2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
3VDCA 3WNPA 3D3AA 2ZEYA 3A21A 1OH4A 4RN5A 3OB8A 3DYMA 4MGSA 4JKMA 1SHWB 2QQMA 2LS6A 5HXMA 3I3BA 3T0DA 3LEKA 1TVGA 1UZ0A 3OGRA 5JXGA 2QQLA 4OUEA 1D7PM 4H08A 3W5NA 4QB6A 2WO3A 4P02B 2VC9A 3OG2A 3FL7A 2VOTA 3OGSA 2VCAA 4DUXA 2HYXA 1HN1A 1ESEA 1L7RA 2L9LA 2RVAA 2J1RA 1DLCA 1LNSA 4JHZA 4A4AA 1JZ8A 3SEEA 4K7JA 1U8UA 2VTFA 1W0NA 4HG6B 2Q0SA 1JU3A 2BGOA 3CQOA 1WCQA 3I2IA 3F2ZA 1JU4A 3C1UA 4DEVA 4LPLA 2B4KA 3HNBM 5IYYA 1ESDA 5IHRA 1DYOA 1VYHA 2ZXQA 3GXUA 2WN2A 1PX4A 1UMHA 3C7EA 2EICA 5JUVA 3HN3A 3EB7A 2VPTA 1ES9A 3WEZA 2J7MA 4KI5M 1ULPA 4MOAA 3NNGA 1I5PA 2VQUA 4QX3A 2YFUA 5B5SA 2C26A 4PQQA 4OMDA 2WABA 2WUHA 2VZRA 2XQXA 1US3A 2QQNA 2W1SA 3A23A 4PF1A 3C8XA 4BXSV 1JI6A 1BHGA 1W9WA 1V2GA 1UY4A 4A45A 2ZEZA 3T2OA 2VO5A 3LPGA 2W1WA 1Z8HA 4K3UA 5G05L 1T2XA 3IDAA 1WKYA 5G04L 4W50A 2CDPA 3WF4A 1O8SA 4BK4A 3NJVA 1UXXX 2YB7A 2QQKA 1W8OA 1GMMA 2VZSA 1UWWA 1IQDC 4XVHA 4DXRA 3VD9A 2WZ8A 1XNAA 3ACIA 4QDSA 1W99A 2VZVA 2ORZA 3OBAA 3GM8A 4MO3M 1JYXA 3CKHA 3MILA 4XUQA 1F4AA 4W4ZA 3OEAA 2W1QA 4TXWA 1R64A 4LQRA 1F4HA 4PT6A 4DUVA 3EYPA 1JZ7A 4OAOA 2W1UA 3OGVA 2E32A 1NUKA 3UESA 2JD9A 2X09A 4Z2AA 3WNOA 2O14A 1UMIA 1BWRA 5JXJA 2W3JA 5B4XA 5EIYB 4TTGA 2E31A 3GDBA 3RJTA 4MADA 2J1EA 1NX9A 2QQJA 3T0AA 2VZOA 2Z4FA 3DECA 2WO2A 1EUTA 2Q0QA 3IAPA 3WF0A 4A41A 2Y6LA 1JYVA 2VZ1A 2W95A 4W8JA 4ZY9A 2J1TA 1J00A 2Y6HA 3MV11 2ID4A 4QDQA 4JJ6A 2B9VA 1PMHX 3JXSA 1H6YA 1IVNA 1UY3A 3LEGA 2HLEA 3HNMA 4RSHA 4LKSA 4UI9L 5JXHA 2ZEWA 3ECQA 3K46A 1GNYA 1ULOA 2BZDA 3VDAA 4PPYA 4JX0A 2CDOA 4ARXA 2WBKA 4XUNA 3FHQA 2Y6KA 1SDDB 4LHSA 1DEOA 3DYPA 3CDZB 4MGQA 3CMGA 4TX1A 4OZOA 4BJ0A 3ETPA 1GOHA 2VM9A 5JXIA 1JZ5A 1KEXA 1UXZA 3U37A 4QX0A 1XPWA 4ZZ5A 2C9KA 2Y6JA 3SKVA 4JKKA 4Q9AA 5LA0A 4P08A 1CX1A 4A6OA 4CU9A 5I0DA 5C70A 4JJ4A 3IIIA 2VZUA 5B4NA 4QAWA 2VZ3A 4M4RA 5JMOA 3HJRA 2DDUA 2VMEA 2DCKA 4A44A 5A1AA 5C7GA 3C7FA 1GU3A 2W91A 2OKXA 1FXWA 4IUGA 2W94A 2WAOA 2APJA 1ESCA 2HSJA 4K9SA 1JZ6A 4BK5A 2WQ8A 4AAXA 3MO4A 2C4XA 1ZMBA 3WNLA 3CZJA 4OAPA 3VD4A 3ABZA 3ACHA 3FHAA 4RW0A 4D8MA 2ZEXA 3ACFA 1K45A 3W7VA 1TG7A 2BGPA 4JHLA 3IAQA 1GUIA 2BERA 1WABA 3C7GA 3DT9A 1XC6A 3SLRA 2LW8A 3MV01 2VZPA 3J7HA 2XONA 4UAPA 4HYQA 3THDA 3PUHA 2EIEA 4D0QA 1PP4A 3PT5A 2KD7A 2WZEA 2EIBA 3MUZ1 5CD9A 3P1IA 1YZFA 1UY1A 4A3ZA 1DEXA 1FXWF 4L0PA 3LQCA 5DPNA 3I2FA 1OF3A 1K12A 4XUTA 5IJRA 3P6BA 4GWIA 4FI9A 2X05A 1OF4A 4UOJA 4XUOA 1UYYA 1J83A 1O8PA 1VJGA 3CIHA 2J1SA 2PQSA 2R7EB 3LEIA 4ET7A 5HOEA 3LPFA 4QB1A 4QX1A 4A42A 3WNKA 3CZUA 1KGYA 2WAAA 4NRDA 2W9XA 5LCWL 4BDVB 1OD3A 1K7CA 3T09A 3I2JA 4P5YA 2VCCA 4OYUA 1BWPA 5BN1A 5DN2A 3VD7A 1UX7A 5FUIA 3T0BA 4QPWA 4M8KA 3T2PA 4S1PA 2XOMA 2QQOA 2YFZA 2J1AA 2W87A 1CZSA 2V5DA 3T2QA 1NAEA 2DCJA 1O59A 5C71A 4XZUG 3C7OA 4QX2A 2VL4A 1OT5A 5DQ0A 2X10A 3ZM8A 4AG4A 3WNNA 1K3IA 1PMJX 3SEPA 3C7HA 4CU6A 4QB2A 4DXSA 2RJ2A 3HEIA 4KMQA 1JYWA 3OEBA 1W9TA 2EIDA 3VD3A 1W8NA 3AC0A 2QQIA 1PX3A 1MPXA 4YPJA 1GOFA 4JKLA 3VDBA 3HP4A 3WF2A 4RYDA 2XHNA 3K4DA 3HNYM 4HF7A 1UY2A 4KWUA 2YC2A 2WO1A 3UNPA 3K4AA 2VQTA 4I8IA 4CVUA 5JR2A 4GWJA 5LA2A 3SKJE 3ACGA 3W5MA 4CU8A 3DT8A 1BWQA 3I3DA 4QDRA 5CZKA 2W5FA 2VJXA 3NRUA 3PUIA 5CYYA 3I2GA 2W92A 5IFTA 5HPOA 2W46A 3K77A 3MBWA 4OMCA 3FN9A 2ORXA 3P94A 2VR4A 1H6XA 2Y64A 3WF3A 1NKGA 4ZXEA 1GOGA 2VZQA 3E1F1 2V4VA 4M4PA 2VMCA 3THCA 2WYSA 5IFPA 2V72A 2VZTA 4ARYA 1US2A 2E26A 1P8JA 2YG0A 4P00B 1K42A 3UETA 3WQBA 1RYYA 2J1UA 3WNMA 3DT6A 3IB3A 5A4AA 3NJXA 2W47A 3K75B 1JZ4A 3NQHA 1J84A 4E8CA 4K40A 1W9SA 1JZ2A 3I2KA 3A7QA 4JGGA 4XURA 2J1VA 5EJZB 3I3EA 4ZZ8A 2Y6GA 4GZ9A 1JYNA 5LA1A 1UYZA 2J22A 3KVNA 3I2HA 3I97A 1JHJA 3BN6A 4DUWA 5F7UA 3LE0A 3WSOA 1SG3A 4IYJA 4DEQA 2VMDA 5J1XA 1JRLA 4CU7A 3MUY1 1YQ2A 4XUPA 1CZVA 3DC7A 1CIYA 2BBAA 5JD3A 3DYOA 3GGLA 1L7QA 2QBXA 2JDAA 1UYXA 2WDBA 4CUAA 4JKOA 3DCIA 2VCBA 2JE8A 3VD5A 2E33A 4CUBA 1CZTA 3BGAA 3HOBA 3BZWA 2YC4A 1EUUA 4CUCA 2JKXA 2RV9A 1UY0A 3HPNA 3A22A 1JZ3A 3K4ZA 2Y8KA 5EJ1B 4DXTA 4Q7QA 1DP0A 4E8DA 2VMFA 1GQPA 3T08A 5DMYA 1XNTA 2WN3A 3WF1A
chains in the Genus database with same CATH superfamily
5EYYA 1W25A 4UU1A 3B5LB 4UUAA 2L17A 3EJKA 4JOQA 5T5LA 4YREA 3LWCA 5F39A 2CL0X 4E12A 3MW4A 4EO7A 4GKVA 1XJ5A 3DFFA 1SKQA 3OGSA 2F3SA 4A4AA 4CIYA 1ZA4A 5FZ6A 4C8DA 2ACVA 1XA0A 3JAKB 5CR9A 4P32A 5ITZB 1G5TA 1FU8A 3QX8A 4RENA 5IXSA 3CUTA 3QVLA 2O8EA 2YV4A 3URFA 3CW8X 3K5WA 2VW1A 2GVDC 3FDZB 4GT1A 1QPGA 3GBFA 2G0TA 5D3KA 3ODGA 4OXYA 1XNQB 1KQOA 4ONEA 2PGDA 1X1SA 4TWAA 4GECA 2CF6A 1AKNA 1ODIA 3HWSA 5AOVA 1Z7WA 1HDKA 1J59A 1ZH8A 5DUUA 3TVYA 5A7PA 1YJKA 2VWHA 2O7QA 2BEJA 1XNAA 3H1YA 1VBD2 1N47A 1R083 4MVJD 5DN6A 2OCBA 2V65A 3UT5B 5B3JA 4L4SA 2P2DA 1G19A 3NASA 3D4OA 4INJA 3MFYA 5DXJA 2V54A 3AZVA 5HKKD 3SSNA 3P0IA 2IXDA 3QKRA 3OEWA 1XTKA 4QGGA 2V96A 3LDGA 1EU1A 3PUVA 1C8M1 1V2HE 3C5VA 1JB1A 1XNKA 3DL7A 1M34E 1XTZA 1NIPA 3INRA 2C2BA 4RD2A 4XWWA 2D4AA 1H9BA 1FP6A 3Q8LA 2O20A 4OYLA 1U7HA 4N49A 1FT9A 4NXMB 3HEMA 4XM1A 3RYKA 2RHJA 4JSYA 5DN9A 3JAMA 1PZXA 3MWEB 1ZRCA 