2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
4K7JA 4ARYA 1UWWA 5I0DA 2WAOA 3DC7A 5A4AA 2DCKA 2W87A 3DECA 3ACGA 4OMCA 3C7EA 4JKOA 4QX2A 4GZ9A 2E33A 3I97A 5JXHA 2ORZA 1JU3A 1WABA 1TVGA 3GGLA 5C7GA 2QBXA 3UNPA 4MADA 2JD9A 1JZ7A 2XOMA 3T2PA 4AG4A 1JI6A 4XUNA 3DYMA 1DP0A 1JZ8A 3UETA 2Z4FA 3WQBA 2VM9A 4HF7A 3WNOA 1PX3A 4GWJA 2VZ1A 2OKXA 3T09A 1F4HA 2J22A 3MBWA 3NRUA 2VC9A 4TX1A 2J1UA 4MOAA 3I2GA 3HNMA 4M4RA 3OEAA 4JHZA 3THDA 3LEIA 1EUUA 3W5MA 3WF2A 3PT5A 2VZUA 4BK4A 3WF1A 3GDBA 4K9SA 2BZDA 2WDBA 1WKYA 2W94A 5IFPA 1K7CA 3CKHA 1VJGA 1UY4A 3HNYM 1IQDC 4XUPA 2J1RA 2Y8KA 2YB7A 1UY1A 4BXSV 4QDQA 4P5YA 1SG3A 3OGSA 4W4ZA 4PPYA 2WN3A 1XC6A 4QDRA 1CX1A 1UMIA 4XUOA 4JKLA 4Q7QA 4UAPA 4A44A 4KWUA 1BWRA 4JGGA 1UYXA 1P8JA 3K4ZA 1TG7A 2HSJA 3OBAA 3EYPA 4OZOA 4UOJA 1GUIA 3CZUA 1R64A 4OUEA 2EIDA 5LA1A 1ULOA 2J1TA 3HP4A 2HLEA 2QQIA 1K45A 1HN1A 3WNMA 1IVNA 5F7UA 2BGPA 5C71A 3LE0A 1GOGA 1JU4A 2EIBA 4JKMA 4MGSA 2Y6HA 5DN2A 1CIYA 1GMMA 3HN3A 3NNGA 2Y6JA 1MPXA 1ESCA 2X09A 2WYSA 4QX0A 4A6OA 3T0BA 2CDPA 3IDAA 1L7RA 1KEXA 4DXRA 3VD9A 3CZJA 2VZ3A 1Z8HA 3MO4A 2RJ2A 2VPTA 2W91A 2WN2A 4RSHA 3K4AA 4A41A 1J83A 2R7EB 1NAEA 5B4XA 5BN1A 1UXZA 2V5DA 4XZUG 1PMJX 3K77A 3HPNA 5HOEA 1JZ3A 1CZVA 2HYXA 1JHJA 3DCIA 3LEKA 2JE8A 3LPFA 2DCJA 3BN6A 2E32A 3SLRA 5B4NA 4S1PA 4ZZ8A 1JYXA 1OD3A 2VO5A 4A3ZA 5JXGA 3THCA 5DMYA 2QQKA 4KMQA 3SEPA 1BWPA 4E8DA 1SDDB 1J84A 2WABA 1GNYA 5B5SA 3SKJE 4M8KA 4PF1A 1UXXX 3HEIA 2KD7A 3ACHA 4K40A 2QQLA 1WCQA 3K46A 1W99A 3DT8A 4L0PA 2PQSA 2VZOA 4LHSA 1U8UA 4QPWA 3P94A 1DLCA 4ZZ5A 4DUWA 4JJ4A 4ZY9A 2WZEA 3VD3A 1JRLA 3T0DA 1W9TA 3NJVA 3MV01 2CDOA 3OG2A 4QB6A 3CQOA 3DYPA 2Y6KA 4Q9AA 3I2JA 4A45A 1F4AA 4K3UA 4HYQA 3I2IA 4DUVA 2W1WA 4AAXA 2V72A 4JKKA 4W50A 3T2QA 4YPJA 2X10A 2B9VA 1UYYA 2VQTA 3DYOA 4XUQA 1UMHA 4MO3M 4CU8A 2V4VA 3WSOA 5C70A 3SEEA 2VZSA 3EB7A 1W8OA 4D0QA 4OMDA 1XNAA 3MUZ1 2J1EA 2WO2A 5EIYB 4QB2A 5CYYA 3UESA 3DT9A 2YG0A 2J1VA 4CUCA 4IYJA 3CIHA 1NKGA 2W1SA 3OGVA 4JHLA 2W46A 4BDVB 4BJ0A 2ZXQA 5LCWL 3HJRA 1US3A 4KI5M 3WNNA 5JD3A 1W8NA 5JXJA 3ECQA 3I2KA 3NQHA 4QDSA 2VZPA 1JYNA 5IJRA 1PP4A 1OT5A 2J7MA 4XUTA 3ETPA 1O8PA 1DEXA 3HNBM 3GXUA 3VD5A 3A7QA 3LPGA 2Q0QA 3MV11 4JX0A 3T2OA 2VZRA 3WNLA 2E26A 2XONA 3I3BA 5CZKA 5LA0A 4I8IA 4W8JA 4CUAA 2E31A 2VCCA 3DT6A 3C7OA 3E1F1 4A4AA 3P1IA 2JDAA 1JZ4A 1K42A 3I2FA 2BGOA 3W7VA 2Q0SA 5DQ0A 4DXTA 1LNSA 2W9XA 2W92A 1PMHX 3A23A 4UI9L 1GOFA 2DDUA 2WO3A 2VCBA 5IHRA 4LQRA 3WNPA 2C4XA 1JZ2A 4LKSA 4MGQA 1JZ6A 4P02B 2VZQA 5J1XA 1CZTA 2WBKA 2QQJA 2VOTA 2EICA 2W1UA 3I2HA 3VDBA 1GOHA 3OB8A 3WNKA 3RJTA 2YC2A 2W5FA 2B4KA 2YFZA 5G05L 1UY2A 4QB1A 4QX3A 1KGYA 1US2A 4P00B 3VD4A 2ORXA 2VMFA 1UZ0A 4CVUA 4XURA 5JR2A 3OEBA 3K75B 1JYVA 3LQCA 2BERA 2JKXA 3IB3A 4A42A 1BHGA 1NX9A 2RVAA 1UYZA 1ESEA 2VR4A 2XQXA 2ZEYA 1ESDA 3KVNA 4GWIA 4RYDA 4D8MA 2C9KA 2W1QA 1UX7A 1UY0A 3C1UA 1H6YA 4DXSA 1W9WA 2YFUA 2BBAA 1VYHA 2LS6A 5JXIA 2VMEA 1SHWB 3I3EA 2VJXA 2WAAA 2VQUA 4E8CA 2WZ8A 1BWQA 2O14A 2VL4A 1OH4A 5A1AA 3FHAA 1V2GA 4RN5A 4PQQA 2VZVA 2W47A 1OF4A 3SKVA 4HG6B 4CU7A 2WUHA 2EIEA 2ID4A 4DEVA 1O59A 2Y64A 3IAQA 5LA2A 2WQ8A 3K4DA 2J1AA 3GM8A 3MUY1 1NUKA 1J00A 3ACFA 1ULPA 3P6BA 4OAPA 2Y6LA 1EUTA 3VD7A 4H08A 1K3IA 3U37A 4TTGA 2APJA 1UY3A 4XVHA 3FN9A 2X05A 1XNTA 4JJ6A 1JZ5A 1H6XA 2WO1A 3C8XA 4QX1A 4Z2AA 5JMOA 3T08A 3MILA 2QQNA 5IYYA 3I3DA 1GQPA 4DUXA 1O8SA 1ZMBA 2QQMA 1XPWA 1OF3A 1T2XA 1YQ2A 3CDZB 1GU3A 4LPLA 1PX4A 2ZEXA 2YC4A 4CU9A 3VDCA 4OAOA 3FL7A 3ABZA 5G04L 4ET7A 3J7HA 1CZSA 3WF3A 1W0NA 3PUIA 5HXMA 2QQOA 3C7FA 1W9SA 2J1SA 3IAPA 3JXSA 5EJ1B 4FI9A 1YZFA 1JYWA 5CD9A 5HPOA 2VMDA 4TXWA 3PUHA 1DYOA 3C7HA 2XHNA 4BK5A 2C26A 2ZEWA 5FUIA 4DEQA 2VMCA 3WEZA 3T0AA 4PT6A 1FXWA 3VDAA 2Y6GA 4M4PA 3FHQA 2LW8A 1K12A 4ZXEA 2W3JA 3A21A 3C7GA 3W5NA 2L9LA 4CUBA 2VZTA 3ACIA 1RYYA 4ARXA 4NRDA 1I5PA 3ZM8A 3CMGA 1ES9A 3BZWA 3BGAA 3WF4A 3NJXA 3LEGA 4IUGA 1D7PM 4RW0A 4P08A 3D3AA 2W95A 2VTFA 1L7QA 1DEOA 4QAWA 4OYUA 2RV9A 3AC0A 2VCAA 3IIIA 5IFTA 3F2ZA 5JUVA 5EJZB 3WF0A 5DPNA 3A22A 4CU6A 2ZEZA 3OGRA 1FXWF 3HOBA
chains in the Genus database with same CATH superfamily
3A6EA 2W87A 2IPOA 1NXQA 1T1JA 3JZIA 3ZH2A 4HX9A 4ZGBA 3CU7A 2BUKA 2Y2UA 2BR3A 5DNUA 2PL3A 1CDZA 2I67A 3GV0A 5FBZA 2OECA 2CGEA 2ZIGA 5KWEA 3BCSA 5EIHA 2GNBA 1I14A 4OCZA 3WL6A 3NBZC 2VJMA 2X1LA 1U02A 2FW8A 5AUPB 4M4RA 3HT1A 3I2OA 1EJ6A 4F84A 4MK4A 5ILOA 2VDQB 3PHIA 2HMYB 3G2NA 1VBD1 3CFYA 4EVIA 4DV2B 4BNUA 5ADVA 1UDWA 1Y3AA 3PJGA 4D3YA 3OD0A 3OJXA 2OCKA 1E2HA 4GM4A 1P0MA 2RIPA 2Z8XA 4JLJA 4P82A 5GALA 4BBPA 3BF7A 2D40A 3W3AA 3GHMA 1ZYBA 4YXFA 3ITKA 1JVBA 4E5KA 4A5OA 4EYSA 3O73A 4UFMA 3O8CA 1B15A 1C0EA 1W6QB 4X00A 2DXIA 3U40A 2I34A 1I51A 1QGOA 4YXWD 2GYYA 4MA5A 1AS0A 2OV1A 4MKRA 2AYYA 2Y1FA 4Q4DA 4J3FA 4TSFA 1SA0B 2CXTA 3H2IA 1PD0A 3PE3A 5HR5A 4UF0B 4XKJA 5SZIA 4Q0UA 1KXGA 1E3QA 1DNPA 4YVWA 2V7VA 1NRIA 4P3NA 3D8BA 2AN9A 2PL1A 1NQOA 1COWD 4YUXA 1RZRD 4OBWA 4Z8YA 3GFRA 5TQJA 3FUVA 3OFKA 2YN0A 1IZZA 1QDEA 3V1TC 3S44A 4XRGA 2C5HA 1TQ5A 5FORA 3ZIUA 1M34B 1QCYA 