2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
2J1EA 4XUOA 4JHLA 1W9SA 4LKSA 4XUNA 1UX7A 3NQHA 3A21A 1DP0A 1CZVA 1UZ0A 3C7HA 4A44A 4UI9L 1CZTA 1JHJA 4ZZ8A 4PPYA 4OUEA 3U37A 2VMFA 3WSOA 3C7OA 2B9VA 1JYVA 1UXXX 1K45A 3LPFA 2C4XA 2RJ2A 3ACFA 2W1UA 4ARYA 4OAOA 2EIDA 2VPTA 4A41A 2ID4A 4ZZ5A 4W50A 1ULPA 1ZMBA 1WKYA 2WAOA 3VDBA 3RJTA 3WF1A 1NAEA 3PUHA 2YG0A 3I2FA 1OT5A 4P08A 3THDA 3WF4A 1ULOA 1YQ2A 2VM9A 1DEXA 4QX3A 1L7QA 1US3A 4A6OA 4CUAA 3K75B 1GMMA 1K7CA 4DEQA 3SEEA 3I3DA 4JGGA 4HYQA 2RVAA 3OEBA 3WQBA 1BWRA 1J00A 3LQCA 2J22A 3NNGA 3HNYM 4XURA 3DT6A 3FN9A 2W87A 3SLRA 5HOEA 3VDCA 4JX0A 3CKHA 3NJVA 3C7EA 2JDAA 1UWWA 1UYZA 2ZEZA 2VZUA 3DYMA 3F2ZA 3W5MA 2W94A 5IJRA 3VD7A 3DCIA 3VD3A 3K4AA 4ARXA 2YC2A 1SG3A 1XNAA 4Z2AA 4A42A 3UESA 2HYXA 4UAPA 4XUQA 2BGPA 4UOJA 1ESEA 3T08A 5CZKA 3KVNA 3FL7A 1H6XA 3T09A 2HLEA 2RV9A 2DCJA 2VZ3A 2Y6HA 1UYYA 2E32A 2WZ8A 4AG4A 2W92A 1JZ5A 2ZEWA 4P00B 3ABZA 4BXSV 1XC6A 3IIIA 4AAXA 3CIHA 2L9LA 3WEZA 2J1AA 1TG7A 1EUTA 4LHSA 1MPXA 2W95A 4Q9AA 3VD5A 2JE8A 1EUUA 4RSHA 3OEAA 1OF4A 4QAWA 5HXMA 2WO3A 2V5DA 2W3JA 5DPNA 5LA0A 1PMHX 2CDPA 4S1PA 2QQOA 1F4AA 2C26A 4JHZA 2VZQA 2VZ1A 3MBWA 3W7VA 4DXRA 3PUIA 1Z8HA 2WO1A 4JKLA 1PX4A 5C71A 5I0DA 2LS6A 1GU3A 2WN2A 1ESDA 4NRDA 4D0QA 4OYUA 3WNKA 2JD9A 3ECQA 4DEVA 3MUY1 2VCBA 2X10A 2WN3A 1GOGA 1PX3A 2BGOA 4OMCA 2C9KA 5B4NA 4HG6B 5CYYA 5JXGA 2E33A 4PT6A 1UMIA 2VJXA 2ZXQA 3OB8A 5IFTA 2BERA 3ACHA 4ZY9A 4DUVA 2VZSA 4KWUA 4JKMA 2VMDA 4QPWA 1KGYA 5C7GA 1W8OA 1NUKA 2O14A 5DN2A 3BN6A 3LPGA 1U8UA 4QDQA 2CDOA 5FUIA 4CU7A 4OZOA 3I3BA 2W47A 2R7EB 2B4KA 1JZ7A 2LW8A 5IFPA 5EJZB 1JZ4A 1RYYA 2XQXA 3T2QA 1VYHA 1NKGA 2QQKA 2XONA 4PF1A 4QB6A 4CVUA 2J1SA 1ES9A 4XVHA 3NJXA 4BJ0A 1OF3A 3MO4A 4OMDA 3ETPA 2VTFA 4RN5A 3LE0A 3C7FA 4GZ9A 3OBAA 4BK4A 4E8DA 3WNLA 2WAAA 3CQOA 4W4ZA 2VZOA 2W1QA 2YFUA 3LEKA 5EIYB 4TXWA 4BDVB 1FXWA 4P5YA 1HN1A 1R64A 1BWPA 2W9XA 1KEXA 2HSJA 3MILA 1JYXA 2E31A 1SDDB 5JXJA 1JU3A 4MOAA 3OG2A 4XUPA 1K42A 5BN1A 2QQNA 1JRLA 1GQPA 4ZXEA 1JZ8A 2QQIA 5B5SA 4TX1A 2WUHA 2WQ8A 3P94A 3A7QA 1O8SA 4ET7A 5JR2A 2VO5A 2VZPA 3J7HA 4PQQA 1J83A 4LPLA 1NX9A 1ESCA 2KD7A 1K3IA 1UMHA 3DC7A 4IYJA 5JMOA 3CDZB 1LNSA 1US2A 3MV01 2Z4FA 4LQRA 1UY4A 3VDAA 4GWJA 2WZEA 3I2GA 3MV11 2J1RA 4L0PA 2ORZA 3WNMA 2WABA 2WBKA 5JD3A 2VMCA 2ZEYA 3CMGA 4QDRA 3HP4A 5A4AA 1DYOA 3ACGA 2WDBA 2VC9A 2ZEXA 3IAPA 3HNBM 4CUBA 3K4DA 4OAPA 1XNTA 3PT5A 1O59A 1CIYA 2J1UA 5JXHA 1W9WA 4HF7A 4W8JA 4QB2A 3DT9A 2X09A 2VOTA 3UETA 1PMJX 3DECA 4YPJA 3HN3A 4RYDA 3HPNA 4K9SA 2QQJA 5LCWL 4XZUG 5DMYA 3JXSA 3GDBA 4DUXA 3W5NA 3NRUA 3GXUA 2ORXA 1BWQA 4QDSA 2Y6GA 5EJ1B 2OKXA 3E1F1 2APJA 5J1XA 3SKVA 1JZ2A 3I2JA 5HPOA 2W5FA 1JYWA 2XOMA 1WABA 1W99A 2W91A 1D7PM 3WNNA 4IUGA 4H08A 1WCQA 3I97A 1CZSA 3FHQA 1UY1A 2DCKA 3C1UA 5IYYA 3IAQA 4CU6A 3IDAA 3D3AA 3HOBA 2XHNA 2BBAA 2VQTA 4K3UA 4P02B 2YFZA 3P1IA 4XUTA 1H6YA 2J1TA 5LA2A 4QX0A 1UY2A 4CU9A 1UXZA 3FHAA 3OGVA 3IB3A 3EYPA 2J7MA 1XPWA 4MGSA 4QX1A 4M4RA 4MO3M 1W8NA 4QB1A 4DUWA 4TTGA 3ZM8A 2EIBA 4CU8A 3BZWA 3LEIA 3VD4A 4FI9A 1UY0A 1T2XA 5IHRA 4KI5M 2QQMA 2VQUA 1VJGA 4DXSA 4JJ4A 3T2PA 1W0NA 1V2GA 3A23A 1SHWB 3DYOA 1I5PA 5JXIA 2DDUA 2X05A 5LA1A 2Y6JA 3T0AA 2EIEA 1W9TA 3WF0A 3UNPA 2VZTA 3AC0A 3DYPA 1OH4A 2WO2A 1P8JA 2V72A 2V4VA 1DEOA 3MUZ1 5B4XA 2Y6KA 3BGAA 5C70A 4E8CA 5CD9A 1O8PA 1IQDC 1BHGA 1L7RA 4D8MA 2EICA 3WNPA 1FXWF 4KMQA 2VR4A 3OGRA 4JKKA 1CX1A 2VZVA 4K7JA 4M8KA 2W1SA 3K46A 3T2OA 3EB7A 2BZDA 2YB7A 2QBXA 3I2IA 1TVGA 2W46A 3A22A 3K77A 4CUCA 1PP4A 3SKJE 4RW0A 2WYSA 1JU4A 1F4HA 4JKOA 1UY3A 5F7UA 1OD3A 3C7GA 2JKXA 3CZUA 2VCCA 1GOHA 3DT8A 5A1AA 2W1WA 3SEPA 1JZ3A 2J1VA 3THCA 3WNOA 2VL4A 3WF2A 2Q0SA 3LEGA 3HNMA 3K4ZA 5JUVA 1UYXA 1K12A 1DLCA 2YC4A 3P6BA 3HJRA 1YZFA 2Y64A 5G05L 4BK5A 4MGQA 4A45A 1IVNA 4I8IA 4Q7QA 4QX2A 2QQLA 3VD9A 3I2HA 2Y8KA 4MADA 1JI6A 2VZRA 3CZJA 3GGLA 2Q0QA 4A3ZA 3OGSA 1GUIA 3T0BA 2E26A 2PQSA 2Y6LA 3GM8A 4GWIA 4DXTA 3WF3A 3T0DA 2VMEA 5G04L 1GNYA 5DQ0A 1JZ6A 3ACIA 1JYNA 4A4AA 3HEIA 3I3EA 3I2KA 4M4PA 4K40A 4JJ6A 1J84A 2VCAA 1GOFA 3C8XA
chains in the Genus database with same CATH superfamily
1TQ8A 1U0NA 2F9FA 1T6XA 3DEKA 4TMZA 4OMFG 4ZD6A 1TTTA 2GN0A 1MQ8B 3AJ8A 3TQSA 3WMWA 2XGGA 5DGCA 3A1TA 2P62A 5EPAA 1C30B 4HMQA 2QE7D 3EQ2A 4P35A 1QFMA 1MF7A 3E18A 4QGMA 1I3KA 4JVAA 4FAGA 1G21E 4AURA 1KMIY 1MO2A 1G8YA 1P4AA 3O5SA 2R87A 4G9EA 3E6CC 2V3WA 5I48A 3OCCA 1MACA 1ODLA 4KGDA 5AVVA 4UE6A 3K70C 2GASA 3LVRE 2QX9A 3V3KA 3C15C 4RLQA 4LRXA 3PFBA 1JL3A 2RH9B 1SOVA 4W5WA 2RB4A 3VGIA 3OPXA 2GHQA 5SY9A 1U0JA 4ENTA 2PU5A 2Z6VA 4XUQA 4P53A 5DTMA 3U13A 4B6PA 5CBLA 3L8EA 2I2WA 4CTNA 1LFAA 2G0AA 4H0FA 3GVPA 2QR3A 3M4YA 2B3TA 5AW8A 3DOIA 3WMGA 2GN3A 1KQPA 1PGPA 5F9MA 3W5IA 3ALQA 4L97A 4KRGA 4DIFA 2H1OA 3ISJA 3WUDA 4C0WA 4DC0A 2PEYA 1FPN3 1SU6A 3C70A 2ZUBA 3TGWA 1VP3A 1JKXA 3IILA 1TYCA 3SHFA 2EXKA 4EJRA 1OILA 2J3JA 2PRJA 1QG4A 1GU3A 4WUVA 4AJJA 1U8EA 1K5HA 1T24A 2VK1A 2CDRA 4DLKA 4LFBB 3ACDA 1SVMA 3VJRA 3FVTA 5J37A 1JYEA 5EOVA 4YPOA 1TZMA 1IONA 3BMQB 3NBQA 3SSMA 