4P08A 2I03A 4U2DA 3PF9A 2XYHA 5B4NA 1RI1A 4KBBA 2VZ3A 3QYPA 4N39A 5F2EA 1K97A 4XYXA 2ROQA 3N6XA 3SYLA 5BXYA 2HA7A 3FYTA 2Z3ZA 1Q1QA 5JI7A 2RBEA 3C7FA 3ASYA 4X1IA 1RI3A 1R0ZA 4ZCMA 4GKXA 5BXXA 1KERA 2HA0A 3LDKA 5KTPA 2DULA 5T4EA 3BGIA 4CIDA 1H1IA 2BHSA 3PSAA 1P1JA 1NYWA 1FSPA 1UOEA 1QGZA 3TEWA 3DZIA 2ZGLA 3CRRA 5LYJF 4BFLA 2AL7A 4IV3C 5EFUA 1MQ9A 3SQNA 1ELOA 3A4NA 3LJKA 4EY3A 1BU8A 3CY6A 1TQ6A 1NW9B 2H11A 5KCMA 3Q2IA 5LZ6A 4ZYZA 3IUPA 4BO1A 4LHNA 3MPUA 4OUMA 3HI4A 3OMWA 2IZZA 1STOA 1B2LA 4NHKA 4N7MA 4P7BA 2RDNA 4FBLA 4OHRA 2CMDA 2UZAA 3WLEA 3KYDB 2QQOA 4TTPA 1P2VA 3T7DA 4GMFA 2N46A 1CRZA 3RU7A 3W3ZB 5K0GA 1Y81A 1UMDB 5CEFA 1AYN2 3OE7D 5BSKA 3V0AA 3KV5A 4AFCA 1JHUA 4CMJA 3UN1A 4ALLA 1JEYA 6REQB 4WXRA 1QWOA 2D2VA 4TN7A 3VR2A 3D5QA 2HWB2 1WBLA 1BE0A 3ZDYB 4W6WA 5TQ2B 3DQQA 2RK6A 4PAMA 4ZAYA 1L8AA 3VR3A 3SEAA 3R8FA 1JVNA 3DT8A 1CY4A 3NPMA 2F4NA 1CJUC 1PUJA 3KJXA 3RYPA 4QPGC 1U0HC 3CKMA 1RXIA 1M67A 5ARDA 4QGBA 4K6FA 4ARZB 3CURA 5DRTA 2BKAA 4ZZ2A 1T6YA 1SXQA 4IVPA 4QU1A 1NXXA 2P27A 4HYYA 4PX5A 2YDYA 3LH5A 4U2EA 2DT8A 4F2PA 4OHYA 4P4UA 1URXA 1Q1EA 4KE8A 1IIRA 4XWGA 4FPCA 1HDZA 4FP9A 2AJDA 4I50F 1OI7A 4G37A 8MHTA 2RDMA 1OXBB 1DQSA 1MH1A 3H5LA 3GEPA 2WM9B 3ZTYA 2NOAA 3JYPA 4GOKA 5LBTA 3GNLA 2ZJ4A 3WRYC 4MP6A 3ODPA 1EVKA 3Q7PA 3NETA 1RXSA 4CUBA 2ATIA 1V39A 4TTQA 2QRJA 4A0HA 2YW9A 4UPEA 2V4MA 1BWSA 4GPBA 5C33A 5YASA 2HBRA 3VR5H 4KGDA 1U0TA 4OBXA 2O2JA 2QVXX 5LMZA 1JSZA 4BN0A 4BLQA 2VH9A 1JBQA 3INYA 3H0KA 2Q3JA 2VVTA 2AQIA 4B3JA 1WW3A 2YJ5A 2R25B 4FYMA 3EBPA 1UDWA 2GI4A 3OOJA 3PX2A 4QOSA 1UPAA 5TSWA 5EJ8A 4HNHA 3TNLA 1FYUA 1B3BA 2ETVA 4MK4A 3CVUA 4JZYA 5JVDB 4KMSA 2WWGA 1YB5A 3H9CA 5ESWA 4Q15A 4DM3A 2V3WA 4ETMA 3S3TA 2CNLA 3OCPA 4IETA 3JARB 4IS2A 3O03A 4GJYA 1JXNA 3GHHA 3A9CA 3C7AA 3SM9A 1OWOA 4S1NA 1BCSA 4UVDA 4E21A 1XU7A 3NV3A 2O1SA 1GA1A 5FA5A 2WMOB 2QA5A 4DGQA 3LP5A 2ZJFA 1R0SA 4AS2A 1OYYA 2X76A 4P54A 2VJDA 1WLCA 2FN9A 1ZMRA 3IEKA 3SSMA 3X3HA 2B21A 1N5MA 3OCVA 1F0NA 4LY0A 2GK6A 1C80A 1DG9A 2ORZA 1CEEA 3N87A 3NHBA 2ADEA 2P9TA 4W5WA 3CKHA 2XKAA 2QNKA 3O0WA 2HIHA 2W1QA 4AS3A 2XE4A 1O6GA 1NVEA 5KWIA 1EB9A 2OAQ1 3CFYA 2CFSA 3HO8A 4P33A 3ABOB 3ROQA 3G5LA 1X7ZA 5HV0A 4Q18A 3HY6A 1K4YA 2ZI5A 1H4TA 4FLMA 1VBD3 3A31A 1VGRA 1XQXA 3RTGA 4P9GA 4M1QA 4PSCA 3CR7A 5HI0A 3BTVA 2AW3A 4LIPD 1FRNA 4TWIA 4QOGA 4IWXA 2P5SA 1A6CA 4AZVA 1C50A 1XU4A 2Q99A 2IZ5A 5TQ0B 3TDMA 2LM3A 2XMDA 1RLJA 1ZI9A 1XDGA 5KTOA 3E3MA 5I7UA 4PJYA 1CEQA 1IC6A 3FE2A 5T4HA 1M9NA 5HCAA 3AJAA 4WV8A 4DR3B 3D4BA 3FH0A 3Q8BA 3FPJA 3FCEA 2QJVA 5JNTA 2WKKA 5HDBB 2IFTA 4WM7B 3QMWA 2H7YA 3EQ6A 3OPTA 3TRKA 2I2XB 1QJ4A 3C5CA 2AF3C 3G9UA 1N3IA 4P7KA 4DB4A 5DTIA 2XEDA 4CQJA 2XPCA 4I01A 3PU8A 1QF7A 5IN4A 2LIVA 1K45A 1QGOA 2RGNA 4XYLA 4MV2A 3MRTA 5ER6A 4RD6A 1AQYA 2QD5A 1SBIA 5I0TA 2YN0A 4WBXC 4D0QA 2JJYA 5A6SB 1IK6A 1H2XA 2B37A 4N3AA 2IXGA 2GA9A 3OH8A 3L82B 1OFVA 1KOJA 3TZHA 4A3SA 3DV8A 2YY1A 1UXOA 1TC1A 4XFFA 1KEZA 1LU2A 3KOMA 2PKWA 1BWPA 4OYUA 2NMOA 1IB0A 5E8AA 2VOEA 2ZJBA 2VTKA 4TV9F 4C5CA 1HR0B 4EWLA 2ZVDA 4H27A 4MHRA 2A4KA 2WFF2 4RPCA 1Q0LA 4F1JA 1FEZA 3DHNA 2HU2A 2OCDA 2XAUA 1ID8A 3KQSA 2D7FA 2HADA 5IATA 4ENVA 1TIBA 4AZ3A 3I0MA 3K5IA 3E5XA 5GV7A 2XRMA 1OYVA 4FXOA 5I51A 3QKSA 1T9CA 3HNYM 2CLSA 1OPMA 3L8GA 1HL3A 2G25A 4K05A 4DCPA 3W2FA 4XCBA 1HKHA 5A7HA 2NWQA 4GMXA 5I7OA 2O3TA 4HH4A 2FX2A 2A0UA 4B6SA 5L4NA 5L3QB 3F6PA 4FQZA 1QKJA 4R2LA 4C43A 1CIWA 4D3WA 2J41A 2G09A 1FFGA 5IEBA 2E63A 3KJQA 3DEMA 3H2JA 2HWB3 2AG8A 5GOZA 1CDZA 6PFKA 1NN5A 3RQIA 3NBQA 5A9SB 1CX4A 3I9NA 2OV4A 2IWGB 1E62A 4ND8B 3Q8AA 4E8CA 1THGA 3FUVA 1ZZEA 2IUWA 3LW7A 4DRZA 3OI7A 1U7DA 2JENA 3NALA 2QJFA 4XACA 1BMFA 4LR4A 1PT7A 1N2BA 2XSZA 4PZAA 5D3QA 5E9QA 3V1UA 4PWYA 4QDUA 5EL0A 5EWSA 4BBPA 2VCBA 3D4KA 5FP9A 2QTNA 3DMRA 2FPIB 1T4GA 3MIDA 3AKTA 5HIMA 4LT5A 1G60A 1M7GA 2W37A 3Q9SA 5BNZA 3BD9A 4IEYA 2QZSA 4MEAA 4C4XA 5AVTA 1T4MA 4LJ5A 5BN3A 3LBNA 4LEJA 2SCUB 3O9MA 3AZPA 3CA8A 3D8HA 5CW1A 2BWAA 1PO11 1Z0SA 2YHIA 2Z2JA 3KZKA 2FK7A 3WLLA 4DINB 3N2NA 3G5AA 4E46A 1J8YF 1FYDA 3ZN6A 1FLAA 2FMDA 4M0EA 1PGPA 1UMCA 2I2BA 3V56A 4BE4A 4ZT6A 1FOD1 3X1KA 1HTWA 2O8EB 4KC0A 2HPVA 3BFPA 2BFMA 2Q9CA 4QQ8A 4QXQA 1RI4A 3E3NA 1C9MA 3ZWDA 3EDOA 5CFQA 1SKAA 3GDGA 4OQLA 2DLNA 3AUFA 4U4AA 1GTRA 5DLDA 5LQUA 3WMRA 2WJSA 4UBIA 4Q00A 4GL4A 1H1TA 5KYTA 2ONCA 1KEEA 2Y92A 3STVA 1RUJ2 3GZJA 2CK3A 1BMV2 4KI0A 1HXHA 2ERXA 1DOHA 2ORED 3SE0A 2YY5A 4GI5A 3ZUGA 4XUDA 2B1GA 3BGWA 3PFBA 4M0KA 1VMEA 2QRPA 4LOSA 1KDYA 5BR4A 3WDWA 2WLTA 3PRKE 5K3SA 2H1RA 2O4CA 4U2GA 2Z4FA 4UREA 4ONUA 1Z83A 3EIFA 5K05A 4QTXA 3NVMB 3WLFA 4ZOEA 5A3QA 5IK5A 4NBSA 4O4LA 2IK8A 5T3NA 3VR2D 2AJLI 3E9NA 5SZKB 4RNDB 1R10A 3H0EA 3MXOA 1RJ7A 2IL1A 4S2HA 3ZE1B 2PH1A 3VDAA 3BWMA 3VKFA 4AI9A 2XJUA 4GOND 2CZGA 3VR3D 2G5PA 1E94E 3L0PA 3DKKA 3FWNA 1O5LA 3VTAA 1XNBA 3HHPA 1N25A 2AKYA 3F0TA 4PLHA 1RUE2 1UUFA 2MYUA 1DGWX 2F3TA 2JEOA 3FGNA 2D3SA 2Q5TA 4X1IB 1NJ1A 3MJFA 2WQ6A 4RFRB 1PDVA 4HP8A 1Z5UA 3E1SA 1Y7LA 2DR3A 2CGOA 3CF6R 5CIQA 4FGLA 4RCZA 4B79A 