3N9NA 2CL5A 3QX8A 1NQWA 3GCXA 4CIAA 3WGHA 1Q7TA 2WD8A 2XPJA 3OWXA 1HJFA 1RYEA 2IY8A 1M2OA 1QKJA 1DQ6A 3AUYA 1YMVA 2CEKA 2YASA 4OXYA 4HMPA 3WT3A 1BQEA 4EK9A 1DLIA 3GBGA 3SEEA 2ZJ4A 3WLRA 4OMDA 3O3MB 3HEAA 1GL9B 1U0EA 1WZEA 4XI9A 5C8CC 4FOQA 3GBWA 4HSLA 2XHKA 4CNBA 1CF9A 3QZUA 1Q7EA 4URUR 1WO8A 3O1UA 3A6GA 3D3EA 3WK7A 3PIJA 5A4DA 3QJ5A 5DX0A 4WEQA 1A7JA 1PEAA 1GFZA 1ZOIA 1U63A 1X42A 1TCAA 3DT6A 1GTSA 3THXA 3RC7A 3B1ZA 3EFHA 4GFDA 2JZNA 4ZCLA 4RDXA 1MZ5A 4JC1A 2AOUA 2XY4A 4KR9A 3EZ7A 1Y7HA 5T5JA 3P27A 2ZSFA 3OJ0A 3FM9A 2PGJA 1LW6E 2UVDA 3J7TA 2HWD2 1XQ1A 4KR2A 4OM7A 1O94A 1PEYA 4RHV1 1WXIA 1BKYA 3LDGA 5FPXA 2GMMA 1CUEA 2HCRA 3CUVA 2JVKA 1A4IA 5DXFA 3AP4A 5FZFA 5DF1A 4IG4A 1XD2B 4AI8A 3HMKA 4ACBA 2G1UA 2V3VA 4F5EA 3I5XA 3QBJA 4WASA 5FPLA 5J40A 3G5MA 5K20A 2HJ9A 1USWA 2GFQA 2QBYB 3AY3A 3EA5A 1ZD8A 1EYBA 2JDID 4YMVA 4EN9B 4XB1A 4ZEMA 2HWC2 1AO0A 3AJDA 3WIOA 1Q0RA 3CISA 5FAXA 3HNPA 2NVUB 1PS0A 1EXMA 4O4JA 2QTCA 3G79A 4BQOA 1B16A 3HJHA 4IIYA 4M89A 4E2QA 3WJ2A 1A9OA 3NHPA 1QYRA 3ZE8A 2O0OA 4BLOA 1GAWA 2CF5A 2JLAA 3AYEA 4FMPA 4L5CA 4E5NA 4FCVA 1AF9A 2HCTA 3GRAA 5HCNA 4LF8B 4C7OA 1XAJA 4DR3B 1KDMA 2ZR7A 3H11B 3E6DA 4R5MA 2ENUA 3PIGA 4RIHA 4WTOA 2WTXA 4NE9A 4YMIA 2WIKA 4X97A 3U4SA 1F6WA 5SY4A 1ES9A 4IHJB 4CCWA 4AEMA 1VLJA 3EC1A 2QX6A 3V8BA 4MW0A 3UAGA 3C3BA 1NUQA 3WF0A 3A22A 4Y5SA 1FFXA 4X1IA 1KJLA 2WKQA 2CKMA 4BIMA 3AY6A 4HNAB 1F8VA 1L1EA 3V4VB 3JTMA 5MFZA 2CHHA 4QX2A 2P9JA 4BPZA 3RVRA 5HIAA 2WAYA 5FYBA 2IEBA 4DQAA 5FKBA 4GKAA 5SY9A 3OTFA 2FOIA 1I2BA 4TYWA 1Y6RA 1WMAA 2R16A 4DIUA 4LX8A 2R6AA 2QM8A 4GALA 4Q9DA 4PWYA 4K6OA 4F3KA 4Y6SA 1LHUA 2WIFA 4CTJA 2WUFA 3R3WA 3LUPA 2SKCA 2BGGA 3S2UA 4Q00A 3EIHA 2XUQA 2IVZA 4UHDA 3GYDA 3GEMA 4YGEA 2IYTA 3GJ6A 5IT0A 5LYJA 4M0HA 3COJA 4A91A 4PCVA 4OOFA 4LQLA 1KPIA 2CKDA 2OZPA 5FLXA 1GHTA 1KYWA 2QN3A 3VDMA 1CQIB 4TS3A 4XHXA 3AHGA 4DOMA 1SRRA 2J9ZB 4BJ3A 1UEJA 3ZDDA 4MR8B 3ENKA 2XNDA 3MRVA 1E4VA 3FGZA 2HA4A 3NIFB 4ZXKA 4K1YA 3T0BA 3FLEA 3B6EA 4PGGA 4GMHA 3TAUA 1TTQB 2IHYA 3F4LA 3B5EA 5CNMA 1JQLB 2GC0A 1Z25A 2VK8A 5UKDA 2FQWA 4QT4A 4QWMA 3I04M 3TN7A 1RUH2 5EEGA 1X8LA 4YMUA 4XDQA 3K70D 5AI8A 4DA4A 2RGEA 3ZDFA 5HXVA 4EB6B 3IDQA 4KP7A 5LY2A 4DRVA 3GYBA 4MV3A 4RXMA 1YR3A 4JKIA 3QACA 3USUA 1EXVA 2X8LA 4WERA 3RVMA 5CW2A 1YIPA 2B7CA 5JSFA 4H16A 1FT9A 1F5FA 4LJKA 3VH4A 2PQSA 3X43A 3T4HB 1FYXA 3JZVA 1RAEA 2QVSB 5FBVB 4XIGS 3VQTA 2P17A 5IN5A 1C7ZA 1H2XA 2VTBA 3EEIA 3PTLA 3N2ZB 3N86A 2QQUA 3JALB 4ILKA 3M8LA 1C4XA 4L85A 3QPDA 3D9QX 4NOMA 3MBOA 3CIHA 2NP7A 4GKXA 5DI9A 5IT4A 3T3NA 3RQ0A 3BE6A 1WBFA 4F1WA 3D4KA 4EKEA 1WDWB 1WCWA 1EGHA 2X58A 4PQYA 3T5AA 2DCYA 4FW8A 5JUWA 2E26A 3DFFA 1MTOA 1JMKC 1TQ4A 4XIYA 4GZMA 4FN5A 1GFSA 1PN3A 1CQXA 1FUIA 3OAAA 2NU8B 4P9GA 4ZONA 3BTVA 5B3JA 2JIGA 1P1JA 3U80A 1UPBA 3K4QA 1XK7A 1EXDA 3AOEC 1ZCJA 2BOIA 3JYNA 3FUQA 3NW9A 3WQSB 1TVMA 1R8QA 1Y5RA 1YRZA 1RBZA 2BI7A 3IVXA 3ZXXA 3U1VA 3RNSA 3H7IA 4F7DA 4QWNA 3TLXA 2DECA 5BP7A 4Q4X1 4RYDA 1ZX5A 5HDQA 2XMGA 1F15A 2VQ6A 2VXRA 5KDLA 3PQFA 4KODA 4IXDA 2OC9A 3S70A 5AHWA 2JIMA 5BSTA 1BQ4A 1K6MA 5CBLA 4U3JB 1GWNA 4X61A 3Q8LA 1L5QA 4NG5A 1FP4A 4BMOB 2JIPA 3WNZA 1P2DA 1SKYE 4OX9B 1HT1E 1NTRA 4LNVA 2WRAA 2XCLA 3L7LA 4XH9B 4Y9SA 4N53C 2CYAA 1XR3A 3LLVA 2P2DA 4DIQA 2BCGY 3H1FA 3RCBA 4C2UA 1VBMA 4NU8X 1NG9A 1B35B 4RSGA 1HL3A 2OD7A 2BFEA 3KB2A 5ERXA 3BTOA 1GG2A 1VA4A 5IJAA 4UZEA 1XQVA 5E6RA 4OQQA 5EJFA 1IDOA 1UKEA 2CGPA 3UWMA 3AP1A 3NHSA 2QQOA 5TEVA 2Y0EA 3VBSC 3RFUA 3SHQA 5EG5A 3CF4G 1FRFS 1DTSA 5BWOA 4RKEA 5IXYA 4HWRA 3GLRA 1H2WA 3GD5A 3PEVA 5IT6A 3FE2A 2IH2A 2WSMA 1QANA 4D9NA 3PR1A 1SBFA 2C2YA 4IUYA 5AHXA 3AKSA 1IYZA 2BGRA 4KNVA 3OZWA 4X8HA 1KY4A 1E5SA 1KY2A 2XKKA 2I22A 2HR1A 2I4LA 1ZUWA 1ZAKA 1IB6A 4DCUA 2JEZA 2G1KA 1BKSB 2JFNA 3ROTA 1Y8QA 1FUKA 3RUHA 2C57A 4V03A 3INNA 4DJEC 4UM7A 4NNPA 4EUSA 3M70A 4B9EA 1HXS1 5IVHA 3HVJA 4XR9A 3LDKA 4A7KA 3BI3A 3P7MA 5DHUA 2G9QA 4XF9A 1C7IA 1GLHA 2RIRA 2J1UA 2JJMA 2WIGA 3M0EA 1SWVA 2E37A 3WRYA 3A27A 1YJCA 1K6IA 5HILA 2REQB 1A50B 2VL7A 4CEWB 2D6NA 3VZRA 2OFFA 2YIMA 2GZ1A 1JYTA 3I23A 4TV9A 2J0EA 3WLJA 4F06A 1LVUA 4MGHA 2FPOA 3C4QA 3KZVA 2V58A 2R6R1 3AVOA 1SCJA 1UMBB 4M0EA 4UAPA 1OYYA 2GNDA 4JYPA 4BFVA 1Z45A 5GOTA 2HRBA 2IZ1A 2IZ5A 4YCAA 3D81A 4BEBA 1DXHA 2GN1A 3ATGA 4Z4QA 4P5HA 4GPBA 2YNMD 3ZCVA 5AD1A 1FTYA 1ZK3A 5C3UA 2FW6A 3N7LA 4PRYA 4DIKA 2YROA 6GPBA 5FZKA 1B0UA 3ITQA 1N8TA 4JVLA 3HLKA 2WWJA 1P7VA 1QJX1 2NQTA 1H0SA 3NAQA 4A6PA 1L4UA 2JW5A 1UJ4A 3VAZA 4L50A 3IM0A 2RKBA 3KXPA 1F0YA 4W1SA 4Y22B 2WRZA 2JE8A 3FYCA 4IERA 4QEZA 2W93A 1XDGA 1LQTA 1FPN2 4IJMA 1M1UA 3V7WA 4L8WB 4E03A 1WJGA 4GB32 1NMYA 5LQCA 2G6TA 1ZQ1A 1SWWA 2ADEA 1DUIA 1S2MA 1EQUA 3G7DA 3HBMA 4F3TA 3IQGX 4RD1A 2L82A 3AQ4A 3FJYA 3H8WA 2R47A 4EA7A 3IT0A 4DKJA 1YS2X 1F1BA 4TYPA 2CLHB 3FN4A 1QPZA 4GX1A 4YAJA 1E96A 5SZKB 1OGIA 1XBTA 1GVHA 2ZWOA 4COZA 5J48A 3QEJA 4FW9A 4IGFA 4WN9B 2HT6A 5KTKA 3OE7A 4LYGA 2IU4A 2WYFA 3T4XA 2NPIA 1L5SA 4G0MA 3SH5A 3CUYA 2O50A 1MZVA 1ONOA 5IUNC 2WJAA 1WCIB 4QXCA 4CMEA 1Z0UA 