2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
3JCMM 1QVFF 1CK2A 3CCRF 3N4ZA 3CXCF 3CCVF 1W41A 2BO1A 5EO3A 1YJ9F 3HAXD 3VI6A 3PLAC 1NMUB 3OBWA 3CPWF 1N8RH 3LWQC 3LFOA 2OTLF 1K9MH 1VQOF 1VQ5F 4TZZA 3RA5A 5FLXM 1XBIA 2AIFA 5GANK 5EWRA 4LCKA 3I56F 1VQ4F 3V7QA 1K8AH 5FJ4C 2CZWA 1CN7A 3CCMF 3CG6A 3G6EF 3G4SF 1W42A 1S72F 3E1YA 1PXWA 4BY9D 3MCAB 3LWRC 1QVGF 4NUTA 1VQ9F 3V7EA 3OBYA 3N4YA 1M90H 3PAFA 1T0KB 1W2BF 3ON1A 2KG4A 1KC8H 5G4VC 1GZ0A 2QA4F 1YJNF 2LBXA 1Q7YH 3CCQF 3E20B 4BW0B 1YHQF 3SIUA 1W40A 4X3MA 1VQMF 1YI2F 3NVKE 2OZBA 1DT9A 3CCEF 1X7OA 3FFMA 3SIVA 2OTJF 2KTUA 1VQ8F 3G71F 3NVIB 3J7AR 1VQLF 1KQSF 1IPAA 3CMAF 2HVYD 3CCJF 1M1KH 3I55F 3HJWC 1SDSA 3CCUF 1W3EX 3VMFB 5GIPC 1YITF 1RA4A 2KTVA 3CCLF 3GYQA 3WXMB 3JAMM 1RLGA 3CD6F 3IR9A 3NK6A 1K73H 1Q86H 1VQNF 3CC7F 3J81M 3CC4F 2LBWA 2VGNA 1VQPF 5GINC 2VGMA 3NMUC 1GO1A 2ALEA 2WALA 1H7MA 3RA6A 1KD1H 2I6DA 3CCSF 1ZWZA 1Q81H 1X52A 1GO0A 5GIOC 2QI2A 5DCVA 2OHWA 1X7PA 3CPQA 1Q82H 1NJIH 2FC3A 3NK7A 1VQ6F 1VQ7F 3J80M 5GAPK 2JNBA 4X3LA 3CMEF 2QEXF 5G4UC 3OW2F 3LWPC 3O85A 3LWVC 3CC2F 4C4WC 1E7KA 5IT9M 1YJWF 1YIJF 1VQKF 3LWOC 1JJ2F 5A2QM 3AGKA
chains in the Genus database with same CATH superfamily
3VTIC 1KNJA 2HX0A 5FNVA 3CCRF 3P0ZA 3HAXD 1QAHA 3IMPA 4ZI7B 2CSLA 1JFFA 3K0TA 3VYSC 5HY0A 3LFOA 4BT7A 1T0AA 5ITZB 4X1KB 2OTLF 1NQ3A 1CLIA 5HY4A 4R40B 1VQOF 4G88A 1TUBB 1XBIA 2AIFA 3TD5A 5EWRA 1VQ4F 4X20B 2R6R1 3WJRA 5FJ4C 4FFBB 3G4SF 3FBAA 3ZO8A 3MCAB 4KWEA 2VAMA 3LWRC 2UZHA 3JAKB 3DDNA 5MN4A 1M90H 3N4YA 1U3LA 1T0KB 3KIZA 1W2BF 3ON1A 1KC8H 2RB9A 1RQ2A 1Q7YH 1ONIA 3HKEA 1W57A 1JY8A 3CYPB 1VQMF 2OZBA 3VO8A 4O4HA 4YJ2B 5EAZA 3CCEF 3R0PA 3FFMA 3RYHB 3RYIB 3WJPA 3JATA 1VQ8F 4C81A 3M4SA 5IJ0A 1Q8RA 3S06A 5B8FA 1VQVA 3CCUF 1W55A 1FNKA 3JARA 5GIPC 3D00A 1YITF 3CCLF 4TV8A 3TD4A 3JAWA 1RLGA 4B62A 4EI9A 4NWOB 2VXYA 2N48A 5EYPB 1K73H 1Q86H 4ZI7A 3CC7F 2LBWA 5LOVB 1VQPF 5GINC 5ITZA 3VYUC 2Z1EA 5JH7A 1GO1A 1TVKB 2ZVYA 1W5AA 1VK3A 4G4XA 2UYNB 3RA6A 1KD1H 3HKCB 2PMPA 1GO0A 2Z01A 5LXTB 4BVQA 3N2GA 5DCVA 3IEWA 