2WA4A

Factor inhibiting hif-1 alpha with n,3-dihydroxybenzamide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 99
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa4A01
1YCIA 2XUMA 3P3PA 4JAAA 1H2KA 1H2LA 1IZ3A 2W0XA 4Z1VA 4AI8A 3KCYA 1MZFA 4QU2A 2ILMA 4BIOA 4B7KA 2WA4A 1H2MA 2CGNA 2Y0IA 2YDEA 2WA3A 3P3NA 1MZEA 3OD4A 2YC0A 4B7EA 1H2NA 3D8CA 4NR1A 4Z2WA 5JWPA 3KCXA 2CGOA
chains in the Genus database with same CATH superfamily
1XB9A 1R083 3HKCB 2RV9A 1DF4A 2WO1A 4YM0A 5A1AA 4JZGA 3DGEA 2ZGNA 1RVF2 3ALQA 4AVVA 3OFNG 1WW7A 1W9YA 5GZEA 2YZ4A 4ZONA 4LITA 4GX2A 3FE5A 1I94O 1JU4A 1XNDA 3IAYA 1AR71 1SCRA 3LEGA 2HBTA 2DUPA 5LMUO 1W0NA 2NMNA 2X7RB 2HYXA 3T2PA 4NN0A 4DXWA 2VWJA 3D8CA 1URFA 4JTOA 2VXJA 1U97A 2BCCH 4UOJA 4L97A 2K0GA 5JCTA 1APNA 1SHWB 4JCKA 3DYPA 4AVSA 2QR4A 5K4LA 4BISA 1IOAA 3IMMA 4DV4B 1AR61 2AHZA 1OCRC 5LYJB 3ZX6A 2W3JA 5IYBO 5L7OB 2W1UA 5LBEA 3H3LA 2JRIA 3CB2A 4IHJB 1UCXA 1VBD3 2OIIA 1W0OA 1S2KA 2OT5A 2ZNJA 4AFCA 4KG0A 1WLCA 2A1XA 5IUQA 2G9FA 4I0WB 4Q0SA 3ZYRA 1NR7A 3U0ZA 3RS6A 4KFMA 3WQ7A 1UOFA 4EE2A 1FXVA 2ZAHA 4YJ2B 4KWUA 3I3MA 1UY1A 1C28A 3BABA 4ONUA 1GZWB 1OH3A 3L74H 3H01A 3OB8A 2E31A 1Q6UA 5JH7A 1OD3A 2WNVA 4XBLA 4GZ9A 4XIKA 1JH5A 1SETA 5FCCA 4KHPB 2ZXQA 4QHBA 1KD7A 4YJ2A 3IAQA 3SMHA 2GBOA 4JYBA 3NWKA 2X8KA 4RA0A 4DMIA 5J09A 5LA0A 2DU1A 2RE9A 5L7OC 4JRLA 3AG2B 2IM9A 1AXKA 2WLLA 5BZBA 4QB6A 1B04A 1YIFA 3T1LA 3FL7A 4M3CE 3HKEB 2KSDA 4HONA 3I4IA 1J1TA 5FPOA 1UZWA 3WR0A 4FLZA 4ZXEA 4OPHA 1BLZA 4CH4A 1NT0A 1UKGA 2AHYA 3ZIAG 1F35A 5CA3A 3H9VA 1ZZ7A 1C1FA 2NQYA 1FAFA 1DG6A 4E8CA 3ZMUA 1A8MA 1N8RW 3TN93 5JPMB 4YZ3A 4QHZA 1ZSPA 1IBMO 3KG2A 2YICA 5ACA2 3JBG1 2XJPA 4G4FA 1NAEA 1FPN2 3AYCA 1G8MA 5LEKA 4DUXA 2KXLA 5EPAA 5K1XA 2AZ2A 5EXOA 4B7KA 5A3PA 4GWIA 3OUHA 3GNEA 5IATA 4D94A 5GONA 1YIPA 3MV11 3TXQA 1BHBA 1AYN3 4LH7A 4LJHA 2CAZC 4IEQA 4CDUC 4UYBA 3ZKYA 3OYWB 3KV4A 1WW4A 2W52A 5JWPA 5H9RA 4FI9A 2MNGA 2ZEXA 3WNNA 4Q26A 2CTRA 2K9ZA 2JDHA 1CXZB 4YM1A 5FMDA 2HHHB 2EILB 3JAWA 3RZKA 1M06G 4BIZA 4CCMA 3ZSLA 1MZEA 4DQAA 2W6IG 2QTWB 3I2JA 4QB1A 5LHHA 4JF3A 3A4UA 5JMOA 5D1IA 2BBAA 4CDWC 4LF5O 1FV2A 2WJSA 3ZN4A 1AILA 5DEDA 4LA3A 1XE8A 2NLRA 1IG0A 1YQ8A 2BSKB 4WV8A 5DG1A 1YXWA 2QM8A 2BQPA 2UWAA 1QJY2 2FDKA 3QO8A 2H0VA 3VUOA 1GP5A 2HWD2 2P17A 2BOBC 5DDJ2 1POQA 3VZLA 2WLMA 3T1YB 1O4YA 1JHJA 3NQHA 1QVFU 3OTOB 1OURA 4NIIA 1KS4A 1ONAA 3WV6A 5L9VA 4TWTA 4H2AA 3E89A 4LPLA 2ZACA 3CEIA 3R4SA 4DV6B 4Q4Y1 2XJVA 4Q29A 1GN3A 1ENVA 1V9U2 4MGTA 4LFCB 2I07B 3ACHA 5F2VO 1RUI3 1UIKA 4LIVA 4PDWB 1W6PA 3C7HA 4NIHA 2BV4A 3W7UA 5A7WB 5F8PA 2LS6A 2OCCC 2JE9A 2ARCA 1FX5A 4MYEA 3B00A 4RHV1 4ZKTB 5IVBA 4BQ3A 1UPGA 3JD0A 1BMV1 3IAPA 1OF4A 3EXAA 2A70A 4AILC 2XVLA 3LUTB 5FZ6A 3PJSK 1XREA 3OT7A 3OMAB 1Y6XA 5BR8B 1WB8A 4RUFA 1J5EO 2D3SA 2Q5ZA 3N36A 1UY2A 5FMBA 4HKOA 3OGVA 2PFWA 1XNTA 4YVSA 3ZHUA 1OCZB 4AWDA 2F4VB 2Z2SB 4BW5A 4GIQA 3H1KH 3M99B 4PCRA 2WZR2 1XI1A 4AVTA 3N7KA 4HYOA 1PPJH 2RN9A 2GU9A 3LWCA 2QJVA 1VQ8V 5FYIA 4JX0A 4ZY9A 4LF8B 3NNFA 1XXNA 5JIUA 3VB9A 1H2MA 2VG9A 1NY71 1OPOA 3FN9A 2A71A 1O3QA 5JJJB 4CEWA 4NHMA 1F4NA 2BVBA 2YXHA 4O4JA 2XJTA 1OZ0A 3HNBM 1PGL1 5H5NA 1HRV3 1RTVA 2GTSA 1TNRA 4XJUA 1DQ2A 1TG7A 2AEZA 3ZOIA 5LK5A 4PF5A 3KV9A 1W3XA 1QDOA 4R52A 3OMIB 3WP3A 1H30A 1NY72 2VUAA 2DCJA 2QQLA 3ZJZA 1JYVA 3FHIB 4WM8C 4KI5M 4XJ8A 1TME3 2DV9A 4IHJA 2LW1A 1W90A 2VZSA 1S55A 4TQFA 4L0PA 3MI8A 4A2UA 4RR3A 4UVAA 2P90A 1S77D 1VAVA 2DVAA 3ZN1A 5FZAA 2A6VA 2IXHA 4GZRB 5C3RA 1HNXO 5GZFA 5GW7A 2BTVC 1VE0A 1AR5A 4DFSA 3K3NA 1PM9A 4JGYA 5A3LA 3M8AA 1PK6B 3VQYA 1L3JA 3UKTA 1CAUA 4DZGA 2UU9B 3FHAA 1VBA1 5JIAA 2W9XA 1HR0O 2VTXJ 5FMOL 2RJ2A 3VD4A 3O1OA 4AK3A 4CUCA 1DYPA 5JCOA 3NSTA 3WHTA 3T2TA 2ZGUA 3GYDA 2F23A 2BPA2 3O14A 4XFAA 2XPJA 2KD7A 4JGYC 2VZ1A 3VKOA 4J9YB 3PUIA 3VD9A 2VOKA 4OMDA 3JCUZ 4XHXA 1UOBA 1US2A 3DKWA 3E8HA 3SPIA 4B3TO 4RGKA 1ZAUA 1JZ4A 2ZZQA 5D8AB 5FNVB 3AMPA 4NWWA 2L35A 4MGZE 3M4FA 5CBLA 3AKSA 1OBNA 1XUQA 5D8AC 3RYCA 3X2QC 1QGLA 2EIKC 4AQ6A 3BPSA 2LGWA 4Q2FA 2UU9O 3MIFA 3J8F1 2DCKA 1W8TA 5LEJA 2Q8DA 1KB9F 1YVWA 5EFUA 1IBLO 5FZ9A 2QTOA 5I0SA 5KMGB 2QJ1A 4CS3A 1XL4A 2D5FA 2GNDA 1KRIA 4K1YA 5B1OA 4JAUA 3RVZA 4Q5OA 4JI4B 3D82A 3A2FA 2BOJA 1BXHA 3TEXA 2V4AA 3WDYA 5ANNA 3K5MA 5JXHA 3MGUA 4OZXA 4UW3A 2OKXA 5IJ9B 2RMU2 2RS13 2VQAA 3J81N 3O1RA 4O65A 4JGYB 1B3QA 5T3NA 1YTFB 2ERFA 5B3SB 1Q7YW 5CA1B 2JKBA 1POV1 4Q1PA 3AK2A 2UXCO 1WD4A 4YG3A 2VM9A 1SLTA 2JG9A 4BE3A 3CJIB 2P37A 2Q68A 3FB6C 2J1EA 1W6OA 2YG0A 4FFBB 1W03A 4XFCA 4JDNA 1GLHA 3WNLA 4B1LA 4WBBA 2D44A 4GWNA 2GC3A 2C2AA 3VBSB 2X29A 1Y3TA 4N53B 5T52A 3RYIB 3ACIA 1JBCA 4X88A 5I8TA 3SJQC 2YV8A 4LBLA 4CUBA 1F15A 3VZKA 4X62B 2PHLA 4QT6A 2Q8CA 2QWRB 1PIV3 2GMPA 3RYKA 1JPXA 4WFAV 1CAUB 4EFBA 4IE4A 1QQP2 3O0WA 5IT9N 1UF2C 3VLBB 2WYSA 4DR1O 3O7OA 2XLFA 4J10A 2VCMA 2CGOA 5K9YA 1YQ6A 5CA6A 3QH6A 2MK3A 3CJIC 1SQVH 3JD71 3L9JT 3ZEDA 1FV3A 1N32B 2A06H 3NKTA 4A7YA 3V56A 4LBOA 2W87A 1DLCA 3AYDA 3T4ZA 3ES1A 3T1YO 4E27A 4DR3B 3ZBHA 3S30A 2OCHA 4NO4A 3OSDA 3HR0A 3VDAA 3NNMA 4JI3B 2JDIG 