2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE E
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
1DLCA 5JXHA 1JU4A 4XUOA 4RN5A 4PF1A 3CZJA 1ULPA 2HLEA 2VZ1A 4Z2AA 2WYSA 4TX1A 4LHSA 4JKLA 4LQRA 1CZVA 1CIYA 2L9LA 3SLRA 4FI9A 3VD4A 3LPFA 5IHRA 3K4DA 3GGLA 3NQHA 4QDRA 3C7FA 3WQBA 4XUPA 1VYHA 3A21A 1XNTA 3I2GA 2W46A 3IDAA 1UY4A 3T0DA 5IFTA 5G05L 3ETPA 4M8KA 1K42A 3I2KA 2J1AA 4K40A 2XHNA 1NKGA 2WN2A 4QDSA 3WF2A 3DC7A 3I2HA 4CU7A 2J1SA 3CZUA 4JHZA 1O8PA 3A7QA 3OB8A 4QX0A 4P5YA 2WN3A 1BWQA 1OH4A 5DPNA 3VDAA 4RSHA 3WF0A 3ACHA 3FN9A 3P94A 1JI6A 5C70A 3EB7A 5F7UA 5G04L 4OMCA 2C4XA 1K12A 5B4NA 3I97A 5LA1A 2BZDA 1ESDA 4QB1A 2JE8A 4XURA 1ESEA 3FHQA 1L7QA 1O59A 1W8NA 1UYZA 4KWUA 2JD9A 2QQLA 4XUQA 4BJ0A 2VZSA 4BXSV 3A23A 3DYPA 4PT6A 3AC0A 5C71A 1MPXA 3VD9A 5JMOA 2WABA 4ZZ8A 1T2XA 2W1WA 1P8JA 4JGGA 4M4PA 4QDQA 5EJ1B 4DUWA 3HNBM 3FHAA 5LCWL 2B9VA 2VMFA 3NNGA 4I8IA 1JYXA 1UY0A 5BN1A 3GM8A 3IIIA 5FUIA 1OT5A 2YC2A 1UMIA 3SEEA 2YFUA 5CZKA 2BGOA 1J83A 4A45A 2VZRA 2QQMA 1JRLA 2EIDA 2YB7A 3DYOA 3IB3A 2WBKA 2APJA 1H6XA 2BGPA 5B5SA 1ESCA 2W1QA 4W4ZA 2WO2A 2ORXA 3NJXA 4D0QA 1JZ7A 3K4ZA 3T2QA 1XPWA 3E1F1 1US2A 2V72A 4JKKA 4NRDA 5JD3A 3C7GA 4CUCA 3CDZB 3CKHA 2J7MA 4QB6A 4HF7A 2J1RA 3I2FA 3OEAA 2C9KA 4DXTA 5EIYB 3T08A 3WNNA 2E26A 3W7VA 1KGYA 4LPLA 3DCIA 1W99A 3LEIA 3OBAA 2W95A 4H08A 2W87A 1SDDB 1PMJX 2VZ3A 3MILA 4P08A 3K46A 4RW0A 2VZVA 4YPJA 2B4KA 2PQSA 4JKOA 3P1IA 1EUTA 3BZWA 3D3AA 1DEOA 5HXMA 5I0DA 1W8OA 1Z8HA 3RJTA 1OD3A 4JJ6A 1UXXX 3GDBA 2ZEZA 4JKMA 3MV11 4AAXA 1PX4A 2HYXA 2VL4A 4PPYA 2LW8A 4A42A 2QQIA 4S1PA 2VZTA 4Q7QA 4TXWA 3T2PA 3I3BA 1DYOA 1GUIA 2W94A 2Y8KA 1SG3A 3VD7A 2VJXA 4DEQA 3CQOA 3ACIA 3JXSA 3WEZA 3NJVA 1BHGA 4RYDA 3PUIA 3WF1A 1GU3A 3WSOA 2DCKA 1BWPA 2KD7A 2RJ2A 2VCAA 3C7EA 4D8MA 3DYMA 3DT8A 2W3JA 3ACFA 4CUAA 3WNKA 4ZY9A 1UYYA 4P02B 2EIEA 5A4AA 3ECQA 4OAOA 4K9SA 3J7HA 2QQNA 2VZOA 4K3UA 1GMMA 4W50A 3WF3A 1BWRA 2BERA 1DEXA 1V2GA 3UESA 1KEXA 1WCQA 1JZ2A 2J22A 1UYXA 3OG2A 2O14A 4AG4A 2YG0A 3BGAA 2DCJA 4GZ9A 3DECA 4CU9A 3NRUA 4MOAA 1US3A 3GXUA 2E31A 2WAOA 1OF4A 3K77A 4KMQA 1YZFA 5C7GA 3THDA 4CU6A 3OEBA 1UY3A 1UY1A 3FL7A 2ORZA 2XOMA 3I3EA 3LEKA 1TVGA 2W1SA 2WO1A 5HOEA 3PT5A 5DN2A 5JUVA 2XONA 2RVAA 2Q0QA 3F2ZA 3THCA 2Y64A 4MO3M 1J84A 1DP0A 1JU3A 2X09A 5CYYA 1W9TA 1ES9A 1D7PM 1YQ2A 3MBWA 5JXGA 2WZEA 2QQKA 4UI9L 3MO4A 4ET7A 1K3IA 3C8XA 4E8CA 2VR4A 3HJRA 3SEPA 3T0AA 4K7JA 3T0BA 4E8DA 1JYVA 2VC9A 5IFPA 3OGVA 1J00A 4CUBA 2WO3A 4JX0A 2ZEXA 2QQOA 4A6OA 2YC4A 1TG7A 2X10A 4KI5M 2Y6KA 2Q0SA 2V5DA 1UZ0A 4IYJA 1UX7A 4OAPA 1PX3A 2Y6JA 2JDAA 1UXZA 3CIHA 1F4HA 2WZ8A 3MV01 4PQQA 1NX9A 3WNLA 3VDBA 3IAPA 2ZXQA 3HP4A 3I3DA 4DXSA 4QX2A 2QQJA 1XNAA 2W9XA 3T09A 3C1UA 3MUZ1 2W1UA 1GOGA 4QX1A 4OZOA 4ZXEA 3OGRA 4LKSA 3MUY1 3LE0A 1RYYA 3EYPA 1GNYA 2OKXA 2JKXA 3K4AA 4JJ4A 5EJZB 3OGSA 4HYQA 2W91A 3WNOA 1EUUA 3HN3A 1IQDC 2WUHA 1FXWF 4ZZ5A 4UAPA 5LA2A 2X05A 1CZSA 2XQXA 2W92A 1JHJA 2VQTA 2Y6GA 3KVNA 1UY2A 2J1VA 2ZEYA 2J1UA 3BN6A 3K75B 3VD3A 1K45A 1JZ8A 2DDUA 1ULOA 1NUKA 3UETA 3WF4A 1O8SA 2WQ8A 1W9SA 4IUGA 3C7HA 1HN1A 2EICA 2EIBA 3A22A 4M4RA 4CVUA 2V4VA 4BK5A 2Z4FA 1GQPA 2VCCA 5A1AA 5DMYA 2E32A 2LS6A 2W5FA 1U8UA 2BBAA 2CDPA 1UWWA 5HPOA 3LEGA 4P00B 3C7OA 2VO5A 5JXIA 5LA0A 1R64A 3ZM8A 3ABZA 3HNYM 4GWJA 4DUXA 4Q9AA 3I2IA 4OMDA 4XZUG 1CZTA 4ARXA 2RV9A 5JR2A 2WAAA 5JXJA 2QBXA 1GOHA 1WKYA 2VMDA 3SKJE 1XC6A 3UNPA 1WABA 1NAEA 2VMEA 4W8JA 4XUTA 3CMGA 4JHLA 5IJRA 1H6YA 1F4AA 4MGQA 3P6BA 2WDBA 1W9WA 2E33A 1GOFA 3LPGA 1PP4A 3U37A 2W47A 3VD5A 4BDVB 4QPWA 4A41A 1JZ6A 4DUVA 3W5MA 5IYYA 2HSJA 1JYWA 4ARYA 3T2OA 1IVNA 1FXWA 1JZ4A 5J1XA 1CX1A 1JYNA 3DT9A 4CU8A 4HG6B 3HOBA 4XVHA 2R7EB 4QX3A 4UOJA 1OF3A 3VDCA 2VOTA 3IAQA 1I5PA 2VMCA 2Y6LA 2Y6HA 4A4AA 2VPTA 1K7CA 2YFZA 2VTFA 3HNMA 2ZEWA 1LNSA 2VCBA 3HPNA 3LQCA 1SHWB 4MADA 4A3ZA 3W5NA 4BK4A 4DXRA 4L0PA 4QB2A 5CD9A 1VJGA 1JZ3A 3WNPA 5B4XA 2VZQA 3HEIA 3PUHA 3WNMA 4MGSA 2J1TA 4OYUA 1ZMBA 2VZUA 4DEVA 4XUNA 1L7RA 4GWIA 2CDOA 5DQ0A 2VM9A 4A44A 1JZ5A 1PMHX 3SKVA 3DT6A 1UMHA 4QAWA 2J1EA 2VQUA 3I2JA 1W0NA 2ID4A 4OUEA 2VZPA 2C26A 4TTGA 3ACGA
chains in the Genus database with same CATH superfamily
4RPKA 5IT6A 5HJ5A 5IBRA 1K5MB 2WNVC 3R7NA 1QQP1 4XGNA 1SC4A 3RIMA 4GEKA 4P9XA 1HLGA 2QVGA 1C9EA 2WINI 1KNQA 2VEDA 3RBZA 1P0PA 2D43A 2G71A 4UFLA 2CEKA 1E2JA 3G9QA 3GCGA 1LEDA 2XCSB 1P2FA 3RAFC 3UK2A 4WV8A 3REFA 5CFDA 2XWPA 4EMBA 4BHPA 1AL23 2O8NA 2A2ZA 2P3SA 2W39A 3RYHA 2IS6A 2GFIA 1EZ1A 1OZGA 1EXMA 3EG9B 2JE8A 1T3GA 3R20A 1ODFA 3I83A 1IZYA 4ZAXA 5LK7B 2AJDA 3H1PA 5SZHB 1VMKA 4YRTA 4X8PA 2RGCA 3OHPA 3DOFA 1JG1A 1XHEA 4UARA 1O77A 5C6CA 1TZKA 2ZG6A 2FWNA 3L0ZA 4KQWA 3SHFA 1ZCBA 1E5LA 1VJ5A 5C5EA 4CTKA 1ZCJA 1LPNA 2FDXA 2WKKA 2VUSA 4LF4B 2XMRA 4GM0A 1W44A 3OAAD 4CCDA 5IEBA 5IF9A 2DE0X 2ZIZA 1K97A 3BH7A 5D8AA 4RD1A 5ALQA 3R0ZA 4P36A 3WXMA 4AECA 5IWCA 2PK3A 2R5NA 1JW6A 1O95C 1NBIA 3BX1A 1KI9A 4GI1A 5ENVA 3LW8A 1NVMB 4II7A 1Z8HA 3VR4H 1TIPA 3PVEA 3TO5A 1DGQA 5MGNA 1FUIA 4WOJA 4BO2A 1T9HA 2AJCA 1EX1A 1HF3A 