1X7PA 3JALB 2BTQB 2UYKA 3NK7A 1UFYA 3HKDB 3RE3A 4ZHQA 1KNKA 4YJ3B 4DRXA 3UT5B 2JNBA 4X3LA 3S02A 5HXUA 3WPXA 3HKBA 2QEXF 3D54A 2Z1FA 3O85A 4C4WC 5J2UB 3F0FA 3IKEA 3VOAA 2IAFA 3GHZA 1YQNA 4F6RA 4I55B 1VQKF 1COMA 3CYQA 4C8EA 3C9RA 3JCMM 4G4ZA 1H48A 1DBFA 2OTMA 3MBMA 1W5EA 3CXCF 1NMUB 3OBWA 4U3JA 5LA6B 5JQGB 2CHTA 4B5CA 1U40A 1W581 3RA5A 2VAWA 3KJJA 5KMGB 2L26A 3I56F 3V7QA 1K8AH 1CN7A 3ZP7A 1S72F 4TV9A 3E1YA 5LP6A 5LOVA 1FSZA 2AMTA 4BY9D 5HXZA 1VQ9F 2HS4A 2F9ZC 1TVKA 2DYYA 3OBYA 4U39A 4BT3A 3RYFB 5EZYB 5CA0B 1YJNF 3CCQF 5HP7A 4BW0B 4HNAB 5HY2A 1YHQF 3V4DA 4LNUA 1W40A 4BT4A 3NVKE 3WGMA 3MDOA 2GVIA 4YJ3A 2RHOA 4RQOA 2PHNA 3JASA 2B33A 2ZOVA 3E22B 3SIVA 2LCAA 2MQEA 4G4YA 1R1MA 3N2KA 3J7AR 1KQSF 4BVSA 1IPAA 2ZODA 4X1YB 5CB4A 3VYTC 5JCOC 3QUWA 2G9IA 4I55A 3VMFB 3VIUA 3S0HA 1SA0A 2I6RA 3GYQA 4O4JA 3V3TA 3ZOPA 3JAMM 4C8GA 3NK6A 3ZP4A 4I4TB 5KX5B 4O2BB 3M1XA 4O4IB 3F0DA 4X1IB 4ZOLA 4I50B 4ZHYB 2CWJA 3CC4F 2W8BC 1ODEA 2VGNA 1IV1A 5LA6A 1PF5A 5C8YA 3F0EA 3NMUC 2ALEA 1YGYA 3ESJA 3WGJA 1H7MA 4TUYB 2YYEA 4BVTA 1X52A 2CVLA 2Z1UA 4PWTA 1NJIH 3FD6A 5GAPK 2R751 5G4UC 3ERNA 3OW2F 3RYFA 2H6LA 4XCQA 3LWVC 3VOBA 3LYBA 5IT9M 4X1KA 1YIJF 2HRYA 3LWOC 2IG8A 1VH8A 1TUBA 1QVFF 1UI9A 3E22A 3QTYA 1SZQA 3N4ZA 2LBTA 4X20A 4DXDA 3CCVF 5EO3A 4FFBA 2BTOA 4EB6B 3CPWF 3LWQC 2HP0B 1XHOA 4X1YA 3JAKA 3VCZA 1VQ5F 1OAPA 1U43A 4TZZA 5GANK 1Z5VA 4LCKA 3KJKA 2YXZA 5KX5A 3C9TA 2CZWA 4I50A 1JFFB 3CG6A 3G6EF 1PXWA 1QVGF 4NUTA 3WGLA 5J2TB 4YJ2A 2K1SA 2VAPA 3RYHA 3RYIA 4B45A 2KGWA 2GLZA 3PAFA 3TD3A 2KG4A 1OFUA 3E20B 5JVDB 3SIUA 4X3MA 1YI2F 2ZVZA 4IHJB 5LYJB 2CW4A 1X25A 4WBNB 1QD9A 1X7OA 5HY1A 2UYJA 4ZK7A 3B6NA 5EYPA 4EI8A 2KTUA 3DC2A 3NVIB 1VQLF 4ERHA 3D01A 4RHAA 3CCJF 1M1KH 3HKEB 1JN1A 2KTVA 5AVMA 1RLUA 3WXMB 4O4HB 3CD6F 2UYNA 3T80A 3JATB 3HKCA 4EI7A 5IJ9B 2HS3A 5LXTA 3S0WA 4EB6A 1H47A 3LMEA 5IJ0B 3JALA 2HP0A 2UYPA 4C82A 3HKDA 3I7TA 4BT2A 3OONA 2VGMA 3UT5A 4BT5A 3JARB 1FFXB 3C8LA 5EIBC 1VHAA 3JAWB 2CHSA 5MN6A 3CCSF 5J2UA 1U3PA 5GIOC 1Q82H 1VQ6F 1VQ7F 4BVRA 1RQ7A 3L7QA 5JH7B 