2WABA

Structure of an active site mutant of a family two carbohydrate esterase from clostridium thermocellum in complex with celluohexase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
NPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNATTSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDAITCAYGNEGTSKEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKYVPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVNDCNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE E
publication title The Active Site of a Carbohydrate Esterase Displays Divergent Catalytic and Noncatalytic Binding Functions.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
A PF17996 CE2_N Carbohydrate esterase 2 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wabA01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2wabA02
2E33A 3OG2A 3C7OA 1DYOA 3I3DA 4RYDA 2VL4A 2QBXA 2W1SA 1ZMBA 3WNNA 1ESDA 2CDPA 5DPNA 3DT8A 3K4AA 3BGAA 4BJ0A 5JXJA 1CZTA 4K3UA 2QQOA 2YFUA 1K12A 2X05A 5A1AA 5CZKA 2VMCA 1JYNA 5IJRA 3K46A 2Y64A 2DDUA 1DP0A 3ABZA 5LA2A 2L9LA 3RJTA 4I8IA 2C9KA 1UYZA 2XONA 2W95A 2WO3A 2WBKA 4BK4A 5B5SA 2J1RA 3NJXA 3OGSA 2J1SA 5IYYA 1IQDC 2J1AA 4TXWA 3SEEA 1ES9A 2XHNA 2B9VA 4AAXA 1JU3A 2YC2A 4XUOA 1CIYA 1GOGA 3FHAA 4QX1A 3SKVA 3P1IA 1PX4A 4A42A 2APJA 3UETA 4AG4A 4DUXA 2YB7A 1YZFA 3GDBA 4JX0A 4GWJA 3FL7A 5HOEA 4QX2A 2BGPA 1JYXA 4RN5A 5JUVA 1JZ4A 2W94A 2VJXA 4K9SA 1HN1A 2QQKA 4GZ9A 4QB1A 3T08A 2C4XA 2VOTA 2JKXA 5JXIA 1JU4A 2J1EA 1JI6A 2X09A 1ESCA 2E26A 3D3AA 2J1TA 1I5PA 1Z8HA 2VZSA 3SLRA 2BGOA 4MGSA 2VM9A 4ZZ5A 4OMCA 4QPWA 3WNOA 3OGRA 1BWRA 2RJ2A 4A44A 1NX9A 2Y6JA 1XC6A 3CQOA 2LS6A 2YC4A 3A22A 4CU7A 3GM8A 1UMHA 1JZ8A 2VTFA 1PMJX 1UY0A 2WN2A 4DXSA 5I0DA 2Q0QA 4OZOA 1GNYA 1TG7A 2ZXQA 2VZOA 4PQQA 2EIEA 3C8XA 1WABA 4DXTA 1IVNA 1GOHA 1L7RA 3C7FA 2VZ3A 4UAPA 5B4XA 1JYWA 1K7CA 2V5DA 4P5YA 3I97A 5EIYB 1W9SA 3WF4A 3C7EA 5IHRA 3K4ZA 4A45A 5B4NA 4PF1A 3CDZB 1J84A 4JKKA 1UWWA 4RW0A 3NJVA 1OT5A 2VQUA 1W99A 1VYHA 3A7QA 3CIHA 1DLCA 3CZUA 1D7PM 2R7EB 1W8OA 2E31A 2PQSA 4S1PA 3P94A 3C7HA 2HYXA 1PMHX 4HF7A 2VZUA 4CU8A 1UX7A 5DMYA 2ORZA 4ARXA 1W9WA 1J00A 1GMMA 4CUBA 4JHLA 4XURA 4W4ZA 4ARYA 2QQJA 2Y6HA 2VZVA 1WCQA 1JZ6A 2VMFA 4OAPA 3U37A 2VZTA 5JR2A 3I2JA 1OH4A 1W0NA 1JZ5A 4PPYA 3CKHA 1SHWB 5C7GA 1UXZA 3MV11 3T09A 3MILA 3FN9A 2RVAA 3SEPA 2W3JA 1GU3A 3T2OA 2Y6KA 3HN3A 1K3IA 4BK5A 4LKSA 3WF3A 2DCKA 4A4AA 2VCAA 1UYXA 1EUUA 2WAOA 3WNKA 1JZ3A 4CUCA 1OF4A 3WQBA 5JXHA 5HXMA 1FXWF 2RV9A 1K45A 1NUKA 2W92A 1R64A 3LPGA 3VDCA 4UOJA 3A21A 4OMDA 4NRDA 3VDAA 5HPOA 1BWPA 4E8DA 4CU6A 2QQNA 2LW8A 4QAWA 1O59A 2W47A 4UI9L 2VZ1A 1CZSA 1US2A 4XUQA 4BXSV 4YPJA 1OD3A 2WABA 2W91A 4DEVA 3WEZA 4M4RA 4KWUA 3BN6A 4W8JA 1JYVA 1T2XA 4M8KA 2W87A 3ACHA 3VD7A 3GGLA 4DUVA 2DCJA 2VCBA 5G04L 2VPTA 1JHJA 3HNMA 4MOAA 4A41A 3NQHA 1L7QA 2BZDA 3BZWA 3IB3A 1US3A 1SG3A 3HNBM 3WNLA 2ZEWA 1TVGA 2QQMA 3I2GA 2BBAA 4FI9A 5G05L 1DEOA 2WZ8A 1LNSA 3I2IA 3SKJE 2WO1A 3LEKA 3CZJA 3MO4A 3DYPA 1O8PA 4A3ZA 2QQIA 2J7MA 3DYMA 4QX0A 4CU9A 2WUHA 1UY1A 4P00B 5BN1A 4K40A 3NRUA 1K42A 5JD3A 2VMEA 3CMGA 1BWQA 1NAEA 3OEBA 3PUIA 1EUTA 1W8NA 3EYPA 3VD9A 1YQ2A 2W5FA 1UY4A 3HJRA 1KEXA 3E1F1 2VCCA 2Q0SA 2VQTA 5IFPA 2E32A 4PT6A 4QB6A 1ULOA 2WZEA 3OBAA 3DT9A 4ET7A 3J7HA 1H6XA 4M4PA 3MV01 3MUY1 3T0DA 4OYUA 5EJZB 4JJ4A 4IUGA 1U8UA 4TTGA 1UY2A 3LPFA 3OGVA 2VC9A 2HLEA 1V2GA 4ZZ8A 2VMDA 3T2PA 2ZEXA 3EB7A 3I3BA 1O8SA 3I2KA 2VR4A 2VZQA 2VZPA 3C7GA 5LA1A 3WF1A 2B4KA 5LCWL 1UY3A 1WKYA 4JJ6A 2Z4FA 3IIIA 2JE8A 1CX1A 3W7VA 4JHZA 1XNTA 3WNPA 4IYJA 4XVHA 1OF3A 2WDBA 4JKOA 4OUEA 4JKMA 4QDRA 3FHQA 3LE0A 4JKLA 4CUAA 3PUHA 2W9XA 4RSHA 3HPNA 3WF0A 2OKXA 1JRLA 3I2HA 5C71A 1ESEA 2W1QA 3W5MA 4HYQA 4Q7QA 1MPXA 2V4VA 1PP4A 1XPWA 2WAAA 3NNGA 3K77A 3LEIA 3UNPA 3DCIA 4D8MA 3ECQA 2ID4A 2JD9A 1GOFA 4LHSA 2Y6GA 2ZEYA 3KVNA 3P6BA 3GXUA 1DEXA 4QDSA 1RYYA 1NKGA 3DYOA 3DECA 4K7JA 3T2QA 3VD3A 1BHGA 2W1UA 5J1XA 5CD9A 3UESA 4L0PA 4MGQA 2HSJA 3A23A 5JMOA 3WF2A 3HNYM 3DC7A 3THCA 3T0BA 5C70A 1SDDB 2WYSA 5JXGA 2C26A 2XOMA 4MO3M 1PX3A 3I2FA 4CVUA 4P08A 1XNAA 2EIDA 2QQLA 5CYYA 3OB8A 3WNMA 4JGGA 3JXSA 1F4AA 1ULPA 2EIBA 3VDBA 3IDAA 2Y6LA 4LPLA 3ACGA 3ACFA 1H6YA 2J1VA 4Z2AA 2EICA 3HEIA 1CZVA 3I3EA 4W50A 2WN3A 3HP4A 4TX1A 4DXRA 5LA0A 4XUTA 2W1WA 2ORXA 2XQXA 4XUPA 3LEGA 3LQCA 1JZ7A 3PT5A 2WO2A 2CDOA 1J83A 3ACIA 3HOBA 2BERA 2ZEZA 1JZ2A 4DUWA 3K75B 3OEAA 5DN2A 4QB2A 3DT6A 4E8CA 2VO5A 1KGYA 1UXXX 2J1UA 4KI5M 4Q9AA 2YG0A 1UZ0A 3ETPA 4XZUG 5FUIA 4ZXEA 1GUIA 1F4HA 3W5NA 3K4DA 2J22A 4KMQA 1FXWA 3ZM8A 1UYYA 2W46A 4QDQA 4P02B 1VJGA 4A6OA 3T0AA 3MUZ1 4OAOA 3THDA 4DEQA 5F7UA 3VD4A 4HG6B 1P8JA 2VZRA 4MADA 5EJ1B 5IFTA 4BDVB 3IAPA 4H08A 3MBWA 2Y8KA 2WQ8A 3WSOA 2YFZA 2V72A 4GWIA 2KD7A 3C1UA 1UMIA 5A4AA 4ZY9A 2X10A 3VD5A 4XUNA 2JDAA 3AC0A 3F2ZA 4D0QA 1W9TA 1GQPA 4QX3A 3IAQA 2O14A 5DQ0A 4LQRA
chains in the Genus database with same CATH superfamily
