2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
3PAFA 1VQPF 1PXWA 3LWRC 3CCRF 3CCLF 3IR9A 1W41A 1YIJF 3I56F 3JCMM 3CC2F 1RA4A 3CPWF 1S72F 1Q7YH 2LBWA 2WALA 2FC3A 4TZZA 2OHWA 5FLXM 1VQ8F 3WXMB 1YI2F 3CCUF 4BY9D 5EWRA 1VQLF 5GAPK 5G4VC 3G6EF 3LFOA 5A2QM 3CMAF 1X52A 3AGKA 5DCVA 3CCQF 2OTLF 1E7KA 2OZBA 1JJ2F 2KG4A 2QI2A 1Q81H 5IT9M 3FFMA 3NVKE 3I55F 3SIUA 4BW0B 3OBYA 1KQSF 3NMUC 3CCVF 3PLAC 1K73H 3SIVA 3NK7A 2JNBA 3E20B 1RLGA 1VQ9F 3G4SF 1ZWZA 1KD1H 1VQOF 1YJ9F 1YJNF 3MCAB 2CZWA 5GIOC 1K9MH 1IPAA 1NJIH 1QVFF 2AIFA 1X7OA 5G4UC 3JAMM 3CCMF 3LWOC 2LBXA 1QVGF 3N4YA 2OTJF 3CMEF 1Q82H 3VI6A 1YJWF 2HVYD 4LCKA 1M1KH 1XBIA 1VQ5F 1T0KB 3V7EA 4X3LA 1M90H 1DT9A 3N4ZA 3O85A 3CCJF 1VQ4F 3V7QA 4NUTA 3HAXD 3HJWC 3CCSF 1GZ0A 3CC4F 4C4WC 5GANK 3RA5A 3G71F 3J81M 3CXCF 3J7AR 1NMUB 3CCEF 1W40A 5FJ4C 2QA4F 1SDSA 2BO1A 1K8AH 1VQMF 2QEXF 1VQNF 3LWQC 1X7PA 1KC8H 1W2BF 3LWPC 3CD6F 2VGMA 3E1YA 3CPQA 3GYQA 2I6DA 3NK6A 3NVIB 1W3EX 2ALEA 4X3MA 3VMFB 3OW2F 1VQ6F 1VQKF 5GINC 3RA6A 2KTVA 3LWVC 1CN7A 1H7MA 1GO1A 1YHQF 3CC7F 3ON1A 1VQ7F 1YITF 3CG6A 1N8RH 1W42A 2KTUA 3J80M 1GO0A 2VGNA 1Q86H 3OBWA 5GIPC 1CK2A 5EO3A
chains in the Genus database with same CATH superfamily
3HKDA 2HS3A 3KHNA 1PXWA 4RHAA 4B45A 4X1KA 4R40B 2CVLA 5HXZA 3JCMM 4C82A 4C8EA 1RA4A 1R1MA 2CSLA 2I6RA 2ZF8A 3HKCA 4TUYB 3VYTC 2KGWA 1W5BA 4BY9D 4ZK7A 3G6EF 3C8LA 5MN4A 3I3FA 1IV1A 2FGYA 3S06A 4TV9B 5EIBC 3AGKA 2VAWA 3WPXA 5HY0A 5J2TA 5HWEA 4X1IB 2OZBA 2KG4A 3SIUA 3I55F 2RHOA 5JVDB 1IV3A 3JAWA 3OBYA 1JFFA 1KQSF 5EB1B 5LP6A 3CCVF 5KX5A 3JARA 2EWCA 3DDNA 3RYIB 1H47A 1RLGA 2GZLA 4LNUA 1VQ9F 2CHSA 3IEWA 1VQOF 5EIBD 2OTMA 3F6MA 1QVFF 2H6LA 4E6EA 2AIFA 4TV9A 1KNKA 5CA1A 3LYBA 4BT2A 2LBXA 3CMEF 3VI6A 1YJWF 3JALB 1TUBB 3OONA 1VQ5F 4YJ3A 4X3LA 3V7EA 3MDOA 3N4ZA 2YXZA 4O4LB 3V7QA 4ZHQA 4O2BA 3HAXD 1GX1A 3ERNA 4C4WC 1SA0B 3WGLA 3S0WA 2BTQB 2RB9A 3V3TA 3G71F 4G4VA 2AIZP 3JALA 1FSZA 3F0DA 2BO1A 4I50B 4WBNA 1VQMF 4IHJB 3U0OA 1OFUA 1KC8H 2Q1YA 3JATB 5HXUA 2ZODA 2I6DA 2GVIA 5CA0B 1W3EX 2PMPA 3QTYA 3QHDA 4U39A 