2ZKNA 3D36A 4FXGB 4YJ3B 5AC91 1MS9A 1NQJA 1EPWA 4IEVA 4AGRA 5KA5A 3UL2A 4XUTA 3CJXA 2H6CA 2FDGA 4HSJA 4A3ZA 3PVNA 3THOA 1GM7A 1H1IA 3LZZA 4WFHA 3LDRA 5CVRA 2WO3A 2P4EA 4JAAA 5IFTA 2QQVA 2DN9A 4MUVA 2AREA 1VB2A 2FMYA 4JKMA 1VMFA 3PUQA 2R6QA 2ZM6B 1VBD2 3LEIA 2GDSA 3JAWB 1S1AA 2JKXA 5C71A 3M1HA 3OGCC 4YVSB 4MH0E 1HDKA 5HPOA 3ZFEB 1AF9A 4TV9B 1UU4A 1UYXA 3I54A 1U5XA 5B1AC 4MVUA 5GM0A 3MF6A 2W0XA 1KFXL 4LBEC 2ZIMA 4UCOA 2VVDA 1Y7BA 5LA2A 1FNZA 4FLXA 2BGCA 4UW5A 3WP5A 4XDJA 1YXBA 1ZZ6A 1CIWA 4I09A 4LF8O 4QDSA 3HVDA 4UCSA 1Q6HA 5FXXA 3B09A 4C7UA 4FTBA 4O4IA 4I3GA 4DIQA 1LCLA 1K5MB 2ZQMA 1ORQC 2A0LA 3O5SA 1BZKA 1NCRB 5SV8A 2EZPA 4DV2O 1VQ5V 2C26A 3OBTA 4LULA 5G05L 2IXKA 4UW4A 1U96A 5FZOA 3O0XA 1OV9A 1D0GA 3R4DB 3ITQA 4YM3A 5LGTA 4H0LB 2YC0A 2Q7GA 2AEYA 4FLWA 2WLIB 2P22C 3AG3C 5BNPB 4XFBA 5IK7A 2OT7A 4E2LA 2V72A 1NA1C 1MVQA 4C1WA 5EZYA 3DPRC 2YI8A 2Q1MA 2PN5A 4TQDA 2EINC 1ND2B 3OGRA 4JHTA 3P3NA 3NMBA 4C8DA 3RJ2X 1LGBA 1FXKB 4LTAA 1G9FA 4AZZA 4B3NA 4WZFA 5ERLA 4AEDB 2P4VA 4LLFA 4FFIA 4LH6A 4XBFA 3F5WC 1TVGA 1R73A 1VRBA 2KKWA 3SXWA 4LNUA 4UFLA 4Z1MG 2A6XA 1N1TA 3PTYA 3PHMA 2Y4UA 4AHXA 4CZSA 5A3MA 1FNYA 2VZPA 1OF3A 5FKCA 4HNAA 3T2OA 5A7OA 2FD8A 4PA7A 4PBPA 3NXSA 4DR6O 3QNEA 2L9LA 2WYFA 4LF6O 4FT8A 3WNMA 5CZKA 4AXOA 1N36B 4UFZA 1BEV1 2X6AA 3C7EA 3ABLB 1AVBA 5LHGA 3SYAA 3CU7A 4FOWA 5FZDA 4DY3A 4LHSA 3BU0A 4L87A 2K2SA 2DVBA 3SYQA 3P1IA 1J58A 1CAXA 2XOMA 5BNNB 2ZXWC 3ZYGA 3N35A 1F4HA 3A8TA 3OBZA 4UCUA 2YBKA 4I0AA 3ABTA 4YGEA 2Z4FA 2B9UA 3RYFB 2B1IA 2FCUA 2IJIA 2F17A 3ZRXA 3OG2A 4CU9A 2GV9A 2CDOA 1QY4A 4DV6O 2Y34A 4MXWB 1YYNA 3UJQA 2RHPA 4FCAA 4COWA 2OPWA 2F6BA 2Y6JA 2NR5A 1SFNA 4G27B 1VMJA 4K35A 1N47A 4KNCA 2VL4A 3R6SA 4M3CF 4LP8A 4U3FH 1OLMA 5HFMA 3I59B 4CCKA 1AJKA 4LKSA 3PN1A 4Q4V2 4D69A 1UPIA 1GM9A 3A21A 1OI6A 5C9AB 1WLTA 1M57B 2YSUB 3WINE 3L2HA 2DUOA 1GQGA 2JD4A 3AKPA 1V9U3 1PZ8A 4OHYA 4R4ZA 1QR8A 1QMJA 3SYOA 3DPRA 5FXZA 3LFIA 1FMD1 2QM7A 5JVVA 3WG7C 2YUEA 4B29A 2EILC 2IFRA 2LW7A 1YJLA 4Z07A 4Q4V1 3GCXA 4EKWA 4CEYB 3NKGA 1CX1A 1SLBA 4UFMA 2ETEA 4TV8A 2BTQA 2EJRA 5F2SA 1ENQA 2QKAA 1RPOA 4M3CA 5F6LB 1ACCA 2ZMNA 4IT5A 4PIXA 4FLTA 4A45A 3LKJA 4AFMA 4W4LA 4I9WA 5D21A 4LO5B 3BVOA 3MEPA 4LBQB 2XAQA 3K75B 5GJ6A 2VH9A 1P7GA 1VQNV 4GH4B 2JG9C 1QU0A 2N04A 2XVKA 5FZMA 2HYKA 4ZU5A 5LASA 4B3RB 1PP9H 1CZSA 4NIAA 2PXJA 4XF4A 4S2DA 1VEWA 1GICA 2QQJA 2WAAA 2ZHKA 1EV12 4F6EA 5A6ZA 1ZX3A 1P49A 2LFRA 3CX5F 4O2BB 1LHNA 1LENA 4GMP1 5HI0A 1W28A 2RDRA 4P14A 4LO6B 2AENA 1OJHA 2E63A 1XMQB 1DZQA 4MVRA 2ADDA 2CUGA 3IWZA 1J3PA 1EUUA 3CKHA 1RUE1 3SJCC 1G9DA 1A8DA 2RS33 1LTEA 3KF5A 4YARA 4JYAB 5IK5A 1O6UA 4BLJA 3JSNA 1AZDA 4TSVA 4QPYA 1E1RG 1XOYA 4IETA 1RC6A 1S0CA 3WX5A 3AG7A 3ZMZA 1CJDA 3M2MA 2WLIA 3CQOA 1SQBH 1SQ4A 1DGSA 3AEIA 4GH4C 2GH8A 4TTGA 4XQWA 3KHBA 2WBKA 3NL1A 4TLGA 2GNBA 3ZXEA 4LF4B 5FZOB 1BL8A 4CZZA 4P2ZA 3TEZA 1A78A 1TE1B 1SF9A 4X1IB 2H6BA 5CB4A 3DSQA 5CBHA 1AR4A 5T50A 4BIFA 1O9HA 3ASIA 4DR7O 4Z82A 2FZ1A 1H8VA 4LF4O 2A6ZA 1YHQV 2WLQA 4AI8A 3B3QE 2RJKA 2WAMA 4UWDA 2YPJA 2WZR3 3QO5A 1C8NA 4DR5O 5LA6B 3RPQA 5HV4A 2YU1A 2FTKA 2EXIA 2V5YA 2QCSB 1A34A 4BM8A 3U78A 2A6WA 3CD6V 1ZL8B 3TJTA 3OE7G 1Z5VA 4URAA 2TNFA 3IIAA 4Q0QA 4X89A 1WA6X 5A1LA 4XAAA 4AGVA 5EBLC 1Q8OA 2EIMC 2QDRA 1OFNA 5FXWA 1ZLZA 3AB0A 2CTWA 2WZEA 4QX7A 2GNTA 1TA8A 3DYMA 5FYHA 3DCQA 2ZS6B 1N32O 5DUUA 3SPCA 2KG7B 3B77A 4FTEA 4LF7B 4COVA 2D3PA 2LP7A 4OX9B 1W8UA 4IEYA 4AAPA 3VDDB 1T5EA 3HOBA 5I0RA 1Q43A 1ZRDA 4JYYA 1IBMB 1AL23 1W8ZA 3DN7A 2VZRA 2FKXA 5BYNA 1VF5B 5DDJ3 3BIEA 2XAFA 4YJ3A 1JZ8A 1MA1A 5DM6V 4OI4A 3B5LB 1VP6A 4GWMA 3P32A 4WBNA 3JASA 3IPVA 4ATFA 1NCQA 4YRDA 4CP2A 1BSMA 4OHVA 4HBNA 4DV0B 1WA4A 2VZVA 4NRQA 1HV0A 3MFCA 3THDA 5JVDB 1SFYA 3NR7A 1IQDC 3S7EA 2DBIA 1SA0B 4JYCA 1VQ9V 4LT5A 5FY0A 2HEYF 2PHDA 5C4WA 3KKYA 1ZZ9A 3K51A 1PKXA 2ZX0A 4PLMA 4IEWA 3KT7A 3PL0A 4UCRA 3ZX7A 4GJZA 1MQTB 3UCSC 5IJ9A 5FZFA 5FYMA 1JOYA 4FPHA 3MW4A 3IFXA 1IXMA 2HWD1 1GO3F 1UFIA 5KLVH 2WDBA 5EWSA 1K5MC 1RP3B 1FS0G 1X50A 4WM7A 4IEOA 5EC1C 1LEDA 5ACA1 1ND3C 3JALA 3BEHA 1MEC3 3I2FA 3RZGA 5CFDA 1V9PA 4FFBA 4LBNA 2O8QA 2WFF3 1X59A 5CA0A 1ENXA 3VQVA 5KWRA 4IV3B 5C8CA 3IMNA 4BOWA 1S4CA 3CC2V 5EIBD 2EULA 1UX7A 4B4QA 1L7LA 4DV5O 1RJ7A 3NJXA 3THPA 1FXZA 1D4M1 1F5JA 1K9MW 4XBQA 1Y9MA 2YGMA 4XACA 1OOPB 4RFT0 1YI9A 2GN7A 1NI8A 1YITV 3MBWA 3QG5A 5JJNB 3UT5A 1UY0A 2OX0A 5C5TA 5AVAA 1LHWA 4A5UB 2F95B 1E5IA 2PUSA 2R1DA 3VL9A 3OY8B 2WPDG 4QDRA 3ON7A 4SLIA 4LF7O 1X33A 2Y4TA 2Y6LA 4FTSA 1S0VA 3GBFA 5KMGA 4FVMA 5LRRA 3VKNA 5IY5B 5HV0A 1AUYA 1WMDA 2VOVA 2FCVA 1H8HG 1CJPA 5JSRA 4EV0A 4NPLA 1ZBE1 4XUPA 1CP9A 3ZMNA 1IKQA 1MEC1 1X4TA 4LKDA 3L2YA 3T4HB 1KU9A 2V09A 4JQTA 1ZRCA 3CJHB 3FWEA 1D7PM 4FPGA 1SFPA 2XLGA 4N23A 3RNSA 3VDDC 3CWBH 3O65A 1PNMA 5JSPA 3AP7A 3TAYA 4H44B 3W59A 4IGOA 3FAVB 2Y6GA 2ZR2A 4ASLA 1EPZA 1V6JA 2P3YA 3DXRA 3S7IA 1C8M3 2GZWA 2JDZA 4UFHA 2NZ9A 4CU6A 2VUDA 1KFUL 3CJHA 5GLTA 5FYSA 1JJOA 4RGGA 3MF9A 2EZOA 5DAXA 5CKMA 5A70A 1X8MA 3KS7A 3I56V 1K3IA 1H2KA 5B1BB 2VXRA 3PJYA 1FXKC 5JQGA 3IZOA 