2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
b'TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
3PAFA 1XBIA 3CCUF 3SIVA 1VQLF 1YIJF 2JNBA 3CC2F 1VQOF 3FFMA 3CMAF 1W40A 5IT9M 3AGKA 3SIUA 1M90H 1W2BF 3HAXD 4BW0B 3LWRC 3CMEF 2AIFA 4X3LA 3G71F 3HJWC 3OW2F 5DCVA 4BY9D 3RA5A 3CCEF 5FJ4C 2OTJF 3E20B 3JAMM 5G4VC 2QA4F 2ALEA 3CPWF 3LFOA 3CPQA 1PXWA 1T0KB 3CXCF 3N4YA 1IPAA 5A2QM 1JJ2F 3RA6A 4NUTA 1GO0A 2QI2A 1NJIH 1YJNF 2CZWA 1E7KA 1GZ0A 1YJWF 1Q86H 3CD6F 1K73H 1M1KH 1VQ4F 1X7PA 3VI6A 5GANK 3J80M 1CK2A 1RLGA 2VGMA 3NVIB 1N8RH 2KTVA 1KQSF 1VQMF 1NMUB 1YITF 3G6EF 1CN7A 2KTUA 5EWRA 3I56F 5GAPK 3CCQF 3CG6A 1VQKF 2OHWA 3CCSF 1ZWZA 1Q81H 3O85A 3IR9A 5G4UC 3N4ZA 3J7AR 1KC8H 1K8AH 1VQ8F 5FLXM 5EO3A 5GIOC 1X52A 1Q7YH 5GINC 3G4SF 2OZBA 1VQ5F 3LWPC 1H7MA 3NK6A 3MCAB 2LBXA 3CC7F 3CC4F 1VQNF 3J81M 3LWVC 3VMFB 1VQ9F 3WXMB 3LWQC 2KG4A 1Q82H 3NK7A 1YHQF 3OBWA 1VQ6F 2HVYD 1QVGF 1RA4A 2FC3A 3I55F 2WALA 4C4WC 1YI2F 3V7EA 2VGNA 3OBYA 2OTLF 1X7OA 2BO1A 3GYQA 5GIPC 3LWOC 1YJ9F 1DT9A 1W41A 1W42A 3E1YA 3CCJF 3CCMF 4X3MA 1QVFF 3V7QA 4LCKA 1S72F 3PLAC 3CCRF 1W3EX 3CCLF 2LBWA 1VQ7F 1GO1A 1VQPF 1SDSA 3CCVF 3JCMM 3NMUC 3ON1A 1KD1H 3NVKE 2I6DA 4TZZA 2QEXF 1K9MH
chains in the Genus database with same CATH superfamily
5GONA 4BT5A 3ZP4A 3JASB 2YXZA 3B6NA 1VQLF 3P0ZA 1VQOF 1U40A 5LP6A 3GTZA 1TUBB 4X20B 4XCQA 3WGNA 1JN1A 1W40A 2UYJA 4BW0B 2DYYA 4TV8A 4PWTA 5CB4A 4ZHQB 5HY4A 3RYIB 5IJ9B 3HJWC 3RYFB 1FNJA 1W5AA 5FJ4C 4X1YA 2OTJF 2B33A 2ALEA 3I7TA 3N2GA 3CPWF 5CA0B 5A2QM 5HY0A 5IYZA 2Z1FA 3IMPA 5EIBC 1GO0A 3ZP7A 1E7KA 4IHJB 5ITZB 5J2UB 3WGLA 4R40B 3HKEA 3JAWB 1K73H 3C9UA 4ZHYB 5LYJB 1VQ4F 5IJ0B 4F6RA 2P6YA 4EB6A 5KX5A 3FD6A 5EB1B 2KTVA 3VIUA 1NMUB 2KGWA 3BYQA 3I56F 2VAWA 2V9YA 3CG6A 3MCQA 3CCSF 1Q81H 4O4HB 3O85A 2RB9A 3LMEA 1KNJA 1W55A 4NQ3A 3N4ZA 1SA0A 2GLZA 3F0FA 2Z1UA 4X1KB 3KHNA 3J7AR 3E22A 3P4EA 4O2AA 1X25A 5FLXM 5JQGA 3WGKA 3M1XA 5EZYA 2LBXA 3CC7F 2ZODA 3CC4F 1VQNF 4G4YA 1Z5WA 4BT6A 4E6EA 3WXMB 3LWQC 1W5BA 2KG4A 1Q82H 