2UYKA 1X25A 2KTVA 1VK3A 5JH7B 4FFBA 5LYJB 5IJ0B 4BT3A 1TUBA 1YITF 5EYPA 4X20A 4G4WA 4ERHA 1Q86H 5CB4A 5GIPC 5HY2A 3F0FA 5JQGA 2G9IA 1JY8A 3ESJA 3JVHA 4O2AB 1VHAA 3M1XA 4B5CA 3Q8HA 3GTZA 5EZYB 5IJ0A 5JH7A 5LA6A 2Z1UA 3CCRF 2HP0A 4ZOLA 5LP6C 5ITZB 4EI8A 3IR9A 1QD9A 1W41A 1U3LA 1JN1A 4PWTA 5LP6B 1Z5VA 3JARB 1Q7YH 2LBWA 5IJ9B 1W581 1YGYA 2FC3A 4TZZA 3K0TA 3R0PA 1YI2F 3CCUF 4BT7A 5EWRA 1VQLF 5GAPK 4IHJA 3LFOA 2NMUA 5A2QM 3K14A 2H8CA 5DCVA 3CCQF 2OTLF 4TV8B 2QI2A 1Q81H 1DBFA 2ZAUA 5JCOC 3NVKE 5LYJA 2HS0A 2AMTA 3N2KB 1K73H 3EORA 4KWEA 5HP8A 4I55A 3MCQA 4U3JA 1KD1H 5GIOC 2CZWA 1K9MH 2Z01A 3VOBA 3ZOPA 3P4EA 4G88A 5G4UC 1COMA 3N4YA 1Q8RA 4LCKA 2HVYD 3FBAA 1M1KH 1XBIA 4F6RA 2DT4A 2RHHA 5BMVA 3CCJF 3O85A 4C8IA 4DRXB 1U40A 4EB6A 3C9TA 5C8YB 2P6YA 3CC4F 3IMPA 3QUWA 2LCAA 5KX5B 1OAPA 3CXCF 5HY1A 3J7AR 4EI7A 2Q1XA 1NMUB 3CCEF 1W40A 4BVTA 5FJ4C 1SDSA 5KMGB 4DXDA 5CB4B 1W5EA 3RYCB 2B33A 4B62A 1X7PA 1XRGA 3LWPC 2BTOA 3VIUA 4ZI7B 3K12A 3S03A 2HQSC 3NK6A 2ALEA 4O4HB 1VQ6F 2RHLA 1VQKF 5GINC 5IYZB 3LWVC 3JAWB 3ELCA 4O4JA 3S0YA 1GO1A 4F6RB 4BVQA 2DYYA 3RYFA 3N2GB 5FNVA 1VQ7F 4YJ2A 3V4DA 4X1IA 1N8RH 3RYHB 2N48A 3MBMA 4NWOB 2VGNA 3OBWA 1Z5WA 4I4TA 5LOVB 2RHJA 4WBNB 3UT5B 3PAFA 5IYZA 4O4JB 3LWRC 3CYQA 3FPIA 2BTUA 2PHNA 2UYJA 4O4HA 3I56F 3TD3A 5ITZA 3CPWF 2Z1FA 2HP0B 2HX0A 3D01A 4X1KB 5GONB 5FLXM 4HNAA 1UI9A 4X1YB 5HY4A 3C9UA 4BVSA 3JAKA 5G4VC 5J2UA 4I4TB 1T0AA 3RYCA 2HP3A 5CA1B 2VAPA 1E7KA 3VO8A 1XV2A 3HKEB 4XCQA 1CK2A 4BW0B 3D00A 2UZHA 3NMUC 4BVRA 3PLAC 4LNUB 2L26A 5C8YA 4ZOLB 5MN6A 3G4SF 1YJ9F 3HTNA 2UYNA 1YJNF 3DC2A 1IPAA 3M4SA 2K1SA 1QU9A 5JCOA 5JQGB 4O2AA 3WGMA 5LXTB 3S02A 5J2TB 4C8GA 3JAMM 3T80A 5EB0A 2CHTA 3LMEA 3KJKA 1DT9A 3HKCB 1RQ7A 1FNKA 1IV4A 2CW4A 3LDTA 1VQ4F 4NUTA 1CLIA 4IIJA 3ZP7A 4BT4A 3HJWC 3HKBA 1W55A 1GZ0A 4O4LA 4ZHQB 3N2KA 3RA5A 5HP7A 3P10A 2LBTA 2R751 1QAHA 4G4XA 2Z1EA 3JASA 1JD1A 5BMVB 1PF5A 3HKDB 1XHOA 3B6NA 3UT5A 2ZVZA 3RYHA 1KNJA 4I50A 3LWQC 1VQNF 1FFXB 1NQ3A 3IEQA 3ZP4A 4B46A 1ODEA 3N2GA 2VAMA 3JASB 3E1YA 3CPQA 3C9SA 3NVIB 