4XTPA 4CU7A 2YBSA 3WUCA 1HRI3 2ZGQA 1VBA2 3ZR5A 1JX9A 4IV3A 2VNRA 1HB3A 1AYN2 5FK7A 1POV3 1QJEA 3OY8A 1AR93 2F66C 3JALB 5FPAA 2PLV2 2IUWA 2XQRA 2PZSA 2HJDA 3Q8EA 1RYYA 4LC1A 1QQP1 3Q8FA 4R8HA 1JJ2U 5FL7G 3W5NA 1YCIA 1LODA 3Q8BA 3ABKC 4MGYE 3M3EA 2IU0A 4K1ZA 1I5YA 3JASB 4LUMA 5FZ3A 2N05A 1R091 4H7LA 5CNAA 5LZ6A 5BV6A 2FQPA 4P9LA 3WOGA 3JD3A 5FLJA 3WXPA 2DQ3A 3K5LA 1ZX5A 2XHKA 1W9SA 3PUAA 2DUQA 3PDQA 5FP8A 5FMCA 1G7YA 2BE3A 1O8PA 3GVMA 5E79Z 1GOHA 4AFDA 2GC0A 5FBJA 4IXLA 3AZWA 2ZBJA 4JZ2A 3LA7A 4IE0A 3K3WA 1XSRA 3RDIA 2VCCA 5KUKA 1WW6A 3JCIA 2YBPA 1ENSA 2ZGLA 3W7SA 5A6QA 4H14A 4OUEA 1O91A 3MIDA 4AQTA 3N9OA 1XRUA 4PDWC 1NCQC 5LOVB 1LHVA 2IW5A 1AB3A 5DAVA 3TYJA 3ZIWA 3WF4A 1SEFA 1Y9GA 1OQDA 1WNSA 4W4ZA 2OWOA 1K45A 4YIPA 4Q4Y2 1PO12 3BTAA 3J7AU 2UWCA 2J1UA 1C57A 4K0KO 3NJZA 1IURA 5FLXN 3ILRA 4FLYA 1CZVA 3S57A 4FFHA 2E7TA 4UT5A 2MW2B 1Z7S3 4JGZA 2CDPA 3VDBA 2XOKG 1RUG3 3FMGA 4CCEA 3IPVB 1SQFA 1D2SA 5K7PA 4B3SB 2WZ8A 4AHCA 4JZRA 3ETQA 4PQQA 2UYBA 1ZRRA 4PIZA 3WP4A 3K2OA 3OGGA 4FPKA 3LCPA 1ZBA3 1KJRA 1ALYA 1VF6C 5ITZA 2GUZB 2ES3A 4JGSA 2D2CB 2F4PA 2YIBA 1M90W 2XHBA 2OUJA 4CSWA 4GMP3 4PDWA 4EWAA 4J25A 4WF9V 5FUPA 4KG8A 2DVFA 2BFUL 4O2AB 4TN7A 4UAPA 1R1A3 4X6RB 4JHZA 3NNJA 2PQSA 1HDJA 1C5HA 5LBQA 4LXLA 2VQFO 1U12A 3GHNA 2VULA 4YVSC 4FOVA 3BY6A 3T1MA 5J3UA 2CU5A 4WZCA 3WCRA 4Q4V3 1NLSA 5FUNA 4MGKE 2R062 4E4ZA 3ABLC 3DGTA 1XEQA 1WLWA 2W08A 3F2ZA 2HWB3 1KBHA 3KV6A 1UZ0A 2EALA 1I94B 1VQOV 4EROA 4AL9A 3M3QA 1N36O 4MW3A 1E5HA 4XF1A 5EBWC 2TBVA 3PVEA 1JZ7A 3SCGA 2DYRB 4KGGA 4GKJB 3QBQA 5FZKA 4AQYB 2HWC2 2O0OA 2P34A 4IV3C 1DDLA 2RMU3 1JZ6A 1QBZA 2VS0A 4M0HA 1BS3A 4GD4A 4V2VA 3E22B 4DK1A 2JK5C 2ZX3A 2B39A 4AF9A 5AFBA 2VBDA 4MVSA 4N43B 4OHWA 1XU1A 1V55C 5DUWA 4LK6A 5D5QA 1IZ3A 3PMEA 4DV4O 4ICGA 1KDMA 3KF3A 4D7TA 4OCTA 3WLUA 1AR73 4GKKB 4FVVA 3H8XA 2Q1ZB 5CKNA 5LMUB 3DPRB 2MHFA 3PJQA 3APOA 3ZRVA 4JTDB 3TNPB 2UYAA 2WWUA 1DLBA 2HFEC 3OAAG 4JPRA 1D5AA 3SKJE 3C2UA 2R071 3E5QA 3VL8A 4D6TH 3RBZA 3K4AA 1AHSA 4I30A 2BWAA 4QGLA 3MHZA 1YRZA 2Q73A 1MVEA 5K8SA 3ZSMA 4HAMA 3RZZA 2QDNA 2XQXA 3LDBA 2X0LA 3CC4V 1SCSA 4M3CB 3A22A 1W8NA 5FZEA 2FDJA 2TEPA 2UXXA 1KGYA 5HXVA 2R9RB 5A33A 4LE3A 5JR2A 1RSOA 1HQNA 1FAYA 1B09A 3AM2A 1VBB2 5I0DA 5JH7B 3J8F2 3FBMA 1ULCA 1YJWV 4UFKA 1WP8A 1NU1H 1FOD1 5JXJA 2X10A 4YZ1A 1N34B 4QU1A 1NXMA 3HKEA 2ADEA 1PNGA 1SLIA 2B9VA 1XQ8A 4W6YA 5JDBA 2Q7EA 3I3DA 4RR3C 1YEWA 4MV2A 5JOWA 2E75B 3I59A 5DXDA 3ZSJA 1AR82 4NIDA 4YLZA 5LYJA 3DV8A 2HWC1 4XXPA 4QQOA 1QJZA 2YC2A 2QWOB 3VHPA 4BZ4A 1GZWA 3BFRA 4MTFA 1RSOB 4I3PA 3B02A 2CWSA 3LPFA 3D3IA 1JW6A 1OA4A 3WW2A 4FXKB 3N7MA 2XJSA 3OEEG 3AJZA 4YPJA 4LIUA 4P9WA 4H7MA 3LAGA 4AFAA 4WFEA 5T54A 2ZMLA 5EYYA 3ETGA 3SPHA 4JI0B 4U7NA 1WCDJ 1QNMA 4YHHB 1PO21 3PUHA 3T3YA 1GNZA 3EJKA 1R6NA 3WF0A 4CCOA 2DVGA 3ZHQA 4HVRA 3SITA 4Q0UA 2HR3A 4X66B 1MSWD 2MPFA 2XR4A 3KM5A 1XYPA 3AZZA 4QXCA 2WNUC 2PY5A 3RYRA 4PF1A 2R072 4XXAA 2WZPP 1SQQH 4MHRA 4X66O 1DYOA 2B46X 3FZ3A 2X53S 1ND2A 1R6TA 4QXBA 1HXS2 2GMMA 5H2FZ 1QOTA 2A9HA 4XHBA 3KVBA 2X05A 3R0RA 1BT8A 1STMA 3AMMA 4XJ9A 4OUMA 1BYHA 5B66Z 1RUOA 2WABA 4DOUA 3KMHA 1FPN3 1QH7A 1K42A 1PIV2 3E2EA 5FBZA 1TUEB 4CDWB 3VD3A 5IE9A 1HRV1 1HXS1 2XJUA 3E6CC 1TZOA 1XSQA 3G6EV 4O4IB 3L71H 4ASMB 1MS4A 4LLOA 2CHHA 1NH2B 1FOD2 3GJBA 4CC6A 1IVSA 2HWF3 5BNOB 5LA9A 4YWAA 4RQEA 5C3SA 5FY1A 4Y1YA 1RUI1 1LOEA 1PMIA 3C3SA 1KS5A 4EWEA 1OD5A 3C90A 3D3QA 2R70A 5JZGA 1XILA 2CL2A 4YW4A 2RM22 3CXCU 5I0TA 5A9GA 5C3PA 3BTYA 2YGLA 5JR7B 5IFPA 4P9XA 3AG2C 1JN2P 3UGGA 2PGGA 2QQUA 4ZHQB 3FLRA 1RUF3 2OVUA 2JE8A 1NTMH 5G04L 1NCRA 4NE9A 4XF0A 2ET7A 2QKCA 2ID4A 4ATEA 4GB32 1AR63 2ZE7A 2UWBA 3MIBA 3C8XA 1VBA3 1J84A 3K0DA 3CCMV 1OMIA 1UOJA 3NAPA 2VECA 4PA9A 4COUA 3S3WA 3ILNA 5BNPA 1U5IA 2BW8A 1RM1C 4LMFA 2ZR3A 4NIGA 4ZU7A 1R3KC 2BJSA 5L36A 2J1TA 2VMEA 2QQNA 3T09A 5FTTC 1WPXA 1GQPA 1BJQA 1FFXA 2WN3A 4B1MA 4CEWC 2VTXA 4YG0A 5JSOA 4CS2A 1ZZCA 2JDNA 4HFSA 1J95A 3PVOA 1VF6A 2ADPA 1JMUB 4QQLA 3ROUA 5HCHA 4XILA 3F5TA 3VKMA 3DXTA 5F39A 1J1LA 3ZFEC 2W94A 2ZGRA 4CP0A 3ETPA 3ASNC 4J42A 5I91A 1COV1 4CH5A 5C6CA 1V70A 5L9RA 2Q7HA 4IEUA 2RS11 2VBPA 4K40A 2LGQA 3POSA 4OVEA 1UO9A 2WZR1 2P3JA 5A32B 3S6PA 3JYCA 5L3DA 2W5FA 3ZIXA 3ZYPA 2VMFA 1LECA 2JS5A 3H3UA 3ABMB 3EVKA 1PL0A 1Q6IA 4N53A 4KWLA 1LOGA 4CVUA 5A2QN 4AEDC 3ZXAC 1OCOB 3EB7A 5C3QA 3MIGA 4NMIA 1TNFA 1DGWX 4LF9O 2RM21 2QE3A 4MGSA 3N9NA 3ZPYA 1JYIA 4I7ZB 1W9TA 3CYOA 3Q4HA 3N7LA 1R093 4FPLA 1H2SB 2FYUH 1ASJ2 3N9PA 1GK9A 4S2FA 5F1RA 3ICXA 4DR6B 3LQCA 4Y1VA 4FQZA 4DB5A 1FT9A 4X1KB 1KITA 1YUDA 3THCA 1VQ4V 3ML0A 2WLNA 2IZWA 3OUFA 3LA2A 2DYSC 1C4RA 1WN7A 3G6BA 3SQOA 1AP6A 2ZPXA 2B7YA 2ZNIA 2DWRA 3MICA 1W6OB 4NUBA 4AEKA 3RT3C 2PAKA 4N90A 2Q4SA 4U7OA 1BVVA 1PGSA 2IVIB 1Z7S1 4MGIE 4XBNA 3CSXA 3E83A 1RUJ1 4DV1O 1IS4A 2QGNA 2DU0A 2RR12 3HT1A 3WNKA 5BUVA 1BBT2 4AEJA 4EYUA 2ZCEA 3E97A 4IEZA 4H55A 5FDBA 2HWC3 3B7MA 1ZBA1 2ZJCA 4KWJA 4NAMA 2XAGA 1VBE3 4YVWB 3NVCA 4BLIA 2IBZH 4LOTA 3AP9A 1RHI3 3PIGA 4QJFB 4JQRA 1GWKA 3B69A 5J1XA 5LXTB 4LOSA 5E89A 4RQFA 