5J2TA 4G4WA 4ZHVA 3CMEF 5CA1B 2Z1TA 4IIJB 1E7KA 3U0OA 5JQGA 3N2GB 5JVDA 5BMVB 3CB2A 3MQWA 2DT4A 1JJ2F 5A2QM 4IHJA 5LYJA 4ZHQB 4DRXB 3AGKA 4WBNA 3K12A 1CK2A 5KMGA 3HKBB 3S03A 1W41A 2BO1A 1YJ9F 3WGKA 3VI6A 3PLAC 1N8RH 2BTUA 3IEQA 4O2AB 5LP6C 2NMUA 1QU9A 4F6RB 1K9MH 3WJQA 3Q8HA 5FLXM 5EIBD 1GX1A 5EZYA 5CA0A 1IV2A 2Q1YA 5IJ9A 3P10A 4C8IA 3QHDA 4HNAA 3CCMF 4U3JB 5IYZB 1W42A 3KHNA 2QTPA 2P6YA 2AIZP 3V7EA 1W59A 1FFXA 4O4LB 1JD1A 2Q1XA 1IV3A 5G4VC 1GZ0A 2QA4F 2LBXA 5GONB 1J7HA 3EORA 3RYCB 4TV9B 3MCQA 5LP6B 1DT9A 3FPIA 3BYQA 4I4TA 5FNVB 5CA1A 2HP3A 3FD5A 4O2BA 1IV4A 2OTJF 4O4IA 4X1IA 3G71F 2RHJA 4IIJA 3CMAF 2HVYD 1Z5WA 3I55F 3HJWC 5EB0A 1SDSA 5BMVA 4NQ3A 1W3EX 4LNUB 1W5FA 1RA4A 4BT6A 4TUYA 2ZAUA 3IR9A 3JASB 2IQQA 5HP8A 1XRGA 3C9UA 3HWUA 5EB1B 2HS0A 3N2KB 4M8IA 2EWCA 1VQNF 3LDTA 3J81M 2ZF8A 4O2AA 2RHHA 3K2XA 5JCOA 5CB4B 3JVHA 5MN5A 2HQSC 2WALA 3C9SA 2GZLA 3P4EA 5HWEA 1SA0B 4O4JB 1W5BA 3F0GA 3HTNA 2I6DA 3S0YA 1ZWZA 1Q81H 2FGYA 3KE1A 2QI2A 4G4VA 4ZOLB 3M84A 2OHWA 3CPQA 2FC3A 5IYZA 2H8EA 3WPWA 2HRUA 5C8YB 3F6MA 4B46A 3J80M 3ELCA 4O4LA 3I3FA 3WGNA 1XV2A 3K14A 2H8CA 3LWPC 3CC2F 5GONA 3GTZA 4E6EA 2RHLA 1YJWF 2V9YA 3RYCA 1FNJA 4ZHWA 3IKFA 4TV8B
chains in the Genus database with same CATH topology
3JCMM 1QVFF 1CK2A 3CCRF 3N4ZA 3CXCF 3CCVF 1W41A 2BO1A 5EO3A 1YJ9F 3HAXD 3VI6A 3PLAC 1NMUB 3OBWA 3CPWF 1N8RH 3LWQC 5HY0A 3LFOA 2OTLF 5HY4A 1K9MH 1VQOF 1VQ5F 4TZZA 3RA5A 5FLXM 1XBIA 2AIFA 5GANK 5EWRA 4LCKA 3I56F 1VQ4F 3V7QA 1K8AH 5FJ4C 2CZWA 1CN7A 3CCMF 3CG6A 3G6EF 3G4SF 1W42A 1S72F 3E1YA 1PXWA 4BY9D 3MCAB 3LWRC 5HXZA 4NUTA 1QVGF 1VQ9F 2F9ZC 3V7EA 3OBYA 3N4YA 1M90H 2GLZA 3PAFA 1T0KB 1W2BF 3ON1A 2KG4A 1KC8H 5G4VC 1GZ0A 2QA4F 1YJNF 2LBXA 1Q7YH 3CCQF 3E20B 4BW0B 5HY2A 1YHQF 3SIUA 1W40A 4X3MA 1VQMF 1YI2F 3NVKE 2OZBA 1DT9A 3CCEF 1X7OA 3FFMA 3SIVA 5HY1A 2OTJF 4EI8A 2KTUA 1VQ8F 3G71F 3NVIB 3J7AR 1VQLF 1KQSF 4BVSA 1IPAA 3CMAF 2HVYD 3CCJF 1M1KH 3I55F 3HJWC 1SDSA 3CCUF 4NQ3A 1W3EX 3VMFB 5GIPC 3D00A 1YITF 1RA4A 2KTVA 3CCLF 3GYQA 3V3TA 3WXMB 3JAMM 1RLGA 3CD6F 4EI9A 