3I7TA 1SA0A 2HS4A 3CYPB 3S0HA 3OW2F 3KE1A 4O2BB 1RLUA 3F0GA 1VQVA 3RA6A 3P0ZA 2MQEA 1H7MA 2ZVYA 4ZHVA 1YHQF 4ZI7A 3E22B 4YJ3B 4BT5A 1W5FA 4TV8A 1FNJA 2F9ZC 2IQQA 1GO0A 3C9RA 3WPWA 5J2UB 2IG8A 1VH8A 4HNAB 2IAFA 2YYEA 1VQPF 3WGJA 3CCLF 3K2XA 3VTIC 1TVKB 1YIJF 1W59A 3CC2F 2H8EA 1YQNA 5CA0A 1S72F 5JVDA 3MQWA 3WJQA 2WALA 3VOAA 2OHWA 1VQ8F 3RE3A 3IKEA 3M84A 3VYSC 3WXMB 1U43A 2R6R1 3WGKA 3CMAF 4C81A 2HRUA 4ZHWA 1X52A 4O4IA 4X20B 5FNVB 3JAKB 5EYPB 1JJ2F 4TUYA 3FFMA 3KIZA 5IT9M 4FFBB 4I55B 3HWUA 4U3JB 1W57A 3TD4A 3SIVA 2Z1TA 3HKBB 2GLZA 4IIJB 3NK7A 2JNBA 3E20B 3BYQA 1UFYA 4G4ZA 5B8FA 1ZWZA 3D54A 3ZO8A 3MCAB 1NJIH 1SZQA 1X7OA 5AVMA 1FFXA 4O4IB 3CCMF 3LWOC 1QVGF 2OTJF 1Q82H 2VXYA 3L7QA 4EI9A 5LXTA 5EAZA 3RYFB 1T0KB 1M90H 2UYNB 3FD5A 3GHZA 5IJ9A 1J7HA 3WJPA 4ZHYB 4BT6A 3CCSF 1TVKA 3F0EA 5GANK 2CWJA 3VYUC 5EZYA 3J81M 5LA6B 3HKEA 2QA4F 1U3PA 3KJJA 1K8AH 1W5AA 2QEXF 2QTPA 5KMGA 1IV2A 2V9YA 1W2BF 4X1YA 3CD6F 3E22A 2VGMA 3GYQA 1ONIA 3IKFA 5GONA 2ZOVA 3FD6A 4X3MA 3VCZA 3VMFB 1RQ2A 3RYIA 3WGNA 4DRXA 2UYPA 4EB6B 1JFFB 1CN7A 4NQ3A 3JATA 3CC7F 3ON1A 4M8IA 3CB2A 3CG6A 1H48A 3WJRA 1W42A 2KTUA 5LOVA 3J80M 2HRYA 5MN5A 4G4YA 4RQOA 4YJ2B 2W8BC 3TD5A 5EO3A
chains in the Genus database with same CATH topology
3PAFA 1VQPF 1PXWA 3LWRC 3CCRF 3CCLF 4EI8A 3IR9A 1W41A 5HXZA 1YIJF 3I56F 3JCMM 3CC2F 1RA4A 3CPWF 1S72F 1Q7YH 2LBWA 2WALA 2FC3A 2OHWA 5FLXM 4TZZA 1VQ8F 3WXMB 5HY4A 1YI2F 3CCUF 4BY9D 5EWRA 4BVSA 5GAPK 5G4VC 3G6EF 1VQLF 3LFOA 5A2QM 3CMAF 2FGYA 1X52A 3AGKA 5DCVA 3CCQF 5HY0A 2OTLF 1E7KA 5HWEA 2OZBA 1JJ2F 2KG4A 2QI2A 1Q81H 4XCQA 3FFMA 3NVKE 3I55F 3SIUA 5IT9M 4BW0B 3D00A 3OBYA 1KQSF 3NMUC 3CCVF 4BVRA 3PLAC 1K73H 3SIVA 2GLZA 3NK7A 2JNBA 3E20B 1RLGA 1VQ9F 3G4SF 1ZWZA 1KD1H 1VQOF 1YJ9F 1YJNF 3MCAB 2CZWA 5GIOC 1K9MH 1IPAA 1NJIH 1QVFF 2AIFA 1X7OA 5G4UC 3JAMM 3CCMF 3LWOC 2LBXA 1QVGF 3N4YA 2OTJF 3CMEF 1Q82H 3VI6A 1YJWF 4EI9A 2HVYD 4LCKA 1M1KH 1XBIA 1VQ5F 1T0KB 3V7EA 4X3LA 1M90H 1DT9A 3N4ZA 3O85A 3CCJF 1VQ4F 3V7QA 4NUTA 3HAXD 3HJWC 3CCSF 1GZ0A 3CC4F 4C4WC 5GANK 3RA5A 