3VBSA 1HMYA 2DBVO 5LLSA 5E8RA 5KOJA 4CSWA 2AR0A 4ZZ0A 1SOVA 2XE4A 4AO6A 2QE6A 4DC1A 1QSGA 2BFWA 1XDBA 3RYTC 4CT5A 1QYVA 3G2OA 2NQTA 3DMTA 5JNWA 4UQPA 4HUQB 1IZ9A 2UU9B 1Y33E 1A5ZA 3OD1A 3FE2A 4GICA 3TEFA 3ND5A 1MB9A 2GCOB 1Y4SA 3DLAA 1I4TD 2IYLD 1ES9A 2IEIA 3VH2A 3HJUA 1CTQA 3SHFA 4DZZA 4C2TA 4BQSA 5ESDA 1NF8A 2ZSEA 1FTYA 4FU0A 1Z4MA 3U3JA 2VPZA 3SICE 2YXSA 2WNHA 1N3OA 5C52B 1C1DA 2CFCA 1OVMA 4OMCA 2XHEA 5DX1A 4XC9A 5I7HA 1NX9A 1UBJS 1DKQA 3K3OA 3IAS6 2JKZA 3QOPA 4R9AA 3GBVA 1DKRA 1T2EA 1ASJ3 1N2CA 1PSZA 2CLSA 4EN9B 1Y4UA 1E92A 1VCIA 4PSCA 3DEZA 2ZQZA 3VBFB 1ZH0A 3UMFA 5DYWA 1HQWA 1CPYA 3KQHA 3O1IC 1ESNA 1B4DA 4QQLA 1NW8A 3CEMA 5DZEA 1ECGA 4Y1FA 5ALMA 4ZZ3A 4AZZA 1WY5A 4FKBA 1VGRA 4AJEA 2HYXA 5CNAA 3MHPA 2LDBA 1W5AA 4PO8A 4CEYA 2PXXA 4N5DA 5FA8A 5WRFA 2JAOA 1N9ZA 4OQ8A 4YPOA 3CKHA 3MN1A 4FIDA 4JQYA 1GSAA 2GMMA 3K71B 2VQEB 4J0GA 1AG9A 1LTKA 4QHYA 3GHHA 3SWWA 4UFOA 1Y7TA 1T0JB 2YN0A 2XMSA 5K0UB 2AMLA 3GGCA 5KJ6A 3H97A 1Y1LA 1PIV3 3LKDA 2HCRA 3NW9A 1MC5A 2VH5R 4B4DA 4B79A 1SLTA 1D1SA 2H52A 4LO5B 3GDFA 3QVGA 3VJLA 4BNVA 4JSTA 2DFBA 5B53A 3PUXA 2VCYA 3R40A 1ADYA 4QT6A 3UXHA 1R1ZA 3NO4A 3SQDA 1JQ3A 4LQLA 3AYAA 4ND7A 2OCKA 3JBG3 4N53A 3ZCUA 4FSHA 5B1HA 5ALZA 1H2AS 3VI4B 3E6DA 3W1EA 1DI0A 4KQCA 2I8AA 4FBGA 1B1AA 1RUD3 1N75A 5F5LA 3N2GB 4NFSA 2X9LA 1GL6A 2VSOA 4BFLA 1JN2P 1F4VA 4ALMA 2HYKA 2BHLA 4FQ7A 4WLUA 3PTAA 3EBOA 3G2JA 1JA1A 4TYPA 4UFKA 5KYTA 1QHXA 3VHNA 1T3SA 3H1EA 3G0CA 1M0TA 3LQRA 5ALTA 3OGVA 1QFMA 1KQGA 2C84A 3E03A 4MKIA 4IIHA 4J07A 5EWJB 4X00A 1GG5A 2I6GA 5K20A 1QR2A 4DR4B 1HKDA 1E5XA 5J37A 2GBLC 1EX7A 4DG9A 1GO2A 3SZOA 1VBFA 1DBIA 4JDPA 2E87A 3O1JC 1OGIA 4NOTA 1YVRA 1JH5A 2OUJA 2D2EA 5AXCA 3FYUB 2I3AA 2C1ZA 2BUKA 2CXUA 1FFGA 1E58A 4FW9A 1BQEA 3FKQA 2A33A 4EG3A 1FBTA 3G7DA 4PW0A 1EK2A 1NKGA 4HOYA 2C78A 3KMHA 3DDSA 3ROKA 2C88A 2CZCA 3OCJA 3NLLA 4GPAA 3T0BA 4Z9FA 5H68A 1Z22A 3AUUA 1G8JA 4LRQA 4BP8A 4DLRA 4OUSA 1KZ1A 2N75A 3RI8A 4IV8A 2AXNA 5KDOA 3LHIA 1J9GA 1U3CA 3L7AA 2I74A 3FWEA 3OFJA 1WETA 4DNXA 3UHPA 3LEGA 3HT2A 4OXXA 4ZONA 5MN4A 2BERA 2YCLA 4DS0A 5FZ8A 4OHKA 1DC8A 3QTBA 1NWHA 4M2LA 1YQDA 1SZCA 3DB1A 5JYCA 2DBIA 5D6NA 5F52A 4MADA 4M0HA 3VO2A 2XRFA 2D1SA 1LF5A 1MVOA 4O59O 2OHFA 3W2IA 4A2CA 4V1PA 2W00A 5LA6B 4NAMA 3ZNQA 2J1LA 2F3RA 5LLDA 4ZQCB 5DBFA 4TYYA 1APNA 3UFBA 3E3AA 4ZT4A 2OV1A 4W8HA 1QG6A 1ULAA 2H5JA 4LYGA 3IMGA 5J4LA 5FI1B 4QGBA 5IJRA 4Q0PA 4JVLA 1L8AA 2GNAA 1ST3A 4H7FA 3T94A 4MVXA 2JIPA 3JV7A 5KNDA 3LFHA 4F4HA 4RA9B 1G6NA 4TXWA 3IV6A 2CL2A 3FR8A 2N47A 4MCIA 3HVJA 1VYVA 4A8JA 5TC4A 1GXSB 3QKWA 3TMKA 4TN5A 3PPVA 4XLZA 3K5WA 3ST7A 1QZ3A 1TF5A 3ZTWA 5KB3A 3NL1A 3QWIA 1XQ1A 3ZBQA 1A71A 1SCDA 3LQKA 2O1WA 2LRHA 1T9ZA 1B23P 4EMBA 1P9LA 4F7DA 2E1PA 4KSYA 1UKZA 2UAGA 4HEHA 4KQ9A 3WQ7A 2GJAA 3P2KA 5AJUA 3ZGNA 1LDMA 1V1JA 3DB2A 4X71A 2HKIA 1FMFA 5FIUA 2C3PA 1O94C 2X3FA 4JT8A 2JKVA 5EFUA 5NLLA 5IK8A 2HNKA 3O3CA 5DEIA 4HVCA 5T3NA 1E6KA 1U0BB 4MW1A 3DE2X 2HJRA 2Z8XA 4CV2A 4E1VA 2VJMA 3T0GA 1RT9A 3BREA 3V8VA 2XHKA 2H5LA 3F9IA 4E22A 1DTWB 4LJ5A 3FLBA 3T7IA 4M0NA 3CUVA 5CU1A 5ILQA 5AJZA 4TXLA 3U7JA 5DN9A 2X5OA 1F4LA 1GPKA 1JF8A 1LJ8A 2FJUA 4E5PA 3A21A 5T4BA 3ZE1B 4QU8A 5DHFA 1X9HA 4B3DA 4DM4A 2DUQA 3MTGA 4GD4A 4DGSA 4H1UA 1RQGA 3R0RA 1PK8A 1JLKA 3L7BA 3V7FA 4A10A 2EHDA 4AI0A 1CE8A 1RJGA 1S3GA 3KKMA 4BDSA 1JHJA 5GV7A 4TMZA 1AQ6A 3QZUA 3NVKI 4Q00A 1WSAA 1BXGA 4AP6A 1KRHA 2O2HA 3D5TA 1J23A 1XDZA 3O3OB 2H3EA 3SSMA 3POJA 2WA2A 5JV5A 1H6DA 1OQEA 4CA9A 2HUPA 3RUHA 2GKSA 1KP3A 3FWPA 5ITWA 3GOQA 4BE4A 4RIEA 1EFVA 2YXEA 2DU0A 1W88B 3QVJA 5EUQB 1XE3A 1ZOSA 4F97A 2I6SA 3L7CA 1PK7A 1KZ4A 4L4UA 1JALA 3OF3A 2HTFA 4EG8A 1V7QA 3TECE 1GPBA 2GVDC 4J0EA 3SC3A 2FPPB 3FCCA 5FKJA 2PHLA 1GU7A 1LENA 5IKEA 1NKSA 1JXNA 3F5MA 4FAHA 2BJHA 3AYDA 1SC1A 1MW8X 2V7XA 2Z58A 1NMXA 3L79A 1OW3B 3NXSA 1OI6A 1B43A 2X6RA 5JNUA 3I73A 4LULA 4FFIA 3EWIA 4Y3UA 2GUWA 4HDKB 1J21A 3FSGD 1OXXK 2VOEA 2ZYVX 5KSPA 5DT2A 1FUEA 4NHMA 5EMNA 1XI2A 4PU0A 2P6CA 1NQOA 3OEWA 3K6KA 3LLMA 3THSA 4GL2A 2VJLA 2IEAA 4GZ6A 5LMCA 1WMXA 5AP9A 4AI3A 3RUEA 3P2OA 5IM4F 5EVCA 3ITNA 1JFFA 1R9GA 4QYIB 3H5IA 2FRDA 4NCKA 5B36A 3FC0A 1JHMA 2C8JA 1UT5A 3R20A 3OY8A 3OZGA 2GNBA 5COQA 3JYPA 3NWKA 4UZSA 3PSHA 3IBSA 1AX0A 1MC8A 3WZMA 3U40A 3FFZA 2G9NA 3LCCA 3BDVA 4UBMA 5F2KA 1ULGA 1BU5A 2IS2A 1K5MB 1CAVB 3G3EA 4BP3A 2N1BA 1CUHA 3UK6A 3ZXSA 2XIJA 3SLIA 1PMIA 1O77A 3B1WA 4L8LA 1RYMA 3N7MA 1MG0A 5FJIA 4EPXA 1I3MA 3MQ2A 1SCBA 4KYUA 4MK4A 4PAWA 1QBKC 1GP6A 2QLBA 1SZBA 2WU8A 4LJAA 4KAJA 3FOAA 2J9XB 4N8MA 4C7XA 1T1IA 3LOIA 2V0GA 4WINA 3BHIA 4WLOA 1B16A 4UFJA 5KPDA 4MR8B 1VOTA 5KMGB 4KLZA 3VDDC 3DO5A 2P8SA 1ZUHA 5CDFA 1XBFA 4F2PA 4M9RA 2O3RA 3TCXB 2X9NA 3PEEA 2NTJA 5DHUA 1MZPA 1FYDA 4BMVA 3SE0A 3VDNB 2WFF3 3JY6A 3FHAA 1RAEA 5H83A 2Q4EA 4QX2A 1RAIA 4A03A 5LQCA 3RYIB 3WG9A 3RG2A 4KQEA 5B3JC 3KKEA 1TZOA 2A70A 1I1OA 2ET6A 4Q4DA 2B98A 4FD2A 1FNBA 1IBKB 5CBKA 4JC0A 4KMRA 4J76A 1WMFA 3CQOA 5A7QA 1QO9A 4V0QA 1JWAB 5AVQA 2VTFA 4G0XA 4ZZ2A 5F78A 4DBVO 3IM0A 4PC7A 4QOJA 1QS0A 4RD1A 4RJIA 1W4RA 3WAGA 1R091 4DDVA 1GYQA 1KO5A 1JG6A 1C4WA 1GOHA 1EIZA 5CIYA 1T2CA 2G04A 5A7NA 1UPFA 2PRJA 3WYFA 2VJKA 3AETA 4IKOA 2A86A 3FPKA 2EFYA 1L8QA 2ASVA 5JWPA 3OQ1A 3U5TA 4KRFA 2Q8PA 4ROTA 1DC6A 3V2UA 3UMVA 4LZZA 3H84A 4B6EA 1EJ2A 2OHOA 5C8CC 1MA0A 2ROQA 1ZRIA 1SY7A 