1YHQF 3VOBA 4U39A 4LNUA 4BT2A 4C4WC 3V7EA 4C82A 4O4LB 3UT5B 5JVDA 5HWEA 2UYNB 4YJ2A 3VCZA 3RYHA 2ZOVA 3GYQA 2IG8A 1W41A 3HKDA 3QTYA 2HS3A 4O4JA 4WBNA 1IV2A 3RYCB 2CWJA 2LBWA 1SDSA 1VQPF 4ZI7A 5B8FA 5MN6A 4BT7A 1JFFA 4ZHWA 3ERNA 3PAFA 4ZHVA 2VXYA 3TD3A 2GVIA 2JNBA 4G4WA 1SZQA 4I4TA 3C9SA 3FFMA 3JARA 4C8IA 3CMAF 3SIUA 2CSLA 2QTPA 1KNKA 5JH7A 3LWRC 3WGMA 5EYPB 2HS0A 4O2BA 2HRUA 3VYSC 3RA5A 2HX0A 5G4VC 3FBAA 3L7QA 2UYPA 4G4XA 5CA1A 4TV9A 3S0YA 2AIZP 3LFOA 3V3TA 2BTQB 3MBMA 2LBTA 1T0KB 3R0PA 1JJ2F 1UI9A 3QHDA 4NUTA 3T80A 2AMTA 1U3PA 2QI2A 1NJIH 1YJNF 2CZWA 4ZOLB 1GZ0A 4I55A 1QD9A 3FD5A 3CD6F 5FNVA 1U43A 1COMA 1M1KH 3F0EA 5GANK 4O4IA 1RLGA 2VGMA 3NVIB 1N8RH 1VQMF 5C8YA 3G6EF 3JVHA 1YITF 2EWCA 5EWRA 4BT4A 5GAPK 3N2KA 4BVQA 3K14A 3K2XA 3C9TA 4F6RB 3JALA 1VQKF 4EB6B 4FFBA 4G88A 2YYEA 5J2TA 1TVKB 3IR9A 3F0GA 4X1IA 3CYQA 4ERHA 1R1MA 4I50A 1DBFA 3MDOA 1K8AH 1VQ8F 1W59A 1Q7YH 1FFXB 5GINC 1QAHA 2OZBA 1VQ5F 2R6R1 1H7MA 5LXTA 3MCAB 3LWPC 3JASA 1W57A 3HKBB 5EAZA 3OBWA 4X20A 2LCAA 2PMPA 4TUYA 4EI9A 3ESJA 3RYIA 4EI7A 1Q8RA 1NQ3A 2BTOA 4ZHQA 5IJ9A 5GIPC 3CCJF 3CCMF 1QVFF 4LCKA 3V7QA 2GZLA 4BVTA 3S06A 2MQEA 4YJ2B 3CCVF 4HNAA 1W5EA 5CA0A 3HKDB 4WBNB 2NMUA 3JAKB 3NMUC 1XHOA 5LA6B 2FGYA 5KMGB 3M84A 4IHJA 4TZZA 5ITZA 3F6MA 5J2UA 3S02A 2Q1XA 4YJ3B 3JAWA 1JFFB 5IJ0A 3CC2F 2HP0B 3D01A 4B5CA 1RQ2A 2HQSC 1M90H 1IV3A 4DRXA 1H47A 1W2BF 3HAXD 3CMEF 1U3LA 2AIFA 4X3LA 1W5FA 4C81A 2VAPA 1Z5VA 2Z01A 1GX1A 2BTUA 3CCEF 3MQWA 4RQOA 5JH7B 2W8BC 4G4VA 2QA4F 3M4SA 3U0OA 4C8GA 3WGJA 1J7HA 5BMVB 3CPQA 4DXDA 1IPAA 2VAMA 3JATA 1IV1A 2G9IA 1W581 1OFUA 5MN5A 3HWUA 5GONB 3IEWA 1X7PA 3J80M 5LOVA 1YGYA 3CYPB 4B62A 3D00A 3TD4A 5LP6B 1KQSF 2IQQA 4B46A 4O4LA 3UT5A 3DDNA 3ELCA 2N48A 4TV8B 5CB4B 1ODEA 2RHLA 1ZWZA 3K12A 2K1SA 4X1YB 5JCOC 3V4DA 3KE1A 3JALB 1YQNA 3N2GB 4B45A 5EO3A 2I6RA 5J2TB 5GIOC 5EIBD 4X1IB 2RHHA 4U3JA 3G4SF 2H8CA 2CHTA 5IYZB 5HP7A 5HY2A 2RHOA 1VQ9F 3HKEB 1JY8A 3K0TA 3C8LA 3ZO8A 3WJQA 5LXTB 2UYKA 2HVYD 3LYBA 2FC3A 3I55F 5KX5B 4IIJA 