2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
b'NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
1NUKA 5JXIA 3SKVA 5HXMA 2APJA 1TG7A 2VJXA 5CD9A 2VCAA 3CQOA 1WCQA 4FI9A 4CU6A 3WNOA 2VMDA 4KWUA 4XZUG 3WQBA 2J1UA 2QQOA 3FHAA 4JHZA 3OBAA 3NRUA 2EICA 4K3UA 3HJRA 4BDVB 1JZ8A 2RVAA 1VJGA 2WAOA 3PUIA 1JZ7A 4JGGA 1ZMBA 3GGLA 2JDAA 4IYJA 3FN9A 4CU9A 4MO3M 1UY3A 5DPNA 1XPWA 1TVGA 2YG0A 2QQJA 3W7VA 3NJVA 2RJ2A 3VD4A 3DC7A 5CZKA 2WDBA 2E31A 3HN3A 2VZUA 2WO3A 2VZOA 1D7PM 2W91A 3I2KA 4UI9L 2C9KA 2WAAA 3WNKA 4CUBA 1K42A 4XUOA 2J1RA 3DECA 4XUPA 3WEZA 1Z8HA 5LA2A 4QAWA 3C7GA 3CKHA 2QBXA 3JXSA 2QQKA 3MUZ1 2BGOA 1EUTA 3NQHA 1GQPA 1T2XA 2CDOA 2B4KA 3BN6A 1BWPA 2VM9A 2VMFA 3GDBA 1W99A 1J84A 4DXTA 5LA0A 4H08A 3VD9A 4OYUA 3A23A 1K3IA 4OAOA 1U8UA 3ACIA 3FHQA 1JRLA 3I3DA 3MUY1 1CZVA 4HF7A 4LPLA 1CIYA 5LA1A 4PPYA 2V5DA 2JKXA 1J83A 2HYXA 4MOAA 1UX7A 3J7HA 3RJTA 4Q7QA 5JR2A 4LQRA 1K7CA 1K45A 2DCJA 3VDAA 4BK5A 4Z2AA 5B4NA 4QX0A 4S1PA 2J7MA 2C26A 4MGSA 3WNMA 1GOHA 1SDDB 2EIEA 3IB3A 2WBKA 3E1F1 4XURA 3C7FA 1UY2A 1OF4A 3IAPA 3IIIA 4GWJA 1BWRA 3MV01 1L7RA 3MILA 4MADA 2WZEA 5EJ1B 5JMOA 1GUIA 2W3JA 1JU4A 4P08A 5FUIA 2Y6KA 3I97A 1CZTA 3LPGA 1O8PA 1JZ3A 1H6YA 4KMQA 2W87A 2Y6GA 3VD3A 2XHNA 1NKGA 2Y64A 1GOGA 1JHJA 2VZQA 4OUEA 3PT5A 4OZOA 1PMJX 2VMEA 1V2GA 3HP4A 2EIBA 2VZVA 2YC2A 3NJXA 2Q0QA 5B5SA 3VDCA 2XOMA 4DUWA 4XUQA 3ETPA 4QDQA 1DEOA 4AAXA 1W0NA 1UY0A 4JKLA 2W1WA 3OGRA 2DDUA 3I2FA 4JKOA 1GMMA 2W1QA 3I3EA 2BGPA 2QQNA 4OMDA 3HPNA 3W5MA 3T2QA 1BHGA 4D0QA 2VQTA 1JI6A 2J1VA 3SLRA 1UMIA 2E33A 1OF3A 4L0PA 1DLCA 3HEIA 5EIYB 1UXXX 2VQUA 1MPXA 3CDZB 3I2HA 4TX1A 4KI5M 1US2A 4A44A 4ET7A 3T09A 4A4AA 4DXSA 1IQDC 2R7EB 4CUAA 4RN5A 1UY1A 2WO2A 4JKMA 1ESDA 4JJ4A 4QB6A 3WF0A 3UESA 4BXSV 1JZ2A 5JUVA 4P5YA 2J22A 2VZ3A 3T08A 2VZSA 3OG2A 2VOTA 3WF4A 1ULPA 4CU7A 4CU8A 3C7OA 3SEPA 2VMCA 2ORXA 2VTFA 2WN2A 4M4RA 1JYXA 4YPJA 5JXHA 5F7UA 5IFTA 2J1AA 4W50A 2X10A 2DCKA 1UMHA 2ZEXA 3D3AA 1PP4A 2C4XA 2WN3A 4E8CA 3A22A 3K77A 4OAPA 1I5PA 2WYSA 1W9TA 5LCWL 2ZEZA 3FL7A 2Y6LA 3T2PA 5C71A 1W9SA 4TTGA 1XC6A 5A1AA 4ZY9A 5I0DA 1JZ5A 4RW0A 4IUGA 2YFZA 3OEBA 2VL4A 4ARXA 2W46A 2VCBA 2L9LA 4DXRA 5JD3A 4PF1A 2JE8A 2WABA 1ES9A 5J1XA 3LEIA 3VD7A 1KEXA 3T2OA 2VO5A 3EYPA 3IDAA 2Y6JA 4JHLA 4QPWA 5JXJA 3DYOA 2W1UA 3K46A 4DEQA 2Q0SA 1DYOA 3ABZA 3DT8A 2BZDA 4A42A 2VPTA 1F4AA 4GWIA 3A7QA 2J1TA 2JD9A 3OGSA 5B4XA 1YQ2A 3ACHA 3UNPA 3K4AA 3I3BA 4BJ0A 4QX3A 3CIHA 3MBWA 1CX1A 4ARYA 2ID4A 3I2IA 5HOEA 3C8XA 1JZ6A 4NRDA 1WABA 1ULOA 3DT9A 3P6BA 1BWQA 4P02B 3CMGA 3KVNA 4PQQA 4JKKA 2XQXA 3HOBA 4LHSA 3VDBA 1W8OA 3DCIA 3LEGA 4PT6A 2Y6HA 4UOJA 4DUXA 4ZZ8A 3LQCA 3NNGA 2Y8KA 2E32A 2Z4FA 1RYYA 2YFUA 2VZPA 3C7HA 4GZ9A 4JJ6A 2X09A 1PX3A 1UWWA 3LE0A 3PUHA 3I2GA 2BERA 3WSOA 5IFPA 3CZUA 1JU3A 4A3ZA 4Q9AA 3A21A 4DEVA 3DYMA 4XVHA 4CVUA 2VR4A 1PMHX 4CUCA 4OMCA 4E8DA 2VC9A 1NX9A 2X05A 4QB1A 1GOFA 1GNYA 4A6OA 4QDRA 1UYZA 4K7JA 4D8MA 5JXGA 1SHWB 2W94A 4UAPA 3K4DA 3MV11 3WNLA 2VCCA 2QQLA 1DP0A 4A41A 4ZXEA 1F4HA 2W95A 5C7GA 1UZ0A 2LS6A 5DMYA 2O14A 2YB7A 3U37A 3OEAA 3SEEA 3T0BA 4RYDA 2QQIA 3WF1A 1W8NA 3DT6A 4P00B 5BN1A 4HG6B 4QX1A 1O8SA 1NAEA 3UETA 4QB2A 4M8KA 3THDA 2B9VA 2W5FA 2V4VA 2ORZA 4A45A 3ZM8A 2HSJA 4ZZ5A 1OH4A 2W47A 5CYYA 2CDPA 1JYWA 3C7EA 4QDSA 5DN2A 5G05L 1OT5A 4I8IA 2PQSA 1GU3A 1US3A 3BZWA 1SG3A 1PX4A 3OB8A 5A4AA 3EB7A 3LPFA 3K75B 1DEXA 1FXWA 3WNNA 2W1SA 1XNTA 1JYNA 4TXWA 2J1SA 4LKSA 2EIDA 3I2JA 4QX2A 1H6XA 1OD3A 3HNMA 4MGQA 3P94A 2HLEA 2WZ8A 3MO4A 3HNYM 3F2ZA 5IJRA 2WQ8A 2W9XA 3SKJE 3K4ZA 3OGVA 1WKYA 2VZRA 1O59A 5DQ0A 4W4ZA 2V72A 4K40A 3ECQA 1HN1A 2LW8A 3WF3A 1L7QA 3ACGA 1CZSA 3C1UA 2J1EA 1LNSA 2ZEYA 1UY4A 5HPOA 4HYQA 2E26A 1W9WA 5C70A 3LEKA 3ACFA 1P8JA 1UYYA 3CZJA 3P1IA 4XUTA 3VD5A 4AG4A 3WF2A 3DYPA 1KGYA 1J00A 2VZ1A 2ZEWA 1IVNA 3THCA 4RSHA 1JZ4A 1YZFA 3T0DA 5G04L 4BK4A 1JYVA 3HNBM 2QQMA 2OKXA 3WNPA 2ZXQA 2XONA 5EJZB 2W92A 2RV9A 4XUNA 3W5NA 5IHRA 1VYHA 1UYXA 2VZTA 4W8JA 4DUVA 3BGAA 3GXUA 1EUUA 1ESEA 1XNAA 3AC0A 2BBAA 2WUHA 1ESCA 1R64A 5IYYA 1K12A 2YC4A 1FXWF 3IAQA 4M4PA 4K9SA 3GM8A 4JX0A 3T0AA 2WO1A 1UXZA 2KD7A
chains in the Genus database with same CATH superfamily
2QZJA 2P35A 3SKVA 1USIA 2A1XA 1WLYA 5KHGA 1VLJA 2ATXA 4A5SA 3OUUA 4QQRA 3HDYA 2V4UA 4OQQA 3FROA 2WA3A 4IIXA 3P2OA 1Y34E 1G20A 2O2YA 4R8SA 2EJCA 3VBSC 4R41A 4EOGA 1ETUA 4DQDA 2BMDA 5FP3A 2VHZA 3MTBA 2H85A 4YQZA 2PBFA 3U17A 4KYIB 1I3HA 4MYSA 4LHLA 4EROA 1TKCA 1X1EA 3IDOA 1N34B 5DLQC 3MUZ1 4INZA 1N2BA 3F90A 1GD1O 4ZYVA 1Z88A 4M1QA 5NLLA 1W36D 2DSNA 2PHUA 1E1RA 4Q4Y1 4X8LA 1XJQA 4KCGA 2WTAA 1XAIA 4OQEA 3T0IA 1HOTA 4IRMA 4YHBA 1TADA 4JYZA 1JIXA 2RI6A 4M9XA 2O0MA 3I72A 3L6EA 4CKXA 5HCUA 5CPBA 3CLKA 2P5BA 1QXJA 3WLAA 5LD2B 2E48A 3CJIA 1XE8A 3JVIA 3MXOA 4PINA 3A4YA 3T4PA 3K70D 1WKVA 3LW8A 4CSWA 1CZTA 4YUAA 2OM6A 4WVFA 2VTDA 2E3JA 3PU8A 1OTXA 2J0UA 3HQXA 1GOGA 3QP9A 2GM5A 1Z34A 5BOSA 1E0AA 4QQNA 1JYEA 1MOQA 5APAA 2VUTA 3U39A 2OZEA 3OZEA 1U94A 3V97A 5FADA 3FW1A 4BMDA 2CXUA 4A16A 3JY6A 2WB4A 3R5XA 1X8LA 3DE6X 