2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
1IPAA 1KQSF 3NVIB 3CC2F 2KG4A 3FFMA 2LBWA 4X3MA 1K8AH 3PAFA 4LCKA 1NJIH 2WALA 3CCRF 1W40A 1VQOF 3NK7A 3LWRC 1DT9A 3NMUC 3HAXD 1VQKF 5G4VC 1X52A 3CCMF 5EWRA 3VMFB 2VGNA 1KC8H 1GZ0A 5GINC 3N4YA 3J81M 4BY9D 3CCSF 1Q81H 3ON1A 1T0KB 3LWVC 1N8RH 3CCJF 1X7PA 1KD1H 1VQ5F 3HJWC 5DCVA 1M1KH 4C4WC 3CMEF 1VQ9F 3CCVF 3LWQC 1VQNF 1YJNF 1PXWA 5A2QM 1YJWF 5IT9M 1GO0A 1Q86H 2BO1A 3CCLF 3MCAB 2QI2A 5FJ4C 3AGKA 2QEXF 3CC7F 1VQ6F 3IR9A 3J80M 2QA4F 3OBWA 1VQ7F 3OW2F 1W3EX 3WXMB 1K73H 3V7EA 3CPWF 3CCUF 2AIFA 3G4SF 1YJ9F 3V7QA 1Q7YH 3I56F 1YITF 3SIUA 2KTVA 1YI2F 2KTUA 1VQLF 2ALEA 3RA5A 5EO3A 1RA4A 1CK2A 4NUTA 3VI6A 3LFOA 2CZWA 3G71F 1S72F 3NK6A 1W42A 1XBIA 1Q82H 1SDSA 1GO1A 1W2BF 3JCMM 4X3LA 3OBYA 2OTLF 3J7AR 5G4UC 5GAPK 3N4ZA 3RA6A 3LWOC 3O85A 3CG6A 3E1YA 3E20B 2HVYD 3CD6F 2VGMA 3CCQF 3I55F 1M90H 3LWPC 1YIJF 3GYQA 3CC4F 3PLAC 2OHWA 1RLGA 5GANK 1QVGF 2JNBA 2OZBA 4BW0B 3CMAF 1W41A 3G6EF 1H7MA 2I6DA 3JAMM 1JJ2F 1VQMF 1QVFF 3NVKE 4TZZA 1VQPF 1NMUB 1ZWZA 3CPQA 1VQ8F 5GIPC 3SIVA 2OTJF 1K9MH 1VQ4F 1E7KA 5FLXM 3CXCF 3CCEF 2LBXA 1X7OA 2FC3A 1CN7A 5GIOC 1YHQF
chains in the Genus database with same CATH superfamily
3C9RA 1IPAA 5CB4B 1KQSF 5ITZA 1Z5VA 3JARB 3WPXA 1RQ2A 3KIZA 2HQSC 4X3MA 1ONIA 5KX5B 1NJIH 3ZP4A 5EZYB 1VQOF 3RYHA 1W5EA 3NK7A 2H6LA 1DT9A 5KX5A 3RYIA 5LXTB 3HAXD 1X52A 4ZI7A 3KJJA 3N4YA 4EI8A 1W581 4BVRA 4B5CA 2BTQB 3M84A 2F9ZC 2NMUA 1PF5A 3WJQA 1XV2A 3MQWA 3WGKA 3LWQC 1VQNF 3Q8HA 1PXWA 4O4JA 2HP3A 3HKEA 4BT2A 3F0FA 2AIZP 1Q86H 3N2GA 3RYIB 4O4IB 3MCAB 3K14A 1W5BA 3QTYA 4LNUA 3RYHB 2YYEA 3TD5A 3CC7F 1RQ7A 3C9TA 4PWTA 4I50A 3WPWA 2H8CA 1K73H 3VO8A 1TUBB 1YJ9F 3G4SF 4ZHYB 4DXDA 1VQLF 3VTIC 4NWOB 2CVLA 5MN6A 5LXTA 3KJKA 4BVQA 3LFOA 2CZWA 2HP0B 3VOAA 1ODEA 3NK6A 4I4TB 1S72F 3HKEB 5EYPB 1XRGA 2ZAUA 4O4LB 3GTZA 2R6R1 2DT4A 4TV8B 3S0HA 4ERHA 4X3LA 3F0DA 5GAPK 3RA6A 2ZVYA 3CG6A 3E20B 2HVYD 1H48A 2HRYA 4LNUB 4TV9B 1JFFB 3D00A 3ESJA 3N2GB 4BT7A 3LWPC 3GYQA 2Z1UA 3JATA 2RHLA 3IEWA 5JCOC 4F6RA 5JQGB 4B46A 