2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
2AIFA 5EO3A 3I56F 1VQLF 5EWRA 1GO0A 3V7QA 5GIPC 3O85A 3CD6F 5IT9M 2OHWA 1YJNF 5GINC 1XBIA 1N8RH 2LBWA 3NMUC 3CG6A 2VGNA 3OW2F 1CK2A 3LWOC 1S72F 1VQ6F 1E7KA 3CCLF 3MCAB 3CC7F 3HAXD 5DCVA 2KG4A 1K8AH 1W42A 1VQNF 3NVIB 3LFOA 3NK6A 3OBYA 1X7PA 3CCVF 1CN7A 5G4VC 3CCSF 2OTJF 3J7AR 1VQ8F 3CMAF 3WXMB 4C4WC 3PAFA 1YJWF 1VQ5F 3PLAC 3SIUA 2HVYD 3JCMM 1VQPF 3VI6A 2BO1A 1VQ9F 1VQMF 1RA4A 3VMFB 1JJ2F 3LWPC 1M1KH 2LBXA 3ON1A 1H7MA 1PXWA 5G4UC 1VQ4F 3CCRF 3JAMM 5GANK 1KD1H 3LWQC 3CXCF 2WALA 3CPQA 5A2QM 5GAPK 3V7EA 1NMUB 2QA4F 3CCQF 4BY9D 5GIOC 1Q7YH 1T0KB 4TZZA 1YI2F 1M90H 1SDSA 3SIVA 1NJIH 1GO1A 3CC4F 3LWRC 1DT9A 1VQKF 3I55F 1Q82H 2OTLF 1RLGA 4LCKA 5FLXM 3GYQA 1QVFF 3CC2F 3FFMA 1YJ9F 3HJWC 3CPWF 2QI2A 1YITF 1K9MH 4BW0B 2KTUA 3CCUF 3CCJF 1X52A 1Q86H 3E20B 1YIJF 3CCEF 2KTVA 1GZ0A 1ZWZA 4NUTA 1W40A 2I6DA 3NVKE 4X3LA 3RA6A 1X7OA 3NK7A 2ALEA 2JNBA 3N4ZA 1QVGF 3OBWA 3J80M 3AGKA 3G6EF 1W2BF 3CMEF 1W3EX 1K73H 1IPAA 2OZBA 3CCMF 1YHQF 2QEXF 2VGMA 1VQ7F 3G71F 1KC8H 1VQOF 3N4YA 2CZWA 3IR9A 3LWVC 2FC3A 3J81M 3E1YA 1KQSF 1Q81H 1W41A 4X3MA 5FJ4C 3RA5A 3G4SF
chains in the Genus database with same CATH superfamily
4O4IA 5LA6A 1GO0A 3O85A 1RLUA 2OHWA 3C9SA 3F0EA 2LBWA 1UI9A 2VGNA 4C81A 4B45A 1COMA 1CK2A 2ZVYA 2DT4A 3LWOC 5IJ9B 5DCVA 3MCAB 3CC7F 3HAXD 3D01A 1K8AH 5HY1A 2MQEA 1VQNF 3LFOA 1FFXB 3OBYA 3C9UA 3S03A 5LP6C 3V3TA 5IJ9A 4O2BB 3CCSF 2OTJF 4FFBB 5JCOC 3J7AR 4IHJB 3PLAC 2N48A 3SIUA 4BT7A 2CHTA 1IV2A 2HVYD 3P10A 1VHAA 3EORA 3F0DA 3M1XA 4FFBA 4IIJA 4O2BA 3Q8HA 4YJ2A 4E6EA 3ERNA 5EB0A 1H7MA 5LP6B 4O4JB 2V9YA 5HP8A 5G4UC 5A2QM 3L7QA 5CA1B 5LP6A 4O4JA 1SA0B 1NMUB 2QA4F 3V7EA 2IQQA 4BT5A 5EB1B 3RE3A 4C8GA 5CA1A 3JAWA 3CC4F 3LWRC 3IKEA 3ZP7A 4B46A 1YGYA 3FBAA 5FLXM 3GYQA 5JH7B 4BVQA 3DDNA 3S0YA 4ZOLB 3LDTA 3E20B 4TUYA 1TUBB 1YIJF 3WGJA 5JH7A 2L26A 2KTVA 4ZOLA 1ZWZA 3VO8A 4I4TB 1W40A 2R6R1 1FSZA 3ZO8A 4X3LA 5EAZA 1X7OA 2JNBA 4I50B 3J80M 2K1SA 3RYIB 3CMEF 3HKDB 1W3EX 3C9RA 1XV2A 5GONA 2IG8A 3F0FA 3HKEB 5EIBC 