2HU5A 3QX3A 1AR61 3UAVA 3THWB 1B0ZA 1K4YA 4R0NA 1F8XA 1QO0D 2ZMLA 2JLAA 2X42A 2HWWA 1I7SB 3KZOA 4PPYA 2PVPA 4X44A 5IVPA 2QW0X 1FCJA 2QJVA 3QKRB 1IB0A 3THRA 3E70C 4BLIA 2G4LA 3QVVA 1QZUA 1UBOS 4MTLA 4PIXA 3I09A 1C4KA 2YQ5A 3HS3A 1IN6A 4UOJA 4TQGA 5DCLA 4RTNA 5JJBA 2KM1A 2OHXA 5C5EA 4ZHQA 3H7AA 4I01A 1LEDA 3MOGA 3RIMA 2TUNA 2VCBA 2JEYA 3NBKA 2A3NA 4OAQA 3WSWA 4NBRA 4X24A 3TQCA 4Q4JA 5FZ6A 2CKMA 2V1XA 2XZTA 3TW8B 3PYMA 5FWJA 2BRUA 1HMPA 2D5AA 4LX8A 4HO1X 4KO1S 4DLUA 3OETA 3DGEC 4FEGA 1KYXA 5FFFA 2A7AA 4HNAB 1X86B 3C2UA 3NBQA 3CHXA 3ZXKA 5KNCD 1X3LA 1X82A 1FNDA 3VPHA 1NW4A 3GPBA 1Z7S1 5HCBA 5FP7A 4IIVA 3NOQA 4ZZ8A 2DCZA 3U4HA 5IVVA 1STOA 1RUH1 4JJ8A 2W42A 4E5UA 2HOQA 3D5OA 2K5UA 3F8SA 3ZU2A 1EJ6A 1XCPA 1O3RA 2ALJA 4A6PA 2DU8A 3B2QA 4LXQA 5H80A 3PURA 3TMAA 1IUNA 1MACA 3IQGX 1S2MA 4LHNA 1C7ZA 5EZ5A 4C9BA 4LRUA 4ZCSA 4UUNA 4HWOA 1XPOA 3ZFFA 2R1VB 5E1OA 2W1QA 3QXJA 1XE8A 3KOOA 4PSDA 3H8XA 2D3RA 3RQ0A 3K0FA 3OO0A 2YW2A 1QH6A 2GN6A 4AWAA 5ALUA 2X5NA 1UC4B 4DGQA 2C5GA 2Z2YA 1S3SA 5C8ZA 4Q4AB 2CMFA 3ODPA 4QQ8A 5CFOA 4UXHA 4C91A 2QRUA 4M1SA 4IOKA 4R8RA 3U1BA 1Z0DA 4XFDA 4W6QA 1KRWA 1YCFA 2PL9A 1L5FA 4EA7A 3ZFEC 4A9AA 3ZHOA 5K6RA 3TOVA 1EXWA 4HDQB 3NUGA 5FRAA 1GWNA 3SITA 1XMXA 4A6XA 1TMYA 1FFXB 2JG8C 3UK9A 4NE9A 3G2IA 5EYPA 3LUPA 3TRHA 3WLPA 4MVJD 2VZEA 5KO2A 2CV1A 1BBT1 2RCNA 1IKQA 1T1EA 4DR7B 1P8JA 2Z57A 1RJ9B 1HL3A 4BDVB 1T0HB 5CH8A 3JQBA 3BDAA 1CJBA 5K45A 1RUF2 4OB8A 2I4MA 3K94A 1SQFA 1SK8A 2EXXA 1HX6A 5C5UA 4D42A 3LIIA 5EZYF 5FY1A 4O65A 4P8RA 4EH1A 2UUAB 2C2WA 5IYZF 2FDCA 1LHNA 2Z3VA 4FDTA 4RS3A 1XVUA 4M8SA 2QY6A 2XYQA 4KYTA 1ZU4A 4UXIA 5J9FA 1TUGA 3UAZA 3OUIA 1E0AA 5HUQA 4QXCA 4AOCA 1OBOA 4Z9YA 5TQ0A 1ZCJA 3E9CA 3Q15C 4ARUA 5JDIC 4QB1A 4G4SP 4RFVA 4COZA 4I2OA 4ZXFA 4LKFA 4B87A 2YC0A 1E2KA 3B7PA 1YE8A 1M5RA 4GLLA 5A3QA 1ULEA 1YS4A 2BPOA 4JASB 1LB1B 5M0TA 5C8YB 1JSLA 4BU0A 3SHVA 3DLTA 2DQYA 3NBMA 2QP4A 4BFZA 3C97A 3VR5D 4EI9A 3RGGA 4DJJA 5BYAA 5LNK1 4WXRA 3L1JA 4WT7A 4XCBA 2QN2A 1TEXA 4YTEA 1ZNYA 1HT0A 1G4HA 2RIPA 5IHRA 1L7VC 2RS31 1SXJE 4CMCA 4ZYYA 4DFSA 4FCWA 5A7OA 2DFTA 1A78A 4QC2A 2RMU1 4TLGA 1AR81 3MS7A 1Z73A 1FFDA 4EW6A 1GUBA 2TYSB 3OJWA 3HWX1 1Y6JA 5FULA 5EE3A 4F9FA 1LBHA 3ROQA 3DOUA 1E3MA 1J49A 5FOUA 2CDCA 5H0IA 4F4JA 5IPFA 3VGPA 1DWQA 2ZX4A 3X2FA 3ZEAA 1ZDMA 3USUA 5A6ZA 4JGYB 2XMQA 3LM8A 5DNUA 1D04A 4RJKA 4FOOA 4NHEA 2UYQA 3QVMA 1I6MA 3WDKA 1ZD5A 4GXLA 4MULA 2FPMA 3EXIB 1ZAYA 4GX1A 1X50A 5D8AB 1VIAA 5TGDA 3EYWA 2XJRA 4RDXA 1C8M1 2BBTA 4H7EA 3AG5A 3K1AB 3DZIA 4E2QA 5LBUA 1IVYA 2PXHA 2IWGB 3K0CA 3SDSA 2D98A 3ZEIA 2JG3A 2OCLA 2QFEA 3GGDA 2YZ7A 5LP6A 5I8WA 4WACA 4C4OA 3NTVA 2KSQA 5EMLA 1K7EB 2RGGA 4QAQA 4XWOA 5DPMA 4GEKA 4QX0A 4XFFA 3POSA 3KV5A 3QPDA 5TVGA 1GSOA 3RVPA 5AW8A 2BGKA 2JF0A 5FZEA 2VK1A 3RC9A 3VD9A 3WZLA 3EGCA 2VDVE 2VQSA 3R9XA 4IQPA 3GBSA 3VZQA 3I59A 2HY7A 1Z3IX 3BGSA 4M3CB 5JD4A 3RVSA 5IUNC 5LM3A 2KLBA 1AURA 4MWOA 5BNOC 5AI9A 3R24A 1NCRC 4K6KA 4EQ6A 4TSVA 4EHDA 3GC6A 4EB0A 3VKWA 2Z8YM 4OFXA 4HAYA 3ZU4A 4IQGA 5KHIA 1KAHA 3PL1A 1A2QA 3BF8A 3DL7A 4WJZA 4PRKA 1R6DA 1W9HA 3PFWO 3DZHA 2ZX1A 3RIHA 1BDMA 2RG7A 2QTFA 2MSNA 2I4IA 4G2TA 1DZQA 4IETA 1TNFA 1VPDA 3E8MA 5JATA 3THYA 2Y1FA 3KYDA 5LVAA 1DIWA 4LHYA 2VZ8A 3G5TA 3I2HA 2QZJA 2X0DA 1EGVB 1SQ0A 3AEYA 3OIVA 4B75A 1CUCA 1G7YA 2UZIR 3PQ2A 1HQYE 4I5DA 5ETJA 5GIOE 4UTZA 1DIGA 3H8JA 1AA6A 5DWDA 1IWPB 1U0NA 2Q30A 4OQQA 4C1XA 3A9RA 3QPUA 4HBZA 2B82A 2RHWA 4AHYA 5M3BA 2HBYA 3DUIA 2OA2A 1EG7A 5HKOA 1Y1TA 1TEZA 3DSRA 5C3UA 4OH7A 2O0KA 3MBKA 2WWFA 2D3PA 3LY5A 1D4M2 1X7NA 3X1WA 4UUMA 3RFXA 2FW0A 3V6MA 2DBZA 4NF2A 5FYHA 2B5WA 2E49A 1ND5A 3LDHA 1UP7A 2X8KA 1YJ5A 1LFAA 4YW4A 1E62A 2BHRA 3ZVMA 5B1IA 4FO9A 2P9QA 5EPEA 2ZSBA 1M0SA 5C9AA 2GH8A 4BWYA 3FLEA 3FBWA 2IOFK 3AR4A 2BGIA 3C87A 3W6PA 1U0SY 1E61A 1UC9A 4CTEA 3BOSA 2FR8A 1LC3A 3HDYA 3KB6A 5C35A 1KR5A 2B4YA 2FFAA 4ML3A 4JI1B 2AN4A 2PH1A 2O8VA 4R9VA 2Z30A 2EKBA 3RF7A 3K9BA 2A1UA 1WAMA 4P35A 1TJNA 4RCYA 1C7JA 2AC2A 4LOIA 1B2RA 4V38A 1L0BA 1L4UA 5JUVA 2PVCA 4NG4A 4Y6LA 3UF0A 5HMLA 1NHWA 3LF7A 4AY6A 2RHBA 2FZVA 4JQOA 3ICVA 3MMPA 3CEJA 1Y7LA 4EUKA 5LB6A 3H42B 3CJTA 3MW8A 3F3KA 1HNZB 1HW5A 1CY2A 4K2HA 1JHUA 1JZ8A 1GQHA 5GZFA 1WMBA 3L01A 3SJ7A 2NIPA 3N7UA 2WZBA 3VVBA 3KBBA 1GSLA 4PQQA 3K9WA 3TE6A 5JCJA 1D4M3 1KK0A 1ZRNA 3B82A 4ENRA 2VZ3A 4O6VA 4UPDA 5G2OA 3DOCA 1O97C 1QC5B 1HG0A 4NR0A 2C0ZA 2VDOB 1EXDA 4NMHA 5HQTA 1AF9A 1OU4A 1TQHA 5C46F 1MJGA 5ULLA 3L1VA 4X9XA 1EVLA 5IFKA 3PVNA 1R3UA 4ZJZA 3Q7SA 3GQBA 4RABA 1G17A 1USGA 1OLXB 3INRA 5K1ZA 2PUCA 5L3VA 3OBBA 3C6ZA 3ZXYA 2MNGA 4L95C 4YYOA 2YGMA 3GB9A 5JIUA 4YGEA 3NTOA 3K16A 5IMSA 1FA9A 4NYMQ 2AKYA 3LK7A 2HA4A 2GPYA 3WD5A 4NWWA 1EK6A 4L5IA 1JEAA 4XIIA 2ZCUA 4LKSA 4MQEB 4HADA 4UVIA 4EGSA 4EWDA 2P17A 4KR9A 3OOHA 3N75A 3A06A 2OT3B 5JHHB 4LO4B 2ACKA 2Q2NA 3JQGB 1BVRA 1EVKA 2ZGSA 1NMSA 5KX5B 4TSRA 1PTKA 2VW0A 3P2JA 2HPZA 5CFDB 4PLZA 3EMVA 1ICIA 1JOJA 2QRMA 2HWC3 4XYEA 4KO3S 3CUTA 5KBYA 5LQMA 1WXDA 2EU8A 1O0BA 3U39A 5CA6A 2RHHA 3RARA 4RVHA 5KQLA 3PGJA 4AG6A 1WQ4A 1RYBA 4EY7A 3GWZA 2HSWA 4QG7A 1SLCA 2ZUDA 2WNUB 3C6MA 4X7PA 3D0RA 4MARA 2EYQA 