4GPZA 1YRHA 1M2NA 5SY6A 1W39A 4FOSA 4L8GA 3RNOA 4JV5B 1G4HA 1PZNA 3SHRA 2FDCA 3HLTA 2R62A 4OFBA 1V37A 4ATEA 4F4FA 2WD8A 2CSUA 3AIKA 3Q11A 4HVRA 4MIYA 1W6OB 2NO0A 3P27A 2NZ2A 5FCCA 3J8F3 2P2KA 1KSFX 2Q8NA 4HT1T 4BUJA 1I5PA 4X91A 3UMMA 5KNDA 2AOTB 2Y6LA 3HV0A 4UHCA 2P62A 4G25A 4XQ4A 2CNKA 1XAHA 4YT5A 3WDTA 3RV3A 3GUUA 4A3SA 4ZU7A 5CVRA 1YO8A 4JVAA 3QU7A 4OM7A 1W6NA 1TAGA 2OYSA 4EA7A 5CB6A 3WMFA 2UVPB 1T2FA 5G0TA 4FFBB 1V0JA 3B1JA 5B4XA 5A5GA 1PK6B 1CGPA 4RFRB 2ABWA 4D6RA 4HPXB 5EJ9A 4Q4JB 5ITZA 3M2PA 1T2DA 4Y6OA 4K9QA 2YHIA 1JEYA 3RUAA 4XM1A 2OPBA 4IGAA 1QDLB 3UMRA 2YOFA 4DV6B 3BFVA 2GBIA 1DQYA 1VE9A 1SUSA 2QRVB 1T1IA 2Q8OA 3MJEA 4EUKA 1RQ2A 5IXSA 3PENA 4L07A 2UZ1B 4XVHA 4UUOA 4RCYA 3R0JA 2DUUA 4PFJA 2Z3VA 3STVA 2W6PA 5I7UA 2CLOB 1WQ1R 3PSAA 4I5DA 2FPOA 1Q3TA 1G8SA 2VF2A 3R3VA 4PG8A 3EIHA 4YHHB 3TXYA 1W28A 3KVBA 4PLGA 4FTWA 4DV7B 2DLDA 4UFMA 1H05A 3AQ4A 4WT7A 2H1RA 1R0ZA 1UBMS 2ZJ4A 3DEYX 4FIDA 3L0CA 5M3BA 3V7WA 2R16A 2G9QA 3A7DA 1KI6B 5FXMA 1DLIA 1NY5A 1NVEA 1GYRA 5B7GA 2ODAA 3O2NA 2D7FA 2VUCA 1ISRA 3OEEA 1VMDA 1BDHA 2C84A 2RHTA 1LRKA 3BAZA 3AIIA 3NBZC 1ZVKA 1X2EA 2GC3A 7ADHA 3AINA 3ZKWA 5FOJB 1SVSA 2EZUA 4XYMA 4DBVO 1SIUA 2V7VA 3RWNA 1PCXA 3W9BA 4BQNA 4MW6A 4G23A 1AL22 1EFTA 4HKOA 2X3FA 5C70A 4RPCA 5FZOB 1D9ZA 1ZIYA 1Q77A 1IE3A 1MU0A 2ZT8A 2N46A 3UAOA 3IB6A 4Y6LA 3SSOA 2V3CC 3A4NA 1GAXA 5DZGA 4WX2B 5J2TF 2VFAA 1RL3A 4XUNA 2XPCA 2XMBA 3BTYA 4S0XA 2BAGA 2ZBDA 4IIJB 4M1SA 2A1TS 2X1HA 2W39A 3VHLB 1QRTA 4B4QA 3FZQA 2G9FA 2WG1A 3T1NA 4GOLD 5HXMA 3HR4A 3M7IA 3MUNA 5F3EA 1WW8A 3WXBA 1NXMA 3GB9A 1Q43A 4BO2A 2QBYA 3R4SA 4QG3A 2IOFA 4O4HF 1I9CA 1YQQA 2P4EA 2RCNA 2AUTA 5F39A 5A1JA 4QPDA 3FIUA 3D6EA 4NCXA 1OU0A 2OXBA 3ZXEA 2C8KA 4BB5A 3UWSA 1CUSA 3AKEA 1BHO1 3ZDVA 2BNOA 4JB8A 3E35A 4O08A 2WDBA 3EAFA 3WP6A 1LECA 4QECA 4UATA 3EZXA 4UI9L 2C9KA 1B0UA 1I3MA 1O0SA 5AKXA 3D6TB 3ZU5A 3HR9A 1XCGB 1DIHA 1EUTA 1IDN1 3FKJA 2JDMA 2C4NA 4ZREA 5HFAA 4Y67A 1NC3A 2HYKA 1I4EB 2WT1A 2WUFA 3THPA 3ZXDA 3PUVA 4Z0NA 3VDRA 3TSYA 1YZHA 4KG7A 2EFJA 1ISIA 3BMCB 4U6QA 4HMZA 3INTA 2VT3A 1CUIA 3KCQA 1Z3CA 5A3JA 4HJRA 3T0GA 4W6ZA 2NXCA 2IYTA 2P91A 4ZQBA 4J07A 4YRKA 2OYZA 3X43A 4KO4S 1GNZA 1PW7A 1Z6PA 1EB9A 5LIPA 5BN4A 4L0DA 1JKJA 4FQ8A 2PYTA 3TKLA 4OQ9A 4MVCA 5ANNA 2QTZA 4IH1A 2PWYA 7ABPA 1GPUA 5JZBA 2ZSDA 1A27A 1FTSA 2ISCA 3D4KA 4RQAA 3OCPA 3HPNA 2CK3A 1Z7GA 4ZVLA 4CKEB 5CU7A 3N2KB 3WP5A 1FU8A 3CPJB 5BUZA 3D8HA 4ONEA 1JB9A 2WI8A 2HA3A 3UV3A 3ORRA 4UT5A 4MUEA 1AZSC 2REOA 3OZVA 4ZKTB 1RW4A 3J8F2 4PPGA 2YYAA 3QRWA 4HSGA 2XH6A 3IAHA 1ONOA 2FOLA 1G4AE 2OORC 2BWJA 5EWMA 5HKAA 1X7DA 4LNVA 4RV4A 4M4RA 2V6FA 2VT7A 1G98A 4EI8A 1DQZA 2OQRA 4AHYA 4PYLA 4B5KA 4AHXA 1L5MA 1L5OA 4KQCA 4RTKA 4K1YA 5IBRA 3OZBA 1OH5A 3MCUA 5BXYA 3Q6IA 4AT1A 4EE2A 4F7DA 3ZYJB 4IQFA 3PDHA 4LSZA 2NN8A 2C0ZA 4UAJA 2HXYA 3I92A 1JR6A 2KWIA 4CCDA 3OOSA 3KDSE 5DDJ1 3B51X 1W4ZA 1FRZA 3H2YA 2C5LA 3OF1A 3DMTA 3KPYA 1A9RA 1YK1A 3I3BA 4OJNA 2IFWA 1T2VA 1UPCA 3TIIA 3IYLW 4FHDA 4Q4Y3 2OAGA 1VBFA 3L1IA 1Q7RA 3HV2A 4WZBE 2GC2A 4JR0A 5FMCA 2UU8A 1JXOA 2AJ8A 3C6MA 1RAAA 3H9GA 2ZSIA 3P0HA 1GCAA 5FA5A 5INTA 1G5TA 4DEVA 2EFDB 4MGYE 3RT9A 2YVKA 4X95A 5FOUA 1N2HA 4HQNA 5CTJA 3JD71 1U3VA 3ZXYA 2EYUA 4WNAA 4RHUA 1ULBA 3BXEA 2CYAA 2ZROA 1F5SA 4WIAA 3WFZA 1OSGA 2YBPA 1E6WA 1JQ3A 3EH1A 4HDNB 1WCV1 4UBOA 5JVDA 4H55A 4XWAA 3IURA 3HI6A 1XZEA 3TDKA 2BFUS 3GJ5A 2CXOA 3IVMA 1U2SA 5K2OA 4DT1B 4Q9JA 5FWYA 5C8YB 3EXG1 4N5IX 4S2EA 2VXCA 5TQ0B 1NI5A 2BFAA 1OWPA 5ARDA 5A4AA 3QE2A 2GN4A 1DXHA 3AF2A 4JUBA 1UQTA 4WM7B 1T36A 2H2WA 1QH8A 1DT5A 4I81A 2YOHA 8LDHA 5JFOA 3VZNA 3PGXA 4ZYLA 2P1BA 2ZSHA 1OC4A 2C2MA 4ZKDA 4TV9B 4YRZA 5LY2A 2DKFA 1LNSA 4TM8A 5HBRA 1EHIA 1FMD1 1WZUA 5HVNA 5T50A 4RENA 3EK2A 2V4AA 4XBQA 1N7IA 3DL3A 3USES 1X1DA 3NANA 4XWGA 2ZE6A 4D4LA 3GL9A 1YFKA 2FD8A 3I0NA 4RVDA 3ZWNA 4EKEA 4PRLA 1J33A 3N2YA 4G9GA 3RC7A 1A1VA 3IL2A 3W9YA 3KQ4B 2AEMA 4K6BA 3L3BA 1M83A 2EIGA 3B9CA 4GM4A 3OPMA 3V8MA 3CQOA 2H9YA 3IMMA 4YYZA 3GMIA 3IHKA 3P9NA 2R49A 5BN3A 3LPCA 2P2DA 2R8EA 3BWXA 2QQOA 4BBZA 2WR8A 2X13A 4BBJA 4QT4A 1M8FA 5EN4A 3HJTA 3LY9A 1JZ7A 3X1WA 3PFGA 1HYHA 4Z2YA 3AJZA 3FUQA 2IC5A 3NHMA 2QQJA 3T6KA 2RJ2A 4MHTA 2OPHA 2QM3A 4I55A 2W6JD 2BFDB 4UMFA 2L0XA 1QGOA 1V7QA 3WGQA 3WEZA 1N3PA 1E1NA 1YACA 4U7HA 3CJTA 1YI7A 5KDLA 1XQNA 3HZRA 1HDKA 1CD5A 4RX1A 1SHJA 3MBKA 3OZXA 1SLLA 2G1UA 4R9VA 3BWCA 4LI3X 1VIVA 1YU6A 4UFOA 4HVOA 4CCLA 2HJRA 3EO6A 3H4MA 2C00A 4JLJA 1TA0A 4DR6B 5DI9A 1JR3A 1CJKC 1CF9A 4BVKA 4JQRA 1XTQA 4XPIA 3PLQA 2F6BA 1P0IA 1L7RA 4YGBA 4HRXA 3KUDA 1L5LA 5JMOA 1LWOA 1TRKA 4IESA 2A6PA 2JKBA 4CW7A 1NUQA 3KZKA 3CLVA 4D8TA 4I3PA 1KTVA 1DQRA 2HMWA 1G2OA 2IQIA 5KSZA 4V1CI 3VH4A 4BTEA 1GZ4A 1P2GA 3G8DA 1PJAA 3WSWA 2M6KA 2X29A 3UUEA 1F5JA 2AQIA 4BGEA 1JUIA 1QR2A 4YK7A 2QW0X 3EXIA 5U1PA 4YRDA 3AVSA 1OC2A 1GGKA 3ON5A 3OOJA 4JJ4A 1G8PA 2X5KO 2VJYA 2WDPA 4XDYA 4LYHA 3U4GA 4WCFB 3MYYA 2PFKA 5J2UB 4K87A 1CULC 4DNXA 4I4TF 1FXZA 3V0BB 2NQ8A 4LJRA 3RIEA 1NNEA 3VX4A 1UMHA 2LVBA 3LVBA 1PR3A 3FYCA 1BX1A 