4X1KB 5HY0A 1IV4A 3N4YA 2CZWA 1ONIA 3HKDA 3QUWA 4BT3A 3D00A 3RYCB 1JY8A 4X1KA 4B62A 4BVSA 1U3PA 5FJ4C 3JASB 3RA5A 5BMVB 3ZOPA 3WGMA 1JD1A 3RYCA 3KJKA 3V7QA 5IT9M 5HWEA 3JASA 5HXZA 3S06A 5BMVA 1N8RH 3WGLA 1JFFA 4O2AB 3DC2A 1VQ6F 1J7HA 3F6MA 1E7KA 3IEWA 2Q1YA 3E22B 2KG4A 2HRYA 4X1IB 3WJRA 4G4ZA 5J2TB 3NK6A 3ESJA 1OAPA 4O4IB 5HY4A 1X7PA 1CN7A 2ZAUA 1VQ8F 2F9ZC 5KX5A 1GX1A 4X1IA 2H8EA 4C4WC 3GTZA 1X25A 3PAFA 1VQ5F 5J2TA 2CW4A 2BO1A 5FNVB 4TV9B 3VI6A 1VQMF 1RA4A 4R40B 3ELCA 3VMFB 5EZYB 4O4HA 1M1KH 2LBXA 2AIZP 1PXWA 3N2KB 4TV9A 5FNVA 1H47A 1W5BA 2ZF8A 3VTIC 1R1MA 3HWUA 3KJJA 5EZYA 3WPWA 5GAPK 3N2KA 4NQ3A 4BY9D 3WJPA 3OONA 4TZZA 4IIJB 2HRUA 2CWJA 3VYTC 3SIVA 4ERHA 2I6RA 4YJ2B 1GO1A 1QD9A 1DT9A 1VQKF 1RLGA 3QTYA 5JVDB 1XHOA 5LYJA 3C8LA 1W5EA 3CB2A 3CC2F 1RQ2A 3BYQA 1OFUA 3FFMA 1Z5VA 2BTUA 3MQWA 1YJ9F 4BW0B 2KTUA 3FD6A 5JVDA 3KHNA 1X52A 2EWCA 3S0WA 2R751 2RB9A 4EI8A 4ZK7A 4BVTA 1IV3A 2RHJA 4NUTA 3JAWB 3TD5A 5JCOA 2VAMA 3R0PA 4G4VA 1H48A 4KWEA 4I55A 3KE1A 3N4ZA 2FGYA 2HP3A 3JVHA 2LCAA 4EI7A 5C8YB 2PHNA 1QAHA 3VCZA 1K73H 2HS3A 3JALB 1SZQA 4TUYB 1YHQF 1KC8H 1VQOF 1U40A 5C8YA 3S0HA 3VYUC 5LXTA 4PWTA 3IR9A 3JALA 2BTQB 2HP0A 3TD3A 1Q81H 4X3MA 2DYYA 3T80A 3WGKA 3JARB 2AIFA 3I56F 5GONB 1W5AA 3VOBA 5IJ0A 5GINC 2RHLA 3NMUC 3JARA 3CG6A 4BVRA 1YQNA 4RHAA 3OW2F 4TV8B 3I3FA 3HKCB 3S02A 1S72F 2HS4A 3WJQA 4DRXB 1W42A 4ZI7A 3K2XA 2B33A 4TV8A 5ITZB 3HKCA 4X1YB 3D54A 1UFYA 4ZHQB 5G4VC 3IKFA 4DRXA 1RQ7A 1NQ3A 1FNJA 3WXMB 2UZHA 2ZVZA 2BTOA 4EB6B 5ITZA 2GLZA 1JFFB 2RHOA 4X1YA 3JCMM 1VQPF 4ZHQA 3LYBA 2AMTA 1JJ2F 4YJ3B 2KGWA 5AVMA 3LWPC 4EB6A 4G4XA 3ON1A 4BT2A 4C8EA 3WGNA 3JAMM 3CCRF 4YJ3A 5IYZB 5KX5B 3ZP4A 4G4WA 5MN4A 3M4SA 1IV1A 5GIOC 1U43A 1YI2F 1SDSA 5IYZA 1W581 3IMPA 1NJIH 2HQSC 4O4HB 3P0ZA 3CYQA 3VOAA 4U39A 2UYKA 4C82A 1QVFF 3N2GA 4WBNB 2Z1UA 2W8BC 3HJWC 3WPXA 4U3JB 5J2UB 3CCUF 3HKBB 1DBFA 5JQGB 1KNKA 1Q86H 1T0AA 4WBNA 4U3JA 2I6DA 4NWOB 3F0GA 5J2UA 3V4DA 4G88A 5B8FA 3HKBA 5JQGA 5CB4B 5KMGB 2PMPA 4BT4A 5LYJB 4F6RA 2ALEA 2UYNB 2UYPA 1QU9A 4X20B 1QVGF 2CSLA 