2J45A 1UMDB 5LLSA 3OIFA 5KX5A 5FTMA 3DOJA 3UJ8A 1UMBB 3K6RA 4HQFA 1T0JB 3NHBA 1HQKA 1QWSA 1KRIA 1T9GS 2HJRA 4OAOA 4EENA 3RF7A 2YMMA 3FB1A 5KYWA 1FLVA 1I0ZA 1R082 4RR3C 4A3SA 3E23A 1PT8A 4F71A 3N74A 1E5RA 3N7UA 2BYVE 4TTJA 4AHXA 2OHIA 1H4GA 1T35A 3S2YA 3TPFA 1POXA 4X54A 4EJSA 3TH5A 4S1OA 4PEVA 1WXQA 1ZM3A 1EBFA 4LCJA 3VO1A 2VZLA 4YVSA 3HR8A 1HE5A 5JBNA 1G3IA 2O2YA 1OGJA 3RKUA 5A5DA 4AURA 2EJWA 3NS7A 3B9BA 3ADBA 2CHVA 3PJQA 5A32A 2WSYB 4YAIA 2PS3A 1X38A 4GR5A 3KP1A 4G4GA 1FFSA 1T5IA 4TMXA 1I5RA 1IE3A 3WLOA 1VPHA 1W34A 4MQ4A 3FNFA 4N6NA 5AW5A 1HNXB 5EGNA 1SXJD 4JLAA 1W0JA 1N2JA 1T36A 4CCKA 2C2XA 4ZI7A 5L4LA 5CVRA 2G9UA 3MHPA 2P6NA 2XD4A 2QL7A 2GMPA 1L5VA 2A4KA 3Q7PA 4IE0A 3RJRA 4OKIA 3TSZA 4NPRA 3E6AA 3DLHA 5FYIA 3IJRA 5LQSA 2AWOA 4FHGA 3MWFA 2EQ5A 2XGXA 1J2RA 1Y6ZA 2RE8A 2VDNB 1U04A 4LNHA 4OQ9A 1QK5A 1HWYA 3ZCXA 1TAHA 2EFDB 2Z30A 2CLLB 1GRRA 4B0OA 3WCRA 2EJBA 1I8TA 3BI3A 1GQPA 2A0UA 3DZGA 4P98A 4ZZ2A 1SBYA 2QKYA 4UBHA 5IKPA 2QPAA 3RBVA 3H6KA 4NU5A 4QQLA 2A70A 3I2IA 3I30X 4C4OA 3NDJA 1LODA 2P27A 5IC5A 3BIFA 1X50A 1A5AB 3HPRA 5BOSA 3KO8A 5THKA 4MWTA 4LHEA 4OL0A 1B6RA 3B53X 1A8IA 1THZA 4M36A 4F9GA 5KAPA 2WB4A 2Z6QA 1NBHA 5F32A 1UBLS 3X43A 1W9MA 5HDQA 3DOUA 2FR8C 1LOBA 2Q4DA 5FI3A 1U0LA 2XB9A 1TECE 2QDRA 1L4KA 4AO6A 5KPJA 3R5SA 4X20B 3TR5A 1JJAA 3I2OA 2ZBFA 2A94A 2OGUA 1KA9H 3WDVA 3PFHA 2QT9A 1S1AA 1WVGA 3N2LA 4QL3A 4WCFC 1NVBA 3BQNB 4JDMA 1WUYA 3DF0A 5DU2A 1VZ3A 4AYTA 1ZIOA 2ZYIA 1JU4A 3FFBA 3H1BA 4JGYB 4D3DA 2HK7A 4L4SA 2Y8EA 3P97A 3AV3A 1BEZA 4DM4A 1DJPA 3M6IA 4UJ3A 5FORA 2IPNA 4Z4HA 2OFOA 2Q2NA 4HV4A 3Q3HA 2WM2A 4ILKA 2CBGA 3LV8A 1SULA 1OX4A 1LGBA 1RXSA 1GEEA 1NJSA 3QV1A 2QYOA 3K35A 4LTDA 2WI8A 3AY3A 2NVWA 4Y9UA 2IY9A 2REOA 5FYYA 4D3XA 5K09A 4CDXC 5EZYF 4XW3A 1DARA 1ZBA3 1PCXA 3UG6A 1CUSA 3H0EA 3WL5A 4MV5A 5EERA 3SQMA 4PT6A 2VHUA 5BUQA 3P3PA 2H4WA 5IAGA 3C6BA 3ZDDA 3BUSA 1KVUA 5B6JA 4COOA 2ZJBA 2BYTA 5EIWA 3A9SA 4UNQA 3IAS1 1SMVA 3V97A 2VYFA 4L9WA 4P93A 1EAH3 4EWLA 2G80A 3P45A 1W93A 4TLLB 4CE8A 1R88A 4JBHA 5B57C 1WXIA 2QVXX 2P79A 1U0JA 4WBNB 3I6MA 2WR8A 3ZZMA 5KOHA 5K20A 4RM3A 1Q1EA 3WBFA 3F6RA 1GZSA 4RD4A 4QB6A 3OTWA 4HNAA 1RLIA 5ER9A 4MUIA 1X7YB 5GM2A 3DCIA 3TNLA 3EZLA 1OY1A 5HQTA 3KB5A 5I0RA 5B7NA 3IQEA 2RS33 1NDUA 5B58T 1MZVA 4B2PA 3TVYA 5BSWA 2WSSA 2CCJA 3PJGA 1G19A 1ODJA 4JJ6A 1ZM9A 2XZTA 1HX7A 3ZV4A 2P75A 4WM7B 4D42A 4ENRA 1ENRA 2WU8A 2PRIA 3EA4A 1S9DA 2DVMA 4RYDA 2EC5A 3E9ZA 4OFBA 2REQA 5JSPA 1G66A 4YX9A 3ZI7A 4CU2A 2NSJA 2DBRA 5GGYA 1V6AA 4TRNA 4MVXA 2FKAA 4BMBA 1BOFA 2PS0A 1ECJA 4XJAA 3WVNA 4G63A 2ZKLA 5FOSA 1NNEA 3UW3A 3K8YA 2Y38A 2ZGSA 1CIPA 4TMYA 4R0VA 5FY8A 2E7ZA 1PJZA 5LSAA 1ZX1A 1PFYA 4K6KA 4ATNA 1MOPA 5D3KA 5ITSA 2PUTA 2V6IA 4LZNA 1GYQA 1A4IA 2QN9A 1W0KA 4QTZA 3LIHA 2YV5A 5CXSA 2IOHA 3OT4A 3H2IA 3JX9A 3ZFFB 1O94D 4PSVA 3HG7A 3OF2A 2CY6A 3KQTA 4LOHA 1S0CA 4HR7A 4HAZA 3W6ZA 4ZV9A 1SVKA 4YW6A 3LSEA 3TMKA 1XJWA 2IHUA 2OPWA 1AN9A 3T5MA 1X8JA 2XXJA 2Q46A 3V2UA 5IK5A 4Q1CA 1G5TA 5IH3A 2ZUUA 2CZGA 4J07A 2ZRBA 2R1UA 1LKZA 5I01A 2JAWA 1UT6A 2GR9A 3NVAA 4YHBA 1CGPA 2Y34A 3I23A 3L4JA 1ONOA 4GECA 3PGMA 4LE3A 2O4CA 1W46A 2VQ0A 4LYGA 1C57A 4N3NA 3FDJA 3D0KA 4N3AA 2QB5A 4P6VF 4CW7A 2C2OA 1MAHA 1TMOA 5KWSA 2RHGB 1UWKA 5J23A 4PZZA 6Q21A 3ZY5A 1KFEB 4D4JA 1X94A 1RPZA 4BRSA 3LPLA 4BK5A 5DM0A 4XXAA 4WESA 5BR7A 1YACA 1YYNA 4PIPA 3D59A 3IKVA 4JC0A 3L84A 1U9IC 3UV9A 4MRRA 1H22A 1E69A 3EDCA 5KI6A 5KQPA 2XUIA 5FBKA 3SZGA 1UZUA 1A82A 1H4HA 1JPUA 3NW4A 3UN1A 1O94C 5AR1A 4OLFA 3LKDA 4WZAB 4IZ6A 1BVHA 1E3EA 4FB4A 4FDAA 1S0IA 4JYMA 9LDBA 2HA0A 3EMBA 1N5IA 4LXUA 4NNOA 4B76A 5AKEA 1N47A 3K8ZA 3FJOA 1U1GA 1J8FA 1ZK2A 1NLFA 2DV9A 1IPHA 1FZTA 3HJCA 1M8GA 2F59A 4P14A 4G1MB 2BI7A 3KHBA 4F7DA 5FEMA 1B0PA 4RLHA 3Q9NA 1NXMA 2R68A 3J81k 3X0DA 1WHTB 5ALDA 3K70C 3AVVA 4D41A 3SX2A 5KOYA 4N12A 4ATFA 1QR2A 4OZXA 1WB4A 3DC2A 4NMWA 3PC3A 1TPYA 3PWZA 2Y0EA 3C4QA 2CVZA 2HLEA 3DMTC 1F0NA 4BBJA 6PFKA 4XYLA 3RR2A 2XJVA 1LOAA 4V0LA 3A21A 4HDRB 1K08A 4C4ZA 2HSZA 1XD2A 4B8YA 4MUBA 2XHNA 3RVMA 4I7EA 3DC7A 4MVJF 3CR7A 2WN3A 4GH5A 1I1QB 1O4ZA 5GGXA 4DLZA 1RLJA 1XZBA 1SNYA 3HSSA 4RFT0 2Z4SA 5IT9A 4LA2A 3A70A 2ZS7A 2WG0A 2VZ8A 2WZR1 3DJYA 1CQ9A 1NJ1A 3F3MA 3L18A 5EJ5A 2AEEA 2GD6A 3LDBA 5EPAA 3ZWNA 3EFEA 3BG5A 1C3OA 1YWGO 3IUMA 2Q5LA 3NRBA 3VR5H 1C1DA 4O2AB 3G8DA 1LVGA 2MEV1 2QR2A 4F4FA 3QPBA 4ZARA 4EVIA 3ZWWA 3KZ4C 3K9CA 2APJA 2V7VA 4X45A 2VLBA 4LMRA 2XYPA 2X7JA 2Y1EA 1PBNA 3DZJA 4S2FA 1FYWA 3B3AA 5KJ1A 3E22B 4PPNA 3VR6A 3OEAA 4ZV7A 1D6NA 5CXUA 3HZRA 1X77A 3IO3A 3C6ZA 3QVOA 2VRCD 5TEWA 2QE3A 3UF0A 2O8BA 4E5PA 2A9PA 3WDYA 1DEKA 1PLKA 2FW6A 4RFLA 4OREX 1A96A 2PL3A 1X0VA 2JWPA 3RT1A 1P3DA 4DSOA 2OTCA 3L05A 2XKBA 5KHKA 5T57A 3MLBA 1T13A 2K5UA 1M8PA 5CDTA 1DMRA 1BXHA 2VQSA 2WSMA 3MIEA 3WGJA 2Z3ZA 2DVDA 4HEQA 3B3QA 1H2LA 2XUKA 1G60A 4WBBA 2ZRPA 3KLPX 4XQGA 4JI3B 2IA5A 2JFOA 1VG0B 4AJ1A 4UTOA 1XJQA 5EE1A 3U62A 1PT6A 1PWXA 5ADVA 4ZOLF 2I6UA 2CV0A 4DY4A 4EY4A 1D0GA 4TVKA 2QF7A 1TCVA 2VTVA 4GLBA 1MMFB 1GRCA 4KO3S 3TTSA 1EE9A 