1BOFA 5FZOB 4BLRA 3OM1A 2QDXA 3KR0A 1EUDA 3F8TA 4R69A 3VOTA 4MS1A 2ZUCA 2K6GA 3U49A 3D8RA 1XKXA 4DXAA 4U2BA 3DPRB 4R0MA 1NL3A 2YHJA 3TRIA 4M21A 1CVNA 2CMHA 3GVIA 3AR5A 2CAVA 3UKDA 2OCGA 5C4IA 1V6SA 4LHYA 3FBWA 4A10A 4WADA 4JI6B 3VZRA 3DC2A 2YXPX 5FOBB 5DPMA 5DAPA 1W5FA 4URHA 5I3CA 1TMYA 4DLUA 2OB2A 1ECGA 1PUXA 2NMNA 4H0NA 2IFWA 1V4BA 3O4VA 4J0IA 4ZVVA 1N4AA 3B48A 1YGYA 4CMCA 4UXJA 2YV8A 1NVGA 3ENNA 2M6LA 5IJXA 4CEIB 1ID8A 1DKNA 4RK0A 2NU8B 3ZCPA 2DUOA 5FP4A 2V0GA 3DLHA 1C30A 4ML3A 3O21A 1LR5A 5F77A 5F6LB 3JRXA 4ZREA 1SBZA 1RRKA 2H4ZA 3R6LA 1Z15A 3KSUA 4MYUA 3EUWA 3T9EA 3CZPA 4BMNA 1KMHB 1MN6A 1YJXA 2ECOA 4KRYA 1Y5LA 3INNA 3ZHZA 1WV1A 3DYVA 3GCWA 4XYLA 4TTIA 3HBNA 3NNLA 4YAUA 5DHAA 3N7UA 1E60A 5FUXA 3EIWA 3WFJA 2C4WA 5KXCA 3PNYA 1PNFA 4CM6A 3RJ2X 4INPA 5BY2A 4N90A 4LDZA 2DMRA 2ZULA 5AO9A 1AGXA 4OFBA 5K45A 1LJUA 1NY72 3DLAA 1O8PA 2CVFA 2VZEA 4O0MA 1L7RA 4BNVA 1P4RA 4BTVA 4OSPA 1ARZA 1XLVA 4P2GA 3EB7A 4MRPA 2GGSA 2Q7DA 1D2EA 3PLRA 2NZ9A 3O9ZA 1QJZA 3IA7A 3OPWA 2PWYA 1JZ3A 1PR0A 2YHIB 3PFKA 2AH5A 3GZNB 2SECE 2BLNA 3LHIA 1NWHA 1TTQB 1PSDA 5I7WA 1PWYE 1OAAA 4OVEA 1JMVA 5J58A 4GJZA 3T2TA 1G5RA 1IZ0A 3FVRA 2FR8C 4OAQA 5AT1A 2BVBA 2WT0A 2WD8A 3ZKAA 3GLRA 4ZAYA 3ORJA 2VZ8A 3BBPA 4MGYE 3NWBA 4QDXA 3GQBB 4R8VA 4HVTA 2DCTA 4B74A 4CMIA 2IC1A 2UUOA 3D6TB 4X94A 1JHJA 2QX6A 4WFKA 5JUWA 2OXFA 4GP9A 4LZOA 1JIUA 3TUIC 3WK9A 2JFPA 3JD1A 3VHOA 2F1JA 4LYDA 4LBNA 1U1CA 5AVTA 1W4AA 2GH2A 2AN4A 2W2MA 1L7QA 2WP0A 4ME6A 4AKTA 4GLJA 1DX4A 4ZQHA 2QR5A 2V73A 3DT6A 4DR6B 1I9CA 1VBC3 1FRNA 4W6XA 2ONJA 3PPIA 3C7EA 3LA2A 3CX3A 2MINB 4N7UA 1HLGA 2P4UA 3KHSA 1P9WA 5K20A 5CDTA 5IDXA 3TUZC 1JSCA 4BUCA 1OXBB 3JQ8B 3ONDA 4R9RA 5EKTA 3PB3A 4MAMA 2IHZA 5IK5A 4G25A 4U7TB 3DAPA 1ZH4A 1ZBE3 4BKPA 2GXSA 1TUEA 1JHMA 1LOGA 3MBOA 1KYVA 1N6KA 4R9VA 2WDPA 1DARA 1RM5A 5EINA 2P3LA 4RA0A 1SXJB 3VYWA 1E3JA 2IE0A 1Z38A 2DCMA 3AIIA 2GEJA 4GB32 2QF7A 2V9PA 3Q7RA 1QKIA 4PGHA 2YHSA 4IQPA 3K31A 4IETA 3F3MA 3IKTA 4U5QA 5BN3A 3TQRA 4J9UE 4Q7LA 3VU1A 3BSSA 1TNDA 2RS12 1JECA 1GZ5A 4BEBA 2QQFA 4LE0A 5L4SA 4N0EA 4KPGA 3X1YA 5ITZB 1VHJA 3KLOA 4NYMR 3ELBA 1D4M2 2XMRA 3WX5A 5DJ5A 5EJZB 1YEWA 3R4SA 4PAOA 2GEVA 2VUCA 2E7TA 1OXKB 3SH3A 4LC1A 2PZ8A 4MQ5A 2ZRAA 3MO4A 1XZMA 1SBIA 4Y3OA 2V7UA 4QU9A 1KIFA 4LY0A 5BMOA 3PFNA 5K6TA 4BXFA 1L7NA 4OZXA 1T4BA 1SVOA 1UEJA 1QJX3 1YQGA 5AVSA 3P3PA 4FZRA 4ZZ2A 2C2GA 4I8XA 2OZEA 3DEJA 3A14A 3SF0A 3F3KA 2OAGA 1SZCA 4OLFA 1LK0A 2PQQA 2WTEA 3RF7A 4FSDA 3Q8LA 3L40A 1FVOA 3TSZA 2GUGA 3JV7A 3Q7SA 4OBWA 2OFPA 3FOFC 3A7DA 5KYUA 3S2SA 4LDAA 3RNSA 4BOWA 4LY9A 1QNYA 4Q1BA 4RH3A 3V1KA 3HCEA 4JTNA 1Z29A 5C7IO 5CVUA 3J8F2 3QX9A 4GVPA 1B0ZA 2XECA 3A9VA 1X87A 4LR4A 4FYWA 3V6MA 1ZINA 1H5QA 3F4KA 4XFDA 3WHTA 4Q0UA 4K1ZA 1JOJA 4UBOA 4AVAA 2BYTA 1QIDA 3RFVA 5DI9A 4UHFA 3SVZA 2UY8A 4GH5A 2FNAA 3I0NA 3QEKA 4GPBA 1PFKA 3FCCA 1MS8A 4X7PA 3LHFA 3ZNPA 4BMEA 2HI0A 2A3YA 1LJLA 4IS3A 1Z7S1 2V7PA 3FUQA 2A86A 1TLFA 5FP0A 4JWTA 4E5UA 3GGGA 2FV8A 4WFIA 2PSEA 3CUWA 4AMUA 4C7BA 1LF5A 1LBQA 2J4CA 3RYHA 5HDQA 4P36A 3LHDA 1SXHA 3RVNA 2IHYA 4FFIA 5K99A 4S1VA 4DM4A 5BUCA 4H7MA 2JLBA 4YRDA 2Y6KA 3PQ4A 3FMPB 4ND4A 2CD9A 5K3SA 1XPUA 5DHPA 2WVJA 2AOWA 1ZK3A 3BK1A 3BPSA 1QYWA 4PO3X 2OZLB 1ND2B 1JIIA 3E03A 5DHFA 4ARIA 3BYWA 3ADPA 4IE7A 1QZTA 3GFRA 3KBBA 3W5BA 1XNGA 2PTHA 3U9SA 3HJRA 1V9U3 1N6IA 4LF4B 1OCEA 3NOQA 1S0BA 4DPKA 3LOBA 5GM1A 4KVFA 5FXMA 4CI0B 1CSEE 4X84A 3RPEA 4MI3A 3RJRA 1R4MB 2WSVA 3TLJA 1HNNA 2WWTA 3R1IA 2VF4X 3LB9A 4AGRA 5AXDA 4DY5A 4U3JB 2QQUA 4C2BA 2HSEA 4CT4B 3UB4A 5JLVA 3QOFA 5EGSA 2XT9A 2ZXUA 1Q7TA 4FW8A 5GWXA 1YLLA 1P5FA 4D56A 1SUSA 1PKEA 4U7PB 2JGJA 1PR4A 3VZMA 2QYTA 5TMPA 1HFJA 4CGYA 2FI1A 3ZSEA 1BEV3 4XILA 1DFGA 2D00A 1TM2A 3P9QA 5DXAA 5ILOA 4LJ8A 3LP8A 5EMHA 3N4MA 4RELA 2WT1A 2XKAA 4WOKA 2FW8A 3OLWA 3B1JA 2IXAA 3OMLA 1NURA 5SY6A 4B47A 2PKEA 4IV5A 4OU4A 2A7QA 1LTHR 3PLAE 3L7YA 1HB2A 4I09A 2ZUEA 3GZNA 2HHHB 2OXRA 3QUQA 1PR6A 4EJFA 3WFZA 2WUWE 2GALA 1MX5A 4R68A 4MLZA 1MXFA 1DTWA 3UWOA 3UM9A 2HJHA 1T6NA 4WY8A 3OPYA 3JQAD 1U2SA 4N7MA 4G41A 1I1HA 2XUQA 3WEZA 4BWOA 1GL9B 3LCJA 1SQ6A 1TAUA 5AKZA 3K5WA 1ACCA 1KVTA 3F5DA 1OIVA 4B73A 2Q3LA 1E20A 3JASA 3SYTA 2E7ZA 2JG9C 1JLSA 2F1KA 1JHUA 2YXNA 3PX7A 3NIDB 1RHI1 3CSUA 4WY5A 1BE6A 3ZZNA 4ARZA 3EPLA 3T7SA 1XCGB 1S0JA 4OLLA 1UF2C 3AB0A 3JBG2 3Q1KA 3HMKA 1RHI3 2W90A 1H42A 1UBRS 2NM1A 1ZGGA 1TZBA 3UZUA 5T5OA 5LR6A 5FTKA 1RIRA 4EN0A 2PMDA 1PJ8A 3CEJA 3AVOA 1KFKB 3I6QA 4BJ3A 4IDQA 4LF5B 3K70B 1BCSB 4J1WA 3ETLA 2F17A 4QYSA 3SKXA 3QH4A 3T0IA 3BEDA 1E6EA 2WHQA 2GNMA 4PW0A 4P14A 4RKFA 3OOHA 2WJHA 1ODCA 1H1DA 2IIBA 1EBUA 2ZGMA 2FPGA 3KKLA 4LVCA 3EEFA 1JAHA 3FPCA 1XJQA 2G5GX 4HZFA 2PUJA 1HLFA 3THYA 1P1KA 4LQRA 3INAA 5KMGB 3MMZA 1K0UA 1M1YE 5ILGA 1SRQA 2X8JA 1E7RA 3KFXA 1C3XA 3ESBA 5FKBA 3H9UA 1IQUA 2WZR2 3DB2A 5T54A 1ZH2A 1A4UA 4AF6A 4E4ZA 3UETA 1HQKA 4QDOA 1E1DA 4JEUA 3VZCA 5IVKA 2W2QA 3CU7A 3IDFA 3C3EA 2WLQA 3KHKA 3PNBA 4LXYA 1CUUA 4PX2A 1V6MA 3S2FA 1GKYA 3TMKA 4DILA 2R5WA 2PL5A 3RQIA 1AS2A 1WRBA 