3LDTA 1YI2F 2PHNA 5EYPA 3WJPA 3IEQA 1X7OA 4TUYB 2BO1A 4M8IA 2Q1YA 3RE3A 1YJ9F 1W42A 3E1YA 4X3MA 1H48A 2IAFA 3HKCA 4BVSA 3CCLF 5AVMA 1SA0B 1VQ7F 1XV2A 1VH8A 3TD5A 1XRGA 3E22B 4O2AB 3VTIC 3VO8A 3JCMM 5JQGB 2DT4A 2I6DA 2L26A 4ZOLA 5HP8A 2ZAUA 3CB2A 5EZYB 1TUBA 3KJKA 4HNAB 1XBIA 3VYUC 3CCUF 3SIVA 4NWOB 1YIJF 1FNKA 3I3FA 1ONIA 3RYFA 2F9ZC 5IT9M 2ZVZA 3AGKA 4LNUB 5JCOA 5JVDB 3S03A 3G71F 4KWEA 4G4ZA 3OW2F 5DCVA 3RYHB 4BY9D 1TVKA 1CLIA 4O4JB 2RHJA 4DRXB 5HXUA 3E20B 2H6LA 3JAMM 1VK3A 2CW4A 4ZI7B 1PXWA 1FFXA 3CXCF 3N4YA 5LYJA 3RA6A 4C8EA 2CHSA 3S0WA 1YJWF 1Q86H 3KIZA 1VHAA 1FSZA 2R751 3HKBA 1RQ7A 3VI6A 3JATB 3Q8HA 5HXZA 1CK2A 4I4TB 3EORA 3ZOPA 3JARB 4O4HA 1OAPA 1CN7A 2KTUA 2Z1TA 3D54A 4BT3A 3S0HA 5LOVB 4X1KA 3CCQF 3IKFA 3HTNA 2OHWA 5LP6C 4O2BB 1UFYA 4ZK7A 5EB0A 1QU9A 5G4UC 3VYTC 1IV4A 4RHAA 5CA1B 1KC8H 3QUWA 4TV9B 3JAKA 5LA6A 3WJRA 5KMGA 1X52A 2OTMA 3F0DA 5MN4A 1T0AA 3IKEA 1PF5A 4YJ3A 3NK6A 4I55B 5HY1A 3J81M 3P10A 3LWVC 3VMFB 5FNVB 1VQVA 2HP0A 4U3JB 3NK7A 3OONA 1VQ6F 2UYNA 4O4IB 1QVGF 3DC2A 1RA4A 1RLUA 2Z1EA 3VOAA 2WALA 5C8YB 3RYCA 3FPIA 2UZHA 2VGNA 3OBYA 3WPWA 2OTLF 3N2KB 3C9RA 4BVRA 3LWOC 1DT9A 4IIJB 1JD1A 4FFBB 3GHZA 4EI8A 1S72F 3PLAC 2HRYA 1W3EX 3CCRF 5BMVA 4I50B 1GO1A 2H8EA 2HS4A 2ZF8A 2ZVYA 3HKCB 3ON1A 1KD1H 3KJJA 2CVLA 2QEXF 3NVKE 1K9MH 3WPXA 2HP3A
chains in the Genus database with same CATH topology
3PAFA 1XBIA 3CCUF 3SIVA 1VQLF 1YIJF 2JNBA 3CC2F 1VQOF 4XCQA 3FFMA 3CMAF 1W40A 2F9ZC 5IT9M 3AGKA 3SIUA 1M90H 1W2BF 3HAXD 4BW0B 3LWRC 3CMEF 2AIFA 4X3LA 5HY4A 3G71F 3HJWC 3OW2F 5DCVA 4BY9D 3RA5A 3CCEF 5FJ4C 2OTJF 5HXUA 3E20B 3JAMM 5G4VC 2QA4F 2ALEA 3V3TA 3LFOA 3CPQA 3CPWF 1PXWA 1T0KB 3CXCF 3N4YA 1IPAA 5A2QM 5HY0A 1JJ2F 3RA6A 4NUTA 1GO0A 2QI2A 1NJIH 1YJNF 2CZWA 1E7KA 1GZ0A 1YJWF 1Q86H 3CD6F 1K73H 1M1KH 1VQ4F 1X7PA 3VI6A 5GANK 3J80M 3D00A 1CK2A 5HXZA 1RLGA 2VGMA 3NVIB 1N8RH 2KTVA 1KQSF 1VQMF 1NMUB 1YITF 3G6EF 1CN7A 2KTUA 5EWRA 3I56F 5GAPK 4BVQA 3CCQF 3CG6A 1VQKF 2OHWA 3CCSF 1ZWZA 1Q81H 3O85A 3IR9A 4NQ3A 5G4UC 