1SVWA 3IP6A 1TZ2A 4QUHA 1TEXA 4EG4A 2R7AA 3D0OA 4AVSA 1YO6A 3H1EA 4G8JA 3ZVKA 4Q9DA 4DADA 3SC6A 3RRBA 2ZAOA 1XRMA 3MT9A 2D74A 4O4IB 2B0JA 3UK6A 4TSFD 2ZDQA 2A3WA 4XYBA 1XTJA 1I36A 2V1XA 3DHNA 4YH1A 4AQDA 3VKOA 2EFYA 1KYZA 1K3TA 5L3ZA 3VPHA 1UM9A 1U3GA 5JAOA 5FYMA 3GQBB 4W4TA 3E05A 3OGSA 4M3CE 4CDUA 3SXJA 1ISSA 1FTNA 4FQZA 1VBNA 5K3CA 2ZT5A 2VHXA 3BM5A 4OHXA 4LBZA 2YUIA 1FK8A 5IVHA 4EUKA 5KWEA 4II3A 3LI2A 1ND3C 3D8HA 2PD6A 3EGDA 4YXWD 2JI6A 1Z2NX 4F93B 1J1LA 3LOIA 1QIJA 5CT9A 4KQ7A 3U26A 1OROA 1XN4A 2AFRA 3MCUA 4JCKA 1HXHA 2MSNA 4MRPA 4LZJA 3QFSA 5IHXA 3ELNA 5C4MA 3BEDA 1TME2 1LVUA 1NFFA 1VBC2 1TZOA 2G1UA 3ROZA 2VO1A 4HGNA 2ZE8A 1E1LA 3GMTA 4G84A 5LD2C 4L11A 3VR5A 3AP6A 1VBB2 2G06A 1Q44A 4NARA 4CDMA 5I0UA 2G0TA 3O38A 4HHEA 4EYOA 5FX2A 2QL6A 1U28A 1YWKA 1FXWA 4CCSA 2UWAA 4K88A 1WCXA 4KFRA 3KJZA 4Q19A 2XQVA 2VMCA 1OLMA 3VHLB 4ZI3A 1TLLA 2ZEWA 2VXRA 1E92A 3EXUA 4CODB 4QOSA 4U2GA 1KMNA 3PPWA 3CRQA 5CD9A 4IH9A 5HZMA 3KCYA 2HGZA 1JQ5A 2OZEA 1PVOA 4RA9B 5JCXA 4K03A 3QIVA 3QOFA 2OPHA 4KL8S 2D6FA 4A2UA 3DT6A 1Z4PX 3I2JA 4G5QA 1ISPA 1NA1C 2FDKA 1JSRA 1RAAA 2CNKA 1Q8SA 4BEWA 4TTQA 2OVUA 3HKEA 3AP4A 1VYHA 3PU3A 3KB6A 2VTKA 1TYEB 2JLXA 3H2GA 2QSZA 1GWNA 1IN5A 3FB4A 3KCQA 1XCGB 4N49A 1EJ6A 3BBPA 3ACHA 2XI4A 3OTOB 2GK6A 3D4KA 3GFRA 3PENA 5FZ6A 3QOYA 4S05A 4PLFA 3UAGA 3TVDA 4HKWA 2DCMA 1UP6A 4MV3A 1E4OA 1FT9A 2IPMA 1YH3A 3SXPA 3L0PA 2CGEA 1IJBA 3U0VA 1MPXA 4YRLA 4ZVPA 4XZPA 4CLEA 4M0FA 3VBSA 1I7QB 4B6OA 2BP6A 1Y89A 3MIBA 2PTHA 4FU0A 2FWIA 10MHA 2Q8CA 1TF5A 2Q8QA 4O2BB 2V55B 4XUEA 4DLVA 3Q9SA 1VECA 4A8PA 2CAUA 4IFBA 1A3KA 4S2HA 1X7NA 5LMCA 2GM4A 1PYOA 4XCVA 3EGWA 3L4BA 1PL8A 1NT2A 2Y26A 1V9LA 2D2EA 4LV8B 4DDKA 3AUFA 1JTVA 3M6VA 2GJSA 3ENQA 2OXCA 4NC9A 1PZEA 2WWJA 3WRWA 5HF5A 4ZJZA 4OMUA 4X63A 1PJSA 3BTXA 4M7WA 1W36D 3HVRA 2W6ZA 3ESQA 4C6TB 2K4MA 1A5ZA 3D3AA 1OFIA 3VFDA 4PAMA 5DMHA 3TQHA 4LGYA 3ABOB 3D7KA 2YINC 3P1JA 4FGLA 5FUYA 2GWHA 1QX4A 2WD9A 4AI2A 5ELLA 4AX8A 3ENRA 1P2SA 5SICE 1UBRS 2ZETA 1FNNA 1GV0A 3QPWA 4F92B 5JRDS 2PD3A 4DO0A 1CSEE 5CYFA 2R1ZA 2D13A 4R0NA 3S6PA 1LC0A 3J8F3 2TMDA 4BU2A 1ECBA 2RGBA 5KHLB 1PR6A 2ADMA 4H1TA 3AI2A 1TKBA 1JS1X 4XUCA 1GL9B 3GJ6A 1PZHA 1J6UA 1XRLA 1L8LA 4CKXA 1CJDA 1CQIA 5A33A 3IUQA 3U80A 5LP6C 3L7KA 3HN1A 2B20A 3ZU3A 3RRDA 4ZV4A 2JFPA 4EKEA 3VBRA 4CP1A 2RDNA 2BPOA 2OGSA 4IETA 2JDIA 3K5WA 3L5OA 5JFOA 5I93A 4HXFB 1CP2A 4CIDA 4CM4A 1OWPA 4LO8A 2WLSA 4ZAZA 4BFUA 2FSVC 4IQGA 5LQNA 3EJKA 2A5GA 4DV0B 3H8VA 3JPWA 2YMPA 4GMXA 5BPXA 2IIVA 2OT7A 5CBPB 4GULA 1OFHA 1K5MA 2Z6AA 4E2GA 1BA2A 4UPEA 3ENWA 2ZI5A 3T3DA 4M9QA 3IM0A 2A7XA 2L0XA 4JOBA 1U3TA 4F4UA 1WSBA 2QTAA 5FT9A 1XTKA 4FI3C 3D7LA 3X3HA 3IUPA 3AVWA 4BBZA 2X5IC 3KKPA 5F3IA 4H55A 1TAQA 3LZCA 1G8KA 4WKGA 5LR6A 2NZYA 2EEZA 2UYYA 4AZTA 2PV7A 2AZDA 4WESB 1PQUA 5DGTA 4L3OA 2NV2B 4XX0B 2X1HA 2QMQA 2VVFA 1NATA 1IAVA 5KKCA 2OCAA 1J0BA 4N47A 2Q5EA 2YN4A 3IE0A 4SLIA 3H1TA 4DQLA 3BXHA 5EXXA 1S2MA 2YV4A 4FMCB 3R3HA 2V03A 3AJAA 1QOSA 5JARA 3EFHA 4BOWA 2Q1SA 5IX8A 4A6DA 5KYVA 5KC9A 3ER6A 3W6OA 1OXUA 3GHNA 4Z3KA 4B6PA 2FPXA 3BVCA 2XDWA 3KFXA 2CJWB 4IDCA 1DAGA 1Y5MA 4JNKA 1WNTA 4ONEA 3EVAA 3C3EA 3DN7A 1AURA 2XIJA 2BEWB 4ARYA 5FNZA 1WMBA 4QKQA 5F1OA 2YY6A 3AP7A 1COWD 3I9MA 4O59O 2P3OA 1DTEA 4MS4A 2MSCB 1GPUA 5FYSA 3TMAA 2XJRA 1QV6A 1L4MA 1CW2B 1KC1A 5AP9A 4CETA 3AUJB 4L8WB 3RVSA 4ITUA 4XASA 1V3VA 2O23A 5ARCA 1V8OA 3H1YA 4YUXA 2HYDA 4M7RA 2EERA 5F1YA 5JIBA 1Z8NA 3GLKA 4JJIA 1NVXQ 1WLTA 4FW9A 1M10A 4PNZA 3ONDA 1JHMA 3E2IA 2Q27A 3NQHA 2HY7A 2V5UA 2VWQA 3O3NB 1P1JA 4HB3A 1UY4A 3ND8A 3RRJA 5IP5A 1WTAA 2IUYA 4IIEA 4W9NC 3EF0A 3FHIB 1OPRA 3LQRA 4JLNA 3PC6A 2XVMA 1AYM2 3HP7A 3PA6A 1SUFA 4IQ0A 3G5LA 4OHBA 3RAEC 3IPYA 3QYPA 3FN9A 2GH8A 5E7MA 2J3MA 4TSKA 4JYCA 2C04A 4NPCA 3U13A 4PG5A 5IJWA 2YWFA 4EB6B 3FCEA 1KBZA 2PIAA 3OOWA 1HL7A 5AK5A 3H9AA 3MF9A 5TF0A 1VMIA 1IBSA 2ZJ4A 1XEWY 4CDWB 4DRZA 2VF8A 4URTA 1G20B 3PWKA 3FETA 1VPLA 3VO9A 4DG9A 4MI3A 4G0UA 1TXGA 3OLXA 5GZFA 2UYGA 4RELA 3ZDVA 3OJCA 4E51A 4DKJA 1PVXA 1I3OA 4YVWC 5DB4A 1G5HA 4J94A 3SC3A 1CY0A 1XPWA 2QUOA 4K0RA 5DPMA 3BFKA 4ALNA 1P7ZA 4L16A 2WILA 1UKCA 3LIPA 4CF7A 4R8RA 4EPVA 5TGDA 2R072 4M0LA 5IVYA 2ZRLA 1XG5A 2VYVA 2IYZA 1FPN1 2QZJA 4DFDA 5H82A 3QIAA 5JNWA 3KZNA 1XV5A 4FR5A 5BQ3A 2IIQA 1XNDA 4HQLA 3WI7A 2QLTA 4G09A 2W22A 3VGJA 1LLFA 2UZIR 4Z0NA 4UOZA 3SLIA 3O4HA 3GNQA 2VZTA 3C41J 4QPGB 2YDXA 2TSYB 3HBFA 4KTTE 4PAOA 1GZWB 3VKMA 2VY0A 1HTBA 3R9XB 5JH7F 2DCUA 2G7ZA 1QORA 3ZBQA 4AG4A 3KR0A 2O7VA 3P2OA 4NIGA 2C2MA 4RJKA 1KPHA 4W82A 2XQKA 2NQ8A 1SVOA 1WG8A 4JU9A 1ZD8A 1DG3A 2VOWA 3VBHA 4ASMB 1E1YA 3KX2A 3BJZA 1LRKA 2AR7A 2VSNA 3U4CA 4LSWA 2NO4A 3O4JA 4LRXA 2IX9A 1DS6A 5C8CC 4QU0A 4WOKA 5I4IA 4YLZA 3I54A 5LASA 2HR1A 4RTPA 5EZ5A 1E2NA 2DEUA 3O1SA 1ORHA 4ORFA 5BSEA 5C7YA 3IBYA 4TSVA 3CNBA 1KWKA 3UYJA 1SCUA 1P1CA 4L08A 2ZIAA 4BFXA 3W2EA 2HK9A 2WKQA 1QO0D 3NJYA 1OA1A 1FNBA 1WD3A 2ONZA 4TS4A 2AI1A 5LQRA 2C9OA 2VQTA 2Y6GA 4Z0HO 3DW1X 2I99A 4D5EA 1AL0G 4H18A 2C6SA 4EEZA 3U75A 3X1YA 2WM9B 3BKWA 4HDMB 