2OZBA 4BW0B 3D01A 3F0GA 3JALB 4DRXA 2CSLA 3S03A 3CMAF 2OTMA 2HS3A 4ZK7A 5HWEA 5JCOA 4X20B 4E6EA 2FGYA 4O4HB 1FFXA 3S0YA 1J7HA 1SA0A 5J2TB 3TD3A 5CA1B 4ZOLB 1VQ4F 2CW4A 3CXCF 3CCEF 4FFBA 2DYYA 2LBXA 1IV1A 3RYFA 2FC3A 2Q1XA 2LCAA 1TVKA 5IJ9A 2VAMA 3P0ZA 3CC2F 2KG4A 3QHDA 2UYJA 2Z1EA 3ELCA 4XCQA 4X1KA 3WGMA 2LBWA 3KE1A 2HP0A 3VYSC 4LCKA 4C81A 1W40A 2MQEA 1JN1A 2VXYA 3WGLA 5HXZA 1H47A 1VQKF 2P6YA 4ZHQA 5MN5A 4U39A 3VMFB 4M8IA 2CHTA 2GZLA 5IJ0B 5GINC 1VHAA 2UZHA 1W55A 5IJ9B 3CYQA 1IV2A 5IYZB 3CCSF 1Q81H 2BTOA 3ON1A 1T0KB 3LWVC 2ZOVA 3CCJF 1M1KH 3JAWA 3CMEF 4G4XA 1YQNA 1YJNF 5A2QM 1YJWF 2LBTA 2R751 3CCLF 3FD6A 3AGKA 3FPIA 2IQQA 5LYJB 2QA4F 2L26A 1VQ7F 3OW2F 1TUBA 3CCUF 5IJ0A 1W57A 3I56F 4G4ZA 2ALEA 4O2BA 1FNJA 2H8EA 1OAPA 4X1YB 1CK2A 4NUTA 3CYPB 3T80A 3ERNA 1XBIA 2N48A 4O4JB 1SDSA 3K12A 4EI7A 2CWJA 3JCMM 2PMPA 1W2BF 3J7AR 5G4UC 3N4ZA 5CA0A 4G4VA 4X1IA 3MDOA 3E1YA 4TUYB 4WBNB 3S06A 3WJPA 4IIJA 5HY0A 3I55F 3CC4F 3JALA 1KNKA 4DRXB 5GANK 2Z01A 2JNBA 3VOBA 4EI9A 2ZF8A 4I55B 5LA6A 5LOVB 1SZQA 1U40A 1XHOA 2HS4A 3UT5A 3JARA 4YJ2A 3G6EF 2I6DA 4BT5A 3UT5B 2KGWA 1VQMF 1QVFF 4TZZA 1UI9A 1UFYA 3LYBA 5C8YA 4EB6B 4TV8A 4HNAB 1NMUB 3LMEA 1VQ8F 1FNKA 4WBNA 3HKBB 3EORA 3S0WA 1X7OA 3RYCA 1KNJA 5GONB 5JH7A 3IKEA 2BTUA 3NVIB 2I6RA 5EIBC 1R1MA 3FFMA 4O4LA 1K8AH 3JASB 3R0PA 3K2XA 4ZHQB 4F6RB 4O4HA 4X1YA 3CCRF 3S02A 3NMUC 1FSZA 4O4IA 5FNVB 5G4VC 1U43A 3CCMF 5EWRA 2UYKA 2VGNA 4X1KB 3GHZA 1KC8H 3OONA 4B62A 1YGYA 3E22B 3JAKA 4U3JA 4TUYA 3J81M 1TVKB 5HY4A 1N8RH 3DDNA 4I50B 1VQ5F 1KD1H 3N2KA 2RHHA 3D54A 3P10A 3ZOPA 5JQGA 5DCVA 3HKBA 3HKCB 4FFBB 3HTNA 3WGJA 3IEQA 5CA1A 1GO0A 5EAZA 4HNAA 3HKDA 5FJ4C 2K1SA 5EZYA 4ZHVA 5HY1A 2PHNA 3JASA 1VQ6F 3M4SA 1W3EX 2YXZA 3P4EA 3WXMB 3MCQA 1IV4A 3V7EA 2GVIA 3WJRA 2AIFA 2HRUA 2Z1TA 4R40B 1YITF 3FBAA 1YI2F 5GONA 2KTUA 3C8LA 5LYJA 5EO3A 5J2UB 3RA5A 2AMTA 1RA4A 5BMVA 1COMA 5J2UA 4IHJA 3VYUC 3VIUA 2Z1FA 4BT3A 3HKCA 2RHJA 2B33A 3OBYA 1QD9A 1U3PA 3LWOC 1VK3A 5LP6A 1NQ3A 3CD6F 4G88A 3ZO8A 5KMGA 4YJ3A 3JVHA 5JVDB 5EYPA 4ZI7B 1YIJF 1FFXB 