4DSZA 1YRQA 5IUQA 4AJLA 2CZCA 4ROSA 3TLGA 3KE8A 3X43A 4AWBA 3KG2A 4QGLA 1ZPDA 1IXSB 1N34B 4AR2A 2FPOA 4LNUA 2VHZA 1IRXA 3DO8A 2I8LA 4LS3A 5FP8A 5K4GA 4MYDA 2GMMA 4HSEA 1Z39A 1SZPA 4K0KB 3F74A 1RXGA 1DKMA 3ORRA 2CWWA 4QX1A 4FT2A 2PH5A 4L8VA 1NT2A 1CVIA 2CXUA 3NS7A 4AF6A 2FWNA 2ET7A 7MHTA 1MVQA 4DV7B 4CP2A 2B25A 1IRIA 3NRBA 3O4JA 2MEV2 2AMLA 4AYTA 4NEQA 3OD0A 2D62A 4F1KA 3V0AB 1T4CA 1OY1A 5EMHA 4DCUA 1JEYB 2YFQA 3T34A 1JA1A 2PGOA 2F8MA 1B09A 2RAUA 5ACA1 4X63A 3MLKA 2NUBA 2GHTA 3GL9A 1HTTA 3FTDA 1F6WA 4K0RA 4TKLA 5FUQA 1TEZA 2G4VA 5DGXA 4NEGA 2WFF3 4ZKTB 4BZQA 1JAZA 2QTRA 2ZT8A 3W8RA 2BVVA 2YYAA 1TK2A 1VB2A 4RL6A 2YUTA 1RUD2 4UMEA 2NZ2A 5SYAA 4PYKA 5IAAA 1F7VA 1FFWA 3PVOA 2C9DA 3KFXA 4FGUA 4R9CA 3O1OA 4TMKA 1Y5NA 5SZJA 1PGL2 3STHA 2OZKA 4S2UA 3IPLA 4RZHA 4D7TA 4OI2A 3VBOC 4BOYA 5KHKA 3KWFA 4MCJA 3SQMA 2DAPA 3R0QA 3K1AA 3TI9A 2NTEA 1KF0A 3JZDA 5FWYA 4U7JA 1AK9A 4YAJA 4EFLA 3ZKYA 3TNYA 1YDEA 1EGQA 1W19A 3HQXA 2XUGA 4O2RA 3BPZA 3HVIA 5C4WC 1M0WA 2GUGA 4DPLA 1MNQA 1EUUA 3MJDA 2BSXA 5D7BA 1TZBA 3HPNA 4XEZA 5JCZA 4E8DA 1TW2A 2ZIZA 1L6IA 2W6JA 5DT9A 3A21A 3OYWA 4QT6A 3QPAA 3WDSA 4HNGA 3RZKA 1ZC4A 1L7PA 4ETWA 1DOAA 1ORRA 1LB2A 2IHJA 2XMQA 1ENYA 4YCMA 2XTJA 1G64A 3KKNA 4NHMA 3S6JA 2AVDA 3S2SA 4CCCA 1RCTE 3X1WA 1ULDA 2XMZA 2X15A 1KEUA 1O7FA 2IXHA 3QGMA 5DCWA 1PV2A 3ZLJA 3OZEA 2GAOA 5KBYA 3RS8A 1GITA 5KJEA 1EVQA 2A1IA 3ZWPA 4OQFA 2J6CA 1Y3IA 4YZ3A 1VHJA 1MJ5A 2BGKA 2J45A 1BCSB 2MSDB 1MXFA 1KVSA 3W5HA 2VZRA 3EEFA 4YY3B 4N0MA 5FO0A 2X86A 2XBUA 4IJQA 1OOPC 5AKIA 3B5JA 4N8EA 2A5GA 2DFNA 2XXAA 2XQFA 2GKOA 3L77A 4L5IA 3V7YA 4O65A 3H65A 1H65A 2HBUA 4PVCA 1V8BA 5FTLA 3LD8A 1YHYA 3T54A 1BA3A 2ZAYA 2AUMA 1KWGA 4L51A 1ZYBA 5ALJA 5FPZA 4KLNA 1X7ZB 1Z3CA 2OESA 1GTJ1 1LPOA 5B6PA 5CD1A 3ZWVA 1JNXX 1GGVA 1YZUA 2ZITA 2UVPA 1XSRA 1GQGA 4F04A 1NFFA 5AW6A 4FCAA 3KYBA 1UY3A 3VN4A 4CG1A 3EEBA 1ENZA 4QHTA 2D1TA 4BYYA 3ZLUA 4RR3A 3LUJA 2JDNA 2R00C 4Y5Z0 1M1XB 4DY6A 2B9UA 4ZZ5A 3HT1A 1VLVA 1G5RA 1L4EA 4PLTA 1YRYE 2XTZA 4XTPA 5KXDA 4E13A 1G8AA 1T9BA 3VHQA 3CJXA 4R98A 1Q6YA 2BPA2 3PXEA 3AL0C 1L4BA 1U5YA 2YQ5A 4X5OA 1BC5A 2P2LA 1EVEA 1BMFD 4FLEA 5K3CA 2YC0A 3DEZA 1RUE3 3QBDA 2K5UA 1L5SA 2UKDA 2H2FA 1IN6A 2XSZD 1KQFA 2G6TA 2VZLA 3ZI4A 1PZHA 1GFSA 3THDA 3DP7A 3QYJA 2MSEB 3GBGA 4EKIA 4X8OA 2QPAA 3A28A 1Z5ZA 1NNI1 1POWA 3PNBA 2WTNA 2FDFA 3A4IA 4EO4A 2PJUA 4D94A 4AECA 4GQ7A 1VR3A 2FV8A 3RGGA 5KC5A 3CEWA 3H9UA 5FT9A 4EG0A 1XTPA 5GINE 5G1PA 4RGBA 5C71A 2QBYA 2YBKA 3VBCA 4D6RA 4Y6LA 2NVBA 4EUEA 1KOFA 2B8EA 3QF4A 5J37A 1W75A 3GT0A 4AZ3B 1TA9A 5G4KA 4PR3A 4MVJF 4MYTA 1SQFA 3QKSB 3KT7A 4I0BA 1U2DC 1ZM7A 1VBNA 3LL7A 2OORC 2QZPA 1B6RA 3N9QA 2IDZA 3A6DA 2V45A 3AK4A 1J99A 3MFQA 2PFGA 2MEV3 1SD5A 4M8LA 3QUBA 1MS5A 1XHFA 4UCWA 5CFLA 4V1PA 4J90A 1W2TA 4B7CA 3JD0A 3POEA 3NRJA 1AMUA 3RSQA 3E48A 3MDPA 2HSZA 2FWIA 2VMCA 4AQ2A 5FBVB 1LBHA 4BV3A 2CK3D 3GGCA 1H8EA 2RHRA 1NJSA 4CDWC 1YGYA 3C3MA 1ZNZA 2QJRA 1N0UA 3V8PA 4JGGA 5JOYA 3N1UA 4QD2A 1IXYA 1QUFA 1C8LA 2WWUA 2I74A 1JALA 1FY2A 5LP6C 1NUQA 1WMAA 2C7QA 1ULUA 3QBVA 1OLUA 2IOFK 4Y1RA 2JDAA 3PNQA 1GYRA 1KGSA 3NYWA 2V74B 4YZ4A 4Y2UA 1FQOA 1RPTA 3F7OA 1BG6A 5H7XA 2RHTA 4B33A 2DY1A 2IKQA 4BLRA 1X92A 3K8OE 2VMFA 5BN3B 4CKYA 3FYDA 2I55A 1JKMA 3G0CA 3NL1A 1NVUQ 3TM4A 1PQWA 3M8KA 5CXQA 4LDNA 2CLHB 5JS2A 1XBFA 2YHIB 3RTBA 3K09A 5GM1A 4MSVA 4GWNA 2DR2A 3AKQA 1WCSA 2YINC 2DHEA 3RRMA 4A16A 1OURA 1YKGA 1DEAA 4X0EA 3ZN6B 3UMCA 2JA2A 1HQKA 1UMCB 4R8MA 2LUWA 3HWJA 3JQFA 1Z8DA 1XZGA 4LK7A 3AI2A 3V9AA 4CG2A 4P4LA 4ZPIA 2QX7A 2DQ4A 1TI7A 2X23A 5TGDA 2ECOA 4ARIA 2ECQA 2Z2SB 4XEHA 3FUQA 1AQLA 2FQYA 2BKXA 3UWOA 3EZ6A 1EINA 3L6EA 3QW4B 1E6LA 5JVDF 1GWNA 3UWMA 2BLLA 4YRPA 1ZBA2 1ND2C 2ZRPA 1FQJA 5FRAA 1KEEB 2VJAA 3G7UA 3F9IA 2P6NA 4WM8A 5TMEA 3ZDSA 1DSSG 1BEUB 3FW1A 1VBMA 1WXWA 2BP6A 3D6UA 4X8NA 4BHTA 5BSMA 4FHDA 3ZH9B 1LAJA 2J4CA 3MRSA 2CCKA 1XQNA 2C57A 1KDPA 5C5EA 3LM8A 2X42A 2JVIA 3KQLA 4O4JA 1DG6A 5ALSA 4QJ3A 4Q7LA 4PDWC 4IM7A 4GDFA 1CQPA 1NOKA 4OL9A 4NR1A 4PX9A 4FDMA 5JI3E 3Q4GA 3QLUA 4O4LB 4IXDA 1QRAA 3PLQA 3GD7A 3LPNA 1W73A 5G2OA 1WZCA 3CT4A 4FFBA 4HQRA 1OXSC 1R00A 1IPFA 4OHFA 1QX3A 1Z0ZA 4YFVA 1VE1A 4RJJA 3S30A 1SEFA 1E2PA 3PTRB 2QP4A 3L1IA 4JJ4A 4Q27A 4OP2A 4XGKA 1JFSA 4AZTA 4BQYA 1WCYA 1MZVA 3T5GA 2V9ZA 2YC4C 3L6BA 4H7EA 3U9TA 2W91A 4RVDA 4FYWA 2W2OA 1IJKA 1C5HA 1SQ5A 1WM1A 1VFPA 4JP1A 1YBMA 2BERA 1FYXA 1MOZA 2YYZA 1UWVA 3TLGB 1H8HA 2QORA 1G20E 1OZHA 5TXGA 1DT5A 3ZCVA 1M06G 4MGZE 4LNUB 1NVTA 4RVGA 2ARKA 4BFXA 3SH4A 1EK5A 1L4LA 1NKVA 4BX3A 3U56A 4UBNA 3PG5A 4N0DA 3UJHA 4IGPA 3NXSA 5T41A 3HN2A 2WG2A 1GU0A 1C5KA 2Z4SA 2W6JD 1X8JA 3INGA 2B6HA 3F2IA 2MSLA 5FDBA 2WYWA 4BE3A 4MAMA 2V3CC 1PK6C 2X8WA 2ZA9A 3JVEA 4ND6A 2WQ7A 3ME5A 4UFOA 3WNNA 4MCHA 4UXAA 1M6NA 2OOSA 1VCMA 3QIAA 1T4CB 3VVCA 4RDIA 1FNSA 1A7KA 2WAXA 2GBGA 3NVDA 4AUEA 1QE3A 5IWAB 1XN4A 1U0FA 4IWYA 1HXS3 1FDVA 5KREA 2ZTMA 1SLLA 1M2OA 4XIIA 1TGYA 2OGTA 3O31A 2O0LA 2MWMA 3DZCA 1YI0A 3QPDA 2D6PA 2DPMA 4Q4CA 4CMIA 5I4BA 2D0OB 1FTSA 4EA8A 3FC0A 