1MJFA 2GLUA 1NQTA 4P5EA 1BDMA 1V8BA 2LCIA 2QG4A 3E3OA 4EJ2A 1GUYA 4B4QA 1R083 3T1LA 3P9KA 1ZICA 1GNPA 2JK1A 4Y33A 3VDMA 1RKQA 3GHMA 4OV6B 3O8OA 2G82A 2O2GA 3NP9A 4IRMA 4AXBA 4JAAA 4WVLA 2H1FA 2QRPA 1JJIA 3FG9A 4HCJA 1JGTA 1JWLA 4CKYA 4M1TA 4M46A 2GAIA 3IAS6 3SR4A 4K1XA 4BAUA 1CPNA 3B3JA 2ILMA 5LLDA 5IKOA 2YRFA 4CPBD 3GEIA 5JI3E 1NV8A 2QSYA 2GKGA 4QPGC 1ODKA 2AD5A 4LJYA 2WRAA 3SX0A 2YRXA 5IXSA 1RD4A 1IWOA 3AZPA 2HQRA 5EHDA 2OAGA 4B4OA 4M2LA 3J80A 5DVZA 4EW3A 1IHOA 3BL8A 2NP6A 3UK0A 3F9IA 3ASIA 2GPJA 1EE2A 4JBIA 2FCTA 3Q6MA 2I7DA 4LYHA 4IHKA 4F9FA 4FSJA 3D9QX 3I92A 1XROA 2OQRA 3K6JA 3GA5A 1W48A 3DPSA 2H1CA 4E1BA 4DNXA 3BZUA 2VOEA 1LBHA 3FR8A 3L2HA 2AT1A 4OXQA 2J9XB 4CU7A 2XDVA 1X2BA 3GMIA 5AOCA 3CEAA 3GFQA 1QAMA 1XCOA 3PUQA 1HQYE 2IVFA 3LK6A 4HC4A 3TQSA 1M72A 3TTVA 1SFNA 3JQPA 1X8EA 1MFZA 1YFZA 1Y3CE 2FNAA 1R092 3MF6A 5JV5A 2K6GA 1SKMA 4MRVA 1X7ZB 3LB9A 3V4SA 4F2GA 2FETA 3TRIA 3NVKI 4RD3A 3FHOA 2GCPA 1D4AA 2HYKA 5FZ1A 4ICIA 5AK4A 3MGAA 3OE5A 4IFEA 3UMVA 1FBTA 4AFBA 4OLJA 2QROA 4YM2A 4UW9A 1APNA 5AW3A 4Y26A 1TF7A 2HWE3 1ZZ8A 4C88A 5FJKA 4W8OA 3SFZA 3F98A 4DXTA 3KZOA 3D3WA 5A9TA 1VFPA 4XACA 1R4NB 2ZGUA 3TAUA 1KZYC 1XE7A 2OCDA 4GWKA 1XTIA 2HIAA 5IK2A 4BPRA 5FZKA 3ESYA 2B7YA 3GDBA 1ID8A 1RWQA 4IW3A 2E49A 3MAGA 2CNOA 4GQIA 2XB8A 4JT4A 3PC2A 3R7SA 3UMFA 5SV8A 1HLDA 4XF9A 1TM3E 4R16A 1KS5A 3FCYA 5LBEA 2FDJA 3JTMA 3W77A 4QGNA 3A4TA 5FZDA 4QNNA 3NBKA 1TYZA 2B69A 5DJ5A 4ZTBA 1X1RA 2GM5A 5HXAA 2K9ZA 2BOJA 1W4RA 4OA8A 1XALA 2A9JA 2CFCA 3M3EA 1QHEA 4AQYB 1IN6A 2OK7A 1G21B 3RFTA 4IIVA 3PDHA 2AX4A 3NHYA 1QV9A 1A9TA 3NJ8A 3QPDA 1CIVA 1U3UA 2VK8A 5EYPA 1IB0A 4WLOA 5A9SB 2ZT6A 1U0SY 1E7YA 3RUCA 2JFUA 2QQKA 1MUUA 4WKCA 4MKFA 1OILA 3FNGA 4TXMA 1JZTA 3LWBA 5DBIA 2Q1MA 1U7XA 3AYDA 2B37A 2JAUA 2PNFA 4QGAA 3ZTYA 2EKZA 1HB1A 3THWA 4KGVA 5JLJA 9ATCA 3EK2A 1R8SA 3ZBUA 3VBUC 3F6EX 3PUSA 2X15A 1NSFA 4UUNA 3C1UA 2PHDA 5ITZA 2PGLA 4ZO7A 4LKSA 3LE0A 4HAIA 3OM0A 3D5OA 4IJKA 2R62A 3GRVA 2CDAA 3NOXA 1UU4A 4MIKA 4IG4A 5ALZA 3NNMA 4DLUA 2DMRA 3WAKA 4JQYA 4XJVA 5FHRA 1KAEA 1A4UA 3MXTA 1L4NA 1HQLA 2FXIA 3P9ZA 3MYXA 4F1WA 1WWKA 1V1RA 5H02A 1I9GA 1ZOPA 4KDRA 1HG1A 4C1BA 1QHNA 2H17A 5BUSA 1QJEA 1FMD1 3EVGA 3JQCA 2P4UA 4CLOA 1P33A 2CCGA 2IBTA 3C6YA 1BCSB 2QVLA 3FNRA 3GZ4A 2VDRB 1JXOA 4P9WA 3C1OA 3OM9A 1EVLA 1MXFA 1QS0A 4X71A 2FHRA 4FFLA 3QI7A 3ZR6A 2Q5TA 3L0IB 3AW8A 4WX2B 3B70A 4JYPA 1FCJA 7REQA 4DAEA 1LBIA 4KWHA 4FLFA 4ZVLA 1G9CA 4FAGA 3R7FA 4B9AA 4E9KA 2JE9A 2J08A 1QO7A 4RXUA 4J9VA 2I5PO 1QVVA 2KQUA 2GN3A 4I6GA 1DHTA 2XGGA 3TBHA 2Z58A 4XLTA 3KYJB 4LRUA 2QVYX 3E0XA 3I42A 1Y9ZA 1PIV2 4JENA 4V03A 5GZEA 4KRYA 3QEMA 2YASA 5DN6D 4BFYA 4IGQA 3TDKA 4DCPA 3FXAA 3DMNA 1QIEA 2OXTA 1RUF3 4YUVA 1YCIA 1QZTA 4IOMA 2QHXA 2PUGA 2OUJA 1CJVC 3TGPA 4HLUA 2GASA 1WMEA 3FSJX 1J8DA 1C0KA 1VL6A 2PUJA 4ZU3A 4EQZA 5CBPA 2ATVA 2WPNA 2XIQA 3RNLA 3CKMA 3BA6A 2WTXA 1SHZA 5EE0A 2JBAA 4F38A 5KB3A 5COBA 5IFTA 4DANA 4ZVNA 5L73A 4QDSA 4JROA 4ZAGA 3TAHA 3WTCA 2BBVA 3IILA 1D6SA 3QLQA 4IXWA 2XRMA 3FJ1A 4BV3A 3RK0A 4D8XA 2BTEA 2J9FB 3HDYA 1GQOA 3VPCA 1AR92 4J1TA 1UAAA 5DG2A 2RHDA 3RYPA 2NSHA 4P35A 3WHPA 1CQIB 4A6XA 2BEKA 2JD9A 2QQLA 1R18A 2W90A 5UKDA 2OSBA 5B7QA 2V45A 2GJ8A 2ZI6A 4YJHB 2Z0MA 1E2QA 5HF9A 1PLLA 3GRCA 3R6GA 4MPDA 5KSZA 1JSXA 2QAGC 5DAQA 3FDZB 1JRLA 5A6XA 1JQAA 3ROKA 1GTRA 3GGDA 3N1UA 4F06A 4RKWA 1T6GC 3E1F1 5FFMA 4YXWA 3ZJ5A 3AO0B 3UT5A 4EQVA 5EJIA 5HR5A 1VBFA 1PJBA 2UDPA 5L4SA 4DR4B 4TS1A 4UHJA 5DTRA 4BNDA 3KKNA 2BFEA 2IXIA 5J7MA 3AJ8A 3V4PB 1A27A 1Z2OX 2C9BA 4ALKA 1DQ6A 1M06G 2JJYA 3SH4A 3NORA 1Y3AA 1N1MA 4ALMA 4P38A 4LDPA 2WS92 1WPXA 1V4NA 1DFQA 3F1KA 5CW2A 4RHV3 2OCBA 5LB6A 2PUCA 2JLBA 1TUIA 1JR3D 4Z4IA 2BH9A 1M54A 5M29A 3HHPA 2QNKA 2VOJA 4QQFA 3JAKA 3FLAA 4DV3B 5AVOA 1IN1A 3U1VA 4F3TA 3RSSA 4Q2FA 1BQEA 3V7NA 3IODA 1GWLA 2RGNA 5KVVA 1RI5A 4IJWA 3U3ZA 3OZBA 1PO13 1IRXA 2ZRHA 1H1DA 3PX7A 2QJRA 3AL6A 2QDXA 2NADA 3C16C 4IEWA 2UU8A 2ZQ5A 1WVIA 3I61A 3OG2A 4BLSA 3KPYA 1UBTS 2L42A 3BD9A 2HRQA 5KDOA 2A59A 2WIKA 3QE2A 5G4KA 2XJUA 5BQOA 2VYQA 3LMKA 1PI3A 1U9IA 4NPHA 3UUGA 3ABQB 1NQXA 4DL9A 3THCA 3N8KA 4NK5A 2ZUEA 4XFKA 1P7WA 3CLTD 5LQKA 2ECOA 2CNWD 4YRQA 1Y9EA 1W47A 2VMHA 1QZUA 4S2EA 4Y1VA 4LE1A 4IMJB 3KKOA 4QICA 4HTAA 2DU8A 4OSPA 4GP7A 1A95A 4TV8A 2I74A 1NWCA 2XDAA 5L6MB 3GJBA 1XTQA 4RD2A 3QX3A 2W2TA 2PZBA 4AG3A 2GZRA 5NULA 2PZGA 5REQA 2PJRA 3SFVA 1XEWX 3LEMA 4CR8A 2PZ8A 1J9GA 4IHQA 3T09A 3VOBA 1CR0A 2UVQA 5JCJA 4KH9A 2VNOA 3H4VA 3CLRC 4IJVA 4ZYXA 4ZXEA 2CF6A 1QJU1 1OXBB 5IMBA 3S2SA 4HSJA 1W1IA 3CBGA 5GM0A 3GLIB 3NEYA 1R4NA 2EZUA 2XUJA 5CB4A 2IZ0A 2GRAA 2DR2A 2ARCA 1EFUA 2VZ9A 1IK4A 3CPJB 4B8ZA 4GZLA 3EAFA 4CDGA 4ACAA 1CZSA 2QX4A 1W88B 1Y3FE 1ZCFA 1HTWA 4MJ3A 2NU9B 1N77A 3W2IA 4L9AA 2CXQA 4JUIA 3DPRC 3JCZA 5FNVB 2MSKA 1JQBA 1ZWLA 2WQ8A 3C7HA 4FOOA 1Z88A 1E98A 2MMCA 3B9IA 2VF4X 4QPDA 2YHBA 1R1DA 1ESMA 2OZVA 2QX6A 4F4JA 1OX4B 1MC5A 3RIHA 1WPRA 4EGAA 3AF4A 2G5CA 1VE0A 3M2MA 3ZE1B 2LR0A 4ZO6A 2JIOA 1J5EB 5M5BA 1I2DA 2VH2A 3EODA 2WTNA 2WMDA 2DQSA 