4ERNA 2CVHA 4M9CA 4OF4A 3WYFA 3JWJA 1RZ3A 4D4KA 2ZJ0A 5T3NA 4AEDA 3BIFA 3RW9A 2JB4A 3GWZA 3AEQA 3BXPA 1OIVA 3FB4A 1QP8A 3ZLTA 3T2OA 1MX5A 4HPJB 5L53A 3Q98A 5A3OA 2B5WA 2BNMA 4Q4Y2 4TMFA 1JLRA 3PNOA 3H16A 3TAUA 1KAHA 1Y43B 3LD8A 4PIXA 5LJLA 1P6QA 3OE4A 2HPZA 3C6QA 2J1TA 4LF5B 2H07A 4M88A 3ZS9A 5EJ7A 1Q8SA 1NF2A 3AR6A 2ZTUA 1ADCA 1FRFS 1G60A 5A9SA 1X9HA 4LOTA 3KUCA 4J0EA 4I1VA 5TMDA 5F7OA 3VBFC 3GEHA 4Y2YA 2LRHA 1ENYA 2VK1A 2C2ZA 4KIUA 4XARA 3RVRA 3AKPA 2BERA 1P4RA 1TW3A 3H1AA 5DV9A 1TPYA 3NAPA 2VW2A 4YVWA 5J58A 4HV4A 1YCHA 1YKSA 2C3PA 1VBA1 5D87A 1WG8A 4WSOA 4LDJA 4QASA 1YC61 1ZD5A 1RVV1 4H7LA 2WLPA 4MO9A 1ZVQA 3E8XA 2WA4A 3K32A 4XAQA 1P2VA 1F2TA 4RHV1 3MNFA 3IMCA 3DMPA 4CNBA 3HA2A 3O8LA 3USSA 5FULA 2L42A 5DN2A 3AERB 3PCRB 1AR71 1Z68A 4CF5A 2PQSA 3FRIA 4CEIB 1B0AA 2PYZA 1FFBA 4I0WB 1Z7YA 3BK2A 2X9GA 2O5RA 2ARBA 2HTFA 4PFSA 4U7DA 4LYAA 2VCMA 1Z5GA 2ORYA 4G1UC 1LU9A 2EQBA 3TRIA 5A0TA 3DMFA 5ARCA 4XX1A 1XP5A 3HRKA 4I30A 4UAUA 1XQWA 5LOVF 4TTVA 1Z28A 1N8KA 4X7RA 4XD7D 2X5OA 3I83A 2HBQA 3P1IA 1KJWA 1Z4QA 4WI1A 2QRUA 3UMJA 1SUCA 1JUHA 1Y6GA 2Y93A 4BRWA 4EZ4A 2A73B 1RABA 4HVQA 3BQMB 2QVXX 2WVHA 3I1YA 1DJLA 5FIXA 5DDJ3 5LU8A 1GPAA 4EGJA 1OD6A 4UU0A 4KO2S 3AB7A 3J81k 2WUHA 1FRNA 1DGWA 3L4SO 1UWVA 2OC9A 2XWSA 5IYYA 1VLZA 2CGEA 1VG9B 5HFJA 4I9NA 2K46A 3X1MA 1Z6TA 2PV0A 1NPDA 4MXVA 4B45A 5C8CB 4JY7A 3KL2A 2PHDA 3T3GA 8MHTA 3OO0A 4GRIA 2XXZA 3N2NA 5LA6A 1R27A 3T4XA 3MWEB 4R68A 3B78A 3JATB 1J1ZA 4DG8A 1OQ1A 4BU2A 3FNBA 1XC7A 1ZJ5A 3JD73 1UC8A 3VR2A 5EV7A 3DUFB 4YVSB 2YS6A 1YQ5A 3HRIA 5DH9A 1EWYA 2Q1WA 1X13A 3N2GA 3NQHA 3WGUA 5JRDS 2ONYA 3RLIA 2A3WA 3MLKA 3VKHA 1MDBA 3L8MA 5KZMB 4DBZA 3IMFA 4FJ1A 4CODB 4UDYX 4V3CA 4DSOA 4RJ2A 3LCRA 3HRHA 3E84A 4XJ9A 3DUIA 5DBFA 4JX8A 3OM8A 4PSKA 5J4YA 3P0EA 2EW8A 3CL1A 1OFSA 4SLIA 2WVJA 2CBXA 4TMKA 1MFZA 1XEAA 5IUNC 5T6BA 1XHEA 1MZFA 4XYLA 3NDBB 4UU7A 3PTLA 4F5YA 3DDHA 4B43A 2FP4B 3W6UA 1BMFA 4PDWB 4DTIA 3ZUGA 1KWKA 1SGWA 4LMBA 3I05A 2AKAB 1U98A 5IVVA 4RD6A 3N9NA 2F1RA 2TSYB 4EG1A 4Z7JA 3D7NA 1W0NA 3CRNA 2LR0A 4YRCA 1RI5A 1FMD3 3QNWA 2A4MA 3QOWA 1R12A 3T2QA 1TEHA 2WRAA 1Y1RA 3LC2O 2FR8A 1XLUA 5AMXA 3UJAA 2C7GA 1ULGA 1OH3A 1HOXA 3C8DA 4TX1A 3AZWA 4RU1A 4ZVOA 2A84A 2AX3A 1USGA 1JZ2A 2PFSA 1OFGA 2ZI3A 1HC7A 3ZY6A 3WZ1A 4EW2A 2JVKA 4JYBA 1AA6A 4ZD6A 4BQPA 3GH3A 5ALZA 3NGMA 2YNMA 4Z82A 2ZIXB 2W6IA 3T2PA 4PQGA 1N5LA 5A1AA 3HLYA 5C7YA 3LLVA 3DWGA 3MGKA 3QU4A 3VO8A 1HFEL 3OGJA 4JENA 1EP0A 3TZHA 4O3FA 3K1YA 5AVYA 3WMXA 5LMNB 2Z1DA 1LI4A 3GQBA 4GOJA 2B78A 2Q3BA 5DM60 2FHPA 2HO4A 3UWPA 3GIWA 4KXUA 2CMGA 3NC4A 4HUJA 4AP9A 3JAKA 1NBMA 1T2UA 1MKYA 1A3CA 4QM6A 4Q15A 1UKRA 3DD1A 3T12A 3SZUA 2XNDD 2RDQA 5J5VA 4MDHA 5TY0A 1YA6A 1B1CA 3HFRA 1H8VA 4RHCA 2EKDA 3GFBA 3LA6A 4J2TA 5LA9A 1ANKA 4IILA 3P5BA 5JQWA 3VM6A 2WWSA 4M3CA 3N7TA 3OJLA 2J3HA 2WWRA 3VI3B 2OA0A 4H3HB 1T0IA 1QFMA 3VL8A 2BSAA 4NX2A 5KDDA 1UZZA 2XB6C 5CG9A 1BYUA 1BCXA 3N9QA 4QYXA 3KR9A 1H1TA 1SXGA 1A4UA 4OHVA 4W5HA 1KWGA 4FOWA 3JRXA 4BCUA 5JY6A 4N01A 3RRXA 1KQPA 4A45A 2PIAA 1I7QB 5CRIA 2DPHA 3QZUA 1CZOA 3MVEA 2Q99A 2ET6A 3QVGB 1S4QA 3LYLA 4OXRA 3JARB 1ZC4A 2PGIA 4M0FA 1M1YE 3E5HA 3ZW7A 1GKKA 3WB9A 2OV4A 4PI2A 2DM6A 4ZCTA 4UXHA 3UXMA 3EUEA 5FKBA 3AHFA 1I3CA 1YDHA 4FB4A 4ZTZB 5F3CA 1Q20A 4AULA 4MAAA 3WRYA 5DDJ2 2HCBA 2WYVA 2A67A 1E3DA 5EIEA 3O1OA 4RSHA 1EP2B 3G1TA 1AM4D 2IHVA 1TZ2A 4G63A 2QQMA 2KLBA 5KHLB 1ONBA 4QYSA 2YBKA 4Q0UA 2IXLA 4XRRA 2C2KA 3R1IA 1T35A 4CEYC 4D6XA 3RUEA 4HTFA 2GLXA 2ZCWA 4FYWA 3NUGA 4UFKA 4K9SA 1OZHA 1Q12A 5C7OO 3K51A 1Z45A 3O8NA 4A8JC 1IXSB 1N75A 4MEJA 3L82B 3GNEA 3TIVA 5JSZB 3THXB 2ZM6B 3OCVA 3UG6A 1FI2A 4DC1A 4EL0A 3BSYA 3N7MA 3JD72 1ENRA 5A62A 4OQYA 1QPZA 3AY3A 1Y37A 3RKSA 3Q3GE 3VZLA 5FBQB 4RD2A 1TMKA 1Z47A 1M0WA 1P4AA 1VBA3 3AP2A 1MO6A 2CFTA 3WBKA 4HZIA 4G67A 1SQ4A 3BBLA 1DBSA 1PSWA 3EXG2 5FQOA 1AMOA 3HCFA 4RHV3 4GZMA 3WGJA 4DDWA 1QFYA 4QUKA 1QPGA 2VDQB 1SUBA 2O3TA 4HVCA 3EHKA 4HNSA 3LBFA 1AR73 2HSGA 2HLNA 4IEIA 4CL0A 3ZDYB 5IK2A 3LW7A 3DV0B 5FXZA 1EDBA 5CDFE 4GQIA 2Y92A 1LJUA 1SUAA 3MJDA 5HQTA 1U63A 1R6DA 3FNRA 1GNHA 3NC0C 3H18A 3MINB 3VPCA 3UJ8A 1LZLA 1C30A 4LMRA 4RV5A 3JVVA 1FMD2 4QAJA 4Y2GA 4OSOA 1FDSA 4LC1A 4MITA 4OUEA 3ZY3A 4CDXB 1K4KA 4POOA 4DUWA 1MBZA 2BKVA 2OCYC 3ZCPA 2CVOA 2HRCA 1WUTA 1PWZA 2GO1A 5BNNB 3BQNB 3GYDA 1EJBA 2FRDC 3CUVA 1D2QA 2O3RA 3OOYA 5FZAA 4I01A 4B4PA 2I6UA 1E77A 2R7AA 1KK3A 5DWDA 4CMIB 5A4JA 2ODBA 3DBHA 3NVAA 3CCFA 2XUGA 4KBYA 5JCXA 3IUYA 2O2EA 1XVAA 1MV5A 4C5BA 4C22A 4U7GA 3CT6A 1GSOA 4OJQA 4JJIA 2WN2A 4WOPA 4FXPA 4TZTA 1JECA 5KYKA 4R9SA 2BOJA 4E8CA 1NUUA 3O7WA 3S2UA 4NCKA 2EARA 4FVVA 5EQUA 3RU3A 1V9LA 1IBMB 2DKNA 3RJ5A 4ETIA 4F4HA 5K0GA 4B33A 2D1TA 4LOSA 1YR3A 4IV1B 1C2YA 4W1PA 4INJA 2WABA 4EABA 4ANFA 1QYCA 3QA3E 2XX3A 5BMOA 1SN7A 4B8YA 5KNCA 3TD9A 5AXDA 2PAFA 1NX6A 2BGWA 3SQMA 1JDJA 1E2DA 5K03A 3FFQA 3G9ZA 1GL7A 2P37A 3ZVLA 3NV7A 3BD8A 5JNWA 4HMOA 5KKCA 3ZJTA 2YJGA 3ZE8A 3OE7D 3GZAA 4OU5A 5EP2A 3LEGA 1ZD2P 1D6MA 2NU9B 1W59A 3VR6H 4MQ6A 4YMHA 4FINA 3CX6A 1QXRA 