4NCHA 3LY7A 4CNBA 1TMF1 4I1SA 2WNVC 3RTDA 4M38A 2PYZA 5LMZA 1BE1A 3P4XA 1QYVA 3PDCA 3WGYA 5CPFA 1JB9A 4R4ZA 2ZPAA 4V0MA 3ZM8A 2JIQA 2BELA 3DZHA 2O3JA 4BAUA 5F35A 3KO8A 4GVXA 3TLKA 3DZDA 3KWJA 2UZAA 1XZ8A 2WS93 1ULTA 5CA0F 4GIQA 2VZTA 4JJEA 3HTXA 1R083 1DIOB 3M6UA 4AZZA 3DA8A 2J0EA 5CM8B 4EFLA 5IDWA 3T3NA 1KJZA 1OIWA 2C7BA 3N6RA 1QHSA 1VI5A 3O8OB 3NMUF 1KK3A 2FEAA 1Q3HA 3M2TA 1XDDA 4EN9B 3FKSD 2E4UA 1PG5A 4PX5A 3HR4A 3KEQA 5L6MB 1LHWA 2CGPA 3O1MA 3W4IA 1Y9DA 2C98A 4KYIB 4R9SA 1XIVA 5KTKA 2C99A 4C5AA 1HE2A 1HEUA 1Z0HA 3VJLA 2PGJA 5EZ5A 1QVWA 4TWRA 1L5FA 2BYVE 3D2AA 2RBKA 1EE9A 3V80A 1E79D 2P79A 3DOHA 1YRLA 1DQ5A 1ZZ6A 4V38A 1KI1A 3O38A 3C5EA 4GRIA 3CA8A 4DM3A 3FDJA 3E5XA 2ZW9A 2ZIVB 3QH6A 4HQOA 4JGZC 4DNYA 1EAMA 4B6GA 1L5OA 4LBQA 4NBNA 3IOYA 4IF4A 4BQ1A 1OC4A 4RZUA 1L4YA 2RAFA 2OE2A 3CLTD 4Y8VA 4RANA 3VDNB 1PUJA 1XYVA 3OEHD 4DLSA 5JCOA 3NNGA 1LLCA 4KXYA 1DIAA 2F8SA 5D8AA 2PUVA 1HOTA 2XGMA 5K8JB 4DRYA 2ZYWX 1VSUA 1E9CA 3WV4A 2GK6A 1SXJD 3OESA 5LQRA 1RMQA 5GM2A 1C0IA 2NVWA 3GBSA 4CDWA 3MAAC 3S1SA 3K09C 1RE1A 3OJLA 1VSBA 2C88A 4IR7A 3AX6A 1EXMA 5M2QA 2CKMA 1PR3A 3FYHA 4YRTA 5FLKA 1R50A 5K8VA 4ZI7B 2JBWA 4N6NA 2AMJA 1DMSA 2R8BA 3TN93 3X1MA 4D8WA 3O4IA 4TWJA 4M98A 3U1BA 1BEUB 4UNQA 1SU7A 4AEKA 2BMJA 2P77A 3KKQA 4MWEA 2WIDA 4OQQA 3QU7A 2IEGA 3I3QA 4X90A 3NKGA 1XE0A 2AGSA 5CVJA 4CDQC 1EK5A 1YKSA 1RJWA 2O7SA 5LFAA 1NTRA 1IJEA 3RC7A 3IEKA 2PFWA 4WVFA 4OJYA 2C3OA 2ZS9A 1N78A 5K8SA 2HGZA 3VA7A 2Q9BA 2MSDB 2ZT5A 4DANA 5JFOA 3WJAA 4QSMA 2N47A 3B1VA 2VTFA 2OBYA 3QPAA 3IELA 4ZYYA 1RSZA 2XYPA 1QU0A 1XA3A 2H7VA 2PH7A 1V1RA 4XJWA 1KL7A 4CM9A 2ZTNA 1WTCA 1R5BA 4HN1A 2FSFA 3PR1A 4PN7A 5K4GA 3THTA 1ZO8A 3QBTA 2EF1A 2J45A 5HJ7A 1W49A 4XXAA 2DY1A 1L4GA 1WSBA 4RHV1 4HQ6A 4YIHA 3LPNA 2KPOA 4GUAA 3RJ9A 4NO4A 3RABA 2KD7A 3JBG3 1ZSYA 5AYVA 5JR3A 4R2LA 4R2HA 3EBLA 2OR3A 4RABA 3B2EA 3D6VA 4R1MA 4AGGA 4PCVA 1KFBB 2QY6A 3GZAA 3NHUA 4PC6A 3WDVA 3SXWA 3LBAA 3FSGA 4W8JA 2QUZA 2JBAB 2QIPA 2UYBA 5A3UA 3WMFA 3GNSA 1T3LA 1WLDA 4WJKB 4HRVA 3BE6A 2EAUA 2RS13 2CVQA 1S02A 3RVDA 4PN3A 2ES4A 3GJQA 5HKOA 3AHIA 4JIGA 2AK3A 1NLMA 2HR1A 4UUMA 3APBA 5K3AA 2B94A 5F5CA 3BXEA 2BVVA 3BB6A 1WCQA 3T9FA 2FKNA 5IYYA 2ZAYA 3TKAA 4G09A 1CEXA 5JIAA 1R3DA 1BVRA 3BZBA 5CT9A 4JT2A 4CV1A 2PFSA 3DTYA 1IDOA 1P1HA 2Q2WA 1XO1A 5B2GB 4XFIA 3PFWO 5ALOA 1O77A 1KPHA 3JQGA 4YCDA 4Q66C 4QASA 2BHLA 4BZQA 3D3JA 2Z6UA 2WSSD 5A3NA 3IALA 3L7LA 2Q4BA 2RKOA 1PQWA 3IP3A 1HB1A 3JZDA 4J76A 1D1PA 1ND2A 3C3XA 2V55B 1VBC2 4KU7A 1ICEA 3WIDA 4E21A 3UY4A 5BYKA 1UH5A 4YRQA 1PG2A 1NSYA 2BTQA 4G85A 1KAEA 2ACKA 4BN4A 3ZE7A 3G49A 1QVVA 3OURA 3TLCA 1UT6A 2VA8A 3ULKA 3PFCA 2J7PA 3OTQA 4ZZ1A 2GHTA 1X0XA 4RF2A 4IS2A 4PZZA 1X1SA 5AVQA 2AUMA 3PEUA 4OM7A 1UL9A 3PWKA 4LBJA 5GZ6A 4QPZA 4HZUA 4BO7A 1IHPA 4JL5A 3L4SO 5EXEA 3AMQA 2J1EA 4XUOA 3D7NA 3TTWA 4FVVA 2WU0A 1SQFA 4B4KA 4D9NA 4GI5A 3S1LA 3ROUA 1JI0A 2AXNA 2IXEA 3HKCA 3JVIA 2PCJA 2L42A 3P32A 2VUUA 4IP0A 3SC2A 3E6DA 4BMCA 1Z8NA 3TTSA 3G88A 2HIMA 3FRHA 3BOWA 5I51A 4TSFA 2P91A 1HXS3 1SCBA 3W8NA 3A3OA 4ZYLA 4C4PA 1A3CA 2ZROA 3GN1A 1WAMA 3I49A 4WCFA 4TL9A 4R8MA 4WV3A 2C83A 3WB0A 5JR7B 3MCWA 4P58A 2H6EA 4Q7JB 5I5EA 4QDKA 5C8ZA 2VWQA 4PLMA 3SCGA 3LDHA 3K4AA 4LHXA 4L8QA 4R31A 5ENVA 1XMQB 4YXWA 3MWLA 4FAHA 2Y71A 1UPFA 2AR0A 3LUFA 1SCAA 4G36A 3JVVA 4ZT7A 2C7RA 4MG2A 2Y68A 2Z30A 4B9EA 1R74A 3DCJA 5HCNA 2TEPA 3E2IA 1H6CA 2WHXA 3FOEC 4I14A 1AGYA 7AT1A 4QGBA 2P3QA 3PFHA 3POBA 2C26A 2DV9A 4NDAA 1CG6A 1KJ9A 5HF8A 4ED9A 1TQ6A 5I0DA 2XQJA 4L78A 1R00A 2SCUA 3WP3A 3A06A 1NR5A 3O94A 2XR1A 4B3XA 1LI5A 5FY9A 2IITA 2QU8A 1RKVA 5J48A 1NVTA 1CJKC 2P2SA 1PNOA 3L0CA 5FUVA 1QGOA 1A78A 4K6BA 1XLWA 3QW2A 2YZ2A 4GXTA 2OFXA 4QUAA 1LLDA 3JASB 2A4MA 4CVUA 3L7OA 5LL6P 2OGWA 3U31A 5I47A 3U4DA 1HYGA 4ZI2A 2I78A 2WLPA 4C7VA 2CXSA 3RHSA 2O07A 3O0VA 4NFSA 3GLIE 1G1MA 4PC7A 3OMWA 2Z4TA 4UDOA 3DP9A 1N5DA 4D9IA 1DV2A 2E63A 2X42A 4UTVA 3PQEA 2FRDC 2QQNA 1F2TA 5HILA 5ELXA 1YU9A 4LKDA 4CL0A 5EHDA 5FZ8A 4FEAA 4FJ2A 2KSQA 4YQEA 1YIPA 1P62B 2ARKA 4RVOA 2PZBA 4B4PA 1WETA 2IU4A 1MR5A 5REQB 4WT7A 3ZFFC 1S7GA 3D6EA 5LZ4A 1YJLA 4AG3A 3GRPA 4IVNA 1RZ3A 4RMJA 5CM2Z 1EBBA 4JC5A 3EUEA 2J1UA 3WSVA 3WRYC 2X09A 5A3LA 4NV3A 3PTLA 2FLVA 1NJSA 4M7RA 2N3ZA 3LRTA 1OPXA 3B85A 2OBLA 3LE8A 1APNA 4LE2A 1Y3TA 3TINA 5IYZA 3IIJA 2AJDA 2RGAA 4IHQA 1SELA 2HLHA 5KTMA 4TTTS 4DLRA 2IXKA 1SKMA 1JH8A 5B3AA 4H08A 4M87A 3U3DA 1J0DA 5KTTA 4YNIA 4MTCA 3RH0A 1NCRB 1C28A 4A91A 1N9GA 3I6IA 2YMMA 2E4YA 4Y2JA 5C8CC 1V1MB 4AVTA 2H1VA 4RC9A 3EA0A 5FPYA 3EMVA 1F5NA 2Q8OA 1XBFA 1AQNA 4DUWA 4JQOA 2NUBA 3DF9A 3ZGLA 3PUZA 3PITA 5FY1A 3GJAA 4NYIR 4ZV7A 3NAPA 4HQKA 3UMBA 3AP6A 1A9TA 1HE5A 2ZEJA 1YQ8A 1HC7A 3A26A 4U6SA 2O8DB 2NZ8A 1RUG2 4RETA 3FUUA 3CTPA 1BHGA 2VVDA 1E0SA 3MS2A 5E95A 3FPBA 5MN4A 3FTFA 2F9LA 1HXHA 3O3NB 1JUDA 3BOSA 3POIA 4BB3A 2UUAB 2IS6A 1C7QA 4C22A 5F9TA 4JKOA 3DH0A 4L7QA 4MV5A 4URUR 4RS4A 2XDQB 2CY0A 3LPLA 1K4KA 3LBYA 1S2OA 3VSDA 1KQNA 1PO22 5I8YA 3T30A 4IQFA 2VCEA 5FBZA 2Y8KA 1R1ZA 2OLEA 3I76A 