OA 4HNAB 4GXLA 2E26A 2GC0A 2R0HA 1RYYA 5FZDA 1PM4A 2ZDIA 4C8DA 3WW4A 4Y1YA 4ZHNA 3AFGA 4OHYA 1AX1A 2EIGA 3LSUA 3VBHC 2J22A 1WBFA 4NRQA 3BKZA 1HNWB 2CUGA 1DQ2A 5EZWA 2HJIA 3A7QA 3LPFA 4PJ0Z 5ITZA 1QY4A 2WLQA 3LCPA 2W91A 2VO5A 4D8MA 4JAUA 1RUF2 2ZEYA 4KQ7A 4P5YA 1H8TA 4O65A 4PDWC 1HRV3 4N43C 4B29A 1UY3A 5BZBA 4DK0A 2UXXA 4AAPA 3KM5A 4UV8A 5LMNO 1GN4A 1YSCA 5A9GA 4M00A 1V9PA 2RM21 3OYWB 1WW6A 1K9MW 2JXAA 4J7KA 3WQBA 2BOJA 1XMOB 4GD4A 3ZRSA 3K06A 3CCRV 4XIKA 1Y43B 1F4NA 3VHOA 1N4CA 5EJ3A 1IURA 3O1VA 1NLQA 1UYZA 1H1AA 3O0XA 5SV5A 4IIJB 4META 3RI8A 4ABMA 4AQYO 1YXWA 2W46A 3B09A 1KECA 5EFUA 2N04A 3RZGA 3GM8A 5B1BC 2A6YA 2QJVA 2IH3C 1VBC3 3ZYFA 3H3LA 3GDBA 2ET7A 2EULA 3VZJA 1GFF2 4D6RA 1HP8A 1UJWB 2ZT9B 2DFCA 3WY6A 2WA3A 1KKDA 2VZUA 3OFNG 1M57C 3O0VA 4QXCA 3VDDC 2DUOA 4IE7A 4FFBA 1UZVA 4LFCB 3Q4HB 2E53A 5A7SA 1AI6A 4JDOA 1GOFA 4D69A 1BHGA 1XNCA 3JCIA 2ZIOA 2PELA 4M3CF 2DVBA 1QJU1 3RZLA 2J1UA 3R6SA 2EIMC 4B3SB 2ZGMA 3KKYA 4CZZA 2W87A 2XHKA 2XJQA 4LXLA 5KC5A 5KWRA 2D5HA 3ZLIA 1ENSA 2VCBA 4XQ4A 4GMP3 5BY5A 1HB4A 4GKJB 4JI2B 3TN91 3ZSJA 1FPOA 1JU4A 2UYAA 2ZGTA 5FBJA 4XW3A 4JGYA 1AI7A 3BU7A 4J9YB 3O0WA 2VD7A 1CJPA 3V0BA 2UYBA 1M4UA 3E97A 2EF6A 1TMF1 3BYWA 4DR2B 3LQCA 1AR62 2OX0A 2HHHO 2M6YA 2OCCC 3MLKA 2Q67A 3ON7A 1WLWA 1X7NA 2OPWA 4RHV2 4TUYA 4R4XA 4WZCA 5D8AB 1XQNA 4MVTA 1PZ8A 5FZFA 5A33B 5JPMB 3T2MA 5LK7B 4MS2A 2RDSA 2RDQA 2ZKLA 2ZXQA 4PT6A 1Y6XA 1XOYA 1W8TA 4Q4X3 4RD7A 1SDDB 4RN5A 1PP9H 4W65A 2CWSA 4OZOA 4DEVA 2UWBA 5M0TA 2BFUS 3VV1A 2R9IA 2ARXA 2WFF3 3OGGA 4C0HA 2WO7A 4XFIA 3DGEA 5C93A 3E22A 1ZBA3 1RVF2 4YGBA 2LFSA 2XHBA 1H8VA 3DKQA 1SQXH 4ZZ8A 1O7FA 3AP6A 3WSOA 1UIJA 1RUD3 3SMHA 4A3XA 4HPKA 5DDJ1 2F23A 1HNZO 1XNDA 3ZIWA 2RN9A 1UZZA 3LEKA 2XBO2 2R16A 5I0TA 2JX9A 5C3OA 4CEWB 2ID4A 3ZHRA 3ORJA 2IUWA 1TME2 2DVAA 3QG5A 3VKMA 3O1SA 4Y1VA 3A23A 1CXZB 5I8YA 4YLZA 2HKXA 2A3WA 4AFDA 3WEZA 4WVZA 1PK6A 5CFCC 2MW2B 2IXHA 2VW0A 1DDLA 2VXJA 1QXRA 1SCRA 5F8PA 2IW5A 4A4AA 1VR3A 4G2KA 4QJFB 4PBOA 1ZRFA 2VE1A 4CDUC 1W9YA 3ZFEB 1KFUL 4IEVA 3J7NA 3ML0A 3N27A 1M56B 3LB9A 1DGSA 1QU0A 4XJWA 1RJ7A 2ZZQA 3IFXA 3HEIA 4M0NA 3AK1A 3WF0A 4MXWB 2Y4TA 4MVSA 3LNMB 1QQP1 3AEIA 4QMAA 3C7OA 5A3UA 1UOFA 2E3CA 3K0DA 3ABMC 3MUY1 5J37A 1NU1H 2WINB 1QR9A 1K12A 4Q4V2 4XACA 1YFWA 1S0VA 1XDCA 4NKGB 4FPEA 1RUI3 3K57A 1KFXL 4XC9A 4X66B 1BL8A 3RYKA 1UU4A 1OURA 1DK1A 4QPJA 1UW8A 3U14A 5IFTA 4O9GA 2NLRA 1TNRA 1OCRC 4JI3O 3AX4A 3LDCA 4Q8LA 4OYUA 3ZXFA 3SCGA 1WBLA 3UGHA 1FMD1 1G8MA 4CA9A 4DV1B 3JALB 1UPIA 4E4ZA 3U07A 2ZGKA 3CC4V 3CSXA 4KMQA 3ZYIB 2I45A 2B42B 4OI4A 3B69A 3FAVA 1POV3 5BNOA 1LOFC 1XILA 5FWJA 1R3IC 2ET1A 1VAVA 3AVSA 1HR0B 1OSGA 1HNXO 3CMGA 2CDOA 5L7OB 4CSWA 1ZBE1 3IZOA 4XFBA 5FZ1A 4BQ3A 3WQ1A 4OMCA 5L73A 3JXSA 1LGCA 3ZXKA 5FLJA 2D40A 3ZFGA 1BKZA 2HWB2 4IQPA 2CK3G 3AYAA 1O8SA 4ASMB 1N3QA 4O2BA 2E63A 2B1IA 