4Q4X1 4RR3B 2BU9A 5CA1A 2Z04A 1E63A 1N1EA 3IO3A 5EP9A 2DAPA 3CLKA 4HLDA 1O95C 4QDZA 4PC2A 2W93A 1FPN2 2QYHA 1Y80A 2O50A 1I36A 4PCLA 2AC4A 1ETUA 2PLAA 1ML4A 4MEBA 3JQ9C 5JO9A 5JJCA 3GRVA 1C8BA 3ROUA 1BDJA 4XGKA 2IVIB 1GLGA 5D21A 1AYM2 4QQKA 4U7TB 4KWJA 1TU0A 3NP9A 5JR7B 3O8BA 3OPYA 2JFNA 1SBQA 2II6A 1G41A 2DHQA 1GUYA 2H6CA 4XIYA 4PX3A 1YXWA 4DXDA 1YQ9A 4KGVA 4O4HF 4D4LA 3GFSA 4ATEA 3VZCA 3FFWA 1QRDA 4YZ4A 3OOWA 2ZSIA 2WLSA 5HCIA 4DKXA 3RV3A 1W6OA 3MHZA 1OWOA 3FMGA 1H2RS 3WHLA 3DC7A 2D5FA 3FDJA 3A27A 3TOZA 4CKCA 3DZGA 5G3ZA 1L7NA 3A1CA 1USIA 4GF5A 3L82B 4W5RA 4XJAA 2ZGNA 3KQRA 2D6KA 5AK3A 4N5IX 1YJ8A 4W7SA 5KC5A 1DJMA 4CM8B 1GL3A 4MRSA 3OJCA 3L46A 2IPOA 5ANNA 8AT1A 1YCHA 3T4HB 2Z0MA 4L9SA 5CVUA 5FQOA 2O48X 2E48A 3WRYA 1TJ3A 2RS12 5D87A 2VO5A 2F3QA 2NZ9A 2OMEA 1PGW1 3LFIA 4WM7B 4WERA 3FUTA 1FJ2A 3RASA 3CT6A 3PNOA 2I4TA 3LOBA 1SKUA 3CWQA 3UL2A 2ZR9A 1XTZA 1QIIA 4HY3A 5BNPA 1HC7A 1YI1A 4DZGA 3CUKA 2KQUA 4BPRA 4RKFA 1ZM1A 5A4AA 2RI6A 4Q3EA 2QGNA 4HUQA 4LGMA 1I3HA 3AU8A 1PO12 2HWF3 5IVYA 3QMWA 5CDYA 4TL7A 1CUGA 3C7OA 1JQEA 2YBSA 4WASA 2XE6A 4WKPA 1GAXA 1WXGA 4WBNB 2CN1A 3NOXA 2VUCA 4OLLA 5BW5A 1EZ1A 1AYM3 3B85A 1MZFA 4MW6A 5AK0A 1AXKA 4YAUA 3DOIA 1KXJA 4I0WB 3ZYCA 2XLGA 2WPDD 1OWNA 4IV1B 1YB5A 3FI9A 5CYGA 1VQ1A 1BW9B 3PBKA 5FZMA 2Y99A 1O7FA 3VKFC 2I22A 3Q8WA 2RGCA 4E03A 1OKKA 4F11A 5LNK6 4E7OA 2PT5A 1URPA 3GALA 4HLNA 3DV8A 1THGA 3VBFA 2GNPA 1FUIA 2CHVA 4XJ9A 4MJLA 1V1MB 3WBJA 1XC6A 2R7KA 4HT3B 5K0SA 1Q0QA 4WLEA 2O06A 3TM4A 4ZT3A 5A3MA 4AYUA 2F43B 1W8HA 2JECA 3I54A 5AOCA 2REOA 2HO5A 2PL1A 1OZAA 5IHPA 3IPCA 1KD7A 3C7FA 3HDTA 1CQPA 1HEIA 2VYFA 2Z9CA 3VX4A 4MUIA 4OFBA 4I4TB 4LJLA 1GTJ1 2WQZA 4KH0A 5FPVA 3FWZA 3WO1A 4CR7A 3TLYA 4IQFA 5L9AA 3Q2IA 3U44B 3GLGE 4Q7JB 1DLLA 1GCUA 3LQFA 1L7MA 2PZBA 2IYWA 1W93A 3THOA 1J56A 2X41A 2I1QA 1LLQA 2R62A 4DC9A 3HBJA 2PEYA 2PKYX 3I59B 2B8NA 1A95A 4DIQA 1G8FA 2ZE6A 1R0WA 5L95A 1G9DA 5BN5B 1TT5A 3FZEA 2CBZA 3MS4A 5IK2D 1XHEA 2CV6A 5C3RA 5FA6A 1T8WA 1F2TB 4YMGA 5J4VA 1G7CA 5DMHA 2EX0A 3IJRA 5B6JA 5IXYA 2H1VA 4LTAA 3WNXA 1SPPA 4QSMA 3BB3A 2FLVA 1YR9A 2XVGA 4AVCA 2HD4A 1X1EA 4P22A 1JVSA 1RPNA 4M99A 5JCZA 3D8UA 3HEMA 2ID9A 5TVKA 2XNDA 4DEVA 2W91A 2QRVA 1XG5A 2V54A 4DDMA 3RHFA 4ODIA 4B8YA 1PE0A 5FWNA 3CH7A 4YACA 3ACHA 2VH2A 2VATA 3N2GA 2VPTA 2OQVA 2ET1A 3P5SA 3POYA 5T50A 2DB3A 1X92A 1D4VB 4DNYA 3FSJX 5AJHA 4DLBA 1CQIB 4M53A 3BKWA 3ESXA 3ANMA 2VG9A 1G6KA 4BV2A 3TVTA 2O2XA 3WP3A 1OBNA 5COBA 4EFDA 1ZEJA 4FI3F 3OLQA 4ZO6A 5A05A 3SHRA 4DLVA 1W8ZA 1AY0A 1H4VB 1EFKA 3ETHA 5EWJA 4FE3A 3NAPB 2FBEA 2XNKA 3OBAA 4G8DA 2BTQB 1T0BA 3L7KA 3RSFA 1QP4A 3C7TA 1D8AA 1FYFA 4CDQC 1D2AA 2G9ZA 1HQCA 4I7EA 1RI3A 4KBBA 2XEDA 2ZVJA 3AKDA 4R1PA 1N6NA 3FYUA 4IL7A 3E1KA 2VZQA 3H86A 3UPTA 1OZHA 5JU6A 3PG5A 3Q6IA 4ZGWA 4FMDF 3ZYGA 4CPBD 5L36A 3W1VA 4I50A 1WUVA 2QQPA 1W5SA 2OM6A 2YHBA 2J9ZB 3EH2A 3KOZA 3PEUA 4F6LA 4GS5A 5APAA 5IUJC 4M0LA 4RDIA 3HXQA 1HQLA 4ITVA 3W59A 1J2JA 5C9AB 5DB4A 3LUHA 1RYYA 5FOSA 2WNVC 2GZDA 2JWPA 3QBEA 5JMOA 1VZ2A 3BUSA 1A9PA 1P2VA 2XH8A 1K9VF 5C5TA 2PKEA 1IEWA 5AJTA 2EIDA 5GM0A 5DTEA 3IDCB 2R00C 3D4LA 1CN1A 2PQQA 3F5DA 2ES3A 2PHZA 4PGMA 2Q9UA 3M0EA 1R5JA 2O1QA 4MV5A 4DXRA 3U5ZB 3ZX5A 4P7FA 1T4DA 4G9SB 1EGAA 3DYBA 5BPXA 4F3CA 2HU7A 5LA6A 2TNFA 1IJKA 4YJ3B 4Q03A 4BO5A 4A4DA 2XODA 4I81A 1B6RA 4YMSA 3JX9A 3VZKA 4QULA 4OLAA 1U7OA 3ER8A 3RJMA 1RYFA 5A9SA 5JRDS 1T8YA 4GX0A 3WO0A 4HVAA 2EZ9A 3KPVA 1UBFA 1OFGA 3FVVA 5J2UF 1RMYA 5CT4A 2WSSA 4QOFA 4RA9A 3N3AC 3D59A 4BNLA 1M5UA 2IXEA 2UXBB 3SXJA 1GXSA 3KVOA 4II7A 3IP7A 3UUFA 2EKZA 3MPUA 3I2OA 3AJZA 5JJKA 5BV2P 3GQBB 4BK4A 4GVXA 4RGVA 3EFHA 4CCKA 1YRLA 2RONA 2G70A 3RVQA 2YC2A 4JYZA 2W2XA 3LCPA 2RBKA 4RN5A 3T1NA 4XQ4A 2QQWA 5DHAA 3I4FA 4OA5A 1E0KA 3ELDA 4KXUA 4ZGBA 1JSRA 4JWKA 2V65A 2G83A 4EROA 3HZRA 1FLVA 1BVP1 5DDIP 3OG9A 1DAIA 4C01A 2A6PA 1ZLXA 3WNOA 1U2TA 5EYYA 1Q7BA 4ZREA 3GPCA 3B9RA 1UMHA 5D3KA 3X44A 3WWCA 3VL9A 4RVUA 2IXIA 1Y9DA 3UW1A 3WGQA 1BMFA 2PO5A 5CVEA 4INOA 2CHEA 5I4IA 5ALXA 3ETLA 4M8IA 3KR2A 3I9V1 4LQ4A 3B8EA 4YCDA 3CDZB 1GLNA 5DNEA 2QVGA 3S27A 4XDHA 4DW8A 3DV2A 3NJ4A 1DTWA 1H1IA 4KBGA 1O2DA 1UPTA 5LQNA 3AVQA 1Z6TA 2D13A 621PA 4Z4EA 4NBLA 1M6HA 5ARDA 2B94A 2R8BA 2ZYHA 1WDTA 4ARYA 4LFBB 3AJRA 1ONPA 3TAYA 5BNQA 4K9LA 2QTTA 1VBC1 3CG4A 3MJCA 4COYA 3I8OA 2PAMA 3TEMA 3ETEA 3PA8A 5TRTA 2ZWOA 1TAQA 4TV8A 1L2TA 2XXAB 5IN4A 1U2SA 1RWOA 1DCSA 1WCDJ 2ZM6B 1VRBA 2IXDA 3QXHA 1IOVA 4PZLA 2Y27A 2PZFA 4M83A 4BO7A 4RHTA 3SR3A 1WCWA 3A4TA 4RHV3 3KPWA 2R6JA 4S35A 4J4TA 4DDKA 1EFDN 2YYAA 2ARAA 1LJUA 3AZWA 2JIZA 1W5BA 3TZEA 5EE0A 4LRXA 3D6TB 2VRCA 4RD2A 1W88A 3SP1A 3NH9A 1HX7A 4CUZA 3OOEA 4KQ7A 1AS0A 2QQMA 4NJOA 3BCWA 2KXLA 5CA0F 1HL7A 3MUFA 2JH9A 4F3NA 4TTTS 1Q1NA 1W6OB 1U2PA 2ZI3A 3PI7A 5IVKA 4EPWA 1ZVVA 3M49A 1EV11 1ZZBA 1E79D 2P0YA 1KFXL 3LSDA 2IYYA 3BBLA 3TB0A 1U04A 3OVMA 1LXCA 1P6UA 2ARBA 2GSDA 4JROA 1C3LA 1YO8A 5KI6A 4JP3A 1DCTA 1OPXA 4FQZA 3WNCA 3QYFA 2UVPB 5IRCD 2DFDA 2P40A 3JQQA 2W71A 2GNDA 2BCEA 4EMUA 4NIHA 2BL4A 4JLDA 2XYGA 2ERCA 1G8KA 3NRBA 4HDKA 3NASA 3NHKA 2PRSA 3LRTA 1TJYA 2IVFA 2OFOA 5BNPB 1R6BX 4BKUA 