2X7JA 4JP2A 2SICE 4G09A 1PNQA 3B9RA 2WY2D 3VTZA 5CYGA 4IIUA 2QBYA 3H50A 1LQUA 2BGIA 2HY7A 3OCJA 3TRHA 5BYJA 1IATA 3V9AA 2UWBA 1GL7A 1OZAA 1Y37A 4YV1A 2NQ2C 5JIBA 1UY2A 2EIGA 5JAXA 1OYVA 2XHZA 3NBXX 4YDQA 2VATA 3CX7A 3DFZA 5KXEA 1D2EA 3VBFA 1Y9GA 1RQXA 1N5DA 2W90A 3N76A 1I80A 2ATCA 1X3LA 4KG8A 1UY0A 2YXPX 2NZ2A 4D6XA 3R8FA 4L11A 2YUTA 5K05A 1MO4A 1TL7C 3I8XA 1WHTA 4W9RA 1Q0SA 1PJAA 3SZGA 3J8F1 4AURA 1KFUL 2AOUB 5FZ3A 2P79A 4KR0A 1LPSA 2P1BA 3KYCB 5KMGA 2DURA 4Y4RA 4KK4A 1KZYC 2DBZA 2VP9A 3DE5X 4WNYA 1OLME 3DUFA 1N6NA 3BB4A 4Y3OA 4YJ3F 3GH1A 4BE4A 4HDQB 4HNGA 2P77A 2BKUA 4LPLA 1XRNA 1CAWA 3FL7A 3WF3A 1QF6A 1T25A 5GAJA 1W28A 4KKVA 1F06A 4MW5A 2IH5A 3VR6H 2JG3A 2R00C 1SFRA 2V09A 5LSAA 1C2TA 4EHNA 3D2AA 4I8XA 4UUQA 4YZ3A 3VU9A 2IITA 4IEEA 1XHEA 2NWQA 1LKZA 1WVMA 5DN6D 2V03A 3GZJA 5F2EA 3QELB 3U78A 3MT0A 4AJIA 2XD4A 1VI5A 2W3JA 1SQ6A 4AK3A 1MO3A 2CLFB 5AK6A 5KREA 5F12A 1QIQA 3RUDA 2HWB1 4BO3A 1VBFA 3L7MA 1BE8A 4FEYA 4KRXA 2CE7A 1M76A 4WVMB 3TDKA 3DVAA 4GVLA 4TL8A 4RA6A 3ICCA 1JF8A 5C3QA 3DOIA 4F72A 3ILVA 2IKQA 4A0RA 1L7DA 1BS1A 1I1HA 4YUYA 1E92A 1LBSA 3N7MA 4QAJA 2P9GA 6ADHA 3I72A 4P9NA 4LMRA 5K4LA 1GFWA 4IL5A 5LU8A 2OQIA 2O23A 3OM0A 3VSBA 3IAAA 5EL0A 1IM5A 1F4PA 1GR3A 2B94A 2FI1A 5TQ2A 3FNQA 4RIIA 2IWRA 2A4KA 1BXZA 3H17A 3RRYA 1RQPA 1G5HA 1UZLA 1IE3A 4DXHA 3MPUA 1KEWA 3UGQA 2CJWA 3A0KA 2AHRA 5F51A 4YP9A 1FDWA 3OZSA 4PAMA 3M83A 4QUKA 3OUHA 2XZOA 3R7DA 5FOXA 4RK4A 3ZYRA 4RACA 5IK4A 3ASZA 4ZV7A 2NTNA 2NU7B 2I3AA 2QDXA 3EQ2A 2A6ZA 3CZUA 5JS1A 5BMVA 1ABBA 4XQ4A 1G5FA 1BVP1 1UCFA 2BEUB 2J5KA 3UK7A 4BGUA 5ADHA 2R1VA 4KI7A 5AVKA 3COPA 2RMU2 3S1AB 4ZC1A 4COYA 5LATA 1ZIOA 1Q0UA 1M2FA 1PT8A 2QPTA 1H4SA 3M5DA 2ZQYA 1RFLA 4YWJA 1N4DA 3BE5A 3AVWA 3UK2A 3RTDA 3MGAA 2EBUA 1MT3A 1CGPA 5F76A 1OC1A 3GEGA 3HCWA 1JLSA 3ZSJA 1NNSA 4DG5A 3TSCA 2GKOA 4O9GA 2Q8DA 2B7BA 2HNBA 1IHYA 1GNYA 3HEIA 4WZCA 3J8F3 1RVF2 2C03A 3FPHA 3LO5A 3GEIA 1Z26A 1KEZA 4CKCB 2WWXA 2BH2A 4ON9A 4JI1B 4X94A 3P94A 3NHLA 3IBTA 3MUFA 3V0BA 2XF2A 3CO2A 1VI2A 3LUKA 1RLUA 1N3PA 4LOKA 4JWKA 4N3AA 4B3SB 1FDOA 3E9DA 3E05A 1QH1A 3AFOA 1SH7A 3ADPA 2V7PA 4IFBA 2ZWIA 1K7YA 5DYNA 4TRRA 1EVIA 4HDSB 4LHEA 3V4SA 1X74A 4JZYA 3VKWA 3IPAA 1R1A2 1TMF1 3DPRC 4NSNA 4QYSA 1UOPA 1VKHA 3CN9A 4P0PB 1W8NA 2X86A 3PHMA 3BBPA 5FPYA 4QRHA 3KHKA 4YR7A 4R52A 1OLRA 1W88B 4QUAA 3HRIA 2YHUA 4LBLA 1SOWA 3F67A 4YQEA 1CUIA 4RO0A 4PFQA 4ZQHA 2ZJ1A 2ZAIA 5SZHB 4IHKA 2QRQA 2FPIB 2GM4A 4N3CA 4LA2A 1BA3A 2GKSA 3HKCA 3R7WA 1IPKA 4R2HA 2OW4A 1NY71 3ZDYB 5G41A 3WQ7A 1P7ZA 4DA9A 4Q2FA 1C3OA 2CUKA 4REQA 1KARA 5LIRA 3QA9A 4YAFA 2VNHA 4NK5A 1ZHFA 2A0FA 4D8MA 1G8GA 3CRQA 4REQB 3ICVA 5AJVB 4KXNA 2FZ5A 5AKYA 4IEOA 2AZXA 3S2GA 1M2OB 2WZ8A 3H6GA 2Q8PA 4K8OA 3CMMA 3N7JA 1IBCA 3OQ6A 1FQWA 3AM4A 3A11A 1SVUA 5LDDC 2JAUA 1GNSA 4NIMA 4W5QA 3AEUA 3QVGA 5FOJB 4DL9A 3KOUA 2IXDA 3QWHA 1MA3A 3EMDA 4KYUA 3FN9A 1YHZA 3AUKA 1ST3A 2D7JA 3KGLA 3KPVA 1QC5B 3EWNA 4BFTA 4DUXA 3QFHA 3P52A 3Q8EA 2IW3A 5EE0A 4AVVA 2VF7A 2B99A 1KO8A 3U56A 1C7EA 2WL1A 1X7ZB 2YJZA 1M0EA 3C41J 3DMHA 1LENA 2I03A 5E9WA 2YYOA 2HJSA 5FYVA 2CWDA 3AB0A 3BGAA 5CG2A 2QYHA 2JB8A 2NYRA 1EUDB 5HZMA 4EZBA 2C92A 5DLDA 1G3MA 2QE3A 1GPMA 5EJZB 5A7WA 3I9JA 2OLEA 3H18A 3TK1A 1NZIA 3QG5A 1OJLA 4OMCA 2WD7A 3N8NA 1GQSA 1JBQA 1R9GA 3H86A 3L2HA 4Q3BA 2BAGA 3DOCA 2WWYA 2JD9A 2F7SA 4JOQA 4CFZA 3WNDA 4C6RA 1EFDN 2B78A 3P4YA 4PEVA 1DJOA 2DYCA 1RMU1 1YVPA 3RVJA 1SCUA 1NM5A 3WIVA 3G59A 4MKIA 1H05A 4LZNA 3QW4B 1GYPA 1GN9A 4Q4Y1 3IV9A 3SNMA 3HJTA 4AY4A 1RUD1 2JFUA 1N3QA 1E20A 3PB3A 1E7WA 1HDOA 4FYIA 4HAZA 3RYRA 3HNOA 4KQEA 4M60A 5ENZA 4KG0A 5FJHA 3WKAA 5G4KA 2PKRA 5HZHA 2J0QA 1DRKA 4EHJA 5ALPA 3CWZA 3KQMA 1EP0A 1EZ4A 3THRA 1SQ4A 4P7JA 2Q5TA 3RARA 1BE1A 3W5BA 3N5CA 3H0EA 1R4NB 2JEYA 4PICA 1JHPA 2PKYX 3RU7A 2VMIA 4P38A 1SD2A 4PANA 1SZDA 1VBD3 2VG9A 3SFTA 2EGHA 1J90A 2QZ9A 3ZSMA 3I3OA 3QLEA 2G7ZA 3H8RA 3SDZA 1NV8A 4DTIA 3I5AA 2ZRPA 1BHQ1 3KOZA 1IZ0A 5K8UA 3HVKA 5EP3A 1W3VA 3V9PA 3GPBA 4Q93A 1Q84A 3KQUA 2NMVA 1OI3A 3B6MA 1ZBQA 1A82A 1G6KA 5SYMA 3WJAA 3AV3A 2VS1A 1HOTA 3AZXA 2DFVA 1UBNA 1UM9B 5LLSA 3IALA 5CYOA 1WLYA 2LDXA 4U7TB 4P34A 3ETNA 4PF1A 4FOPA 4WXRA 2OV8A 1EAYA 3Q0IA 1EAMA 3B3FA 4BB3A 4OYYA 4K05A 4ZZ5A 3PURA 1YR8A 1Q44A 2CDOA 2VPVA 4A45A 3UFBA 1WXWA 4M9RA 2BGKA 5JWHA 2VAXA 3L8EA 3OCCA 2P0EA 4NVPA 4INPA 2UXCB 1F20A 1XL0A 5B4VA 5JQWA 4TXLA 3P9XA 1JEQA 4P4NA 4MW6A 3GT7A 2O05A 2CYBA 2QZ3A 5KXCA 1QH6A 4B48A 1M83A 1YHYA 1WV0A 3PUXA 1CAWB 4MVYA 1K8RA 3DE4X 1K7SN 1WEHA 4O4IA 5L3SA 2EYQA 4A1FA 1J49A 2BFFB 1ZA2A 3A4LA 3L7JA 3Q7QA 4PG5A 1H4GA 5KAPA 5EWMB 5CVRA 3A58B 1DMRA 4EI9A 5C5IA 4OHFA 1GCGA 4B3MB 2XUDA 2KM2A 5DK4A 3QNMA 1AKYA 5EMLA 4UAJA 4EHAA 5IHRA 3WNPA 2O3SA 5C53B 3DFMA 5L40A 2VOTA 3ELBA 3FOCA 3B93A 1MVEA 3V7NA 3MIIA 1T6GC 1WG8A 3ZD6A 3C4VA 3O1IC 2JASA 2O4CA 1PLJA 4RF2A 3B82A 2WZQA 1VLMA 1RLTA 4AJKA 5L51A 2P4SA 1RJFA 1X14A 1YQ6A 4W6XA 4QOHA 1W76A 5TT1A 4PC1A 4DLBA 4KWLA 1SU4A 2OWDA 3PU6A 5T4EA 2CWWA 2B83A 1X80B 5ILQA 3TXYA 4LXYA 4EJ2A 3D8HA 4WA7A 