1JEQA 4JI0B 3EFEA 5FZHA 1FX0B 1TKBA 3ESDA 4FILA 2HWB1 4EH1A 1HE5A 5AM3A 1CUEA 4A7KA 1TE2A 3HBKA 4QDTA 4BX0A 1LPPA 4JNCA 3O0XA 3KM0A 2Q8EA 2BM0A 1L8QA 3G88A 1IS6A 1ULEA 1M2VB 3QH7A 5DNYB 2Q45A 4O8CA 1E3LA 4Q7JB 3ON7A 1A82A 1RHKA 2G88A 1Q6ZA 4QB2A 3CZ4A 5H3LA 4EZBA 3CG4A 3MIEA 3BK1A 3K30A 3MFQA 2D44A 3U78A 2VXYA 4ZZ5A 3ZCUA 4IF6A 1BVHA 3RSFA 2CBGA 3FI0A 4NZPA 2HUNA 4XYBA 4X6YA 4HSEA 2IYYA 4DA0A 4JOQA 1M34B 3S2ZA 1ZX5A 3KYDA 4ACAA 4KQKA 1ENOA 4BWVA 2E5WA 1RXWA 5C52B 2RHWA 3ACDA 2QU8A 4BV8A 2FPXA 5ADWA 1JKXA 5I9SA 3QUBA 3CNAA 2H17A 1O1YA 1AF4A 2RKWA 1QYDA 3B1VA 3IAM6 2PX2A 5EZWA 4NDZA 2IPOA 3FSRA 3OLWA 1BFDA 3EOAI 4CIDA 1UFQA 3B1YA 3EA4A 3TM4A 2GX6A 4PYOA 4QDOA 4UUNA 2LUOA 5A7PA 3H13A 1E2MA 2DEUA 2YCLA 3VL9A 2Q3MA 5JD5A 1SIBE 3MDPA 5HNKA 3OZAA 5H81A 3ZIAD 3TO5A 3P9CA 4JI1B 2JFQA 4ZT7A 3PTRB 1J9EA 3LK6A 5AHKA 1E6EA 4FU0A 4XFJA 3VH2A 2VQDA 2D3SA 1W94A 3NG1A 1NUKA 3VPHA 2QL7A 2BH2A 3EDRA 1SBCA 5BWLA 3PPVA 4QPCA 5KWEA 3OJWA 1G41A 3D9QX 1SM4A 2VQFB 5FPZA 1SULA 2TMDA 5AVTA 4DLAA 2IE8A 1AHNA 1PVDA 4XUGB 3AUYA 2XCOA 1CZKA 1Y3AA 4MO3M 3W7VA 2P9EA 1G5IA 4XVCA 4EN9B 1WUYA 5DK6A 1S3SA 3NKVA 4MVJD 1W9MA 3CLSD 1G8WA 1KEKA 3KV9A 2XUQA 1HSZA 2A5DA 4MVJE 5EEGA 5CA0F 4RHV2 4GI5A 1ZN9A 1W6OA 3T7EA 2P7IA 3IR5A 2HDHA 1UFOA 2D06A 2IYSA 4C88A 2NZYA 5HP4A 4XZ3A 3WSTA 5HI0A 3BTUA 1AR72 3U10A 3SIPA 4CMHA 4QM9A 1Z12A 3U3RA 4ECAA 1JQEA 3Q0EA 2IIBA 2NO9A 4BMNA 4X0EA 4ZVUA 3V3KA 2GFQA 4GH5A 4Q4HB 3AJEA 3A32A 1AYM2 1SXJB 3KLNA 4S1PA 1BQPA 5DHSA 2SKDA 3GLRA 3IE2A 4Q4DA 4FLFA 2UVPA 3KOUA 4FFBA 5GZEA 1QVZA 1RZVA 4N49A 1JOBA 4IJMA 4KK4A 5I7VA 5JXWA 5IWCA 1RQ7A 4S2GA 1KVUA 4Q4JA 1SXPA 3IV9A 4P9WA 2PLV1 1MW8X 3SBXA 1LB1B 2Q0QA 5B5SA 4IV3B 1YR6A 1FJXA 1LPMA 1O5LA 2QRVA 5FBHA 4DQLA 4NPAA 2XCIA 3IAEA 2VVDA 1VCOA 1LSUA 3WDSA 1K2WA 2UZ1A 3T54A 4AN1A 2PANA 1R4NB 1S2DA 3IQDB 3KOXA 2ZGTA 4L4RA 1WVMA 1Z4IA 5JUVA 5DE3A 4MWGA 3DR5A 4HH0A 4BV3A 5CB8A 3ZE2B 4MPDA 3HU5A 2YWRA 1NP3A 1F0YA 4DY5A 3EARA 5IXJA 1TQ5A 1W19A 1TLFA 2BF7A 2JAWA 5FZMA 2QI9F 4OHBA 2VJLA 2UYGA 5BW4A 3NWKA 4K9RA 2QTAA 1K3TA 3UT6A 5LYJB 1ZGZA 1YMVA 4N3BA 3ROEA 1O87A 1JDBC 4G9EA 3JB4C 1EG2A 4DPLA 4TXJA 5DX8A 3WLTA 3ASIA 3QY9A 1H2MA 4MV2A 3PGJA 7MHTA 2H5LA 1WXGA 3PFHA 4JDOA 4D3SA 2P3IA 1PKXA 3JYLA 3ACHA 2JB8A 4RA0A 1BEV3 1YUMA 3I37X 4P9IA 4ARYA 5FZOA 4N7RA 3KB6A 2ECOA 4MSUA 1ULOA 2HBYA 1NONA 3COPA 1KVRA 4PQQA 3VJKA 3WGIA 1Q21A 3V80A 1G6KA 2QL9A 2JLCA 3AF5A 2IDJA 3PJQA 2A5FA 3NT5A 3HCAA 1IJFA 2DC1A 4I1RA 4MVJM 3U3ZA 3Q9LA 2WC2A 3RUIA 1YSCA 4IIJA 3LQRA 4US2R 2HBRA 4PAMA 5EWLB 1D0IA 4LDNA 2QAJA 4YY3B 1V6CA 2F55A 1TQ2A 2V65A 2OQ6A 3F67A 4N90A 4C5CA 3HN1A 3O4HA 3J8F1 1RP1A 1V5EA 2W95A 1N1TA 3R3YA 2ZK7A 4GKXA 4Q0QA 1OIXA 3SH3A 2BVNA 4L50A 5BSRA 1P75A 4GB32 1UKYA 4F4IA 1U5IA 5JNTA 4BQEA 1GEEA 3QXCA 5KI6A 1V1RB 1EUCB 4I8IA 4R2JA 1GU3A 4J75A 4GBJA 3WYNA 2WPDA 3ANNA 4F3RA 4LKEA 4A7PA 2J1SA 4F6LA 1ICIA 1QLWA 3W21A 4GSYA 1IOVA 2E6KA 3E4DA 1THGA 4F3TA 4YCBA 5K20A 1W25A 5CVEA 3BMCA 2AFIE 1R66A 2GERA 2PAMA 1UYYA 4BMEA 2W11A 2AWOA 3MOIA 5D6NA 3DMHA 3WLQA 4YMGA 3G5AA 3AVXA 2FE1A 2AXPA 3LO8A 4X93A 2P79A 3X44A 3URKA 3VB9A 4F8AA 3QEMB 3RRDA 3D8UA 4S3MA 2G1AA 2NACA 3ZYCA 4GGMX 3DQZA 3WZ2A 2YC4A 3K9HA 1DDIA 3SQNA 5AIBA 3SEFA 5HDBB 1XZ8A 3VDQA 4FW8A 4K2HA 4CKEA 3N2KA 2FE4A 1GGFA 3LKZA 1EXMA 1U0NA 1F2DA 1EY2A 3G0BA 3J7LA 4OKIA 3RF7A 1VI2A 5E2AA 2IU6A 2HWB3 4ZCPA 3AFKA 4EGQA 1KBOA 1JEOA 4B75A 5GJVC 2Q50A 1D6JA 3K9LA 4TQAA 4C0SA 4ASMB 1F2NA 1LHOA 3G9TA 3MXTA 2FCUA 2P77A 1Z38A 1T2AA 2HEYF 2GM3A 3B00A 4H08A 1HQNA 2O2IA 1FA9A 1LLFA 1L3JA 2ZP1A 1XTRA 4FZVA 2VOVA 3HBZA 1KY4A 5ABJB 1XKXA 5JCJA 4LBOA 2HI0A 1DZIA 1PR2A 4CG3A 1EQAA 3JPWA 4H14A 5FP8A 4CCOA 4R5MA 3UF0A 3SCHA 1N5DA 2G5CA 3CJQA 4LZNA 3TGLA 4UHEA 3KQWA 2Q30A 1P1BA 1BWRA 1T0BA 4BVLA 2RJ3A 1I2AA 2ALJA 4G5GA 5TGTA 2EBFX 3AG5A 2RHBA 4NKRA 3HHPA 5T41A 5A7QA 4HOYA 4NIHA 1PT9A 2ADMA 4EHNA 1OA2A 4YDRA 4TSKA 4EVIA 4OK5A 4AAXA 9GPBA 4P22A 2NT4A 2O59A 4G1BA 2BGPA 3MWGA 3GFSA 3ET4A 3EXEA 1RC0A 3HT1A 3CNBA 1GR3A 5DAQA 1VP6A 2IT1A 2EJWA 4A44A 3N8KA 3FGNA 2Y05A 1O58A 1SKYE 4WV3A 1QHGA 2PSDA 3FJOA 5F9HA 2HJSA 2VZSA 4AP6A 2JARA 4CU7A 4XQCA 1DGRA 1BGXT 2CLHB 2PA3A 5LXTA 3TLBA 4BLSA 1R8YA 1QH0A 4HDNA 1KZHA 4YPJA 3VNSA 4G0MA 5KHJA 1TYBE 3B02A 4BAZA 4BNIA 1JKIA 5TSWA 2DHCA 1J3RA 4DT1A 4YRNA 5C8YA 5TQ0A 5B6PA 4YTEA 2FW8A 5TGZA 3I54A 3O47A 1ZA7A 2X8KA 1U6KA 5FH9A 4NE2A 1V6JA 3LEIA 3DMDA 4WM7A 1BEV2 3B9BA 1G5FA 3KOZA 2DF8A 2GB4A 3GAMA 5EY5B 1SHTX 4E2FA 5IZCC 3GMDA 2D2EA 3FZNA 2DWUA 1QP0A 4A82A 1KIMA 5DOZA 4GWIA 1TMF1 1X38A 3V65A 3WGLA 3D64A 3N05A 3CZRA 5C1OA 3O4JA 4GE0A 2IL1A 5A5FA 1JSXA 3RTEA 4LO5B 3SHTA 3E0QA 3VZJA 5CBPA 4JYAB 3OI7A 4ZCQA 1CR7A 2WHYA 4P4LA 4XCBA 1L8XA 2FDKA 2BR4A 5B1YA 4BXOB 3FUCA 4A3ZA 3NM4A 1BVUA 1X1SA 1C1DB 4NTZA 1VFPA 3GCWA 1PV2A 3CV3A 2GZSA 4LFAB 1VTKA 5FTNA 2F6RA 1HRV2 2COEA 2PLV3 5AKHA 4AQ7A 4PZZA 2OO7A 5KO2A 5IU6A 4M0CA 3KT7A 1AKNA 1J2JA 5JZ9A 1UBNA 3AFOA 5CCDA 3IBCA 1AGRA 1IM8A 1M2EA 1TM2A 4TPKA 1ZVVA 1FVHA 4NAUA 2JIZA 5F3DA 