2YIAA 5FLXN 5CBFA 4IXLA 5CFDA 3VBBA 1OOPA 3BVCA 3C2UA 4B3RO 5GTHZ 3CCJV 1QOOA 1Y4MA 1YVWA 1NKGA 4OHWA 1LHUA 1WA6X 4INDA 5I0RA 4XJAA 2Y6HA 1IKPA 1JZ7A 1XQ8A 5DAVA 3ZMVA 1JOJA 3E8BA 2ZACA 3Q8CA 3MIDA 1GR3A 1EY2A 4QB6A 1XMQB 1X59A 1KDKA 1V55B 4MTGA 1PO21 3WHTA 1H6XA 4MGKE 1W6PA 4Q20A 4BIZA 4XZUG 2XUMA 4UXNA 3CD6V 1RHI2 1IBLB 4I2OA 2YSUB 5GLVA 4BQYA 2UURA 3KCCA 3CJHA 4K21A 4PIXA 3AL6A 3K3WA 1FXVA 1S0DA 1QMJA 5K9YA 3ACIA 3IAYA 2VVDA 3KT4A 1RITA 1Q43A 3LPGA 1IQDC 2E5LO 3KVAA 2WZ8A 1Q8OA 2Y69C 1S2BA 3BPZA 4PA4A 5FO7B 4R4ZA 2B46X 1JBCA 3KF5A 2ZA9A 5JZGA 2Q5ZA 4PIZA 3UKNA 5HBAA 4CEYB 4KG0A 1VIBA 1F5FA 3UL2A 1AYM1 4K7JA 4QGMA 3T2OA 4X62O 1HRI1 3B8MA 1FOD1 3FKSG 3HQXA 1XBLA 2KM2A 3RW0A 3WV6A 4TTGA 4DUZB 2B5UA 1FNZA 3N9NA 1IG0A 2JIJA 4IUGA 4BISA 4AEDA 3T0DA 1XE0A 2EZOA 3I54A 4RGAA 3ABZA 2L6LA 5FYTA 4IERA 3R65A 3MEPA 3AP5A 5G05L 3L2HA 1O5UA 4BXSV 3D3AA 2X7RB 4XFFA 4EROA 4NYKA 1QF3A 1C5IA 1W9FA 1A3KA 3ILNA 3OAAG 4UT5A 4LPLA 4DR4O 1FFXA 1FNYA 2GP5A 3ZN6A 1OLME 4UBGA 1AYN3 1M5IA 3ZXJA 4FPJA 2ZMKA 1C4RA 1WGPA 4DYLA 3T1YB 4TV9B 2L9LA 5JIAA 5CG8A 3AK2A 1W8UA 1AR83 4LUKA 3VHRA 1NQDA 1KP3A 1QJZA 2EIDA 3JYCA 4LNUA 4BIOA 1PNFA 5C8CA 1RUG3 1KQRA 1S5JA 1OF4A 4YW6A 5FP9A 2A6VA 4CP9A 3H8RA 2XAHA 5J2UA 1VMGA 5IJ0A 1AHSA 3NRUA 1WN7A 2ADQB 4TLFA 4AI1A 3P3NA 1QBZA 4MVRA 4EWAA 5IYZA 3WUDA 2JENA 2YU2A 2PI5A 1CJDA 5A7QA 4YJ3B 2C0ZA 1ZX3A 1MEC3 3UGFA 1W2UA 4YVSB 2LFRA 3NXSA 1RUE3 2V72A 1QLEC 2ZBJA 4H44B 1D4M3 1VQKV 3M99B 1C5HA 1I7FA 1YJLA 2OTJV 4LO5B 4RS5A 3OR6C 4FTSA 3W21A 3SPGA 1N34O 3BOWA 1SG3A 3AG7A 1I5PA 1AJNA 2EIEA 3USSA 5J7MA 4V2VA 4FQZA 4IEYA 1IBMO 1DGLA 3T4DA 3ASNC 1CX4A 4FBFA 3G67A 2Q8VA 1UXXX 3JARA 4ZI7B 3H7YA 3OMNB 3ZSMA 5C8YA 2VOXA 5JXJA 2Z2SB 5BNNB 3RWNA 4I4TA 1D4VB 4FP3A 4IHJA 2Q1ZB 5A7WA 2F6BA 3NW4A 4Y22B 1UWWA 5LXTA 2ZHMA 2PYJA 2YDEA 2XT9A 2WA4A 2OVUA 1UZYA 2R063 3QCWA 5EIBC 3POJA 3I3BA 3L75H 2BOBC 3V0AB 3IDCB 1AUYA 1B6QA 4CBCA 4FMTA 1CN1A 4O4IA 1XYOA 2CGNA 1EZVH 2YY1A 1PMHX 4DRXB 1K5MC 1UX6A 5FMOL 1WB7A 4G28B 1ORQC 1SLCA 2IJIA 3SQOA 3WCSA 3UT0A 1V9U2 2XGXA 4NIAA 2OUJA 3WW3A 1W90A 1UKRA 3D0JA 2QJ1A 4LTAA 4XBNA 3A8TA 1NAEA 2YFUA 2HKOA 3DXUA 4XE9A 1Q8SA 5LMUO 2WL1A 2BGPA 2JB8A 1N32O 4AGGA 3PUHA 2QKAA 3AG1B 4UW6A 3I2HA 4UF0B 1JMKC 2GAUA 2R49A 3KWVA 3J81N 1AR73 4LQRA 4MZUA 3RVYA 3OGSA 3OEAA 3AK0A 2LGQA 2XJTA 2YEVA 3FBMA 1HN0A 2H0VA 4NHYA 4LF9B 2AGAA 4AQ2A 3MDPA 3R4DB 1BS3A 3RRDA 2XJRA 2QQUA 4DR7B 2Q7EA 1PPJH 3ZDVA 4CH3A 4JGZB 3DYMA 4IL6Z 1IBKO 2VMIA 3E8FA 2LTNA 1ZL8B 1XNBA 1JMUB 2GBOA 4JI1B 2AGSA 5C70A 4BDVB 1U5IA 1QJX2 2LW1A 4UFZA 2RS52 3ZXEA 3OMIB 2GHYA 4YXWG 4EE2A 1V54C 3VD5A 4DO2A 4GB32 1J84A 1VF5B 1W99A 3CCSV 3NAPB 1G9CA 4OUEA 3IDBB 5GZFA 2EIJB 5J1XA 2RNBA 3H50A 1JYWA 3VBUA 2F93B 5LEKA 2VW1A 4JI6O 3CBNA 2VRZA 2WYSA 4S2FA 4YM3A 2X29A 3GZTB 3W9AA 1W2TA 1V6NA 3VBFA 3POEA 1OCOB 