6NULA 1OH4A 3S6PA 4OUDA 1RUE1 4X45A 3K5PA 1UMKA 2FTKE 3GC6A 2UAGA 4LZWA 4OQZA 4IFTA 4DSTA 3CEJA 2K4MA 1YNAA 1KI2A 2QLLA 3Q9LA 4E07A 1HNWB 3H1YA 3R20A 3HCPA 3TECE 4Z2AA 3O4JA 2XMCA 2BEKA 4ZQEA 2Y1CA 2D5AA 2FZLA 4R71A 2RAVA 5JQGB 1QLJA 4YACA 3SJ7A 5A32B 3S40A 4M2LA 2W2OA 4LBYA 3A3NA 1NYLA 3QE0A 4IS3A 2P0AA 4PSCA 3AMPA 2D5FA 1VI6A 4XYMA 4X91A 3WDSA 3JYOA 1IS4A 3JASA 2JGDB 1QFMA 3P2EA 3VH2A 5BWCA 2HWXA 1WA5A 2XXZA 1ZJZA 1HYGA 2DUOA 3N53A 2JGJA 1FDIA 2Z83A 4HDKB 3BZWA 4CF7A 3D2CA 3DPUA 2F4LA 2A5YB 2ZOEB 3OYWA 2XJ9A 2Z5WA 1YZQA 3GUHA 1PT5A 4TWRA 3B9QA 3PNYA 5C31A 3HRKA 1FX5A 5A3JA 2WG2A 2IHJA 3AERB 4WESB 5HI0A 3QELA 4CE6A 2B61A 3VU9B 3LIIA 4ABTA 1KITA 4W6ZA 2OL4A 1NCRA 4ZOCA 2ZZNA 3WJ1A 1X8JA 2FR8A 4AGVA 3PGMA 2J09A 4XYGA 1I8TA 2P5YA 4D8XA 2PTHA 1Y3DE 2CBGA 3O82A 4XYBA 5LU9A 1EP3B 4L57A 5GLUA 4PZPA 3LWBA 4OGFA 2EP5A 4MGIE 2HDWA 3THDA 1O3YA 5A6ZA 4MV4A 1NVXQ 2P9BA 2BKVA 4XILA 4XCXA 3DOUA 4YCLA 5B1HA 3VRHA 3ILFA 5K6TA 1ZOOA 1O3QA 4R2IA 3ZC3A 3D0JA 3VBOA 3D5EA 1PK6A 1N0UA 5JPCA 1E7MA 2QN9A 2XW6A 1XKLA 1Z8NA 3PI6A 3WVJA 4QBKA 4X66B 3EIWA 3TL3A 4UHBA 1E2UA 2V96A 1M3SA 2RHBA 3SCZA 4QUGA 3I6MA 1UH5A 4GBED 1W6MB 2PV0A 4XQDA 5FZIA 2R1TB 4KH0A 2ZGOA 2WYSA 1EKXA 1OI2A 4LJYA 1Q19A 1FDVA 4HKLA 5AI5A 5DU2A 2VPTA 3C7KA 1O3SA 2A9QA 2NACA 3FUCA 3D02A 5EXEA 2ON6A 2ODTX 3LFHA 1Y9JA 1IDN1 1N9KA 1IOAA 4A2QA 2QJTA 5K9YA 5FDFA 3D7LA 3ZD9A 1GWLA 4ZVNA 3PSAA 4F6RA 5KS2A 5BUCA 3UN1A 3GJ4A 2VY0A 4Z7JA 4WLFA 3JBG3 4L16A 2V9CA 4YECA 1X8MA 1JU9A 2AKEA 3UKOA 3THYB 3BMOB 3ZPOA 4AJPA 3G8BA 3DD5A 1O6BA 3K46A 3N75A 4LRUA 5FFOC 3GHYA 4I55B 3VZDA 1PG2A 2ERCA 2Q5EA 3NS7A 2LALA 3GAMA 2ZTLA 2B8JA 5TS2A 3OU6A 3K9CA 2X4LA 2AEEA 1KJYA 2OT7A 2H54A 2VQTA 3HDHA 4NHMA 1GQOA 1ONNA 2IYZA 4KQXA 5IDYA 3DJFA 1E3IA 5AVUA 1O0SA 3IDBB 4D6PA 1I9GA 5D3QA 5JCTA 2EQ5A 4JELA 4MP8A 2F3PA 2CMHA 2FDCA 1RPTA 3ILYA 3NEPX 2F2TA 1QQ6A 3F6PA 2BCJQ 4YT4A 2PGDA 4ANFA 1JYNA 1AGRA 4K9KA 2VZ8A 4JCKA 1C14A 1N0IA 3G0DA 2HFKA 1Q7BA 2Q6IA 1X9IA 3X2EA 3C39A 4EFLA 1WQ4A 1U31A 3V80A 2WO3A 1G21E 1NURA 2F59A 3Q98A 4AMVA 1OI7A 3A9WA 3KSMA 1PHPA 3LCRA 4H4EA 2A75A 2CHUA 5GJ6A 5JV5A 4ED9A 1ZM2A 4D9GA 3AIMA 3R5JA 1OIXA 3BIEA 1CRWG 1Q6YA 1UBRS 1MX1A 1N25A 3MBIA 5LQMA 4FZVA 5K4GA 1QIHA 1EM6A 3KAJA 4KLNA 4WK6A 2H1CA 1RWKA 4QPGB 1RBMA 3CF6E 3F97A 3LJKA 3ZE7A 3GXOA 4KUGA 4D1YA 2CDNA 2D2IA 3MG9A 4FUQA 3KCXA 5M2QA 1OI4A 5JIAA 2D0IA 5AFSA 4XOGA 3VD7A 1ZNWA 4IO0A 2QLTA 1XALA 1W4LA 3BORA 4RF5A 2BR4A 1ID8A 2E4WA 1EQ2A 4Q4JB 5DUXA 3K16A 3RSOA 2VYVA 1ZRHA 1VBC2 2V7GA 3W0LB 3AUTA 2WG0A 4Z53A 2VULA 3ML1A 1ZAYA 1GRNA 3VNVA 1QH8A 3OQHA 5GONA 3U3MA 3Q2IA 1W5EA 4GUDA 1BEV3 3PENA 4P4UA 1RDFA 4ZO4A 5JVDF 2GM5A 5LQRA 3L0IB 1CIVA 4UTOA 4GEGA 1DQSA 1ZD1A 4BQPA 2X8JA 5TB5A 1XU1A 2EV9A 4WLNA 1Z38A 1ZH6A 1XYOA 1WY7A 3CLUD 3WNVA 4A23A 4C5BA 1QK5A 3FD8A 3EGDB 4IWNA 2QPLA 4BDSA 4LY9A 4V0KA 2I4OA 5J2TA 3JRNA 3QIVA 3UJCA 1AV6A 2HWE2 1W9HA 2VW0A 4YZ5A 3ZLIA 3BIWE 1D1TA 2H11A 3OG9A 4QXBA 1RWVA 2GAIA 4DQLA 4KR7A 3ZVMA 1NIPA 4EUNA 3OQPA 2FEOA 4WZZA 2Q1WA 2FP4A 3CJRA 4BWGA 2VVDA 3P9KA 4K9RA 3KZ4C 4GP6A 4ZODA 1NBME 2CXPA 3RANA 1ARZA 3K15A 2Q5HA 3H0OA 1C5KA 1LK7A 2HPZA 1IAQA 3QVLA 1F3OA 3EA4A 3H9CA 4LTNA 2F3UA 3TL6A 2COUA 4CXMA 3QFRA 3RW9A 3ZS8A 1YB2A 3K8YA 1MOQA 2WZR3 1XC6A 2PH7A 5BR8B 3LA7A 1ZESA 4KGDA 3KJGA 4ZVKA 1UIJA 4EA8A 1IEXA 4KIWA 1M2VA 2PFKA 4ETIA 2EC5A 1P5FA 2GEBA 1M73E 5TMPA 4MCIA 1EWYA 4DBZA 1O1YA 4FYVA 4YIHA 2Q7OE 1R6TA 1PFWA 3GGGA 3QA3E 3VI4B 1QZ3A 3N2GB 3B02A 3U49A 4B76A 1JFFA 2F4PA 3L4JA 3NJYA 3LP5A 2W7TA 2Y8EA 2A3YA 1CY1A 3ZJYA 1HE8B 1QHHB 1ND2A 1GU7A 1WA4A 3SCGA 2FDKA 5ERGB 2XV1A 1XTBA 3O7WA 4DJDC 2EXXA 1ULEA 2NVUA 1SBYA 5GZ1A 1H2ZA 1PR3A 4BVGA 4ZU5A 1Q12A 1KKLA 3QUQA 1QE5A 3WGZA 3DHVA 3TSYA 4I99A 1SY7A 4F85A 5F1PA 9ATCA 2QTMA 1JN0A 4XFAA 3EF1A 4CRWB 2JIBA 3PQ7A 4PXSA 2RKOA 3VC2A 5T3NA 5J2UB 4FFIA 1SCIA 2CFOA 1C3OB 5CT4A 3FPBA 3H5LA 4B3JA 5AVWA 3DVQX 4QB2A 5T50A 1JHOA 4M0DA 5CU1A 3RAFC 3D1JA 1P60A 2ODEA 4G9BA 1UFOA 2FHPA 3IVCA 5LUAA 2IT1A 4H55A 4FNOA 4NAUA 1ECFA 3NBYC 1MAUA 2Z08A 1BRTA 3FPAA 1UZMA 5J59A 1TD9A 2H51A 1J5XA 4GC5A 2NSDA 1RTVA 5FOQA 3RBAA 5KX5A 3HGTA 3PC7A 2W92A 3MJRA 2WT8A 1WUVA 1CUCA 3ZYBA 4NHLA 1G21A 2WBKA 4DN6A 4W6QA 1PZEA 3ORHA 4RMJA 3VO1A 2QMQA 1NE6A 5CYFA 4MDFA 5A7GA 3HXPA 4COOA 3U1TA 1ZN7A 1ZVQA 3V4FA 2QYOA 4LSMA 2R9VA 3VYRB 5TQVA 4OI0A 4IUDS 3DAYA 4BAZA 1GILA 3R3UA 4P86A 1VYHA 2G80A 4B3FX 2C97A 4HFMA 1P62B 1S2GA 3RIMA 2O1SA 4XTRA 4BTEA 3MMSA 1JIQA 2FGJA 2XLCA 4HG6B 4NMHA 3AFIA 4NIHA 3WKBA 4F71A 3DL7A 5CA6A 2VDNB 4E2ZA 2LIVA 3ACFA 2Q0HA 3RTEA 4OTZA 3PRHA 1RUJ1 4HN1A 3ZKWA 1M1YA 3GJ8A 4FKZA 4DDWA 5EYYA 4ZU1X 1GQPA 1E0DA 1O8SA 3B6ZA 4BZXA 3IBFA 5L7OA 1H3EA 5C4MA 3VDCA 4LSWA 1FB5A 1Z5UA 5LP6B 4A73A 2GEFA 2QRUA 1HJGA 3TKYA 1LZKA 4KREA 3DVRX 4YVWB 1G5TA 1CUUA 2J32A 5FXWA 4U39A 4PLZA 4LZJA 4BQWA 1V9CA 2OFXA 4XPIA 3NSTA 4PHGA 4GWKA 3EWAA 3PPYA 4MVJI 1O0BA 3FHQA 3TZKA 1NVBA 1DTWA 5CXXA 3OA2A 3I1YA 4G26A 4ND6A 3VL8A 1PZXA 4BMEA 5AW1A 4FHEA 1RXFA 1OASA 1XEFA 2XCIA 