3N4ZA 2GLZA 3J7AR 1KC8H 1K8AH 1VQ8F 5FLXM 5EO3A 5GIOC 1X52A 1Q7YH 5GINC 3G4SF 2OZBA 1VQ5F 3LWPC 1H7MA 3NK6A 3MCAB 2LBXA 3CC7F 5HY2A 3CC4F 5HY1A 1VQNF 3J81M 3LWVC 3VMFB 1VQ9F 3WXMB 3LWQC 2KG4A 1Q82H 3NK7A 1YHQF 3OBWA 1VQ6F 2HVYD 1QVGF 1RA4A 2FC3A 3I55F 2WALA 4C4WC 1YI2F 3V7EA 4EI9A 4EI7A 2VGNA 3OBYA 5HWEA 1X7OA 2OTLF 4BVRA 2BO1A 3GYQA 5GIPC 3LWOC 1YJ9F 1DT9A 1W41A 1W42A 3E1YA 3CCJF 3CCMF 4X3MA 1QVFF 3V7QA 4LCKA 4EI8A 1S72F 3PLAC 4BVTA 4BVSA 3CCRF 1W3EX 3CCLF 2LBWA 1VQ7F 1GO1A 1VQPF 1SDSA 3CCVF 3JCMM 3NMUC 2FGYA 3ON1A 1KD1H 3NVKE 2I6DA 4TZZA 2QEXF 1K9MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAF A;  1XBI A;  3CCU F;  3SIV A;  1VQL F;  1YIJ F;  2JNB A;  3CC2 F;  1VQO F;  3FFM A;  3CMA F;  1W40 A;  5IT9 M;  3AGK A;  3SIU A;  1M90 H;  1W2B F;  3HAX D;  4BW0 B;  3LWR C;  3CME F;  2AIF A;  4X3L A;  3G71 F;  3HJW C;  3OW2 F;  5DCV A;  4BY9 D;  3RA5 A;  3CCE F;  5FJ4 C;  2OTJ F;  3E20 B;  3JAM M;  5G4V C;  2QA4 F;  2ALE A;  3CPW F;  3LFO A;  3CPQ A;  1PXW A;  1T0K B;  3CXC F;  3N4Y A;  1IPA A;  5A2Q M;  1JJ2 F;  3RA6 A;  4NUT A;  1GO0 A;  2QI2 A;  1NJI H;  1YJN F;  2CZW A;  1E7K A;  1GZ0 A;  1YJW F;  1Q86 H;  3CD6 F;  1K73 H;  1M1K H;  1VQ4 F;  1X7P A;  3VI6 A;  5GAN K;  3J80 M;  1CK2 A;  1RLG A;  2VGM A;  3NVI B;  1N8R H;  2KTV A;  1KQS F;  1VQM F;  1NMU B;  1YIT F;  3G6E F;  1CN7 A;  2KTU A;  5EWR A;  3I56 F;  5GAP K;  3CCQ F;  3CG6 A;  1VQK F;  2OHW A;  3CCS F;  1ZWZ A;  1Q81 H;  3O85 A;  3IR9 A;  5G4U C;  3N4Z A;  3J7A R;  1KC8 H;  1K8A H;  1VQ8 F;  5FLX M;  5EO3 A;  5GIO C;  1X52 A;  1Q7Y H;  5GIN C;  3G4S F;  2OZB A;  1VQ5 F;  3LWP C;  1H7M A;  3NK6 A;  3MCA B;  2LBX A;  3CC7 F;  3CC4 F;  1VQN F;  3J81 M;  3LWV C;  3VMF B;  1VQ9 F;  3WXM B;  3LWQ C;  2KG4 A;  1Q82 H;  3NK7 A;  1YHQ F;  3OBW A;  1VQ6 F;  2HVY D;  1QVG F;  1RA4 A;  2FC3 A;  3I55 F;  2WAL A;  4C4W C;  1YI2 F;  3V7E A;  2VGN A;  3OBY A;  2OTL F;  1X7O A;  2BO1 A;  3GYQ A;  5GIP C;  3LWO C;  1YJ9 F;  1DT9 A;  1W41 A;  1W42 A;  3E1Y A;  3CCJ F;  3CCM F;  4X3M A;  1QVF F;  3V7Q A;  4LCK A;  1S72 F;  3PLA C;  3CCR F;  1W3E X;  3CCL F;  2LBW A;  1VQ7 F;  1GO1 A;  1VQP F;  1SDS A;  3CCV F;  3JCM M;  3NMU C;  3ON1 A;  1KD1 H;  3NVK E;  2I6D A;  4TZZ A;  2QEX F;  1K9M H; 