3PLAC 2OHWA 3C9UA 1RLGA 3V4DA 3U0OA 3B6NA 3FD5A 4U3JB 3JAMM 2VAWA 4X1IB 3NVKE 2VAPA 1W59A 3HKDB 4ZOLA 3V3TA 3VYTC 4O2AA 1SA0B 3K0TA 4KWEA 4YJ3B 3SIVA 1X25A 1K9MH 3L7QA 1E7KA 1OFUA 4G4YA 5HY2A 1JY8A 2UYNA 3VCZA 3RYCB 1CN7A 5IYZA 1YHQF 4YJ2B 2RB9A 5LA6B 3ZP7A 5HXUA 4IHJB 3PAFA 3MBMA 2WALA 5BMVB 2RHOA 3LWRC 5B8FA 2HS0A 1IV3A 2HX0A 5HP8A 2QTPA 3M1XA 3CB2A 1CLIA 2EWCA 1GZ0A 4TV9A 5HP7A 4BY9D 4G4WA 5JH7B 2ZVZA 5LOVA 4C8IA 1X7PA 3HJWC 4C4WC 1VQVA 5EIBD 1VQ9F 4BVTA 3CCVF 5EB1B 5IT9M 4C8EA 3HWUA 3I7TA 2W8BC 4O2AB 2BO1A 4NQ3A 2QI2A 5MN4A 3JAWB 3RE3A 2QEXF 2ZODA 3C9SA 3IR9A 1W5FA 3OBWA 4X20A 3J80M 1QAHA 3DC2A 3QUWA 3CPWF 2CHSA 1Q7YH 3SIUA 3V7QA 2KTVA 1VH8A 2IG8A 1RLUA 3RYFB 5FNVA 1JD1A 3VI6A 1QU9A 3WGNA 4O2BB 3G71F 2Q1YA 4BVSA 1W42A 1Q82H 4ZHWA 1JFFA 4C82A 1GO1A 3IKFA 4IIJB 5CB4A 5LP6B 2OTLF 3N2KB 5CA0B 1T0AA 2GLZA 3O85A 1Q8RA 3IMPA 3BYQA 3E22A 3JAKB 2VGMA 3CCQF 1M90H 4RHAA 1DBFA 3LDTA 5AVMA 1QVGF 1W5AA 5LP6C 3JATB 4BT6A 1Z5WA 3F0EA 4BT4A 5KMGB 1W41A 1H7MA 5ITZB 5EB0A 1JJ2F 3F6MA 4I55A 1GX1A 1VQPF 3I3FA 3TD4A 1ZWZA 3CPQA 5J2TA 5GIPC 4I4TA 5JVDA 3KHNA 2OTJF 5FLXM 2UYPA 2IAFA 4B45A 4C8GA 4EB6A 5C8YB 1U3LA 4RQOA 2G9IA 2V9YA 5GIOC 2UYNB
chains in the Genus database with same CATH topology
1IPAA 1KQSF 3NVIB 3CC2F 2KG4A 3FFMA 4XCQA 2LBWA 4X3MA 5HXUA 1K8AH 3PAFA 4LCKA 1NJIH 2WALA 3CCRF 1W40A 1VQOF 3NK7A 3LWRC 5HXZA 1DT9A 3NMUC 3HAXD 1VQKF 5G4VC 1X52A 3CCMF 5EWRA 3VMFB 2VGNA 1KC8H 1GZ0A 5GINC 3N4YA 3J81M 4BY9D 3CCSF 1Q81H 4EI8A 5HY4A 3ON1A 1T0KB 3LWVC 1N8RH 4BVRA 1X7PA 3CCJF 1KD1H 1VQ5F 3HJWC 1M1KH 5DCVA 2F9ZC 4C4WC 3CMEF 1VQ9F 4BVTA 3CCVF 3LWQC 1VQNF 1YJNF 1PXWA 5A2QM 1YJWF 5IT9M 1GO0A 1Q86H 2BO1A 3CCLF 4NQ3A 3MCAB 2QI2A 5FJ4C 3AGKA 5HY1A 2QEXF 3CC7F 1VQ6F 3IR9A 3J80M 2QA4F 3OBWA 1VQ7F 3OW2F 1W3EX 3WXMB 1K73H 3V7EA 3CPWF 3CCUF 2AIFA 3G4SF 1YJ9F 3V7QA 1Q7YH 3I56F 1YITF 3SIUA 2KTVA 1YI2F 2KTUA 1VQLF 2ALEA 3RA5A 5EO3A 1RA4A 1CK2A 4BVQA 3VI6A 4NUTA 3LFOA 2CZWA 3G71F 1S72F 3NK6A 4BVSA 1W42A 1XBIA 1Q82H 1SDSA 1GO1A 4EI7A 1W2BF 3JCMM 4X3LA 3OBYA 