4NYIQ 2B34A 1P1IA 3V1NA 4KDFA 5T4HA 1FAYA 1SB8A 2RS53 5LBFA 1J09A 1X9PA 2IUEA 2PZ8A 4FR5A 1KU6A 1N6HA 1NASA 4UEKA 2FCTA 5I9IA 2ZJ3A 1WZXA 4U0KA 1XRRA 3UNPA 5HP4A 4C7KA 1KO5A 1M6YA 3M4XA 3WDVA 3UUFA 4Z4IA 3IH5A 4IH4A 5D85A 4YA6A 1DBNA 2EWWA 4GIBA 2ZT5A 4MRAA 1QR2A 1SIBE 5K0UB 4FSDA 2W2LD 3IUBA 1AHNA 1JDNA 2GD6A 5L7OC 1II8B 5TLSA 3N36A 3DDCA 3LW7A 4RL4A 4AY3A 1Y1SA 4EY6A 2IXLA 3OGSA 1Q1ZA 4WZAB 3EGXA 1LWOA 3LVBA 2ZS9A 1E1KA 1QJ4A 4RGQA 1ZWKA 4B6GA 5IC4A 3IUJA 2IS1A 3RS3A 4YRNA 2PJDA 1H8TC 1I2MA 4P5DA 3GLFA 3R8XA 3RTCA 5GQSA 1HDZA 1B26A 3CMCO 2RI1A 2O48X 4XE5A 4QFCA 3H1AA 2IYOA 5SICE 5DGCA 2A5GA 2IIBA 4E2XA 2RR11 3SISA 4UZSA 3QVMA 2FMTA 3TB0A 4RZQA 5DN9A 2NQ8A 4BWFB 5J5AA 1KYQA 2J59A 2CSXA 5AVSA 4JMPA 2ZEJA 5E7IA 4R7TA 5JS6A 5IJ9A 1FDSA 1VPTA 2JE7A 3LEKA 3NOOA 1NP7A 3M49A 2P3LA 3K5IA 2TEPA 2BTQA 2O3JA 2YHIA 1FP1D 1Z08A 1Z6AA 4IE0A 4G89A 2CSGA 3I5MA 5BVGA 4M8KA 4V0QA 3E2MA 1Q14A 2M32A 1ZNPA 1MW8X 3QYAA 1MS3A 4TQUS 1EV11 3WW4A 1E99A 3ZWAA 3CX3A 1J0DA 4N5IX 2QF7A 2A4MA 3RFXA 1Q1NA 1OUSA 1NXWA 4BVAA 4JA0A 1NVKA 3AETB 2SBTA 2GLTA 4AKSA 4E88A 1V16A 4R9DA 4C7MA 1LS6A 1OGJA 3NUGA 5KYUA 2PMFA 4J94A 4CLXA 4GOND 3NV2A 4Q8LA 1BCRB 3W6OA 5HCAA 4CFSA 1J25A 4PTZA 4CT0A 1T0JB 1YRYE 1JDSA 3GLGE 4EGQA 3EEQA 3LA2A 1TYEB 3VFDA 1YDHA 3KD4A 1USGA 4PVCA 1PD1A 3IP3A 1V95A 3P0HA 3C3AA 1R5BA 1ZK1A 1C1XB 3FPLA 4PN7A 1LNSA 1RJDA 5JI7A 5BSKA 5B7PA 4FMDB 2JJ1D 3FR7A 5C7YA 1KZGB 3TYJA 4WOPA 4DDVA 3VBEA 5HQ3B 3LO8A 5L19A 4Y9RA 4HQFA 4HAYA 4B2IA 4G5RA 4KGVA 2KWIA 3HL0A 1JWAB 2FF7A 5DM0A 3IB3A 3O1MA 4Q4W2 4IR7A 2YV3A 4URVR 2YHAA 3ZMOA 3QSGA 1M06G 2FJ0A 2PK3A 3PNPA 3QMMA 2PYZA 4RVNA 1CQJA 4PPQA 4BNDA 1RI4A 4AUMA 5CJJA 4ZRMA 4TV8A 4SLIA 1KOFA 2BJVA 5G0TA 3GRPA 1OB5A 1KI3A 1H5QA 3DEAA 2HU8A 5B55A 4G63A 2JENA 2SNIE 4LW8A 2V73A 4TV9B 4Q37A 3PVBB 2GPAA 2GAFA 1VXRA 4CPDA 1CJSA 1CUFA 3DDZX 2MIIA 2AXPA 5B30A 3L7BA 3B7PA 4MYUA 3T08A 1R092 4XJWA 5C1BA 3DZDA 1QOTA 5FZ7A 1QJU2 1LQ2A 3U61B 2WC2A 2VBFA 1IFXA 2GNPA 3FDZA 3W7BA 1L5NA 3VKOA 2R48A 5GIPE 4GU5A 3GJYA 4UKDA 3I2YX 1R6XA 5ESXA 5IS2A 2H0AA 3SEFA 1U3UA 3SVZA 3VGJA 1YE8A 1WM1A 2NXWA 3FPJA 5AJHA 3T41A 5EMHA 4EJSC 1UK6A 3KHTA 3B6IA 1Z0AA 3SKYA 4G0YA 5L53A 2D97A 3MFYA 3RODA 1HM5A 3LBAA 1HT3A 1GTRA 4M6WA 3WLPA 5LPNA 1CKEA 2WWIA 3I09A 3KEGA 3S3TA 2WQ4A 2Z43A 1ADGA 1FMFA 1XTZA 2V5YA 5TF0A 4DLTA 3SI7A 4TT3A 1RKQA 4RHV2 1JHNA 1FNBA 1EH5A 1JU3A 1BDIA 4MZXA 3EVFA 5J2TF 1GPAA 4Z9XA 1PG0A 3E3AA 4YHHB 3VYWA 1UJMA 2C5BA 1R00A 5GZDA 2WJVA 3EE6A 4IJ5A 4S0XA 3VYTB 4MRRA 4XWTA 5DLPA 4LRSB 3VTFA 1NJFA 1A7KA 3T09A 1W05A 1EWTA 1FMJA 5SZJA 1TC2A 4AVYA 2VOWA 4IMIB 1XDBA 2P11A 1QG4A 4JITA 1PV4A 1JMVA 4R3WA 1YMUA 4JC4A 3DZGA 3BK2A 3QU7A 3RSGA 1OKKA 1X8EA 1H2AS 1M5UA 3OTHA 2D1YA 1MNQA 4TYMA 4QDRA 1EY2A 4Q5OA 1NY5A 2ZP1A 4XR4A 1T6XA 1XE3A 4A3XA 4ZCSA 3G6JB 2HSJA 3GZNA 3PFCA 4DCMA 4QQFA 3TQOA 2ARCA 2Q8QA 2QMHA 5JLVA 1AS3A 1G2PA 1LOFC 4J90A 2IDJA 2H2GA 4JENA 2B98A 1CR7A 3S7IA 4QUJA 1E32A 2YV5A 1YYNA 1ULSA 3LT2A 1ZVFA 4YLGA 1RBQA 3DEJA 4OL9A 3KD2A 4NY1A 5H8WA 1JEDA 3K70C 3LT0A 1VHQA 4FYXA 5LDGA 2WNUC 3VZOA 1X77A 1HDXA 1QXRA 1Z74A 5P21A 3OSDA 2H6CA 3H1WA 2XNJA 4IE4A 1HDKA 3S57A 1Q91A 2DFTA 2ZCUA 1RU3A 1Z3CA 1G9BA 3TEXA 1O6CA 1THZA 4D98A 1VHJA 4L2IB 2VEOA 4E8DA 1E2LA 1JJBA 1KO4A 4ENUA 3KUKA 4B5KA 3FCSB 3AEUB 3A14A 4FE4A 1LCIA 2XMQA 2H7CA 1B0PA 1Z62A 5A5VA 1BFKA 5U4QA 3BE4A 1SGWA 4X8OA 4AJLA 1HLCA 4ZY9A 1GCOA 2FMFA 3E6CC 1QIEA 4QB6A 2CLEB 3Q5EA 4PYLA 2XEXA 4DHEA 3H7JA 2ZB3A 4RZ2A 1Z6XA 4Q9NA 3P8ZA 1IK6A 4KH1A 2A58A 3OLZA 3PNSA 1EAH2 4D0QA 4R54A 1IHDA 3ZG6A 4EWAA 5LCWL 3MFAA 5L7OB 1UL1X 3B94A 1HETA 1RJWA 2VQ0A 5FZAA 1R66A 4J7AA 1FYUA 5LW9A 5M3BA 5EJEA 2VG8A 3ZOIA 1OTXA 3ETQA 2YVAA 4QO7A 1U7PA 4W6YA 2JL1A 3OMXA 1WW3A 4EB6A 1WMEA 5AHOA 1C3LA 3PQ5A 3PXAA 4D9CA 3BXXA 4F9GA 4LF9B 3LKJA 2Q41A 5EKTA 4URYR 5H7XA 4KFTA 1VCNA 4F2WA 2I6TA 4EB3A 2J4DA 5DDJ1 4ZP1A 3VR3D 4R9AA 1JJIA 5LWQA 5DWDA 1Y6FA 5BNOB 1AK9A 1DIWA 3WGLA 2GZMA 5EFUA 3MFQA 5I8TA 3KFVA 4J07A 2IUWA 4NRMA 5A3QA 3BVCA 1PE0A 4JLPA 2Q62A 4LI3X 4E27A 1UZUA 2VJXA 3PNAA 4R9UC 3WGVA 1YUNA 2AX4A 1MP0A 2RS13 3WFZA 4CPBA 3BEOA 2R1ZA 1TM2A 4DBVO 1A8SA 2XJUA 2P7HA 1F6BA 1P9NA 4E5PA 3IQIX 2RH8A 3Q11A 2ZACA 1TK3A 2ZRBA 4MR7B 1W4AA 2UU9B 1MGPA 1YRAA 4XWOA 5B1EA 2JDIA 1KI6A 1GITA 1NI3A 3HR4A 1FU7A 1H5NA 3OECA 1SJ9A 4LNUB 1LRLA 3M7IA 1T9AA 4K8RB 2OMEA 4AP9A 4PLMA 3DE1X 2FDGA 3IOMA 3R6DA 1WP4A 3S1AA 3AXDA 2WJ3A 4KUHA 5AM1A 2OORA 1W8IA 5J43A 1S3FA 3DBIA 3NLLA 1T2NA 2ORYA 3FNEA 3BODA 4TXWA 4MR8A 2J9YB 5B3AA 4CJXA 4K6KA 3MDPA 4OLLA 1B41A 4JUDX 2IXHA 5DT9A 3AT1A 4TZDA 3NEJA 3WP1B 5ED0A 1U4OA 4ENSA 4EJ6A 2LCIA 2VAVA 4MMYB 4YCJA 2XMZA 3SVLA 4QDUA 3G1WA 1T8YA 2EZTA 4BUJA 4OYUA 3LGAA 1WX1A 3NDRA 2QVYX 4IIFA 3OJOA 3E8SA 2W22A 4UD2A 2C7OA 4IBOA 4TLEA 2XB8A 4GZ9A 1UWCA 5IBRA 4LPKA 2FOLA 3VVLA 3OC6A 3AOGA 2YMZA 1AR62 4KV9A 5TSWA 2OOSA 1LS1A 5T5QA 1ENRA 1E3WB 2XVYA 4LBNA 2ZIXB 1JYSA 3QLUC 2I87A 3MBWA 2B5OA 4Q3DA 4ZN6A 4EPVA 5DCYA 4RA6B 1NT0A 5L3VA 4WVMA 1CAXB 1W6QA 1M34E 