5A3VA 2X9LA 2FN3A 2O48X 4A0GA 1C2YA 4MS3B 2CBXA 4A26A 1W9WA 4D98A 4BWOA 3DR3A 1Z6QA 5DLQC 4EA6A 3JZAA 2HA3A 1M6WA 2QG6A 5C1DA 1KY5A 3D7RA 1PN3A 4YZ5A 2H4ZA 1NRWA 5C7IO 4B45A 5BN4B 5BV0A 1XZNA 2AW5A 1R6DA 1P62B 1VL0A 3L1VA 1DL5A 1E1RD 2O0MA 5B2EA 4FPFA 4ND4A 5GIPE 3G13A 4P9NA 1OXKB 1HRV3 3T3YA 3OLVA 4YP0A 1MJNA 1M0SA 3LOPA 5FZ4A 2B42B 3V64A 3JQ9C 4PV7A 4BJHB 3GAMA 2AGSA 2DBZA 4LJRA 2RGUA 2VP4A 3HB1A 4XTRA 1T6ZA 1TMF1 2IXJA 2EKLA 1NVWQ 3DHVA 1GSAA 3B7GA 3DFIA 1II9A 1H2AS 3QZUA 1VSUA 2WJ3A 3CB4A 3IJPA 1JQLB 3K1JA 2WN2A 4Y1XA 2TEPA 1ZU5A 3R0IA 4OKSA 3I2HA 5B4UA 1WETA 1EWRA 2VJNA 4JUBA 1GU1A 3GO4A 3HJNA 3VSAA 1AJKA 4HN0A 1U1IA 3WYGA 2RMU2 2ATCA 3S68A 3H9BA 4BCBA 2O2SA 4DJAA 4US2R 4PTZA 2WYWA 3TTWA 2QAIA 3RFXA 4MKXA 2JGMA 2QG9A 3C6QA 2Y0CA 3DYPA 3VD9A 5K4LA 2CHHA 3DKVA 3UWDA 1P8JA 4G6ZA 1X14A 5ENZA 2HWF2 1C0EA 1OTXA 2P0AA 3P26A 3AHEA 1E6MA 5BN1A 4XGRA 2IXAA 1PKEA 1A4XA 1YV9A 1Y8RA 3DYOA 4DCNA 1KRHA 5HIMA 5P21A 4TMFA 4K5QA 2LM3A 1KDYA 2OUIA 5CJJA 1LPPA 4Q9JA 5ITWA 4HFNA 4CV0A 2P9YA 1P6XA 4AWDA 4Y1RB 3UGTA 1DYPA 4UBJA 4HWSA 1KGYA 4MVJA 1BBT2 4JIGA 5K3AA 2OM2A 1Y42X 2RI1A 4XJUA 4XCQA 3A14A 5DYIA 1XRJA 5A1JA 3ES4A 5GLUA 3MWEA 1JQEA 4HLUC 3RJTA 3JYQA 1CUDA 1TA4A 4NFHA 4MQEA 2GPAA 2YZKA 5AXAA 4AF9A 3IELA 1OLME 4LBLA 2VHYA 4L2NA 5HEKA 1T24A 5A3RA 1JAYA 1BE6A 2WFLB 5F37A 1LWNA 5BNZA 4QEDA 4CUAA 2C5BA 1BVUA 3WLHA 1YR8A 4JC5A 2ZWVA 2QQ5A 4G1CA 5K0UB 1JZ2A 16PKA 2BY4A 4Q03A 3F78A 1SKUA 2DVGA 3C5CA 1D4VB 2ACEA 5AIBA 2FPIA 5EMNA 4LECA 1OYYA 4HRXA 2CLCX 3VYTB 3PHMA 5DTIA 4FINA 5DNEA 3PT5A 5DN2A 2VP9A 3JAKB 1J09A 2NUAB 3ACDA 1C50A 1F8GA 3AF3A 5J58A 3V2GA 1DAEA 3KGLA 3MIHA 5DIFA 1TJYA 1H2RS 4KV7A 2E6KA 3S81A 1MO2A 3AMNA 2W58A 1Q0LA 5CA1F 2ZSDA 3PJFA 3WYCA 4XH9B 6NULA 4MWCA 3T8YA 5EJ3A 1RUF2 2X10A 4KI5M 3INRA 4QDTA 5KJEA 4F83A 1UKRA 5AHRA 3QWBA 2BHTA 5KU1A 2EXIA 4MVJE 2ARAA 4HB2A 4OLAA 2EFJA 3DJFA 4LGCA 2RHWA 1TQDA 3WIEA 1Y3BE 3TEWA 3P9QA 5ILGA 3TZEA 1JAIA 3LDUA 4ZEVA 3E9QA 4BNTA 3PXGA 4UXIA 4MYTA 3MB5A 2G88A 2W2PA 2B8JA 2IEYA 4RY2A 4BFSA 1XHLA 2PV0A 2IZWA 3PEFA 5T64A 1IS4A 1P19A 5JNRA 1UY2A 2YJTD 2H7YA 5EMHA 1QH9A 3WNZA 5FMOL 2IQIA 4Q0QA 1CVNA 3GIWA 3VR2D 3WV6A 1CRPA 3V80A 4C7MA 3MZ0A 5EEHA 2IL1A 2NM0A 2NU6B 3ICCA 5HF8A 4Q3CA 4S1NA 5A0VA 4AAYA 4OD0A 2PU7A 3A4MA 1MVLA 1XRSB 3HMKA 5AD1A 4UXJA 2HU5A 1ACMA 1DEAA 1PS0A 4KLAA 4UBGA 5FWDA 2BHLA 4F5DA 4DR6B 4QE3A 1OBVA 1QK4A 1PV1A 1G7SA 1KI7A 1AMNA 2PEYA 3OF5A 3JASA 4JLKA 4BNUA 1JZ4A 4EKIA 2L82A 4UXHA 4G5XA 4XEZA 3G6KA 4D02A 3F2VA 3CBQA 4I50A 5FWAA 4DJTA 3FWKA 2JHFA 1AR61 1JYIA 1PSZA 3Q3EA 5ECWA 1ZVMA 4EUEA 2IHYA 2ZSUA 2BOVA 4J1WA 3N75A 2FG7C 2ZAGA 4IGPA 1TUGA 1JIUA 3HBKA 2B25A 4CXWA 2Q1WA 2YS7A 4PO1A 3C24A 3S55A 4ETIA 2AMYA 3ILNA 2XE4A 4UM8B 1SBTA 1SXJC 2FSGA 2X40A 4JOSA 2Q4RA 1G4AE 3ZY4A 3S1AA 3ZCSA 4N5IX 1O7FA 1P61B 2AR9A 2GBPA 3T0FA 1BX0A 2Y60A 3ZY6A 5FPBA 2BEWA 2ZTLA 3VTAA 4LJ9A 4BS9A 1YZVA 1NXVA 1YJ8A 5E1RA 1NJFA 1WOYA 4LQCA 4HGYA 1ZRIA 3DV2A 2R063 4D46A 5H3LA 1RRPA 3PE3A 4PDWB 2BBSA 3FMIA 1E99A 3NM5A 1Q5OA 1RUJ2 1W9FA 3H0CA 5DZFA 3HP1A 1IG3A 4CLDA 5JOQA 4LMAA 4HWKA 3HWWA 1QJZA 1JH9A 4B48A 1CK4A 5F73A 5HZHA 1A0OA 4UFOA 2FPOA 2YIVX 4HO1X 5FK8A 2FR0A 5ITVA 1DKRA 1SHUX 2XWSA 3LC1O 4OVKA 1MC8A 4BGUA 3PUZA 2YNMD 4Y20A 3C3BA 5AVQA 2YIDA 3VBOA 1VBKA 3LO8A 4DTCA 3WP4A 1ULUA 2GERA 4C14A 2EAKA 4ZYTA 4ASKA 3FWEA 1GPH1 2AA3A 4M1WA 1MR3F 4IDBA 1M1YE 5J4KA 1SDDB 4ZS2A 2VZ3A 5HM6A 1CQJB 4FDTA 3WZ1A 3B3GA 4EH1A 1MJHA 4QGLA 3EC1A 5FO8B 2R66A 4BECA 2JEYA 2NT4A 4LVNA 3OTGA 3BK1A 1TAUA 3QU2A 1SEPA 1JIKA 3PD1A 2PHZA 4BNYA 3KFVA 2G77B 1XKLA 1KVRA 2H9YA 2IUEA 2NV0A 4CNQA 1WJGA 1P4GA 4FOQA 1UJ2A 4YIKA 3OICA 3EDMA 3GIDA 4KJXA 1A8UA 1PFKA 4K81B 4AXXA 1DLLA 1KO5A 4BNMA 2QRQA 4ESOA 5A62A 1ZZ9A 3ZE0B 4JUAA 5K0TA 4NCNA 5DW0A 4BKPA 5E3HA 4XMAA 2CLKB 3NMBA 3W4IA 1RUI1 5CXQA 4UUMA 1N7GA 4ZANA 3T7JA 5JVDA 1X7YA 1RC6A 1IEQA 2BV4A 1S55A 3OA0A 1G9TA 1R2QA 4AZZA 4MUNA 1COZA 1B2RA 4B3XA 4ER0A 3EA5A 2DWPA 2C3OA 4Q7MB 4ZCIA 4LF8B 1KI6B 3UAYA 1VBMA 3U4QB 4MGKR 3QUCA 4I3HA 4ET7A 4KR7A 3PR2B 2Q4BA 1W5FA 1AOXA 3V8MA 1BK1A 2FQPA 4IJ5A 4WZBE 4DGQA 3GJRA 5EXPA 1A69A 4D45A 4UHCA 1R6AA 1VCMA 1ZN8A 1P1BA 3JB8A 1W30A 3NGXA 1VSQA 1X1DA 2XJPA 2R8YA 2BBOA 2V98A 4EYQA 1CEXA 1JHVA 3IRUA 2EF6A 5KCMA 4BVAA 1PWYE 1JR4A 1VSBA 1WWYA 2O3JA 3JWJA 1TL7C 2R0HA 3AZXA 1RUI3 4Z92B 4B7UA 1H8HA 2OG1A 3D6MA 3ZEIA 3F0TA 3KPVA 2FEPA 1X7XB 4PI2A 2E48A 4BMOB 3VVCA 1T9CA 4O4JF 1XE8A 1RYDA 3BHNA 5KYYB 3GYGA 3NWJA 4TL9A 1TMKA 1GQSA 3NNSA 4YM1A 3PDUA 1AKQA 1U0HC 4ERXA 4YVFA 4DIQA 1VL1A 2GAOA 5BNNC 1HDCA 1KMCA 4RIEA 1NA5A 1CAUA 4YK7A 4OHKA 1AKRA 2WA1A 3LT5A 1ULSA 3QKTA 2AKAB 4CXYA 4V3CA 1BMDA 2Z43A 2GPNA 1HMPA 3B3QE 4ZRDA 1FQKA 2ZSEA 3GDWA 2VCHA 2WMYA 1XCPA 1COWA 1Q50A 4LBVA 3OHMA 4EG0A 3FSRA 2VBDA 2P9QA 4ZI7B 3ILHA 2RK6A 4K6GA 2QTCA 5T5OA 1W5BA 1FRFS 4B75A 2JB4A 1L4UA 2OLKA 5LBTA 4LJAA 4ZOBA 2VSYA 3HQ4O 3HZOA 1ISIA 3HNPA 3MS7A 4D3FA 3ZBTA 3B8EA 4XOIA 4OYHA 3ZWCA 2EFHB 1BOOA 1NQDA 1SFPA 2VTFA 4IR7A 3ZDEA 1W75A 1N2OA 3B36A 