#chains in the Genus database with same CATH topology
 5GON A;  4BT5 A;  3ZP4 A;  3JAS B;  2YXZ A;  3B6N A;  1VQL F;  3P0Z A;  1VQO F;  1U40 A;  5LP6 A;  3GTZ A;  1TUB B;  4X20 B;  4XCQ A;  3WGN A;  1JN1 A;  1W40 A;  2UYJ A;  4BW0 B;  2DYY A;  4TV8 A;  4PWT A;  5CB4 A;  4ZHQ B;  5HY4 A;  3RYI B;  5IJ9 B;  3HJW C;  3RYF B;  1FNJ A;  1W5A A;  5FJ4 C;  4X1Y A;  2OTJ F;  2B33 A;  2ALE A;  3I7T A;  3N2G A;  3CPW F;  5CA0 B;  5A2Q M;  5HY0 A;  5IYZ A;  2Z1F A;  3IMP A;  5EIB C;  1GO0 A;  3ZP7 A;  1E7K A;  4IHJ B;  5ITZ B;  5J2U B;  3WGL A;  4R40 B;  3HKE A;  3JAW B;  1K73 H;  3C9U A;  4ZHY B;  5LYJ B;  1VQ4 F;  5IJ0 B;  4F6R A;  2P6Y A;  4EB6 A;  5KX5 A;  3FD6 A;  5EB1 B;  2KTV A;  3VIU A;  1NMU B;  2KGW A;  3BYQ A;  3I56 F;  2VAW A;  2V9Y A;  3CG6 A;  3MCQ A;  3CCS F;  1Q81 H;  4O4H B;  3O85 A;  2RB9 A;  3LME A;  1KNJ A;  1W55 A;  4NQ3 A;  3N4Z A;  1SA0 A;  2GLZ A;  3F0F A;  2Z1U A;  4X1K B;  3KHN A;  3J7A R;  3E22 A;  3P4E A;  4O2A A;  1X25 A;  5FLX M;  5JQG A;  3WGK A;  3M1X A;  5EZY A;  2LBX A;  3CC7 F;  2ZOD A;  3CC4 F;  1VQN F;  4G4Y A;  1Z5W A;  4BT6 A;  4E6E A;  3WXM B;  3LWQ C;  1W5B A;  2KG4 A;  1Q82 H;  1YHQ F;  3VOB A;  4U39 A;  4LNU A;  4BT2 A;  4C4W C;  3V7E A;  4C82 A;  4O4L B;  3UT5 B;  5JVD A;  5HWE A;  2UYN B;  4YJ2 A;  3VCZ A;  3RYH A;  2ZOV A;  3GYQ A;  2IG8 A;  1W41 A;  3HKD A;  3QTY A;  2HS3 A;  4O4J A;  4WBN A;  1IV2 A;  3RYC B;  2CWJ A;  2LBW A;  1SDS A;  1VQP F;  4ZI7 A;  5B8F A;  5MN6 A;  4BT7 A;  1JFF A;  4ZHW A;  3ERN A;  3PAF A;  4ZHV A;  2VXY A;  3TD3 A;  2GVI A;  2JNB A;  4G4W A;  1SZQ A;  4I4T A;  3C9S A;  3FFM A;  3JAR A;  4C8I A;  3CMA F;  3SIU A;  2CSL A;  2QTP A;  1KNK A;  5JH7 A;  3LWR C;  3WGM A;  5EYP B;  2HS0 A;  4O2B