1OA4A 2ZHKA 5GTIZ 4LR3A 3ZVXA 2ZNIA 1C1FA 1ZZCA 3T1HO 2V5YA 1W0NA 2XDVA 1ST8A 2F4VO 1U5ZA 2YV8A 2PHDA 2WQ8A 2EICA 1E5IA 3ABKB 1GO3F 4YHHB 2KR2A 4K35A 4I0AA 3T0AA 4LF5B 2XWBB 1QJY2 1OLMA 2BYVE 4N9IA 3SYPA 1L7LA 1W2BU 1OH4A 2ERFA 2Z5UA 3BCWA 4P9PA 3MFCA 4JI5B 2XJUA 5J96B 2CAVA 2GZWA 1NTKH 4HSJA 5JPNB 3M7AA 3QNEA 2R32A 4GH4A 4XIOA 1TEIA 1NX9A 2BSKB 5DAXA 4KG8A 3SH4A 1MPXA 4ZOLA 1R1ZA 3OBTA 4DV2B 3CRMA 1AJKA 1T2XA 2HLDG 5T5OA 4UB6Z 4UVCA 2G1MA 4MGQA 3LIGA 3ASOC 1VPHA 5FYCA 1QOTA 1VBA1 3RYHA 5LP6B 1CAWB 1QHDA 2HYKA 1QWRA 2NPIA 1NZIA 5FBZA 4YZ2A 2R9RB 5JOWA 2W52A 2Q69A 2ZPXA 4JYAB 1N1SA 1WD4A 2ZGPA 2GNTA 3ZHUA 3ZX7A 4XXAA 5FPXA 1RUNA 1O91A 3QH6A 1ACCA 1X36A 3HKBA 5T54A 3CP1A 5LYJA 4W50A 3LDBA 1RUH3 1G1XB 3OUFA 2K46A 1CONA 5FZIA 3X2QB 2E7TA 3M3OA 2JDAA 3NV3A 4FFGA 1RUI1 3LDKA 3C3VA 1TZOA 4AZZA 3NV4A 1AR91 4Q8KA 4FOYA 2QQKA 5DZEA 5EJ1B 2GC2A 4HVOA 2ZR3A 4U3FH 1K42A 2VQAA 4MV2A 2I07B 4QGLA 5FIXA 2W6JG 4BB3A 3S3WA 5IE9A 1PGW2 2PLV1 4OHZA 3QLQA 3POGA 1AR1B 1HB3A 1YF2A 2VZQA 2W68A 4QKFA 4QHOA 4CH5A 3I55V 3ZXLA 4FJCC 1UYPA 1MS4A 4FFBB 4AI0A 2GDSA 4KU8A 2DDUA 4GLXA 3DYOA 5FK8A 4IGQA 4COWA 1BBT3 1E1RG 4WBNB 3E2EA 4URAA 4Z2WA 3WUCA 2LP7A 2ZINA 3ES4A 3LSEA 2ZEZA 2V4DA 2W08A 3K9AA 4QB1A 2ZM6B 5KA6A 3KQ4B 4YM2A 1AX2A 4LHKA 2TEPA 4LLFA 1UO9A 3MIEA 2FDKA 3ZXDA 4JGYB 3G7DA 4BQ4A 2D6PA 1MQTC 3V0BB 4KP4A 2P6HA 4JVAA 3LAGA 1K3IA 2A1XA 3AVRA 5EBWC 3THTA 5A3MA 1U5YA 4J80A 1VRH2 3U37A 3VD9A 3UETA 4CU8A 2ITCC 3H01A 5CEHA 3MIFA 5E88A 3H42B 5B3SC 3LDDA 4OUSA 4WVMB 1BK0A 4TUYB 4GWMA 2CHHA 3VBRA 5DG1A 3PJYA 3DL3A 1ZZ6A 3UT5A 1VQ8V 1I5XA 5F3EA 1RXGA 5CADA 3OGRA 3LOIA 5LEJA 4XYXA 1US3A 2PZSA 4Q0PA 1HN1A 1E5SA 2D6KA 4DIQA 2DYSB 1D0GA 1TUBA 4ZY9A 5FP3A 3W7WA 1BEV1 1XI1A 1J3QA 2PAKA 5F2WA 5FFOC 4X1IA 4GQ7A 4YJ2A 1VMHA 4DPNA 2ZAAA 2HWC1 3E22B 4GWIA 2VQFB 5BNPB 4DZGA 3RQ0A 3FB5C 3AG3B 5HFLA 3ZYRA 2LROA 4CEWC 2GTAA 4JHTA 5CKMA 1LECA 1UCXA 4DV0B 3BODA 2Y8KA 4BK4A 1S4CA 1I9RA 3ETPA 1NKDA 1LHOA 3KB5A 3BA8A 4AVAA 4BAYA 1YIJV 4NTYA 1S0CA 4DRRA 2JDYA 2H6CA 5DZFA 1PK6B 2JDPA 4JTOA 2OPKA 3H9AA 5GZEA 4AYUA 1F8VA 1H4HA 1M56C 2YXLA 4NHMA 2B7YA 2RMKB 4FP2A 4ATFA 4KWKA 1OA3A 2YXYA 3JBG3 4Y5SA 2Y6KA 5FKBA 4KL1A 2EJ7A 4DV4B 2XOMA 1AILA 1YQ6A 2K9PA 3DC6A 4H7LA 1ENVA 2FKXA 2EXKA 2HG5C 4FTEA 2QSAA 1GZWA 2KD7A 2IU3A 2DCYA 2HP8A 3DXRA 4HAMA 3UO2A 5H9SA 1CPMA 3MIGA 4GWNA 2Z5WA 4EEQA 4YY3O 4YVWB 2Q4PA 3THCA 2WQZC 2P3YA 4NPLA 2FQPA 2Y6LA 4FM1A 2WS92 1FYUA 1EV13 1C8M3 1UIKA 1SA0B 1JH5A 2A6XA 3PVOA 1DZQA 4LE4A 1FKAO 3WB2A 2JS5A 1CP9A 5L19A 1AR81 1IS5A 1OQ1A 2HWE1 4LIUA 4ITCA 1HV1A 4K8RB 3OD4A 3I3DA 3UNPA 3PTRB 4JKKA 3K5NA 2O1QA 3SC7X 2PGGA 3PUIA 3VOUA 5C3QA 4FPHA 3P6BA 2HWF2 3KT7A 1WMEA 4R9BA 4DR6B 4YWAA 1QHTA 2JDIG 3W5NA 4H14A 2AXTZ 2EIKB 2VZTA 5IYBO 3A0BZ 3FHAA 1LOAA 5LBBA 5K7PA 5A6XA 2M7WA 3RBZA 2WN3A 5GLUA 2CDPA 1PV0A 1MEC1 