3V3TA 3G71F 3J81M 3CXCF 5HY1A 3J7AR 4EI7A 1NMUB 3CCEF 1W40A 4BVTA 2QA4F 1SDSA 5FJ4C 2BO1A 1K8AH 1VQMF 2QEXF 1VQNF 3LWQC 1X7PA 1KC8H 1W2BF 3LWPC 3CD6F 2VGMA 3E1YA 3CPQA 5HXUA 3GYQA 2I6DA 3NK6A 3NVIB 1W3EX 2ALEA 4X3MA 3VMFB 5HY2A 3OW2F 1VQ6F 1VQKF 5GINC 3RA6A 2KTVA 3LWVC 1CN7A 1H7MA 4NQ3A 1GO1A 1YHQF 4BVQA 3CC7F 3ON1A 1VQ7F 1YITF 3CG6A 1N8RH 2F9ZC 1W42A 2KTUA 3J80M 1GO0A 2VGNA 1Q86H 3OBWA 5GIPC 1CK2A 5EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  1VQP F;  1PXW A;  3LWR C;  3CCR F;  3CCL F;  3IR9 A;  1W41 A;  1YIJ F;  3I56 F;  3JCM M;  3CC2 F;  1RA4 A;  3CPW F;  1S72 F;  1Q7Y H;  2LBW A;  2WAL A;  2FC3 A;  4TZZ A;  2OHW A;  5FLX M;  1VQ8 F;  3WXM B;  1YI2 F;  3CCU F;  4BY9 D;  5EWR A;  1VQL F;  5GAP K;  5G4V C;  3G6E F;  3LFO A;  5A2Q M;  3CMA F;  1X52 A;  3AGK A;  5DCV A;  3CCQ F;  2OTL F;  1E7K A;  2OZB A;  1JJ2 F;  2KG4 A;  2QI2 A;  1Q81 H;  5IT9 M;  3FFM A;  3NVK E;  3I55 F;  3SIU A;  4BW0 B;  3OBY A;  1KQS F;  3NMU C;  3CCV F;  3PLA C;  1K73 H;  3SIV A;  3NK7 A;  2JNB A;  3E20 B;  1RLG A;  1VQ9 F;  3G4S F;  1ZWZ A;  1KD1 H;  1VQO F;  1YJ9 F;  1YJN F;  3MCA B;  2CZW A;  5GIO C;  1K9M H;  1IPA A;  1NJI H;  1QVF F;  2AIF A;  1X7O A;  5G4U C;  3JAM M;  3CCM F;  3LWO C;  2LBX A;  1QVG F;  3N4Y A;  2OTJ F;  3CME F;  1Q82 H;  3VI6 A;  1YJW F;  2HVY D;  4LCK A;  1M1K H;  1XBI A;  1VQ5 F;  1T0K B;  3V7E A;  4X3L A;  1M90 H;  1DT9 A;  3N4Z A;  3O85 A;  3CCJ F;  1VQ4 F;  3V7Q A;  4NUT A;  3HAX D;  3HJW C;  3CCS F;  1GZ0 A;  3CC4 F;  4C4W C;  5GAN K;  3RA5 A;  3G71 F;  3J81 M;  3CXC F;  3J7A R;  1NMU B;  3CCE F;  1W40 A;  5FJ4 C;  2QA4 F;  1SDS A;  2BO1 A;  1K8A H;  1VQM F;  2QEX F;  1VQN F;  3LWQ C;  1X7P A;  1KC8 H;  1W2B F;  3LWP C;  3CD6 F;  2VGM A;  3E1Y A;  3CPQ A;  3GYQ A;  2I6D A;  3NK6 A;  3NVI B;  1W3E X;  2ALE A;  4X3M A;  3VMF B;  3OW2 F;  1VQ6 F;  1VQK F;  5GIN C;  3RA6 A;  2KTV A;  3LWV C;  1CN7 A;  1H7M A;  1GO1 A;  1YHQ F;  3CC7 F;  3ON1 A;  1VQ7 F;  1YIT F;  3CG6 A;  1N8R H;  1W42 A;  2KTU A;  3J80 M;  1GO0 A;  2VGN A;  1Q86 H;  3OBW A;  5GIP C;  1CK2 A;  5EO3 A; 