1P6QA 1LPOA 4G5RA 3KF3A 2RHPA 4LHKA 1GAEO 2A3WA 3EC1A 4HATA 4QQOA 1ZVFA 4Y2UA 1XUOA 1E3IA 2XWJI 2FF7A 3TFWA 3WDVA 3LX4A 3P6BA 3DBRB 1L5QA 4QYIA 5HJ7A 4L5JA 5FR3A 1EYBA 3CSUA 1BHGA 5J1XA 1GQYA 4N6GA 4UNRA 3S7ZA 5LY2A 2Y77A 1H2BA 4RGYA 3CJIC 1JQLB 4PS1A 2JDMA 3JXSA 3N6XA 3OF5A 4XYXA 2X0JA 3SC6A 3I7DA 2G80A 2BYVE 4M9ZA 3SVZA 4JP5A 4HJXA 1K5MA 3ZZMA 1CAVA 1C7FA 5FNZA 3FW1A 2IOQA 2QR3A 1I0ZA 3ILXA 1H22A 5CM2Z 3FTEA 2D40A 2VQ6A 3QNUA 1KJIA 1U5CA 2ANCA 3E4CA 2GM4A 2WWHA 2QRGA 2XJ4A 1VE9A 3FMFA 2DQ4A 5AM0A 3VD4A 1OOPA 4Y6RA 1Z25A 5LK5A 4LHXA 4HAXA 4TT3D 3UAYA 2PN1A 4MR8A 3C15C 5KMGA 5EZQA 3D3KA 4E5SA 4Z6KA 3UMCA 3OLCX 1E9VA 1L8LA 1E2UA 1CZOA 1FVOA 1JPNA 2Q1YA 3O31A 2J3QA 2XMBA 5E6HA 4K3UA 2CXQA 2OOSA 3OKAA 3RYIA 2Q8EA 4QU0A 4BC1A 1JYFA 4L4ZA 3H4VA 1QXSA 3H8RA 3VR6D 3JZIA 1E1RD 4JI0B 1B3BA 1B14A 1YE5A 4ZN6A 1ZP6A 1J8DA 1G7SA 4MTCA 4D9HA 1TT5B 2ZI5A 2FGJA 4MQUA 3O1OA 1PX0A 4WZAE 1KMHB 2E26A 3VBHB 4C90A 1JDTA 2IHVA 3CH4B 1R5NA 4M1OA 1SPPB 2VAWA 3FB4A 5EYXA 3M3QA 1LGNA 5FTTC 5F5XA 2IQIA 4XLLA 3RSGA 1MEC1 4KX5A 1PHMA 3PNQA 5ICCA 3AVWA 1IEVA 4UDYX 5IT0A 1ZONA 2QRVB 4IF4A 3NX4A 3L7NA 1V26A 4XA8A 3AI7A 3EF3A 4OQYA 3THWA 1KNXA 1AQNA 5KOHA 3RLFA 4RMGA 1QIMA 1NRIA 2P3OA 5MHTA 3WBKA 3FMPB 3QKRA 3TTYA 2XJQA 4IH1A 5HE9A 3LVRE 2RHCA 2ERXA 3RFTA 1UIJA 4HEA6 3OBRA 3U7FB 2OV2A 1RQPA 1ZHFA 5KU1A 2ZYRA 2I7CA 2DYCA 3SM9A 3TGLA 4LJ7A 3RTEA 3C5EA 4PZCA 4LMRA 4EG5A 4NAHA 2VH9A 5E6UB 1AVTA 2ZLBA 4LXXA 1FV2A 1DKUA 1AUYA 1AC5A 1XZKA 2JASA 1NVFA 3CB4A 4HLUA 3W79A 4RK4A 1T1JA 3GFTA 4G26A 4AXXA 1X94A 3KKOA 4AI6A 4A15A 3L04A 2WAOA 5FPHA 3VO1A 1LV8A 2DJ5A 5FO0A 2BE9A 3QFSA 2JJMA 1NCQC 4ZTZB 4Q0QA 3STWA 4GH4B 4WGFA 2I67A 3JATB 1FFAA 4OQMA 2C7PA 4PZYA 3TW8A 4I50B 1E0SA 3TI7A 2DWUA 1F4PA 2PHDA 4HXFB 1U90A 1VSQA 5E89A 3OFSA 2EOAA 4MW0A 4I1YA 3SCGA 2BMDA 1Z88A 4E2YA 4HNAA 4KAAA 4F06A 4UPEA 4PHGA 2YVKA 1RYHA 4NMWA 4ZJUA 1AKRA 4RV5A 4INJA 1QXJA 5A5VA 1ZIOA 3GEPA 3TCKA 3UANA 2QD3A 4ITCA 4BYMA 1NPTO 5EIHA 4GALA 3ANTA 1KS2A 3ME5A 3Q7EA 5PNTA 1SCQA 2Y1GA 3W2FA 3H8SA 3LPFA 2RDRA 4DV5B 4ASKA 2Q5CA 4ONUA 4Z3DA 3U9LA 1UQXA 3LIHA 4NIIA 5DGHA 5H7XA 2JDZA 2REBA 2R1VA 3FJOA 3GUZA 3GOHA 5DUUA 3M2TA 2XLCA 1NR5A 3STXA 3U78A 4J49A 1G16A 4CL2A 2Q1XA 5A9SB 2CDBA 5JCOA 2GZWA 4QODA 4YV7A 4DPLA 1GQQA 2PT7A 3VPFA 4XOGA 2NO5A 4Q4AA 2UY8A 3EZ7A 2VA9A 3R6DA 1XPWA 4C2UA 1KJNA 5L6MB 1QYIA 3ML1A 4IEVA 1XN1A 1XGKA 4MR9B 5F1OA 1U9ZA 2GK3A 5I9TA 2GYUA 4A6SA 2PJZA 2H9AA 1H1TA 2QB5A 4BQYA 2Z5FA 5ESRA 4P1ZA 4LWOA 4DSUA 4BMBA 4ZANA 5LQDA 4BLWA 2KI5A 1FFXA 4P34A 2PMKA 1P7VA 3OI7A 5AXBA 1YXMA 4G4GA 4ZU3A 3WA6A 5HRAA 1O6ZA 3ASYA 3KQMA 1RJ9A 4QUBA 1CNMA 2AUTA 1RUJ1 4G5GA 4HXCA 5K99A 1U3FA 1YQ5A 1A8QA 5LBTA 5IFLA 5BNFA 2CAUA 4RDCA 1K88A 5G1NA 5K4LA 1AL0G 5KREA 4IMRA 5AC91 1ULUA 1X8LA 5ALGA 2AJLI 5F33A 2O7QA 4IE6A 1VSVA 3WLMA 1HKHA 3NWOA 1W4AA 3SKYA 2O23A 1P39A 5GONF 1RBZA 2F9LA 5IT6A 4BLPA 1G3UA 2WJYA 1J2TA 2WVJA 4CTKA 2C9ZA 3KHCA 2A92A 5AM2A 4Q3OA 4MITA 4BNHA 5JXJA 3LO5A 4RZ3A 2X05A 3DM9B 2PMDA 4RIIA 3ROFA 4HN0A 3WLQA 2O07A 3EW9A 1R4NB 3AL0C 4HL6A 2Q4TA 4ZAYA 4IP0A 2YXLA 3HFJA 5F7JA 1YQTA 4YRSA 4ZALA 2PGJA 2PBRA 4EY3A 2V8BA 1UBLS 5C8YA 1QIKA 3HFGA 2BISA 1P9RA 1TAUA 2IP1A 2PYDA 1YCIA 1I1HA 1DV2A 3ENKA 1AH2A 4HX9A 4TV8B 4E4RA 3I9V6 2BFBB 4YRFA 4B3JA 1DKPA 1GDTA 2FGKA 4N49A 4ZZ5A 3ZZUA 4MVWA 2CBGA 4R2MA 1TFUA 2FSPA 3R8XA 2AH2A 1J5PA 1ZREA 4UM8B 4BVHA 1P9NA 4WOBA 4KZKA 2ZX2A 4JQTA 3PQEA 3NDRA 9GPBA 3BALA 1Q50A 4JFRA 4P53A 3BSYA 4FYHA 1Q2XA 3TF5A 1U5AA 2H11A 4G1FA 2OAGA 3AYZB 2M2IA 3CL1A 3TR5A 2W7TA 4F45A 5EJ6A 2X77A 3BCRA 3R3UA 1HTWA 4UCXA 3LCJA 1HFKA 4XB1A 4H1TA 3NFYA 1PCXA 2SBTA 1ZSNA 2J0SA 3HVKA 4JGYA 5H3HA 2W6QA 3HK2A 1Z0AA 1VG0B 4GBMA 4Y7CA 3TJMA 3D0OA 4W4ZA 4D5GA 2XNSA 3Q7RA 5I8TA 4ZRDA 3EXIA 1HXS2 2HC9A 3MJEA 2P7HA 5D8AA 1V3UA 4ERNA 2ZVDA 5B58C 1KK2A 3K1AA 4A4AA 2ZRDA 3T3IA 3VSBA 4NHXA 5HPYB 4UJ3A 5L45A 2PJDA 1OAKA 4I36A 3JALA 2NNWB 2PLV1 2PHUA 1BCSB 3VJRA 4RVCA 1L4KA 4GZMA 5HJEA 1P0PA 1K75A 2I2WA 5BQ3A 1JODA 1P3JA 5EPUA 4WN9B 1WL8A 2IEZA 4RENA 3L2HA 3AL5A 1S9DA 4DWVA 4UVEA 4IIEA 4AW9A 5J2TF 5BSHA 1GP2A 4M3CA 4UBNA 1MS8A 3HYCA 1H4HA 4WY2A 3PHJA 4BP1A 2WU4A 4BZQA 2LWIA 3Q8MA 1QE3A 3FBGA 2CD9A 3DPRB 2DULA 4Q93A 5IK4A 1NFFA 1EUTA 3USZA 1FDIA 3HJRA 4YM3A 2CHQA 1FMCA 4JJGA 5JMCA 1POWA 1YHNA 2VPPA 1ULDA 3N5CA 2CW5A 1CP3A 4V02A 2QN7A 4BQ1A 2BH9A 3P0HA 5E7IA 3IDEA 3O4VA 5TPWB 1Y4WA 4KXQA 2LKDA 3NHMA 1KDMA 1HQNA 3QWAA 3ZYZA 3AZQA 3K8ZA 5JFTA 4EELA 4HFSA 3MVEA 1CZRA 1DELA 2HPAA 1LBEA 3Q2KA 4KWLA 1OOPB 2ZQ5A 1P0IA 2QMEA 1PM7A 2HN9A 2G19A 2ZXFA 3FH0A 1S2NA 1ULBA 1QTIA 3ZR5A 5HZHA 3B89A 2DETA 5CVTA 1W0OA 3RU3A 3CVJA 3S2UA 1NSYA 2DVFA 2V4ZA 3DYIA 2B8MA 2VHZA 3JZAA 3L8MA 1MS5A 4A92A 4Z7JA 3DCJA 3FLRA 2QP9X 1RL3A 4QFDA 1YFXA 1D3AA 2GFIA 3HXOA 2QQLA 2PWZA 4K6GA 2XBUA 1WD5A 3GJ3A 4TM7A 3TZLA 3KE9A 4LDJA 1OGJA 1GGNA 2AJ8A 2B8WA 3LP8A 2PLRA 1QE0A 1KO8A 2C2XA 3HOBA 1JZ2A 1HORA 3BWDD 1C29B 4TMXA 2VWPA 3OIFA 2R7NA 4B7ZA 3D43A 2WR8A 3UG6A 1C4OA 3T9CA 5EHNA 4FGJA 3KQWA 2OR3A 1V8PA 5FBWB 3G9UA 1WUYA 5JD5A 1N2ZA 4H08A 1L4EA 5GZ1A 2WQ8A 4ND6A 3DDUA 3L07A 1I10A 1RLUA 