5T55A 5JH7B 3T09A 1H1IA 2RS11 5LY2A 3THOA 4RQPC 2QKCA 3VL9A 3VZLA 4UYBA 3HMYA 3ZXAC 3ILRA 3ZFGB 5KXCA 3VN4A 3JQWA 3TXSA 1GQPA 4QIWF 1AP6A 1NZCA 2C6SA 5CKNA 3B5LB 4MTFA 2NQYA 1LGNA 3NWKA 3J26N 1JX9A 1O8PA 5CFDB 1OOPB 4RQFA 4DS0A 1W06A 1VB4A 2VJXA 3STZC 2WSSG 5AC92 1SLAA 5KX5B 2WZPP 4PV1B 5HXVA 5JJJB 5K1PA 5KAFZ 5AVAA 4XDKA 4FXKB 1Z7S1 4FLUA 1B35B 4TQFA 1VE0A 4XF4A 1V55C 3BALA 1XHZA 3H0OA 3JATA 5F9TA 1A8DA 3J7HA 1BCCH 2QEXV 3HKEA 1KJRA 4EN6B 3BI3A 1F4MA 2XLAA 3KGZA 3AZWA 1GTOA 2FMYA 4M4RA 1HNWO 3CE2A 4NR1A 2R061 5K8SA 3ZKYA 2HFEC 4Z1MG 3CU7A 2D6OX 4MH0E 1X33A 1PGL1 5C9AA 2B5HA 3OE7G 3PMEA 3O1OA 5SV8A 1ZSPA 5DUWA 5H5NA 4IE5A 1MG1A 2VZVA 3KF3A 4N23A 2VCCA 2B8MA 1YITV 1VBE1 4JI3B 2I2SA 4OCTA 1GQHA 5FZHA 2R70A 3ZIAG 4CEYC 2FDFA 1W9WA 4D6SA 5JZGB 4HETA 4Q4Y3 3J8F2 1IDSA 1QNYA 2PQQA 3AMMA 2FCVA 2I74A 2OXBA 3GXUA 1AP5A 1VQ7V 2D93A 4JI8B 3SPHA 1O9GA 1AR71 3HBZA 3E6CC 3P1IA 5AFBA 1XSRA 2DBNA 3KD4A 1WD3A 4IEUA 1NR7A 3FMGA 1NY71 3C7FA 3WD5A 4LO8A 4EN0A 1HDJA 2QQMA 1ULDA 3VHNA 5HV0A 5CB4A 4N53A 4K0KB 4R9DA 3RYIA 4LF8B 4DV5B 3I7DA 1FFXB 2UUCB 1YC61 4EB6B 3DN7A 1M93A 4LFCO 2IU0A 2JD4A 1EAH2 3CJIB 4B3RB 4XFHA 3HKDA 2P4KA 4TXWA 1CAXA 4QPKA 4BYYA 4XQWA 3O1PA 1R1A3 3USUA 5H2FZ 4AI9A 5JOYA 2YPDA 5I8TA 2HVKC 5JR2A 2D6LX 1YCIA 4XETA 4CP9B 1XL6A 4HFSA 1PVC3 3FFQA 4EYUA 3MYXA 1JZ2A 1UYXA 1VBD3 2ZMNA 2RJLA 1AL0G 1WP8A 1I5ZA 4YVSC 2PHRA 4YZ5A 3ZKUA 2OCHA 2Y4UA 4DR2O 5FDBA 2CH7B 4CCDA 2WWWA 2GH2A 2XBO3 3JZVA 4OGQB 2XAQA 1UOBA 1VQLV 3TJTA 1JU3A 3DSQA 4TSVA 5FPVA 1PIV3 4AI2A 2R071 3N2KA 4X9QA 5FPRA 5ANNA 4YG3A 4CH4A 1COV3 2TNFA 5FMDA 3ZX6A 1IHMA 1QJU2 3ZSEA 4G9SB 2QQVA 3T0BA 1AL21 2Q30A 3WNKA 1BGYH 3W7XA 3WB0A 2GDFA 4UWDA 4KI5M 4YFZA 2WLIB 1OD5A 3ZDSA 3ITQA 4BQWA 3HNYM 1PO11 1Z78A 4JI4B 3EVKA 5KMGA 1LKNA 1YJ9V 3JARB 4QX7A 4PD4F 4BZ4A 4DNYA 2BU9A 4CU9A 3VBHA 4WF9V 3CCVV 4X62B 2FMLA 4I0WB 2QQWA 5CA1A 4I4TB 2UY9A 4LKEA 1W6NB 3KHBA 4IHJB 3AZXA 3BY6A 4NUBA 4NTXA 2UUAO 5F5IA 4QE9A 1OXCA 1HQNA 1R092 2UXCO 1DYPA 4PDWA 1KITA 4Q0UA 4I3GA 3JU9A 4JRAA 4A45A 2W9XA 2QWNB 2HWD1 3HAGA 2V5DA 4R9AA 5T50A 2RR12 3JD73 4UCUA 1JOYA 4HYOA 1I3HA 2WN2A 3URFA 4EWEA 3JB4C 1Z5VA 3U11A 1DFQA 4WFEA 4FLZA 1ZRIA 2A73B 3E8GA 3RMXA 3FB7C 4YSFA 5DDJ2 2YB7A 3K3OA 4JYYA 1N0JA 1O6UA 1WA8A 2V73A 5HCHA 1W3XA 4DUYO 5HPOA 4G27B 3E8HA 5D5PA 5FWEA 3SLIA 4CUBA 4GX0A 2VTFA 2RMU3 1JZ3A 1UMHA 2BCCH 2XJPA 4RWUA 4FAGA 2ZGSA 5EIBD 1W6MB 1RUJ3 4DV3B 1EFRG 1SQ4A 1MOFA 2YEVB 2EAKA 1A78A 3VDDA 1BVVA 3K4DA 4X66O 3A0NA 2R041 2DWRA 4JGZC 4TWTA 4WV8A 1N8RW 2PHUA 3VBOC 2AZ5A 4V2WA 2VZPA 1J1TA 4PLNA 4A6SA 2LQTA 1W8ZA 5C8WA 3NVCA 5DAQA 3VKNA 4U2AA 3CLPA 4JZGA 4DV1O 5LK5A 2RS32 3K08A 4JZ2A 1IBMB 3BTXA 2KSDA 1EN6A 3ZN5A 2WZR3 4Y1XA 3NAPC 4O4HA 1KBHA 2J42A 4EJRA 4J42A 2C2AA 4LWSB 2JG9C 2VVEA 5CBGA 2QUOA 1ZA7A 1SPPA 2Q8CA 2EBOA 1B3QA 1JVMA 1FXKB 3BUCA 