#chains in the Genus database with same CATH topology
 3HKD A;  2HS3 A;  3KHN A;  1PXW A;  4RHA A;  4B45 A;  4X1K A;  4R40 B;  2CVL A;  5HXZ A;  3JCM M;  4C82 A;  4C8E A;  1RA4 A;  1R1M A;  2CSL A;  2I6R A;  2ZF8 A;  3HKC A;  4TUY B;  3VYT C;  2KGW A;  1W5B A;  4BY9 D;  4ZK7 A;  3G6E F;  3C8L A;  5MN4 A;  3I3F A;  1IV1 A;  2FGY A;  3S06 A;  4TV9 B;  5EIB C;  3AGK A;  2VAW A;  3WPX A;  5HY0 A;  5J2T A;  5HWE A;  4X1I B;  2OZB A;  2KG4 A;  3SIU A;  3I55 F;  2RHO A;  5JVD B;  1IV3 A;  3JAW A;  3OBY A;  1JFF A;  1KQS F;  5EB1 B;  5LP6 A;  3CCV F;  5KX5 A;  3JAR A;  2EWC A;  3DDN A;  3RYI B;  1H47 A;  1RLG A;  2GZL A;  4LNU A;  1VQ9 F;  2CHS A;  3IEW A;  1VQO F;  5EIB D;  2OTM A;  3F6M A;  1QVF F;  2H6L A;  4E6E A;  2AIF A;  4TV9 A;  1KNK A;  5CA1 A;  3LYB A;  4BT2 A;  2LBX A;  3CME F;  3VI6 A;  1YJW F;  3JAL B;  1TUB B;  3OON A;  1VQ5 F;  4YJ3 A;  4X3L A;  3V7E A;  3MDO A;  3N4Z A;  2YXZ A;  4O4L B;  3V7Q A;  4ZHQ A;  4O2B A;  3HAX D;  1GX1 A;  3ERN A;  4C4W C;  1SA0 B;  3WGL A;  3S0W A;  2BTQ B;  2RB9 A;  3V3T A;  3G71 F;  4G4V A;  2AIZ P;  3JAL A;  1FSZ A;  3F0D A;  2BO1 A;  4I50 B;  4WBN A;  1VQM F;  4IHJ B;  3U0O A;  1OFU A;  1KC8 H;  2Q1Y A;  3JAT B;  5HXU A;  2ZOD A;  2I6D A;  2GVI A;  5CA0 B;  1W3E X;  2PMP A;  3QTY A;  3QHD A;  4U39 A;  2UYK A;  1X25 A;  2KTV A;  1VK3 A;  5JH7 B;  4FFB A;  5LYJ B;  5IJ0 B;  4BT3 A;  1TUB A;  1YIT F;  5EYP A;  4X20 A;  4G4W A;  4ERH A;  1Q86 H;  5CB4 A;  5GIP C;  5HY2 A;  3F0F A;  5JQG A;  2G9I A;  1JY8 A;  3ESJ A;  3JVH A;  4O2A B;  1VHA A;  3M1X A;  4B5C A;  3Q8H A;  3GTZ A;  5EZY B;  5IJ0 A;  5JH7 A;  5LA6 A;  2Z1U A;  3CCR F;  2HP0 A;  4ZOL A;  5LP6 C;  5ITZ B;  4EI8 A;  3IR9 A;  1QD9 A;  1W41 A;  1U3L A;  1JN1 A;  4PWT A;  5LP6 B;  1Z5V A;  3JAR B;  1Q7Y H;  2LBW A;  5IJ9 B;  1W58 1;  1YGY A;  2FC3 A;  4TZZ A;  3K0T A;  3R0P A;  1YI2 F;  3CCU F;  4BT7 A;  5EWR A;  1VQL F;  5GAP K;  4IHJ A;  3LFO A;  2NMU A;  5A2Q M;  3K14 A;  