2OTLF 3J7AR 5G4UC 5GAPK 3N4ZA 3RA6A 3LWOC 2GLZA 3O85A 3CG6A 3E1YA 3E20B 2HVYD 3CD6F 2VGMA 3D00A 5HY0A 3CCQF 3I55F 1M90H 3LWPC 1YIJF 3GYQA 3CC4F 3PLAC 2OHWA 1RLGA 5GANK 1QVGF 2JNBA 4EI9A 2OZBA 4BW0B 3CMAF 1W41A 3G6EF 1H7MA 2I6DA 3JAMM 1JJ2F 5HWEA 1VQMF 1QVFF 3NVKE 4TZZA 1VQPF 2FGYA 1NMUB 1ZWZA 3CPQA 3V3TA 1VQ8F 5GIPC 3SIVA 2OTJF 1K9MH 1VQ4F 1E7KA 5FLXM 3CXCF 3CCEF 5HY2A 2LBXA 1X7OA 2FC3A 1CN7A 5GIOC 1YHQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IPA A;  1KQS F;  3NVI B;  3CC2 F;  2KG4 A;  3FFM A;  2LBW A;  4X3M A;  1K8A H;  3PAF A;  4LCK A;  1NJI H;  2WAL A;  3CCR F;  1W40 A;  1VQO F;  3NK7 A;  3LWR C;  1DT9 A;  3NMU C;  3HAX D;  1VQK F;  5G4V C;  1X52 A;  3CCM F;  5EWR A;  3VMF B;  2VGN A;  1KC8 H;  1GZ0 A;  5GIN C;  3N4Y A;  3J81 M;  4BY9 D;  3CCS F;  1Q81 H;  3ON1 A;  1T0K B;  3LWV C;  1N8R H;  3CCJ F;  1X7P A;  1KD1 H;  1VQ5 F;  3HJW C;  5DCV A;  1M1K H;  4C4W C;  3CME F;  1VQ9 F;  3CCV F;  3LWQ C;  1VQN F;  1YJN F;  1PXW A;  5A2Q M;  1YJW F;  5IT9 M;  1GO0 A;  1Q86 H;  2BO1 A;  3CCL F;  3MCA B;  2QI2 A;  5FJ4 C;  3AGK A;  2QEX F;  3CC7 F;  1VQ6 F;  3IR9 A;  3J80 M;  2QA4 F;  3OBW A;  1VQ7 F;  3OW2 F;  1W3E X;  3WXM B;  1K73 H;  3V7E A;  3CPW F;  3CCU F;  2AIF A;  3G4S F;  1YJ9 F;  3V7Q A;  1Q7Y H;  3I56 F;  1YIT F;  3SIU A;  2KTV A;  1YI2 F;  2KTU A;  1VQL F;  2ALE A;  3RA5 A;  5EO3 A;  1RA4 A;  1CK2 A;  4NUT A;  3VI6 A;  3LFO A;  2CZW A;  3G71 F;  1S72 F;  3NK6 A;  1W42 A;  1XBI A;  1Q82 H;  1SDS A;  1GO1 A;  1W2B F;  3JCM M;  4X3L A;  3OBY A;  2OTL F;  3J7A R;  5G4U C;  5GAP K;  3N4Z A;  3RA6 A;  3LWO C;  3O85 A;  3CG6 A;  3E1Y A;  3E20 B;  2HVY D;  3CD6 F;  2VGM A;  3CCQ F;  3I55 F;  1M90 H;  3LWP C;  1YIJ F;  3GYQ A;  3CC4 F;  3PLA C;  2OHW A;  1RLG A;  5GAN K;  1QVG F;  2JNB A;  2OZB A;  4BW0 B;  3CMA F;  1W41 A;  3G6E F;  1H7M A;  2I6D A;  3JAM M;  1JJ2 F;  1VQM F;  1QVF F;  3NVK E;  4TZZ A;  1VQP F;  1NMU B;  1ZWZ A;  3CPQ A;  1VQ8 F;  5GIP C;  3SIV A;  2OTJ F;  1K9M H;  1VQ4 F;  1E7K A;  5FLX M;  3CXC F;  3CCE F;  2LBX A;  1X7O A;  2FC3 A;  1CN7 A;  5GIO C;  1YHQ F; 