2AXPA 1YSCA 3N8KA 2K7FA 3PX3A 4LG1A 3UKVA 3ADDA 3ZW7A 3ZXDA 1ZZ8A 2CXXA 4JLAA 5BXYA 1GYRA 5KOHB 3RRJA 1XQWA 5DNDA 2A9FA 2IVZA 2CNNA 3TYXA 2XYRA 5AVKA 4EYQA 4LKEA 2HCFA 2XH6A 2Y38A 2YIJA 1OH5A 2JZOA 3KOMA 2BR5A 3DW3X 2NQ2C 7REQB 2X0EA 1C80A 5LDHA 1VBA2 1OTXA 3K0AA 5BUVA 5ICSA 4ZT2A 3WYBA 1T2UA 3PDWA 4EHLA 1LESA 1IS4A 1H0KA 2BZSA 4CFSA 5F98A 1B7GO 4IEZA 3WLAA 3AOEC 4DLLA 3N9QA 1AIPA 1UJ2A 3DEHA 3AIKA 1HB3A 3I8TA 1ND3C 3AKRA 4WADA 4F93B 2PX2A 1QC5A 5E9JA 2VBPA 3CZQA 1MOQA 5DLPA 1HDZA 2O5RA 1BN7A 4DN6A 2AH5A 3BODA 4PIYA 2FZKA 4YT8A 4G0VA 2NLOA 4R5MA 4NI5A 4NX2A 3C8XA 4K81B 3N3HA 3N58A 4MQBA 4OKSA 3AKZA 1W3XA 3ES9A 1OLXA 4L0DA 3I97A 2G7MC 3HYLA 3Q9OA 4P9XA 1P77A 4KTVE 1WS6A 4OVKA 4AS2A 3WG2A 3O1RA 3AIMA 4GE3A 3O7OA 2Q28A 3I64A 1OXUA 1T6XA 5EP4A 2VQUA 2VDLB 3DMPA 3IKWA 3KKPA 3UICA 3SI7A 4PLWA 3EZFA 3IELA 4M21A 3NBFA 1LPBB 1J06A 4DDUA 3EOBI 2XCIA 5LBFA 3VR0A 2YWJA 5HFNA 2D74A 4MGKR 4B84A 2VN8A 4MQEA 2AN9A 4DLZA 4KXYA 1K86A 5F7OA 2PXJA 3MD0A 4BNJA 5C1DA 2R86A 2QUIA 4KQIA 3JQGA 3VHLB 1C0KA 1E5SA 1E66A 3OZTA 1NGSA 2WSBA 5BWMA 1C9NA 3OSZA 4MAFA 4U7GA 5KX5A 4W5OA 4FVVA 1CFJA 5CFDA 3IPVB 3TWOA 1K8YB 2R071 3PHCA 1YS6A 3HKDB 1MEEA 3TEWA 1DADA 4RPCA 1SHJA 1VKRA 3ZDVA 3EISA 1PJ2A 2GO7A 4CP0A 1E7YA 1F6DA 2MJLA 4L51A 1W59A 3EF0A 2CE7A 3CR3C 3T54A 3GP5A 4FCTA 3RV4A 3O75A 1KPHA 3TOCA 3WMRA 2WNUA 2JFXA 2D97A 2B61A 3CZJA 3FKSD 1P31A 4RR3A 1RZRD 1KO7A 5K8TA 1A9QA 4RQPB 3R4DB 3PC6A 4B3IA 1ZH8A 3LF1A 5BNZA 1BS1A 3NAMA 2A4MA 3F6CA 2WZEA 3UYLA 3JPWA 3FNGA 3WHPA 3OO1A 2OFFA 5CH3A 4HLCA 1NR7A 1ZZGA 3BJEA 5EVJA 3KZNA 4MHSA 4TXNA 5F9FA 3HY4A 1IHPA 2EW1A 4FPCA 2I4OA 2J4DA 3LXMA 2Z6AA 2YC4C 1FTNA 4UAGA 5IG2A 1X8KA 2XWSA 1TCCA 3DKIA 4F2DA 2PTGA 5IUKC 2GB4A 4JKLA 4BRZA 2ZU0C 3P2EA 3O2QB 4J0DA 4M1TA 1RCTE 1ESEA 4HGOA 4O4IF 3S8MA 1LZLA 3C6QA 3HGTA 4J94A 4CFZA 5A6QA 4EGJA 4KK3A 1C50A 3RUFA 4CM8A 1N1YA 1NJ5A 1BG6A 2GC2A 4RDHA 2DVBA 2AREA 3O1HB 1HDGO 3S2YA 2AC7A 1KA9H 2P77A 2AN5A 3FSGA 2OZVA 4JGGA 1LOFC 1F4AA 5JAZA 4Y1VA 3HJHA 3AFHA 5BVHB 1I80A 4WM7A 2G09A 1JUHA 5ALLA 5TDHA 1NJ8A 3JD0A 3QMVA 5AHOA 4DILA 4YX9A 3SVTA 1TCBA 2MR6A 5BV7A 1U6IA 2CBXA 4W5NA 2QAGB 2Q1TA 3KKLA 5ITVA 2ZEZA 3EPPA 1F5NA 4CDUA 3C74A 1K5GA 5F3EA 1GNSA 2BWAA 1QHNA 5LL6P 4KI5M 1K1EA 2QE3A 1T8SA 3ICPA 3DCQA 1FTGA 5CB0A 3EGOA 4ZVUA 3UWOA 3TBDA 3K8QA 4UBOA 4OA8A 1F2DA 2IK8A 1GLHA 4YRIA 4WBNA 4AL4A 4UTNA 1JIIA 1NKTA 1PBNA 1KOGA 2YMQA 3ZI4A 2VSQA 4BMYA 1RUF3 1QIFA 4Q7MB 5CD1A 3E3NA 4NOJA 4IV1A 2BV4A 5T7BA 3KJXA 3DZCA 1CZTA 3OJXA 2V7UA 1BW9A 4FZ5A 4H0NA 3NIGB 1E5VA 4BP9A 2E85A 4MIKA 5JANA 3P52A 1R5OA 3DE7X 3KV6A 2Q4BA 4X61A 1XTVA 5B1EA 4F92B 4KQMA 4CF4A 1M34E 4BIFA 2FEOA 1NBEA 3BYWA 3V1KA 4BX3A 1FJXA 1DX6A 1V1MA 3RAGA 1RR6A 2DWQA 4DADA 2QQKA 3MPPG 3BTXA 2W43A 4KQKA 2G5TA 4FGUA 2F43A 2E1RA 5FDBA 3WOHA 3L7MA 3WGKA 3W58A 1O3QA 1AK1A 5FNVB 5BXQC 5J3JA 3Q85A 4GGMX 3DOEA 1LBTA 3QMPA 5ALRA 4I4TA 3JALB 1YB6A 2FHSA 4HP8A 1T1RA 3U44A 3C7DB 4P3XA 2QOEA 4NCAA 3ABOB 1ILEA 1BA2A 5DGXA 1NUAA 3G68A 2HU8A 2DJIA 1KDTA 2VCHA 3A1UA 1B09A 5J58A 1QQBA 5FY7A 2RGRA 3NB0A 3BMCB 1OFNA 2ZBQA 1E4VA 5I0RA 2D00A 2H2GA 2Q3LA 4ZQEA 4DXHA 4BVEA 5BN5A 2F7SA 3A6GA 1K6MA 4IFBA 1MA3A 1HE8B 1F2TA 1DB3A 4E2ZA 2RGYA 2FPOA 1IZ7A 3QWBA 4GKKB 4DVGA 5HA5A 3JWJA 4B85A 3BWBA 4WVZA 4ZO8A 2Y6KA 2BGNA 3CJQA 4DB2A 1POV3 2Q6LA 3DL3A 3W05A 1OLMA 4J7AA 1SLAA 3JXEA 1LUAA 1NU6A 1R0CA 1QO0A 4AF6A 3GNLA 3R5KA 4WM8C 5HPOA 2OZPA 1O59A 5EJ2A 2QPAA 4EN0A 3APBA 2WYUA 2PS3A 1CQIA 3KXDA 2VJNA 4E5MA 1DRUA 1ZI8A 4LO7A 3HNMA 4CQMD 3MTIA 2HLPA 2PBLA 1RAHA 2HHAA 3QPWA 3VR4H 4INZA 2VDWB 3A4LA 2GA9A 4V1CB 3NAPA 1X9TA 3PEWA 5T8KC 3S81A 2BTQA 3BHJA 5L19A 3PVCA 4M87A 4ALJA 3B9BA 1UMBB 4L3WA 4B29A 1GPWB 3CLUC 5F2SA 1DXYA 2HMAA 3PRHA 2QTCA 4IV3C 1NXWA 5F23A 2OE2A 3QQPA 1FDWA 2I2DA 3W6NA 1MIHA 4GLBA 4IX1A 3OE1A 4ET7A 2PMWB 4AZWA 2CUZA 5EJEA 2OUKA 2CVPA 4BNWA 3UHAA 5K5EA 1HE1C 2GTIA 3EVGA 3MW2A 4P0PB 1KJJA 5I7OA 1RDFA 4BC0A 2ZRPA 1Q0RA 3UWPA 3WQSB 5JNLA 4IO0A 2OZEA 5MGBA 2C4WA 4ESHA 4FFOA 5KNCA 1JHPA 3ECSA 5AVOA 4JKMA 5CIQA 4KB5A 4XE5A 4RH1A 5CX4A 4NMIA 4D3SA 1E5TA 1YONA 2PKRA 5EQUA 3PDQA 2DV9A 4GPD1 1CUSA 3K5PA 5EQJB 2F8MA 2JD9A 5AJYA 3AKEA 5GOTA 3PHMA 4P58A 3PLQA 3A7EA 2X4LA 5BYJA 3LD8A 1QYXA 3CLTD 2WJWA 2BBWA 4N1AA 2CL6X 1XPRA 3AVVA 2GSYA 2ZPXA 1GZVA 2NV2B 5L3RA 1PX3A 1FE8A 4G9GA 4JB2A 4CDXC 4FFGA 1BX3A 4IIJB 3OA2A 4YJ3A 4ZVPA 2FG7C 3MJFA 4QEDA 4HUTA 2C94A 2IFTA 2P30A 1RUG1 3KO8A 4GB32 1ZD1A 2H4HA 3K0AB 1GG9A 2R8YA 4RMHA 3A9CA 4EB6B 4FOSA 1ECCA 3MIEA 4OHFA 2AOXA 5IC5A 4EM6A 3ETPA 1Z4IA 1JAZA 2OHVA 1C9EA 2DCYA 1E2NA 1UL9A 3B1XA 1G291 1V35A 1VP9A 3LPAA 4ZOQI 2GMWA 1BS9A 3ILFA 3U49A 5CK5A 3LWBA 4RKRA 3N7KA 3HUFA 1KQNA 2O14A 5TS3A 2DXIA 1XCOA 1JYCA 3VYSB 2W1SA 3QPBA 4DYHA 4MVJA 4N41A 2WWRA 3EPLA 1P75A 2QKYA 3IQEA 3OH8A 3P32A 2XWPA 3NC0C 3UWMA 1U9CA 5DTIA 3C3DA 2VCMA 2SICE 5IDVA 2F55A 2VJCA 1HM5A 3RK0A 1I7DA 4DLPA 4PCUA 4YGBA 4UDOA 2Q6VA 3RRDA 4IJKA 3A26A 4V0MA 3HB7A 2PUHA 1T43A 2HSEA 4DY4A 5KAMA 3AHIA 2QNIA 1WVIA 5A1TA 2JLCA 3QHPA 3GGPA 4F8YA 1Z6ZA 4HD8A 1WF3A 4PQ9A 4PWZA 3WLRA 5C6CA 1DWUA 2IZOA 1NE6A 3N8NA 4ZQFA 