3H5TA 3NYIA 3COJA 1X94A 1DIRA 2ZRGA 3HVUA 3ONNA 3MWLA 3PNVA 2GEFA 3UENA 1W5BA 4BX2A 1EVZA 3CNEA 3PFIA 5IXYA 3JX9A 1UQXA 4LV8B 1IDOA 3A7QA 5E9JA 2WMNB 2XUJA 2X6QA 3IP7A 5A4KA 5KSOA 4Q37A 2AZ4A 4HUTA 3K1AB 3PWKA 1Q0RA 5EVJA 3ES1A 1HLDA 5FWYB 1RQRA 4PZUA 3P2KA 1Z2EA 4HN2A 3KDPA 4QVKA 1PEYA 3QU9A 2C78A 2YZMA 1Q7GA 3GHMA 1CY1A 3JQBC 4NZYA 5EXSA 1LX7A 3SKYA 1L5KA 1R5NA 2ZE5A 2P9QA 4DEYA 4L0DA 1VHLA 3B5IA 4HDNA 3P97A 2M6RA 3ZLIA 4XAEA 3WF1A 5CLJA 4G5HA 2WA3A 3U78A 2BEOA 4G8CA 3OYWB 1EDDA 2YU1A 1AA9A 1ZM2A 4N5IX 1E58A 3BJIC 2WF8A 4B6OA 3EIXA 1UMZA 1JWAB 4KBZA 1CR6A 4FJ2A 3REQA 1CN1A 4HLUC 1ICIA 2W0MA 4H7LA 1UZZA 1H6AA 4ZU4A 5BWBA 3ED5A 1FMJA 1I33A 1NQWA 2ZWAA 2P2CA 3E27A 1W0NA 2BBSA 1TZOA 4QLBA 4ND4A 4UVHA 4YUZA 2HF7A 3FPLA 3L2OB 3KZNA 2BOVA 1F17A 3CRQA 2R66A 3Q7IA 4ZAFA 4CXMA 1FUKA 4Y24A 1K3FA 1G9SA 4OMDA 1L6RA 3M89A 3HZZA 3W9UA 1U1GA 1MTOA 2OUIA 3AHFA 4H35A 4I1OA 3QOPA 4BKQA 3NZEA 4ARSA 4Q4Y1 2VPPA 1RKBA 1Z06A 1PZEA 2IU4A 4DADA 3H1BA 1HJFA 2D5CA 2XXAB 1QJX1 1A95A 2IEBA 4HOOA 1ZRSA 3CTPA 1OPXA 1KMQA 3PPWA 4C7MA 4MQBA 1H4VB 4YA6A 4DUVA 2V7BA 2KM1A 4BTLA 3DMNA 1QKKA 1DBQA 3T95A 2W2TA 1JG4A 1ZBA3 2MYPA 3GPCA 4L97A 4IUDS 3T61A 2ZX1A 4XPZA 4LBVA 4DLBA 3ES9A 4MLZA 1LSUA 2JARA 2UVPB 1WY5A 5K0JA 2GEUA 1S7GA 1VB5A 3QEBZ 4HY3A 5HKKA 2X53S 5JAMA 4XD2A 3UGHA 3V1NA 4RR3B 3X2SA 5B6JA 3FHQA 3RRNA 4F8EA 1CQ9A 4FN4A 4PY2A 4OZOA 4BJ0A 3JCIA 2K4MA 3H9EO 4WINA 1NRXA 4D02A 3DONA 1HOXA 1Z18A 4LMRA 3FGOA 5MN6A 1E98A 4RTJA 4EGSA 5E7IA 2IBTA 4C78A 4RANA 4DLNA 3W06A 3ZZ1A 3V4LA 1E2JA 4HQKA 4CETA 3GY0A 1H8ED 2FH5B 2AJBA 1TJ4A 2GFIA 1ND3C 5FPHA 1W8DA 4RH3A 2BDEA 1PZMA 2EW1A 3AKRA 3P3PA 4XCVA 1XD2A 5ICFA 2WJVA 5K9YA 2O1QA 4AHWA 3ZV6A 1QRDA 1JU9A 4IE6A 3ED1A 2ZWMA 2QAJA 1Z7S1 2JDKA 4PPNA 4XSVA 1PK7A 1ND5A 1QPZA 3LC7O 1UJ5A 1QQ6A 1DJQA 4G8JA 4LJYA 1RUG2 5LB2A 5P21A 1XU9A 4CKWA 2VQDA 1FLVA 1NOVA 4XUOA 1AZLA 3UJAA 4KLZA 2ZYTX 3EFBA 5J4HA 2OQIA 5EZSA 4M54A 3VDXA 2R6HA 4JB3A 1KSHA 4J7UA 1PBTA 3PHGA 3WA7A 1A1SA 4EG3A 3F9RA 2NZWA 2QBYB 5FR3A 2BUCA 5A5GA 5DNVA 2JDHA 5H4GA 1AHSA 2K2WA 3QF4B 1PJZA 1FS5A 3HKCA 5G4KB 4AT1A 4DWOA 5CFPA 5I8ZA 3DMYA 5FUMA 5F7JA 1U6JA 2XHNA 3K4DA 3KWMA 3SXWA 5EHIA 5C5DA 1XEWY 2O0MA 4V1CA 4TROA 2CGEA 5A32A 1H6CA 3L6DA 1Q1ZA 3VZPA 2R7MA 3A0RB 2RHBA 2G8LA 1U5ZA 5KO2A 5FXVA 4JCKA 3CX3A 2ET6A 4G4IA 2XMPA 3IX7A 3MGGA 3DE4X 1A9PA 3RYIA 3THCA 4E5DA 4HXYA 4YQFA 4B7EA 2QX8A 2VBGA 3U13A 3IDEA 1WMEA 4XURA 1VPHA 5J23A 1GP6A 1O4TA 2WRAA 1GCGA 2DWPA 1K6EA 3ZNQA 1ZNWA 1QVZA 1OLUB 4Y1RB 1OLQA 3LYUA 4F2DA 4C4OA 1AS0A 2RS32 3NVCA 5JVVA 2WK1A 3V1KA 1KC3A 1QK5A 2PLV2 3LSYA 1YO8A 2PUHA 3T8YA 2J07A 1G7YA 4NCKA 2VPQA 2FZEA 1AR92 1O87A 3UM9A 3DYBA 1T35A 4O33A 2AXPA 1OH4A 1Q8QA 3OD1A 3QUQA 3ONDA 1F5SA 4AEKA 4F45A 4JEIA 1WRBA 2VK1A 4I1YA 2FFHA 4K1ZA 4UE3S 1LKNA 4XF3A 1NYLA 3COZA 5KNCA 1CHDA 1U8UA 1LULA 4TTRA 1LU1A 1O7JA 5DCYA 3ETLA 2IC1A 3AYCA 3DZHA 1T3HA 2PWAA 3ZE2B 4G07A 4ZT5A 1V6KA 4HL0A 5B6IA 3G9XA 3IBFA 1P2DA 1K5JA 3ZHVA 1H8HD 1DUSA 5FFMA 1U0LA 3U7JA 2JB9A 1OMOA 1MZ5A 1P7YA 4C4SA 2CTVA 4WVFA 1W0KA 5HF6A 3W7BA 1YR8A 1JLMA 4OQDA 3R23A 4RTPA 1TB4A 3DDNA 1YS4A 5AFSA 1MX5A 4IRXA 1KI7A 3D6NB 3G89A 3ZV4A 3SCZA 2ZSDA 1JS9A 4WM8B 1T13A 3BL6A 1O97C 5IJWA 2GKGA 4V39A 4EJ0A 1EK0A 3OQIB 2O0JA 1JAYA 1CULC 4WAUA 2HQOA 2Y38A 3FY4A 3OQVA 4HDCA 2QDNA 3ALQA 4PBSA 4QHOA 1V35A 4Y9TA 3GDBA 3VC1A 4O4JB 5C52B 4MVCA 1KJRA 3SLGA 3LVBA 5IKOA 4AULA 1B16A 3D7LA 1HYHA 4M0PA 1VRWA 3OJLA 4P93A 2RGYA 2D3TA 3GLKA 1MX1A 4HRXA 4KR0A 3BT7A 5K9ZA 5AT1A 2IYQA 3QVSA 1W87A 3DBOB 2GU9A 4FFGA 5HGJA 3AWIA 1VIWB 3OUHA 3AVRA 3SC6A 1RRGA 1V1JA 4FFBB 3VPSA 4S0XA 4URWR 4DRXA 5KTNA 2GPBA 1IPKA 4XJZA 4EJSC 5LIRA 3U7HB 2VXJA 4F5YA 2O3UA 2SBAA 1ZSNA 1NZJA 4DR5B 1XJCA 1W9YA 1JJBA 4GLLA 2RGCA 2VY0A 4ZOQI 2IDKA 5CPBA 3ANNA 4YGYA 1UM9A 1SCJA 2QVYX 2ZJ8A 2ZBDA 3PJRA 4HV4A 3EWNA 4WK4B 5F2WA 1BDIA 3G0IA 1Y6GA 2JFUA 1NMSA 4ZDJA 2OMEA 1VJCA 2PCJA 4LXLA 1Z7YA 4AJJA 1XMIA 3BXOA 1G38A 3ACLA 1KARA 4YR9A 4L8GA 3EPRA 1RZVA 2H8GA 2RG1A 5LLTA 2C5DA 1VJ1A 2VAXA 3VR1A 1QM5A 5E4YA 1VDMA 3T0IA 1O57A 3MFAA 1OF1A 3NHUA 3BQMB 3N6VA 3KC2A 3ZIDA 1GWLA 1XPJA 2VH1A 4R16A 1ECGA 3F71A 2CD7A 4AMUA 1WDWB 2HRRA 1IOLA 3VI4B 3C97A 3DWEX 5GZDA 4JB2A 4GZMA 4OQNA 1J8QA 2RS13 2OK8A 4RIEA 1RUG3 3AGPA 4NYJQ 1F0YA 1Z0IA 1VKZA 1LDEA 4RHV1 4J1QA 3WHTA 3AC0A 1S8OA 4LKDA 5ALLA 1CRPA 1W4LA 2DCTA 3A6LA 4FZ3A 4ABTA 3S2EA 4QBTA 4RHUA 5JSRA 1IM8A 4AG5A 1ZJ6A 3IZOA 2J7KA 1JFFA 4L4YA 1M2OB 2ZJ7A 3DXXA 4UW4A 4HB0A 4F12A 3FHTA 3K30A 5K6AA 2Y8EA 4CMIB 5BY2A 3WMGA 3OCJA 3BTUA 1U0SY 2ADDA 4BQ5A 2ORXA 4Q21A 3N58A 2PSHA 5AI8A 3LSTA 1PUIA 2FHPA 4ARUA 1TJYA 3D2CA 4DA0A 2H57A 4EVSA 5KJCA 1RM3A 4DLRA 3FROA 4AVSA 5AYVA 2DWQA 4QO8A 4XIFA 4IILA 3LTEA 3HA3A 3T4PA 2VPXA 4IVRA 2IV3A 2PS9A 3QKTA 4IE7A 3PP8A 5U9CA 1XJWA 3OUUA 1XTIA 4MA5A 2VLBA 4UBLA 4G4SO 1T5IA 1SBFA 1O3YA 3ZHBA 3I53A 1JAHA 1VB4A 1HT2E 4P3YA 4RV9A 4AYXA 4ZVQA 3U3RA 1A34A 2EAAA 1DXQA 3MWKA 4A03A 3NJ4A 4XABA 1VIVA 2PIAA 5ALOA 3R6GA 1S4QA 3NGXA 2I4LA 3PEYA 1DQPA 