3IR9A 3NK6A 4EI7A 1K73H 1Q86H 1VQNF 3CC7F 3J81M 3CC4F 2LBWA 2VGNA 1VQPF 5GINC 2VGMA 3NMUC 1GO1A 2ALEA 2WALA 5HWEA 1H7MA 3RA6A 1KD1H 4BVTA 2I6DA 3CCSF 1ZWZA 1Q81H 2FGYA 1X52A 1GO0A 5GIOC 2QI2A 4BVQA 5DCVA 2OHWA 1X7PA 3CPQA 1Q82H 1NJIH 2FC3A 3NK7A 1VQ6F 1VQ7F 3J80M 4BVRA 5GAPK 2JNBA 4X3LA 3CMEF 5HXUA 2QEXF 5G4UC 3OW2F 3LWPC 3O85A 4XCQA 3LWVC 3CC2F 4C4WC 1E7KA 5IT9M 1YJWF 1YIJF 1VQKF 3LWOC 1JJ2F 5A2QM 3AGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM M;  1QVF F;  1CK2 A;  3CCR F;  3N4Z A;  3CXC F;  3CCV F;  1W41 A;  2BO1 A;  5EO3 A;  1YJ9 F;  3HAX D;  3VI6 A;  3PLA C;  1NMU B;  3OBW A;  3CPW F;  1N8R H;  3LWQ C;  3LFO A;  2OTL F;  1K9M H;  1VQO F;  1VQ5 F;  4TZZ A;  3RA5 A;  5FLX M;  1XBI A;  2AIF A;  5GAN K;  5EWR A;  4LCK A;  3I56 F;  1VQ4 F;  3V7Q A;  1K8A H;  5FJ4 C;  2CZW A;  1CN7 A;  3CCM F;  3CG6 A;  3G6E F;  3G4S F;  1W42 A;  1S72 F;  3E1Y A;  1PXW A;  4BY9 D;  3MCA B;  3LWR C;  1QVG F;  4NUT A;  1VQ9 F;  3V7E A;  3OBY A;  3N4Y A;  1M90 H;  3PAF A;  1T0K B;  1W2B F;  3ON1 A;  2KG4 A;  1KC8 H;  5G4V C;  1GZ0 A;  2QA4 F;  1YJN F;  2LBX A;  1Q7Y H;  3CCQ F;  3E20 B;  4BW0 B;  1YHQ F;  3SIU A;  1W40 A;  4X3M A;  1VQM F;  1YI2 F;  3NVK E;  2OZB A;  1DT9 A;  3CCE F;  1X7O A;  3FFM A;  3SIV A;  2OTJ F;  2KTU A;  1VQ8 F;  3G71 F;  3NVI B;  3J7A R;  1VQL F;  1KQS F;  1IPA A;  3CMA F;  2HVY D;  3CCJ F;  1M1K H;  3I55 F;  3HJW C;  1SDS A;  3CCU F;  1W3E X;  3VMF B;  5GIP C;  1YIT F;  1RA4 A;  2KTV A;  3CCL F;  3GYQ A;  3WXM B;  3JAM M;  1RLG A;  3CD6 F;  3IR9 A;  3NK6 A;  1K73 H;  1Q86 H;  1VQN F;  3CC7 F;  3J81 M;  3CC4 F;  2LBW A;  2VGN A;  1VQP F;  5GIN C;  2VGM A;  3NMU C;  1GO1 A;  2ALE A;  2WAL A;  1H7M A;  3RA6 A;  1KD1 H;  2I6D A;  3CCS F;  1ZWZ A;  1Q81 H;  1X52 A;  1GO0 A;  5GIO C;  2QI2 A;  5DCV A;  2OHW A;  1X7P A;  3CPQ A;  1Q82 H;  1NJI H;  2FC3 A;  3NK7 A;  1VQ6 F;  1VQ7 F;  3J80 M;  5GAP K;  2JNB A;  4X3L A;  3CME F;  2QEX F;  5G4U C;  3OW2 F;  3LWP C;  3O85 A;  3LWV C;  3CC2 F;  4C4W C;  1E7K A;  5IT9 M;  1YJW F;  1YIJ F;  1VQK F;  3LWO C;  1JJ2 F;  5A2Q M;  3AGK A; 