4JI2O 5FYVA 4YW2A 5KXCA 1ZBA2 5LMNO 1BK0A 3CCLV 4RUEA 3BUCA 5JI9A 4BXSV 1IXBA 1MABG 2E9QA 2JICA 3CJIA 4TUYB 2ZE8A 1NE6A 4KHPO 4B4PA 1OC1A 1WKYA 3KZ4C 4AEMA 4GKKO 3FHQA 1R3IC 3AK0A 2EIMB 4KL1A 5IJ0B 1ENRA 1N3PA 3WHUA 1BMFG 4RGAA 4YVWA 5EP9A 3CBNA 1H2NA 4DV3O 3SNMA 1N0NA 3W5MA 1QOOA 3RWNA 3RYCB 1TQ5A 4URTA 1WLEA 5F2WA 3MV01 3WNXA 2OYQA 5IK4A 3JU9A 4XJWA 1QR9A 1Q86W 2YUAA 5BXXA 4L8JA 1BBT3 2R32A 1LR1A 1W2TA 4A3XA 1PNLA 5CKQA 1HX6A 3WW3A 5CIRA 4X64O 5JVDA 1HN1A 2XT9A 1YHFA 3D6EA 1AJQA 2XMLA 4Q0VA 5AG2A 4MZUA 4CRQA 2UXCB 3OD4A 3W7TA 4OI0A 5T5OA 2Q8VA 3CO2A 4HPKB 1PM4A 2HEPA 2HBUA 2BBVA 4PI2A 1ZNPA 1ZWIC 3GBWA 4MT8A 1L7RA 1ULPA 4YXWG 5AFEA 4RS5A 1GZ9A 2VZTA 2UXDO 4UFJA 3H50A 1I5ZA 4XABA 1YSCA 4NHKA 1ZVFA 4FP2A 1OLQA 1K97A 3FBYA 4NRPA 3WQ0A 3B01A 1X9TA 2E32A 1G6UA 3LA3A 3KD4A 3CC7V 3I49A 5H9PA 4XMIA 4R4XA 1A6CA 4NJ4A 2VO5A 3H9AA 1OXCA 1AI5A 4FPJA 2W92A 2B1GA 1UY3A 1GANA 4I4TA 3CPWU 1CONA 2CTVA 2MEV3 1I9RA 1B35A 5M0TA 4JKLA 4XUQA 1AVMA 4PDRA 4FJCC 3KB5A 4LQRA 1JMKC 1HQWA 1U5YA 4KH9A 4NB5A 1VPHA 4ZKIA 3SISA 2YXSA 3I2OA 4OYUA 1COV2 1Q56A 4E4EA 2RS53 3E35A 4QX1A 3PVBB 4AHWA 1O3TA 1MEC2 2A3XA 5DG2A 4BIOA 1OQ1A 5A7WA 4QPIC 5LP6A 5FZ1A 1EN5A 1O9GA 2B9ZA 3LSDA 3TOJA 5KXBA 1AR92 2XGXA 4PELA 4W6XA 4FBFA 3P3PA 4P9PA 1WCUA 4WM7B 3IIIA 3DYOA 3FYIB 4DR5B 4EWDA 2DFCA 3BN6A 3ZHVA 3B94A 1N0JA 1GU3A 3VHOA 4IEPA 2CGPA 1XQNA 3EO6A 3ZRSA 4YW5A 2PI5A 1UMIA 1SRYA 4QX0A 4AI2A 2RS52 1MMMA 3T08A 1UAIA 4H37A 1WD3A 4XIOA 3ABUA 2ZDIC 4JTAB 3UJOA 5A3UA 3OCPA 4S2HA 1AYM3 3WDVA 1QJX3 4FFGA 4LR3A 3CMEV 4K6BA 5F5AA 5J2TA 1GYKA 1I3HA 2VZOA 3QD6A 3FKSG 3HKDB 3RYHB 1OT5A 1C8M2 1EY2A 3BODA 5IW0A 1W6NB 4R9BA 4WBNB 4QE9A 4QGMA 4A44A 5LCWL 1RINA 2PLV1 3VBHA 2OIGA 5FJHA 2DF7A 4UBGA 1HNZO 1FFTB 1KP2A 2AUYA 1V6NA 1CX4A 1XC6A 5B4XA 2Y69B 3AG4C 3VDDA 4KU7A 1OCRB 3J8F3 3DEMA 2BSKA 3DKQA 1QHDA 4QXHA 5LA1A 3BU7A 2VMDA 2HKXA 4ARYA 5GTHZ 2LFSA 2CE4A 2JEUA 1TMF1 2LRPA 3VQWA 4FZ0A 3ZCCA 1BHAA 4DXZA 1YTFD 3MUY1 3CRRA 3HT2A 5LY2A 1SLLA 1KJLA 5KA6A 4BYYA 2K9PA 3LD8A 4QX5A 4ZBMA 1REDA 1VALA 3TETA 1EYBA 4BMBA 3LOIA 4EZHA 4KXRA 1RHI2 2QQIA 3WB1A 4OLLA 3CL1A 2R0FA 5CFCB 3UKNA 1W39A 3USUB 5A7SA 4O2AA 3POEA 3OYWA 2ATKC 1JQ0A 4DR1B 1IBLB 3KLSA 4DW0A 2GC2A 4CXYA 5J2TB 3MD0A 2LW8A 4CTEA 1NG0A 3T1HO 3VKLA 2RS51 2WNEA 5D5PA 1Q8VA 4YY3B 2JB4A 2XJRA 3RZHA 2FDFA 2Y26A 2F4VO 4IERA 3WG1A 3O1MA 1HRI1 2WLPA 4J7ZA 2P6HA 3PURA 5HCFA 4DUWA 3MPBA 3TBDA 1ODMA 5J48A 4E8DA 3E5XA 2NP0A 4DS0A 4YVWC 3T4VA 2OXBA 1PM7A 4XETA 4JGZB 1CESA 4MG2A 4LFAB 1NXD1 2GMEA 4N9IA 3RSJA 3I3BA 1XNRB 4CEYA 4RQPB 2OA2A 1RUD3 2DWEC 1HRI2 4WM7C 4HL0A 5APAA 3OTOO 2FDIA 1XL6A 1V00A 4JGZC 4I55B 4P08A 2OQ7A 1EFRG 3NAPC 2E7AA 2E7QA 3IDAA 5BY5A 4CDQB 4IW3A 5A33B 2ADQB 3AJYA 1DQ5A 2VD7A 2WNUB 3V0AB 3U1XA 5LOVA 3KHCA 3BVCA 4LBQA 2IFWA 1NTZH 3LNNA 4HLTA 2Q4PA 3E1F1 4ZIBA 3N3HA 1NA1B 4TLFA 4BPZA 1ULDA 5FO7B 3HQXA 5H9QA 4Q1RA 1E5RA 4F6RB 4ZPIA 1YFUA 2Y6KA 3OUSA 2AYHA 4MXWA 2QQWA 2C5DA 2G4IA 2C6SA 2HVKC 2WLHA 1YQ5A 3M3OA 2QKSA 4GYCB 5CISA 5IVFA 1REEA 4JVAA 3OPWA 2UUCB 3N2KA 3SR2C 1BHGA 1US3A 4GH4A 4KBBA 3H42B 1Y74A 4CCJA 1FXHA 1IGOA 3OUJA 1GV9A 2IXJA 3E86A 4LHKA 3AKRA 1WCKA 1O3SA 2R041 5HCAA 1TUBA 2GAUA 4U2AA 4EEQA 2D43A 3RWKX 4OI1A 1K34A 3ZYIB 1TMF3 3AL5A 3ZXDA 1Q90D 4I4TB 1GP4A 1HJFA 2DURA 2ZXWB 4XCAA 4Y4YA 5H9CA 2WIIB 1V6LA 1W2OA 4NWVA 1G9CA 3JBG2 3GF6A 4B3SO 3I2KA 2Y6HA 4Y20B 2HG5C 3QH7A 4MTGA 4AQYO 2WO2A 3VBSC 2HWE2 2BWCA 4YYOA 1QNWA 4QQPA 3ZO0B 3OR7C 1OLRA 3NV4A 4IL6Z 4GALA 2ZA9A 3NRUA 5DZEA 5BNNA 5EJ3A 4CCDA 3E22A 5JOZA 1ZTEA 4ZS2A 4RS5C 5D2AA 5J2UB 2OZ6A 1URXA 1BMV2 2ZKLA 4O4HA 4B8EA 2E5LO 4DW1A 1JHNA 4QD2A 5L7OA 3CF6E 2YHJA 2F43G 3H8RA 2WT1A 2OIEA 1OCCB 2JDUA 2ZGTA 4PLOA 1NBMG 4XFGA 1UW8A 5KXDA 2VVFA 2ZX2A 3GWKC 1X8EA 1FMD2 1B35C 5BY1A 4PV1B 1YFWA 1NQDA 3CHXA 3O1TA 3CNAA 4OXSA 1JR9A 3NJVA 2PYJA 4COYA 2CY6A 4FPCA 3CRMA 1EBOA 1TEIA 2DCZA 1CAWA 3I55V 5LW9A 3S5AA 2XASA 2C1FA 2N7GA 5J9PC 1LUWA 1QJU1 3WT3A 1LU1A 2HJIA 4N43C 5GLUA 3U4XA 2QWNB 1ND3B 4B3RO 3UYJA 2VTFA 4EN8B 1YNAA 2CDYA 5FZBA 1H2GA 3CCQV 4QGNA 4QE7A 4FPYA 3I3EA 1PZ9A 4JRAA 4XMAA 4CYDA 5CB7A 1UJWB 4RN5A 3BOWA 3N9LA 5LP6C 3M70A 3JAKB 2RR11 4ARXA 3I5DA 1BBT1 5A3NA 2Q0AA 1TAEA 2VE1A 3AVRA 4J80A 1F9KA 4W65A 2YXYA 2WT2A 4QIWF 1H4HA 1V55B 1PHMA 3ZMTA 1ULFA 4MHUA 2DDUA 3S0MA 5IT6A 5CG9A 2VQEB 4KBZA 4K20A 1MPXA 1RMU1 4QQ2A 1QJY3 2IVJA 1KQSU 4F83A 1JXNA 3ETDA 2VMGA 1UZYA 5FFOC 3ZDSA 3K48A 4Y5TA 5KX5B 1DF0A 3JCZA 3K46A 4HKWA 1JOJA 1GSLA 1UY4A 4LK7A 2WRAA 3ZRWB 1PNFA 4Y4RA 2Y48A 2A5ZA 1Z0HA 1BE3H 3DXUA 2JD9A 2LALA 5IYDO 4XUOA 1AX2A 1UYZA 3NW4A 2ZHLA 4D3WA 2JGDA 2W6JG 4LEJA 5FWEA 1UIJA 5H6RA 1FD9A 5FPZA 2W0FC 4XFFA 3N27A 3UK9A 1OA3A 2QA4V 1L7QA 3F95A 3POJA 1LULA 3FLTA 5LBBA 1JOPA 2NMOA 3P5BA 3ACLA 2CAUA 5K0UB 4FK5C 1UX6A 2UUAO 2XBO3 3M3IA 4DR2O 5KR7A 2RQ6A 3QLQA 5J36A 1LU2A 2VUJA 2QFEA 3CDZB 5FLIA 3CP1A 4F7ZA 4FZ1A 1NZ6A 1JUIA 4CP9A 2ARAA 2UUAB 2HH9A 2WO7A 1XOUA 3ILFA 4DV3B 1N3OA 3G67A 4QQHA 2VUCA 2G1MA 1DZTA 2EX3A 4EFEA 4OZOA 4ZZ5A 2ZE5A 1SERA 4JI0O 2JB8A 4YSFA 3I2DA 4XTMA 5CADA 2UY8A 1CWPA 2YFUA 3LPGA 1QXPA 4A7ZA 4QPIB 3NAPB 5GZDA 1J3RA 3QCWA 3I2HA 3G80A 2KG7A 2JJ2G 2Q8OA 2G9ZA 1NTKH 1I7FA 2XDVA 5CFDC 2LM3A 1WLDA 4ET7A 3KCCA 4ITCA 5LY1A 4IGGA 3AXDA 4BIUA 1W6QB 1QLNA 2RS32 1PVC1 4D8MA 2HJFC 1N34O 2RG4A 4LKEA 5H6QA 2JJ6A 3K4DA 2JG8B 3WB2A 1QQP3 3BIWE 4XE9A 1VQMV 5CMUA 1H1AA 5IVYA 5CAZA 3VHNA 1NH2D 1MS5A 3HMYA 3GGLA 5FP3A 2K1EA 2E53A 4OGQB 3V64A 1VAMA 1VP7A 4JI6B 4WCEV 2VCAA 2YIAA 5CA1A 4Z8BA 5FUIA 5C7GA 2WQ4A 2Z42A 2AXTZ 2XKPA 4X62O 4N7UA 2C9KA 4COZA 2JIZG 3K4ZA 5CEHA 3B9IA 2B4KA 1XE0A 5J37A 2Q1FA 3JD72 1BVP1 1RUI2 1S2BA 1RXGA 3VGIA 3TB0A 3HKBB 4N9HA 4JI8B 1QOSA 2C4XA 2Y0OA 4YFZA 1JFFB 5FPVA 3NV2A 4KMQA 2ZGSA 2J7MA 2QVSB 4H13B 4UXNA 1MNGA 1K73W 3URFA 5FZHA 2R061 3QACA 1PNKA 2GHYA 2YC4A 3CXHF 1OLME 1GMGA 2QDOA 1Y76A 1RVF1 5BMVB 3POBA 2P1BA 1MQTA 1QCEA 4CPBD 2R063 3OTFA 4OHZA 4ES8A 3SEPA 5F5IA 4Y1UA 2ODMA 1NLRA 4NXNB 3C3VA 5B1BC 1YQCA 4AI0A 2YROA 1W2NA 1VBD1 1D4M2 2W46A 2WSVA 4DK0A 1D5NA 4PA3A 4O4JB 4JI7B 3B93A 1S72V 1J5EB 4CE8A 2W47A 4QWNA 5TISZ 1PVC2 5J2UA 4FMTA 1PO13 1O8SA 1FKAO 1VBC1 4G28B 3ZDVA 3KCXA 5TSWA 1JTZX 5E1AC 5FLHA 3GBGA 1XMQO 1NS1A 5JPNB 1I0HA 2UUBB 4Y24A 5DN2A 1XHXA 5HFLA 3EHKA 2EIGA 3VBRC 2YY1A 1W2AX 1L0NH 2EVXA 2WNUA 1EN4A 4Y20A 4UW6A 2UUBO 5CN0A 4K0KB 1SZTA 3T0DA 5FYBA 4IV1C 3I8TA 5JAXA 3OEBA 3H7JA 2WLKA 4Q8KA 3R65A 2A3WA 4NYKA 4Q4X1 4S2GA 4C91A 3ZN5A 3JD2A 4G3YC 5JXGA 2ARBA 2CH7A 1DIWA 1CEZA 1RL3A 5CU1A 2G9GA 1A32A 1S0IA 2D93A 5DZGA 2MEV2 1BZWA 1F51A 4ZI7A 5EBMC 3WEZA 3W7WA 4ZU4A 1ZZ8A 5L3EA 4P5HA 4RYDA 5CYYA 5A32A 3AK1A 1VBB1 4LHNA 4YGCA 5F3CA 1VB4A 4GUNA 1HLCA 3JB4C 4CH3A 5EYPA 3RFRA 2HWF2 2R16A 1AL21 1OCZC 2BOIA 2YMZA 4A6OA 4LF5B 1TME1 4FLVA 4X8NA 1O5LA 2VNVA 1VIWB 2BEOA 1V6KA 1JODA 3U37A 4QB2A 1E1QG 3HJRA 3G4SV 1RB8G 2O1QA 2R49A 1UYPA 2WS91 2GSYA 1K7DA 3H1WA 5KHGA 3K06A 1DBNA 4GT1A 5ACA3 1H2LA 3IB3A 4PIYA 3WZ1A 3RVYA 4JC1A 5J7MA 3ZMOA 5CG8A 1CZTA 2ZEZA 1FYJA 2DVDA 3UO3A 3ME2A 2VW0A 1YLLA 4CUAA 1OQEA 4JDMA 1Y66A 3H1HH 4XVHA 2VWKA 2HLEA 2EINB 1ND2C 2WR9A 2RMKB 4PQ9A 2WNVC 2A73B 1GN2A 4K8ZA 3VZJA 4J41A 5F37A 2QZ2A 3U75A 3JAMN 5CFCA 3I2GA 4J1WA 4NOTA 4I5SA 4LBKA 1H8TA 1RXFA 1YO8A 3N9QA 1M56C 4XZPA 1HIXA 5LMNB 2GP5A 4IE6A 4MX3A 1NLQA 1YQ2A 4D6SA 2PHUA 4JAVA 5C33A 5FZGA 2UXNA 1GKFA 5LBFA 1HR0B 1K92A 2XONA 4UV9A 2QM4A 2WUHA 1NVPB 3IBMA 5FPUA 5LBCA 2XWJB 4ZZ8A 5LRSA 1US6A 3VD5A 5IWAB 2PHXA 4E4SA 4EN7B 4I50B 4R7CA 4I50A 2JXAA 5FAXA 2V73A 1PX4A 1HB2A 4IUGA 1K33A 1ROPA 1ST8A 4YGDA 1KP3A 5IK8A 2JENA 4CDWA 3ASOC 1XNAA 2WFPA 4FIPC 1C3HA 3JARB 4Q4W3 2EIJB 3T2MA 5FY7A 3VBUC 2D6MA 2BUKA 4HMZA 1WMEA 1DP0A 4CCLA 5HXMA 2RJLA 4YW6A 1P7BA 2OZJA 1S76D 4AAXA 2HEWF 1B06A 5DUXA 2J1VA 1IX9A 3U4SA 4I01A 3KQ4B 4I02A 3RYHA 4LWSA 3FC0A 2ZHMA 2B5UA 3HB3B 1MZFA 1FOD3 4FOYA 3ZYFA 4BQ4A 4XQ4A 1HNWB 2XKOA 1O7FA 1LOCA 5LHIA 2KR2A 4Y3OA 1AJOA 1EUTA 1GOGA 3STZC 2EA7A 2P6JA 1OKOA 3WP6A 5A80A 2QQMA 1AR1B 1W6NA 4ZI7B 1F31A 3FX7A 4PHZA 5FP7A 4GA9A 2XUMA 3OGIB 5DAWA 1GZTA 4UCTA 2HKOA 1VQ7V 3I97A 3AXEA 4HK9A 4M0NA 2N74A 1Q81W 5IYCO 3HWJA 1ZA4A 3GZEA 3RI8A 3H8UA 5JMCA 3ASOB 4C1XA 1NKGA 4FFFA 1FMD3 2QSAA 4IGPA 3ZN6A 5FZLA 3TN92 2I74A 2DYRC 3IM0A 4LO8A 2V5DA 2V7QG 1VRH1 3APBA 4DRVA 2W1QA 2IJKA 4KP4A 2D40A 5FYTA 1H9PA 4HVOA 2VJXA 1AR91 3VBFB 1W8WA 2BTQB 2ZDIA 1DLLA 5K0UC 1H4GA 3TN91 4CA9A 1LJ7A 3HPNA 5F32A 1BKZA 5FYUA 5DUVA 2Y0PA 2B42B 1ZZBA 3K0GA 5A3WA 3STLC 1O4TA 4JI3O 1W2BU 1QVGU 3AP4A 5JJEB 4DNYA 3MIHA 5IY5C 1V9U1 5B2GB 1XHZA 3U07A 2HWE3 2VMCA 2WWWA 2WLJA 4XYXA 5HCBA 4W6WA 2CV6A 3ZS8C 3ETEA 1A3KA 2QTSA 5DQ0A 1WUVA 3AVSA 3O0VA 5IJ0A 4KWKA 1RITA 4IE7A 4F4LA 4GWJA 3AC0A 1W0JG 1BQZA 1SS3A 3VN4A 4QU2A 1SDWA 1SDDB 4MS2A 2GNMA 3S5QA 2D6PA 2XAHA 1YJKA 1L0LH 3TRSB 1AX0A 4AHYA 2C24A 2YS8A 5IWFA 3USUA 3F7YC 4V1PA 3EFFK 3VZOA 3ZXLA 4F3JA 5JQGB 4M00A 3R66A 1QJFA 1RUG2 4NROA 3H1MA 2K46A 1UPSA 3D0SA 2ZMKA 1Y76B 4ORFA 2RNBA 3HAGA 5L3FA 2JGUA 2DMXA 1Z2GA 3ENRA 4ASKA 3DF0A 3PUSA 3ZXKA 5A7QA 1Y4WA 4XDQA 1VF7A 2WT0A 3NJYA 2ZEYA 1I5XA 3D0JA 4IGQA 5A7NA 2YFZA 1S5JA 1HJGA 1QF3A 1DYKA 1KDKA 4ZHNA 1DCSA 4YNIA 3U11A 3MLJA 5BNOC 1U0AA 2VR4A 4O9EA 1D2DA 3R4UA 1LGCA 2A75A 1HRV2 2C9AA 5FPBA 3OBAA 2DBNA 5EZWA 3WU2Z 2VQUA 1H6XA 1G6NA 5FMOS 1EAH2 1RMU3 3APQA 1N33O 4CBCA 5T5JA 5IYZB 3WNPA 1I08A 4X1KA 4XDOA 5JUVA 2EXJA 4IIJB 3H8OA 4RAIA 3LSUA 1Q8QA 1GMMA 2RMU1 2R042 3HKDA 4XPVA 3OOXA 3BI3A 1PD3A 1BQPA 2WC2A 1D0HA 4P02B 4QPIA 2XHNA 4RFRB 4AGGA 4IV1A 2PAEA 5FY8A 2DCYA 1NT2B 2UURA 5B4NA 3HKCA 4L9BA 5BNPC 1H8EG 3LDDA 4MSWC 4YW1A 2YYOA 1Z5WA 1SQXH 3BYWA 3SJBC 3RMXA 1VR3A 1WWYA 2P06A 2D6NA 2NN4A 4HVQA 1EN6A 2P5BA 1W6QA 3NV3A 1QXRA 1NOVA 3OMNB 4E4HA 1JU3A 2ITCC 5C4WB 1IQAA 3AK3A 3NV1A 4JI5B 4QPGC 2RDNA 4AR2A 1RUG1 1M4UA 3MPPG 5LP6B 4LFAO 2BOCC 2HP8A 2QZ3A 1ULEA 2Q6AA 1Q8PA 1V6OA 4Q20A 2A3QA 3RGBA 2AZ5A 1WB7A 3UGHA 2ATFA 3H1YA 4JI4O 4CP1A 5JI7A 4GLXA 2CTPA 1AI6A 1UQXA 1XBLA 4XFHA 2D6LX 2EJ7A 2WNOA 2DQ0A 1CAVA 1W2UA 4AQ2A 3OF1A 3MO4A 3VBHC 2UUCO 2W39A 1IS5A 4K9SA 2ZZJA 1HKDA 1F4AA 3ZHTA 3LIHA 4JI2B 2ZAAA 