#chains in the Genus database with same CATH topology
 3C9R A;  1IPA A;  5CB4 B;  1KQS F;  5ITZ A;  1Z5V A;  3JAR B;  3WPX A;  1RQ2 A;  3KIZ A;  2HQS C;  4X3M A;  1ONI A;  5KX5 B;  1NJI H;  3ZP4 A;  5EZY B;  1VQO F;  3RYH A;  1W5E A;  3NK7 A;  2H6L A;  1DT9 A;  5KX5 A;  3RYI A;  5LXT B;  3HAX D;  1X52 A;  4ZI7 A;  3KJJ A;  3N4Y A;  4EI8 A;  1W58 1;  4BVR A;  4B5C A;  2BTQ B;  3M84 A;  2F9Z C;  2NMU A;  1PF5 A;  3WJQ A;  1XV2 A;  3MQW A;  3WGK A;  3LWQ C;  1VQN F;  3Q8H A;  1PXW A;  4O4J A;  2HP3 A;  3HKE A;  4BT2 A;  3F0F A;  2AIZ P;  1Q86 H;  3N2G A;  3RYI B;  4O4I B;  3MCA B;  3K14 A;  1W5B A;  3QTY A;  4LNU A;  3RYH B;  2YYE A;  3TD5 A;  3CC7 F;  1RQ7 A;  3C9T A;  4PWT A;  4I50 A;  3WPW A;  2H8C A;  1K73 H;  3VO8 A;  1TUB B;  1YJ9 F;  3G4S F;  4ZHY B;  4DXD A;  1VQL F;  3VTI C;  4NWO B;  2CVL A;  5MN6 A;  5LXT A;  3KJK A;  4BVQ A;  3LFO A;  2CZW A;  2HP0 B;  3VOA A;  1ODE A;  3NK6 A;  4I4T B;  1S72 F;  3HKE B;  5EYP B;  1XRG A;  2ZAU A;  4O4L B;  3GTZ A;  2R6R 1;  2DT4 A;  4TV8 B;  3S0H A;  4ERH A;  4X3L A;  3F0D A;  5GAP K;  3RA6 A;  2ZVY A;  3CG6 A;  3E20 B;  2HVY D;  1H48 A;  2HRY A;  4LNU B;  4TV9 B;  1JFF B;  3D00 A;  3ESJ A;  3N2G B;  4BT7 A;  3LWP C;  3GYQ A;  2Z1U A;  3JAT A;  2RHL A;  3IEW A;  5JCO C;  4F6R A;  5JQG B;  4B46 A;  2OZB A;  4BW0 B;  3D01 A;  3F0G A;  3JAL B;  4DRX A;  2CSL A;  3S03 A;  3CMA F;  2OTM A;  2HS3 A;  4ZK7 A;  5HWE A;  5JCO A;  4X20 B;  4E6E A;  2FGY A;  4O4H B;  1FFX A;  3S0Y A;  1J7H A;  1SA0 A;  5J2T B;  3TD3 A;  5CA1 B;  4ZOL B;  1VQ4 F;  2CW4 A;  3CXC F;  3CCE F;  4FFB A;  2DYY A;  2LBX A;  1IV1 A;  3RYF A;  2FC3 A;  2Q1X A;  2LCA A;  1TVK A;  5IJ9 A;  2VAM A;  3P0Z A;  3CC2 F;  2KG4 A;  3QHD A;  2UYJ A;  2Z1E A;  3ELC A;  4XCQ A;  4X1K A;  3WGM A;  2LBW A;  3KE1 A;  2HP0 A;  3VYS C;  4LCK A;  4C81 A;  1W40 A;  2MQE A;  1JN1 A;  2VXY A;  3WGL A;  5HXZ A;  1H47 A;  1VQK F;  2P6Y A;  4ZHQ A;  5MN5 A;  4U39 A;  3VMF B;  4M8I