4HDNB 3THXA 3HCNA 4AP6A 4GGOA 4YV2A 2X4DA 2C20A 4B40A 1UC4B 3VZNA 2RB5A 2BFNA 2ERYA 2JIRA 4L28A 3M81A 5SV5A 5CA6A 5AM5A 3REQB 3K4HA 4A8HA 2OIIA 2PBFA 3OY7A 3WNCA 5KYNA 4NMHA 1GPWB 1QHIA 5DT2A 2F1HA 4JCCA 4DUXA 1NP7A 3LPAA 2RVAA 3DM9B 3IVCA 4YJ3A 3HJUA 1LLDA 1TUIA 4QQ2A 5JCOC 4CDGA 2QAIA 2D7JA 3K0FA 1ZN7A 1NMYA 4NONA 1I14A 4PC7A 2ZHMA 2DGDA 2C88A 1PNTA 4FI3C 1QQP1 4CFYA 3O75A 2ENUA 3GPIA 2P3IA 2C5HA 3IJEB 3S1AA 4MS4A 1OGYA 5PGMA 1RXYA 3ZR6A 5GIPE 3VOBA 4XJWA 4AVAA 1Z15A 2I6FA 3KEFA 4BK4A 1DNPA 2Q2QA 4H7MA 3AYAA 3OPWA 1TLFA 1M76A 1ZJ4A 3ACIA 5TEVA 2Z2YA 1C28A 1A78A 4HNUA 5CU1A 3OQOA 1FNMA 4PYQA 1PHRA 3Q10A 2RHDA 1PL6A 4QMAA 1NSFA 1LVGA 4JLDA 1LPPA 4EQVA 1EZ1A 4FPXA 1JIIA 1R6UA 5HRAA 1DBVO 2ZX4A 1EVIA 1OIXA 3FGZA 1ASJ1 2C00A 3GFBA 1R15A 3IBCA 3JD71 2HDHA 4X8MA 5GADl 4QKBA 4XAAA 3EGEA 4ZDIA 1TE1B 1CUDA 1DQYA 3VBHA 1KK3A 4OMFG 4XOGA 3ADDA 3VA7A 3O7WA 1NQOA 1PWHA 5A3LA 2QS9A 4DA9A 3RWOA 4XUNA 4BO8A 3IOCA 3MWFA 4OXIA 1YC61 4CDRA 5AKZA 4HDRA 3NGMA 2X5OA 5DZFA 1RIIA 1B0ZA 3RKRA 2WYHA 4HNAA 3NB0A 4O4LF 5EJ5A 1HRI1 3HP7A 4IZHA 3JSXA 1QGUA 4ZV9A 4PWZA 1HTBA 1KORA 1FE8A 1KU0A 3N7TA 1QU3A 3MCAA 3KUKA 1XD2B 5CBKA 4JC5A 4FHZA 1G6NA 4MZXA 2Z69A 1VRBA 2I65A 5E2AA 1KVRA 2YHUA 2ISQA 3GFFA 5CB4A 1I7QB 5I93A 1TPYA 2QT1A 1D4ZA 2FK8A 4YXFA 3C3DA 3H16A 2UZ4A 2OXFA 4KWJA 3VZDA 2Y99A 3EJ6A 4CKWB 5FY4A 4BO9A 4BEJA 4M0UA 1GZHB 5FKCA 1OH3A 5FA6A 1Z7EA 1DIGA 2FPMA 2CJWA 2JAPA 1QU0A 3AW8A 1EAH3 5E2IA 1W1IA 3INNA 3PI6A 3HL4A 5CB7A 1L4HA 4PYOA 2O5VA 3TG2A 2XDVA 1HDGO 1A72A 4F3NA 4F83A 1ZM4A 2QT9A 3ENVA 3BAFA 4MP8A 4MKXA 3Q1KA 3HKCB 2JASA 1J42A 4PLYA 3MIHA 4GZLA 5F5XA 4FMPA 5KNCD 5B58T 3DMFA 2WR8A 4PYMA 4G3XA 2BGUA 5U4QA 2VR1A 1X6VA 3ZHZA 2O2CA 2PAMA 2OG2A 4MULA 4V1CB 3COSA 5A32B 1RI2A 3FLEA 3BL5A 3I3DA 4A0FA 5JZMA 3NRUA 3H19A 1C3HA 5HPOA 2HWF1 3UJDA 3NHMA 1W0KD 3Q12A 3AJ9A 5KQLA 3FJOA 1PJSA 2LR0A 2CU5A 1VJDA 4A7KA 3RYIB 4GE0A 5EERA 5A3WA 1JUHA 3A3PA 3FN4A 3DHVA 3I9MA 5ECWA 1I7LA 1SZJG 2ZIGA 4N0QA 3M3QA 4LF4B 1F8UA 4JA0A 3OFSA 3L41A 4UPVA 1QFZA 3BN6A 3ETJA 3RSSA 2G6BA 2VWQA 1L8LA 3ZSLA 5JNLA 4ZMBA 3DC7A 1XEAA 4YDHB 1PYOA 1WO8A 4ZZIA 4Z3DA 5K8UA 4M7RA 3A05A 1XYOA 4QUKA 1UFRA 1N2GA 1A2QA 1CJKC 3SYRA 2GZRA 3A22A 1BMTA 5EWLA 1WSAA 1G8JA 4MVWA 2DF8A 4EA7A 2JANA 1WE2A 2IYZA 4EHJA 2UYOA 5IH7A 1SC4A 2YRFA 1YJ5A 2JG9C 3USUA 3OJWA 5AFEA 5HXMA 3FAZA 4L9RA 2E4XA 4U00A 4I4IA 5ENZA 2ZI9A 3L5KA 4JI0B 1HY3A 3EG9A 3HYSA 1UXJA 2PH3A 2IU3A 3H2GA 1KFJB 2WV9A 5AW1A 1E2HA 4BVLA 4QPNA 1TUEA 3I5YA 2HJSA 4EGQA 1Q3EA 4N47A 1KY3A 1AQNA 2Y0PA 3EH2A 4IHKA 4C0SA 1H3NA 2ZULA 2D2EA 3NC0C 2ZAIA 5C3RA 3A1VA 1A4UA 1CY8A 1QC5A 3WF4A 5D51S 5HILA 2WUGA 1OR8A 1G9FA 2ZE8A 3R3XA 1HXS1 5DWDA 2NV0A 2WZ8A 2ZUUA 3RYTC 2MTBA 3QNMA 3WKBA 3L05A 1M74A 2P5TB 2GZ1A 4MQLA 1U2EA 1TZKA 5FULA 4LZPA 1KKUA 4LXTA 1R7RA 1REDA 1JHVA 1GQRA 4FYVA 2FPXA 4UBHA 2AG1A 4YO8A 2OV3A 4K9DA 1AQIA 1E8MA 1V9LA 1XD9A 1N3QA 1WQ1R 4RS5A 3CBGA 1LJ7A 1GT91 3N2GA 2ONJA 4MV7A 1XQ6A 2CJYA 4BE7B 1HIXA 2WNVA 2B4TO 4AEMA 2IPXA 4DRXB 1MS3A 3S5UA 2X0IA 4MVYA 4QU9A 1JV2B 4XILA 2Q30A 4ZCTA 3NPAA 4ZDKA 3WWEA 4JV5B 3U37A 5CXUA 5DW0A 2I7CA 4L99A 2W4MA 4YW1A 2GS9A 4NAOA 2VOKA 3ZSMA 4D3YA 3F8WA 3VBUC 1UM9B 2VZ0A 4ETNA 2RARA 1AYN3 4O02B 1V6NA 4HQOA 4QD3A 3U0ZA 4AY2A 1VG1A 2UZIR 1E9BA 2H1OA 1MEEA 4X00A 1TZ2A 3PCTA 4XKJA 2JHGA 3S28A 5BPXA 3WOHA 2DFKB 3OBIA 5F9HA 4CT5A 3IVXA 4B44A 4J4BA 3RUIA 1ZH6A 4AJ4A 4DM7A 2HCRA 4RKYA 1ALYA 3ZFFC 3WFZA 3AR5A 2VHUA 2Z9CA 3IUEA 1D6SA 1IBKB 4F3KA 3L7OA 4FFDA 1NC1A 3P9YA 5EEGA 2BHLA 2QR2A 3IPYA 2JH3A 2C0QA 2C7OA 5HCUA 3EMKA 3UHPA 2DCJA 3HCEA 4FLFA 3CZ4A 2EJVA 1SDWA 1WUVA 4LF6B 1CDOA 3O12A 1RKUA 7YASA 3TOVA 4MGEA 1VJ5A 4UEOA 5EMJA 2ZR9A 4EMSA 4Z0HO 2FDCA 3IUSA 5AOAA 3ZXKA 2XMGA 1N8KA 2J0QA 2VQTA 2O7VA 2F6BA 1D6NA 1ULCA 3EA5A 1JFFB 1Z0HA 2J4FA 4KHPB 4EYEA 5JU6A 4KRXA 1KVUA 5BW5A 1RXFA 2Z2KA 2WT1A 4DQLA 4JUIA 4IOJA 3I30X 1KZYC 2G9UA 4GSKA 1YR1A 3CH7A 2R7NA 4NBNA 1D07A 4MPPA 1LRKA 3ELDA 4QTUB 3ZKUA 1N1VA 4NWIA 2COUA 1OXUA 3TIIA 1W4RA 3ZWMA 1RKVA 3TJZA 5KWEA 4HEHA 3HB5X 5LQRA 5JZSA 4JVSB 5ALRA 4HAYA 4C14A 2BDUA 2AMVA 1KETA 2AZ5A 1WMXA 3AF0A 2WB2A 4PG5A 1RPAA 3PSHA 4YYZA 5KSWB 2WSMA 4D7SA 3K51A 5F3IA 1BXGA 2VNHA 3ZNPA 4CEWC 4Z4IA 1WKVA 1Z0FA 3N4MA 3I7DA 1XN1A 1WB9A 4KQMA 4BVJA 1OB5A 3KDSE 4DTIA 1Y4AE 1VXRA 4RFVA 3UYJA 4U7TB 3QD6A 3THXB 5F3WB 4ARCA 5JECA 2X9LA 1AO3A 1E69A 4YEDA 3HU1A 5C46F 4KR7A 2Z43A 4NOTA 2PG3A 2XLCA 3U3JA 4DG8A 3ZWQA 2RD2A 4ER6A 2PKQO 1A5TA 3PJEA 3AMHA 1EDOA 4MWGA 4YJ3B 3WK8A 3A14A 3VKOA 2OC4A 2VTFA 4CKXA 4XQGA 4HG6B 1Q11A 3EDCA 3C3BA 1KVQA 3H9JA 1QLJA 1IBSA 3RRBA 4M9XA 1J2EA 4YJHA 4JQTA 3K0FB 2V7TA 4R9RA 3A32A 3WL4A 5ICEA 1HKDA 3DL0A 1DQ1A 3K48A 4BKMA 4R1LA 5D6NA 3S1AB 4MS4B 2PHTA 2GZ3A 5TPZD 3LRTA 3E5RA 2HMUA 5CKMA 2O5EA 3PL5A 4DV4B 4ZO9A 1O8SA 2PBZA 3HU2A 2VJYA 4EKGA 3CLRD 3JQAA 5CT6A 4WVWA 4HRYA 5ESDA 1GP2A 4C06A 4BQFA 1W93A 2V7QA 4L6IA 2VJMA 1B8PA 4C1NA 1GR3A 4WA7A 3UJ8A 5L6MB 1CLUA 1CY0A 1A8QA 4GVXA 4J6GA 2LXNA 4DIOA 1OA3A 2LZ0A 4M3CE 2HJIA 