2QTPA 5CB4A 5KMGA 1W2BF 2OZBA 1XRGA 1Q8RA 3MDOA 3K14A 2QEXF 5LOVB 2UYNA 4X20A 2LBTA 5HY2A 3KIZA 1JN1A 3QHDA 4HNAB 2OTMA 3P4EA 5LOVA 3FD5A 4I55B 1FNKA 2Z01A 5HXUA 5MN5A 5EYPB 3RYFB 4HNAA 3HTNA 1FFXA 4EI9A 3G4SF 1W59A 5EO3A 4ZHWA 5EWRA 3JATB 3MBMA 2VXYA 1VQLF 3B6NA 5GIPC 3CD6F 3JAKB 5EYPA 1YJNF 3RYFA 4IHJA 3VIUA 1XBIA 5LXTB 4M8IA 3JATA 3K0TA 1PF5A 3JAKA 2NMUA 2HP0B 3CCLF 2GVIA 3NVIB 1KNJA 3MCQA 3CCVF 3CMAF 5IJ0B 4O4LB 1YJWF 2HX0A 3TD4A 1SA0A 2VAPA 2IAFA 3K12A 3VYSC 1VQ9F 3RYHB 2Z1FA 4O4LA 2UYJA 4RQOA 4ZI7B 2Z1TA 2H6LA 1W5FA 3I7TA 2VAWA 2CVLA 1VQ4F 3RYHA 3LMEA 2ZODA 5GANK 1KD1H 3LWQC 3CYPB 3CXCF 2WALA 3CPQA 3M84A 4LNUB 3CCQF 1TUBA 4ZHVA 2RHHA 4XCQA 1Q7YH 1VQVA 5HP7A 1M90H 1T0KB 4I4TA 4G4YA 2H8CA 4LNUA 2OTLF 3I55F 1Q82H 3UT5B 4LCKA 1CLIA 3FPIA 3GHZA 5MN6A 4I50A 4C8IA 2G9IA 3CPWF 2GZLA 1W57A 2QI2A 3UT5A 1YITF 1Z5WA 1K9MH 3RYIA 3C9TA 3CCJF 3CCEF 2HS0A 2Q1XA 3HKEA 1GZ0A 2YXZA 2ZOVA 1W55A 3NVKE 1VK3A 2CHSA 3RA6A 1ODEA 5EIBD 1VH8A 3IEQA 2YYEA 1TVKB 3N2GB 3NK7A 2Z1EA 3OBWA 3AGKA 4DXDA 4B5CA 3G6EF 1IPAA 3CCMF 4ZHYB 1TVKA 2VGMA 1VQ7F 3G71F 2P6YA 1U3LA 3LWVC 4O2AA 5CA0B 2FC3A 3J81M 5LA6B 3E1YA 4F6RB 1KQSF 3E22A 3U0OA 1W41A 4BT6A 5CA0A
chains in the Genus database with same CATH topology
2AIFA 5EO3A 3I56F 1VQLF 5EWRA 1GO0A 3V7QA 5GIPC 3O85A 3CD6F 5IT9M 2OHWA 5HWEA 1YJNF 5HXZA 5GINC 1XBIA 1N8RH 2LBWA 3NMUC 3CG6A 4BVRA 2VGNA 3OW2F 1CK2A 3LWOC 1S72F 1VQ6F 1E7KA 3CCLF 3MCAB 3CC7F 3HAXD 5DCVA 2KG4A 1K8AH 5HY1A 1W42A 1VQNF 3NVIB 3LFOA 3NK6A 5HY4A 3OBYA 1X7PA 3CCVF 1CN7A 5G4VC 3V3TA 3CCSF 2OTJF 3J7AR 1VQ8F 2F9ZC 3CMAF 3WXMB 4C4WC 3PAFA 1YJWF 1VQ5F 3PLAC 3SIUA 2GLZA 2HVYD 3JCMM 1VQPF 3VI6A 2BO1A 1VQ9F 1VQMF 1RA4A 3VMFB 1JJ2F 3LWPC 1M1KH 2LBXA 3ON1A 1H7MA 1PXWA 5G4UC 1VQ4F 3CCRF 3JAMM 5GANK 1KD1H 3LWQC 3CXCF 2WALA 3CPQA 5A2QM 5GAPK 3V7EA 1NMUB 4NQ3A 2QA4F 3CCQF 4BY9D 5GIOC 4XCQA 1Q7YH 1T0KB 4TZZA 1YI2F 1M90H 1SDSA 3SIVA 1NJIH 1GO1A 3CC4F 3LWRC 1DT9A 1VQKF 3I55F 1Q82H 2OTLF 1RLGA 4LCKA 5FLXM 3GYQA 1QVFF 4BVQA 3CC2F 3FFMA 1YJ9F 3HJWC 3CPWF 2QI2A 