1S0DA 3DC5A 4K21A 1PGL2 1HNXB 2ZT9B 5FY4A 3BCWA 3POFA 4DUZO 1CQ9A 4LKFA 4JI8O 2W2IA 1SBFA 3VBSA 3J7HA 4EZ4A 1V6MA 1XYOA 1PZ7A 1WPBA 2G19A 3BOPA 4DEVA 3K59A 3U14A 2EIKB 1V0AA 4OQ9A 3RYPA 2BZDA 4DUZB 4JKKA 1XBFA 4PJ0Z 2IH1C 1NYWA 4GB31 3ZYBA 1RFYA 2GTAA 1UU6A 1QNYA 1YWKA 4DY5A 4O61A 4ZHQA 3WVJA 1QXJA 5FJKA 3J7NA 5GLWA 1SMVA 4AW7A 5K1PA 4PDMA 3VBBA 5A3OA 1JYXA 4A4AA 2BTOA 3L75H 4QX2A 4LFCO 1RUH1 2G38A 4FFKA 5C8YA 3T4DA 2VOTA 4K8XA 1R082 3VBOC 2AZ0A 1SACA 4GMP0 3FAVA 5DAQA 4MADA 1AR72 5ISLA 1EM1A 5FOBB 2Q8EA 3FUQA 1YZBA 1B6QA 4XC9A 1CN1A 4M01A 4NTWA 4CS4A 5A3TA 2TUNA 5GALA 1NX9A 4BU2A 3MDSA 2W1WA 1CAWB 4FP3A 3E8BA 3VBFC 4W50A 4K7JA 4FM0A 1R1A2 5FXVA 3LOBA 5KX5A 4HETA 4K8RB 2RM23 5FWJA 1AYN1 4C90A 4U3JA 1EAH3 1RMU2 4B08A 2PF4E 1UZVA 1NR1A 3JATA 3LDKA 2PHTA 2EIEA 1W59A 4Z2WA 4YIOA 1LOAA 3DXRB 4BQ1A 5JZGB 5B3SC 4LBJA 4D7SA 1C8M1 1P8JA 2JDPA 2YB7A 2Q67A 2WSUA 5LA6A 4DUYB 1F5FA 3M8LA 2EIJC 4OFGA 1ND3A 4J9ZB 1DZRA 1IBKB 2ORXA 3LDEA 3B9CA 5GLZA 2HEVF 2KA3A 1YI7A 4IYIA 2YEVA 1S0JA 5LXTA 1FATA 1O5UA 4R9CA 4HG6B 1P84F 3ZFFB 2CWMA 5FP9A 3BKZA 2J1AA 4TWKA 2Z79A 3POGA 4JV4A 4FAGA 2X6BA 5CB4B 4XJZA 5IWAO 3KT1A 4XOGA 1I1EA 1RUNA 4GKJO 4PA6A 2FDHA 2OYZA 4WFGA 3HBZA 1S3JA 4CU8A 3OBRA 3I3QA 1TMF2 2ARHA 1OPMA 4GJYA 1JZ5A 1TVKB 1KEXA 2WS93 2PMWB 5E1RA 5FNVA 3C7GA 3AZXA 1VMHA 2VMIA 1Q3EA 4FM2A 3RZLA 2VRZA 2AC1A 2CTQA 5LGNA 3ZMVA 1EAH1 4BDVB 2Y69C 3HD8B 1WBLA 4AVBA 5KHJA 4MXVA 3AX4A 1F23A 3WSOA 4NRMA 3UKVA 1SQGA 3UT5B 1SLCA 1R3JC 3FFQA 2W95A 4IYHA 4A42A 4XDKA 3IGAC 1G1XB 1PMHX 5C93A 5SV5A 2P67A 2XXZA 5JCOC 3B2EE 3LF7A 1XNCA 4OX9O 2FB5A 3KZIZ 4QKNA 4UF0A 3TEYA 2QNKA 3DUIA 3O9OA 2ZIOA 3K5NA 5E8AA 1S2EA 3SH4A 3GCWA 3UNPA 4DV7B 4IE5A 4Y22B 2ZM6O 3LDCA 1RUC3 3J9SA 1V54B 2WQZC 3LB9A 3VBFA 4CCNA 4P00B 3AKQA 1G86A 3L70H 2IU3A 3T30A 4KUMA 5KUMA 2D98A 5C9AC 2BGOA 4CXXA 1ULOA 2OW4A 5F7UA 3BCCH 3AZVA 1O4ZA 4NHXA 4NR1A 3SH5A 2JDKA 1DQ4A 2JEXA 3FB7C 1K12A 2LJ2A 1WJZA 1SC5B 3DL3A 4GXLA 3V0AA 2LROA 2ZEWA 4XUNA 1BGYH 5FO9B 3HN1A 4YFWA 1W9WA 5DZFA 1H38A 1XNBA 1SA0A 1WW5A 4YHHO 5DN6G 5IVEA 3KSCA 2WNVB 1F8VA 2FHRA 1LNQA 3S3XA 2OS2A 2V1DA 1DFQA 3E8GA 3FUOA 2WQ8A 3ZR6A 5LK7B 1VRH3 4KGQA 4J6GA 3KCYA 1KUQA 4BQ5A 1X36A 2RDSA 1SG3A 2VQFB 4KU8A 3SLIA 1OCOC 5LB6A 4UBHA 4BHPA 1QEXA 5C9AA 4JI1B 2HWF1 4UV8A 4HN0A 4F6RA 3B4SA 1QJU3 1DK1A 1PMJX 2E33A 4NXMB 5EV7A 4HZ3A 1SBEA 1NKDA 1I5PA 1Y74B 1PO11 3POIA 2CNAA 4NHLA 4EN9B 2ZX4A 3J7LA 3GB7C 3WG3A 3BA9A 4NKGB 3CMGA 2P3KA 4AVAA 1XJAA 5DDJ1 2UXBB 3T1CA 2VPVA 1XDCA 1ZM1A 4Y1ZA 2OPKA 4WFFA 4XDPA 2M7WA 2VC9A 4RWUA 2XL7A 1WZXA 2QWQB 2I2SA 3RN4A 4FSJA 2HLDG 1RUH2 4QXKA 4RSUA 1CPMA 4MVMA 2GALA 2PI4A 4YGBA 3MW3A 4V2WA 4HKLA 3OGSA 4MVQA 5T55A 5FRAA 4MLOA 3H7YA 4FOQA 4I0BA 4P30A 4CUGA 1HQLA 4E9KA 4DV5B 4RHV2 3JARA 4OUSA 1RM1B 1X9PA 5BXZA 1N1VA 2XLAA 1G8WA 4QPJA 3GXUA 4I9QA 5KXEA 3K77A 1VRH2 5L9BA 4I55A 3CLPA 1ZRFA 4BK4A 3ASNB 5EZYB 2PELA 2XAJA 3KT4A 4Q6GA 5GZGA 3LEKA 2XBO2 1C1LA 2ZABA 3W20A 1LB2A 3WDWA 1AJNA 3MHSC 2R30A 2GP3A 2F93B 4DV1B 2JX9A 3OR6C 5JLVA 2E51A 3WG2A 3A0RA 2Q0OC 1KMIZ 2AACA 3O1PA 4NAOA 3ZPOA 1CIYA 4E2QA 5FYZA 4X8AA 4CDUA 1QKQA 1SPPA 1RUJ3 1CVNA 1BK1A 1W99A 2O8OA 3ZSEA 3W7XA 2MEV1 4YY3O 1LOBA 4K8FA 3Q9OA 4OI2A 3PMSA 2AH2A 4GB33 1KYOF 2JDYA 4DINB 5C8WA 1VARA 4CDXB 3ZKUA 4HSLA 1PO23 2QQKA 3C3TA 5ITZB 1VIBA 4H33A 4AFBA 3K03A 3MYXA 5B1AB 2YIBD 2NNUA 1RHI1 4GX0A 3PTRB 4D6RA 4DPNA 4O9GA 4GKYA 5KAIZ 1GRJA 3SCFA 3IDCB 2ZGKA 3VBHB 4AQSA 2PHFA 1O3RA 1MS3A 3LNMB 2Y60A 4GCZA 1DF5A 5EQUA 4NXMO 5T5PA 1B35B 2BVVA 2WAOA 1W9FA 4G2KA 3VOUA 2CH7B 1QDCA 2Z3YA 3H1LH 4IESA 1PL4A 3WD5A 3VBOA 1LNSA 3M3CA 4DXSA 2BRTA 3ZXGA 1AL0G 4WVMB 4Q8LA 1JYCA 3AG1B 3ZFGC 3TXSA 1Q82W 4FO9A 2ITDC 3PU8A 4AVCA 3W9AA 1YFYA 1OHFA 2QWPB 2WKKA 1ASJ3 4QX8A 3EHBB 2VAUA 1WMFA 3NNGA 1NQTA 1R3LC 3H1JH 3N9MA 2WLLB 3AL6A 4BXFA 4W4KA 1W04A 1DGWA 3UT0A 3CCJV 2YI9A 2XBO1 4CH6A 4LE4A 4N53C 2BNNA 1H8TC 1J83A 1DQ6A 4Z92B 3CS5A 2WWJA 1HP8A 1YJNV 2OUHA 1JOBA 1ZUQA 5IVVA 3MIEA 2JE7A 3DECA 1LOFA 4EB6A 5LGUA 4OULA 3TWIA 3R05A 1GP6A 4UVBA 1F4MA 3I2IA 5C70A 4B3TB 1Q8SA 3D4KA 2JIGA 4LUKA 2IJJA 5EYPB 3D3AA 1YC61 2GH2A 4YZ5A 3RYFA 4XURA 1YIJV 3N4MA 2YU2A 4W8JA 5BPXA 3JB8A 4A41A 1M4WA 4JI5O 4FAHA 1UZZA 1WBFA 3MLKA 4QKDA 4Y5SA 4RS5B 1JCHA 2VNGA 4L11A 2UU8A 3GALA 3VQXA 4UF0B 1V6IA 1GFF2 4L99A 3WDTA 5BMVA 4RD7A 3C7OA 2H94A 3KV5A 4TXWA 2ZTNA 4ISRA 5C4WC 4TT3G 5F5QA 3UESA 2VBBA 2ZCWA 1PO22 3VKFC 4MTOA 3ECQA 3JXSA 3HQRA 2P5OA 5GKAC 3WG7B 4NTYA 4Y22A 2HWB2 1TGOA 1HB1A 2V4VA 5FOJB 3OEHG 2X5IC 2BU9A 1W8FA 4DRXB 2WN2A 1UKRA 4PLNA 5ABJB 4CC5A 2QKDA 1TVKA 1JYWA 1C5IA 1JZ3A 3WF3A 5FYYA 2IH3C 1MZ5A 2E6VA 3PU3A 5FZIA 1M1KW 3K9AA 1DHKB 1Z7S2 4DR3O 5GLVA 4X1YB 2GDFA 4UB6Z 5E16A 1AR62 3ZFFA 1NUKA 5CBGA 5EJ1B 1AX1A 4Y26A 2ORZA 2EBOA 4BK5A 1CD3G 3FFZA 2VY0A 5IVCA 3QOPA 2Q9LA 1WCQA 4AYUA 2YEVB 3KVAA 3J4UH 3POYA 4MOAA 5LATA 4UFIA 4PI0A 5F9TA 3AFKA 4LO7A 1WMXA 2PYTA 1GQHA 1LRHA 4P9GA 2RR13 2EXHA 4WVVA 4NVPA 5FYCA 4QHOA 2H3OA 2XG3A 4WVZA 4HANA 4C0HA 1QU7A 2OTJV 3SPGA 2VW2A 4CXWA 3D5OA 