2IYSA 1OC2A 3DB1A 4A10A 4J1TC 1O7JA 1RXIA 5FV4A 4E6EA 1KYYA 1X3SA 1KMQA 5GV8A 1ULDA 1LENA 1H4TA 3MJTA 4AKIA 1CNFA 4IFIA 3KHCA 3O92A 4BBAA 4DA6A 4L8QA 3CZJA 1Z6GA 3AI3A 3W5UA 3SHOA 3EN0A 1Q15A 4IDEA 5BURA 1EVYA 2W0SA 5I9MA 5C8YB 1S2IA 5DWVA 1ZXBA 5E6HA 4RK5A 1RQLA 1RWNA 5HKLA 1SVLA 3TM5A 2HHCA 4ILEA 3E9EA 1H8VA 3M33A 4KC0A 4GAEA 1I33A 1VI5A 2OHOA 3LRXA 3VRHA 4OG2A 1RUNA 3K0BA 4P3OA 3IR7A 4NROA 1BXRA 3ESRA 4TL8A 3G9XA 2D6PA 2QIOA 2G1MA 4IEXA 2QOEA 3BGIA 2JGRA 2DWQA 2YOFA 2Z8YA 1BHQ1 5GQSA 1I2BA 3O0XA 3OFKA 5CXXA 4NEHB 4NBRA 3ZYZA 2NO0A 1JYXA 4YMGA 5FYVA 4U9UA 3ZGZA 5JOZA 2XGSA 4XDYA 3MIFA 3D3KA 3UUWA 4PZ9A 3RH0A 3F9RA 4YRJA 4MAAA 4JI5B 1DT5A 2DH5A 5BW4A 1SOMA 4HQRA 2UVPB 5TC4A 4A16A 4JB3A 4GE0A 5H70A 2V9PA 4JJEA 4XSVA 2YZMA 2YU1A 1TMF2 4WY2A 5DHFA 1RB8G 3F6BX 2NVUA 1XZQA 4HAUA 1FFAA 5CEJA 3A4YA 1ZK0A 1VE6A 4QYWA 1JUIA 2BFBB 2A3RA 1U8XX 3HCPA 4UULA 2H57A 1BYUA 2J4CA 2FP4B 3H2HA 4R9CA 3C70A 4CR6A 1X3LA 4GI2A 1DJLA 2WNUC 1N2HA 5BVHA 3WNKA 2IEBA 4AGRA 2VHEA 5IAOA 5IJZA 3V32A 2VLIA 3EGOA 1U0AA 3SE7A 2QRGA 3D2BA 2IE0A 5FXMA 2H2FA 4MICA 4LBJA 3K0CA 3EYAA 2VPZA 5BUZA 1ZUNA 1IZ3A 3H1FA 4I99A 2NTVA 4WVWA 2BJVA 3LEKA 1V7QA 3Q7TA 1DBIA 3H9CA 3WAGA 3RRMA 2WTAA 4L8VA 1XTTA 1NMYA 5FZ7A 2IOFA 2QRLA 2C5HA 4JP2A 5B53A 3BXFA 2GALA 2ZK7A 3IIMA 4BV8A 2QD5A 2VTBB 2XCRB 2BNMA 4GC5A 2GYVA 2YWCA 2HU2A 1YQCA 5BW8A 1FE8A 2YRWA 3KNZA 1FVHA 5EHGA 4B4RA 5ESWA 3NMUF 2Q0SA 2FEOA 1PQ4A 2M98A 1U2DA 1JH8A 3DCYA 2YZNA 4PIYA 5AK3A 1KJQA 3IHWA 4UKDA 3BWVA 3FY4A 3Q0IA 2MEV3 3CLSD 3EG9A 1TU4A 3RIYA 1QLWA 5K3FB 5FRAA 4AMGA 4Y6GB 5JRZA 4JEIA 4JEHA 4CL2A 1KH3A 5DXDA 4IMIB 4MSVA 1UC4B 3HE3A 1MV5A 3O93A 5DZSA 1YFWA 3E03A 3VKWA 3RC3A 4NU8X 1N5KA 4X1KA 2CXHA 1PDOA 2H4XA 4CMKA 3EFOB 2WW8A 4MWSA 2JL1A 4TV9F 1G7RA 4DMRA 3ERCA 1U0RA 3S1LA 3FF4A 2VTBA 4YNIA 5JS8A 3HUTA 5COAA 1ZZ6A 4X61A 4FSXA 3U3MA 3W1EA 3ZZ0A 4KXFB 1OVGA 2DKOA 3GMSA 4ZT5A 2YQ4A 1TTTA 4HYTA 2ZBQA 4XZUG 4DPLA 2DQYA 2H7CA 1NBMD 3FFXA 1GOHA 1WKYA 4QXBA 5EEGA 2XWQA 4CPBA 1YI8A 5ACA2 3WK4A 3P6BA 2QZSA 5DI3B 3I4LA 2VPVA 5KQRA 1NUAA 3G8CA 3R8XA 4L27A 3TZLA 1NVEA 5ED4A 3GV0A 4CE6A 5A9RA 3ABSB 4F8YA 4EA7A 4HNUA 3D6UA 3MICA 3QHQA 2FPIB 3FDIA 5CJ2A 2ZJ1A 2RM21 2W6ID 3W5NA 4WNAB 2DG2A 4MUYA 2IHNA 3L0YA 4I55B 2QTNA 4U7FA 2VK2A 3EC2A 2QI9C 3AMMA 4QXAA 3RRFA 3CH5A 4RWEA 4LJ8A 3K0KA 4PXAA 4GF5A 2RHBA 5DAXA 2L69A 4MS1A 4RK1A 1XEFA 3EQ2A 4O4HB 1G8AA 4JRAA 1I51A 4LNUA 5FMCA 4LXHA 1N78A 2G17A 3KUCA 3L07A 1ZMTA 3ABRB 2D7DA 1HQWA 1QJFA 4K87A 5CG9A 4JHZA 3AL3A 3NFRA 4OFWA 1U5IA 1YQTA 3OPMA 1F4VA 3LOBA 1LX7A 1ZN7A 4E07A 4YJKA 4BQYA 3VPGA 1ESDA 1WQ1R 3JXEA 5AKGA 1RAIA 2H9AA 2BV3A 1H8TA 3ZHZA 5DX1A 2YICA 3W3ZB 5JH7A 4RQPC 2VCEA 4CCCA 1Q2XA 5AC93 1RWMA 2KR2A 2V73A 4YP6A 3SEEA 2VQFB 2JCXA 1MX9A 3EZ9A 5HW0A 1MS5A 2WM8A 4FVTA 4RPHA 3I6YA 2QZ9A 4DINB 1O8CA 1ZRNA 2HWD3 2ZYUX 3X1DA 1PJTA 3T2QA 5JSOA 3F1LA 3FAKA 4IZIA 3QD6A 5HBAA 2CYBA 4XSHA 1W6PB 3ORHA 4HYYA 1N1GA 3GP8A 2IVIB 1K8XB 4EYGA 4JEMA 4TV9B 2C9KA 2FB9A 4QPCA 1O3SA 4I5IA 1U7UA 4XWAA 2DULA 2HDHA 4IE4A 3RKRA 4M9RA 2O8FA 1J3RA 5HXMA 5HUHA 4X6UA 5E7QA 2CL7X 4D5GA 4BLUA 3F71A 3KYDB 1NVVQ 1NPYA 3D2LA 2ZA9A 2ZRMA 2I6GA 3JXSA 4RS4A 1Y1LA 4F97A 3R9KA 5HK8A 3EAQA 2AJTA 3N36A 1R081 3EBPA 5CIQA 3UJ9A 3H7JA 3UBTA 1GPWB 1JHYA 4R4JA 4YW7A 3Q8FA 3OQIA 3CWQA 1KEXA 3PKZA 3MWDB 3ORQA 1Z0IA 1VLLA 5F6KA 3O4RA 5D1HA 2VG9A 1PNOA 2GZDA 5EQDA 3HA7A 4TKVB 1NF9A 3RAPR 5C51B 4KQMA 4O1HA 2ZPUA 1I9CA 3EEOA 2LTAA 4FHEA 4FPOB 5LRRA 4KG7A 1XLWA 4PHHA 4LKDA 3ZLJA 4EN0A 3EYWA 1ZITA 5EWLB 1XAGA 5C5TA 1REDA 3VU8A 4YN3A 1XGKA 2CHEA 3WLSA 2C24A 5KXCA 4LE2A 4EY5A 5FYDA 1AHIA 1OQ1A 5KSYA 5C4WB 5APAA 1VCNA 1LHNA 3C8MA 2Y6KA 2VDJA 1V47A 1OW3B 2JW5A 3KKEA 2FI1A 5F51A 4OXYA 1GAXA 1GZ4A 4ZC8A 4QRIA 1C8BA 3WIOA 3TIGA 4LN1A 1DPFA 2O5CA 1V0JA 2ISQA 2QZ2A 1SC3A 5IUQA 3HN6A 3H3ZA 2J33A 2TRSB 3DLTA 2A6YA 5TMBA 4XOUA 1M1YB 1UZLA 2CYCA 5EVJA 2W0MA 2GZSA 3D6NB 5DMXA 3DONA 3LD9A 3ZOIA 1FSZA 3NIFB 3KVNA 4MGIR 2PWZA 1YKSA 1SCAA 2HSDA 1BEUB 1SKBA 2B83A 2BMFA 4R81A 2AXEA 2X3FA 1RACA 3OEEA 3WC4A 3ME2A 1RE1A 5CVJA 4OB6A 5LRSA 3EVTA 2B1RA 4UW6A 3L04A 4E31A 4Q4W2 5K99A 2VW2A 1VOTA 1YCFA 3LYHA 4I50F 2Z5GA 4RJIA 1X74A 3BMXA 3AXSA 3TN91 1ZH6A 1FQWA 3SC7X 3CH7A 3SQLA 5ACA1 4URYR 4BLJA 1X9IA 5A03A 1R0KA 5EUCA 5LP6F 1CU1A 2ZPTX 3ZNPA 1XKQA 1ID1A 4MVJD 1MZFA 1KI2A 5IXYA 3LT1A 4BNJA 3HOBA 2R7EB 3PQ7A 4A6EA 2I71A 1GKBA 1NFQA 2WDZA 3IAFA 1WD7A 1SZJG 3DGEC 1AB5A 4WFKA 4CIVA 3GCXA 4A3ZA 2YY5A 1GTG1 4Q24A 5EQFA 3I64A 4FX5A 1P4HA 4NJEB 3SK0A 1Z06A 3OT5A 1HYQA 1O6ZA 2XKAA 1CIWA 4RTRA 4TT3D 3ZYBA 2K2QB 1A8MA 3OBRA 5L9AA 2YHJA 3AQ4A 4CV3A 2G9NA 3L1IA 1EINA 3OQPA 2V7QD 1U3VA 4TTAA 4UE6A 3TEJA 1W0JD 2DFBA 3ZVMA 2Q5IA 1GQFA 2RAUA 1VBB1 3LLMA 4C29A 5HCIA 3TF5A 3U0ZA 1VBA3 3ZWBA 3JVEA 4ZOAA 1P7YA 5FWJA 3ROMA 1Y7TA 5ESDA 5ALFA 5LZ4A 1HKDA 1NI5A 1UOJA 3WZLA 5HYVA 4XM0A 3IERA 5IG2A 3EIOA 1QH8B 4DJDC 1PWEA 1FMFA 4XUQA 4EB8A 2V54A 1C9NA 1XSRA 4X0EA 2R85A 1DHKB 3KQVA 4UYBA 4G0QA 2OAEA 4DRXB 4JBLA 4OI2A 3LQ4A 1Y4UA 1KK1A 