3O9MA 2BFDA 4FPFA 2ZR9A 1REDA 4PO3X 3RG8A 5TS2A 4JBGA 4Y4YA 4W82A 2G76A 2XD4A 3WIOA 3S55A 3B48A 3H4TA 3Q12A 4J1NA 1S9HA 1B14A 3I32A 2XBO3 3WYAA 5FPAA 2WQ8A 4WHMA 2GT1A 4BP9A 3RYPA 1QMPA 5KYXB 4XSHA 1Q2UA 1SUIA 3O73A 2O5CA 4B7ZA 3APBA 5LQKA 3CZQA 2ZPTX 2I2BA 4LXQA 1DWOA 1I9GA 1YCGA 3ZN2A 3NJYA 3WDVA 2CE2X 1OFNA 4YYOA 3KXDA 3TLKA 3U19A 1EGMB 4AKIA 3B1ZA 3KQSA 1Q15A 1YA4A 3BWBA 1B43A 2PMCA 1CLUA 1F8XA 1XNAA 4M8NE 3RUDA 2YDYA 4DM7A 5JAZA 2OVUA 3Q9UA 2PTGA 3IBTA 3ES1A 1HE2A 2J9XB 4QQPA 3WDUA 1MNAA 4RTMA 3QU9A 1Z7S2 4DCJA 4QXAA 1I4TD 2W43A 1ZOIA 3EGXB 1OXCA 4XSVA 2UY8A 5LBUA 2HWB2 1JEDA 3KTDA 5JYDA 4HATA 2FI1A 5JSFA 1U8TA 3E9MA 3JD2A 3SQDA 3L7AA 2JIBA 4X97A 4A0SA 5KC6A 3KAKA 4DDVA 5CZKA 4AVAA 4WCFA 4RSMA 3ZWMA 5J2UA 1C8KA 4J94A 1HORA 2YW2A 3IRVA 2JENA 4FSDA 1VBB1 3V0BA 3QLVC 4Z9FA 4W1RA 1ZD1A 3VZOA 3IKWA 2XVLA 3BZBA 3SS9X 3PPWA 4DIFA 2AJCA 4ESOA 1HYGA 2RAPA 3AYDA 1BAPA 3G5TA 2O2JA 4QJ4A 3V7UA 4FFOA 2GYYA 4WV8A 5LMZA 1FXSA 2QSZA 4EFDA 1IKQA 1CIJA 5EKXA 3M3QA 3OQ6A 3KF5A 2VEOA 4FPYA 4GWMA 4E11A 4C4XA 1B6RA 4BMYA 4UVDA 4Z2AA 1SLTA 3IIJA 5LK5A 3BL6A 5L4LA 1Z4OA 5FOVA 1KRWA 4E2XA 1GPJA 4IAOA 3TTUA 2ETXA 2JANA 4QUBA 4KWKA 1R6VA 1H2ZA 1O8PA 5EPOA 2GXSA 4Y9TA 4Y6GB 5AVKA 3A1NA 1GNQA 4JUCA 6REQB 2B20A 4XIFA 2R68A 4KQXA 1NVXQ 5DKFA 2JJQA 1A9SA 3CTMA 1UY0A 4DR2B 2CL2A 5TXGA 4H3WA 2Q62A 4IR7A 4LE2A 4KPEC 4RPGA 3ID6C 4R0VA 1ZAKA 3QK7A 1NMSA 1TA4A 4BFTA 1HMYA 3E5UA 4IQGA 1IN7A 1YB2A 1G6NA 1LV7A 3ZGXA 4XIGS 4RZXA 3EIOA 1YQ6A 3I34X 3IIMA 1MOZA 4CUAA 2XLAA 4DPKA 1II9A 2KE5A 2YQ5A 4GP9A 4Q34A 2CYBA 1GOTA 2LNDA 4TL9A 4YJGB 2VOTA 4IYRA 3A0UA 1LEDA 3EC7A 4I1IA 5JS2A 3W59A 5MGNA 2V6BA 4D9JA 5IC4A 4BNVA 3JZVA 1UU6A 3MN1A 3NETA 2ZOSA 4AMVA 3AERA 3WA7A 3RDPA 4CEIA 3TL2A 4JEIA 3EZ6A 5B30A 4EBFA 1GTJ1 1MC4A 5IVKA 3B36A 4JDUA 4LHNA 1O95C 1S0DA 2GTPA 3OQHA 4GSKA 5BN5B 4KXNA 1PZ8A 4RIIA 4YAFA 2AN3A 3ZFEB 2EAUA 2DMRA 1WHTB 1X1AA 1PEDA 3HVUA 4BWGA 3PXDA 2JL1A 3L6OO 1B41A 2WHEA 4S2DA 4ML3A 2XW6A 5AJHA 3WE7A 4AJJA 2UZ4A 2DH5A 1EP9A 4IDBA 3C8MA 5C8DA 3V9PA 4BNNA 2HX1A 1RXSA 4B4KA 3LAWA 3FD8A 3CLRC 2PLV2 3OKCA 2Z69A 1GDHA 3GT4A 1IOLA 5D7NA 4WBNB 3EEOA 4YNIA 1G63A 1HMPA 5I0UA 2C9ZA 4HBZA 5AM0A 4YCCA 1MV8A 1ZH6A 2PIDA 1NJ5A 5C8CA 3AJ9A 1R18A 5F9TA 3B8EA 4ZOCA 3H0OA 2YB7A 4DSNA 5CDUA 4MQEB 2QSJA 3MWEA 1RJ9B 3JATA 4CCKA 2XT6A 1OR8A 3VR5D 2BPA2 4YRGA 4UFJA 1FP6A 3QH6A 2ANBA 4IVNA 2XBO2 1QHSA 5BMVB 1ONSA 1TEVA 3VU1A 1J3PA 4D8VA 4YVSA 2B2NA 5JSYA 3FCUB 2TMYA 4K9KA 4I9HA 5CW1A 4LWQA 1KR2A 4GMDA 1U3GA 2NO5A 4XEZA 2Z1NA 3DPIA 2WKQA 2RBGA 3OGVA 1YV9A 2YVLA 4RGBA 4CIBA 1XYOA 3CNNA 1R0BA 2LW8A 4LV5B 2HH9A 4U2KA 4Y18A 3BSFA 4D6PA 2J1EA 1KEPA 4JVMA 4L7VA 5FXXA 1XDUA 4F2GA 4DFDA 3BHNA 2ZKIA 4UFHA 2EP5A 4IZ6A 3AYAA 5IMBA 5C0OE 4OH7A 1XMJA 2FP4A 4LXLA 3MJ4A 5EUMA 1WRBA 4PDWA 1XZKA 2NPIA 1COV2 5E16A 4CMJA 3AVVA 4WPGA 1VLHA 4A7YA 1Z6QA 3WQHA 4L08A 1V5FA 2VECA 1TMF3 4UMDA 5T52A 4BNHA 3ESRA 1CK4A 2ZABA 1DVRA 5L7YA 1ILEA 2QYSA 1DGQA 2W71A 3IVAA 1H1IA 3BI3A 3AP4A 3QCWA 4CQMD 4D8WA 2PDAA 2ODEA 4GMGA 2ZRDA 4WY5A 3FDFA 4CIWA 3M82A 1BCRB 4PSCA 1UBKS 5L19A 4MGZR 2Q7OE 1SCAA 3WGVA 4DDUA 5A3LA 2FN3A 3ZJYA 3ZIUA 1JP7A 5FY9A 3PXAA 5JLAA 3K72B 4BJ5A 3INNA 3KETA 4QODA 5TEWA 1GYPA 3RRJA 2QE3A 2ZIXA 1GRVA 2BWAA 1KSHA 4MRSA 5AVPA 4FBMA 1V35A 4GDFA 3RJTA 3FETA 1S4CA 2PPVA 1PDWA 3S2EA 4Q4W1 1XNRB 2QGZA 4XTPA 4DQAA 3PVSA 4GR4A 3CF6E 4FXOA 4IDAA 1YC5A 2X8WA 1RACA 4U8GA 1H42A 4OSPA 1XPJA 4TN5A 2FTKE 4TTAA 4CKBB 1YDFA 2YY7A 5DAXA 4JL5A 3TH5A 4I5FA 3AP6A 2QI9C 2YY5A 4EJ6A 1FYFA 2UXBB 2RK3A 2XSZD 5BNPB 3LXMA 1YJCA 3F4KA 5EHZA 1Y6FA 1A2OA 2WNUC 3HKBB 4R81A 3KT1A 1KOGA 1O3QA 1QO0A 4EUSA 1CYEA 1R9GA 2WWJA 1ZA1A 2Y9MB 2PD4A 3TW0A 4YASA 4KGDA 3AFIA 4NMXB 3RDIA 5JUWA 2GJSA 4QB6A 3PL5A 1CY2A 1GZVA 2PJDA 4GPTA 1PO11 1KEZA 4Q3EA 5JXHA 1DHTA 4CPBD 2GNTA 1VA5A 1P74A 3N8DA 4RACA 3BXOA 1STOA 2E4UA 4KJXA 3W1VA 4TVKA 2ZU6A 3DWIA 4CLXA 4L28A 2O0JA 3K0EA 1XRSB 3QVGA 4Q26A 2EJBA 3I59B 2E5FA 3I2DA 3ERCA 1IK4A 1ES9A 2ACKA 3JARA 3IEXA 1N3LA 2RMU3 1S2MA 1VBB3 3IDSA 3OFND 4MUFA 2QRJA 4DXZA 1S01A 1UQRA 5ULLA 1KNQA 4E5YA 1TQ8A 4NWIA 1MR5A 1OLME 1FLDA 3ONFA 5DYTA 2XVYA 3ZEIA 2ZE8A 2CKMA 1H6AA 2HMSA 3F5SA 3IS3A 5CFNA 2GNBA 5AJYA 1ULFA 1P2SA 4EY4A 5J48A 5KB3A 1I94B 3RASA 4PZPA 5M0TA 1XZIA 5IKOA 3G1WA 1DDOA 3D7KA 3DDUA 2J0EA 3FWKA 1AKMA 2CJFA 4I0BA 2WNIA 1CUHA 1AQNA 1SIOA 2ZTNA 4MNTA 3WWPA 5EXEA 1M2KA 5FZCA 4IXTA 4BB0A 4UREA 1ZN2A 4L3WA 3L40A 4V2WA 3PJYA 1IC6A 5JZMA 4ZAYA 3QVXA 3A04A 1CT9A 2D2XA 3GZUC 3KS7A 2VTVA 1A5SB 3U7IA 4CDRA 3THXA 5JSZA 4C08A 2IUEA 3ND7A 3TUIC 3IKMB 3UO8B 3QLEA 13PKA 5A80A 1JW9B 4E5VA 1ZGBA 2I7VA 5L3RA 2GAUA 2CDPA 1HX6A 1A2KC 4M7PA 1WULS 4NABA 1PJ4A 3EYWA 2ENRA 1G8FA 2OFXA 4YFZA 2YZMA 4KO3S 1JG7A 2P5TB 4CP1A 5ESRA 5IJRA 4G4FA 4Q0SA 3H8JA 4MGTA 1T1SA 2Z8YA 4DCMA 2I80A 1QE0A 3FYSA 1HNWB 1WV1A 1KJ8A 1VYUA 5GM2A 3A31A 5LQAA 4FEGA 4B8WA 1XBFA 4OUMA 4E27A 2VBFA 3ACGA 1WSAA 1GN9A 2IYOA 2C94A 1KK1A 4RCZA 1ZNZA 1ST8A 2A0UA 2OBFA 1XGKA 2IPAB 1KGYA 3DV0A 5IAAA 2D7JA 4CF7A 