5CBFA 5I93A 2UY9A 4IL7A 4TOIA 3OW2U 4M4RA 1NJIW 3VBUA 2ENRA 4BW9A 3EQEA 1R1ZA 2IJHA 5LWBA 2KQXA 1K5MA 1OH4A 1PGW1 5FKBA 1Y43B 4P9YA 5D8AA 5T5LA 1EP0A 4BR6A 2QBXA 4RL7A 2ARXA 4TUYA 3CCEV 1S5HC 2ZE6A 2AGSA 2VW1A 3G6JB 5EC2C 4E2GA 3K04A 2AGAA 5L73A 1R1BA 2R9IA 2XH6A 2ET1A 1EV13 2XNDG 3ZYHA 1BQ0A 1QJU2 4XW3A 1QLEB 4META 4HXCA 2PA7A 5DABA 1RPRA 4DV7O 4ASUG 1M5IA 2E76B 3B8MA 5A6XA 2J42A 4FQ4A 2J22A 1V54C 2QEXV 2ZGMA 3IC9A 1LHOA 4QAWA 4LR4A 1UYYA 1JYNA 2D5HA 2QQOA 5A1FA 3H1IH 1OSGA 3A0BZ 3MFAA 1G9AA 3HPLC 5EJZB 3N2GA 1XNQO 2WA4A 3MW2A 4BWAA 1VQPV 2D97A 1D4VB 1HXS3 2Q30A 4OHXA 1H0BA 2ZGOA 1QH6A 1PV0A 4F8AA 1SESA 3GWOA 1RJ8A 4B4RA 2F4LA 1CAVB 2PYLA 3BB6A 4P9IA 1KXGA 1RUJ2 1XNKA 4K3AA 4XF9A 1GZCA 4MVZA 2B45X 1N1YA 5FY5A 1XPWA 4O4LA 1OKQA 4CEWB 3Q4HB 1ZBE2 4YW7A 1Y67A 2R72A 3B40A 3U10A 3V0BA 2SBAA 1OVSA 2Z69A 1RUF1 5F3EA 2Y64A 2PHWA 1Y9QA 1RUC2 1UWWA 4X8PA 3CMAV 2QE7G 3A0NA 3MUZ1 2O14A 1OUSA 1KKDA 5F3GA 1H1MA 3E6BA 3AFGA 4Q4X3 1SZXA 2R0HA 4LORA 5K0UA 4ZS3A 1K3EA 3K5OA 2VVEA 4OMCA 1XMOB 1RUF2 4QPKA 1G9BA 3GM8A 4J1XA 4UCVA 2VCBA 3BRCA 3BPZA 3AMQA 3AYEA 4XJAA 2XWBB 3E5UA 1RUD1 1VLNA 3T0AA 3VZMA 1XMOO 2FMDA 3BGAA 1HWYA 3GHMA 4IIJA 5A6YA 1LR5A 5JZGC 1VBB3 4ES9A 3INAA 1JZ2A 1YI2V 3RQ0A 1VAKA 3UKMA 1DTOA 1NCQB 2EAAA 4FPPA 1EZVH 3SYCA 2PHRA 3FJSA 4XFIA 1K5SA 3KQRA 1TME2 1ZRIA 5FPRA 4DR4B 1RUD2 3NNLA 4DXTA 2RVAA 5FV3A 2WL1A 3ACGA 2YXLA 1OUXA 2QUOA 2OQ6A 1N1SA 2JDAA 3OPZA 2JWPA 2Z5WA 3AP6A 4XF3A 4TYSA 4N21A 2DOSA 4DR4O 1S0FA 4LBQD 2JDMA 1W8HA 4RO2A 3CZUA 1W06A 1VJ2A 4IV1B 1J3QA 3JQWA 3WQ1A 4O4LB 1PK6C 2FZ2A 1WCSA 1DGLA 2RS31 1R092 2P2KA 3ZVXA 1M93A 1GUIA 1W05A 1LEMA 1HV1A 3POWA 3K57A 1SZBA 3WCSA 1ULGA 5IYZA 3TEWA 2Y33A 4FPOB 2E3CA 2R073 2P3IA 3G71V 1REFA 3GZUC 1ZL8A 1VMGA 3SYPA 5C8CC 5C3OA 2CYFA 3N2GB 3A7QA 2A6YA 3THTA 3BALA 4G9SB 4WM8B 1RUC1 3DC6A 4J7JA 2NLJC 4CCCA 2JS3A 5GONB 4MVTA 4WFBV 2Q5TA 2XTAA 4LHLA 3DTUB 4FPFA 4JASA 3ZHSA 3SJAC 4K3UA 1LESA 3LEMA 2OTLV 4YW3A 1L8DA 1KQRA 4BH9A 4JV5O 4BQWA 1BCCH 4QNHB 1S5LZ 3ZMSA 3AG1C 3ZFGB 4DO0A 2EF6A 3M7MX 5ABJA 3O1UA 5C5UA 1BEV2 1VBC3 2CSGA 4O2BA 4D0QA 4I0XB 1SLAA 1JA8A 4XAEA 1WAZA 3UGFA 2IXIA 1J59A 4R8CA 4JYAO 3W21A 4XQDA 1N33B 3ZN0A 4HOOA 2IXLA 1IS3A 4EN0A 4CEYC 4DRRA 1GNHA 4IEXA 4U36A 3WY6A 1UN1A 1M56B 2KM2A 3SC7X 4BQXA 3CCVV 1GWLA 1WA8B 4QPGB 5FQ0B 3RMYA 4EB6B 2EIBA 4AI3A 3JD4A 3TK1A 3C7FA 4O4HB 3VBUB 4R50A 3VBRB 1HN0A 1IPKA 5I8YA 4AI9A 3SCHA 1I6XA 4D7YA 4DV0O 1H9WA 2VOWA 4PBOA 5DAPA 1TUBB 3UETA 1GTOA 1H6YA 1JUHA 3SPJA 1NVPD 3IKWA 4DYLA 1XYNA 1LAJA 1IPSA 1OFSA 3KGLA 5EIBC 3SHRA 2BNMA 1JYTA 1CPYA 3AMNA 4QKBA 4WVMA 1AJPA 4INDA 4JDOA 5JOXA 4JI1O 4Q4Y3 2YDEA 5E6HA 1NA1A 1KECA 4X20B 1X7NA 4PT6A 5KBFA 3A0HZ 1AXYA 4HZFA 3VV1A 1UOGA 4QMAA 2A7AA 3RRDA 3BHPA 2PTMA 3ZXJA 4X20A 3IJ4A 4Y5Z0 3ZN6B 1HW7A 3PIJA 4TV8B 3ZFFC 1GN6A 1GAXA 1DGRN 3WW1A 3MAQA 1LHUA 1QHTA 3I7DA 5IYYA 4Q4W1 2C0ZA 5FREA 3IN9A 1R64A 1IPJA 4LCUC 1KC8W 3ACFA 4LWSB 2SLIA 3N2KB 4CDQA 4HNAB 1L1FA 1YFXA 3EBRA 3LIGA 2E74B 1VQKV 3GJAA 1JVMA 3D36C 5JXIA 1XNQB 4BAYA 4BA6A 4PJYA 1CAXB 4YZ2A 3IT8A 3OEAA 5I8SA 3TCUA 3J7MA 5ANQA 3UM7A 3FYEB 4EQVA 2RDCA 3RG0A 1MZ6A 1W8OA 1HB4A 3O1VA 1RIRA 2VU9A 1EV11 1MS8A 1COV3 1QWRA 3JZVA 4L8QA 3G7DA 5CFCC 1AP5A 2JEMA 1UNBA 3MDPA 4DO2A 3QF7A 5KAFZ 1UL9A 2JJ1G 4CDXA 5FPLA 1IKPA 5DMYA 1F7YA 3AG3B 1ZA7A 3J26N 2D6KA 1XU2A 4M4PA 3TNQA 4MSVA 2WSSG 1YJ9V 1GM8A 4RQPA 4X6QB 4NPMA 1UMZA 4N43A 2DFBA 2AR6A 5L3BA 4AE2A 1THZA 4HN1A 1OCCC 3ZFGA 3LFMA 2RDQA 4Z2AA 2FBEA 5JOYA 4LFBO 3MLLA 3UO2A 4OQ8A 1WP7A 3ZLIA 3WF2A 2BP6A 1HNWO 5F5CA 1H8TB 2XJQA 3JD1A 3ATGA 1X82A 3ABZA 3USSA 4N7IA 2NPIA 1ZYBA 2UXBO 4NTXA 3JBG3 3WNOA 2Y8KA 3RZJA 3IDEA 3FD9A 2XUEA 4R6ZA 3RWRD 1S0EA 3VBOB 2VQ0A 2NN8A 2H0BA 2O57A 3ELNA 4PDLA 3VD7A 2DE0X 1FJGB 1T6GC 4DR2B 1AR81 4JI6O 5GZCA 1AL22 1E57A 3T2QA 1W0PA 4LNUB 1IBKO 1LOFC 4XZUG 3ZFEA 4CDXC 3BAAA 4MGQA 1LUVA 4PD4F 2ETNA 3AP5A 4DUVA 5FZ4A 5FZ8A 1Q5OA 2Y6FA 3X29B 3RI9A 5AVPA 1FJGO 4CPBA 2VZQA 1KD1W 4MO3M 5FIXA 3ZM8A 5J96B 5EIYB 1CPNA 4Q27A 2BERA 3LSQA 1M9NA 5BNNC 3EMRA 1IG3A 1SQPH 3H0OA 3ABKB 3HQUA 1T6BX 1AYM2 1QJX2 2H8PC 2RCVA 3AMHA 4H3WA 2GUZA 3ST7A 2EXKA 4BB3A 5HBAA 3CE2A 2GN3A 2D3OW 3WQBA 3ORJA 4GAZA 1POV0 1CGPA 2DW4A 3OUIA 1U5ZA 1R081 3CRCA 4AOCA 3EYPA 4R9AA 4D6QA 5H9SA 3JD73 5IHRA 3Q8CA 1N4CA 5GTIZ 4X64B 5FPXA 4P9OA 3UQ8A 1VBE2 3X2QB 3P30A 4L2NA 3WUDA 1D2QA 2X5IA 4BQYA 2VGDA 1GNYA 4GX1A 1MG1A 3OD0A 1R1A1 2VZ3A 4DR7B 2CAVA 2W68A 4KQ7A 5EK0A 1PIV1 5AC93 5FK8A 1RVF3 3BTZA 1AI4A 4RQPC 4BWOA 5EYXA 3VZNA 2B5HA 3AZYA 4Q0PA 5F3IA 3Q8AA 1E5SA 4TV9A 3FB8C 2D7FA 1PX3A 4TZDA 1MQTC 4CDQC 2KB1A 2ZINA 4JV5B 1K5JA 2EAKA 5BR8O 4HT1T 2ZKOA 1DU3D 2FL4A 5L19A 2E5LB 4XCBA 2Z0AA 1RUE3 4JTCB 4BQ2A 4Z1VA 4MW8A 4B3MO 1WA8A 4QPGA 5FQ0A 3RZMA 4O7XA 1K8AW 3T1HB 3NO8A 2NYYA 2A7WA 2AW9A 1FI2A 3LSEA 3OJBA 5FZ7A 2JG9B 4QKFA 3MZHA 1O59A 2JVDA 3AYAA 1DGRA 4B3MB 4JTNA 5AC92 2FCTA 4GX5A 1AI7A 2WA3A 2VQEO 3BA8A 2R7EB 4PA4A 3IDBB 1ZREA 4HPKA 4Q4W2 3FX3A 5KHHA 1AYM1 1QJX1 1QLEC 2HWB1 5IDJA 2WFF1 1K5QA 3VBRA 4MVOA 