#chains in the Genus database with same CATH topology
 3VTI C;  1KNJ A;  2HX0 A;  5FNV A;  3CCR F;  3P0Z A;  3HAX D;  1QAH A;  3IMP A;  4ZI7 B;  2CSL A;  1JFF A;  3K0T A;  3VYS C;  5HY0 A;  3LFO A;  4BT7 A;  1T0A A;  5ITZ B;  4X1K B;  2OTL F;  1NQ3 A;  1CLI A;  5HY4 A;  4R40 B;  1VQO F;  4G88 A;  1TUB B;  1XBI A;  2AIF A;  3TD5 A;  5EWR A;  1VQ4 F;  4X20 B;  2R6R 1;  3WJR A;  5FJ4 C;  4FFB B;  3G4S F;  3FBA A;  3ZO8 A;  3MCA B;  4KWE A;  2VAM A;  3LWR C;  2UZH A;  3JAK B;  3DDN A;  5MN4 A;  1M90 H;  3N4Y A;  1U3L A;  1T0K B;  3KIZ A;  1W2B F;  3ON1 A;  1KC8 H;  2RB9 A;  1RQ2 A;  1Q7Y H;  1ONI A;  3HKE A;  1W57 A;  1JY8 A;  3CYP B;  1VQM F;  2OZB A;  3VO8 A;  4O4H A;  4YJ2 B;  5EAZ A;  3CCE F;  3R0P A;  3FFM A;  3RYH B;  3RYI B;  3WJP A;  3JAT A;  1VQ8 F;  4C81 A;  3M4S A;  5IJ0 A;  1Q8R A;  3S06 A;  5B8F A;  1VQV A;  3CCU F;  1W55 A;  1FNK A;  3JAR A;  5GIP C;  3D00 A;  1YIT F;  3CCL F;  4TV8 A;  3TD4 A;  3JAW A;  1RLG A;  4B62 A;  4EI9 A;  4NWO B;  2VXY A;  2N48 A;  5EYP B;  1K73 H;  1Q86 H;  4ZI7 A;  3CC7 F;  2LBW A;  5LOV B;  1VQP F;  5GIN C;  5ITZ A;  3VYU C;  2Z1E A;  5JH7 A;  1GO1 A;  1TVK B;  2ZVY A;  1W5A A;  1VK3 A;  4G4X A;  2UYN B;  3RA6 A;  1KD1 H;  3HKC B;  2PMP A;  1GO0 A;  2Z01 A;  5LXT B;  4BVQ A;  3N2G A;  5DCV A;  3IEW A;  1X7P A;  3JAL B;  2BTQ B;  2UYK A;  3NK7 A;  1UFY A;  3HKD B;  3RE3 A;  4ZHQ A;  1KNK A;  4YJ3 B;  4DRX A;  3UT5 B;  2JNB A;  4X3L A;  3S02 A;  5HXU A;  3WPX A;  3HKB A;  2QEX F;  3D54 A;  2Z1F A;  3O85 A;  4C4W C;  5J2U B;  3F0F A;  3IKE A;  3VOA A;  2IAF A;  3GHZ A;  1YQN A;  4F6R A;  4I55 B;  1VQK F;  1COM A;  3CYQ A;  4C8E A;  3C9R A;  3JCM M;  4G4Z A;  1H48 A;  1DBF A;  2OTM A;  3MBM A;  1W5E A;  3CXC F;  1NMU B;  3OBW A;  4U3J A;  5LA6 B;  5JQG B;  2CHT A;  4B5C A;  1U40 A;  1W58 1;  3RA5 A;  2VAW A;  3KJJ A;  5KMG B;  2L26 A;  3I56 F;  3V7Q A;  1K8A H;  1CN7 A;  3ZP7 A;  1S72 F;  4TV9 A;  3E1Y A;  5LP6 A;  5LOV A;  1FSZ A;  2AMT A;  4BY9 D;  5HXZ A;  1VQ9 F;  2HS4 A;  2F9Z C;  1TVK A;  2DYY A;  3OBY A;  4U39 A;  4BT3 A;  3RYF B;  5EZY B;  5CA0 B;  1YJN F;  3CCQ F;  5HP7 A;  4BW0 B;  4HNA B;  5HY2 A;  1YHQ F;  3V4D A;  4LNU A;  1W40 A;  4BT4 A;  3NVK E;  3WGM A;  3MDO A;  2GVI A;  4YJ3 A;  2RHO A;  4RQO A;  2PHN A;  3JAS A;  2B33 A;  2ZOV A;  3E22 B;  3SIV A;  2LCA A;  2MQE A;  4G4Y A;  1R1M A;  3N2K A;  3J7A R;  1KQS F;  4BVS A;  1IPA A;  2ZOD A;  4X1Y B;  5CB4 A;  3VYT C;  5JCO C;  3QUW A;  2G9I A;  4I55 A;  3VMF B;  3VIU A;  3S0H A;  1SA0 A;  2I6R A;  3GYQ A;  4O4J A;  3V3T A;  3ZOP A;  3JAM M;  4C8G A;  3NK6 A;  3ZP4 A;  4I4T B;  5KX5 B;  4O2B B;  3M1X A;  4O4I B;  3F0D A;  4X1I B;  4ZOL A;  4I50 B;  4ZHY B;  2CWJ A;  3CC4 F;  2W8B C;  1ODE A;  2VGN A;  1IV1 A;  5LA6 A;  1PF5 A;  5C8Y A;  3F0E A;  3NMU C;  2ALE A;  1YGY A;  3ESJ A;  3WGJ A;  1H7M A;  4TUY B;  2YYE A;  4BVT A;  1X52 A;  2CVL A;  2Z1U A;  4PWT A;  1NJI H;  3FD6 A;  5GAP K;  2R75 1;  5G4U C;  3ERN A;  3OW2 F;  3RYF A;  2H6L A;  4XCQ A;  3LWV C;  3VOB A;  3LYB A;  5IT9 M;  4X1K A;  1YIJ F;  2HRY A;  3LWO C;  2IG8 A;  1VH8 A;  1TUB A;  1QVF F;  1UI9 A;  3E22 A;  3QTY A;  1SZQ A;  3N4Z A;  2LBT A;  4X20 A;  4DXD A;  3CCV F;  5EO3 A;  4FFB A;  2BTO A;  4EB6 B;  3CPW F;  3LWQ C;  2HP0 B;  1XHO A;  4X1Y A;  3JAK A;  3VCZ A;  1VQ5 F;  1OAP A;  1U43 A;  4TZZ A;  5GAN K;  1Z5V A;  4LCK A;  3KJK A;  2YXZ A;  5KX5 A;  3C9T A;  2CZW A;  4I50 A;  1JFF B;  3CG6 A;  3G6E F;  1PXW A;  1QVG F;  4NUT A;  3WGL A;  5J2T B;  4YJ2 A;  2K1S A;  2VAP A;  3RYH A;  3RYI A;  4B45 A;  2KGW A;  2GLZ A;  3PAF A;  3TD3 A;  2KG4 A;  1OFU A;  3E20 B;  5JVD B;  3SIU A;  4X3M A;  1YI2 F;  2ZVZ A;  4IHJ B;  5LYJ B;  2CW4 A;  1X25 A;  4WBN B;  1QD9 A;  1X7O A;  5HY1 A;  2UYJ A;  4ZK7 A;  3B6N A;  5EYP A;  4EI8 A;  2KTU A;  3DC2 A;  3NVI B;  1VQL F;  4ERH A;  3D01 A;  4RHA A;  3CCJ F;  1M1K H;  3HKE B;  1JN1 A;  2KTV A;  5AVM A;  1RLU A;  3WXM B;  4O4H B;  3CD6 F;  2UYN A;  3T80 A;  3JAT B;  3HKC A;  4EI7 A;  5IJ9 