3WGQA 3LGAA 1EFKA 4DNFA 2VYCA 3PURA 2Q8OA 4NFSA 3MPBA 3H1WA 2ZDHA 4U3JA 3BIXA 4ZRDA 2ZYDA 5BY5A 1TO2E 1QMGA 2C4WA 2H4XA 2IZ6A 4QDQA 4QYMA 3VBHB 3WK6A 1TIKA 3KQOA 1YONA 2XVZA 4MW1A 4QUAA 3LA8A 3PGA1 3WW2A 2XZDA 3C8UA 3LFIA 4YRLA 1HW5A 3JQXA 5HWSA 4QJ5A 4TSVA 4FAHA 3E1KA 2REQA 4O4JF 3FLTA 4HDRB 3AI7A 4KR9A 3Q72A 4LK3A 1ZCAA 2GEBA 1LUAA 5MN5A 4Z3OA 3EVAA 3C6QA 3JYNA 5IFKA 1SKUA 3GRYA 5G1OA 1RP1A 2V3VA 2FFAA 2D97A 4HNAB 2BUAA 3SYNA 4DKXA 2OHJA 1QGUB 1KJNA 3QVMA 3F3SA 3QWFA 4M60A 2XHZA 3MGCA 4K9SA 4YQZA 5JCPA 2IXJA 2J9RA 5JRJA 3MO4A 5DGIA 3GGPA 3RAEC 4OFWA 1M2FA 1M0EA 3PBKA 4UNQA 5LBBA 4OK3A 2LUOA 1IH8A 3K0CA 1N2CA 3HN6A 3OTFA 1E32A 3DZJA 5CB4B 2IHVA 3UGJA 5CNIA 1KYZA 4QQFA 2HL6A 1JI3A 2OD7A 4S2EA 3TSOA 4MRNA 4EKEA 4ESOA 2CE7A 3KOWA 5GPBA 1MHTA 2AT1A 4D6QA 2LALA 5DPNA 3S57A 2QGFA 3BL8A 3D2AA 3MEPA 4U2FA 3E3OA 1NVAA 1SFRA 3LPFA 3KJZA 1GLNA 5E3IA 5ALDA 2GZSA 3GAFA 2HJ9A 3QKUA 2NSLA 3N07A 2Y2UA 2CJWB 1WDLA 2GBLC 4FTBA 5IUKC 4I1RA 2NSJA 2IXLA 4BOWA 2OP0A 3LFHA 1C0EA 3B6KA 4P3KA 2C4KA 5ECYA 4WOPA 1QV9A 3A6JA 3ZMNA 1XALA 2G77B 2P5UA 3KB6A 1Z82A 2OGWA 3H3JA 2IHYA 4LHLA 4IL5A 4P9LA 1E66A 1NY6A 5LFAA 1D2QA 1I6MA 4YDSA 4GC9A 2XQGA 4C76A 2XCIA 4CTKA 2R6AA 3KKMA 3ZVKA 1UBJS 2G8NA 3LIIA 2NSHA 2QUOA 4LUMA 2RE8A 3B8HA 3NHYA 3GRRA 2IPOA 3Q5EA 5ALMA 2C1FA 4BMVA 1VSBA 4KGZA 3IBMA 1P7PA 5I7AA 1BYUA 1WZNA 1W2WB 2WYSA 1CXZA 2VZTA 1WU8A 1KWKA 1OTXA 4OQ8A 2JI6A 1YZTA 4CL3A 2Q8NA 4Q9NA 3V1LA 3ZWAA 4FPYA 3W2GA 4EJRA 2PPLA 3U7EB 4TTJA 1T6GC 4AVVA 4CL8A 1L9XA 2YXPX 3TTYA 1H2MA 1VE3A 2FDRA 1D4AA 4QM8A 4U36A 1QCCA 1ZK2A 2G36A 5AW5A 4ZVPA 1CIJA 2PN1A 4FCTA 3LL4A 1V25A 4ZU3A 2EJCA 4HAXA 3MMZA 2UZ1A 3HWWA 5IAEA 1J58A 4K8FA 4Y6RA 3M0EA 4EHBA 1UX6A 2FBEA 3HYRA 5EWLB 5EZYA 1H66A 3FZYA 2ILTA 1XTQA 4PZ9A 2VSFA 1GQPA 2XQKA 5L9RA 1RUJ3 1MB3A 2Y1FA 1FIUA 2WVHA 5CLIA 1K9VF 1KDKA 3I72A 5E38A 3MIEA 2ZSFA 3D6MA 3WZ1A 1KRWA 3USUB 1KK0A 5K0CA 4I1SA 2O59A 2RK3A 1D7PM 1LI7A 1E7QA 1OWNA 3SSOA 1CQJA 3IUMA 2MR5A 2H9AA 3L4BA 3EG9B 2XT0A 3EZNA 4BMZA 2ZTNA 3CH4B 4O0MA 1UWCA 4U8HA 1KGDA 1O3SA 3GO4A 3TD6A 5TV2A 2VT2A 2XT9A 1XEWX 3J8F2 3TLXA 4EDHA 1QAOA 4DFSA 4NESA 4NVRA 5CCBA 4QXPA 4XJTA 3WQHA 3PIDA 4ZYTA 4YN3A 3PJQA 4WCFC 2XQVA 2GXQA 3H8WA 4NNPA 4B43A 2GZWA 5ICSA 3VKMA 2B34A 3H8UA 2AQKA 3WHUA 5I0RA 3VVBA 1QC5B 4JL6A 1RZRA 4G63A 3OBRA 3KM5A 1VZ2A 4ZHQA 3CG4A 3O2QB 3HJFA 3O2SB 2VZVA 1VP6A 1SVLA 2VYFA 4KXXA 1F4AA 1IEXA 1UOGA 4KQ2A 5ABPA 1FZQA 4GXTA 3DVQX 5A3JA 1DQ4A 4Q1EA 1G21A 4NFLA 3KALA 1U0EA 3WRXA 1NQTA 2B3DA 1NAIA 4RS5B 5FBKA 3H4VA 5KHAA 4KNWA 3N2GB 2ZB3A 2FEXA 3IUNA 4JROA 4QOJA 4KV7A 2K2SA 5A4IS 2WNVB 4NG5A 2EBWA 4YRQA 3JTEA 1KDZA 2QYOA 2TMKA 2I6XA 1GU7A 4HVQA 4DCJA 4S04A 5KYUA 1R081 3ZXEA 2CNDA 4OTZA 3GEHA 3Q6IA 1CDDA 3RSLA 4M21A 3CVYA 1SB9A 3TN7A 4Y6QA 4YGBA 4WZZA 1TNDA 1ZGHA 1U2GA 3ENQA 3KVRA 4QX5A 1WB4A 2PNJA 3C1TA 3UXHA 4M46A 5IULC 3UXMA 4J4TA 1J09A 4ENQA 3LW8A 2E1PA 4DVJA 1FMCA 1N4DA 4NVPA 3DF0A 3UWSA 1OGIA 2H07A 4EEXA 1E63A 2AEEA 1M8FA 1WPGA 1SEVA 4FSXA 1KC1A 3TLEA 3KT6A 1U0RA 2IZ7A 3MN1A 4LI3X 1Y9DA 1RUD3 1KFUL 2D7CA 3ESRA 4Z4CA 5G1NA 2R7EB 3OUIA 1TAGA 3VU0A 1P1BA 5FYBA 4R7GA 3QFSA 1L3CA 3CX7A 3E22A 1KSGA 4A7ZA 2I78A 3T2PA 4QU0A 3RUFA 4B2IA 3AHCA 5IZ4A 4YSFA 3P0HA 3BD6A 1H3EA 4UUQA 4F5ZA 3CH5A 3B01A 3GC6A 4PZZA 2GFHA 1E92A 2D1SA 5DFAA 4LF5B 4KDRA 4JQOA 1ZITA 3VD3A 3GQVA 2YH2A 4MYSA 4QNMA 4GOXA 3O9ZA 3CN7A 4WY2A 1E9AA 2CL7X 3IVGA 4G5OA 2FMUA 2RJOA 3H1GA 4UFKA 3PTYA 1NQJA 1W6NA 2GN4A 2JFFA 3KELA 4AFMA 1DJLA 3ENKA 1PJ3A 3AZOA 3BWXA 2B3TA 2R2GA 5HIIA 1EAYA 1HB4A 2W5FA 5AOBA 4DA4A 2H6BA 3NOQA 3UAXA 1CG6A 1FJHA 4YIKA 1PEAA 1BH2A 1BHSA 4PCUA 5EG5A 1TYEB 4R52A 3T7TA 5EPOA 2X4IA 2VHYA 2R4QA 3JQAD 4PNPA 5BSGA 1J8FA 1BZYA 4ARYA 2ET1A 2E26A 2ZGVA 4L2NA 4RIHA 2V7QD 2J8ZA 4L5AA 4RVHA 3U09A 4K46A 4J94A 4HDSA 5JY6A 3ROTA 1RAGA 4Q4DA 2RAFA 3OBBA 3ZY5A 2PSJA 4DV1B 2ZQYA 4KLRA 2C2MA 221PA 1BXGB 2UY8A 4K6KA 3I8XA 3SQWA 4DY3A 4G09A 3OQIA 1J8MF 5IAOA 3V6LA 3ASZA 3IAS6 1VJTA 4IG4A 2HBTA 1JLHA 5FMBA 3IP6A 1IGOA 1M54A 3O4FA 1ZD8A 4AO7A 4PPFA 4FK8A 1ZL0A 3AR6A 1FL9A 2YV3A 1UANA 2FQPA 2VNVA 5I8WA 5C3MA 2WQZC 5FYVA 1SHLA 1GRRA 4LOHA 3L2HA 4LSWA 3IMMA 2PVCA 5J96B 4LY3A 1EA7A 1ZICA 2OA0A 4CCJA 2D44A 5JXGA 2X14A 2G0AA 2N7GA 3DR3A 1E3TA 4D96A 2R5FA 5A2GA 4BX0A 2BNNA 2JAQA 4Q34A 2CKDA 3SBEA 2DVBA 3QVOA 4EI8A 3ZXIA 1GQQA 4YJHB 4PNHA 1AKRA 2NSYA 4H77A 3MG9A 4QHYA 3OOSA 3I4CA 2RGGA 6ADHA 4JNKA 4MTCA 2WE8A 1GTVA 2NPFA 2NU6A 4NYMR 1XVUA 3W1EA 2XQIA 2CCGA 1HDCA 4DMHA 2EGHA 1Y3DE 5C3OA 2VRCA 1NW3A 5A0FA 3EPJA 1RVV1 2WABA 2Y60A 3GLQA 3DMTC 4Z4HA 1QQBA 2WWIA 4OXRA 3UV7A 1W9WA 5IXJA 2WUVA 3GFQA 4D9CA 5SY6A 4KQ7A 5HKOA 3NJZA 1AKYA 5A1LA 5TGTA 3A2KA 2YWXA 3JQAB 1V9CA 2EXJA 4DLAA 5KNLA 3J8F3 5DBHX 2GZ2A 1EFDN 1KXJA 2VJMB 1UIRA 4L5BA 4RD1A 4RJKA 4NPMA 5AM1A 2W48A 3I76A 1NUKA 3MBKA 4WKCA 4FEAA 3BXXA 3FDXA 1MB4A 2QZ3A 2WUEA 2O8CA 2D1QA 4XI9A 4IGEA 3FBMA 4U3JB 2YCLA 4KPEC 4JJZA 2ODWA 4S24A 5DHQA 2E4UA 2I8AA 4JP8A 3A1UA 3NDIA 2BKLA 2PA0A 3FTQA 2PMDA 1E1DA 2JIBA 