1YITF 1K9MH 4BW0B 2KTUA 3CCUF 3CCJF 1X52A 1Q86H 3E20B 1YIJF 3CCEF 4EI8A 2KTVA 1GZ0A 1ZWZA 4NUTA 4BVTA 1W40A 2I6DA 3NVKE 4X3LA 3RA6A 1X7OA 3NK7A 2ALEA 2JNBA 3N4ZA 1QVGF 2FGYA 3OBWA 3J80M 3AGKA 4EI7A 3G6EF 1W2BF 3CMEF 1W3EX 1K73H 1IPAA 2OZBA 3CCMF 1YHQF 2QEXF 2VGMA 1VQ7F 5HY0A 5HY2A 3G71F 1KC8H 1VQOF 3N4YA 2CZWA 3IR9A 3LWVC 3D00A 2FC3A 3J81M 3E1YA 1KQSF 5HXUA 4BVSA 1W41A 4X3MA 1Q81H 3RA5A 5FJ4C 4EI9A 3G4SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIF A;  5EO3 A;  3I56 F;  1VQL F;  5EWR A;  1GO0 A;  3V7Q A;  5GIP C;  3O85 A;  3CD6 F;  5IT9 M;  2OHW A;  1YJN F;  5GIN C;  1XBI A;  1N8R H;  2LBW A;  3NMU C;  3CG6 A;  2VGN A;  3OW2 F;  1CK2 A;  3LWO C;  1S72 F;  1VQ6 F;  1E7K A;  3CCL F;  3MCA B;  3CC7 F;  3HAX D;  5DCV A;  2KG4 A;  1K8A H;  1W42 A;  1VQN F;  3NVI B;  3LFO A;  3NK6 A;  3OBY A;  1X7P A;  3CCV F;  1CN7 A;  5G4V C;  3CCS F;  2OTJ F;  3J7A R;  1VQ8 F;  3CMA F;  3WXM B;  4C4W C;  3PAF A;  1YJW F;  1VQ5 F;  3PLA C;  3SIU A;  2HVY D;  3JCM M;  1VQP F;  3VI6 A;  2BO1 A;  1VQ9 F;  1VQM F;  1RA4 A;  3VMF B;  1JJ2 F;  3LWP C;  1M1K H;  2LBX A;  3ON1 A;  1H7M A;  1PXW A;  5G4U C;  1VQ4 F;  3CCR F;  3JAM M;  5GAN K;  1KD1 H;  3LWQ C;  3CXC F;  2WAL A;  3CPQ A;  5A2Q M;  5GAP K;  3V7E A;  1NMU B;  2QA4 F;  3CCQ F;  4BY9 D;  5GIO C;  1Q7Y H;  1T0K B;  4TZZ A;  1YI2 F;  1M90 H;  1SDS A;  3SIV A;  1NJI H;  1GO1 A;  3CC4 F;  3LWR C;  1DT9 A;  1VQK F;  3I55 F;  1Q82 H;  2OTL F;  1RLG A;  4LCK A;  5FLX M;  3GYQ A;  1QVF F;  3CC2 F;  3FFM A;  1YJ9 F;  3HJW C;  3CPW F;  2QI2 A;  1YIT F;  1K9M H;  4BW0 B;  2KTU A;  3CCU F;  3CCJ F;  1X52 A;  1Q86 H;  3E20 B;  1YIJ F;  3CCE F;  2KTV A;  1GZ0 A;  1ZWZ A;  4NUT A;  1W40 A;  2I6D A;  3NVK E;  4X3L A;  3RA6 A;  1X7O A;  3NK7 A;  2ALE A;  2JNB A;  3N4Z A;  1QVG F;  3OBW A;  3J80 M;  3AGK A;  3G6E F;  1W2B F;  3CME F;  1W3E X;  1K73 H;  1IPA A;  2OZB A;  3CCM F;  1YHQ F;  2QEX F;  2VGM A;  1VQ7 F;  3G71 F;  1KC8 H;  1VQO F;  3N4Y A;  2CZW A;  3IR9 A;  3LWV C;  2FC3 A;  3J81 M;  3E1Y A;  1KQS F;  1Q81 H;  1W41 A;  4X3M A;  5FJ4 C;  3RA5 A;  3G4S F; 