B;  2HS3 A;  5LXT A;  3S0W A;  4EB6 A;  1H47 A;  3LME A;  5IJ0 B;  3JAL A;  2HP0 A;  2UYP A;  4C82 A;  3HKD A;  3I7T A;  4BT2 A;  3OON A;  2VGM A;  3UT5 A;  4BT5 A;  3JAR B;  1FFX B;  3C8L A;  5EIB C;  1VHA A;  3JAW B;  2CHS A;  5MN6 A;  3CCS F;  5J2U A;  1U3P A;  5GIO C;  1Q82 H;  1VQ6 F;  1VQ7 F;  4BVR A;  1RQ7 A;  3L7Q A;  5JH7 B;  5J2T A;  4G4W A;  4ZHV A;  3CME F;  5CA1 B;  2Z1T A;  4IIJ B;  1E7K A;  3U0O A;  5JQG A;  3N2G B;  5JVD A;  5BMV B;  3CB2 A;  3MQW A;  2DT4 A;  1JJ2 F;  5A2Q M;  4IHJ A;  5LYJ A;  4ZHQ B;  4DRX B;  3AGK A;  4WBN A;  3K12 A;  1CK2 A;  5KMG A;  3HKB B;  3S03 A;  1W41 A;  2BO1 A;  1YJ9 F;  3WGK A;  3VI6 A;  3PLA C;  1N8R H;  2BTU A;  3IEQ A;  4O2A B;  5LP6 C;  2NMU A;  1QU9 A;  4F6R B;  1K9M H;  3WJQ A;  3Q8H A;  5FLX M;  5EIB D;  1GX1 A;  5EZY A;  5CA0 A;  1IV2 A;  2Q1Y A;  5IJ9 A;  3P10 A;  4C8I A;  3QHD A;  4HNA A;  3CCM F;  4U3J B;  5IYZ B;  1W42 A;  3KHN A;  2QTP A;  2P6Y A;  2AIZ P;  3V7E A;  1W59 A;  1FFX A;  4O4L B;  1JD1 A;  2Q1X A;  1IV3 A;  5G4V C;  1GZ0 A;  2QA4 F;  2LBX A;  5GON B;  1J7H A;  3EOR A;  3RYC B;  4TV9 B;  3MCQ A;  5LP6 B;  1DT9 A;  3FPI A;  3BYQ A;  4I4T A;  5FNV B;  5CA1 A;  2HP3 A;  3FD5 A;  4O2B A;  1IV4 A;  2OTJ F;  4O4I A;  4X1I A;  3G71 F;  2RHJ A;  4IIJ A;  3CMA F;  2HVY D;  1Z5W A;  3I55 F;  3HJW C;  5EB0 A;  1SDS A;  5BMV A;  4NQ3 A;  1W3E X;  4LNU B;  1W5F A;  1RA4 A;  4BT6 A;  4TUY A;  2ZAU A;  3IR9 A;  3JAS B;  2IQQ A;  5HP8 A;  1XRG A;  3C9U A;  3HWU A;  5EB1 B;  2HS0 A;  3N2K B;  4M8I A;  2EWC A;  1VQN F;  3LDT A;  3J81 M;  2ZF8 A;  4O2A A;  2RHH A;  3K2X A;  5JCO A;  5CB4 B;  3JVH A;  5MN5 A;  2HQS C;  2WAL A;  3C9S A;  2GZL A;  3P4E A;  5HWE A;  1SA0 B;  4O4J B;  1W5B A;  3F0G A;  3HTN A;  2I6D A;  3S0Y A;  1ZWZ A;  1Q81 H;  2FGY A;  3KE1 A;  2QI2 A;  4G4V A;  4ZOL B;  3M84 A;  2OHW A;  3CPQ A;  2FC3 A;  5IYZ A;  2H8E A;  3WPW A;  2HRU A;  5C8Y B;  3F6M A;  4B46 A;  3J80 M;  3ELC A;  4O4L A;  3I3F A;  3WGN A;  1XV2 A;  3K14 A;  2H8C A;  3LWP C;  3CC2 F;  5GON A;  3GTZ A;  4E6E A;  2RHL A;  1YJW F;  2V9Y A;  3RYC A;  1FNJ A;  4ZHW A;  3IKF A;  4TV8 B; 