2H8C A;  5DCV A;  3CCQ F;  2OTL F;  4TV8 B;  2QI2 A;  1Q81 H;  1DBF A;  2ZAU A;  5JCO C;  3NVK E;  5LYJ A;  2HS0 A;  2AMT A;  3N2K B;  1K73 H;  3EOR A;  4KWE A;  5HP8 A;  4I55 A;  3MCQ A;  4U3J A;  1KD1 H;  5GIO C;  2CZW A;  1K9M H;  2Z01 A;  3VOB A;  3ZOP A;  3P4E A;  4G88 A;  5G4U C;  1COM A;  3N4Y A;  1Q8R A;  4LCK A;  2HVY D;  3FBA A;  1M1K H;  1XBI A;  4F6R A;  2DT4 A;  2RHH A;  5BMV A;  3CCJ F;  3O85 A;  4C8I A;  4DRX B;  1U40 A;  4EB6 A;  3C9T A;  5C8Y B;  2P6Y A;  3CC4 F;  3IMP A;  3QUW A;  2LCA A;  5KX5 B;  1OAP A;  3CXC F;  5HY1 A;  3J7A R;  4EI7 A;  2Q1X A;  1NMU B;  3CCE F;  1W40 A;  4BVT A;  5FJ4 C;  1SDS A;  5KMG B;  4DXD A;  5CB4 B;  1W5E A;  3RYC B;  2B33 A;  4B62 A;  1X7P A;  1XRG A;  3LWP C;  2BTO A;  3VIU A;  4ZI7 B;  3K12 A;  3S03 A;  2HQS C;  3NK6 A;  2ALE A;  4O4H B;  1VQ6 F;  2RHL A;  1VQK F;  5GIN C;  5IYZ B;  3LWV C;  3JAW B;  3ELC A;  4O4J A;  3S0Y A;  1GO1 A;  4F6R B;  4BVQ A;  2DYY A;  3RYF A;  3N2G B;  5FNV A;  1VQ7 F;  4YJ2 A;  3V4D A;  4X1I A;  1N8R H;  3RYH B;  2N48 A;  3MBM A;  4NWO B;  2VGN A;  3OBW A;  1Z5W A;  4I4T A;  5LOV B;  2RHJ A;  4WBN B;  3UT5 B;  3PAF A;  5IYZ A;  4O4J B;  3LWR C;  3CYQ A;  3FPI A;  2BTU A;  2PHN A;  2UYJ A;  4O4H A;  3I56 F;  3TD3 A;  5ITZ A;  3CPW F;  2Z1F A;  2HP0 B;  2HX0 A;  3D01 A;  4X1K B;  5GON B;  5FLX M;  4HNA A;  1UI9 A;  4X1Y B;  5HY4 A;  3C9U A;  4BVS A;  3JAK A;  5G4V C;  5J2U A;  4I4T B;  1T0A A;  3RYC A;  2HP3 A;  5CA1 B;  2VAP A;  1E7K A;  3VO8 A;  1XV2 A;  3HKE B;  4XCQ A;  1CK2 A;  4BW0 B;  3D00 A;  2UZH A;  3NMU C;  4BVR A;  3PLA C;  4LNU B;  2L26 A;  5C8Y A;  4ZOL B;  5MN6 A;  3G4S F;  1YJ9 F;  3HTN A;  2UYN A;  1YJN F;  3DC2 A;  1IPA A;  3M4S A;  2K1S A;  1QU9 A;  5JCO A;  5JQG B;  4O2A A;  3WGM A;  5LXT B;  3S02 A;  5J2T B;  4C8G A;  3JAM M;  3T80 A;  5EB0 A;  2CHT A;  3LME A;  3KJK A;  1DT9 A;  3HKC B;  1RQ7 A;  1FNK A;  1IV4 A;  2CW4 A;  3LDT A;  1VQ4 F;  4NUT A;  1CLI A;  4IIJ A;  3ZP7 A;  4BT4 A;  3HJW C;  3HKB A;  1W55 A;  1GZ0 A;  4O4L