5FP0A 3NR2A 1RMQA 1S2EA 4RK7A 3KDAA 1UKBA 4B85A 2REQB 5AVRA 3ZYHA 5IJ0A 3HVJA 4DS3A 4C03A 1Q1NA 2PUWA 4YP6A 1CJSA 2DVAA 2CJPA 5FUVA 2JLZA 2QAGC 4HGNA 4TYYA 2NP7A 3UB3A 3F5DA 4X92A 4IMRA 2WOOA 3BFKA 3UTCA 4NL4H 3WO0A 1E1QA 4EAAA 4RTNA 2QT0A 2P8SA 2ZUTA 4B0OA 4MWCA 3BHJA 3IAUA 4M8NE 1VBD1 2Q49A 3O1RA 3ETGA 2ZEXA 3W7VA 1N2CB 1N5RA 2VBBA 3FLBA 3X0DA 3U4MA 3Q3EA 3LXRA 4LULA 3M3IA 2VZPA 1GCOA 3VU3A 1AVBA 4GBGA 4PIXA 3RT1A 2AD1A 2EIEA 3NO8A 2R2AA 2EIBA 2XCSB 4NV3A 1MR3F 1I1HA 2WJHA 1XMPA 3PEUA 4BBAA 4RACA 1HOTA 5JSOA 3TTTA 3HJTA 3LXUX 5COBA 2WR9A 2AMJA 4P38A 2D0IA 3ZDFA 2VTEA 3EEQA 4ZPJA 1IEVA 1N2XA 4PIPA 3VD7A 2OXIA 2BCGY 3EVCA 2JFYA 5FZ3A 1P3Y1 2AKAB 4RZIA 1XZQA 4HB2A 4I8XA 4OBBA 2CLFB 1NJGA 2CYAA 2EIDA 4B82A 3RVMA 2H0BA 5CCDA 1UKAA 5BSFA 5JUWA 2C6SA 5A7GA 2O06A 3WGGA 2PK3A 4TRRA 3H0CA 3I6QA 1VJ2A 4OUSA 2JFQA 2QX6A 4AAPA 1B76A 4RJLA 4Y2HA 1IZYA 4DIQA 4UARA 4L73A 1PS9A 5IUNC 5HJEA 1OFSA 5FEUA 2VNRA 2X0JA 5D21A 1Q14A 3H50A 4L76A 1NTOA 1P7CA 1RZRD 3AU9A 1B4DA 2GZMA 2VRBA 1YDWA 3IQIX 4O59O 2ZKNA 5LBFA 3V8RA 1JZ4A 5JNSA 1P3JA 4N3CA 4D8WA 3UJNA 2PIDA 2A84A 4JJFA 4DCVA 5ALGA 3RVRA 4AB1A 4DA7A 1XQYA 4RPIA 3MI8A 1GGMA 4ZI2A 3ZNNA 5EXTA 4DCOA 2NPIA 3EFHA 1ZL2A 1ZUHA 1TAQA 5FK7A 2UZ1B 4UOQA 1SUBA 2UUAB 2X58A 2ZGTA 3MCTA 5AVXA 1QTQA 2WM2A 3FBTA 3PICA 5EZYB 2EVXA 3I3QA 5KTMA 1H8VA 4W6XA 3RLFA 2HWB1 2YMZA 5EVCA 4CDUC 4N0PA 2O54A 4D6YA 1GZSA 5CT5A 1SHKA 3S7IA 2LGJA 3BXPA 4LVCA 1C8KA 1D1QA 3SZOA 5FOVA 3EUEA 2JS7A 5IMBA 5TT1A 5C5UA 2Z8ZA 1E61A 3W1WA 4OM8A 2WG1A 1F5NA 2KHZA 3NJYA 1CQJB 1DC7A 4UDXX 2EALA 1ESEA 4GEKA 3MT7A 3TLYA 1YCHA 1GV0A 2J3KA 2QRLA 3O8CA 2Y71A 3GFPA 4DIFA 1KQ3A 2F62A 3G5TA 4IR7A 3V2HA 4YCBA 3PS9A 2YXDA 4HK4A 1QJCA 1Z28A 1HV8A 1IQ0A 3QX7A 1DEHA 1FS4A 3GD5A 1E1KA 4D1YA 4GZ3A 3TOCA 2AUNA 2PFKA 5L9BA 3PDCA 1Z8HA 2A35A 3KXPA 3QX9A 4YJ3F 4R9NA 4P7JA 4ISQA 1ODFA 4ZHQB 4AY3A 3TOSA 4YVWC 1T8UA 5JEEA 4QZVA 4HBGA 2ERFA 4B1MA 1P62B 4D8UA 4PGAA 1BGVA 3F1KA 1EWVA 4F4UA 1H6DA 3F5MA 4PZCA 1YVDA 3FKQA 2PU5A 3VSAA 1JYSA 4LFAB 5CG2A 4LVNA 3DKVA 4NULA 4ZVNA 5LP1A 3BCSA 2R1BA 1G21B 5DAVA 1DC8A 3N9LA 4NV1A 4A27A 1ZK3A 3HNRA 1QE0A 3R7SA 4B80A 1P4SA 3O4GA 5B3AA 4ETIA 1JOPA 1N6KA 1US8A 4Y4RA 4O63O 3VNBA 1V8OA 2VBDA 3IA2A 2VT7A 4BMNA 2NN8A 2EAUA 1VMKA 1Q15A 4PRYA 1W52X 1PX0A 1GPBA 5KYUB 3S81A 1U1CA 2O5CA 3LDUA 3FWKA 3RABA 1AH2A 2Q4SA 2BHNA 3BXEA 4BMYA 2P2NA 5GONA 5F7OA 5GJWC 4GH4A 2YIVX 2IJGX 2VO1A 4GGMX 5IF3A 2HJRA 3LOQA 4GOMD 1FSZA 1JDTA 1IDN1 2I4RA 3ZCXA 2WVAA 5KU7A 4MOWA 4CU2A 4HGYA 4MI3A 4NK4A 4MWOA 5H02A 1JT2A 1XVLA 3KQYA 1NU8A 2X6RA 1AN9A 2EW2A 4RGYA 3TZ6A 1DCMA 1PJLA 2PMCA 1LZLA 2PX8A 2KPOA 1LPSA 3HABA 4OB7A 3OLXA 4NU5A 2WNUA 1AXEA 1D9XA 3VOAA 5DAWA 3DL4A 3CBQA 4BMSA 4BU2A 1EG2A 3AOGA 1H94A 1NXD1 1L5YA 4A1OA 1XZPA 3QA3E 1N8SA 2EJUA 2CYCA 4UOJA 3W58A 2BTEA 4QTYA 3AZWA 4D4LA 2Q3BA 4MKIA 5GM2A 2Z6QA 1NX6A 5IVJA 4RXMA 3F49S 1CYDA 5LZ4A 2V9PA 1I2BA 5JZOA 3E22B 2Q45A 5DN2A 4YFZA 2JCSA 4NH4A 5CB4F 3LPDA 3LU1A 2O0OA 4ZMRA 4RSUA 3C8ZA 2BGMA 1NI5A 3DTTA 1OT5A 5LWBA 3W5AA 1XEXA 1N57A 3WW3A 3HA2A 1J5PA 2EF0A 2WUFA 4NABA 3TQFA 4D3DA 1MDFA 1A7UA 1AU9A 1KMNA 1OX4A 2VNGA 1UDAA 4F3TA 3FPBA 4R1NA 1W6NB 4LBZA 4JDOA 4DUYB 2D2XA 1E1CA 4X7MA 1GD1O 3FGPA 1MJHA 2VRCD 4QYTA 3MSXA 1CX9B 2QTZA 2WYIA 3IHKA 2JAHA 1KA9H 3NEAA 1SK9A 1M2GA 5F1RA 3MS4A 3OKPA 3SJBA 1NKGA 3QBEA 4JR0A 4MWEA 3T7SA 3E1F1 3STYA 1SQ4A 3NEYA 4HTFA 2PRJA 3IB3A 2XGXA 5AXBA 1P5FA 1E7SA 2ZQZA 4EG8A 4JOBA 4E1VA 3Q7EA 4HDSB 3TB4A 2WKRA 5HIKA 3CUKA 1GGJA 2IXEA 3F6BX 1N2SA 5C8CC 3GNQA 4LIUA 5E89A 3R5SA 3ICVA 4I1VA 1JFVA 2VMDA 1Z4QA 4S0ZA 1MV5A 5JD3A 3GGLA 4I5DA 4ZQGA 2WDBA 2WFF1 2BEWA 2F8LA 1NWCA 3IIKA 3WCSA 3MGUA 3OP1A 3JWHA 4XWTA 3SIXA 1D2AA 5K3AA 2IXAA 3ANXA 4ZJUA 4M3NA 3E9DA 3CLVA 3BF8A 4DAEA 2ZB2A 4CDXC 4UXIA 3MBIA 2JEYA 3OZVA 2M9MA 4G5YA 4PXSA 4YM3A 4PAQA 4Q3LA 4BNWA 2VDKB 4WLOA 4JA2A 4YJGA 4GSYA 4C20A 3AO0B 4YP1A 3ZD7A 1DZTA 5K7SA 4AG3A 5B37A 1E89A 3BH0A 5FI0B 1Z74A 2WD8A 1E1QD 3NBMA 1HYGA 3NBAA 3LC0A 1GT6A 5IBRA 1U8AA 1CZOA 3WHPA 3EUWA 1U3UA 1DYOA 3LRPA 1IMOA 4GFDA 2V09A 4XYGA 5GLVA 2C4TA 2NU6B 5KYYA 1F20A 2J6HA 4ITCA 1G9BA 3M7AA 2B7BA 4B5LA 4C0XA 3TAYA 2QQNA 5IABA 4COYA 1BHGA 1K3TA 4E70A 3RNOA 1OLME 2X22A 1WWYA 5LYYA 4D97A 1PR1A 3I5MA 1XYYA 3OZTA 1XA3A 1OHHA 2ZPAA 4CCKA 1MRZA 4D44A 4PLFA 3RSGA 1B6GA 1YL6A 4IINA 3J26N 4JI8B 4BQRA 2ZBQA 2PANA 5BYNA 3R20A 2O8CB 3DFZA 1T8YA 2IBSA 2CVOA 5EZ6B 2HU5A 2ZGQA 3FKSA 5IM5A 2AFRA 1PVC2 2OZVA 5J9FA 2VLIA 4ZAWA 5J4VA 5EUCA 3ZBTA 2WHEA 4FYIA 3RU2A 3BKWA 4FHCA 3LSDA 2FDJA 2GNBA 2ZWVA 9LDTA 1GGNA 2WKSA 5DHSA 1S6YA 4QPCA 2C2WA 1AQ6A 2PXCA 1CUFA 4X60A 5IJ0B 1UMKA 5IWCA 4RA9A 4DZGA 1N6IA 2QMUA 4Y18A 3CQ9A 3HYNA 1RR6A 4X44A 2H1FA 2BFAA 1OKQA 4PGHA 1R1ZA 1EG7A 5ITSA 4R6WA 3J7TA 3EF3A 4CCSA 1HG0A 5JARA 3JY6A 2GMPA 1VBB2 1BMV1 1AF7A 3SNMA 4FN5A 4E2YA 4URVR 1FATA 2RCNA 3WISA 3IHLA 3SH3A 1LI5A 2DBZA 2XB4A 4JLBA 4IF6A 5JZGA 3V4ZA 3W8EA 2JLBA 1CUBA 3KPYA 4LTAA 3ZD8A 4WLUA 5CFNA 5DH9A 2FQWA 4PBPA 1C1DA 4K81B 1T0HB 3B7GA 