#chains in the Genus database with same CATH homology
 3JCM M;  1QVF F;  1CK2 A;  3CCR F;  3N4Z A;  3CXC F;  3CCV F;  1W41 A;  2BO1 A;  5EO3 A;  1YJ9 F;  3HAX D;  3VI6 A;  3PLA C;  1NMU B;  3OBW A;  3CPW F;  1N8R H;  3LWQ C;  5HY0 A;  3LFO A;  2OTL F;  5HY4 A;  1K9M H;  1VQO F;  1VQ5 F;  4TZZ A;  3RA5 A;  5FLX M;  1XBI A;  2AIF A;  5GAN K;  5EWR A;  4LCK A;  3I56 F;  1VQ4 F;  3V7Q A;  1K8A H;  5FJ4 C;  2CZW A;  1CN7 A;  3CCM F;  3CG6 A;  3G6E F;  3G4S F;  1W42 A;  1S72 F;  3E1Y A;  1PXW A;  4BY9 D;  3MCA B;  3LWR C;  5HXZ A;  4NUT A;  1QVG F;  1VQ9 F;  2F9Z C;  3V7E A;  3OBY A;  3N4Y A;  1M90 H;  2GLZ A;  3PAF A;  1T0K B;  1W2B F;  3ON1 A;  2KG4 A;  1KC8 H;  5G4V C;  1GZ0 A;  2QA4 F;  1YJN F;  2LBX A;  1Q7Y H;  3CCQ F;  3E20 B;  4BW0 B;  5HY2 A;  1YHQ F;  3SIU A;  1W40 A;  4X3M A;  1VQM F;  1YI2 F;  3NVK E;  2OZB A;  1DT9 A;  3CCE F;  1X7O A;  3FFM A;  3SIV A;  5HY1 A;  2OTJ F;  4EI8 A;  2KTU A;  1VQ8 F;  3G71 F;  3NVI B;  3J7A R;  1VQL F;  1KQS F;  4BVS A;  1IPA A;  3CMA F;  2HVY D;  3CCJ F;  1M1K H;  3I55 F;  3HJW C;  1SDS A;  3CCU F;  4NQ3 A;  1W3E X;  3VMF B;  5GIP C;  3D00 A;  1YIT F;  1RA4 A;  2KTV A;  3CCL F;  3GYQ A;  3V3T A;  3WXM B;  3JAM M;  1RLG A;  3CD6 F;  4EI9 A;  3IR9 A;  3NK6 A;  4EI7 A;  1K73 H;  1Q86 H;  1VQN F;  3CC7 F;  3J81 M;  3CC4 F;  2LBW A;  2VGN A;  1VQP F;  5GIN C;  2VGM A;  3NMU C;  1GO1 A;  2ALE A;  2WAL A;  5HWE A;  1H7M A;  3RA6 A;  1KD1 H;  4BVT A;  2I6D A;  3CCS F;  1ZWZ A;  1Q81 H;  2FGY A;  1X52 A;  1GO0 A;  5GIO C;  2QI2 A;  4BVQ A;  5DCV A;  2OHW A;  1X7P A;  3CPQ A;  1Q82 H;  1NJI H;  2FC3 A;  3NK7 A;  1VQ6 F;  1VQ7 F;  3J80 M;  4BVR A;  5GAP K;  2JNB A;  4X3L A;  3CME F;  5HXU A;  2QEX F;  5G4U C;  3OW2 F;  3LWP C;  3O85 A;  4XCQ A;  3LWV C;  3CC2 F;  4C4W C;  1E7K A;  5IT9 M;  1YJW F;  1YIJ F;  1VQK F;  3LWO C;  1JJ2 F;  5A2Q M;  3AGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...