A;  2CHT A;  2GZL A;  5IJ0 B;  5GIN C;  1VHA A;  2UZH A;  1W55 A;  5IJ9 B;  3CYQ A;  1IV2 A;  5IYZ B;  3CCS F;  1Q81 H;  2BTO A;  3ON1 A;  1T0K B;  3LWV C;  2ZOV A;  3CCJ F;  1M1K H;  3JAW A;  3CME F;  4G4X A;  1YQN A;  1YJN F;  5A2Q M;  1YJW F;  2LBT A;  2R75 1;  3CCL F;  3FD6 A;  3AGK A;  3FPI A;  2IQQ A;  5LYJ B;  2QA4 F;  2L26 A;  1VQ7 F;  3OW2 F;  1TUB A;  3CCU F;  5IJ0 A;  1W57 A;  3I56 F;  4G4Z A;  2ALE A;  4O2B A;  1FNJ A;  2H8E A;  1OAP A;  4X1Y B;  1CK2 A;  4NUT A;  3CYP B;  3T80 A;  3ERN A;  1XBI A;  2N48 A;  4O4J B;  1SDS A;  3K12 A;  4EI7 A;  2CWJ A;  3JCM M;  2PMP A;  1W2B F;  3J7A R;  5G4U C;  3N4Z A;  5CA0 A;  4G4V A;  4X1I A;  3MDO A;  3E1Y A;  4TUY B;  4WBN B;  3S06 A;  3WJP A;  4IIJ A;  5HY0 A;  3I55 F;  3CC4 F;  3JAL A;  1KNK A;  4DRX B;  5GAN K;  2Z01 A;  2JNB A;  3VOB A;  4EI9 A;  2ZF8 A;  4I55 B;  5LA6 A;  5LOV B;  1SZQ A;  1U40 A;  1XHO A;  2HS4 A;  3UT5 A;  3JAR A;  4YJ2 A;  3G6E F;  2I6D A;  4BT5 A;  3UT5 B;  2KGW A;  1VQM F;  1QVF F;  4TZZ A;  1UI9 A;  1UFY A;  3LYB A;  5C8Y A;  4EB6 B;  4TV8 A;  4HNA B;  1NMU B;  3LME A;  1VQ8 F;  1FNK A;  4WBN A;  3HKB B;  3EOR A;  3S0W A;  1X7O A;  3RYC A;  1KNJ A;  5GON B;  5JH7 A;  3IKE A;  2BTU A;  3NVI B;  2I6R A;  5EIB C;  1R1M A;  3FFM A;  4O4L A;  1K8A H;  3JAS B;  3R0P A;  3K2X A;  4ZHQ B;  4F6R B;  4O4H A;  4X1Y A;  3CCR F;  3S02 A;  3NMU C;  1FSZ A;  4O4I A;  5FNV B;  5G4V C;  1U43 A;  3CCM F;  5EWR A;  2UYK A;  2VGN A;  4X1K B;  3GHZ A;  1KC8 H;  3OON A;  4B62 A;  1YGY A;  3E22 B;  3JAK A;  4U3J A;  4TUY A;  3J81 M;  1TVK B;  5HY4 A;  1N8R H;  3DDN A;  4I50 B;  1VQ5 F;  1KD1 H;  3N2K A;  2RHH A;  3D54 A;  3P10 A;  3ZOP A;  5JQG A;  5DCV A;  3HKB A;  3HKC B;  4FFB B;  3HTN A;  3WGJ A;  3IEQ A;  5CA1 A;  1GO0 A;  5EAZ A;  4HNA A;  3HKD A;  5FJ4 C;  2K1S A;  5EZY A;  4ZHV A;  5HY1 A;  2PHN A;  3JAS A;  1VQ6 F;  3M4S A;  1W3E X;  2YXZ A;  3P4E A;  3WXM B;  3MCQ A;  1IV4 A;  3V7E A;  2GVI A;  3WJR A;  2AIF A;  2HRU A;  2Z1T A;  4R40 B;  1YIT F;  3FBA A;  1YI2 