#chains in the Genus database with same CATH topology
 4O4I A;  5LA6 A;  1GO0 A;  3O85 A;  1RLU A;  2OHW A;  3C9S A;  3F0E A;  2LBW A;  1UI9 A;  2VGN A;  4C81 A;  4B45 A;  1COM A;  1CK2 A;  2ZVY A;  2DT4 A;  3LWO C;  5IJ9 B;  5DCV A;  3MCA B;  3CC7 F;  3HAX D;  3D01 A;  1K8A H;  5HY1 A;  2MQE A;  1VQN F;  3LFO A;  1FFX B;  3OBY A;  3C9U A;  3S03 A;  5LP6 C;  3V3T A;  5IJ9 A;  4O2B B;  3CCS F;  2OTJ F;  4FFB B;  5JCO C;  3J7A R;  4IHJ B;  3PLA C;  2N48 A;  3SIU A;  4BT7 A;  2CHT A;  1IV2 A;  2HVY D;  3P10 A;  1VHA A;  3EOR A;  3F0D A;  3M1X A;  4FFB A;  4IIJ A;  4O2B A;  3Q8H A;  4YJ2 A;  4E6E A;  3ERN A;  5EB0 A;  1H7M A;  5LP6 B;  4O4J B;  2V9Y A;  5HP8 A;  5G4U C;  5A2Q M;  3L7Q A;  5CA1 B;  5LP6 A;  4O4J A;  1SA0 B;  1NMU B;  2QA4 F;  3V7E A;  2IQQ A;  4BT5 A;  5EB1 B;  3RE3 A;  4C8G A;  5CA1 A;  3JAW A;  3CC4 F;  3LWR C;  3IKE A;  3ZP7 A;  4B46 A;  1YGY A;  3FBA A;  5FLX M;  3GYQ A;  5JH7 B;  4BVQ A;  3DDN A;  3S0Y A;  4ZOL B;  3LDT A;  3E20 B;  4TUY A;  1TUB B;  1YIJ F;  3WGJ A;  5JH7 A;  2L26 A;  2KTV A;  4ZOL A;  1ZWZ A;  3VO8 A;  4I4T B;  1W40 A;  2R6R 1;  1FSZ A;  3ZO8 A;  4X3L A;  5EAZ A;  1X7O A;  2JNB A;  4I50 B;  3J80 M;  2K1S A;  3RYI B;  3CME F;  3HKD B;  1W3E X;  3C9R A;  1XV2 A;  5GON A;  2IG8 A;  3F0F A;  3HKE B;  5EIB C;  4X1K B;  5HY0 A;  1IV4 A;  3N4Y A;  2CZW A;  1ONI A;  3HKD A;  3QUW A;  4BT3 A;  3D00 A;  3RYC B;  1JY8 A;  4X1K A;  4B62 A;  4BVS A;  1U3P A;  5FJ4 C;  3JAS B;  3RA5 A;  5BMV B;  3ZOP A;  3WGM A;  1JD1 A;  3RYC A;  3KJK A;  3V7Q A;  5IT9 M;  5HWE A;  3JAS A;  5HXZ A;  3S06 A;  5BMV A;  1N8R H;  3WGL A;  1JFF A;  4O2A B;  3DC2 A;  1VQ6 F;  1J7H A;  3F6M A;  1E7K A;  3IEW A;  2Q1Y A;  3E22 B;  2KG4 A;  2HRY A;  4X1I B;  3WJR A;  4G4Z A;  5J2T B;  3NK6 A;  3ESJ A;  1OAP A;  4O4I B;  5HY4 A;  1X7P A;  1CN7 A;  2ZAU A;  1VQ8 F;  2F9Z C;  5KX5 A;  1GX1 A;  4X1I A;  2H8E A;  4C4W C;  3GTZ A;  1X25 A;  3PAF A;  1VQ5 F;  5J2T A;  2CW4 