2B1IA 1Y9QA 1LRLA 5JISA 3TRJA 2PXXA 5L7YA 5A4JA 3P97A 1YK1A 4PPNA 2YGLA 5KDOA 3IE0A 2NZJA 1I4DD 4J0KA 2VW0A 3L6EA 1R0LA 1BZWA 4XVCA 2ZI9A 4K8FA 1I2CA 2Q6KA 1ADJA 4ND7A 1LOCA 3RSQA 3C7OA 3DS8A 4RX1A 4AQYB 5GGYA 2COUA 2OQIA 2W1UA 4EX6A 1AR81 4A41A 3M9WA 2MHFA 5JCXA 1W93A 1NAEA 1DEXA 3KUKA 1WG8A 2IUFA 4O3MA 2MPFA 2Q5FA 4H77A 4C6SA 2KI5A 2PU7A 2VYNA 3GRCA 5DOZA 4NG4A 4BMBA 4KBBA 4LWOA 4B84A 4Q37A 1CAXA 2HV8A 3OY7A 3Q41A 1V6IA 2A33A 2VH5R 4QVIA 4EJSB 1GUAA 3E58A 5LYJA 3BMOA 1UWWA 2P9EA 2VH1A 2H6BA 2C6SA 4MWCA 4B3CA 1YBFA 4KIWA 4U36A 3R5XA 4MKGA 1I6KA 4PLCA 5LDHA 4L74A 4GG1A 2XWBF 3IURA 1WW6A 4QKDA 3G59A 4GKXA 1RVV1 3OJFA 3FBYA 4M9CA 1IKPA 3NRBA 4JD5A 1EFLA 3R4DB 2R66A 4X8PA 3HM9A 3SS8A 4FO9A 4BXSV 3WRWA 4O9GA 2DG2A 1XVTA 4KXMA 3H8XA 3EZ9A 5LKRA 3BYZA 4HLNA 4LOHA 4EF6A 4LEIA 1GA1A 3K9CA 2LDXA 2PS9A 2I6XA 2BGTA 1FDSA 1GVNB 3GRKA 1YUBA 3EZLA 1Z8HA 3PF9A 4Z8BA 2NU9A 3MHZA 1LU2A 3K9LA 1OBFO 4PYJA 1K88A 1Z0KA 1KE2A 3EQ7A 1EFVA 2XNHA 3UJQA 3HJUA 2BUBA 1MORA 4YW3A 5KHHA 1AKQA 4J91A 4QLBA 4M3NA 4XCVA 1HK7A 4MHSA 5K05A 4WZZA 1E59A 4A0HA 1E0JA 3NNFA 3U4IA 5U1PA 4CCKA 2EV9A 2RH8A 3BIJA 2DCYA 4URVR 1HDGO 4KR9A 1F8VA 3WYEA 5CT8A 4EUNA 1ABFA 4QLOA 4EAAA 3V6LA 4F1WA 3L93A 5EFUA 2VQ3A 3CINA 4CR6A 5AM1A 2I3BA 7YASA 2WE7A 4NK4A 4H7PA 2G07A 1QBGA 3QELA 4TWBA 4DDWA 2IYAA 3DUWA 2O3TA 4B71A 4B6RA 3OG2A 4MI1A 1WXDA 1NE4A 1EUCA 1NJ2A 6ADHA 2EWWA 2I4MA 1XTZA 3C16C 3GZUC 2FVXA 1UPUA 4CQMD 1PO7A 4A36A 3CN7A 2BEVB 3CWQA 1EVYA 4MB2A 2GA9A 2ATIA 5FRAA 3RFRA 3C98A 3PZBA 5ALEA 1XTSA 5TS2A 4TUYA 3U3OA 4N0PA 2FWMX 1C7ZA 2PS3A 1Z6QA 4R6WA 3RYFB 4UFNA 2WM2A 5EG5A 4DLYA 2RGYA 1PLKA 2FZ5A 4JGBA 3KXLA 5HDBB 1LLUA 4CBVA 1BW9B 1HT0A 4RH1A 2YUEA 3CTMA 1M7BA 4U7HA 2QVLA 4CTMA 2OXBA 4O9EA 5JHGB 2Y26A 3L49A 4M8SA 2Q1XA 3NWOA 4MUAA 3BXHA 2YZ7A 3VHXB 1M2VB 2Q5QA 1SIBE 4UCQA 3S2ZA 4QG3A 1W4BA 5EHGA 3ETNA 2G88A 2IDKA 4L0CA 2JA1A 3W2EA 3LCPA 4QOHA 2A3RA 2FY8A 1PT7A 3F97A 3RHZA 3H8UA 2W2KA 3OIFA 4X9XA 2CDNA 2R4TA 4D3SA 1F0KA 2WC2A 2R8PA 1OZFA 3O9VA 1TDJA 4OK3A 1JLHA 3KKPA 1S2KA 4IV3C 2WTBA 1FL9A 3WF0A 1CQIA 1JAXA 3UK9A 4W7SA 4YEDA 4EL5A 1P2BA 2D1FA 2OSBA 4X45A 2PXHA 3WNPA 4DNFA 3OGRA 4RL7A 1ZZ7A 2BGKA 3T5GA 2C2XA 1WQ3A 1Z75A 2VPXA 3IAS6 2P40A 1U9IC 5FBHA 2CMKA 2PUHA 3AYAA 1LD3A 4N3NA 4RIEA 2C96A 4ZDWA 4EM6A 2I6QA 2H1FA 2XTJA 3AHHA 1C80A 3E7FA 4TZTA 1IZ7A 1K12A 1ZPDA 3KUDA 2QVBA 4YVSA 4F0JA 4H3HB 4R98A 4ZTUB 4MDEA 5AJWA 4QHYA 1QRUA 1DAGA 3ZOKA 1EUYA 4RKYA 3LBFA 1EGVB 4YMGA 2V8OA 1RUH2 2X6RA 3I2KA 4HEHA 3JAWB 4NAHA 3TB0A 1KTIA 4WCFC 3VD3A 4WVMA 3ANYB 1VB4A 4YW1A 4HVCA 4BVBA 4WK2B 1N1YA 2VKTA 3K5IA 3ON5A 2Z98A 4XTCS 2Q3DA 4DSAA 2IHKA 3WF1A 3AVPA 4BQIA 4QECA 1NBEA 1EIZA 1L3JA 1C9NA 3NC4A 5FY4A 2NM0A 2W8BA 3ON7A 5DSXA 3R44A 2VGDA 2IPNA 3SMHA 1JJ7A 5HOEA 4Q01A 4IDDA 3GIDA 5I8SA 2X1MA 2V7QA 3PE6A 2XCTB 5LPNA 2PGOA 2O59A 4IXDA 1AMUA 2JI7A 2R8RA 5IARA 1IS6A 3MGAA 5C80A 3OFSA 5I9TA 3LXXA 4HGQA 8AT1A 2HYXA 3FCYA 5A4KA 5E8AA 4FKMA 3ZW8A 3PUJA 1JIXA 1YZYA 4XM0A 1AJKA 3IP5A 2X5IA 5F3EA 2PX4A 2Y92A 3ITEA 1O4VA 3WZ1A 3AOEA 1U3WA 2A4KA 3WSWA 3IIIA 4XYMA 5C32A 3RJZA 1NOKA 3HPRA 3OUTA 3UH0A 3FFBA 1QCDA 4CM8A 3ZN6B 2OPWA 3M3IA 4ALKA 3RWMB 3H0CA 4E5SA 3L0DA 4YP6A 3OJEA 4UFPA 4LIVA 1YIDA 5G0VA 1CQJA 2J41A 5EJ3A 1C4WA 4XLTA 1CF4A 3AKZA 4C05A 1EG2A 5BYAA 3IUMA 4P9NA 3K0CC 5HR5A 1PZ9A 4BN0A 5JVDF 1OLXA 3EW7A 2GDZA 2R062 4FI3F 4WLUA 1WEHA 1H1MA 3ROMA 3IQGX 1G4AE 4R9DA 1GD1O 2ROQA 3QE0A 3V5NA 3UBTA 5JS2A 1U8UA 1FW8A 5ER9A 4S2GA 3GJ6A 2PR7A 3HBLA 1NC1A 3R7WA 2ETXA 4ABTA 4JQZA 3PUKA 3GGOA 4QMAA 1X1RA 3HYRA 3X0DA 4OI2A 1SBFA 1G5PA 4TXWA 3DMPA 2X4GA 4LFAB 2Z08A 2ETVA 2MSKA 2BRUC 3NWKA 1H8TB 1ECJA 3A7QA 1FNBA 4PDWC 5EZWA 1EXNA 3AF2A 4TLCA 4PGAA 3BRWA 3G8YA 5FZ7A 2DQKA 5A9SA 5CA1F 2FDHA 4EH1A 1BZYA 4WXHA 2O5CA 2HYKA 3OTIA 2JEYA 1ZWKA 3R3JA 4PSUA 3WR5A 2B8TA 4Q4AA 1ZBE1 4NH0A 2OCLA 1ZD5A 3C6ZA 3CNLA 2QX8A 5JFGA 2DWCA 2Z3WA 1ADFA 3GY0A 4C1WA 3Q8MA 2H51A 4QT0A 4X61A 1YRWA 3UJ8A 5J4YA 3UN1A 1WMBA 1QVZA 2AEZA 1N2SA 1RC8A 3CJRA 4CDNA 1ZIOA 1K5GA 5FUNA 1BDIA 4WKGA 3ZXKA 4BZXA 5DOVA 4NU0A 4H3VA 1MT0A 4B1MA 5KQLA 1Y7BA 1RI1A 5I45A 2ZJAA 4OGLA 4QZVA 4IDCA 1BX1A 1NN1A 4W7IA 1PHMA 2VT2A 4RJIA 1IPFA 1USWA 5BV6A 3QNWA 4JU9A 5EEGA 3FYCA 1BIFA 4JJ7A 1DKQA 2EG9A 1ECCA 2IYSA 1GSLA 4TWTA 4ZI7A 4D98A 3CLUD 2WPDA 4MO3M 4Z7QB 2QN6A 4LA4A 2JW5A 3G0HA 4G1BA 3VVMA 4QWWA 1MJ5A 1FOD1 4OP2A 4URZR 1DAKA 1EPUA 4EX7A 4KYUA 2YXEA 4ON9A 3EVBA 1JHAA 2B39A 3AG6A 3NDJA 2DLCX 3UMJA 5NULA 5TVKA 4XEZA 4PLZA 1LPMA 3VSBA 1WW2A 3V2HA 3MLKA 1PR5A 3T4VA 3VR4H 2QBXA 5LBBA 4NV1A 2JKVA 2AWNA 4BMSA 2WNUB 3JD2A 4F1JA 1T6ZA 4Z99A 3LLVA 2CKDA 5B3LA 1N2IA 1P2DA 2VRWA 5FRDA 3KR1A 3T54A 2VZRA 2YTZA 4PYOA 3I5AA 1PS8A 1CR1A 2AFIB 4FONA 2A0FA 3PFFA 3K1AA 2BZSA 2JXAA 4NJ4A 3KQVA 4M4PA 3W5HA 5L51A 4ZYXA 4LOJA 3LY5A 3QWBA 1VE3A 4I5IA 2V6JA 3VN4A 4CDXA 4YRLA 1I01A 4CXMA 1M2JA 2WZQA 3A0UA 1EQUA 1TM1E 3AI2A 3BN3A 2F1RA 4UVHA 3KJGA 1JLKA 4MW0A 3PV0A 4PYNA 5EHNA 2VOJA 3TIFA 1MB4A 4WKCA 2H1LA 4TV8F 1V9U2 3AKCA 4ZDJA 