1LKNA 4DXRA 2VNOA 5L3CA 2Y0IA 2HWE1 1YDXA 5KHKA 2P6CA 1DQ0A 3UV9A 2R9AA 1MOFA 2VQTA 3HNMA 4J7KA 2EIDA 4N8MA 4UVCA 2ZGPA 1UD1A 4A6SA 1VQLV 4YZ4A 1W0KG 1PVC3 4I2OA 3GDBA 2LTNA 4UB8Z 2V4DA 5DPNA 2X6CA 4P5YA 3WF1A 2BNOA 4DV2B 3CRQA 1GBGA 1RGSA 3E8FA 3WDUA 4EJRA 1GWMA 2EICA 1M57C 2Q69A 3RW0A 4I0XA 2IXCA 2HWD3 4ISQA 4P9JA 4Q4X2 2PAMA 3SKVA 1MS1A 3FB5C 4X65O 3OPTA 1COWG 2RS12 4AEDA 1UXXX 3WB0A 5ABJC 2D3RA 2ZOEB 3K9SA 1FXKA 3OGJA 3HIFA 2A79B 1W3VA 4LNVA 4YM2A 1Y4MA 4UUJC 3SDLA 1AR83 2HHHO 1XE7A 1UMHA 2OCCB 5IAVA 3E6DA 3HKBA 1N3QA 4WM8A 1YF2A 2DYCA 2DTYA 5KC5A 1JFFA 1IS6A 3CRAA 5FZ0A 2JIJA 5IAXA 2ZD9A 4AHZA 1PGW2 1GKBA 1GH6A 4DEQA 3JATB 4B7EA 1HW5A 1K4CC 3KGZA 3JSLA 3PLQA 3QO7A 3P6BA 3AG4B 2LQTA 1PK6A 2FMLA 1W6MA 5E88A 3HN3A 2WS92 4OPAA 3KWVA 2J1RA 2DYSB 4GQ7A 1WGPA 2PQQA 4SBVA 5CA0B 4ABMA 3WFVA 3J80N 1NZIA 3CCUV 3BTXA 1OOPC 1DQ1A 1FYUA 3WW4A 2PLV3 1S0BA 1E79G 2ZHNA 3T0BA 3QTCA 3M7AA 1NZCA 2DJVA 4QGPA 4BCUA 3CEWA 2Y38A 4E2SA 2BFUS 2ZX1A 4LF9B 1LGNA 1AXZA 1NCRC 3SGIA 4ZOLA 4E4DX 1UXZA 4LF6B 4UI9L 3ZXFA 3ZHRA 2XVGA 2JG8C 1QQCA 4NHYA 1MR5A 3MHHC 4Y33A 2J1SA 2GSMB 5FO8B 3F7VC 3A23A 1GR3A 3ZSKA 4DRXA 5FY9A 2P7TC 2R043 2BYVE 3A0KA 1Z78A 3O12A 4X9QA 4PDVA 3RVHA 1XNRO 2VZUA 3O1SA 4MTXA 1VBE1 5CFDB 1UU5A 5KHIA 1QIQA 2A3YA 5B1NA 2JG8A 4XEZA 2GC1A 1SBDA 1OOPA 5F6KA 3H3ZA 2Z5UA 1FFXB 4YG6A 3L73H 4U3JB 5FP4A 4TSFG 2NM1A 1FPOA 2DWDC 1K4DC 2F1MA 2YPDA 2M6YA 3LE0A 5A7PA 4IDZA 1D4M3 4X65B 5C8CB 1NE4A 4FLUA 2W91A 1HNZB 2VOXA 3W58A 3K79A 4J11A 4LBMA 3V0BB 3ZYJB 4RR3B 4QDQA 1ODNA 5DECA 1ZBE3 3IC7A 1IHMA 4A7KA 1Q8IA 4L92A 3L72H 2ILMA 5J98B 4UXAA 5C8YB 3SEEA 4C0BA 3ZRWA 4JI7O 3JQXA 4FM1A 1SKVA 3B8NA 1GOFA 4Y1XA 2E26A 1BCXA 4GULA 4CP9B 2JECA 3K08A 3HEIA 4LA2A 3JAKA 1ASJ1 2B8MA 3K3OA 1IDSA 1OVPA 1OA2A 3RYIA 3K58A 3HNYM 2R1BA 3PNAA 4AG4A 3OM3B 1G4YB 3TGUH 4WVWA 2UXDB 1T2XA 3ES4A 4RHV3 5L3GA 2IWGB 2LO1A 5FR3A 1FPN1 1EZJA 4LO4B 2WWSA 2HVJC 4R9DA 4LFBB 3JUUA 1W6PB 4QM9A 1F2NA 2D6OX 3CIHA 3GZAA 5KC6A 5FZCA 2WFF2 1RUH3 2RJZA 1MS0A 2QQPA 2P4KA 1GN4A 2JGDB 1MACA 1JI6A 3HBKA 1W6MB 2W1SA 3VHRA 2X5IB 4ZOLB 3AKTA 3WG4A 2CGNA 2YIDA 4BJ0A 1JS9A 3CCSV 3HR9A 2VMHA 4GKXA 3EXUA 3LGRA 3GZTB 4BMEA 4NPRA 5BNQA 2CK3G 4AI1A 1P4RA 4NXNO 2IC1A 5IJRA 2DTWA 2WINB 1BEV3 1VBC2 2I45A 5B5EZ 3LSSA 5IVJA 3SH3A 3CZJA 4QX3A 4EN6B 4QM8A 1RUE2 4HK8A 3VDCA 2XB6C 3CCRV 1OHHG 5I0UA 1S0GA 2X09A 1R6KA 4IQPA 3V65A 3L9DA 1PVXA 1MSDA 1VQ6V 5EHDA 5BNOA 5LL6Y 4XDLA 2BGPA 4QPWA 1SPPB 1KKCA 2DCTA 3N7JA 4CDUB 2BDRA 4ZXKA 4FPEA 4DUYO 4X1YA 1AROP 3ABMC 1QJY1 4X1IA 3RJRA 2L6LA 3QVNA 1CR7A 2LUWA 3WDXA 3FLPA 2XL9A
chains in the Genus database with same CATH topology
3ZSEA 2C1FA 2N7GA 2MEV1 1R083 3VDDC 3Q9OA 1LOBA 4K8FA 4OI2A 3PMSA 1QJU1 2AH2A 4GB33 3WT3A 1LU1A 2HJIA 4YM0A 4N43C 5JSPA 4DINB 5C8WA 5GLUA 3AP7A 3U4XA 3TAYA 2ZGNA 4CDXB 1RVF2 4HSLA 1PO23 3ALQA 4AVVA 4M26A 1ND3B 3W59A 1WW7A 5GZEA 4AFBA 4EN8B 1YNAA 3MYXA 2YZ4A 4ASLA 1EPZA 1V6JA 3FE5A 1OIKA 4QGNA 3S7IA 1RHI1 4FPYA 1XNDA 1AR71 1C8M3 2GZWA 2JDZA 1PZ9A 4JRAA 4DPNA 4O9GA 2NZ9A 4XMAA 4GKYA 1SCRA 4CYDA 1KFUL 5CB7A 5GLTA 2DUPA 4RGGA 3SCFA 3BOWA 2NMNA 3M70A 3MF9A 4NN0A 3IDCB 2ZGKA 3VBHB 4AQSA 2PHFA 1O3RA 1MS3A 3D8CA 1X8MA 2RR11 3KS7A 4JTOA 4BGMA 5T5PA 1B35B 1BBT1 1H2KA 2BVVA 2VXRA 2Q0AA 3PJYA 4L97A 1QDCA 2K0GA 5JCTA 1F9KA 4IESA 4W65A 4XTPA 1APNA 2WT2A 4JCKA 3WUCA 3WD5A 1H4HA 3VBOA 1HRI3 2ZGQA 3M3CA 1VBA2 1PHMA 4AVSA 1IOAA 4IV3A 2VNRA 3ZXGA 1ULFA 1AL0G 4WVMB 1AYN2 4Q8LA 3S0MA 1JYCA 3ZFGC 1AR61 1POV3 5IT6A 4FO9A 5CG9A 4K20A 4AVCA 3OY8A 5L7OB 1AR93 1YFYA 3W9AA 1RMU1 2PLV2 1OHFA 4QQ2A 1QJY3 2WKKA 1ASJ3 1UCXA 2WBPA 1VBD3 1QQP1 2OIIA 4R8HA 4F83A 1JXNA 1W0OA 2VMGA 1UZYA 1S2KA 5FFOC 3ZDSA 3K48A 1DF0A 1WMFA 4AFCA 4KG0A 4HKWA 1JOJA 1YCIA 1LODA 1GSLA 1WLCA 4MGYE 3M3EA 5IUQA 2G9FA 1PNFA 4I0WB 1DGWA 2A5ZA 4Q0SA 1Z0HA 4K1ZA 3ZYRA 3U0ZA 4LUMA 3RS6A 2LALA 2XBO1 1R091 4H7LA 1AX2A 4LE4A 4N53C 3WQ7A 3NW4A 2BNNA 2ZHLA 4D3WA 1H8TC 5CNAA 1DQ6A 2ZAHA 4Z92B 5BV6A 4LEJA 2FQPA 1UIJA 4P9LA 3WOGA 2OUHA 1C28A 4ONUA 3MIEA 5FLJA 2JE7A 5FPZA 3WXPA 1LOFA 1GZWB 4XFFA 4OULA 3TWIA 3UK9A 3R05A 1OA3A 1ZX5A 1LULA 1Q8SA 2XHKA 3FLTA 3D4KA 2DUQA 2WNVA 4LUKA 4XBLA 1G7YA 4XIKA 2GH2A 4YZ5A 2NMOA 1JH5A 3ACLA 3N4MA 4AFDA 2CAUA 5FCCA 5K0UB 4QHBA 2GC0A 5BPXA 1KD7A 1UX6A 3JB8A 1M4WA 4FAHA 2XBO3 4IXLA 3M3IA 1UZZA 1WBFA 3MLKA 3AZWA 3SMHA 2ZBJA 3QLQA 3LA7A 3NWKA 5J36A 1LU2A 4RS5B 2X8KA 4L11A 2VNGA 4RA0A 4DMIA 2DU1A 5J09A 2RE9A 2VUJA 3RDIA 2QFEA 2UU8A 3GALA 5L7OC 1V6IA 5FLIA 1WW6A 4JRLA 1GFF2 3JCIA 4L99A 3WDTA 1ENSA 2ZGLA 1AXKA 4H14A 4F7ZA 1JUIA 1O91A 4RD7A 3MIDA 4AQTA 1YIFA 3ILFA 1N3OA 1XRUA 4QQHA 4PDWC 3T1LA 1DZTA 4M3CE 2ZTNA 1NCQC 4ISRA 3I4IA 1J1TA 1LHVA 5C4WC 4YSFA 3I2DA 4XTMA 3WR0A 5CADA 5F5QA 3TYJA 2UY8A 3ZIWA 2ZCWA 1PO22 3VKFC 1SEFA 3ECQA 1QXPA 4A7ZA 1UKGA 5GKAC 4QPIB 1OQDA 4Y22A 2HWB2 3NAPB 5FOJB 5GZDA 1J3RA 4Q4Y2 1PO12 1ZZ7A 3QCWA 2X5IC 1C1FA 2NQYA 3BTAA 1DG6A 2Q8OA 2UWCA 1C57A 1A8MA 3NJZA 3TN93 1UKRA 4PLNA 5JPMB 4YZ3A 3ILRA 5ABJB 2QKDA 2E7TA 1Z7S3 5CFDC 5ACA2 1C5IA