1MOZA 1XMJA 4MITA 3R9IA 5MN4A 1SCSA 3U6KA 4WM7C 1HRV1 1UBHS 2RCNA 4BNMA 1GRRA 3RS2A 3AR5A 1W1IA 3PG5A 4W4ZA 3AF2A 1JT2A 4A2WA 5J96B 2GH2A 1O96B 2WLQA 3HKDB 1JJAA 2JFZA 3FETA 5AKEA 2PO5A 5K6AC 1YLLA 3S2IA 1JZTA 2QSJA 2P2NA 4XPIB 5EE5B 1I6WA 4NQRA 1UXGA 3N6VA 3ZX5A 3GMIA 1Z36A 1T1IA 3HCAA 5FZ4A 4AJ4A 1R3DA 2G83A 4EI2A 2IV3A 1WD4A 1I3NA 4DXRA 3OZBA 5DM70 2VPIA 1VC2A 1ZRIA 2VAPA 4ER6A 1IN8A 1PJ2A 2I62A 5J58A 2WSSD 3E9EA 1Q1GA 3KG2A 3N59A 3E5RA 5L9BA 3B3JA 2C2ZA 2Q49A 5SY6A 4US2R 4LO7A 2GERA 4LBZA 4O61A 4OULA 3RS0A 1E8NA 2VHWA 3UXHA 4FN4A 2F43B 2DTWA 2ZIEA 3TLZA 4FPYA 4DJAA 3WDTA 1A9QA 3IFSA 221PA 5LRRA 1AXRA 4FMBB 3D2LA 1EESA 2A7AA 6Q21A 3OBZA 4X65B 4MXWB 3MTEA 4YR9A 4AZ3B 2IOFK 4EJFA 5IBPA 4LXTA 4BLQA 2XUJA 4P2BA 5FO8B 2OB1A 3SJCA 3H8VA 5K8CA 3UMGA 2OAP1 1O6UA 1X7ZA 3PFWO 2V4VA 3G0HA 2GAJA 3IE2A 2JDUA 5I8SA 2P8SA 1BS2A 1TCVA 1AE1A 4JHLA 2V4ZA 4D3ZA 4KWTA 1DAMA 1NLMA 2BFOA 1EI9A 4NV0A 4CA9A 1DZIA 4A6EA 3RIHA 4GPTA 4EYEA 1PQWA 4XASA 1E2KA 1CN1A 5EKDA 1D4VB 1W8FA 1SKYB 1A9YA 4BO8A 2O5CA 3I1IA 5J4VA 1HEIA 4P0TA 3EIOA 4BO6A 4D02A 1XAHA 1YQTA 3UGTA 1OTYA 3C3CA 2PKQO 5DM4A 1NJ2A 1I1QB 2MU1A 1Z4OA 4I66A 4QYMA 1NJ6A 3N5KA 3Q7PA 1JZ2A 4HQ0A 1L5OA 4ZT3A 2B4KA 4YB8A 5JZMA 1SHLA 4KDCA 3TDNA 3WB0A 2J85A 3DR5A 1LA2A 1N5IA 4A42A 3HBAA 4EYUA 1N0HA 3O6VA 2OX0A 1GQ2A 1Y4UA 1RXEA 1ODFA 2ACWA 1UJ2A 4Z51A 1VBB2 4K21A 4YDRA 4WW0A 3G2JA 3MQFA 1FPN1 1BKDR 3ADCA 2BN4A 4Q4LA 1PO7A 3KQVA 3OOHA 4OLHA 1JQ5A 4XTCS 5EUMA 1J8FA 8OHMA 3DCYA 4IDCA 3CYFA 4XXAA 4MGYE 4ID9A 1C8M2 1RAAA 4M8LA 1K3IA 2HHJA 4R1NA 5F2OA 1RXUA 1REQB 1TIBA 3V5NA 1XNTA 2Y92A 3R3VA 2YH2A 2AV6A 4QODA 3F5DA 4ASUA 3NH9A 4HAWA 3DBRB 4QQOA 3IPYA 1LFDB 3NNLA 4DRRA 5KINB 1FRQA 1HYBA 3H5WA 1Y1KE 4KQCA 2LXNA 2DRIA 4UHKA 3DWFA 4C3OB 3AJAA 1KFCB 1U2GC 1LNZA 3RJZA 1F38A 4TTRA 4YMTA 3MCAA 3TLJA 3IEVA 1XJCA 4F6LA 5JI3E 3PZRA 5AJTA 5T4FA 3IBGA 2LV8A 4LQDA 1BVVA 3Q5GA 3PFIA 4OU4A 4O2LA 3LAGA 3IKWA 3CZ5A 2Q4SA 4R0MA 3OF1A 5DM2A 3FW1A 1GGVA 1PVDA 1QVAA 1A77A 4BV2A 3RWMB 2GMWA 1NP6A 5ICCA 2C83A 4JB8A 4N49A 1N6IA 1DIRA 3ZLJA 2ZGPA 1OKOA 1GG8A 4G0VA 3WO0A 3ACLA 4Z5XA 2ACVA 3ZVLA 4LLFA 3DE7X 4OHWA 5DB4A 1PZGA 5D3MB 2RI6A 4UCFA 3GGCA 3ZJ4A 1DXOA 2QIOA 4YP7A 2XPCA 2KR2A 1U2DC 2OE2A 4U2AA 3WV6A 5CK5A 2DFDA 1FRVA 2ZIXA 4HFRA 2FQQA 5CD1A 3N74A 5FY7A 4EENA 1YT5A 4P14A 2X14A 1AX0A 3TQIA 2TMKA 3SZRA 2P1ZA 5C4WB 3FRJA 3IQXA 4LIUA 1TYZA 4HGQA 5E8AA 4D3FA 3VBSB 2WICA 4GA9A 4QIHA 2DM6A 4YW6A 2IYQA 1CX1A 4UEOA 2A0YA 2MOKA 3IP8A 3PRKE 2HMWA 4ZYVA 2GBFA 2YHBA 1QU0A 4WFJA 5A4MS 1NLZA 1T2VA 4HTFB 1PYOA 2IUYA 3O1SA 2H4YA 4JT2A 1Z34A 3HZOA 1XB2A 5LMCA 1XMXA 3UYJA 1AKEA 5BVHA 5EUCA 3LAWA 1MD9A 4BLWA 1DBSA 4Y2VA 1ATIA 4Z9FA 4QOIA 2DHRA 4C01A 1JEYB 1AF4A 1KHTA 5IM4A 2VZ3A 1Z8HA 2FWMX 4LC9A 2HNKA 1DS6A 4L72A 3B8EA 3R5HA 4OJQA 3A25A 1PK6C 2IZOA 1TLTA 3G8CA 1F2VA 3ZCUA 3Q3CA 1DDLA 2AMVA 2GCGA 1RRMA 1LOCA 2UZIR 4OMUA 3PJQA 3D8NA 3E9CA 3RRDA 1V8OA 2J67A 3L1HA 4B3XA 1SDDB 3POFA 4DR5B 1D2QA 3I4IA 1LEMA 1F9KA 5DSXA 3OTIA 2R60A 5IRCD 3ZFGC 2YXSA 2O3TA 5EC8A 3MTBA 1B93A 4DUWA 3AZQA 2HWC1 2ARBA 5FXVA 5D8AC 2AN4A 4QUEA 3A1SA 4QXKA 3JD4A 4H0CA 3AL5A 1ZGBA 2BU9A 2VNGA 4D4LA 5HMLA 3J7AC 1JG6A 3HU1A 3DGTA 3QBVA 1R6BX 4EOGA 2XB4A 2O20A 2RH9B 1SHKA 2D2EA 4U7DA 4CUCA 5F7ZA 1Y7LA 4U1RA 2ECFA 1GO2A 3SQMA 1IQPA 3BHJA 1C4RA 1ONAA 3NPAA 2O8CA 3OLYA 1ZGAA 1GNZA 4EGFA 2VJQA 4V38A 4AS2A 3GXUA 2JI7A 3PVSA 2PJZA 5A3SA 3TVDA 3GBVA 2VUAA 3BCRA 4OIMA 3M7AA 2Y05A 3KWMA 2AFIE 3LYAA 2XIJA 3QI2A 2AEZA 4UTPA 2QRHA 1CVLA 4NE7A 1PO12 4I7EA 3C6KA 3ILRA 2H63A 3I6IA 3KOXA 5FUPA 5K9ZA 2OGUA 2D43A 3CZPA 4PZUA 5HKAA 3NHUA 4MO9A 2N46A 3Q9NA 1B8NA 5CFCB 1ODCA 2ZUVA 3U0VA 1VSBA 1TQDA 2GN7A 4NPMA 5BXXA 5CJ2A 5DT2A 5H16A 1ISFA 1PGOA 3F2VA 3WLFA 1JTFA 3EGVA 2BBAA 4S2HA 2LBPA 1RIIA 1PJSA 2X3FA 2OC4A 3C6BA 3QKRA 1W49A 2A5ZA 1IZ9A 3M3PA 1PDOA 4YRJA 1BE6A 1WVIA 1CFJA 3VBCA 2J41A 1RAHA 5J4LA 2VSOA 1EP2B 4Y6QA 5HKLA 4EFDA 4L9SA 3TPFA 4X3OA 1U4NA 4JXJA 1C57A 4NECA 5AVQA 2P3YA 1U8AA 4NR1A 4GYKA 5HKKD 1RE1A 4G24A 4AQSA 1V9U3 3E1KA 3ZXFA 3A1VA 3MF6A 4NCNA 2HLPA 5E4YA 3UW3A 2ZEXA 4BZPA 2PS9A 1TMF2 1EEHA 4NEGA 2AWOA 3BTXA 3H2KA 1M5RA 3AI2A 4N0MA 4W7IA 2BV3A 1E60A 1YBHA 2JFYA 3LA6A 4C0HA 2CXHA 1PGL2 1TE2A 3WEZA 5F9FA 4C88A 4ASMB 3KAPA 5EUQB 5JPIA 2JLBA 3D0RA 3UV3A 3GRRA 1PF7E 3ICPA 4RK5A 5JAQA 3DULA 4TQ9A 2H48A 3AHJA 1ORVA 2RE9A 3NXKA 1LVHA 4P3YA 3ZHSA 4KMOA 3CKYA 5IJXA 1PK6B 5A3VA 3CURA 2ZTUA 3MJTA 2P2SA 2VSNA 4LJHA 4YY3B 1H9AA 2PS1A 4L6IA 4ZVTA 2VJKA 4MCHA 5MN6A 4F4JA 5F3EA 4YGDA 3HCNA 1CY6A 3OWHA 3FWHA 1DQ4A 4O2RA 3PDUA 4GYYA 3UCFA 4YRIA 5IATA 2R7MA 5FP9A 1T43A 5IM5A 9ABPA 4EJMA 3M2TA 4M1EA 3KQPA 2R30A 1RXCA 4AF6A 3IMNA 1E98A 2AG8A 2O2GA 3P0FA 1UFRA 1E2GA 2JAQA 1TPZA 3EGIA 3DO8A 4GMGA 1NQAO 4CEHB 5HRUA 1NVDA 1HFKA 1P1CA 1OFGA 2BLLA 4DNYA 3H1MA 4FGWA 4Y7DA 3GJBA 3AKZA 2NM1A 4YCBA 1OA0A 2H18A 1YB1A 4D7YA 2AQKA 2CVPA 1RMTA 1P29A 2ZYGA 5DI3B 3MMNA 4EWLA 1UYXA 2PT6A 3VDNB 1D8TA 2ZMNA 2GC3A 1YUBA 4HJRA 3VX3A 3F1LA 3BGIA 2REQA 2D7DA 2ISSD 