5HCFA 3VBUB 2ZD9A 1WLTA 2FD8A 5FPBA 3AXDA 5FY5A 4IE0A 3CIHA 5EP9A 3GYDA 1KMIZ 5KC6A 4AI8A 3WZ1A 2P6CA 4I0XB 4LP8A 1FI2A 4RGGA 5LA0A 4PLOA 4MO3M 3MLLA 4YNIA 4KGQA 4BXFA 1CAUA 2W5FA 3ABKC 4DINB 3I49A 5DM6V 1UOGA 5LBQA 3C7EA 4IGPA 4XABA 1AR5A 1JUIA 4NHLA 3GNEA 2F43G 3VD7A 5JMCA 4MVZA 4JTNA 2X09A 2GMPA 4XHBA 5IAVA 2RM23 1W8NA 3AP7A 4IEZA 1VEWA 4E8CA 4FLXA 1PX4A 3M8AA 2NN4A 1PM7A 5IJ9A 1XMQO 3H1JH 1M9NA 3S7EA 1IPKA 3CCUV 1N32B 1JYVA 4QPIB 4GZ9A 3TEZA 1JQ0A 2VCMA 5DAPA 4AVVA 5FPZA 4UFLA 4MADA 2DJVA 1FV2A 3E1F1 4DR1B 2R0FA 4I02A 1M1KW 5LP6C 2JJ2G 2ZCWA 3VD4A 5CFCA 2Y0PA 4Q4W2 5LRRA 5ACA2 3M4FA 1RUC1 4M4PA 2EAAA 4NIGA 1J3PA 4R50A 4A6OA 4AQSA 4CDUA 3NSTA 1MS0A 3CNAA 1LEMA 1VBB1 2AR6A 2VZRA 1IBKB 1Q82W 4XEZA 1HXS2 4MGTA 3K79A 1EUUA 4ZS2A 5IVYA 2XQRA 5LYJB 4QPWA 1ULEA 3S5AA 3CQOA 1LR1A 2LM3A 3PU3A 1UAIA 4HKWA 5I91A 4BQXA 2WFPA 2V4VA 1W9TA 1ZZBA 3JAWA 3FL7A 2LW7A 1JZ8A 1MS8A 4O61A 5GONB 3ZO0B 3VBSC 1Q5OA 2YIDA 3WP5A 3TN93 5C4WC 5DZGA 4NVPA 4JI6B 2F66C 4EN8B 3L72H 4XF9A 1NCRB 3OTFA 1TMF3 3W58A 3RYCB 2EIBA 3HOBA 2BNOA 3SKJE 2O57A 3SEEA 2XOKG 3CJXA 4AQTA 3BOPA 1OA2A 5KHGA 4LIVA 2X53S 4TOIA 1DZTA 3B94A 1W6QA 5EYPA 5FQ0B 5D21A 3T1YO 1Q8PA 3F7VC 2J1EA 4I5SA 3O5SA 1ZTEA 5FZ4A 1LOFA 2N74A 2DVDA 5CA0B 1GNYA 4CCJA 5F7UA 4NMIA 2NM1A 2LALA 4AHCA 2NNUA 1H0BA 1DU3D 1EP0A 1CIWA 1RUF1 5B4NA 3ZHQA 2ARHA 1BMFG 1JFFB 4D7TA 2FDGA 1DQ1A 4HG6B 1V6OA 3WF4A 2QM7A 5BPXA 3VBRB 3M8LA 3UT5B 3T4HB 3O12A 4BCUA 2DYSC 2EJRA 1WMDA 1NI8A 5A32A 1WCKA 1TUBB 3RG0A 4E4SA 3K5LA 3KCYA 2AENA 5FY4A 2YXSA 2GN7A 3RT3C 4O4LA 4Z07A 1K7DA 4YJ2B 3HT1A 4CCLA 2ZXWB 1GSLA 5BNPC 2VMHA 4LK6A 1LESA 1UQXA 1VF6C 2G4IA 3KV9A 2Z42A 3CXCU 2IXJA 5FZ3A 3T1LA 5A7PA 5FXXA 4GAZA 4K40A 2RQ6A 3IIIA 5CIRA 2ATKC 4RR3B 1YQ5A 1W9SA 1UPGA 1LOBA 2P1BA 2VQTA 1P8JA 3BA9A 2OWOA 3W7UA 3BCCH 3QOPA 4BE3A 4MYEA 3NNGA 4BWOA 5FYYA 3F5WC 1QQP3 1JODA 3S3XA 4PA7A 1H2KA 1I1EA 3SYOA 1D2QA 5JOXA 1P49A 2PYTA 5LRSA 3P3PA 4JV5B 4QKNA 4CXYA 3AXEA 4IEPA 1WMXA 2BVBA 4N7IA 1EPZA 2BNMA 3B40A 3HNBM 3ETEA 2B45X 1MA1A 1OLQA 1Q90D 5JUVA 4NRPA 4CP1A 3QH7A 3CZJA 3ABLC 4HANA 2BGCA 5JR7B 5A3LA 5CAZA 4WVWA 3AP4A 1HRV2 4TV8A 5T52A 2XKPA 2KXLA 1GZWB 1FMD3 2FZ2A 4LFBO 1R082 4YVWC 4YW5A 4I30A 3O14A 3N2GA 1H30A 3ZHSA 1WCDJ 3H1KH 3HPLC 3SJCC 2WBKA 3UESA 1V6MA 3OJBA 3PUAA 1K34A 1XYPA 5FREA 2YZ4A 2VL4A 2VGDA 4RHV1 4Y5Z0 3LOBA 2QWOB 1NH2D 3ZMZA 5DN2A 3E89A 3VDBA 1GAXA 5JVDA 1IOAA 4LFAB 1F9KA 3BTYA 2QKDA 4MVOA 5HXMA 2OS2A 1ZRCA 1ZBE3 4U3JA 2R1DA 3I4IA 1DQ0A 1UU5A 2GNMA 3MUZ1 5EIYB 2UXBB 4JQRA 1XNRB 1DP0A 4SBVA 4Y1UA 3TNPB 4BHPA 1UKGA 2EIKC 3ACFA 1AJQA 4I50A 1VBC2 1RVF1 4HZFA 3PVBB 3SYAA 4ASUG 4R8CA 1VAMA 4JI1O 1R6KA 1LODA 2XPJA 3IDEA 4ES9A 1WPBA 1FS0G 1CZVA 3POFA 3VQWA 3CF6E 4J9ZB 2A6ZA 4L0PA 4XCAA 3IAQA 2VU9A 1S2EA 2XBO1 2FDHA 4BH9A 1FXZA 1BZWA 5FZAA 2IXIA 5BY1A 4LO6B 4CP0A 1T6BX 