3D2BA 1P2VA 1ZD8A 2WILA 2OT3B 4I1OA 2Q3CA 2OD9A 3KSZO 2V5UA 4TMVA 5DX1A 3ROZA 2DU1A 3P52A 3VTKA 1U5YA 4X1IA 5IZ4A 1OLSA 3VR5D 3NZEA 3A9CA 4GBED 1D2MA 1VBD3 2WWIA 5J4KA 5L3SA 4ZGBA 2F62A 4Z0PA 2ATFA 1IC6A 4DTIA 1R9MA 1S9DA 2R00A 5AI8A 2NNLD 3QYAA 2ZHMA 4DQDA 1KSHA 4HWRA 1UU5A 2VHUA 1W90A 1M6VB 3A1DA 3ZCSA 3EVTA 1UYYA 5FTTC 3NBXX 1JJFA 3AI1A 2AYXA 3TGLA 2QW1A 1TT5B 3AINA 2N1BA 1B1CA 1RDFA 3CZ5A 1V16B 2VRBA 1GZWA 2HCJB 5DF1A 3VR6H 5BNPB 1CZLA 2ILVA 3MGKA 4MGIR 4FFRA 2EQ5A 1O1YA 3Q6MA 4B7UA 1GNPA 1ZLXA 4K1YA 1HDEA 4OLJA 3V1MA 3NHYA 1SCKA 3JS5A 3W59A 2JIDA 3IUJA 3BWDD 2OUHA 2CNKA 2XHZA 3AYZB 4YAFA 5I4IA 4L07A 4JLPA 1T9CA 1YR3A 3E5MA 3NOVA 1PHPA 5D8DA 4CG2A 1KQOA 4KUGA 3PGA1 3GRUA 2HZBA 3GLHA 1U0OC 3L1KA 1SXQA 1GZTA 2ZT6A 2IKSA 5DBEX 3QD6A 1BWSA 1DBVO 1T4GA 4Q7EA 2VJCA 5H4HA 2AUTA 1X8KA 5KPJA 1G55A 3H8SA 4B46A 2FDCA 3VPSA 1ABEA 3N8DA 2JK1A 4FYKA 2CSUA 5JR2A 2HMVA 4Q48A 1YNSA 1F12A 1SCUA 1YQWA 1T35A 1MC1A 1XJ5A 2JEOA 3WTBA 2ZE8A 4EZ4A 1ZJZA 2IVJA 2OP0A 1OXSC 2Q3BA 1Q5PA 1E2QA 3H13A 5FPQA 1UQRA 2R11A 4UOZA 1P7PA 5SZIA 2QSUA 5SYAA 2ARXA 5DTIA 3ELWA 1B0PA 4YWJA 1CUAA 3NNDA 2XUPA 4CMJA 4J1XA 1FP7A 4LZJA 4US2R 4Y4RA 1CEYA 4W99A 1BOOA 4F9FA 5KVVA 1W8TA 2X2FA 3GJ3A 2EBWA 3QOYA 4OGGA 3RZMA 2AOXA 2PZGA 3NNNA 1IOWA 2D3RA 4P02B 3SHOA 2GK4A 1G20A 1M75A 2ZBPA 5FIUA 1Y3FE 3CR7A 4D0RA 1RYBA 4Q4V2 3KDPA 1WDMA 2VNVA 2FFBA 5I0TA 4EBFA 1A2BA 1XJAA 3QVKA 1M3SA 1YKGA 4HLUA 4QKQA 3OY2A 5ARCA 3ZQ4A 4KWJA 4GX1A 5TQ2A 5J2TB 1CQIB 4KIUA 1EUDB 4KQHA 1MOZA 4KTVE 3V2UA 4C8DA 5FWJA 3OZVA 4NJMA 2Y8EA 2V4VA 5A7QA 4D9MA 2C2KA 3H1EA 4Y24A 3HJBA 3H0OA 1KWKA 2QQGA 3TQOA 1LI4A 3WYAA 2XBO2 4XQ0A 3P2YA 1ILWA 1RM0A 4MQEB 3VTZA 3DTNA 4QARA 5AD1A 1PZFA 1QQBA 1JU4A 3MMSA 3A4UA 1MIHA 4A7YA 4YASA 3ZYHA 5A7NA 1AUXA 1NFQA 2XB2A 3G7UA 1KO4A 1O95D 2YYYA 1Z0IA 5M34A 1SULA 3B2NA 3IQEA 3SXJA 2BFOA 2R8EA 3G0DA 5IKEA 2W4QA 4UUPA 4J16C 4DMKA 5FZDA 3PL5A 3NNMA 4KO4S 1DAFA 1JODA 5LNK1 4OCZA 5HIMA 3WLLA 5CJPA 5KYYA 2JD2A 3JPYA 4RPLA 4GE0A 1A34A 2PKQO 3MZHA 1IN4A 4MLCA 2PGXA 2XL9A 1AR83 3DXYA 4ZALA 1L8XA 4LNUB 4UI9L 5IU6A 1RUH1 1QK3A 3NBYC 2OD7A 3RHTA 4JEHA 2RKWA 3IQHX 1XRLA 5FZMA 4Y6OA 1P74A 2J3LA 2AS0A 2ZSKA 4NCXA 1A9OA 1ECFA 1UL1X 3A4VA 4FINA 4MROA 1W8WA 4DY6A 3SX0A 4DRRA 4A0RA 1E2UA 3IEMA 4K6MA 4RR3C 1ORDA 5AJTA 3PTAA 4PS0A 5EE1A 4E2XA 4LF7B 3GPCA 2FQWA 4M0MA 1NLFA 4RIIA 2X58A 1P0MA 2H48A 3I4IA 4I9FA 1C29B 1T6BY 3L4KA 1RXUA 2B0CA 5DLDA 3OU7A 3CLKA 1MGOA 4LOKA 1I30A 2G0TA 1TI7A 2BKEA 1GCOA 3DXFA 2Y6HA 2DCZA 3C85A 4GMGA 3DM5A 5E88A 4KREA 2ZEWA 4F7WA 4AWBA 1G291 3CL1A 3UUGA 3T7RA 5LRSA 4CM9D 4B81A 1I2AA 4NFHA 2EQBA 3G7DA 4OYYA 2ZAMA 3KPJA 1CJVC 2ZS8A 2YKGA 3KAJA 4DMFA 2ZAAA 1HNWB 4CSWA 3FZYA 4YRPA 4J0JA 4Y6LA 4IIJB 1GOGA 2A9KA 4OMCA 2NU8A 3O1IC 1S3SA 2ZSIA 3A3KA 1N3IA 5CAEA 4HVQA 2MMCA 1FMD2 1GV9A 4MYTA 4JYZA 4O6VA 3PHBE 2VJAA 3OPNA 3PSAA 2GZAA 1QJU1 5FR2A 4XAQA 3UJDA 4ALJA 3Q4GA 4A16A 1ZICA 5L7OC 1C1XA 4EVRA 4D4KA 3PRYA 3EIQA 5CB4B 4OU5A 5EZSA 1UEIA 2Z6QA 3JQ9A 2CXHA 5T3NA 3G2OA 3ILYA 3IMCA 1WPXA 4K03A 3L05A 1W2WB 3IJRA 2NXEA 4GMP0 1VCNA 1W2HA 1R091 4QJBA 1ZVVA 2P0EA 1QS0B 1Y37A 3NUGA 4BO9A 3HXQA 1VDZA 4BNMA 4AKGA 2YMLA 1JFFB 1R12A 1XFDA 1IS4A 5E1DA 4N53B 2QP9X 3TAUA 1LOBA 3H4MA 4HDMB 2FBEA 1X7XA 2G70A 4E4TA 5M04A 2C4NA 1SQ4A 1PG0A 1AV6A 4ZVSA 1R1A2 4LJHA 2WIKA 1Q8SA 2SKEA 4S05A 4QYWA 3RD5A 3I0ZA 3MRTA 1XMOB 3VZOA 3MJSA 3ZI4A 2XMDA 1X7WA 4LPKA 1NP6A 2VR1A 3CNHA 1PR9A 2IBTA 1UUFA 1HN0A 5F5IA 2VNSA 4COUA 1DZTA 1RS0A 3BT7A 4EROA 4G9GA 2Z79A 4ZQEA 3ZCVA 4WCDA 2NSHA 3SIXA 3FHJA 5J63A 4PLFA 3NYIA 4EYKA 2XJ4A 4XOGA 3UEOA 3AP3A 3V4LA 3A2KA 3EH2A 2F8TA 3J81k 2C9CA 1HRKA 4ILKA 1XPWA 1NXSA 3O5AA 2JAWA 4QX1A 4LTNA 2XUEA 1G6KA 1NYRA 4QU8A 4OI0A 1Z12A 1H2XA 5LZ9A 2H2FA 3QV2A 1QVAA 3SYMA 2DBRA 4MUXA 1P60A 4B33A 4OI1A 2HW8A 1DKRA 2DDUA 3CRVA 5HCHA 4MTLA 1G5HA 1YBMA 2GFHA 3O4FA 2VJMA 5DAVA 5BPHA 3T7EA 5JBIA 3WZMA 2I8CA 3W90A 4L8YA 4A23A 5ITVA 3URMA 1DQ1A 2BPOA 4I55F 1OB5A 4JRLA 1W0KA 4F5DA 3K46A 4TYYA 4YCNA 4E2YA 3O83A 4Q1CA 3ETJA 5DN6D 1I24A 5JPIA 3ZD9A 1KXGA 3H7YA 1HO3A 3PUYA 4Z3OA 1LX6A 3LIPA 1YCHA 4M1QA 3UOWA 3TSWA 4LYFA 1IHOA 1Q50A 1XQYA 4QATA 4ZDIA 4MUEA 3T3OA 4BJHB 1ZD2P 3A3NA 4LDRA 3SQDA 2D0IA 3DE0X 4OQZA 3NKFA 1Z08A 3ZPYA 3TRFA 4KNCA 3SX2A 2BT4A 4EG1A 4IWYA 2V3VA 1QDOA 2ZWMA 1J1TA 1L5WA 3M89A 2GYUA 4BVLA 3VISA 5FOTA 4QDUA 2YY1A 4FPLA 5I5GA 1M33A 4YCBA 5CXQA 3GBFA 2E7AA 1GZSA 1AM4D 1U2DA 2H1RA 2WQ4A 5E7JA 5KQGA 2RJ2A 1O6FA 3LH5A 1UINA 5I8PA 2IZ0A 4BGDA 5LRRA 1P1JA 5I9MA 2XQGA 2AW5A 3ETEA 1N2BA 2VZ9A 3K75B 1WCYA 3JQWA 1J00A 4O1HA 4Q4JB 3UT0A 4LY3A 4HDCA 221PA 2OPHA 2XQKA 3EG9A 1M1YB 1ZA7A 5AHXA 4DSNA 2OEPA 2VMGA 2I07B 1SNYA 3LU1A 3LVBA 4UOEA 4MLPA 5A32A 4MJ7A 3AEKB 5HZMA 2VXJA 2J48A 3N3AC 5LLSA 5SV5A 3RSGA 4JDNA 2OO7A 1E2HA 1QOQB 4HRYA 5DUVA 4NMLA 3AYCA 1AK9A 4ZI7F 2ZQZA 3IUPA 3W20A 2WMDA 3NL1A 3OPTA 4JS0A 3MLLA 3LSTA 1E0KA 3ENRA 2C5BA 1S0GA 1IBKB 2B8WA 3RVLA 4TQAA 1VECA 1Q91A 4PYQA 3HXPA 1SRRA 1L5YA 2XSZD 5L3ZA 3HYSA 1SG0A 4Y20A 2KX7A 