4B40A 1KTVA 1SRRA 3DZFA 1T8PA 2I2CA 4HUJA 2OBXA 3NXKA 2O6LA 3GUVA 1RUE2 1N7HA 1YYNA 4X3PA 5FY9A 5FPXA 3KAPA 1B8VA 4L92A 4LIUA 2FZGA 1XVAA 1D7AA 3LSYA 4XM1A 5B64A 1QNFA 1CUZA 2IHBA 2N0SA 1E89A 4G8BA 4QXPA 4KWTA 1U0AA 4N6NA 5ALQA 1LLCA 4GE0A 2IC1A 1RD4A 3D81A 1KIAA 4R1MA 4C1BA 3VR5A 5J23A 1GOTA 1UZAA 1NVUQ 3AUKA 3NIDB 2XXAA 2H17A 4LC1A 2D0IA 3R77A 2X5XA 1JYSA 1HRI2 3NCTA 1TNDA 1MQTB 4YAWA 2QT9A 1K3UB 4M6WA 5LRSA 5FAXA 1W4CA 4RZSA 3VSEA 1OBHA 4XM0A 2BQPA 2ZBUA 1E99A 2RFLA 3PD7A 4P3NA 5GLTA 3C1TA 4MA4A 3IWZA 1F6WA 4WCVA 2X2EA 3T7EA 3H16A 4O4JB 2BEUB 4CZ2A 1KFEB 3SD7A 4DLSA 4ZI5A 3Q98A 5M04A 1P0MA 4XX1A 2CJYA 1US2A 4KTTE 1XU7A 3VDQA 4II3A 3TNQA 1UIRA 2PS9A 1USVA 4PGHA 1H0RA 2EFJA 3UA4A 3G0BA 1N32B 4FGSA 2WQ6A 3HJFA 1PL8A 1YQCA 1U80A 4G1EB 2IZWA 3LOUA 5FO7B 4CP2A 3TFOA 5DK4A 1FXUA 2JFVA 2D43A 4XZ3A 1JFTA 3NRUA 2UVPA 3D6AA 4JU9A 2H1FA 1E3TA 4RVDA 1WB6A 1SMVA 1TA4A 2C2KA 1FNSA 4RF5A 4IDGA 2BYTA 2ZTSA 4ALLA 3L9XA 3F7MA 3PNLA 4OQZA 3R7DA 1F20A 4JC8A 3L1HA 3DNMA 1N0WA 3T0DA 2P9HA 4E3ZA 4YW6A 3VA7A 3FWYA 2W2MA 4ZV7A 1JIVA 4CDUB 3JD72 4NATA 2P65A 3W5HA 3MWKA 1R50A 2AD1A 2Z2JA 1LS1A 5LA9A 3B1KA 1FFYA 3H3ZA 1FPN3 3OIYA 1J0XO 1JHDA 2V09A 4IIUA 3DBRA 4MIEA 3ECAA 1UFOA 2IP4A 1AJOA 2AFIB 3KB8A 4WK2B 3WW1A 3BIWE 3CJXA 6ADHA 1X8XA 1CR2A 1RRMA 4MPPA 3DEIA 1X2EA 3MIZA 4WNAB 4D9BA 3WNBA 5KTNA 5AK4A 3H9CA 2Q9BA 3EUFA 4QTXA 3V8PA 5DNAA 2X76A 4PXAA 3OURA 4CE8A 1O4TA 4Q9IA 3RC1A 2V0CA 4YJFB 4R8KA 3RAPR 1A8DA 1S4QA 3DUWA 4P08A 4OYLA 1OYYA 5A4FS 2G0NA 4FDVA 4OV6B 4N90A 4EJRA 3NHRA 5AKXA 3K9FC 4QQPA 2Q3MA 1X7WA 4F84A 2GAFA 2SLIA 1PJBA 2AX4A 5JPIA 4QPGB 2XL7A 3SMVA 5KU7A 4N3AA 2FDXA 4BH9A 1R0YA 4YAOA 2RS13 2YG0A 1YLLA 1AHNA 2YIVX 4MW2A 1NVGA 1GNVA 5CCXA 1R6XA 3T9BA 2XCLA 4KXMA 1R15A 7ADHA 1LRJA 4JLVA 4UW3A 1C8KA 3DKWA 3HDQA 3AERA 1UQRA 1TZJA 3AF1A 4BQOA 1J8MF 3FUVA 3ZIDA 1KZ7B 3VR3D 2V98A 1PO13 1NQ5A 3EFBA 1YDFA 5IT5A 2YDEA 2FMYA 2GAJA 2BTVC 2ISQA 4Z86A 3HMQA 1OIXA 1GU1A 1X7HA 1XYOA 1GQRA 3BK2A 4IJVA 1XZBA 5ANRB 2X8AA 2WK1A 4Z7QB 1H1LB 4PNPA 4NY1A 4LFCB 2Y0IA 2O5CA 1SLIA 1Q7EA 1KMHA 1EVQA 5LFAA 4WBSA 3VBHA 5H9VA 3K5IA 2ZWMA 1U94A 3EVAA 4HVRA 1TIBA 2A3YA 3NAZA 4K8FA 2QHXA 5TPZD 3IEUA 1Z15A 4XUGB 3NBXX 4Y0NA 4XTPA 3WSTA 2K4MA 3JQ7B 3STYA 1W6UA 3NYWA 2Y6VA 4J0JA 4V3CA 5A6YA 5A0FA 2JARA 4N76A 1LAJA 4W5HA 3KQNA 2GZRA 2QDKA 1PV2A 2B1QA 4DXSA 1GNYA 2ZFUA 3QKIA 3KK0A 4KREA 4ACAA 2OMKA 4GU5A 3M4NA 1ADGA 3GY0A 2HMVA 1M7BA 3Q9LA 4LBOA 5C53B 1FYEA 4AG5A 1E7QA 1E0JA 2ILTA 4YONB 4YASA 1JJFA 3B60A 3LFMA 2Z9BA 2UYGA 4MGIE 5F51A 3V4LA 3VXKA 4W5JA 5E6UA 3PXCX 1X1AA 2Y1WA 1OFIA 5DMYA 1S02A 4XIKA 1GMMA 1PBTA 1LNZA 3ILHA 1E3DA 1QJX2 2EFDB 1ZC3A 4BTLA 4AMVA 2FPGA 4GH4A 3UMMA 3JATA 1GNHA 1WWKA 2GWRA 1WGPA 1G66A 2B1IA 3WBBA 1L9XA 2OV8A 1Z78A 5GJ6A 1WX1A 1Q3KA 2EG9A 2KB0A 3KOWA 1FOD2 3D4BA 3ICCA 5CCEA 1N5DA 4NK4A 5BUZA 1DWOA 3MWFA 3SE7A 2VRBA 3K5HA 4A41A 4PLFA 3G0HA 5IJAA 3OSUA 1AUPA 1YD7A 1IY0A 4IQ0A 1E2EA 1N5LA 1DEOA 3MCVA 4AKTA 3AKYA 2VU9A 4IERA 3T5PA 3N0RA 1HE2A 3RBVA 1F0YA 3MF4A 5EERA 4C3ZA 4OBXA 4ZYXA 3NORA 1BN6A 3WDSA 4LXUA 5I6DA 5JNVA 2Y26A 3MYRA 1T5HX 5L53A 1J9EA 3BA1A 1JTVA 2Z1MA 3D8CA 1DFGA 3I2DA 6ABPA 5A04A 4KNYA 4YS6A 3PIJA 5ICMA 4I5GA 4DEYA 4XYGA 2X4IA 3T2PA 2BFMA 2PZEA 3LP5A 4F5WA 1BIFA 1C1FA 2O8NA 1H8HD 1DL5A 4JAAA 5D5QA 4Q1DA 2JE8A 1Z39A 2GOYA 5FTNA 4MR9A 2D59A 1H2ZA 2HA5A 3VPBA 1NMEA 4Q7EA 2DFPA 4JWTA 5K8LA 5CLQA 5ALVA 3WMGA 4AJ1A 1EX6A 1GPMA 2GN2A 1J1LA 4CL0A 2NT3A 3UNPA 5BV0A 4LSWA 4RY9A 3N2YA 3ZHSA 2RR12 1E32A 1VPEA 2XCTB 1FOD3 4FN5A 3MXOA 2IOFA 3JRNA 2JL1A 5CP8A 3X43A 1WCV1 4BZPA 3H2SA 4L74A 2FHRA 1N92A 5EZYA 3LVBA 2P6UA 4BBJA 1XQNA 4XR9A 1A4XA 2IE0A 5IYZA 2RJNA 5LATA 5IWFA 1H1AA 5BRNA 3QUTA 4Q01A 4G3XA 4W9MC 3BU7A 2QZPA 3KZXA 4Z4QA 3ALQA 1BMDA 1Z13A 1UADA 4BE9A 3D2AA 3HP1A 3OPTA 1QDLB 5DUVA 1VRH2 1I2DA 2J6IA 3NRCA 3S2ZA 1VP6A 3RQIA 1OC4A 1RPAA 1UK9A 1IY9A 2XBLA 1CIJA 3LXUX 4G4IA 5JPNB 5KQSA 1QKQA 2OD9A 4G85A 1WLYA 2R6CA 2IJGX 2PN5A 3IAPA 3FIUA 5KJEA 4MUAA 4F46A 2RD2A 5KWEA 4UEWA 4KVZA 2DT8A 2ZIZA 2BAGA 1GQPA 1R4NA 5HE8A 3UTCA 4BBZA 4LOAA 3E82A 3IUNA 3KUKA 5F3RA 4A26A 3D8NA 1TQ5A 4TSKA 1M2WA 1AR72 2WF8A 1J5XA 3I45A 1UYPA 5IAJA 1D0HA 2MOKA 4L76A 5A7FA 4I8IA 3HWWA 2P9GA 1RMTA 2J1AA 4GZ3A 2HQBA 2F59A 5BOSB 4FPKA 2BFBA 2Q5FA 4LRTB 1T6NA 1VBB1 3SYKA 3ZE0B 1KYZA 1WJGA 4LRSB 1QORA 4M6WB 5DM70 3AFGA 4XTMA 5FXVA 3T08A 4M9QA 2VOTA 1WIWA 2NYVA 5F5CA 3PQ3A 4DCCA 1Q56A 3J7LA 2A9OA 1UZUA 4IHKA 2WPDA 3H3XA 1XTSA 4KDFA 1C1XB 1DEAA 5DGCA 5TT0A 2B99A 1UF2C 1SR8A 2NZVG 5KHLB 3X29B 1EFPB 4RZIA 3G8AA 1T5TA 5GALA 4UMDA 3SIPA 3MHTA 3D3QA 4MUXA 2FXVA 2RS51 4A1OA 1ZS9A 4H7DA 3MTAA 4MB2A 1HYEA 2WTMA 3ZIWA 3WIVA 2JLVA 5BURA 5AHKA 1N6HA 2NM0A 3UMSA 3PNVA 3G85A 3R3JA 3NNNA 4EYSA 4OXKA 2C7GA 4YUZA 2DC1A 4YMWA 4ILKA 3ZWNA 5FWXA 2IZ7A 2VZTA 2EGUA 3U0VA 1NPDA 3FTPA 2CJPA 1BCSA 1Y3IA 3CLVA 1I9GA 1Y8RB 2X4GA 3DXUA 1RYNA 2DCKA 5IEJA 4QX7A 1Z2PX 4WN9A 3WLJA 4QVKA 2HEWF 1GKLA 1DOHA 4H1VA 4Z0TA 1VE6A 2CLFB 1DG3A 5IK2A 4BYGA 2VNRA 4IXTA 4IXLA 1OROA 5L7YA 4R84A 4OLBA 3DPRA 2H1SA 2B9UA 5FZFA 3DFIA 3F74A 1L4YA 3OT1A 3WGLA 1LSOA 3N6VA 1TME1 