2FPPB 4K6OA 1TMF2 4DNOA 3OIVA 3S0MA 2DWQA 2XONA 5IK7A 2QY6A 2WSUA 4YONB 3RGGA 3WWOA 3DE2X 1UYXA 3OUTA 3H3XA 2HLDD 3NBYC 3LG2A 2UYBA 2FSVA 4CDXA 4DADA 3LHDA 3WKAA 1K12A 1FXWF 3TLAA 2OLKA 4XJXA 2VYCA 5DASA 4Z9BA 1RHQA 4D6YA 3K2BA 2VDOB 1V95A 3QIVA 3C41J 5ITVA 1E9SA 2ZGMA 3V6MA 4YREA 2J5KA 3PEWA 3HJCA 1F14A 3W34A 4M9ZA 4LE4A 3KRTA 4CMIA 2F1OA 1RRKA 1BVP1 2C4MA 2XXJA 4R2KA 1XKTA 4DIKA 4ZJZA 2R00A 1BBT2 2IJGX 1NSYA 3S0JA 2WAAA 3C3DA 4KG8A 5ALOA 3KZOA 4RY9A 4RS5C 1BWPA 3M4XA 2VMFA 4EA9A 2WM2A 5GZDA 4K0RA 1T5IA 3IT0A 4UPEA 4AQYB 2NM1A 4MDYA 1HK7A 1JPJA 1IQRA 4BKMA 3VSCA 1A8HA 1JRLA 4DZGA 4JDNA 4ENUA 5CVTA 1G0NA 3WZLA 4OFXA 2O2XA 4IV1A 4D5EA 1GUAA 3RFUA 1NYRA 5DBGA 1W0KA 2DCJA 3E3NA 4HL6A 3GY0A 4QM7A 2J59A 3LC1O 3N8HA 1CJMA 3KBBA 2AA3A 1HNZB 4TKMA 3W20A 2BBOA 3WQRA 2Z8XA 2ADFA 4PIVA 4GPEA 2WLQA 2GF0A 1U81A 5EHDA 4HDKB 3ER6A 3D6AA 4QX8A 4DB4A 4JA0A 5AUQA 4HPWA 1IHDA 4S0ZA 2VA8A 3EUAA 3NATA 5FO8B 4ODIA 3KQUA 3RFFA 3V1NA 2QCSB 4G8CA 3RVBA 3TOVA 4AD8A 1E6CA 2NU9A 4ZVRA 4B7KA 2R30A 1M5TA 2PT7A 4RMJA 4OOEA 4YCNA 5A3NA 3LXUX 4EY7A 3O94A 5B3AA 3W5MA 1FX0A 1YIDA 4E5KA 1X14A 1Y1PA 2IYEA 2V7QD 3ZI7A 4RZIA 3LUFA 2JFNA 1UOPA 1W2HA 3KQOA 3HFJA 2J22A 1JBCA 3VN4A 3OG2A 1AKWA 2V7GA 5AKIA 1M2VA 4ASKA 3NHUA 2AOXA 3ZDZB 3C7AA 3HFSA 1E96A 4QXMA 2RMU2 2H3EA 5GV8A 3FNIA 3R3WA 4ND5A 1W1WA 1VBB2 4URYR 3WOVA 2JHGA 4L4XA 3FVTA 2XGSA 4BO3A 2L9LA 4HFMA 1M34A 3P3PA 4J2HA 2YWBA 3K16A 4YJDA 1OZ0A 1LLQA 1AYM1 5CXXA 3K0KA 1F0NA 2GXQA 3OT1A 3POSA 1N4AA 3NHSA 3CUKA 1WQ3A 3CRW1 3PITA 2VBDA 2JB9A 3TEWA 4ARAA 1AXGA 5FFFA 3F3SA 3CB4A 2VKQA 3EVDA 4HRVA 3PE4A 4HNRA 2C29D 1BA3A 1TNDA 1L5FA 1W36C 1FE8A 1N2GA 4Q4W3 1U1CA 3CG0A 1CAXA 3VPBA 4UW5A 3D4IA 3LC7O 1YRQA 4EKIA 4HZUB 4LZAA 1MRSA 2Z95A 4YJ2B 4Q9AA 2GSWA 4QVGA 4H6WA 4QJ3A 4LZWA 3T06B 1LW7A 4O0MA 1EFPB 3ZHTA 4IUCS 3G9UA 4UNNA 4TUYB 1XFAA 2QSUA 4K9OA 3WINE 3LVRE 1KVTA 2ARCA 2DUQA 2HAEA 3QPUA 3E97A 1T8UA 3KELA 3M7AA 4TKVB 1F4HA 5DMYA 3BF8A 2X2OA 5DX0A 3OLCX 1W88B 4LJ6A 1CUDA 3UZUA 4BATA 3H97A 2BM8A 3FNGA 3O83A 4JC5A 3KLSA 1SZDA 4MUMA 1NLQA 2A5JA 5KBYA 3QKWA 4URAA 2JG9A 3D02A 5F2KA 2VDNB 1W04A 1WY5A 5EKUA 5KDOA 4LXUA 3NNJA 4AJKA 1PO13 4A8PA 4EYUA 4WD3A 3C8HA 4KXWA 5DXFA 2D2FA 3NKTA 1VJCA 3ADOA 1BXRB 5HF9A 1GAWA 5KOHB 3LEMA 3UMVA 2C9YA 1DARA 4QE3A 2IXGA 1SXJA 1DC4A 3LEKA 5EE9A 5C4IA 1BYHA 3WF2A 3UY4A 4RGQA 5IAKA 1FFCA 4ZU4A 4R0NA 1WW6A 2CNOA 2AACA 5A70A 2XVAA 3M6WA 3LP8A 2H2GA 1SXQA 1E2PA 3A1WA 3V6LA 5TX7A 1JWLA 4YCAA 1ZU4A 3STTA 5KQPA 4TS4A 4IE6A 3EPKA 2GVZC 3G9QA 1T4DA 4KQ6A 4IV3A 2CNAA 3VTKA 2FVYA 2VJOA 2CBZA 4RQPC 1T0UA 1ND3C 4ENWA 4EWDA 4AQ6A 3T3OA 4CU6A 1E60A 4P31A 2FEKA 3RRFA 4G5YA 1SACA 5ED0A 5A7WB 4UBLA 5IDWA 1R4NA 4RVCA 5FUVA 2O0LA 2R6JA 5TV2A 4U2CA 1C5KA 2WG2A 3GGLA 1ZLYA 1UY3A 1XD2A 4WE3A 4GB31 2ZQZA 3V8PA 3AFGA 3OPYB 4AJHA 4DSAA 3GQVA 4YROA 3CKHA 1QZXA 4NIIA 4AZWA 5TGDA 3H7YA 3EFOB 4ENVA 3NOXA 2WWUA 4KXFB 4TLDA 3SWWA 3FFXA 1RXFA 4XUCA 1XF9A 1QFZA 3R8FA 4EEXA 5LYJA 1C7FA 4BY9E 5BT8A 4GYKA 4P0TA 5EIHA 2P2ZA 4X84A 4EWLA 2Y6FA 2XYRA 1L8OA 3BA1A 5E6RB 4UQPA 2O6LA 3PFWO 2SNIE 1SOUA 2X1LA 2W3JA 2Z6UA 1E5LA 3AGQA 1IN5A 1G4UR 5FYTA 3M3EA 3STUA 1WB9A 3DMYA 3DOHA 5EGNA 5I9NA 3PIDA 3ZDRA 3KALA 3NZEA 3OECA 3AWDA 3D4NA 2W1WA 2Z1MA 4M46A 3QTLA 4TLLB 4HAVA 4OA8A 2DVBA 4CR6A 5EWLA 3HZHA 1ZJZA 4HAWA 4R8KA 2DBNA 5IVJA 1VL1A 4N03A 2V7WA 1Z82A 5JTUA 3AHEA 3LIGA 2VULA 2FEPA 1XDGA 1Z5WA 3R3XA 5GZFA 4GALA 4H3KB 4DWJA 4M2LA 4EJFA 2R0FA 2EKBA 1D1SA 3N9LA 3E22B 4Y2QA 4WZFA 3HNOA 5DHPA 3EIXA 1YRYE 5E89A 5I48A 3BWVA 2RGWA 3ABSB 3REFA 4CQLB 4L4UA 1KPGA 3AYEA 4ZVQA 1EUCA 4XCAA 3EEQA 1CS0B 2EX0A 2HOQA 2QLMA 3PC3A 3H1TA 4JT4A 2BW0A 1KIFA 2D1YA 3LUJA 4HEQA 4Y2SA 3BDIA 1KPIA 4G89A 2NU7B 1USWA 4UD6A 1NLFA 1WIWA 1XZQA 1SLAA 3D3WB 1J58A 5DN6D 4Q4W2 3NTLA 2VHQA 3WIVA 1NRIA 1IATA 1L5NA 4QUGA 3OJXA 5SZJA 3OAAA 2J3IA 4XQGA 2FEAA 1RAHA 1VRBA 4UEWA 2DY0A 1THMA 3ED1A 4TT8A 5HGXA 5KQMA 2QE7D 3QEMA 4HQLA 1NNUA 3TSWA 1ZBA1 1QKKA 3KSDO 3I9FA 3QE3A 3IAS1 1CF4A 2AC1A 4XX0B 1A71A 1K08A 2IYQA 3FVVA 4NZYA 3GP3A 1HT1E 1HV0A 1E98A 1JVSA 3FMIA 1GQHA 2VP0A 3M3CA 3ZQKA 5FZ4A 2YXEA 1XRRA 1MF7A 3IESA 3ABQB 4HG6B 1RLIA 4LS3A 2P68A 1QHYA 1WBBA 3TRJA 4YDSA 4MB0A 1PO12 4XRGA 2NZUG 2C2YA 1KL7A 1WD5A 3I1JA 5HCBA 4KL8S 2BEJA 2OB2A 3T3IA 1UDXA 1JYNA 2BBVA 4AYTA 5FMOL 2YJ5A 3I2JA 1W0JD 5AW5A 2AOWA 4LOIA 1OW3B 4J03A 1BEV1 1FNNA 5FO0A 3AUJB 1Z15A 2Q3HA 1XTSA 4OL0A 2QAIA 5L7OB 3RS0A 5ABJA 3TEXA 2QTVB 2OP0A 4G5SA 3TNDA 3KQNA 2YMMA 3NHJA 5KQSA 5BYNA 3PDWA 2Q5EA 5FP0A 3VBOC 5ES3A 1FNYA 2HL6A 2BU9A 2EKQA 3FJSA 4I0AA 3PA8A 3HA3A 2W2QA 4XCXA 5FY1A 1Q8QA 1AYM3 4TZKA 1PBTA 1T0HB 5ALMA 1KY3A 1YHFA 2RV9A 3W5NA 4F3NA 1KDKA 1I6LA 1YQGA 2H4ZA 4ZWNA 1YJAA 2VHCA 2IIVA 5MFPA 1LDGA 3A3OA 3MUEA 5BR7A 2R0HA 2YV5A 1FFHA 2WMYA 4JCOA 5J1TB 3HK2A 1DGLA 4Y24A 1WW7A 1HRV1 2HHCA 4EGAA 1W6MB 1BWSA 2YY1A 5FJHA 4WNYA 2BIFA 4G4GA 1EBBA 4PLHA 4Z1MD 2DBVO 1WB4A 5JOQA 1V96A 3UPDA 1TQ4A 5KIAA 3R7BA 1EWVA 1T5TA 2CXRA 2EFGA 3VBCA 4DRRA 5FYSA 3FSJX 4J4TA 3WNKA 5JS8A 