4DT1A 2E5LB 4EG3A 1P2FA 3AJRA 3ZYGA 4KAXA 1FDTA 2ZJ4A 1VRH1 2I8LA 3D82A 2XJVA 1I2DA 3MFCA 2XMPA 3CZ4A 2DULA 2VZSA 1RHKA 4F2HA 1E7WA 3EXEA 5ALTA 7ADHA 4WN3A 4XQWA 1QGDA 3CVOA 5J1TB 2W47A 1OQAA 3I6YA 2PJZA 1RUI1 2J4DA 5IVPA 1QRDA 5DAQA 2K0GA 2G82A 1RC1A 2J1SA 2IIQA 3WLIA 3YASA 1Q19A 3UJAA 5FZEA 3HD8B 5LJLA 2D2IA 1GG2A 3MPBA 2CXQA 1TM4E 3VYSB 1O3SA 4ZN6A 1FX0A 1BCSA 1Z0UA 2PUCA 2X0FA 5EXSA 2VUJA 3RYIA 3RLIA 3LGAA 1Q3TA 2R49A 3K70D 4R40A 3N75A 4KW7A 1XJ0A 4ITCA 5FOXA 4IV1A 2ZYSA 1NAHA 1SCUB 1V5IA 2JDZA 1MQSA 4CEWA 3I39X 3QHQA 4TSRA 1LESA 1W87A 3NHJA 5FMOL 4ETMA 1HWYA 1LSJA 1Q1QA 1Y3CE 1TADA 2HLPA 1N2EA 3PPXA 4E2SA 4NAVA 3VQTA 3PEVA 2W0XA 3DP7A 2LW7A 2CXTA 4WVLA 1OYYA 3TAXA 4O4IF 1S2BA 4F4IA 4D8UA 5IM4A 2VF2A 5K1ZA 5CNKA 3D7SA 1D2QA 3MWDA 3RADC 1K5JA 3JWPA 4HKTA 1Y6ZA 3A1WA 1MX3A 4FD2A 4K1XA 1RYMA 1SKBA 1TF5A 4K9SA 3WLUA 1TFUA 2CNWA 1MIOB 1GARA 1ODNA 2ZI6A 2UZ0A 4RDCA 3B93A 3GLFE 4QBTA 1YCDA 3BJZA 3ESQA 2N75A 4JVNA 1ZW6A 4XJVA 1SVSA 2CYAA 1CULC 3B6ZA 5HM6A 1W9MA 1CK4A 4CG0A 3UJOA 3EAQA 1XDWA 1E2LA 1ZUNB 3VZKA 1ULCA 2IH2A 1VQ1A 4TL6A 4UCXA 3MF9A 1SUEA 4CFYA 2E0IA 1BD3A 3W3AH 1VLLA 4PIZA 4WXRA 4ZAFA 1V2GA 3WNXA 3WGTA 4EITA 4WA8A 3K0AB 4IUYA 2ARBA 4QQ8A 3HXKA 4J16A 3C5VA 2IYPA 5C3OA 2OM6A 3QBDA 2OHFA 3DEYX 4MX8A 1YR2A 4WZBE 3IAXA 4FCWA 4MIOA 5FUYA 3C8UA 2I91A 5JZGA 3IA2A 2ZRPA 1RI3A 3KCQA 5IK7A 1KY5A 5JI2E 1RMU3 1AZTA 5AI9A 3DHYA 1X9HA 4MICA 1DGWX 4Z2WA 3BMNA 4AQ2A 1IBCA 3HFSA 3DVSX 1UYXA 3RUDA 2J33A 4NZPA 4DNPA 2F8MA 2H4WA 4UTXA 3V9AA 1O7JA 1TK2A 2QFEA 3SHTA 2C2BA 3VR3A 5CNIA 1GZHB 3T0BA 1QJX2 4JB3A 2CV1A 4BCCA 4OP1A 4P4UA 3T0DA 1YZGA 2DSNA 2ZGUA 1Y4ZA 4TLEA 4A9AA 1M8GA 3M5DA 4NYIQ 1V6LA 3W9YA 3OP1A 2VAVA 4B79A 3SZRA 3H5RA 2HOQA 3LF7A 1G2OA 2P68A 5A33A 2E1RA 1LPSA 2BAGA 1N5IA 5GGXA 2FWJA 1DGRA 3H9EO 2NVUA 2ADMA 1JAZA 4DCCA 4UXHA 3HCWA 4XDPA 1P4HA 5BQ5A 5D2CA 1A8MA 3EF3A 4YWHA 1XU9A 3P27A 3C87A 2RS32 5FTWA 4N40A 1A4XA 1XROA 1YTLA 3HKCB 2R751 3OCYA 3T41A 1PJAA 3VBUA 4LDQA 3T08A 1E7YA 3GW8A 4TRNA 2ONCA 3E8SA 4UZSA 5BR1A 3LA3A 4YRSA 4B5KA 5BO5A 1XZCA 1NFFA 4PE5B 4CLRA 3ER9A 4FMDB 2AYZA 2IXGA 5HCAA 1K68A 4AYTA 3K16A 1BNCA 3AR3A 1OKKA 3KALA 2EKZA 2PGLA 4MB6A 4RPKA 4N1AA 1DZRA 1J0AA 4IEVA 4OQ8A 3UJBA 4RQPA 3JB8A 2IP1A 5KNCH 2OQRA 4PG6A 3FJOA 3K5PA 4GM0A 2C4TA 4EYEA 1OQ1A 4O4HF 3KF3A 4CIVA 4BWYA 5CLQA 1AR93 3UMVA 4W1RA 1XKTA 4HUQB 2I34A 2VHXA 4IMIB 3HO8A 4CM4A 5JZGB 4OGFA 4EGSA 1YQDA 2EP8A 4IE5A 3BWXA 4Q5IA 2GNDA 4A7ZA 3HLYA 2EIHA 4Z07A 3WMEA 4KR2A 2ZGOA 3LL4A 3A6GA 3ILNA 1YIAA 4A03A 3FW1A 1G8SA 1FX5A 4KPUA 4RR3B 2EC5A 3ST7A 4XDOA 2WAAA 1TMF3 1GDHA 1AX2A 2WQZA 3AERA 5I7VA 4DMLA 1JVNA 4G4IA 4HJXA 4Q0PA 2EHDA 4PZ0A 2FPUA 4TS3A 2EL9A 4DEXA 4F3TA 5EWLA 1WU8A 1SKUA 5GLTA 3BGOS 5CG2A 1QKKA 2ZYIA 3PFIA 1EGAA 4TLBA 2FSPA 1SIWA 3FCXA 1TEIA 1E4YA 5TVGA 1NATA 1B8UA 3FFZA 3N05A 1M7HA 1LGBA 2I4TA 3WG3A 4Z92B 5ADVA 3WW3A 3C1OA 3ZWCA 1NP7A 4B3NA 1GVHA 3ZWBA 3JSXA 4P31A 3R3WA 3S2IA 3KWMA 4DARA 1QFZA 1AR92 2XGXA 3EGEA 1RTKA 1TA4A 1A9SA 3GXUA 1H94A 4AZVA 3T1HB 1HRI3 3N2ZB 3AJEA 2GO1A 4UMFA 4ASUD 2BI8A 2PO5A 4XAAA 2OUJA 4Y2RA 2BRUA 3WP5A 2FP4B 2O0LA 4JLKA 3B6KA 5CEHA 2A73B 1C50A 2GM5A 1WJGA 1GKIA 3NT5A 4R16A 5L3RA 4OQDA 3KJXA 3IB3A 4BNTA 4KR3A 3CF6E 2YMPA 1I32A 4XQ4A 1J0CA 5HKKD 5IAJA 3I1JA 2X0KA 4EHHA 1X7WB 4X20B 4UJ3A 1GTG1 5F6KA 5IXJA 2NPOA 3PIGA 3ZXLA 2OHOA 4LUCA 1L7BA 4C08A 3QXXA 4ZZ3A 3BPZA 4B44A 4WBXC 3ZVRA 3UHAA 1RC6A 1H2YA 5KB3A 5KYGA 1VHLA 4NECA 1B8VA 4DPLA 2XMBA 1U99A 3QOPA 2OA0A 2AUYA 2IEZA 5JD6A 3H87A 5DK4A 3A9WA 4HAOA 5CDFE 4YDHB 3VKLA 4LO5B 1Q20A 1PWHA 4IH4A 2IYZA 1A2KC 4TRJA 1D2HA 3EDCA 3HNMA 4DT1B 1WNTA 1Q7GA 3WDYA 4Z4FA 1Y48E 5FYBA 1M72A 4EQ6A 2DFVA 3B5JA 3JRWA 3VSAA 1E98A 2NP0A 3BREA 5JCTA 2R47A 2H2IA 3L7CA 3G9QA 4XJ8A 1UCFA 1BG6A 1YNOA 5G04L 4PTYA 5TRTA 1J1IA 2W2XA 1RWBA 4OBBA 1DQ4A 2HRQA 3FLAA 3ZTWA 1DPGA 5FZ9A 3I6BA 1RPAA 1UFOA 4Q8KA 4RK5A 3AHJA 1UKAA 4RA6A 1ODMA 1HFEL 1RUC3 3BGVA 2IUTA 1NVXQ 1M2OB 5G0TA 1CUGA 1WCUA 2G7MC 5AM4A 3RBXA 2PQ0A 3KTAA 3RIMA 1N0UA 4YP9A 4FVTA 4EI9A 3WF4A 2P6MA 5KYWA 4YGBA 3RS6A 5JY6A 3RAGA 1D0GA 1L2TA 3H5LA 3PDIA 1RWKA 4KQ1A 1H66A 1BVP1 1Q0PA 3TL2A 4B3IA 4DLWA 2QAGC 1G5TA 4E4SA 4JX0A 4TLLB 3H8WA 4JP8A 4XRGA 4Q47A 1UOGA 2Q1UA 3LQ1A 3PKIA 3ICWA 4CJXA 3LD9A 4FFWA 3AUKA 2W94A 3GZTB 3IAM6 4L4YA 1UC5B 4FFFA 4NOKA 2RHJA 5FCDA 4JUDX 2HWYA 2ODPA 3DE6X 1JJIA 4RLFA 3C48A 5LQCA 4KN9S 1UQUA 2W70A 1L4FA 2DQZA 3IPVB 3ABZA 2ZJBA 4AL4A 1E4OA 2PT5A 2VS1A 2HXGA 4BUZA 2Y27A 4YBZA 1LB2A 4QWMA 4BIIA 1ZRCA 3OM0A 4KWKA 4HGNA 4TKUB 1RUI3 2ZJ7A 2B45X 4LLOA 3X1XA 1V8FA 5SV2A 4DA7A 2OAP1 4M9RA 1OW3B 1YASA 5EJ5A 3BDAA 3KOYA 3Q9SA 1P6UA 2H65A 1KOLA 1CB0A 1K3UB 3A1EA 4AIIA 2CFIA 1K63A 3FWKA 2ZGVA 4QPWA 3QI7A 4YPVA 2FSVC 5FFMA 1FVHA 3ZG6A 4CL3A 4IMPA 1UZAA 3CLVA 2GCIA 4QRHA 3GI1A 1XRUA 4QTTB 5A3OA 1ACLA 3E7WA 2W6JA 2XCQA 1MV8A 4LXIA 3T2QA 3L0IB 2VZ0A 4N3GA 5CKQA 1X1EA 1AR62 1I4EB 3AJYA 1RVF3 3PR2B 3SZLA 1IMOA 4WZAB 4DDUA 2QBYB 1SCIA 1QC5A 3R3YA 3NAZA 5EYXA 1C9EA 2WK1A 5FJHA 3PUWA 