3F3YA 5TQJA 1N7HA 1GPAA 4Y2GA 2G19A 3NAPA 3JD2A 4ER7A 2PGXA 2IUYA 4KMOA 1Z5PA 2BM9A 1XU1A 4D9GA 2G83A 1GEGA 4IEVA 2W9XA 4BDVB 4TYNA 4DQ0A 3AEQB 5FY0A 5A7SA 3EC1A 4KMRA 4EBFA 1DBNA 2W87A 3U5ZB 3ZW8A 4UHFA 3L1KA 4K5QA 3WY6A 1OB2A 5HV4A 3IMKA 4GD4A 1MRSA 5AI4A 1FOEB 3L43A 2OCXA 1RUE1 4DG9A 1BE6A 2RDQA 5FQNA 2WZR2 4FFHA 5JNWA 4OJNA 2RS33 5LEKA 4WY8A 4Z4QA 5A62A 3H4MA 1EXDA 2PLV3 4YRMA 4PVDA 3DE2X 2ERCA 4RV4A 5CFDA 1JHNA 4DJFC 1AR93 4U2KA 1GKUB 1AX0A 4PTZA 3PX7A 4MW9A 3OQPA 1ULEA 1H93A 2AFIE 4BUJA 3FPHA 5FO1A 2DTEA 2XKBA 4R2IA 3N2KA 1OA2A 3RHSA 1ULBA 3R6TA 4OHUA 3AXEA 3BRSA 4FPGA 2YG0A 2JGNA 3B7WA 4YLYA 2FSVC 2AH2A 3BIEA 4JGZB 3QE9Y 4GLBA 1XDDA 3KZVA 5M34A 2J22A 3PMSA 4OFXA 3IAHA 3RUPA 4W9NA 3Q3IA 5L4SA 3RYHA 3GP8A 4N3GA 1N3OA 1KH1A 1L7QA 4D3SA 1JZTA 2MEV1 3GDFA 4AFDA 5JZ9A 3RBXA 3RODA 2V6IA 3AFOA 2NYYA 4HQNA 3PD1A 2AG5A 4B71A 1YFXA 5JWOA 2IYFA 2P7HA 2B61A 5FLJA 3D6VA 4D4MA 3LLCA 4ASMB 4HEJA 3OJBA 1DRUA 3A58B 2CFIA 3RJRA 3FPCA 5DCUA 2LROA 2R60A 2QTVA 4LO7A 1DWPA 2AHRA 2HMVA 4HWSA 5CBLA 1DAGA 4F97A 4JSTA 1WUTA 5F3RA 4EJFA 3BMXA 4XDQA 4N7JA 5ALEA 3FFTA 2X0FA 3GDOA 4BGIA 4Q4V2 5DRYA 4WZBE 1LHWA 1JU4A 1M2NA 2B4KA 3C3EA 2AIRA 2CXXA 5D8AC 1D8AA 3V9PA 1HUQA 4B6RA 1EX1A 2WF5A 2AN4A 3RIHA 2QLLA 4ATEA 2QOEA 4KQGA 1AUYA 4FT8A 4JJ8A 2A14A 1HO3A 3ZR4B 5A4MS 1YHZA 3R8XA 3A23A 5K4HA 4CYDA 2NSDA 2OILA 3EXHA 1G9DA 1I4LD 3L7MA 1NSTA 1RHQA 2X2FA 5TPZA 2NO9A 3A3NA 2X5IA 3GEIA 4EG7A 2RIPA 3E0XA 3CF4G 4S2FA 1RHRA 1T91A 4LNAA 4OCZA 4N90A 1Z5VA 3NBZC 4E5NA 1AJOA 2WF7A 3YASA 3S27A 4Z82A 4HJXA 4CL2A 4BB0A 1US8B 3RFFA 3RIYA 1UCXA 1ZCJA 3KU1A 5HOQA 2CUNA 4KFCA 2CNBA 3SXJA 4IOMA 4FVVA 2OQ7A 2V4UA 3R5TA 1JR3E 3ICQB 3DGEC 5JV5A 5EPEA 3DDZX 1PVC3 1N33B 1WVIA 2E4YA 1BN7A 3PXGA 3B82A 3F8SA 5GONB 4GH4B 5DNAA 2JJQA 1IEQA 4L4ZA 1RTVA 1OAKA 4LMAA 3N70A 3EFOA 2JIJA 1UL9A 1OX6A 4OGGA 2VDJA 5FPQA 4DSUA 1LGYA 3L2YA 5FYCA 2UY9A 2E5FA 3LVQE 1W9FA 4II2A 4BLWA 2IYUA 2XCLA 3KVYA 1E99A 3UATA 3GJAA 3TZLA 2WNUB 4YCNA 2C58A 3BRQA 1HEYA 3TUZC 4CLEA 2WYOA 5IDVA 3RGBA 1W5TA 3CE9A 3LHDA 5JJ5A 4MHTA 3TO5A 3D3WB 2QCSB 1GO2A 4XBQA 1L5FA 4NH0A 3M83A 4XQ4A 2XV1A 1KY2A 1T0BA 3B38A 2Q8DA 3C6ZA 5C1DA 4H6WA 4BFTA 3B36A 2OQ6A 2Q0HA 4Q2FA 1PVVA 4W5RA 1V8FA 4Z7OB 1VRH2 4O08A 4LF8B 4Y8VA 1U7UA 4GALA 2AK2A 4ZXKA 4H1UA 4P0TA 4R2WA 4NIHA 1XEXB 1EDZA 3PQEA 2ODQA 2RSLA 3U17A 2Y1GA 4LRTB 3S8YA 1CD5A 5L40A 3TMKA 4RYDA 1J21A 2IEIA 3DLBA 4DNPA 1OX4B 3G2OA 3GVXA 1K92A 3BBLA 1JVBA 5GVRA 4L3VA 1UBLS 4GWJA 3ACGA 1QNYA 2UYGA 3ROZA 2ZYRA 1E1CB 4P81A 3QLTA 4KOEC 5HE8A 4ZI3A 2QQPA 2C0CA 3DHEA 3ZO0B 1EHIA 2GRUA 5DZEA 3O4HA 3CB2A 3JD4A 4YBZA 2WZR3 3SMQA 5LY2A 1HF3A 2O05A 3P94A 5IT9A 4BO2A 5TMDA 1NSYA 1TQ4A 4YNIA 1WB6A 3WJ2A 4HTFB 2ZRHA 1N0HA 5GAJA 1OHHD 1N1EA 3KZ1E 2ZUCA 3EW7A 4K40A 3MFCA 1H2AS 3Q9UA 4UJ3A 2AYXA 1VAMA 3N9IA 4DR1B 2PL5A 3NNDA 2VPYA 3VYSB 3WLIA 2NT3A 2FN8A 1ZC3A 4Z9FA 2XUDA 1HA3A 3J7MA 2MJLA 4JR2A 1L5QA 2BMDA 2FX3A 1R0KA 4GIQA 1LNZA 4RETA 3KEGA 4O1IA 3VSCA 5ALQA 3FBGA 3FKSD 4CI9A 4B4RA 2BEWB 1WCIA 1G8GA 3OQ1A 3CONA 1FPQA 3Q1LA 1CNMA 3G17A 3CF6E 2AG0A 2RB4A 3CHYA 3M6UA 2NIPA 1J2TA 1HT0A 3K4ZA 3TTXA 2CB0A 5EJ1B 1A8MA 5JYEA 2F4PA 1TCBA 1Q5OA 2LDXA 3H6GA 2PD6A 4XF0A 2ZZKA 3OJFA 4HN0A 4ER5A 4F72A 2DQZA 4MHSA 3EPLA 1WQ4A 2DPGA 2REBA 1AXRA 2EYUA 2X1VA 4YJGB 4YC7A 1JYEA 2ZSUA 3OGRA 2C5LA 3OOWA 3IERA 4KFSA 5HCHA 1SB8A 4IUBS 4N7RA 4LA2A 1MACA 4PFJA 4XQCA 5B2EA 2PZMA 1WCKA 4NIAA 1UXGA 1Y33E 4Q93A 5EZYF 3H2HA 2DG2A 4JBIA 4N53A 3BE5A 2Z8YA 1BS2A 2OHFA 5C8WA 1X0XA 2BGOA 4BEWA 521PA 2VVEA 5FI3A 3EZLA 5IX8A 4ILKA 1A69A 2YFKA 2Y6VA 1GYPA 5KYYB 3CNHA 3KSCA 2FPRA 2MYNA 3N2YA 4DYHA 3L8MA 1TM4E 4IQGA 5HPYB 2YZ4A 3M4YA 1KO5A 4OBWA 1CAXA 1XZ8A 5AJVB 5FV4A 2IOQA 2CJXA 1DV1A 4UOEA 2W39A 2BYTA 3DH0A 4CE6A 5TVKA 1SRQA 3GA7A 4NJOA 1N3LA 4FNGA 3G5MA 1X3SA 3I3OA 5FBZA 2CXRA 2WLSA 4AKIA 3BU0A 4HNSA 2EXIA 4J3NA 4HNQA 3G8YA 2JCBA 4H2AA 1TQ2A 5HKBA 2ORIA 1KY4A 3UESA 2PKYX 4XIOA 5HFJA 3JCZA 5E3HA 2X29A 5FWEA 1EESA 1BQ3A 3EXAA 3WLSA 4YUWA 5C5IA 2DERA 2HC9A 4DV5B 3MW2A 5FPUA 3K3NA 3SHWA 3Q7RA 4R9UC 2YMQA 3F46A 4ZQHA 2P1DA 5L3SA 1KHHA 4ZHQF 3ELWA 1XT6A 1ZM9A 2EX0A 2P1BA 3E6CC 3CLPA 4DBVO 1G8FA 4L8YA 5TX7A 2P67A 3TZKA 4HR7A 3E9QA 1JG2A 1HYEA 3M33A 1NXMA 1I2AA 1JSRA 3W5DA 1W4BA 5EE5B 3PZRA 1T3SA 3C3PA 3JZFA 3TUJC 3WG1A 3CF4A 1K7YA 2Q8PA 1DWQA 5FPSA 4D41A 4RA9B 5JAXA 2FR8C 1RQGA 2JI9A 5BQ5A 2H85A 4R1PA 3PVNA 5D8DA 3T0FA 1E2DA 4FEEA 4YRDA 1R8QA 3K05A 1F8FA 1OKKA 1CRQA 2JDPA 3LUCA 2GAIA 2I3ZA 5AKKA 2OLEA 1KBZA 1ZBA1 4Q9KA 3O1PA 3KSRA 3ENWA 2QJWA 1SU4A 2FSFA 3AINA 3ZYGA 5B55A 1TCVA 3DA8A 5KYWA 1F35A 1I3NA 1NVXQ 3DE5X 3FHAA 1Y8RA 5JZGB 1ORVA 4FYXA 4RIGA 3PNOA 2Q5HA 4IMIB 4G41A 2XUHA 1WW5A 4RTQA 1C4OA 1C1DB 2ZRLA 2BKUA 5FO7B 2ZI7A 4B81A 4N65A 4LXIA 3NAPB 3Q9OA 2DR0A 1FPN2 5A9TA 1G3MA 4BCCA 3WCRA 3ZFEA 1AZTA 1HT1E 4QPPA 4CV0A 4MH0R 1RBZA 3QUSA 3ZFGA 1BKZA 2I4MA 3WYEA 1YUNA 1YZQA 1XP5A 1A9YA 3HDHA 4TL8A 4OY3A 4YECA 1NT4A 3RC9A 1SC9A 1KO4A 3E3AA 3UJ3X 3LT1A 4FP2A 2E2WA 2E6UX 1G3QA 5C1PA