1UBOS 4GOLD 3LKDA 3QVUA 1CIYA 1BJKA 4DQ0A 5FR1A 2QSYA 1SCNE 5EN4A 3HYTA 1DRJA 2ZWMA 5JVDA 3A7EA 4EFKA 1YI1A 1QFXA 1WQ3A 4TKZA 3LDHA 3EXIB 3LUCA 1NBEA 5BN1A 4QM9A 2H2WA 3JYQA 3MAGA 3FLMA 4IPTA 1J1ZA 1ABEA 1Y3BE 2I6QA 4D4IA 5EVCA 4A6XA 3D4NA 2OO7A 3PC3A 1UAGA 4D4MA 2AA3A 4YJ3A 1B35A 2GHRA 4R1MA 2B5HA 4J0JA 1WCIA 1O4WA 3A3KA 3MXOA 3FB4A 4DILA 5TT0A 1DCMA 3I9LA 1E4YA 4PQGA 4YUVA 4JK3A 3SIXA 5T7BA 2FWIA 2PIAA 4KK3A 2B6HA 4GI2A 3H19A 3OESA 3O14A 1BZYA 2OKCA 3MMXA 3WR0A 3K05A 2PX4A 1AS2A 3OCUA 4V0SA 2VP4A 2WNEA 4PO8A 4DV4B 3FDZB 4ZVSA 4X20B 4C0JA 3D7NA 5GGXA 5MGNA 2XF8A 4B81A 4K81B 3HDJA 4AL4A 5IK5A 4GMDA 3AZZA 1K3FA 3H7AA 4Y1EA 4O2AA 1G8WA 2YOGA 1QO0A 5DASA 2WIIB 3SMQA 2ZSIA 4UBNA 2C4XA 1E0SA 2ZQ5A 2PLWA 1NG0A 2B8MA 3HJNA 4XTPA 3HDYA 2FBEA 1NOVA 1COV3 4UMDA 3NOQA 4XF0A 4HXFB 2P6HA 4G9EA 1NUHA 1DAOA 2X19A 3NC4A 3AG5A 2WHPA 3TMKA 2OGTA 3IAEA 2WF9A 1JAXA 3AR2A 3ODGA 3STWA 2OO5A 4GMKA 4GE3A 2EZ4A 2CHEA 3GARA 4NMLA 1X7YA 4BMDA 4D79A 1I6KA 5F9HA 2X0JA 4NZMA 2HX1A 3PVCA 2QVXX 3S29A 1SKUA 1MJGM 3M5PA 5DH9A 3MGKA 2M1ZA 5BVGB 1Q8OA 2QNBA 2WIBA 3MIHA 4MA0A 1XTIA 1R88A 4TMYA 1DGWX 4UMVA 3FTDA 2P2GA 4PNHA 3WGKA 1T6YA 4BLVA 4TYNA 1TZOA 5IAGA 2HMVA 4W6WA 4Q3OA 1IBKB 2R5FA 3H9EO 1S0IA 2VH1A 1HUQA 3SE0A 4EARA 5JBQA 2O5EA 2XCUA 1DWQA 1W19A 4CM9D 1Z75A 3QBQA 2G0NA 2GPSA 3X1KA 4JA2A 4G0PA 2TECE 4KWKA 3BTYA 1C9MA 3ND8A 1QG2A 2Q1YA 4D4KA 5CK4A 1ZX1A 2PUAA 1E5RA 4UNSA 3OZCA 2WD7B 4A10A 1B6SA 4JB3A 2XSZA 2QUBA 3DLPX 2Q5FA 4ZKEA 2Z95A 4FOOA 4NBRA 1QJX2 4ZAGA 4ABYA 1GR1A 1SUSA 3C87A 3L6CA 5TIIA 4XACA 1HXHA 1T4CA 5JZSA 4JWTA 3I9FA 1YFXA 1O2DA 1VAVA 3OCXA 2BELA 2JG9A 5J47A 1YU9A 3AJRA 3T7SA 1V11B 4YLEA 4RHUA 4DNFA 4WM8C 4NOTA 1DQRA 4PZ0A 5BNTA 4KIFA 1BO6A 3RS6A 3WNOA 1T8SA 2XUAA 1IUNA 5C2JB 2Y1OA 3AM1A 2CV1A 3BH7A 3BHMA 4WJKB 4RTQA 2HHCA 5AI4A 2BEUA 1IPJA 1XDZA 4RLSA 5JE8A 1G8PA 4XGQA 5EGSA 1OV6A 2WSUA 3BXHA 1ZM4A 3ZXDA 3POIA 3H2BA 3IB6A 1HZJA 1O08A 1VBE3 2NPFA 5NLLA 2VNKA 2E18A 5E8JA 3QVGB 1GQQA 1QO0D 3S2FA 1T15A 1YH3A 1S2NA 2NO5A 4IETA 1NP3A 1QWSA 3ZNPA 1SKBA 4CIBA 3O0XA 4Q03A 1JAHA 3S2ZA 2QQWA 3RZHA 2J7PD 1GOGA 4Q9LA 1VB4A 4MGSA 5IUQA 4XXPA 5FPZA 5D7BA 4TSFD 4D0RA 3RRBA 4CTMA 4UW5A 1TRHA 1XNKA 3L6RA 3K8QA 4MCAA 3IXMA 3VDDB 3HIFA 2GPBA 2C7RA 2GZSA 2ZUEA 3CR8A 2A9FA 1VMKA 5FQ0B 4EB0A 2CSUA 1FBTA 2BJSA 4I50A 1JW9B 1MRNA 1V37A 2PY6A 4ZS3A 1XWIA 1U8TA 1HLGA 1WUYA 2B4QA 5E6HA 3SHRA 3D3WA 1OD3A 2R66A 1I0LA 1WB4A 1UK9A 3KSCA 3T52A 1FFXB 2WYWA 4U7JA 4MUYA 5EZ6B 4KO1S 2HU5A 1THTA 5A9SB 2GARA 2ZR9A 5K5EA 2A5JA 1K97A 4BQ5A 4W65A 1RUI2 3WQQA 1Y42X 4B6QA 1CUBA 4MQLA 3QOXA 1KZHA 4B74A 2E4ZA 4CU8A 4BKUA 1HOXA 1BMV2 1W93A 3BIXA 1W8OA 2QRMA 5CYYA 4V1CA 4POAA 1XI2A 2EWVA 4R41A 2PS3A 3K0BA 4HNUA 1EVZA 3K9FC 3BK1A 3WNNA 1YQUA 5LFAA 4QDSA 3G7NA 1IPSA 4K20A 3D4BA 1JOBA 2RGYA 5C9AC 4CMIA 3BDAA 4HNQA 4QXAA 1R2QA 1LFAA 2BVBA 1DC7A 1QP7A 4EG7A 1GQRA 3QE2A 5CKQA 1U3GA 4YMWA 1Y6JA 2YICA 5DSTA 2W52A 1VPDA 5CVJA 1YR6A 2QUKA 5FPTA 1G4HA 4Z8BA 1ISIA 5FL3A 5B1DA 4LZZA 1QJY2 1MVLA 1BMFA 1UADA 4LBOA 1E3DA 3KDAA 5BWNA 3A6HA 4DA7A 4F3CA 5JR2A 3SXPA 1EPWA 4N5HX 5F5QA 5BSEA 3OCYA 5HCIA 2BBVA 1DCKA 3KKQA 1JHQA 3RC3A 1Z0SA 1XZHA 3TUJC 5JSPA 4NG4A 2LP4Y 1K5HA 2ZKNA 1G2IA 1JSZA 3RVHA 1N5RA 3M6MD 2XDVA 4TLGA 2Y64A 2BGCA 2X6TA 1CNFA 2C5EA 2MSLA 2MYUA 3G0CA 2GP5A 4F6RB 4BVEA 4BUZA 1HNXB 3ON7A 4L78A 1NCQA 3JBG2 3T9DA 4WACA 3WAGA 1S6YA 1S9DA 5KOYA 5IJ0A 4O5OA 1QAMA 1V6IA 3EUFA 1ZBDA 4CDWC 3M9LA 4PBPA 2F9FA 5JSUA 2GO7A 5TY0A 5DN6A 4X8PA 2VJDA 4M98A 2I7XA 1O6GA 1JEJA 1WKVA 4B1FA 1V8FA 1ORWA 2AFIB 4IWYA 2JDYA 1C4OA 4JJZA 5B36A 5KPJA 3GRFA 4OG2A 1W0JD 2PT9A 3KV4A 3SHVA 5FUVA 3DOFA 1NHWA 3NKGA 2JHGA 1P0QA 1V7PC 5GGYA 3V64A 4H31A 4IJVA 1EE1A 4ARXA 1E63A 1Z2AA 1O96A 1XFDA 2X4IA 4YUZA 1L4LA 1UJ5A 2R32A 2Q6VA 1ZR4A 3FIJA 4RA0A 2ZJ6A 1SQGA 1FA9A 3GPLA 3MHZA 2O6HA 4L2IA 3IPCA 3DC7A 1C0KA 3HXLA 3HR9A 3HJCA 3FTNA 3MELA 3HL4A 3BZBA 3ZKAA 1DTWB 3MLKA 1Y80A 4Z9AA 5JXHA 7YASA 1H2YA 1WUJS 5I9NA 4ZT4A 2Y1KA 4JLSA 1PVC3 1MVQA 2N75A 4E3WA 5KB3A 3L77A 1AUXA 1KYIA 4DR6B 5H9PA 2FVYA 3VJLA 3UJ3X 4NAVA 1P9RA 1MB4A 4Q27A 3ROZA 3OHPA 1OHHA 5D2AA 3ZYCA 1OW3B 1CSEE 1DFGA 2VC9A 3JW8A 3KNZA 3IXQA 4O08A 3TJRA 2WE7A 4HT3B 4C04A 2WDBA 3FPKA 3OPXA 3AP9A 5ELMA 4CDRA 2WLSA 1PGJA 3I0ZA 1XO1A 4OZOA 2CBZA 3QUAA 4FYJA 3WSTA 5C5EA 3I8TA 2EIDA 2J1TA 3K92A 4NCJA 4C7VA 3FCAA 4G8JA 1RWOA 3N6RA 1DKMA 1FYWA 3B7GA 3ZIAA 1ND2C 4IVNA 5AUQA 3ZK7A 3TTVA 4N5LA 4KDEA 1XCLA 3U3OA 3GXBA 2QRKA 1I3HA 3NUQA 4DJFC 4XEZA 4CKBB 1W4BA 4OVEA 1SPBS 5IU6A 2PL9A 1JODA 4BB9A 1MXFA 3MTIA 1MB3A 2O8FB 1QC5A 5KX5B 1CRPA 1DC6A 3C7CB 1K8ZB 1ADJA 2GHQA 1PYGA 3A37A 3WJ7A 3KVBA 5JCOA 3VKGA 1W1UA 4PXAA 1MRSA 1LB2A 5FD8A 3LWZA 1TT5A 3ZNQA 5EKSA 5ALOA 3V8VA 2I9KA 1YU6A 2FWJA 4J4HA 3K32A 5B58T 4QASA 4JBWA 3AZPA 3OHSX 3NYWA 3IDOA 4Y9DA 1KP9A 5EHNA 3GZEA 4TKVB 3KEOA 2VTVA 5BWBA 4XBQA 5HQJA 1JLMA 5JCJD 3A6ZA 3TI9A 3N35A 5IWFA 1B43A 1K5PA 4MUJA 4RH1A 3DHEA 2Z3VA 2O1WA 4GR9A 1FU4A 4JFAA 1OQ1A 4E4SA 4N53A 2NMNA 2QR2A 1E64A 2YWBA 