2IBMA 4D41A 2Z2JA 4GR9A 4JXKA 4KE6A 2X53S 5MF6A 2V8OA 1XD9A 3WGKA 4YQFA 5JSRA 3BE5A 3O12A 1VE6A 3TGPA 5SV5A 1EFCA 3ZHUA 3K3PA 1XTKA 4H4DA 2OHJA 2XTMA 5HJ5A 4E94A 3CZPA 2BHSA 1TPZA 3FSGA 3AYZB 1R8SA 4UD2A 5GGYA 2ZAIA 2OXTA 3IIKA 4NOLA 4FPLA 4JAAA 4KNVA 1HDCA 5JH7B 2G67A 3ENNA 3BOPA 1G20E 4JTOA 4UZEA 4OZXA 5ALFA 5AW2A 1XB2A 5JAUA 1NBWB 3GA0A 2OO5C 2Q5JA 2WM3A 3U4CA 4YCLA 2H57A 3ZIXA 1ML4A 1ABFA 4K46A 4BX2A 5GJBA 5E6SB 5CT4A 5HGJA 3NJXA 4CM8B 1CZHA 3JCZA 3P52A 1QMGA 1ZJ6A 2QDRA 3PWSA 4BYMA 4CM1A 3KLMX 2CE7A 3DPRB 1Z7S1 3UKVA 3IIEA 4BXOA 4YP0A 3ENQA 2BPOA 4HGRA 2C5DA 3M70A 4L0PA 2AK3A 1FMLA 1C1DA 2MYNA 1QZTA 3O8BA 5LUBA 3DDCA 5EKTA 4OA5A 2PQ0A 3ZZ1A 2R061 1GYQA 3JZIA 2HJVA 2NV6A 5C5DA 2F7SA 4ZOAA 2G4LA 3PHLA 4NHOA 4HGPA 4FQ4A 3HL0A 4ALMA 4Q05A 1DIOB 5KNBA 3UUFA 3NUZA 4UUMA 3ALQA 3UT5B 5GZCA 1TGYA 4LDAA 4FNOA 3SVZA 1NVBA 1RYZA 4BH9A 1SEFA 1XX6A 2Y68A 3DTTA 4BNGA 4D3YA 4B3NA 4ZRNA 2P9FA 2JH9A 2VNOA 1XLTC 1PVXA 2VQAA 1HLGA 3BGSA 4C3ZA 4ADSG 4GB33 3E18A 3PTAA 1G19A 1IPSA 2ZYWX 3KCNA 1EQ2A 5JDIC 1EGHA 5FO9B 8OHMA 1W35A 3N9PA 2XKOA 3A9SA 3CHYA 3IVXA 1KXJA 2K9ZA 3GEPA 2V09A 4GIBA 4YJ3B 4TQ9A 5DDIP 4AVTA 1VKJA 4MWCA 5KYXA 1NIJA 1TAUA 3QUAA 4MWOA 1Y1SA 3U26A 1R1DA 1AR62 1IY0A 4NROA 4BNJA 3UUGA 2J7PA 3CMGA 4BMSA 1FXUA 3ANMA 3FOWA 3L0PA 4EB8A 5CA1F 4Q4CA 5U9CA 1BHQ1 4DQXA 4DIEA 2D1FA 4KI0A 4QPGC 1ORIA 2HWD1 3VR1A 2WK1A 1OYYA 5L73A 3GJ0A 4RF5A 4ZEXA 3PX2A 2C5GA 3QFCA 5SYMA 1GQGA 4CPDA 3H19A 2Q5LA 4P98A 1KJQA 3WL8A 2XUZA 2CMKA 2C3MA 1SOWA 2XY4A 3FPLA 5JAQA 2CJYA 4QREA 2VOWA 3BRSA 4WOCA 3ZGZA 4Z07A 5C3MA 4UNSA 1H94A 3ZBPA 4D8UA 3DM9B 1V6KA 1H2BA 2ZBRA 2QYTA 1PR6A 3LHKA 3R77A 4WRRA 5F8PA 1LENA 3VUOA 4QWMA 4A2CA 1TJPB 2LWIA 5CT6A 4L76A 4NLLA 1IPEA 4QFDA 1II8B 3PFNA 1CCWA 2F8TA 3CCCA 2B37A 2NTVA 2AOTA 1JOPA 3ES4A 1VSBA 4NYJR 2BGRA 4KBZA 5EJMA 2PYIA 1C7JA 3E9EA 4C7JA 5IZ4A 1RCUA 4XGRA 1MQTB 4UE6A 4MUJA 1RMYA 2ODQA 2VMIA 2P5YA 3HCPA 4U7TB 2XDWA 2V7UA 3C48A 3DDNA 3DTVB 4E5SA 4CKCB 1YVPA 5BSHA 3U0VA 1JHRA 5LJIA 4B3GA 1QGED 1NLUA 2JPDA 1PK6A 4IOJA 1HTTA 2QJVA 4NQRA 1HDZA 5C9AC 1PR1A 3N3AC 4G1MB 4GC5A 1RAIA 3TQSA 2B1RA 6REQA 5EIXA 1XE7A 1MFPA 1UINA 3OD0A 3ZOZA 3EVTA 1FF9A 3PQ4A 4N6OA 2GPNA 1TYEB 4FC7A 4LRYA 2WINI 5CB4F 1EAYA 4P3XA 5JIUA 4LBVA 1SFRA 1TYZA 3A9UA 2TRSB 4NOTA 4YP5A 2FDIA 5CDHA 2ODTX 4Q6WA 3ULKA 1ZBA3 2BGMA 3E5XA 5IW0A 3BRWD 4HAYA 2A7AA 3MJCA 4LSWA 2FMUA 2PLWA 3UC5A 4DOMA 1LTKA 5FPPA 4G4JA 4YJGA 3ROTA 3VPGA 2ILMA 2XBO1 4EPTA 4FHEA 2I74A 3EY9A 3SJUA 3PZBA 2W37A 2QEQA 3WW2A 2HJHA 3FI9A 4FE3A 5JOWA 1XP8A 1HQKA 3R3UA 1KI6A 4JLWA 1VA4A 4OAOA 2IS2A 1RQPA 3LA8A 5ELLA 5JRJA 3ZWCA 3KIPA 2RS51 1SRQA 4B4VA 1G3RA 4II7A 5KQGA 3VDAA 3L1HA 5BN5A 1CRPA 4JUIA 5BNOB 4RL6A 3ZFEA 2C5EA 1GNLA 4JXJA 2P9HA 1CUFA 1SLBA 1LU1A 4TM7A 1S2IA 1COV1 1SBNE 5BNFA 1ODTC 2QPOA 3HYNA 2HEWF 5IT6A 3ZSKA 2YWXA 3JS5A 4FWIB 1MR3F 1JHDA 3EXFB 2ZA9A 3VYSB 4QX5A 1QMJA 1S7GA 2BDEA 2GCNA 4LYYA 3O75A 4P86A 1JXNA 1O4ZA 1Q14A 3CURA 4LI0A 3JQFA 2QRHA 3R0XA 4Z3OA 4A2UA 1ZGHA 2L17A 4TS1A 4WBNA 1CVNA 2ECQA 1UU4A 2NW6A 4R8LA 1KFBB 4RTQA 5AQEA 4B6SA 3ZXJA 2PWBA 4CDNA 4O1IA 1CEYA 3T08A 2ANCA 1LDYA 3GHMA 1JFFB 3IUNA 4CCSA 4MQEA 2P6HA 3URMA 1RJ9A 1HRV3 1OXUA 2QVZX 2WEKA 4CU2A 2BTEA 2V3WA 1ECFA 1REFA 4P9NA 5BW6B 4IWYA 3OEHA 1NSTA 2Y8EA 4YPFA 2XRMA 2PMFA 5BMVA 2EW1A 4D42A 4M86A 1MDFA 2NP6A 4OP3A 2HJWA 5AOVA 1HRKA 2IXHA 1DQPA 5FEMA 3ILXA 1ULZA 5BWOA 2VBPA 4CG1A 4HQOA 2RIPA 1A78A 5EYYA 2VO5A 5K0CA 3D7LA 1W0CA 1SJ9A 3VV3A 1IBSA 1T0JB 4HLDA 4AJ2A 4YUXA 1GBGA 4R0MA 5HIMA 2ZJ2A 4AMZA 4C0AC 2A0KA 3VGIA 1VHLA 3C1OA 4UTRA 1UODA 3ESCA 4H0CA 2ID4A 1VLMA 4WUTA 2ZS7A 3BULA 4L11A 3M2TA 4GWLA 4KUHA 1P77A 3KV3O 5EIOA 2ZZJA 2IBSA 4OGWA 1YR1A 4Y26A 5BQXA 2FMXA 1L5QA 2XYVA 2VPZA 5E1BA 3AKTA 2O50A 3FUXA 4KLRA 4FLEA 1KR5A 4D7YA 4OY3A 1QS0B 4DBLE 1ZJJA 3C14C 1EFRA 3CZUA 4XM0A 1YZNA 1KEEB 3UNXA 4F71A 2F4PA 2HMVA 2B83A 1WSBA 3SMQA 1GA4A 3NYRA 2H54A 3EJ6A 4BQXA 1AY0A 1KGDA 5FK8A 1EDZA 3E6CC 2BFOA 1OI6A 8ABPA 3ZLBA 4Y3OA 2XDAA 5ER9A 1Y0BA 5J23A 4CFZA 3AF0A 1BCRA 4TMYA 2PVCA 1Z7S3 3LWZA 3BCUA 1ST2A 4XDPA 1BOFA 4YT4A 1H9BA 5BV1A 2WWTA 3IIAA 3GLFE 3EPJA 2NV0A 3TNLA 1I7LA 4YRBA 1R6BX 2JS7A 3KHSA 3R3ZA 2R063 4BFWA 4NHMA 2H7XA 2ZKNA 1GRNA 1W7AA 4N43B 2X42A 3A9CA 2Y1GA 3RS5A 5IAOA 4X60A 5F5AA 2H4WA 4S1NA 1M1NB 1W0PA 3OKAA 2VP3A 3T1MA 1RI1A 2XYQA 2HD4A 1FVFA 3KKPA 2VHUA 1YZGA 1L5WA 1HURA 1CVLA 1T9BA 1W581 2FP3A 3ZE9A 4KXMA 2WQ7A 2EKZA 4LNUB 3TVDA 4D2IA 2O1EA 5HIIA 4EG3A 1VMHA 4IJUA 3O9VA 5CLFA 2JZNA 3A2LA 4KI7A 3N0WA 3IJEB 5A3MA 4JC8A 1P1RA 3FOZA 4TTIA 4CKBA 4MCJA 3I5AA 3ISVA 2ZR8A 3C4VA 5HKLA 2RE9A 1W93A 1KI1A 5BNPA 1NZFA 2UUAB 1JFTA 1Q1ZA 3HDVA 3UWOA 1ZBA2 3LWDA 4MV8A 5JJ5A 1JJVA 1I8TA 4JSTA 1W3XA 3PHIA 3UM9A 1QIIA 1F9EA 3OVMA 4EN8B 4A0RA 1WU8A 4RF2A 1G7TA 3KJIA 2XVKA 1R0KA 1JDPA 1HRI2 1N1DA 2FEOA 1X7XB 4RM2A 5BXQC 3AL5A 4JQZA 4P35A 3A11A 3U1TA 1L5ZA 3EZYA 2A4KA 4DNFA 5EVJA 2NUTB 2HWD3 4R9BA 2IYRA 3DP9A 2A75A 1GQPA 2G0NA 4HQRA 1C8M1 1T9CA 5L40A 3R8CA 4NDAA 4OCZA 2AV6A 2Q5IA 1AV7A 