F;  5GON A;  2KTU A;  3C8L A;  5LYJ A;  5EO3 A;  5J2U B;  3RA5 A;  2AMT A;  1RA4 A;  5BMV A;  1COM A;  5J2U A;  4IHJ A;  3VYU C;  3VIU A;  2Z1F A;  4BT3 A;  3HKC A;  2RHJ A;  2B33 A;  3OBY A;  1QD9 A;  1U3P A;  3LWO C;  1VK3 A;  5LP6 A;  1NQ3 A;  3CD6 F;  4G88 A;  3ZO8 A;  5KMG A;  4YJ3 A;  3JVH A;  5JVD B;  5EYP A;  4ZI7 B;  1YIJ F;  1FFX B;  3PLA C;  2OHW A;  3C9U A;  1RLG A;  3V4D A;  3U0O A;  3B6N A;  3FD5 A;  4U3J B;  3JAM M;  2VAW A;  4X1I B;  3NVK E;  2VAP A;  1W59 A;  3HKD B;  4ZOL A;  3V3T A;  3VYT C;  4O2A A;  1SA0 B;  3K0T A;  4KWE A;  4YJ3 B;  3SIV A;  1X25 A;  1K9M H;  3L7Q A;  1E7K A;  1OFU A;  4G4Y A;  5HY2 A;  1JY8 A;  2UYN A;  3VCZ A;  3RYC B;  1CN7 A;  5IYZ A;  1YHQ F;  4YJ2 B;  2RB9 A;  5LA6 B;  3ZP7 A;  5HXU A;  4IHJ B;  3PAF A;  3MBM A;  2WAL A;  5BMV B;  2RHO A;  3LWR C;  5B8F A;  2HS0 A;  1IV3 A;  2HX0 A;  5HP8 A;  2QTP A;  3M1X A;  3CB2 A;  1CLI A;  2EWC A;  1GZ0 A;  4TV9 A;  5HP7 A;  4BY9 D;  4G4W A;  5JH7 B;  2ZVZ A;  5LOV A;  4C8I A;  1X7P A;  3HJW C;  4C4W C;  1VQV A;  5EIB D;  1VQ9 F;  4BVT A;  3CCV F;  5EB1 B;  5IT9 M;  4C8E A;  3HWU A;  3I7T A;  2W8B C;  4O2A B;  2BO1 A;  4NQ3 A;  2QI2 A;  5MN4 A;  3JAW B;  3RE3 A;  2QEX F;  2ZOD A;  3C9S A;  3IR9 A;  1W5F A;  3OBW A;  4X20 A;  3J80 M;  1QAH A;  3DC2 A;  3QUW A;  3CPW F;  2CHS A;  1Q7Y H;  3SIU A;  3V7Q A;  2KTV A;  1VH8 A;  2IG8 A;  1RLU A;  3RYF B;  5FNV A;  1JD1 A;  3VI6 A;  1QU9 A;  3WGN A;  4O2B B;  3G71 F;  2Q1Y A;  4BVS A;  1W42 A;  1Q82 H;  4ZHW A;  1JFF A;  4C82 A;  1GO1 A;  3IKF A;  4IIJ B;  5CB4 A;  5LP6 B;  2OTL F;  3N2K B;  5CA0 B;  1T0A A;  2GLZ A;  3O85 A;  1Q8R A;  3IMP A;  3BYQ A;  3E22 A;  3JAK B;  2VGM A;  3CCQ F;  1M90 H;  4RHA A;  1DBF A;  3LDT A;  5AVM A;  1QVG F;  1W5A A;  5LP6 C;  3JAT B;  4BT6 A;  1Z5W A;  3F0E A;  4BT4 A;  5KMG B;  1W41 A;  1H7M A;  5ITZ B;  5EB0 A;  1JJ2 F;  3F6M A;  4I55 A;  1GX1 A;  1VQP F;  3I3F A;  3TD4 A;  1ZWZ A;  3CPQ A;  5J2T A;  5GIP C;  4I4T A;  5JVD A;  3KHN A;  2OTJ F;  5FLX M;  2UYP A;  2IAF A;  4B45 A;  4C8G A;  4EB6 A;  5C8Y B;  1U3L A;  4RQO A;  2G9I A;  2V9Y A;  5GIO C;  2UYN B; 