A;  2BO1 A;  5FNV B;  4TV9 B;  3VI6 A;  1VQM F;  1RA4 A;  4R40 B;  3ELC A;  3VMF B;  5EZY B;  4O4H A;  1M1K H;  2LBX A;  2AIZ P;  1PXW A;  3N2K B;  4TV9 A;  5FNV A;  1H47 A;  1W5B A;  2ZF8 A;  3VTI C;  1R1M A;  3HWU A;  3KJJ A;  5EZY A;  3WPW A;  5GAP K;  3N2K A;  4NQ3 A;  4BY9 D;  3WJP A;  3OON A;  4TZZ A;  4IIJ B;  2HRU A;  2CWJ A;  3VYT C;  3SIV A;  4ERH A;  2I6R A;  4YJ2 B;  1GO1 A;  1QD9 A;  1DT9 A;  1VQK F;  1RLG A;  3QTY A;  5JVD B;  1XHO A;  5LYJ A;  3C8L A;  1W5E A;  3CB2 A;  3CC2 F;  1RQ2 A;  3BYQ A;  1OFU A;  3FFM A;  1Z5V A;  2BTU A;  3MQW A;  1YJ9 F;  4BW0 B;  2KTU A;  3FD6 A;  5JVD A;  3KHN A;  1X52 A;  2EWC A;  3S0W A;  2R75 1;  2RB9 A;  4EI8 A;  4ZK7 A;  4BVT A;  1IV3 A;  2RHJ A;  4NUT A;  3JAW B;  3TD5 A;  5JCO A;  2VAM A;  3R0P A;  4G4V A;  1H48 A;  4KWE A;  4I55 A;  3KE1 A;  3N4Z A;  2FGY A;  2HP3 A;  3JVH A;  2LCA A;  4EI7 A;  5C8Y B;  2PHN A;  1QAH A;  3VCZ A;  1K73 H;  2HS3 A;  3JAL B;  1SZQ A;  4TUY B;  1YHQ F;  1KC8 H;  1VQO F;  1U40 A;  5C8Y A;  3S0H A;  3VYU C;  5LXT A;  4PWT A;  3IR9 A;  3JAL A;  2BTQ B;  2HP0 A;  3TD3 A;  1Q81 H;  4X3M A;  2DYY A;  3T80 A;  3WGK A;  3JAR B;  2AIF A;  3I56 F;  5GON B;  1W5A A;  3VOB A;  5IJ0 A;  5GIN C;  2RHL A;  3NMU C;  3JAR A;  3CG6 A;  4BVR A;  1YQN A;  4RHA A;  3OW2 F;  4TV8 B;  3I3F A;  3HKC B;  3S02 A;  1S72 F;  2HS4 A;  3WJQ A;  4DRX B;  1W42 A;  4ZI7 A;  3K2X A;  2B33 A;  4TV8 A;  5ITZ B;  3HKC A;  4X1Y B;  3D54 A;  1UFY A;  4ZHQ B;  5G4V C;  3IKF A;  4DRX A;  1RQ7 A;  1NQ3 A;  1FNJ A;  3WXM B;  2UZH A;  2ZVZ A;  2BTO A;  4EB6 B;  5ITZ A;  2GLZ A;  1JFF B;  2RHO A;  4X1Y A;  3JCM M;  1VQP F;  4ZHQ A;  3LYB A;  2AMT A;  1JJ2 F;  4YJ3 B;  2KGW A;  5AVM A;  3LWP C;  4EB6 A;  4G4X A;  3ON1 A;  4BT2 A;  4C8E A;  3WGN A;  3JAM M;  3CCR F;  4YJ3 A;  5IYZ B;  5KX5 B;  3ZP4 A;  4G4W A;  5MN4 A;  3M4S A;  1IV1 A;  5GIO C;  1U43 A;  1YI2 F;  1SDS A;  5IYZ A;  1W58 1;  3IMP A;  1NJI H;  2HQS C;  4O4H B;  3P0Z A;  3CYQ A;  3VOA A;  4U39 A;  2UYK A;  4C82 A;  1QVF F;  3N2G