2OHHA 2RAPA 3GYDA 3MQFA 3RYKA 4OSEA 3RG2A 1HB3A 2ZI7A 2YW2A 2XZDA 1YZQA 1X1QA 1YFZA 4KWTA 3QY9A 5AFEA 2IX3A 3KT3A 2YJZA 5LMUB 3C45A 2WF6A 2L19A 4OA5A 4BZWA 5HIKA 1AL23 2JDKA 5D1NA 5A80A 1LTQA 2WF7A 4Z9XA 1AG9A 4Y9DA 3HHPA 3AF4A 4YMLA 4QQKA 2XJPA 3LLMA 4NCJA 4EBBA 1YQ6A 5CB8A 2JEMA 3VNQA 4OLBA 2BEUB 1ZJJA 3VR3D 5C3SA 4K2AA 4OXRA 2MCFA 1B00A 2WU4A 2BCJQ 3WK6A 5KWSA 3HJCA 2PIAA 3GROA 1JYIA 4JT8A 2E5FA 3MRXA 2JFFA 2GN6A 3N8GA 4ID3A 2LKDA 4X7RA 2FCVA 2CHHA 3KQRA 1RU3A 1TF7A 4I5FA 5TT1A 2O4CA 2FPIB 5T55A 2OZLA 4W5TA 3FPSA 4KN5A 1CUSA 1SQGA 3QFFA 3DLIA 4CU8A 4D0NA 2HCBA 3IMNA 1ZDMA 3HWX1 1WZNA 3E5QA 2XCLA 4XCAA 3DOCA 2O20A 1KBQA 2XCRB 4CN8A 1L6IA 3LW7A 4DRXB 4M0NA 2YN0A 2I80A 5FL7A 3ZSMA 1HDOA 5C2JB 4X8HA 2Q4RA 1IM5A 3U7QA 4TGLA 2A5GA 1C41A 5K8TA 2CNBA 3NHSA 3SKJE 1YQTA 3HYNA 4R83A 4U7WA 4R9AA 1YFXA 4KR7A 3EVNA 3FMVA 1UPBA 3NEAA 4PSKA 3T5PA 3N87A 1AK2A 3WIUA 1MUUA 4QPIB 4MRRA 1WU7A 1A77A 5EEHA 3IT2A 4Z86A 1KDOA 3GVXA 1MTOA 4Q7QA 4GQ7A 2WFLB 2ZJCA 3H5NA 4L6IA 3HFJA 3NV4A 3AJ9A 2JD1A 1XVLA 4C87A 2WWFA 1ZHOA 1H2NA 1PVC3 4E5MA 2QV7A 1XVAA 1PSZA 5B58C 3LF2A 2OO5C 3GLGA 4D81A 3JD73 5IVEA 2JGLA 5FY8A 3A9UA 1C9MA 1TRHA 3V1NA 3URKA 5DLPA 4GLBA 1HGXA 4PAMA 4XPVA 4HWGA 1MW9X 1N2CB 2VPTA 3M3DA 3TXAA 1IS3A 1OJ7A 2CV0A 3QX8A 4G5GA 4P83A 5WRFA 3AMPA 4AJEA 3CZQA 3BKZA 2J9FB 3WQ7A 4HYQA 3GD7A 3N59A 5LASA 4KKVA 2GAJA 5GJ6A 1J8MF 1YIOA 3VDCA 1COV1 3K3OA 3FGOA 2I4OA 4JU8A 1Y8CA 1QLJA 4MGTA 3OZIA 4MWGA 2ZCWA 1U0SY 3TN91 2FA9A 2HWF2 4MRSA 2B61A 2Q46A 2G1JA 3MPPG 4HH0A 1QDUA 2VT3A 3W1WA 1RHJA 1LECA 3CUVA 3OM8A 1ND2C 4IEOA 3ZMNA 4UAPA 2GVZC 5FPTA 1EHYA 3MTGA 4IFIA 1OFUX 1FJHA 4MGEA 1LZKA 4MRMB 4DJFC 2CJWB 4LKOA 1E77A 2QDKA 1KSJA 3VDMA 3PDQA 3SZOA 1KK0A 1MEC1 3BGWA 5DPNA 4P5HA 4KPUB 2QD5A 2JLAA 2ZJ1A 4UNSA 5L3QA 2YWEA 4HRXA 2R7LA 4X1OA 2VZ1A 2XJUA 4M3CB 2SKDA 4S0XA 4QOSA 4D0QA 5HCFA 3A9SA 4Q1EA 1YKFA 1ADYA 2RHPA 4IDHA 2E33A 3DZJA 4UFKA 3K20A 1JS1X 2C20A 5DGDA 1OZ0A 2OPBA 4B3GA 5LA6F 5HPYB 1IVYA 3SCHA 4FOWA 3VHNA 4D41A 2CDOA 5H3LA 4UF0B 5IS2A 4M88A 1K98A 3OZAA 5H1YA 4UM9B 2CFOA 1YHZA 1XEFA 5AXBA 1PT9A 4GMDA 1Q2XA 2ZTLA 1XTPA 3O4GA 2V97A 3GFQA 5BN4B 4E5VA 4N9IA 3HVIA 4KJZA 1O9HA 4D96A 2IHJA 1BEEA 5CIRA 4G1VA 3I8XA 3AJDA 2BFCA 1V37A 3AF1A 3UO8B 1JZTA 3JCZA 1UKVY 2CEAA 4Y6RA 2ENUA 2YX1A 2QQIA 4TT3A 2XA2A 5LKAA 4AVBA 4P9YA 3OKCA 1F4VA 1HE1C 5BWLA 2B98A 4YMSA 4J0QA 1JFVA 3BB4A 3SHVA 1CRZA 1F35A 1WX1A 4XQDA 1ETHA 4ND5A 3RQ0A 5JSQA 2PHUA 1P2UA 5B57C 3P9XA 1RT9A 2NYRA 5C35A 2D7DA 4L3WA 3QY0A 2X2EA 5D3ZA 4AY2A 1FLDA 2IUWA 2VTDA 1Z5NA 3X3HA 4B6JA 1GADO 3TN7A 3PVBB 1JMKC 3RS5A 4ZRDA 4YXWD 5BNOB 3GB9A 1OURA 1PIV1 1V9LA 3IO5A 4BPZA 4X20A 1XTBA 4PCAA 2OQ2A 4Q1AA 4UUBA 1U7PA 2BEWB 5CB4F 1SWVA 4UHKA 5CITA 4NVRA 5GINE 1JEQB 3SE7A 4Y0NA 3Q72A 4QJ5A 5IKXA 4KO1S 4W5QA 4JLUA 4YJFA 3T7TA 4NPMA 3EPHA 2JG8B 3Q8KA 4Y1FA 2I67A 3CEWA 1XTTA 3VD4A 1QJY2 4FI9A 3TF5A 4AYXA 5EXXA 4QRIA 3LWBA 1CLUA 1GRCA 1IATA 3ZJ4A 5FV4A 1HSOA 4M1YA 1NI4A 3ZQUA 1NUPA 1TQ5A 1NR1A 4V0OA 4HAWA 4FFDA 2MDTA 2VEDA 4FC6A 1W4ZA 1S55A 1P1IA 1VRVA 4EG8A 3L7AA 3NW4A 4D4GA 4QC2A 4I6JA 1XAGA 1U81A 1L5ZA 4KL8S 1FMFA 4LF8B 3HKDA 1QP0A 3I05A 1GAQA 2ZFUA 3E1KA 5ITWA 1IQRA 1IZ9A 3NAMA 3LIGA 3F74A 2GPBA 2Z56A 4V1CB 4IIXA 3LKJA 3EDYA 4WOCA 1HMYA 4Q6BA 1RZVA 2YRWA 4D7TA 3TDKA 1K5MC 4GWIA 2VHYA 4H59A 4EUEA 4L8LA 2P4HX 1JHVA 2XUHA 4HQFA 1T4CA 2V4MA 4CDGA 5CNMA 3C8XA 3AR9A 1E1QA 5TE9A 4MS1B 3VNUA 3R7WB 1H5UA 4P7KA 2A0UA 3WDSA 4OUEA 3ITDA 4XBNA 1WKBA 3RT1A 1Z25A 3S6PA 3RNOA 3SJCA 5KHKA 4RD4A 2ZS7A 4AKHA 4AJ1A 2EWVA 4WM7A 4ZWNA 1YA6A 4E15A 4Y22B 4WRRA 2VQAA 1DYKA 3SM3A 1ZN7A 3VR1A 3O90A 4ITRC 1BO6A 2DFKB 2JAOA 5T5JA 4B8ZA 1KO8A 3O0WA 1MLDA 5KO2A 3ZU3A 3ND6A 4B6EA 2GB4A 2W11A 2J30A 3HCOA 1UOBA 1TB4A 1QEXA 2KM1A 3MFQA 2XRYA 3BX1A 1RUG1 3V9PA 2SBAA 2K2SA 5AW9A 4FDTA 4ZOLF 2C42A 1PK9A 1DE0A 3UWKA 4KQFA 3IPRA 3UGKA 3U4QA 1SM4A 1A9XA 1H6XA 1QF3A 4IMRA 2O8FA 1D4VB 5DYTA 1TG7A 3O0XA 2Q0AA 4CF5A 1PL0A 5KVCA 1MPXA 4OD0A 2IOFK 1EP3B 1RYEA 4LV5B 2ZWPA 4YRFA 1D0IA 1SVWA 1N2CA 1U94A 4ZEMA 1GG5A 4UM5A 1KYYA 5A3TA 2H1SA 1SOAA 4I2OA 3RRYA 4HB2A 1VPTA 3UXHA 4EA6A 3ZH2A 1O4YA 5LXTB 1CUBA 4YM1A 4D43A 3HDGA 5E4JA 3QCWA 3E3OA 4EFMA 2QJOA 4G89A 2X5NA 5A71A 4O2RA 4F3JA 3OZWA 1DLJA 3DQQA 1RL3A 2NVUB 3WLTA 3PNOA 4UFOA 2JLCA 3BTAA 3DJYA 1H05A 3CZCA 1YZKA 2IW3A 5KWIA 2A1TR 5F98A 2FMTA 2B21A 2P6UA 2NQYA 2NP7A 3F98A 5K0LA 1OKKD 3ZXYA 3OT1B 4BWVA 3RASA 3H5IA 1U0BB 4RPCA 5IXYA 4FB4A 1NSTA 2XY4A 1JTZX 1FFCA 1O8SA 4KNWA 2C94A 4QPCA 2YJ3A 3AW8A 1S1AA 4TT3D 4KQEA 1SLIA 1EFPB 1MKYA 1H9PA 4YJ2A 3P2EA 2V98A 3W05A 4P22A 3HEAA 1ZOPA 1CR7A 2GMMA 1VL6A 5LD2C 2EFDB 2ZYHA 4TM8A 1Q8OA 2QE7A 3WWYA 2PL1A 1HL7A 5K01A 2E4XA 5E8JA 4Y2GA 3LO5A 4AYUA 4QPDA 3C6XA 4EECA 3TJMA 3B8EA 4HL0A 5JJCA 1FTGA 3K9NA 2XWBB 2PAEA 3MJTA 3UWMA 1JBQA 4L3VA 4XX1A 1JDNA 5CDUA 5M7EA 3M4FA 2AD1A 2Z4RA 3DLCA 1HRI2 3BF7A 3I97A 1YV9A 3FHCB 2WKPA 5CCXA 4G1MB 1IQ0A 4PM4A 3HOBA 4GZMA 1O97C 1PDWA 1V3VA 1HRDA 4R2MA 1M66A 3EDMA 4QPPA 5AKJA 3OJBA 2BGCA 