1XNTA 1DYOA 2WAOA 3ZEDA 1TME1 4O2AA 3BABA 1PO23 1WW5A 1LAJA 1RMU3 4LBQA 3T3YA 4I0BA 4XILA 1GK9A 4Y33A 5J48A 3MFAA 2BBVA 4LR4A 3EMRA 1XU1A 2SBAA 5IVFA 4XPVA 2PY5A 1B35C 3U10A 4P9XA 4CXXA 3SPCA 4FFFA 1ASJ3 3SYQA 1DLCA 1DG6A 3ZMTA 5FPLA 3RYPA 1CPNA 3WF1A 3ROUA 2DQ0A 3GBGA 5T3NA 1C1LA 5L3DA 4HXCA 1VP7A 4ZU4A 5GLZA 1FT9A 3OPTA 1Q86W 3HKEB 4I55A 3AZZA 4IEXA 4DY5A 3MF6A 4Q4V1 3APBA 4IL7A 5JSPA 2PUSA 4NIDA 3NL1A 2P5BA 3I8TA 4RSUA 2GNDA 2VPVA 2JEXA 4JI5O 4Q4X2 4XJZA 1F4AA 1YIFA 1WCSA 1AYM3 3FX3A 4FLVA 1HRI3 4QQPA 4O4JA 4LF7O 1SQFA 1FOD3 5C9AB 2VZOA 3IPVA 2OYQA 1TNFA 2P4EA 2WFF2 2ZX0A 1QVFU 4DV2O 3AMHA 4LF6B 3M7MX 1ZBA2 4UI9L 3RGBA 1QXPA 1ND3A 1RUD2 2BTOA 3AZVA 1QNMA 2CWMA 1D0HA 3LEMA 1GMGA 1W03A 3CO2A 3OBAA 2YUAA 2W0FC 1HLCA 4CTEA 4JYAO 1X4TA 4Y20B 5IT9N 4B7EA 3LUTB 1K8AW 4YIOA 1SLTA 5LGUA 3NO8A 3WHUA 3ETDA 2PMWB 4W4ZA 1KD7A 4AQ6A 2XXZA 1YHFA 2GUZA 1WZXA 1SMVA 4F83A 2JRIA 3A0RA 2NR5A 4LKFA 4PLMA 5F6KA 2HWB1 1RINA 4L97A 1GN2A 2VWJA 3ZN0A 2CGPA 4COYA 1QDCA 2DU1A 2QQPA 5CB4B 3OSDA 1ZX5A 2EXHA 4NN0A 3CJIC 2HBUA 3WT3A 3S0MA 4FCAA 1SQVH 2VNVA 5E8AA 1J1LA 2RG4A 1NVPD 3WLUA 5FNVB 1A34A 3HIFA 2AACA 1CAXB 3HVDA 4YM0A 4PQ9A 1W0PA 4I9QA 2ZM6O 2VMDA 2QE7G 1GN3A 3ASIA 1UYYA 1RJ8A 4JDNA 1C57A 2BWCA 1SZBA 5FO8B 5GZDA 4WM8A 3I97A 3ATGA 3FUQA 1RHI1 2GC3A 4Y5TA 3OM3B 5LOVB 4ZPIA 4S2DA 2QQLA 1J58A 3M3QA 3UM7A 2AW9A 3VGIA 1A6CA 1WAZA 4OX9B 5L9BA 4C1WA 1Z2GA 4JDMA 1FPN3 2W94A 2ZQMA 1E79G 4QX2A 4HNAA 1ZRDA 4CCCA 3D0SA 5CBLA 2WKKA 3FLTA 1ZYBA 3SR2C 1GICA 4FQ4A 4B3TO 1GLHA 5JQGA 5IUQA 4E8DA 4CDXB 5GM0A 5I0UA 2BQPA 1CGPA 4FLTA 1Z0HA 1SKVA 3ST7A 2WNUC 2WLKA 3VBHB 2YI9A 3J7MA 3LDRA 4I3PA 1NT2B 1GP4A 4Y26A 2VQFO 5CA1B 4L2NA 2V1DA 3NQHA 2FZ1A 3VLBB 2AZ2A 4ONUA 3MIHA 1BVP1 5F5QA 3OUHA 3KV5A 1ZZ7A 3OGIB 3RYRA 4DV0O 2WLJA 4PDWB 2QDRA 3VZKA 4EKWA 2YBSA 1NCQC 2CL2A 1XYNA 2DCTA 1WUVA 5ANQA 3KZIZ 1O4ZA 4A3ZA 1QOSA 4RUEA 5F3GA 2ZJCA 1JZ6A 2XR4A 3IWZA 4WFFA 4FPLA 2KG7A 4KBZA 1KUQA 3BB6A 1JZ5A 1REFA 5FTTC 2ZOEB 4FSJA 4A44A 4OMDA 2E75B 2HEPA 3RMYA 4JGSA 3JASB 2Q5TA 4IIJA 2JG8C 5CA6A 4Q0SA 2CE4A 4DV4O 3JD1A 5FLHA 2Y60A 3TK1A 3F5TA 4E2SA 4I9WA 1HW7A 1H8EG 5B1BB 5A3TA 4EQVA 4DXWA 4UVBA 1F23A 2D2CB 5B5EZ 1DYKA 5BMVB 3LF7A 2AHZA 3WP3A 2BTQB 1ZUQA 1LR5A 1M57B 3MDSA 1GQGA 4LJHA 1APNA 2JDUA 1FATA 4WFAV 3ZFFC 5ABJB 1KKCA 3OR7C 2EXIA 3ZMSA 1PX3A 5CKQA 2Z0AA 5JJEB 4RA0A 1TVKA 3EQEA 2GN3A 4JZRA 1V6IA 2XTAA 1ND2B 3OT7A 4NB5A 2IZWA 2JE7A 3GZAA 1JR9A 2WRAA 4YFWA 4AL9A 1UY0A 4U7OA 4J1XA 4DR6O 2ZHNA 1NTZH 4O4HB 1FXKC 5FY9A 1JN2P 2C1FA 1MQTA 3RWKX 4LNVA 4B1MA 4P00B 4EZ4A 3A0HZ 3LA2A 3V64A 2D3PA 1SPPB 1HQWA 2CTPA 2FDIA 1N3PA 2XH6A 3N7KA 4Z2AA 5C33A 1AYN2 2VNRA 2UUAB 5FYVA 2OA2A 1GP6A 1I08A 4MSWC 2UXCB 3RYFB 1LOGA 4XUOA 5KHJA 1JUHA 2F17A 5I93A 5F5AA 4X20B 4UBHA 4XAEA 2QQOA 1R3JC 5KBFA 4AVBA 4EV0A 1RUG2 3T2PA 4A7YA 2JDZA 5K0UB 4L92A 