A;  4WBN B;  2Z1U A;  2W8B C;  3HJW C;  3WPX A;  4U3J B;  5J2U B;  3CCU F;  3HKB B;  1DBF A;  5JQG B;  1KNK A;  1Q86 H;  1T0A A;  4WBN A;  4U3J A;  2I6D A;  4NWO B;  3F0G A;  5J2U A;  3V4D A;  4G88 A;  5B8F A;  3HKB A;  5JQG A;  5CB4 B;  5KMG B;  2PMP A;  4BT4 A;  5LYJ B;  4F6R A;  2ALE A;  2UYN B;  2UYP A;  1QU9 A;  4X20 B;  1QVG F;  2CSL A;  2QTP A;  5CB4 A;  5KMG A;  1W2B F;  2OZB A;  1XRG A;  1Q8R A;  3MDO A;  3K14 A;  2QEX F;  5LOV B;  2UYN A;  4X20 A;  2LBT A;  5HY2 A;  3KIZ A;  1JN1 A;  3QHD A;  4HNA B;  2OTM A;  3P4E A;  5LOV A;  3FD5 A;  4I55 B;  1FNK A;  2Z01 A;  5HXU A;  5MN5 A;  5EYP B;  3RYF B;  4HNA A;  3HTN A;  1FFX A;  4EI9 A;  3G4S F;  1W59 A;  5EO3 A;  4ZHW A;  5EWR A;  3JAT B;  3MBM A;  2VXY A;  1VQL F;  3B6N A;  5GIP C;  3CD6 F;  3JAK B;  5EYP A;  1YJN F;  3RYF A;  4IHJ A;  3VIU A;  1XBI A;  5LXT B;  4M8I A;  3JAT A;  3K0T A;  1PF5 A;  3JAK A;  2NMU A;  2HP0 B;  3CCL F;  2GVI A;  3NVI B;  1KNJ A;  3MCQ A;  3CCV F;  3CMA F;  5IJ0 B;  4O4L B;  1YJW F;  2HX0 A;  3TD4 A;  1SA0 A;  2VAP A;  2IAF A;  3K12 A;  3VYS C;  1VQ9 F;  3RYH B;  2Z1F A;  4O4L A;  2UYJ A;  4RQO A;  4ZI7 B;  2Z1T A;  2H6L A;  1W5F A;  3I7T A;  2VAW A;  2CVL A;  1VQ4 F;  3RYH A;  3LME A;  2ZOD A;  5GAN K;  1KD1 H;  3LWQ C;  3CYP B;  3CXC F;  2WAL A;  3CPQ A;  3M84 A;  4LNU B;  3CCQ F;  1TUB A;  4ZHV A;  2RHH A;  4XCQ A;  1Q7Y H;  1VQV A;  5HP7 A;  1M90 H;  1T0K B;  4I4T A;  4G4Y A;  2H8C A;  4LNU A;  2OTL F;  3I55 F;  1Q82 H;  3UT5 B;  4LCK A;  1CLI A;  3FPI A;  3GHZ A;  5MN6 A;  4I50 A;  4C8I A;  2G9I A;  3CPW F;  2GZL A;  1W57 A;  2QI2 A;  3UT5 A;  1YIT F;  1Z5W A;  1K9M H;  3RYI A;  3C9T A;  3CCJ F;  3CCE F;  2HS0 A;  2Q1X A;  3HKE A;  1GZ0 A;  2YXZ A;  2ZOV A;  1W55 A;  3NVK E;  1VK3 A;  2CHS A;  3RA6 A;  1ODE A;  5EIB D;  1VH8 A;  3IEQ A;  2YYE A;  1TVK B;  3N2G B;  3NK7 A;  2Z1E A;  3OBW A;  3AGK A;  4DXD A;  4B5C A;  3G6E F;  1IPA A;  3CCM F;  4ZHY B;  1TVK A;  2VGM A;  1VQ7 F;  3G71 F;  2P6Y A;  1U3L A;  3LWV C;  4O2A A;  5CA0 B;  2FC3 A;  3J81 M;  5LA6 B;  3E1Y A;  4F6R B;  1KQS F;  3E22 A;  3U0O A;  1W41 A;  4BT6 A;  5CA0 A; 