A;  4ZHQ B;  3N2K A;  3RA5 A;  5HP7 A;  3P10 A;  2LBT A;  2R75 1;  1QAH A;  4G4X A;  2Z1E A;  3JAS A;  1JD1 A;  5BMV B;  1PF5 A;  3HKD B;  1XHO A;  3B6N A;  3UT5 A;  2ZVZ A;  3RYH A;  1KNJ A;  4I50 A;  3LWQ C;  1VQN F;  1FFX B;  1NQ3 A;  3IEQ A;  3ZP4 A;  4B46 A;  1ODE A;  3N2G A;  2VAM A;  3JAS B;  3E1Y A;  3CPQ A;  3C9S A;  3NVI B;  3I7T A;  1SA0 A;  2HS4 A;  3CYP B;  3S0H A;  3OW2 F;  3KE1 A;  4O2B B;  1RLU A;  3F0G A;  1VQV A;  3RA6 A;  3P0Z A;  2MQE A;  1H7M A;  2ZVY A;  4ZHV A;  1YHQ F;  4ZI7 A;  3E22 B;  4YJ3 B;  4BT5 A;  1W5F A;  4TV8 A;  1FNJ A;  2F9Z C;  2IQQ A;  1GO0 A;  3C9R A;  3WPW A;  5J2U B;  2IG8 A;  1VH8 A;  4HNA B;  2IAF A;  2YYE A;  1VQP F;  3WGJ A;  3CCL F;  3K2X A;  3VTI C;  1TVK B;  1YIJ F;  1W59 A;  3CC2 F;  2H8E A;  1YQN A;  5CA0 A;  1S72 F;  5JVD A;  3MQW A;  3WJQ A;  2WAL A;  3VOA A;  2OHW A;  1VQ8 F;  3RE3 A;  3IKE A;  3M84 A;  3VYS C;  3WXM B;  1U43 A;  2R6R 1;  3WGK A;  3CMA F;  4C81 A;  2HRU A;  4ZHW A;  1X52 A;  4O4I A;  4X20 B;  5FNV B;  3JAK B;  5EYP B;  1JJ2 F;  4TUY A;  3FFM A;  3KIZ A;  5IT9 M;  4FFB B;  4I55 B;  3HWU A;  4U3J B;  1W57 A;  3TD4 A;  3SIV A;  2Z1T A;  3HKB B;  2GLZ A;  4IIJ B;  3NK7 A;  2JNB A;  3E20 B;  3BYQ A;  1UFY A;  4G4Z A;  5B8F A;  1ZWZ A;  3D54 A;  3ZO8 A;  3MCA B;  1NJI H;  1SZQ A;  1X7O A;  5AVM A;  1FFX A;  4O4I B;  3CCM F;  3LWO C;  1QVG F;  2OTJ F;  1Q82 H;  2VXY A;  3L7Q A;  4EI9 A;  5LXT A;  5EAZ A;  3RYF B;  1T0K B;  1M90 H;  2UYN B;  3FD5 A;  3GHZ A;  5IJ9 A;  1J7H A;  3WJP A;  4ZHY B;  4BT6 A;  3CCS F;  1TVK A;  3F0E A;  5GAN K;  2CWJ A;  3VYU C;  5EZY A;  3J81 M;  5LA6 B;  3HKE A;  2QA4 F;  1U3P A;  3KJJ A;  1K8A H;  1W5A A;  2QEX F;  2QTP A;  5KMG A;  1IV2 A;  2V9Y A;  1W2B F;  4X1Y A;  3CD6 F;  3E22 A;  2VGM A;  3GYQ A;  1ONI A;  3IKF A;  5GON A;  2ZOV A;  3FD6 A;  4X3M A;  3VCZ A;  3VMF B;  1RQ2 A;  3RYI A;  3WGN A;  4DRX A;  2UYP A;  4EB6 B;  1JFF B;  1CN7 A;  4NQ3 A;  3JAT A;  3CC7 F;  3ON1 A;  4M8I A;  3CB2 A;  3CG6 A;  1H48 A;  3WJR A;  1W42 A;  2KTU A;  5LOV A;  3J80 M;  2HRY A;  5MN5 A;  4G4Y A;  4RQO A;  4YJ2 B;  2W8B C;  3TD5 A;  5EO3 A; 