3POYA 1PNKA 4XUNA 4YRDA 3HPNA 4AEMA 4IYHA 5FOBB 3TGUH 3K75B 5GW7A 5LBFA 3T1CA 2ITDC 1V9U1 2PYLA 4CH6A 3Q8FA 5F3IA 5B4XA 5FZKA 3SPJA 2RHPA 5JIUA 3LEGA 1VBA3 2DFBA 2WSVA 4XZPA 5A2QN 4K8FA 5ISLA 3RZZA 4Y1ZA 3AMPA 5H9RA 2QTWB 2FBEA 1GOGA 4DUYB 2DTWA 4P9YA 4PBPA 1RUE2 3G80A 4M01A 4QPIC 1D4M2 3AJYA 2A06H 4CEWA 5IYDO 4BIFA 4CU7A 4S2HA 3K4AA 2JGDB 5FXWA 4B8EA 1SFNA 2A70A 1LUWA 1E1QG 2VUJA 4JYBA 1V70A 4AHXA 4LHSA 4R7CA 4FT8A 4BLJA 3HB3B 3MHHC 4OXSA 2WYFA 1VLNA 5CFCB 1BSMA 1AR93 5LA2A 4BQ2A 2O14A 4RAIA 1V00A 1RFYA 5LA6A 3DC5A 4CDUB 2PLV3 1CIYA 3T2QA 3WX5A 2ZHLA 3MW2A 2AREA 1QJX1 4X1KB 3CCEV 1QNWA 2RS51 4BPZA 3ZSKA 1NA1B 1ODMA 2VNGA 2Y26A 1XOUA 4GB31 4XFGA 4JASA 4C90A 2R062 2X6CA 1AXYA 2CSGA 3U0ZA 3M1HA 4P9IA 2UUBO 1XC6A 3OBZA 5IYCO 4JI8O 1M4WA 1NCRC 2XQXA 4DV6O 4GJZA 1H2LA 2X5IC 3VDAA 2D3RA 2Q6AA 4F6RB 2QDNA 1NJIW 4PDRA 2Y6FA 4AHYA 3W7TA 2MPFA 3JB8A 2Y0IA 5F32A 3I59B 4W4KA 3BVOA 1WP7A 4K0KO 3I2IA 2B9VA 4LF8O 4QQOA 4GX2A 4DV5O 2PA7A 2PHLA 3HBKA 4XBQA 2UUCO 4JTCB 5EYPB 3WG1A 1WA4A 1L7RA 1PL0A 3WOGA 3E5UA 1FYJA 3HWJA 1VJ2A 3DECA 4CS3A 2CAZC 1QJY1 1BE3H 2HH9A 4Q1PA 4W4LA 5JJNB 1AR72 3NMBA 5I0DA 3ZM8A 3LIHA 1BEV3 4FM0A 4C0BA 2ZGLA 2LS6A 3BFRA 1N1TA 2DCZA 4ARYA 2QR4A 3B2EE 4DFSA 2GSYA 2QGNA 1KEXA 3SH5A 4RQPA 2HWC3 5A80A 4J25A 1RMU1 1MVEA 1TVGA 5J2TA 3M2MA 2Y0OA 1GWMA 2HR3A 5FZGA 3DPRB 3R0RA 3VUOA 2OT5A 2ORZA 1YUDA 5FZ8A 1WW7A 5APAA 1ULOA 1G4YB 1O9HA 3B8NA 4GKKB 3MF9A 2HLEA 2D6NA 3ZS8C 1ASJ1 4CDQB 2FDJA 2WLNA 4QPGB 1X9TA 2RV9A 2ZGQA 1XEQA 3OTOB 4CCNA 1SQBH 4RFRB 3AKTA 4ARXA 2ZXWC 5FZ9A 2CAUA 5J3UA 5A7NA 4U36A 4UFMA 1MZ5A 3I3QA 2WUHA 2R6QA 5EQUA 4JI4O 1XPWA 4RR3C 2EINC 4KHPO 3WG3A 3A2FA 4UW3A 3SXWA 4JF3A 4B7KA 1SEFA 3MI8A 1ZAUA 2A0LA 2Y6GA 1QLNA 4MTXA 1PGW1 2N05A 2CU5A 5EZYA 2V4AA 3RJ2X 4IDZA 3JCUZ 2BOCC 4L87A 5DEDA 4HN1A 4QM9A 1H4GA 2MHFA 1SHWB 2KA3A 4WVVA 2VH9A 3L9DA 4QGPA 3QTCA 3CEWA 1MZFA 3IBMA 1CEZA 3T30A 4J7ZA 1N33B 1AJOA 2Y69B 2XKOA 3M3IA 1GYKA 4CEYA 4XDJA 3UGGA 1B09A 1F2NA 3EHBB 4KFMA 3KSCA 4WFBV 4JHZA 2CNAA 5FMOS 1UY1A 3GJBA 3A4UA 1HX6A 4AF9A 3OB8A 4CU6A 4CYDA 4YW3A 4PF1A 2HWE3 5FAXA 1SACA 4FPYA 4TV8B 3GALA 4CXWA 2EX3A 2RDRA 3N2GB 3H8UA 3WQ0A 5KLVH 4CS2A 2Q0AA 1Q81W 4UCRA 3KG2A 1QH7A 2ZX1A 2PF4E 5IJRA 1W39A 4QKDA 2WO3A 5JVDB 4DV3O 2Q0OC 4D0QA 4UCVA 3POIA 4QU1A 3H8OA 3B77A 4TV9A 2RS13 4J7JA 4AEJA 2VQUA 4ZBMA 2OYZA 2J1RA 1LHWA 1RUH2 2OIEA 4FFHA 4XXPA 4X1YB 3AJZA 3MGUA 4FFKA 3WNXA 3C7GA 1S76D 2P06A 1G9FA 1QXJA 1REEA 4JI7B 3TNQA 5LCWL 1PMIA 1AX0A 2WQ4A 1KGYA 4WCEV 2CTWA 4E2GA 4I50B 4UCTA 1Y67A 2ZNJA 1OCZC 1SLLA 1T6GC 3Q8AA 5KR7A 2MEV3 4OI1A 3PVNA 3LE0A 2O0OA 3ELNA 2ZGNA 2P3JA 2Y33A 4YVSA 4F7ZA 4RFT0 2YG0A 1Z7S3 4S2GA 4YYOA 3N36A 1QJEA 1PHMA 1BBT2 2VM9A 4AWDA 1FPN1 4O2AB 3JCZA 4D6QA 5JXHA 3BHPA 3EB7A 1YJNV 4OQ8A 4BMBA 5BR8O 2E7QA 5JXGA 4YGCA 1Y9QA 1OH3A 4KGGA 5FMCA 2EZPA 