1N0WA 5K0NA 4CQLB 4XHXA 3FWYA 1DKOA 3EGOA 1T9BA 4EUFA 5G3YA 2JARA 3A6FA 1Q56A 3I83A 1LWOA 2PJUA 1CP2A 4FYXA 2PTGA 1Q8PA 4DV6B 1J2EA 2K7ZA 4DREA 1QY4A 3ZBUA 4TYMA 3REOA 3QFRA 1E7QA 4UDXX 1DFHA 3H99A 1M2FA 3HFRA 3H8OA 1NJFA 3RO7A 3R0VA 3VDQA 5FP8A 1I7DA 3BBLA 1F8FA 3TE6A 3W5SA 4UE3S 3IUEA 1FJ2A 2PAAA 2HFJA 1N1VA 4W1SA 2W6ZA 4D4LA 1TLTA 2Y64A 1RUE1 4ERNA 4U9UA 4B6OA 4CP9A 1UWCA 5DXDA 4HMOA 2CXPA 1QHNA 1ZVJA 1QE3A 2WTMA 5I8ZA 3L04A 1MJGM 4D6YA 4G8CA 5CLIA 2BRTA 2UYQA 4PQGA 4RYLA 1N7IA 4A4AA 3JUUA 2H5JA 5L9BA 3PRKE 1R8SA 4YMWA 3QWFA 4WK4B 2PXCA 3AUUA 3FCAA 3LUPA 3DBLB 3AZQA 1H2ZA 3A1UA 3U0VA 3U37A 5B1IA 3ZDRA 4B29A 3RJTA 3VFDA 4ONUA 1J9EA 4WV8A 1XAJA 1E3SA 4BRZA 1C2YA 1SHZA 2ZUWA 2HDNB 2P3KA 3BKXA 4DC1A 5GV7A 3U44B 5JSYA 3G82C 1FF9A 1Z7YA 4F60A 4NG5A 2DFLA 3KYBA 3KLSA 4O7XA 4YG6A 4ZPIA 2D7CA 4FK8A 1DQ2A 3MIEA 1CZNA 4R05A 4MVCA 2X15A 1WBDA 2ZEZA 1UMDB 4HNVA 1NLUA 3PXXA 4MINA 4B5LA 5CLHA 4FGZA 2DTDA 3AV3A 1SFPA 1CUHA 2PNFA 5FJIA 2RS33 2B3DA 3VHQA 2V45A 1WBFA 1QR2A 2CNNA 4V3BA 4MYSA 1YMQA 3VZNA 2BR3A 4KMMA 3W6NA 4OL9A 1OXMA 5JD4A 3WYDA 3TGPA 4BN5A 2Q6LA 3KUUA 1AYN1 2ZRQA 5KI6A 1RI2A 2AN5A 4AIRA 4S1PA 5E1RA 2YFKA 1M34A 2QT0A 2Q5CA 2EFEB 3MI8A 1C7EA 3V64A 1L7VC 1TW2A 2QI9F 2Y1DA 1YB4A 3C3CA 1O0SA 3UPDA 5F1YA 1E32A 4JOSA 1YL6A 1U0FA 3DQPA 3ZN5A 3I1YA 4RWEA 4KN6A 1ORTA 5IFTA 1BAPA 3IP6A 1RUF3 3QUSA 4P7BA 5H59A 3D6UA 1AL21 5HUHA 5C9ZA 2RMU1 1NE2A 3UA4A 2QZ9A 3H65A 4QAQA 4WXMA 4KQCA 2WYUA 5E0OA 5I9LA 3AKEA 1JQLB 2XQXA 1CZOA 3BJRA 1VL2A 1PYDA 5ACA1 1T8RA 3FI9A 1NZJA 4MULA 3OC0A 2JG9B 1GPMA 1AK1A 1F9AA 1PJBA 4KU8A 2MT9A 4W4ZA 4A6SA 5EWLB 1BJKA 3T9BA 1U5ZA 1GGHA 2ZAHA 4MR8B 1G5IA 1QC5B 3U4CA 4N0MA 4F9GA 4EIWA 3P9RA 4MAAA 3AL3A 1UKYA 1M83A 2RCNA 2P11A 3SEAA 1XU7A 4HEQA 2E21A 2C2WA 1KH2A 4A7KA 3EXUA 3CLSD 2WIFA 1AJEA 2OMKA 4X65B 4NAMA 2FMIA 1G4UR 1Y4AE 4QJ3A 2C31A 1OLQA 3R6TA 5KS2A 3OQBA 1YJ5A 4DIDA 2IBSA 4GEGA 3TNLA 3AEQB 1FQOA 3LC2O 3AKSA 1C81A 2BEJA 2WNVB 4URFA 1QSGA 5E3IA 3IB6A 3LLUA 4PG8A 4QICA 5JFTA 2WA2A 2VCMA 1VLJA 2I33A 2P4EA 4L16A 4BM8A 4Q9IA 3A0KA 5TC4A 3CH4B 3EMBA 1EVEA 1MFZA 3IV9A 1WV0A 4UXIA 4CPBA 1K3FA 3COVA 3HBMA 4G56A 4HLCA 3V8NA 3IUSA 4RU1A 4ND2A 2ZSHA 3JARB 4IE4A 4JOBA 5JWHA 3ESXA 3T1OA 4XUDA 1GNLA 1KU6A 3KL2A 1DIWA 1E3DA 2BTOA 3HDTA 2V0NA 1OASA 1YJCA 3JWHA 1WOYA 2J31A 3HVHA 4DJEC 1FU7A 2GP5A 5KNDD 4EZHA 1QV7A 1DJMA 3P0EA 1Y1PA 4NP6A 3NEPX 2JAXA 2QPTA 1RUE3 5H3HA 3JW8A 5HK8A 3NO4A 4D57A 5KJFA 2ZRJA 1JAIA 1GYPA 5TR9A 3BH6A 4PNZA 5C8YA 2AG8A 3HDVA 3ROXA 4AKEA 1YVDA 4EPTA 3FWZA 4NTZA 3NHBA 2Z8YA 1OSNA 3UGTA 1CQJB 1USUA 3RFCA 2JD0A 1E7SA 5K8IA 3P2KA 3DE5X 2J9GA 3VGJA 1R1DA 5LZ6A 2A94A 3S30A 3TEJA 2HRDA 4F4JA 1FUKA 2X5OA 1B43A 5JZSA 5CD1A 3SLGA 2NMOA 4ESHA 4CWAA 3TPCA 1ZBDA 4Q4V1 1CAWB 1MAHA 2IYVA 3BXGA 2DR3A 4RKQA 1AKRA 2QMEA 1EAH3 1GAJA 1CJTC 3MINA 3BF8A 3RVQA 2OFWA 1O94A 2G04A 1O6ZA 1Z0ZA 1UBSB 3EF0A 3V4FA 1J8DA 4YJ2F 3NC1C 4GLOA 5FNVF 1O08A 4JDUA 1QYDA 5CYPA 4NHYA 1GQRA 3IERA 2CMGA 2PQMA 5JNUA 4FD3A 2VDPB 2PKWA 5IULC 4MZDA 3AHGA 1TTHA 1U90A 1P39A 1A9XB 1Y9ZA 4XE9A 3KT8A 2GMWA 3SDBA 3KXKA 1L5NA 3WGKA 3PUHA 1CUYA 3KQLA 2E49A 3TX6A 3GJ5A 1GZVA 1I6LA 5B3JA 1OYWA 4R1QA 2QTBA 5GZ1A 1BU8A 2R96A 2QSZA 3TDMA 2V74B 4XD7A 1LRKA 4BWFB 4DCNA 4UNNA 1FOD2 1TE1B 3MVEA 2AACA 5C5CA 3K2QA 2YC2A 1ST8A 1H3EA 1Y9MA 4QFDA 2LR0A 1S8OA 3ZI7A 1CUJA 2PN1A 5DHRA 3IGFA 4HXGA 2D7JA 4O33A 1WW8A 3DBHA 4KDRA 1T5LA 3RROA 1SQ0A 2HHCA 3WL3A 1RAAA 2JH3A 4TKZA 4QAWA 2Y0EA 1PDOA 2QMZA 1FU4A 3FNIA 1DTEA 3AYDA 4MHUA 1VPVA 2NO9A 1D1QA 4OV6B 2G4IA 4OKSA 2WIGA 3L9JT 1X70A 4DRXA 1PYOA 2G40A 2QJWA 4DVGA 4Y67A 3WHUA 4PT6A 1HLDA 3OB8A 1KI3A 4NOMA 5A03A 5GJVC 5I7SA 2P78A 3FFQA 4L5CA 1ZA4A 4PWYA 1CRQA 2BGRA 4HQNA 4RF4A 5DBGA 3ODGA 1EEXB 1NA5A 5TQ0A 4ZO8A 2OV1A 4YLEA 5L9AA 2FQXA 1XXHA 5DCYA 4QB6A 1LQUA 2WZPP 4YAWA 1Z6YA 3OI7A 4EJ0A 1Z5UA 3P0IA 4I5DA 3OPQA 4XHBA 3DVAB 4G01B 2P2YA 2PV7A 3REQA 3PHCA 4FZ5A 2K5UA 1XRQA 2Q21A 4I4TF 2R5FA 1MC5A 3GVHA 5ALKA 2IU6A 1V1MA 1QNLA 3A37A 2UXBB 4D6QA 2X1HA 2WWXA 5IN4A 4AHYA 3T52A 4QO8A 2HBQA 2X1LA 2QHXA 3L4BA 4X44A 1FMD1 3OIVA 1N5JA 1RUF2 4U0JA 2UWBA 4DCPA 1JG1A 4GI1A 3KOMA 1ZJWA 1RJFA 5DUXA 5IFLA 1POWA 2R65A 1W6OB 1WQ1R 4NCAA 5IYZF 4WBNA 3A6HA 4C30A 2EZ4A 3NYRA 1YQXA 3GA0A 1CIYA 3ANTA 3MYYA 3BALA 4QB2A 4YW4A 5F51A 4P9LA 2GK3A 3FI0A 1UT5A 4AZ0A 3E5RA 1CNFA 5JDCA 2NADA 4P9JA 3W5NA 2HTFA 5J2TF 1AQLA 2D98A 1Y9GA 1GKBA 4MHOA 5M5BA 3VDDA 1JKMA 1XTKA 2RG1A 3D43A 3HKDB 4JGZB 2BMVA 2Z4SA 2A7XA 2BOVA 2C5SA 4RA9B 1RRVA 1U28A 4IUGA 1L5GB 4V2VA 4V1CA 1AVBA 1AT1A 3H3JA 5DYWA 5I7AA 5KTOA 3Q8CA 2H1HA 1H0HA 4H35A 4B82A 2IELA 3HJHA 1EX7A 4E03A 3DAHA 1AN9A 1V8ZA 4FEEA 4L6AA 2NSYA 1ZVMA 3D4KA 5D5HA 1GXSA 4FPGA 3LEIA 5IHRA 3VBSB 2RI6A 2JWPA 1VJGA 4TMXA 3IUYA 2O7RA 3KWLA 1KWGA 2YQ4A 1LX7A 2I87A 1BCXA 5KOJA 3A6JA 3HP1A 3AC0A 4Y1VA 4GZ6A 3JTMA 4I55B 4D8MA 3R75A 3HQRA 3VO8A 5DG2A 3UMRA 3R5KA 3RE1A 1XZDA 3LT1A 4LGMA 3LA7A 3FNFA 1IM2A 1JEQA 1L7OA 5EMLA 3HPQA 2J5BA 3N3HA 3GA5A 1WCDJ 1CY0A 3A2NA 4NMHA 4RD6A