2VPXA 3ZQ4A 3T5GA 1L7PA 3G8YA 2BGPA 1I7SB 2C7PA 3LQ2A 4AZWA 1JEQB 2J87A 1AKYA 4E2SA 5FLKA 2KX7A 3AYAA 1KS4A 4KKXB 4BX3A 1WA6X 1TA9A 4UVDA 3T7RA 3CO2A 3KYDA 2HFKA 2JG9A 1SM4A 1V8ZA 2D5HA 5K0JA 2PHLA 2GHRA 5JIAA 3S44A 1RRCA 3PR1A 1N6PA 4FHFA 4MYEA 1D09A 4O7XA 3S5QA 4LRTB 5JC1A 1GEGA 2C03A 2X8AA 5HMLA 1ZA1A 3WYFA 1KFBB 3UB4A 1JLLB 4FQ8A 5DN9A 5L3QA 3WDWA 3PNVA 3KLSA 3PQ8A 1CN1A 1BWPA 1ABFA 4B8WA 3MPPG 1PVVA 1LEMA 3G7UA 4PIMA 4IV3B 3OU6A 5HCBA 1K7XB 4W1SA 4AEDB 2VJQA 2XYVA 5LMNB 4CCOA 4OHMA 2ID8A 4RCZA 3LC2O 4FOYA 1PK6A 2FKNA 4TSFA 4U39A 4MLZA 4C91A 2ZGMA 2G25A 5H3CA 4X9XA 3KHKA 2NWQA 2RK4A 4B2LA 3OY8A 2IEZA 3NRJA 4KQXA 1L7NA 1NL3A 1JFFA 3DBVO 3TECE 1E2FA 1VKNA 5JI2E 1PJLA 521PA 1LV7A 1KSJA 5EXSA 1WO8A 2G9ZA 3O82A 1BMV2 2XZDA 3PXDA 2G28A 1DADA 2FLWA 2PBLA 2QLJA 1PGPA 4Q5OA 3RTGA 3N35A 3VZCA 2UZ4A 3AMQA 3R05A 5TVKA 1KEKA 4RR3A 3LUJA 5CH3A 3IT3A 2V5DA 1L5HB 3WLJA 1QQP2 1UZ0A 4U2AA 3JYHA 2WS91 2FWAA 4TTTS 4XI9A 1NX9A 1HRI3 1W85B 2YZ2A 3B51X 3T9DA 4FYHA 3RPQA 1JAHA 1NT0A 3I5AA 1A88A 3ZSKA 5HTKA 1QGZA 1UPSA 1OVPA 2FEKA 3QVGA 4JJ4A 4KREA 3CM0A 3EIFA 4LUMA 1AUQA 4CCEA 2C1FA 5ICSA 1YS2X 5GZDA 3P0EA 4MP8A 1DRWA 2G5TA 3E7PA 3V0BA 4HPXB 2WLQA 2IUWA 2O8EA 4BLOA 3S8EA 1HXS3 2XRYA 4UW5A 4MARA 4ID3A 3G8AA 1R0SA 1YC5A 5FBZA 4B32A 3A1UA 4MV2A 1GYKA 4TWZA 3FZYA 4MYSA 5BSUA 3KMHA 5TXGA 3IR6A 4YYOA 4K28A 4QUDA 4C0AC 5T5PA 4QFBA 1PR4A 4PBOA 1W2OA 5EZSA 3LQYA 1ULGA 1N3YA 2V0NA 4TZ6A 1I3HA 3PDWA 4QOHA 3ZC3A 1OVSA 3JQBC 3DAPA 4Y6LA 3UXMA 1F4AA 4ES9A 4XF4A 1K0FA 4HNQA 4D4GA 2BFUS 2C20A 4M6WB 1DQSA 3L7OA 1V9U3 2JFNA 3EZ2A 1UIKA 2EEPA 3PQCA 2P6MA 3JWGA 1ENOA 4HONA 2XRFA 1YR1A 1JVSA 3MRXA 1PGOA 3SYRA 5JAZA 2Q50A 3SNHA 2LXNA 1YS4A 1MNAA 3I34X 4BMEA 4UUPA 1AXKA 5IUKC 4RH0A 5JOYA 3H19A 1ZY2A 4D6PA 4YRFA 4UBOA 2Q2WA 1A9XA 5CDFA 3EF3A 3GCZA 3A06A 2Z42A 3VBSC 4RKEA 5BSVA 3CX3A 4F3NA 1WS6A 2FHSA 4KH0A 4NK4A 1VJRA 1V37A 3IAEA 1URPA 2HSGA 2ZIGA 3OESA 3Q8KA 2FVXA 4XEUA 4GD4A 1GNSA 3T7IA 3WFJA 4ZVSA 4IVQA 3S5AA 2JCSA 3ORJA 3VDAA 1RT9A 4OJMX 4A8TA 5FZOB 5JEDA 4GS5A 2FFBA 3M1LA 2UU9B 2ZE5A 2P34A 2MJLA 4GB32 1E6UA 4GOOD 2HBZA 3WK6A 2AJ8A 1W8NA 2DQ4A 1X6VA 1H1LA 2A0KA 3TUJC 3LNTA 3VV2A 3RDIA 3RRZA 3F8TA 5F3CA 1RJGA 1CZHA 3URMA 1RGSA 2A92A 4A8JB 4E1AA 1XTSA 4QD3A 3UK7A 4Q1DA 1E1CA 2QM8A 2FFAA 1SKAA 4L7VA 2A30A 4INJA 4LSMA 3D6VA 5EZYA 1U7PA 1PZXA 1SURA 4BV2A 1QPZA 4QEKA 2YROA 1H9AA 4N7BA 4HDNA 1GSOA 3OOYA 3B6IA 1QAQA 3EPLA 3UGJA 1Q0RA 5F12A 3OZCA 1T5SA 2WNIA 4POAA 2QUHA 3ANTA 2CXPA 3L41A 3RHSA 5HGJA 2YV3A 4Q9IA 1XPUA 4XDOA 1GA1A 4Z3OA 1GRNA 1PW5A 4AGVA 5HCUA 3RSHA 3G0DA 1UW8A 2ZJOA 1N2GA 3JQRA 3I3BA 2A3XA 4XARA 5FZEA 4Z07A 2B92A 5JJIA 4WJLA 3H42B 1FJHA 3P2JA 1R27A 2R0FA 1EUYA 3NGLA 5IVJA 2YIMA 3A0RB 1R0LA 3O9MA 4DXDA 5JNTA 1XWIA 5EXDA 5A4AA 2AUTA 1JQ3A 1E1NA 2XOKD 4I8DA 3V5NA 3VSEA 5B3JA 2GM9A 4M3NA 1B35A 3AR4A 4J3NA 3DEJA 2PAEA 3K3NA 2LIPA 5H68A 1YJBA 3EOBI 4QYTA 4JAVC 4FPYA 3WYEA 2QRUA 2GCNA 5E6UA 2RH5A 4JT9A 3I3EA 3T61A 3ZSLA 3AX6A 3GMDA 4FMDF 3ZSMA 1G6Q1 4KGXA 3DBRA 4W8GA 2W6CX 3KOZA 1DJNA 2EQAA 2GYWA 1BRMA 2Z98A 3T95A 4FC7A 4F1JA 5DUWA 4JR0A 1CVIA 2WJZB 2ZT8A 2BWCA 3WIVA 2RG4A 1ZFNA 4U4AA 4MK4A 1AF4A 2HV9A 3BWXA 4CTMA 1KYIA 3JALB 4R98A 4R2WA 2A9KA 4TZTA 4WM7C 4FYKA 5LB2A 3NTUA 1VPVA 2HWC1 3ZOKA 3CPHA 3WK9A 4BEBA 2REBA 4DZZA 4UTNA 4EPXA 4Q4X2 2ZR9A 5U4XA 3MTAA 3DLPX 3NCTA 4P81A 4IX9A 4LOTA 4Q3NA 3GLFB 1XXLA 4DR3B 1Z8FA 1QG2A 3AFMA 1F17A 4RWZA 3H1MA 3WQRA 1OIXA 1CUWA 4FMPA 2NNWB 2W92A 5LA9A 3Q88A 3A9TA 1FNDA 1T0IA 3LBAA 2QUBA 3QUAA 2HCRA 1GPAA 4DLLA 4GP9A 2C5SA 3HCDA 2B94A 3FCAA 2Y1OA 1XP8A 1D6JA 3BREA 3HPQA 4EGJA 2R1BA 4LJ6A 2RS53 2I2SA 2A0FA 1PO12 5AM4A 1W8FA 3LF7A 5DP1A 4GPZA 4Q4JB 1UXKA 4D7YA 1SU4A 3HCCA 4JXXA 3RDPA 4QECA 4OBWA 1YRAA 4ASUA 1OASA 5FV3A 2ET1A 4P92A 1EWYA 2HEYF 1XMQB 4R4XA 4IINA 3ZXAC 3KV9A 2CZCA 1MH1A 1NV9A 1IQ0A 3D7SA 1YB6A 4KQ1A 1QNWA 3I4IA 2NG1A 3TPCA 4E1VA 5A6SA 3EZGA 3ZE7A 2VJKA 2ZEJA 1ZJ5A 2A5FA 4JI1B 4K8FA 1Z47A 1T6BX 4YONB 3M4FA 1LK7A 5JSZA 3PIRA 4CCMA 1IJEA 1XDUA 3AR3A 1JJFA 3L1JA 1GPDG 4ARIA 3OWHA 2E1PA 1OVMA 1P0CA 4INOA 4HATA 4G9EA 1K88A 2WLTA 3WNPA 4H7EA 3QF7A 2O9JA 3FLMA 4RTSA 3ND5A 3QU9A 2G08A 2G07A 1CR4A 1PL7A 5AOBA 3UJ6A 4YAUA 1GKKA 4KQHA 3V9PA 4FGUA 4RQPA 2CVOA 5IT4A 3JARB 1IAQA 4IKEA 1ZKDA 3LUPA 2GAUA 1FRZA 2WYVA 3WGOA 4M9UA 4H6PA 3UPTA 2WMOB 3WLMA 2DETA 5HIIA 3KJIA 1A71A 4AULA 2WUEA 4DIUA 1RXGA 1JSLA 1XT6A 5FUWA 4JI8B 3PQDA 1FFEA 1GQHA 4FFMA 1CB0A 1K7FB 1RI3A 3OOXA 1JKJA 1RABA 4CCJA 4E6PA 4KE9A 5TPWB 4TROA 3KXLA 1AR83 3PC4A 1ZUD1 4H17A 3JRXA 4HX9A 4XQWA 2ZJCA 3D1VA 3F3SA 5FPSA 4PFKA 2HMUA 2D6MA 2QNRA 4B3CA 2B61A 3MJEA 4GBED 4X6QB 3CEWA 4WEOA 5FBLB 3KUXA 3VA7A 2VYND 3DLBA 3I3MA 1W5TA 4XIJA 5IT5A 1SLIA 4JBGA 4LDAA 3JQEA 2H1VA 1VHLA 2FMDA 3AW9A 4UUAA 4NS1A 1FDUA 4U7JA 3BICA 2I9KA 3EGXB 4E2WA 2HLHA 2ZI7A 2VZVA 3P1IA 3UT5B 3GQVA 3WP3A 3LPCA 1RLOA 5DDIP 3P5SA 4NATA 4I4TA 2NN8A 4S1PA 5A1FA 3T2PA 1TIKA 1USGA 1EPUA 3NAPA 2XUOA 3BYWA 1OBOA 4E4ZA 5KHGA 3SF0A 1RVF3 3AX4A 1YVUA 2BCJQ 3SX4A 1LFAA 