5E3HA 1K88A 3G6JB 4Q0PA 1Y1KE 2EX4A 3WB0A 3RZGA 2VTEA 1TUBB 1KJIA 3I59A 2HC9A 4B4DA 2RM22 2B45X 5CG2A 1PFQA 4CHGA 4B2IA 3AX6A 1H85A 2VLIA 3C2UA 2FWIA 4JGYC 4TV9A 4C4ZA 4IDDA 4IHQA 3ZYHA 4ZT3A 3L8YA 3WDWA 2I6SA 4O9GA 4EN0A 1NPTO 3EISA 3LHSA 4OZOA 1FIUA 4BQYA 2EIBA 2PBRA 1CHNA 1QIQA 2J85A 3I0MA 4WK4B 2CVZA 3DOEA 5C4WC 1E9BA 2XUAA 4LKDA 2B8NA 3QACA 1YFYA 3H9AA 5C35A 4NK4A 4LAFA 3UCEA 3ANYB 4QNMA 3KD2A 2O54A 4RD1A 1NN0A 2QG9A 4P5YA 5CVVA 2AOUB 3MFAA 4PCUA 1BBT1 1JR3E 3MEQA 3LA2A 1MQAA 1T34A 1ZH2A 2NQ2C 2DGDA 1VAKA 2PT5A 1SHUX 1EBUA 2CAVA 3FUVA 1LD3A 4XOUA 1RRCA 4PLNA 1A3KA 2XKBA 3BCSA 2EWWA 3OWXA 3EC2A 5IK4A 1QNFA 3CQ9A 3SD7A 3U75A 2WNOA 4EYKA 2OMEA 4BIFA 3NALA 5JQGB 3BILA 5FAXA 1EZ1A 4UU8A 2MR6A 2ZAAA 4HLUA 3M0EA 1WP4A 3H9CA 3MPUA 1X33A 4LISA 4U6SA 4HNQA 1UC9A 4NXNB 3FBMA 1K06A 3H2GA 1YXWA 4HN9A 2OBXA 4I1OA 4MX8A 4HH4A 4J91A 3EDQA 4HWOA 4MS4B 2ZUDA 3W5UA 1MJNA 2Q3JA 2HQRA 4C7OB 4QJIA 4LE0A 3MWYW 3Q87B 4M00A 3E1KA 2RS53 5GJCA 1FC0A 4B2LA 2C8JA 2JLWA 2B42B 2WJ4A 2FPPA 4DGSA 3NX4A 5CNAA 5I8PA 3LNTA 3RBZA 5FBZA 4F86A 1OAKA 2X7HA 3L06A 4AG3A 4BFUA 2E5LB 5L7WA 1RR6A 1DX9A 4EJMA 3E53A 5TVKA 2H0QA 3AR4A 4YRLA 3JYPA 1COV3 1Z6YA 2ZJ5A 1A5TA 5JOYA 1NF8A 2WJJA 2PELA 3OF2A 4KU8A 1MENA 4NMMA 2ZAMA 3F3KA 1DRKA 2J31A 2EHJA 2C1ZA 4RIGA 2R062 1E3TA 3RVLA 4MYTA 3NYQA 2FW7A 5JYBA 1BN7A 1LKNA 4GRAA 5BVGB 3BN3A 2RMU1 2AJBA 4EDFA 1ZCFA 1FQOA 3U49A 3F5MA 4E2ZA 3EG5A 4E4HA 2DPGA 4P3KA 4PO8A 4Y20B 1YFLA 2E4YA 1XAGA 2HEIA 3SQXA 1D1QA 3MLJA 2QIOA 3MK31 4JD5A 3MZHA 1SWWA 2OMKA 5G1PA 3WRXC 3NDIA 2PM8A 4OX9Y 4C4OA 2QN2A 3FMPB 1I80A 1EJ6A 2CDBA 1NE6A 4JLBA 4I3FA 4DA7A 2X5IC 3B3GA 5T8KC 4Y33A 1JIQA 1D03A 3EMKA 4G37A 1KOLA 1N6OA 1UKZA 4DCCA 2YXPX 4NBLA 3V64A 5HTOA 1NHWA 3NUQA 4V0KA 2O2GA 3OIFA 4A15A 1W8ZA 2G08A 4TTPA 1J90A 5H59A 4EITA 1FYEA 4AJOA 5TDHA 1R0YA 1KJYA 4AFAA 3QJGA 2IHUA 2CGNA 2AFVA 1V48A 2B94A 4WFQA 1II0A 1LBTA 4R1TA 3I28A 1QTRA 1DLLA 2HWD2 3GLVA 3AKRA 2PS0A 1I1HA 1PZHA 2I1VB 4W7SA 1B8OA 4W5WA 1AT1A 1CQZA 3PPXA 4IZIA 2IA5A 3FYUC 2J07A 1CFZA 2I03A 4CM9A 3AP3A 3KR1A 4QX6A 2QA5A 4XUOA 1V1JA 2PMDA 1G3UA 4MPPA 1QHNA 1DJOA 3U9SA 4G8BA 1B16A 2XKKA 3BOSA 3WG3A 5KEIA 3I9KA 5AVXA 3T3HA 2I4RA 1NQVA 2EF1A 3WUDA 5JZGC 2QN8A 4G07A 3VZKA 1EVKA 2X9QA 5CM9C 1RMQA 2DU1A 1JHNA 1DFHA 2C2BA 2XE7A 3BB3A 2HF2A 3E1F1 2Y2VA 3D0JA 3A6HA 2HRRA 2VJQA 3LOIA 2BZ1A 2VSYA 4B6GA 1FATA 4RSGA 3RO7A 3GYGA 1QJEA 2ZBGA 3EPRA 1JQAA 4QXRA 5IABA 3ZQJA 2JAHA 1R0CA 3Q1LA 2FQXA 2XGGA 3ZTTA 4IS2A 1GARA 4NOKA 3DAGA 4HZUA 4BRZA 1M75A 3LDAA 4L5BA 2IF0A 4C4SA 3DBOB 3W77A 4AIRA 1EFPA 4TUYA 3D4BA 1ZDMA 1KMHB 2H65A 2I1LA 4TKVA 3LQKA 2O4UX 2YDXA 5DO9A 1UK9A 3NT4A 1GKIA 2WD9A 1FL9A 1U2GC 1DIAA 2GD6A 2C4XA 1IY9A 5TB5A 4OAPA 1V6MA 3RT7A 1KI7A 4WXPA 4R9AA 5EXXA 3NMUF 3ADPA 3DUFA 4FMCF 1C1FA 2JBAB 4M49A 2YFZA 1E59A 2ZUVA 4P5EA 3RKRA 1WA4A 4LOJA 3B3AA 1T6XA 3T5DA 3WSVA 3RIYA 3UB4A 2RS52 1R8XA 4CEJB 4UTPA 2EBHX 3P9RA 1C8M3 1AS3A 4MR7B 4PWZA 1BXRA 4AWXA 5KOHA 2DVMA 1XNDA 5M04A 3M4ZA 2DUPA 4CV1A 1BEUB 3G6KA 4CRWB 2XQXA 1T5BA 3DDSA 2BGKA 4ND1A 4NPRA 3ANLA 2AYZA 2AJTA 1VYVA 4NZ9A 3AXEA 3MBOA 1URPA 4FCTA 5HKKD 1KJJA 3F47A 1K4MA 1F0KA 4HNHA 4NIAA 2OHFA 1JU3A 3L1UA 4L95C 1B7GO 1V3QE 2RDRA 4UMVA 1GAEO 4L9RA 2BM1A 1D04A 2XUKA 1RPZA 3HT2A 1G6HA 2GUWA 2CNWD 4GLFA 4GW3A 3EOZA 3SVLA 3UK7A 4XIIA 3PEEA 4MQLA 2DYCA 5A7WA 3KQHA 2POCA 2HTEA 4YUZA 4BQFA 2Z09A 1KU0A 4PYMA 1DBPA 1PJZA 3DYBA 1HDRA 2V4VA 2XB8A 3OPYA 1V8DA 1ZD8A 3SHFA 5SYAA 4LJYA 5TPZA 4AYWA 4B76A 5EHIA 4RFVA 3EFOA 5KWRA 4F9TA 3RZMA 2FWNA 4FZ3A 5DCUA 1BBT3 4JBWA 4S12A 1F38A 3WLRA 3A9TA 2YKGA 4EUFA 4ZVPA 3JZAA 4F3YA 1GPMA 2WMDA 1JMKC 2F2TA 2NUPB 4JDMA 1J0DA 3D3NA 3UQYS 4M3CE 5BNIA 3A0KA 4OHMA 3ZYGA 4QL3A 3QXGA 1FFEA 4E30A 1E66A 3E5RA 2M1XA 3U4IA 1XVLA 3AVOA 1XZCA 1WEKA 2VRWA 4JI7B 5AKYA 3CZJA 3P97A 1CY1A 4PRZA 1AUVA 5E6RA 4L5JA 1YB7A 1ZXXA 3ORFA 3Q8KA 4MLZA 2WKPA 4UVGA 3QYPA 5JI7A 4N48A 2CZCA 4HKTA 2LE0A 1KEWA 2PR7A 1ZCBA 3E1SA 4HSJA 4DUVA 1Z2PX 3H42B 5I9MA 1JOJA 1SDWA 1V43A 4JGZC 1S2KA 1PL8A 3P9YA 3BT7A 1ZIDA 3OD5A 2CC2A 5DBIA 2XE8A 4OXIA 1UP4A 3NBFA 4MKFA 1SVMA 1RTKA 4BLIA 2PQ2A 4J4HA 4NATA 3ZLJA 4YMVA 1YK0A 2ZGRA 1NE2A 1YR9A 4RFSB 2PFWA 1NKTA 2CXPA 3AUFA 4L27A 3UJDA 1IQUA 3QBEA 4Q9DA 4GEKA 1RLTA 5EIAA 5FPLA 1C28A 5K3SA 1ZZGA 2DFNA 5ALPA 3E22A 2ZGUA 3AXTA 5CFLA 4E2YA 2PZJA 1JU9A 4ZI3A 3T35A 4GVXA 4TRMA 2JATA 4ZT2A 4CQLA 2ACVA 4AGGA 1GITA 1EXDA 4OYUA 1OYOA 5JROA 4D79A 4A10A 1CS0A 3MTGA 3SYMA 3RVPA 3QFRA 3K3NA 2NTYC 2G6TA 4NZOA 3I4CA 1J2UA 1ODFA 4P80A 4GWGA 5JR2A 2JKVA 2JLXA 3CCBA 3GRZA 1J0BA 3PA6A 4L4YA 5JEDA 3GDWA 2NU7A 3QFSA 1UM9B 4A0HA 4TLFA 4MRAA 1M1XB 3D3WA 4ZU5A 1SZPA 3NBKA 3IEKA 2YWJA 1GPDG 3O3MB 1DWQA 2WJPA 1EA5A 2YWEA 4U1RA 2IS1A 3Q7PA 2ZWPA 5BRAA 3TSZA 3WGGA 1PMJX 1SQFA 2GCPA 4E4ZA 2CLIB 3V33A 2F1JA 1Z39A 2PRZA 2AZMA 1KSJA 5M2QA 2FCTA 5BXXA 2HQOA 5FK7A 3SZRA 4RJIA 3ICPA 3UK6A 1MS4A 4H7HA 5SZHB 4JBIA 3M89A 1R8JA 2QN3A 3QV2A 4RR3C 4XX0A 5F2NA 1O6ZA 1O94C 1O7FA 4BTVA 4OQZA 1QVVA 4HXYA 4KVGA 4C90A 2P5UA