#chains in the Genus database with same CATH homology
 2AIF A;  5EO3 A;  3I56 F;  1VQL F;  5EWR A;  1GO0 A;  3V7Q A;  5GIP C;  3O85 A;  3CD6 F;  5IT9 M;  2OHW A;  5HWE A;  1YJN F;  5HXZ A;  5GIN C;  1XBI A;  1N8R H;  2LBW A;  3NMU C;  3CG6 A;  4BVR A;  2VGN A;  3OW2 F;  1CK2 A;  3LWO C;  1S72 F;  1VQ6 F;  1E7K A;  3CCL F;  3MCA B;  3CC7 F;  3HAX D;  5DCV A;  2KG4 A;  1K8A H;  5HY1 A;  1W42 A;  1VQN F;  3NVI B;  3LFO A;  3NK6 A;  5HY4 A;  3OBY A;  1X7P A;  3CCV F;  1CN7 A;  5G4V C;  3V3T A;  3CCS F;  2OTJ F;  3J7A R;  1VQ8 F;  2F9Z C;  3CMA F;  3WXM B;  4C4W C;  3PAF A;  1YJW F;  1VQ5 F;  3PLA C;  3SIU A;  2GLZ A;  2HVY D;  3JCM M;  1VQP F;  3VI6 A;  2BO1 A;  1VQ9 F;  1VQM F;  1RA4 A;  3VMF B;  1JJ2 F;  3LWP C;  1M1K H;  2LBX A;  3ON1 A;  1H7M A;  1PXW A;  5G4U C;  1VQ4 F;  3CCR F;  3JAM M;  5GAN K;  1KD1 H;  3LWQ C;  3CXC F;  2WAL A;  3CPQ A;  5A2Q M;  5GAP K;  3V7E A;  1NMU B;  4NQ3 A;  2QA4 F;  3CCQ F;  4BY9 D;  5GIO C;  4XCQ A;  1Q7Y H;  1T0K B;  4TZZ A;  1YI2 F;  1M90 H;  1SDS A;  3SIV A;  1NJI H;  1GO1 A;  3CC4 F;  3LWR C;  1DT9 A;  1VQK F;  3I55 F;  1Q82 H;  2OTL F;  1RLG A;  4LCK A;  5FLX M;  3GYQ A;  1QVF F;  4BVQ A;  3CC2 F;  3FFM A;  1YJ9 F;  3HJW C;  3CPW F;  2QI2 A;  1YIT F;  1K9M H;  4BW0 B;  2KTU A;  3CCU F;  3CCJ F;  1X52 A;  1Q86 H;  3E20 B;  1YIJ F;  3CCE F;  4EI8 A;  2KTV A;  1GZ0 A;  1ZWZ A;  4NUT A;  4BVT A;  1W40 A;  2I6D A;  3NVK E;  4X3L A;  3RA6 A;  1X7O A;  3NK7 A;  2ALE A;  2JNB A;  3N4Z A;  1QVG F;  2FGY A;  3OBW A;  3J80 M;  3AGK A;  4EI7 A;  3G6E F;  1W2B F;  3CME F;  1W3E X;  1K73 H;  1IPA A;  2OZB A;  3CCM F;  1YHQ F;  2QEX F;  2VGM A;  1VQ7 F;  5HY0 A;  5HY2 A;  3G71 F;  1KC8 H;  1VQO F;  3N4Y A;  2CZW A;  3IR9 A;  3LWV C;  3D00 A;  2FC3 A;  3J81 M;  3E1Y A;  1KQS F;  5HXU A;  4BVS A;  1W41 A;  4X3M A;  1Q81 H;  3RA5 A;  5FJ4 C;  4EI9 A;  3G4S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...