4HLTA 4GUNA 1WCUA 3AP9A 2OZ6A 1K92A 3LNNA 4D94A 1PD3A 5FP4A 3G6BA 4MOAA 3AM2A 3LSDA 3AYDA 2Z3YA 1YTFD 1S2KA 4LBEC 1XNQB 4FAHA 1HDKA 3POSA 4FZ0A 1SRYA 1M90W 1LOCA 2H94A 4IV1B 5IWAB 1K45A 1VBE3 3H1IH 2DE0X 1BT8A 1RL3A 3FD9A 3VKFC 2QVSB 1BMV2 1KB9F 4Y22A 3L74H 4KNCA 3UJQA 2YU1A 2IC1A 4J6GA 4LFBB 3ES1A 1RSOB 1I94B 1T5EA 3WR0A 1EM1A 1KJLA 2WS91 5DABA 3MBWA 4AW7A 1GM8A 2CTVA 4OULA 3ZHTA 3P30A 1GWLA 4PI0A 3D3IA 2WNVB
chains in the Genus database with same CATH topology
1O3TA 5HCFA 3IKWA 4M0NA 1YFXA 3PVJA 3D4KA 4MXWB 1UPSA 1SLIA 1QQP1 2EVXA 4QMAA 4HMZA 2Y38A 4DMIA 3VBUB 4TZDA 1QGLA 3FWEA 1SLBA 2EA7A 1WLTA 1F31A 5E1RA 3ZPYA 5J37A 1MR5A 1YWKA 3R4SA 2WINB 2E51A 3AXDA 1ND3B 4Q4V2 2D3SA 4LT5A 1YFWA 2VW2A 1POV0 3GYDA 1YLLA 3NV1A 1VALA 1OFSA 5KC6A 4FPEA 2HWF1 4AI8A 1DQ4A 3WZ1A 1RUE1 1RUI3 1KFXL 4K1YA 1UN1A 2ZGRA 1D4M1 4MXVA 1HV0A 2O8OA 1FI2A 3DUIA 4RGGA 4TYSA 4B4QA 4PLOA 3ZYGA 4YNIA 3MLLA 3RNSA 4KGQA 3RYKA 1CAUA 1UU4A 4D7YA 4AVCA 3JUUA 2JEMA 4DINB 3TWIA 2VNOA 3NJZA 1AZDA 1DHKB 1UW8A 4AHWA 3AYCA 1O5LA 4O9GA 2NLRA 1TNRA 2BVVA 1JUIA 3AX4A 4NHLA 2WIIB 3GNEA 3TYJA 5JMCA 4MX3A 1Y0ZA 4Q8LA 4JTNA 2GMPA 3SCGA 3ZXFA 4XHBA 1WBLA 1OIKA 1FMD1 2RM23 3AP7A 4IEZA 1NX4A 1UPIA 5GLTA 4ZU5A 4E4ZA 3U07A 2ZGKA 4D3WA 1PM7A 2YYOA 2WC2A 3ZYIB 4Z92B 2I45A 3S7EA 2B42B 4OI4A 3B69A 1POV3 5BNOA 1LOFC 1IPKA 4M2FA 3JBG2 5F1RA 4QPIB 4G4FA 3ME2A 4F3JA 2ET1A 1X50A 4EN9B 4JGZA 1VAVA 1ALYA 1GNHA 1K5MA 5FPZA 4AVVA 4HL0A 1FV2A 1ULGA 3UJOA 5JZGC 1OSGA 3FE5A 5KHIA 2MNGA 3VBOA 2R0FA 5L7OB 5AC91 4I02A 2ZKNA 1ZBE1 4CVYA 2OUHA 4XFBA 1LJ7A 2ZCWA 1O3SA 3WQ1A 3N7LA 2VOWA 5CFCA 5L73A 2R073 4Q4W2 5LRRA 1LGCA 3ZXKA 5ACA2 3M4FA 5FLJA 1RUC1 2D40A 4V1PA 3ZFGA 3S30A 1BKZA 2PN5A 2HWB2 2EAAA 4IQPA 2BPA2 2R1BA 3AYAA 1J3PA 2F4PA 4ASMB 2P3IA 3KT1A 4AQSA 3NSTA 4CDUA 1N3QA 3NAPA 1MS0A 2E63A 3CNAA 1V6JA 1LEMA 2JG9A 1AL23 1VBB1 2AR6A 4SLIA 4BLIA 4WM8B 4AEDC 5J09A 1EV12 1C8M2 4IXLA 1OTJA 5CFDA 4MUVA 1OOPA 1PNGA 4XEZA 4E4DX 1HXS2 1DRTA 3C2UA 2UWAA 1S0IA 3B02A 2OG5A 1QOOA 3RDIA 4OJ8A 1PO13 1ULEA 2NMNA 4OHWA 1LHUA 1VRH3 2LM3A 4OLLA 3B3QE 4INDA 4AFBA 2WT1A 3V65A 1VBA2 1UAIA 5I0RA 4XJAA 5KEUA 1IKPA 4AVSA 4HKWA 5EWSA 5I91A 4N53B 4M27A 2WFPA 2P34A 1JOJA 2ZACA 4J1WA 3MIDA 1ZZBA 3EATX 1GR3A 2JICA 5BYNA 1EY2A 1MS8A 4MSVA 2NYYA 4Y20A 2ZX2A 3ZO0B 3VBSC 1H8TB 1O3QA 1KDKA 1Q5OA 1CAVA 1PO21 2XB6C 4QD2A 4XMAA 1X8EA 4Q0QA 4X8PA 3WHTA 4MGKE 1W6PA 3WP5A 3TN93 5C4WC 4N7UA 1ENQA 5DZGA 2XUMA 1DGWX 5C8CC 3TB0A 1RHI2 4NVPA 4I2OA 2ZMLA 4L11A 4EN7B 5GLVA 1JYIA 4EN8B 4LBJA 4XF9A 3FLRA 1AXKA 1NCRB 3OTFA 1TMF3 2XVGA 3W58A 1HQLA 3USUB 2UURA 1DF0A 1RC6A 2WT2A 2BNOA 2NMOA 4CDXC 3KCCA 2A3XA 4MGIE 3CJXA 4AQTA 4CDWA 5JSRA 3PNAA 4K21A 3BOPA 1RUI2 1OA2A 2HWD3 3KMHA 3J8F1 2VULA 4LULA 4PIXA 5KHGA 2WBOA 2X53S 1S0DA 1QMJA 1DZTA 5K9YA 1AR92 3B94A 3DV8A 1LU1A 1W6QA 1C8NA 5FQ0B 4UXAA