#chains in the Genus database with same CATH homology
 1IPA A;  1KQS F;  3NVI B;  3CC2 F;  2KG4 A;  3FFM A;  4XCQ A;  2LBW A;  4X3M A;  5HXU A;  1K8A H;  3PAF A;  4LCK A;  1NJI H;  2WAL A;  3CCR F;  1W40 A;  1VQO F;  3NK7 A;  3LWR C;  5HXZ A;  1DT9 A;  3NMU C;  3HAX D;  1VQK F;  5G4V C;  1X52 A;  3CCM F;  5EWR A;  3VMF B;  2VGN A;  1KC8 H;  1GZ0 A;  5GIN C;  3N4Y A;  3J81 M;  4BY9 D;  3CCS F;  1Q81 H;  4EI8 A;  5HY4 A;  3ON1 A;  1T0K B;  3LWV C;  1N8R H;  4BVR A;  1X7P A;  3CCJ F;  1KD1 H;  1VQ5 F;  3HJW C;  1M1K H;  5DCV A;  2F9Z C;  4C4W C;  3CME F;  1VQ9 F;  4BVT A;  3CCV F;  3LWQ C;  1VQN F;  1YJN F;  1PXW A;  5A2Q M;  1YJW F;  5IT9 M;  1GO0 A;  1Q86 H;  2BO1 A;  3CCL F;  4NQ3 A;  3MCA B;  2QI2 A;  5FJ4 C;  3AGK A;  5HY1 A;  2QEX F;  3CC7 F;  1VQ6 F;  3IR9 A;  3J80 M;  2QA4 F;  3OBW A;  1VQ7 F;  3OW2 F;  1W3E X;  3WXM B;  1K73 H;  3V7E A;  3CPW F;  3CCU F;  2AIF A;  3G4S F;  1YJ9 F;  3V7Q A;  1Q7Y H;  3I56 F;  1YIT F;  3SIU A;  2KTV A;  1YI2 F;  2KTU A;  1VQL F;  2ALE A;  3RA5 A;  5EO3 A;  1RA4 A;  1CK2 A;  4BVQ A;  3VI6 A;  4NUT A;  3LFO A;  2CZW A;  3G71 F;  1S72 F;  3NK6 A;  4BVS A;  1W42 A;  1XBI A;  1Q82 H;  1SDS A;  1GO1 A;  4EI7 A;  1W2B F;  3JCM M;  4X3L A;  3OBY A;  2OTL F;  3J7A R;  5G4U C;  5GAP K;  3N4Z A;  3RA6 A;  3LWO C;  2GLZ A;  3O85 A;  3CG6 A;  3E1Y A;  3E20 B;  2HVY D;  3CD6 F;  2VGM A;  3D00 A;  5HY0 A;  3CCQ F;  3I55 F;  1M90 H;  3LWP C;  1YIJ F;  3GYQ A;  3CC4 F;  3PLA C;  2OHW A;  1RLG A;  5GAN K;  1QVG F;  2JNB A;  4EI9 A;  2OZB A;  4BW0 B;  3CMA F;  1W41 A;  3G6E F;  1H7M A;  2I6D A;  3JAM M;  1JJ2 F;  5HWE A;  1VQM F;  1QVF F;  3NVK E;  4TZZ A;  1VQP F;  2FGY A;  1NMU B;  1ZWZ A;  3CPQ A;  3V3T A;  1VQ8 F;  5GIP C;  3SIV A;  2OTJ F;  1K9M H;  1VQ4 F;  1E7K A;  5FLX M;  3CXC F;  3CCE F;  5HY2 A;  2LBX A;  1X7O A;  2FC3 A;  1CN7 A;  5GIO C;  1YHQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...