5IW0A 3AR8A 1LY1A 5A5GA 3OSDA 1ZCFA 4A3ZA 4XMIA 4GQAA 1HRV2 4EWEA 1J2UA 2D0PB 4N9IA 4FQ8A 5TPWA 4CGYA 1R8YA 4C1WA 4U4AA 3QLQA 9MHTA 4O2AF 4QTUB 4S2EA 4GUDA 4ZEMA 4X6LA 1DBWA 1OASA 2HWD1 5JIAA 4J2OA 5BORA 1OFTA 4YNBA 1UCXA 4YUWA 1CJTC 4UBHA 5B3KA 1X7WB 3QY0A 3HIFA 4OYUA 2GN8A 1FUYB 2AZ5A 5JS2A 1UDWA 5EEGA 4CQMB 3A1WA 2CE2X 4KR7A 2PLWA 5LXTF 3DDCA 5EIWA 2Q4SA 1W76A 4AI9A 2PHXA 4QYMA 1EFRD 1EWQA 3MRXA 4YUAA 5H8WA 4D92A 1IJFA 1P73A 3HJGA 4EN6B 2IGBA 1UAIA 1DIHA 2GI4A 1N2SA 4HZIA 1DDOA 3P9ZA 3AERB 2OYCA 1XSRA 2Z42A 1DIAA 5ALYA 4JI4B 1QAMA 4KFUA 4G9EA 2AEFA 3GJXC 1JHYA 1CDDA 2M1ZA 1V9LA 4JOQA 4ITUA 3KPJA 3EIOA 4OU5A 4I14A 5A3OA 4CPBA 1FRVA 4GMP1 3SJBA 5CFCB 2DG2A 13PKA 3WRVA 2I8LA 2GM5A 1XZIA 2KR2A 3PGKA 2XADA 4WEQA 3ZQKA 3G2PA 1BVUA 2EA7A 4DDHA 3TQOA 3KT1A 3ZQ6A 1WUHS 5JFGA 2ZSKA 3O1VA 4OYYA 4N7RA 2ERFA 3AKQA 1XU9A 3EJ6A 1P4RA 3T7DA 5CM8B 3V7WA 2QMUA 1XZCA 4KMQA 3IB6A 1IZYA 3WIDA 2JRCA 3ZWXA 3QFTA 5IFTA 1FEZA 3CRMA 3WGIA 4D25A 2I29A 2H4ZA 1XTIA 2IYTA 1L5OA 2YY7A 4AT1A 1YGYA 2AE2A 1RAAA 1V37A 2I65A 2E33A 1K7YA 4KXWA 1JDBB 3VVLA 4ID3A 3S1SA 2FP3A 2HNAA 1TADA 4BMZA 4CCWA 3FM9A 3D6MA 7REQA 1MS4A 1XNDA 1NZFA 4X7MA 4LORA 2PRYA 3RWBA 5LZ8A 1KFJB 4EYEA 4KITB 1B6SA 5B1YA 2ZHNA 2B0JA 2EWVA 1XLVA 4LZPA 1RWXA 1VLNA 3VBOC 3CU7A 1VIVA 4JR0A 5GQSA 4CP1A 4U39A 2WJZB 2QLNA 1W73A 2O05A 2FPGB 1NLRA 3NKTA 1ESCA 6REQB 3KTAB 2OEPA 3ZY2A 4AL9A 3D7MA 3GDOA 4BMDA 1GG8A 1PGPA 2IOHA 3EZGA 1CX4A 1LQ2A 2J9RA 3U4DA 3WK6A 421PA 4QQHA 2LROA 5FYSA 5DTJA 1I30A 1DCFA 1VKZA 1CUVA 1DU4A 3SBDA 3AHEA 1D0IA 4K1XA 4HETA 4CDWC 3E7DA 2C97A 3AOGA 3O95A 5AI5A 5CG2A 1NZDA 5AOBA 2B37A 4LE0A 1G4UR 5ECGC 3D6FA 4C05A 1A8IA 4PF1A 1G0OA 1WF6A 3G6JB 2R1DA 1GUFA 4GMP0 1SOUA 4NAOA 4JCCA 1ZBA1 3JTEA 1XRRA 5C3QA 3PFFA 1W2TA 3NC1C 5DCYA 1MO4A 4S1VA 4CPDA 3TLEA 2E82A 3UGFA 4RHYA 2COUA 3UBMA 3IPVA 3MT9A 4GMFA 3ZD9A 1NQDA 3N74A 4CTNA 5IUQA 2UUBB 4YECA 3HKDA 4LSGA 3E5UA 2ARCA 4IEWA 1CY1A 2HADA 3A10A 4G4JA 3AVPA 1PHRA 1Q83A 2L82A 2EWMA 5JXHA 3VPGA 1C9JA 2V6FA 1EU1A 1NNUA 4D96A 2NYYA 4WXEA 1SEPA 3BA6A 4PF5A 5D85A 3SVLA 2C2YA 5JTTA 3OZEA 4TVOA 4XFKA 1TUEA 3KYBA 1Z47A 2NO7A 3PLNA 2XR1A 3QVTA 4AFDA 4NWIA 3Q12A 4RQPA 3KU1A 1ZK1A 2PK3A 5GP1A 1CVLA 1GNRA 5FOQA 2FN9A 1CR1A 1VMIA 4XDYA 3NJYA 3CLHA 4B82A 2AG1A 1MZEA 1XDSA 2WAYA 1F12A 4EX6A 1SQ5A 5A02A 1YR8A 4KI0A 4DMKA 1K42A 1JLSA 2DHRA 4TQUS 3OEBA 2DUOA 1H2LA 4XLTA 2XZPA 4L9AA 2D62A 3LUGA 5EZYB 4KMOA 1HTBA 5DBEX 1S9HA 2PANA 1RP1A 5IYZB 1W6RA 1YQ8A 1PZGA 3GJ7A 1ZJ4A 4JBWA 4MWBA 4KXLA 3HXMA 3I53A 5C3SA 3PU8A 1PJ4A 2QS9A 4HWRA 3V3KA 2B3TA 1E79A 1AXRA 5CEFA 1K4KA 3RVLA 3W5DA 1VLVA 4DLWA 2RM22 4QE3A 1WPQA 2IYPA 4XXPA 4EVSA 3TEYA 4OBWA 4AQ7A 3AMPA 4DBZA 2MMCA 3V34A 1GAQA 1G9AA 1BMV2 3EVDA 2K2SA 4LF6B 1SC4A 3AEXA 1L7AA 2CNLA 1Q57A 4D9KA 2QRPA 2RJKA 4PBOA 1BZWA 4QU1A 1WQ1R 5BVHA 1FS4A 2UYOA 2ZYSA 3TL3A 1JG3A 2JICA 3BSWA 3DBOB 4EOGA 2QAGA 5JCTA 3WQRA 3GEGA 4RC9A 1OR8A 1Z4QA 1KOJA 2QL9A 3RWOA 1Z56C 2B4AA 1T2DA 4UD6A 4EVIA 2NT4A 2XQGA 3PPIA 1GGEA 3I3EA 2GLXA 1FMJA 4Z8BA 4IRMA 1CJUC 5IKPA 3AZOA 3O9VA 4KO4S 5FEUA 3UJBA 5DYNA 1UXJA 1ZN9A 2EAUA 3GELA 2ZT6A 1HWYA 1T15A 3Q5GA 2OQ6A 4EEZA 3ZV5A 3SSAA 4HPJB 4Y6QA 1RFLA 2VLBA 1WLTA 4FOVA 2G17A 1W48A 2KBFA 2ZJ8A 3D2BA 2HBTA 3DCNA 2XI4A 4M1QA 3PJRA 2DWCA 2G5CA 1DUIA 1N7JA 3AHCA 2YFQA 2AFHE 2CLLB 2FDRA 5FOVA 1PT8A 3B20A 4N12A 2RM23 4GQIA 4LBJA 1JDSA 5A1AA 1NLFA 1PT7A 4C0HA 1KYWA 4TT3A 4GFDA 4ZCLA 1A77A 4ZWNA 4B34A 4MQLA 4BKOA 1PO7A 1MFPA 3U6BA 4E4ZA 1M76A 3S5UA 5I8SA 4J90A 1SBZA 3IOYA 5FNVA 2PG3A 4QICA 2Z2XA 2FCTA 5FWXB 1DKLA 5IAEA 4Y9DA 4FDMA 2Y0BA 1SUPA 1KEWA 3FUWA 1V43A 4DYDA 4AYWA 3JQFC 1NIPA 2ZS6B 4XH9B 1Q17A 3BXPA 5C81A 1SRQA 1G2IA 1U7TA 3IYLW 2D2VA 2VXJA 4ZVVA 3VR6A 1E1RA 4FPYA 2Z6QA 3DQQA 2FSVA 3BMCA 1QIHA 3L0OA 3AR3A 1C4XA 4KN9S 3DEMA 3CV3A 3BD7A 3KT0A 1WABA 3AB0A 5BV6A 1KBQA 5CFLA 2VXOA 3OT1B 3VAAA 2G5PA 1H2YA 3F6YA 4PQRA 2O20A 2I03A 4M46A 4MLOA 3MT0A 4GP9A 4J1TA 1T34A 3ZWCA 4NDAA 4A23A 1E2QA 1X1CA 1K8QA 2GZ2A 1W05A 3T95A 3DHYA 3TRJA 1DE0A 2BDUA 1CRPA 3R5TA 4EEKA 4JJAA 1MHTA 5FA5A 3N2EA 1WUKS 2GLUA 4ZD6A 2A2ZA 2E4UA 5B57C 1AKMA 4OJNA 2CSGA 1I5OA 3ND7A 3H1YA 3E4DA 1SHWB 1CAUB 1HXS3 1CVNA 2CXSA 4HQ6A 3GRYA 1KDRA 4LLOA 3BJRA 2AYZA 2C98A 2V3CC 1E9FA 5TGTA 3STTA 1EUUA 3K1JA 4JLOA 3LF2A 2XZDA 3IILA 3FZ3A 3R2JA 2W08A 3KZKA 1V1RA 2VDWA 4G01B 1ZGAA 3VYTB 2R6GA 4V1CA 3AZPA 4Q0MA 4OHWA 3BTOA 4C3OB 4MKGA 4WY8A 2OZ6A 3HZZA 1UMBA 3G88A 4C14A 4EFNA 3AI3A 2J7KA 5ICEA 3TAHA 3AP4A 1TVGA 1DQPA 4OXYA 4QQ2A 3IDZA 2QORA 1BA3A 4GT1A 1QCCA 1BHO1 5L8VA 3WTCA 5JNTA 2OCXA 3OLVA 5DLQC 3TOSA 4ZC8A 3ZNPA 4BQQA 4BZWA 3BTZA 1HRDA 1J0DA 1KEXA 4L6AA 5ALHA 1SXJD 1PX2A 5CIRA 5HILA 1ZI6A 4L2NA 2GN9A 4PS0A 5DT9A 1K97A 3P0RA 4B3GA 5SYAA 1FZQA 1TM1E 2ZRGA 4XQDA 1V2GA 5BT9A 3RSZA 1A82A 4BY9E 4MPDA 4MHUA 1KZ9A 1PJTA 3EB7A 3AYEA 4UHBA 3FOWA 1AYN2 2P2GA 2QIPA 4FXKB 4B3SB 3BE6A 1H2MA 2OW4A 5AKYA 5HGXA 3S7TA 1XHLA 5EP1A 1Z0IA 4QDOA 1NXXA 4NMMA 2EVXA 3GBFA 2Q8CA 1V3QE 5EIAA 4RVGA 3ZGZA 1RIRA 3OZIA 1PT6A 2XG3A 2QZ2A 4IIJA 5EJ9A 3PK0A 4B9AA 5GJCA 4FGWA 1V2HE 1ND2B 2RCYA 5DBIA 2PJRA 3M1YA 3PC8A