3ER6A 4CCLA 1O6FA 1TA0A 3AUFA 5JSHA 3T4VA 3SZLA 3LPCA 1ID1A 2Q30A 1H8HD 3LCMA 3WL4A 5BOSB 2WB4A 3FH0A 2FPGA 4DMGA 4KPYA 4O8ZA 2ASVA 4IINA 3GI1A 3OZDA 2R6FA 3FFBA 1UFQA 3I01A 1NYQA 1UDCA 2QVBA 2AD1A 4F8AA 4AK9A 4LF5B 2O19A 4MWZA 2MHCA 3ZD8A 3DFIA 2JDPA 1MS5A 1F5NA 3S2EA 1LJUA 1XMOB 1DT3A 3ZXKA 3M2MA 3QE4A 2IS6A 4IV3B 1U3TA 4GOMD 3B85A 2AXEA 1TYBE 5A62A 1M8FA 2EKQA 4B9AA 5DEOA 3CBGA 4XEHA 4OA5A 4U00A 1Y6ZA 4WT7A 1DBVO 4AMYA 5B2GB 3KK0A 2QZ2A 2FY8A 4DEVA 3HFRA 3HM2A 1W8DA 3QHPA 2RHPA 1KJ8A 2W42A 5DBEX 3C16C 3EDCA 3KE9A 2ZBUA 1O7JA 3D8RA 1HNNA 3C2QA 1DRVA 1H30A 5H81A 3JQGA 2L18A 3KSUA 3VR4A 4D99A 4Y1YA 4D4JA 4CDQA 1GEEA 1WU8A 3RVNA 2UYBA 4GC9A 5B12A 2HWB3 1ULZA 4M0UA 1BAPA 4M53A 4FI9A 2J3DA 3EY4A 1CQWA 2D6LX 4MOWA 2Z2SB 5JQGF 2WV9A 1CEQA 4P98A 3WGNA 5KQLA 3M1HA 2CNDA 3T1VA 5F6LB 3T30A 4XWGA 5E6UA 3RRJA 1R8YA 4QRIA 2YNMC 1VJ2A 4KNWA 2J8ZA 5A9RA 3KQ4B 5BYAA 4DR4B 3WX5A 5BURA 4I30A 4GVXA 3O8DA 4MS3B 3NKTA 2RI0A 2ONYA 2YW9A 3S4YA 5DPNA 3RIXA 2UYYA 1DDIA 3BK7A 2VCHA 3LRXA 2WKSA 3RFFA 1LOEA 4IV8A 4AVBA 3N6XA 3A6FA 1FX0B 4ZCQA 4LXQA 1FNCA 4HX5A 2DCTA 3SCHA 2P3SA 1VBB3 1N9GA 4V24A 5LZ9A 4I1VA 3GVHA 1I1EA 4P3OA 4LBWA 2WT4A 5ADWA 4GQIA 1TB4A 4UQOA 4HF7A 1U8XX 4D94A 3PTAA 1Z88A 4MICA 2EJBA 5AVVA 3GQBA 5K2MA 5KDOA 2OB2A 5IHPA 4MVJE 2I71A 4RJKA 1GWKA 2TMDA 4INDA 2NU6B 3H9AA 2WZCA 1U28A 1XA0A 3UMFA 4YUAA 4ZVLA 4D8VA 2PYIA 4BNFA 1WUIS 1XV5A 3SQLA 1CY0A 4D41A 4AQ6A 3TEJA 4HH4A 4RK1A 3L3BA 1RJ9A 2QQGA 2KBEA 3WL8A 4XFIA 3V1LA 3UHJA 3T5GA 4ARAA 1M1NA 2DTDA 1E5IA 4DNPA 3MIFA 5ALQA 3R3JA 2D0DA 3LBFA 4YT5A 1PSZA 2Z79A 4Q1BA 4F4UA 3QLTA 4COVA 1HPLA 4AZ0B 4A16A 4FMCB 2F4NA 3RM3A 3U3XA 1V9SA 1RSZA 1JOPA 1JG4A 3LOUA 1QP8A 3SCFA 3OQ1A 2P8JA 3TTXA 1KQPA 2JRCA 3LG2A 3SLRA 1KVQA 2H7XA 3NG1A 4US1R 3GFOA 5L7YA 4DE5A 3WK4A 1XZFA 4KMSA 3TUIC 3ZYIB 1U9CA 2AN5A 2QU8A 4ER3A 2XB9A 4BXFA 4Q7EA 5EZYB 4OV6B 1OXXK 2HLDD 4KVFA 4YAGA 4CCYA 4QBTA 4YCNA 3E7FA 4BKPA 1KI9A 3WK8A 4WDQA 4LXGA 3OPYI 4H6WA 3JXEA 1TKCA 3UJQA 4OB8A 4N7RA 2A88A 4CDQC 2PRJA 4Y2YA 5ALDA 1E2NA 2BP7B 1RRFA 3GUUA 3NDIA 4DLRA 1L8OA 1EX1A 5HFJA 1W3XA 2PGXA 5BNNC 2Z6VA 2F64A 4GYJA 1MEC2 1T2AA 2OHJA 3ESRA 2C04A 1AQUA 4LE4A 5HIMA 4EPWA 4P54A 2W6ZA 3VBUB 4H1TA 1OT5A 1KAEA 2QP3A 2FPWA 5CIYA 4B1MA 3AUXA 3UMCA 1NATA 1XRLA 4O02B 2M6RA 4ZQCB 3W3AD 4W99A 1R081 1AHHA 3ZX4A 1U5CA 3WWDA 2Q6TA 3SIWA 2HF2A 3WWZA 1NW8A 4B09A 3NALA 5K3OA 3JY6A 1XQNA 2QTVA 4E4ZA 2HDHA 2G25A 2AX3A 5JLAA 3D5QA 4Q24A 5F21A 4BNGA 3BA6A 4CMCA 4RMGA 3QEMB 1LSJA 4KTVE 3VZLA 1G5QA 2I2CA 4IZ6A 1I2CA 1NBOA 4GI7A 3TPZA 2NSJA 4IP0A 5ETJA 1PIV2 4XD7A 3AKDA 4B4PA 5EIBC 4YI3A 1LGCA 5FBLB 1A8IA 5IKXA 1XXLA 1Y9QA 4QUDA 3JYHA 4H59A 5IC5A 5FCDA 4ZGWA 1OBOA 3NBMA 3JQ8B 3RSFA 5KXBA 2WPDD 4AZTA 1PJ8A 3RYIB 1AQJA 5JNWA 4A8TA 3PQ8A 3OAAD 3QKSB 2QL5A 3NWKA 1WE2A 2K9ZA 3M3HA 2WQ7A 1NR5A 4JQCA 3AK0A 2DLCX 1KXJA 4DRXA 1FZTA 2OQVA 3MTQA 4G9SB 4LTDA 1RABA 2QM3A 3OF5A 3ZBQA 2J1SA 1J2JA 1JTVA 1IXKA 1M33A 3LLMA 1PNFA 3ZIXA 3GA0A 5CD9A 4ZHNA 3GRUA 3MINB 4IV1B 3BRWA 4A8JA 3E9RA 1WLCA 4Z7OB 3G2LA 1K89A 5J2UA 4B47A 4EAQA 3FCOA 5D1IA 4ZCTA 2O7NA 3RABA 3AI3A 4FBGA 1AZSC 2AZTA 4MUNA 5EE9A 5B7NA 1N2XA 1U0RA 4LBVA 4YEDA 4NLLA 4KC0A 4BNYA 3IUNA 2G0TA 3USCS 1OILA 2J3EA 2WU8A 5KNDA 4IGIA 5IFTA 4TYQA 4YONB 4M7WA 2QYSA 4XJXA 1JOJA 1YCDA 4MO2A 1A6CA 2PUTA 4CLOA 4ITUA 2IHKA 3BXPA 1MC1A 4Y0VA 2ZS7A 1T6NA 2I7TA 1XXHA 3W20A 1BHO1 4FGJA 2DVAA 5CT5A 4MEAA 2WFLA 5KVQA 4HKWA 4L7VA 1KVSA 2G5GX 2X5KO 4YRGA 5KNBA 3EHKA 3K1AA 1CIJA 3IBCA 4NENA 4YJHA 3AYCA 4IRUB 2IF2A 5A32A 4EJRA 4E4HA 1U6KA 3I6YA 4NATA 3NX4A 3TOZA 1ZZEA 1E8DA 4QPJC 5JR7B 2C9AA 1E9DA 4HRYA 1HB3A 3A3PA 3U6BA 4FWTA 1BXHA 2KLHA 1M7GA 5TJ9A 1JXMA 3GZTB 3KPYA 1R091 3UICA 4DQKA 4UUBA 4A3SA 3GCGA 3L18A 3H9GA 5A7WB 2B21A 1EA7A 1E1RD 1VPVA 1QQ7A 3R2JA 2N1BA 1XOIA 5FO9B 4OU5A 1SCBA 3ADDA 2BMVA 5HKOA 3AF1A 5HX7A 4CMEC 3OF2A 4LRYA 3COZA 3FOEC 3M6VA 5U4XA 4EI7A 1ORRA 5AC92 5KTSA 1I33A 2NT3A 4W4TA 2JHCA 4EI8A 2Q27A 5CDHA 3EJKA 5EJ3A 1ODMA 2DWOA 2YTZA 4FD2A 2LM3A 1Y4WA 3QUBA 3A10A 3U4QA 4YT2A 1XG5A 2NUTB 4WGFA 3DMTA 5EVJA 1KDYA 4C4PA 2IYYA 3FBMA 4KBGA 4WY5A 3U39A 1TMGE 2I8AA 3WQ1A 4D5EA 3DZIA 5ICGA 2JI8A 3VC1A 1J22A 1KRHA 4QGHA 2P68A 3SPXA 3ALQA 3LYUA 1CZHA 4OLAA 3NAPC 1B8PA 3QI7A 3VD3A 4MIYA 4ZCMA 1T8TA 4DIFA 3L0OA 1QR6A 1GTL1 3MXTA 4NXMB 4X6XA 3G9XA 2PVPA 1HV8A 3PJYA 1WNFA 1AUVA 1Q20A 4B85A 3IE1A 4D3WA 1Y7TA 3HS3A 4S2GA 4ES8A 1Z6ZA 3O1TA 3AXTA 4Q39A 1OYOA 4OSEA 4L4UA 3PTZA 3C8HA 3WKCA 4QTTB 1V5EA 1KVRA 1P2SA 1R0BA 4FWIB 3CVYA 3QKIA 2A0XA 4YS6A 1BMFD 3IBSA 1NV9A 2WYHA 4AULA 3N7AA 5E88A 5DM1A 3K73O 2MSCB 4TN7A 4CT4B 4P5PA 1CRLA 2WWWA 2ZSHA 4HJXA 5INTA 4XXHA 1P4GA 4Q4V3 4I50B 1IN1A 1SZJG 1NT4A 4N53B 3AJYA 4B4KA 1EIZA 3CLKA 4P00B 3RG0A 3GVIA 4KU4A 4CTKA 1GUBA 3H2GA 4RS5C 1SHTX 1ZGZA 5G0SA 3AY0A 5H4HA 2HPVA 1L4BA 4HWSA 3AUJB 5FYDA 4TWTA 4LY6A 3JRXA 1Z4JA 1V5FA 2R6CA 4NZOA 4CXWA 4QOFA 1XJ0A 3D3NA 2R8PA 2NO9A 2RGCA 4UEJA 5KVCA 2C3YA 1NOKA 4Y1FA 1AQLA 3RU9A 3ST7A 3JARB 4KZPA 1E9EA 1SUBA 1EZZA