#chains in the Genus database with same CATH homology
 3PAF A;  1VQP F;  1PXW A;  3LWR C;  3CCR F;  3CCL F;  4EI8 A;  3IR9 A;  1W41 A;  5HXZ A;  1YIJ F;  3I56 F;  3JCM M;  3CC2 F;  1RA4 A;  3CPW F;  1S72 F;  1Q7Y H;  2LBW A;  2WAL A;  2FC3 A;  2OHW A;  5FLX M;  4TZZ A;  1VQ8 F;  3WXM B;  5HY4 A;  1YI2 F;  3CCU F;  4BY9 D;  5EWR A;  4BVS A;  5GAP K;  5G4V C;  3G6E F;  1VQL F;  3LFO A;  5A2Q M;  3CMA F;  2FGY A;  1X52 A;  3AGK A;  5DCV A;  3CCQ F;  5HY0 A;  2OTL F;  1E7K A;  5HWE A;  2OZB A;  1JJ2 F;  2KG4 A;  2QI2 A;  1Q81 H;  4XCQ A;  3FFM A;  3NVK E;  3I55 F;  3SIU A;  5IT9 M;  4BW0 B;  3D00 A;  3OBY A;  1KQS F;  3NMU C;  3CCV F;  4BVR A;  3PLA C;  1K73 H;  3SIV A;  2GLZ A;  3NK7 A;  2JNB A;  3E20 B;  1RLG A;  1VQ9 F;  3G4S F;  1ZWZ A;  1KD1 H;  1VQO F;  1YJ9 F;  1YJN F;  3MCA B;  2CZW A;  5GIO C;  1K9M H;  1IPA A;  1NJI H;  1QVF F;  2AIF A;  1X7O A;  5G4U C;  3JAM M;  3CCM F;  3LWO C;  2LBX A;  1QVG F;  3N4Y A;  2OTJ F;  3CME F;  1Q82 H;  3VI6 A;  1YJW F;  4EI9 A;  2HVY D;  4LCK A;  1M1K H;  1XBI A;  1VQ5 F;  1T0K B;  3V7E A;  4X3L A;  1M90 H;  1DT9 A;  3N4Z A;  3O85 A;  3CCJ F;  1VQ4 F;  3V7Q A;  4NUT A;  3HAX D;  3HJW C;  3CCS F;  1GZ0 A;  3CC4 F;  4C4W C;  5GAN K;  3RA5 A;  3V3T A;  3G71 F;  3J81 M;  3CXC F;  5HY1 A;  3J7A R;  4EI7 A;  1NMU B;  3CCE F;  1W40 A;  4BVT A;  2QA4 F;  1SDS A;  5FJ4 C;  2BO1 A;  1K8A H;  1VQM F;  2QEX F;  1VQN F;  3LWQ C;  1X7P A;  1KC8 H;  1W2B F;  3LWP C;  3CD6 F;  2VGM A;  3E1Y A;  3CPQ A;  5HXU A;  3GYQ A;  2I6D A;  3NK6 A;  3NVI B;  1W3E X;  2ALE A;  4X3M A;  3VMF B;  5HY2 A;  3OW2 F;  1VQ6 F;  1VQK F;  5GIN C;  3RA6 A;  2KTV A;  3LWV C;  1CN7 A;  1H7M A;  4NQ3 A;  1GO1 A;  1YHQ F;  4BVQ A;  3CC7 F;  3ON1 A;  1VQ7 F;  1YIT F;  3CG6 A;  1N8R H;  2F9Z C;  1W42 A;  2KTU A;  3J80 M;  1GO0 A;  2VGN A;  1Q86 H;  3OBW A;  5GIP C;  1CK2 A;  5EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...