4NS4A 4FQ7A 1UXGA 1XQVA 5LUAA 2J4FA 3DTVB 1JL3A 4R52A 1REQB 4IRUB 4I55A 3ECQA 4ARZA 2E37A 3D8UA 4JGYC 2PH1A 2SHKA 4QYIA 2HYIC 3SJUA 1Z62A 4XC9A 2ECFA 3ZDZB 2D3WA 3KKMA 1V9U2 2Q1FA 3AKDA 1RUE3 3GGOA 2YHUA 2GJ9A 4DM3A 4FKBA 2WO1A 5JY1A 2BGJA 3V1MA 3DULA 4L75A 5FUVA 3KUUA 1CDDA 3BCHA 5CHEA 4CRWB 2PFWA 1XB2A 2FN7A 5IZCA 3ITDA 3EW7A 3C2QA 2D44A 2KM1A 3PF8A 3PTLA 1P1FA 2GBLA 4CUBA 1OB2A 1UK8A 4KGQA 4EPWA 2CTVA 1H2FA 2C3MA 3N7MA 3BJRA 5DISB 1AR81 1QVAA 2GN1A 4NKRA 3O1VA 1ASJ1 4WZAA 1FJGB 4NBLA 5EXTA 2SKDA 1NONA 2IZ6A 2NLOA 4BZXA 4QX1A 3PTAA 1UWVA 3FROA 3H83A 1LDNA 3AKTA 3R4DB 4DN6A 4EHNA 1HFJA 5JDCC 4NONA 4NHOA 2VBIA 2WT2A 2B7LA 4I50B 4YMUA 1VXRA 5KEIA 1SPPA 1U5BA 3LLUA 4NFYA 2ACWA 4NABA 2EYUA 3ROQA 1IPJA 1EXNA 3ZH9B 2C0CA 2FN8A 2I66A 2QYSA 4C06A 2X4LA 1VJ0A 2RHOA 3RI9A 5C8ZA 2Q3BA 1NT4A 3IEUA 4CIWA 2WTUA 1KHHA 4AL4A 5IVEA 4JDPA 2ZGTA 4W5JA 5T6BA 1XTBA 1XNCA 4N8MA 4P00B 1ST3A 1YVRA 4L4RA 3ABZA 1HJFA 1Z08A 3KAKA 2N1MA 4QOIA 4RAOA 1SG9A 5J3UA 1WTCA 3EVDA 1TNFA 1FFBA 4C9BA 1G2QA 3HY4A 3TOXA 1KO8A 3R2JA 5B4TA 3FW1A 1RHQA 1NZIA 7AT1A 1JEAA 3GUZA 3E58A 3UMRA 3VL8A 1QQ7A 2NZVG 3ZN4A 1K4MA 5IFKA 5EHXA 2ECKA 5T4BA 1C9DB 2P67A 1Z45A 5FTLA 1EYBA 1KNXA 2PY6A 4WZFA 4DNFA 3GT4A 3WYAA 1Z39A 2ZI9A 1WW6A 13PKA 4N53C 1Z4QA 2LIVA 4FPKA 2VTEA 1YQ9A 1RP1A 3ENVA 3LUDA 2ZGKA 1UWCA 4G85A 5CKNA 3EVCA 5D86A 1LX6A 4KXVA 5KNDA 2OP1A 3MB8A 1TW3A 3W4KA 1OJLA 1VG1A 2I6SA 5EJEA 2ZULA 1PJCA 2D0PB 3DG9A 3I9LA 3E97A 4MV9A 2R65A 4LTMA 1U8YA 2PMDA 5CVCA 1T2AA 2AEZA 4G0NA 3ZX7A 1E2IA 3IDOA 1U2GA 1E3WA 4IEOA 1C5IA 1RYHA 4NWIA 3JAWA 3RMYA 1J90A 1PJRA 2QX7A 4YG0A 3W9AA 4CKCA 1TZMA 3V8VA 1CF9A 4DRYA 2AC2A 1PR5A 4K9LA 1KJWA 4IJ6A 5SYNA 4RVGA 3R76A 1EVKA 5TEVA 4JBXA 3VKLA 5DGHA 3F7TA 1YAHA 2NN3C 5KUTA 4RVDA 2UZ1A 3B7WA 5A0TA 1NF3A 2VXCA 4QBFA 4Q01A 1BS9A 3OMWA 3TKAA 3HYNA 1OT5A 2YC2A 3CYFA 3B82A 3TW6A 3K70B 3IXQA 5CBKA 5G3YA 4C6HA 2DUWA 3GUUA 1B14A 2P90A 4D9HA 1MEC1 3TIIA 2A1TS 2XYQA 2CLSA 3SQOA 4Z9YA 2LTNA 3UMGA 3DEAA 2PMWB 1RVV1 4BLVA 3WRXA 3N8GA 1AZDA 1N8KA 2GYYA 5AOVA 5FYTA 4LPLA 4I4TB 5FQNA 5CK5A 1X33A 5DXAA 4RETA 1OKOA 4O2BA 2GVDC 4RY0A 1G0OA 3ZS8A 5FRDA 2GETA 4E22A 3MJDA 1CFJA 2GCIA 2UY9A 3JYNA 2OBXA 4Z4CA 1VLZA 1RIFA 1US8A 2FX2A 3SC4A 3W2HA 4R69A 2IY8A 5YASA 1C30A 4LJ5A 4FLEA 5IUNC 5AVVA 3MWLA 4BZQA 3CKYA 1JXQA 1HB4A 3QBDA 2I45A 2OUHA 1RXEA 2EDAA 3C7EA 3OVMA 1PFUA 1KQOA 1CDZA 3Q3JB 2X2PA 4FIDA 1JFLA 3WR5A 4LHLA 2GJ4A 1KI1A 1AKMA 2D4HA 4JYZA 1CLEA 2H9IA 3MBOA 4Q4DA 2BERA 3ZCRA 3AEUA 1ZJYA 4MW5A 1X86B 2O8QA 1ZJJA 4UDXX 3FHTA 3C48A 3HR9A 3HKDB 1T4MA 4OYLA 1U99A 5LCXA 4BQNA 5ALSA 1ZMXA 3RARA 3FNBA 2IVZA 1O6UA 5C4IA 4JA0A 3WMRA 2XJ4A 5A3LA 2HHJA 1GPNA 2G1KA 5FFNA 2H4YA 2IXGA 1PR1A 5B1YA 1YQ2A 2VF7A 2BWJA 5JXWA 3COPA 3Q1KA 2PNJA 1JEJA 4BQ3A 3OZGA 2YXSA 2Q3LA 3GT0A 1YS9A 3F74A 3CRNA 4BYMA 1AE1A 4N43C 3KHUA 4DS0A 4IYJA 1D2CA 1Y9MA 4IL5A 5LXTB 1QJCA 3EQZA 3VOSA 1U1CA 3MAAC 5IN5A 4FMDB 3ZXIA 3WMWA 4AK3A 3FA2A 1KK2A 1LDMA 1GOGA 2X5NA 4TYSA 5AM1A 4UZEA 5DNYB 4XTCS 4ROTA 1V3QE 5JZMA 4NY1A 3KWMA 1FMCA 3ZGNA 3PNAA 3CXUA 2Z3VA 4Z1VA 3H8JA 4XFBA 2DR3A 1M2JA 3W2TA 1YL7A 3GLRA 1G21E 3A9RA 5BT9A 4RS3A 4MYUA 5ICCA 2X6TA 3KOOA 4K9OA 1IDN1 1ZBE2 3UETA 3TNYA 4NEGA 3KWJA 5FP4A 1M74A 5ALPA 3A22A 3NTQA 2Q6VA 3B00A 3UOAB 4LF7B 5ALYA 3ZFGB 1N92A 4CQNA 3SE0A 1O95A 2DTXA 5KVAA 5F7OA 1W2TA 5KO2A 4YJ3A 4C78A 2XSZA 4FPLA 2I0FA 1TEVA 3ETNA 1UFVA 4WKOA 4EHJA 4O4IA 3U7EB 3BSWA 1DC5A 1CEYA 3HA3A 3LCRA 1B09A 3HRHA 2IELA 5ICGA 3FAZA 3IQIX 3VU0A 3IH5A 1QYXA 3LUAA 2GKOA 1GCUA 3BCWA 2WNVB 3JQ7A 3HDGA 5IUJC 5TMEA 3QUBA 4N3BA 3EWAA 4A3XA 4RL6A 3IIEA 4KE8A 5BYBA 2NZUG 2O3TA 5JHGB 4ZDWA 1N2CE 3ETGA 3DKRA 1W88A 2XXAB 2OMEA 2C9CA 3RFCA 2D2VA 3H4TA 2RHRA 2NXCA 1OFGA 3AHFA 3QA3E 2JFWA 2L19A 2E55A 1PIWA 3S2IA 1SH7A 2HIHA 1RXCA 3WJAA 3LCVB 2GZWA 4KYVA 4I4CA 4NJ4A 1SKYB 5ADHA 3H6HA 4D9GA 1WLWA 4I1YA 4OIMA 1UL1X 5JDIA 3PDQA 5ANRB 1XMSA 3ETHA 3BE5A 2R041 1XU1A 3HU3A 5AI9A 4KUHA 4S2GA 3ANYB 3CONA 3TLAA 1ZOSA 1L1FA 1MD9A 2JRCA 2YFKA 4TKVA 1DE0A 3R4SA 5TMPA 1N0VC 3BT7A 2ZTNA 3VI3B 3WF0A 2AMJA 2I34A 4IE7A 2HWWA 1JI6A 1PHMA 3T3IA 4FD2A 3DCQA 1N6NA 1Q3TA 2M9MA 3JQAA 3F5MA 5KTKA 1G16A 3PMSA 5FKJA 4CN9A 2VE1A 3K0FB 4K20A 1G8HA 1JQDA 3P2KA 5EXEA 1P44A 1OMOA 4CL3A 3KJFA 4DJEC 4BB5A 3OYWB 3UKDA 1I3MA 2IUFA 1ISGA 4J6GA 1IMOA 4CP9B 4WERA 3HYTA 2RHLA 1HRKA 1Y82A 2HZ7A 4GSYA 1SJ9A 2SKCA 4AMUA 2BFFA 4D57A 3SMQA 2Q99A 1E2EA 1VR3A 1WL8A 2J7PA 1PT5A 2P2ZA 1QZ3A 4OJYA 4BNGA 3S29A 4FDLA 3E4DA 1A9SA 2DHDA 2NMOA 4IEZA 1YK0A 1NVVR 4BH9A 2UWCA 3B5LB 3T5TA 5J2TF 2DUJA 3WIDA 1HR0B 2BRUC 5JD3A 4LV5B 3F6PA 4OQZA 2EJVA 4HMZA 3AH8A 3WNNA 4EQ6A 4RFRB 3T7EA 2VMGA 1LCLA 3A4IA 3SQDA 1E2PA 4CA9A 1FTQA 4JLPA 4JXKA 4BQ1A 3NALA 4G5OA 4YJHA 3TOSA 4YMHA 1USVA 2FPMA 1L7LA 1PRYA 1RHMA 2XLBA 2P9BA 4ETWA 2A1IA 2RB4A 3EEQA 3H2ZA 4J29A 3LFTA 1SG3A 4Q3OA 2AE2A 1FTWA 2LBPA 4Z5XA 2GPSA 3E7XA 4ZU7A 4B74A 1LPBB 4EW1A 1XCJA 1UBSB 1FXUA 1KP3A 1XK6A 5KAMA 1NRJB 1TYAE 2R87A 1DWPA 5LNK1 2GESA 4HOYA 4ZT4A 1W3VA 2R8EA 3PB3A