A;  2HRU A;  3VYS C;  3RA5 A;  2HX0 A;  5G4V C;  3FBA A;  3L7Q A;  2UYP A;  4G4X A;  5CA1 A;  4TV9 A;  3S0Y A;  2AIZ P;  3LFO A;  3V3T A;  2BTQ B;  3MBM A;  2LBT A;  1T0K B;  3R0P A;  1JJ2 F;  1UI9 A;  3QHD A;  4NUT A;  3T80 A;  2AMT A;  1U3P A;  2QI2 A;  1NJI H;  1YJN F;  2CZW A;  4ZOL B;  1GZ0 A;  4I55 A;  1QD9 A;  3FD5 A;  3CD6 F;  5FNV A;  1U43 A;  1COM A;  1M1K H;  3F0E A;  5GAN K;  4O4I A;  1RLG A;  2VGM A;  3NVI B;  1N8R H;  1VQM F;  5C8Y A;  3G6E F;  3JVH A;  1YIT F;  2EWC A;  5EWR A;  4BT4 A;  5GAP K;  3N2K A;  4BVQ A;  3K14 A;  3K2X A;  3C9T A;  4F6R B;  3JAL A;  1VQK F;  4EB6 B;  4FFB A;  4G88 A;  2YYE A;  5J2T A;  1TVK B;  3IR9 A;  3F0G A;  4X1I A;  3CYQ A;  4ERH A;  1R1M A;  4I50 A;  1DBF A;  3MDO A;  1K8A H;  1VQ8 F;  1W59 A;  1Q7Y H;  1FFX B;  5GIN C;  1QAH A;  2OZB A;  1VQ5 F;  2R6R 1;  1H7M A;  5LXT A;  3MCA B;  3LWP C;  3JAS A;  1W57 A;  3HKB B;  5EAZ A;  3OBW A;  4X20 A;  2LCA A;  2PMP A;  4TUY A;  4EI9 A;  3ESJ A;  3RYI A;  4EI7 A;  1Q8R A;  1NQ3 A;  2BTO A;  4ZHQ A;  5IJ9 A;  5GIP C;  3CCJ F;  3CCM F;  1QVF F;  4LCK A;  3V7Q A;  2GZL A;  4BVT A;  3S06 A;  2MQE A;  4YJ2 B;  3CCV F;  4HNA A;  1W5E A;  5CA0 A;  3HKD B;  4WBN B;  2NMU A;  3JAK B;  3NMU C;  1XHO A;  5LA6 B;  2FGY A;  5KMG B;  3M84 A;  4IHJ A;  4TZZ A;  5ITZ A;  3F6M A;  5J2U A;  3S02 A;  2Q1X A;  4YJ3 B;  3JAW A;  1JFF B;  5IJ0 A;  3CC2 F;  2HP0 B;  3D01 A;  4B5C A;  1RQ2 A;  2HQS C;  1M90 H;  1IV3 A;  4DRX A;  1H47 A;  1W2B F;  3HAX D;  3CME F;  1U3L A;  2AIF A;  4X3L A;  1W5F A;  4C81 A;  2VAP A;  1Z5V A;  2Z01 A;  1GX1 A;  2BTU A;  3CCE F;  3MQW A;  4RQO A;  5JH7 B;  2W8B C;  4G4V A;  2QA4 F;  3M4S A;  3U0O A;  4C8G A;  3WGJ A;  1J7H A;  5BMV B;  3CPQ A;  4DXD A;  1IPA A;  2VAM A;  3JAT A;  1IV1 A;  2G9I A;  1W58 1;  1OFU A;  5MN5 A;  3HWU A;  5GON B;  3IEW A;  1X7P A;  3J80 M;  5LOV A;  1YGY A;  3CYP B;  4B62 A;  3D00 A;  3TD4 A;  5LP6 B;  1KQS F;  2IQQ A;  4B46 A;  4O4L A;  3UT5 A;  3DDN A;  3ELC A;  2N48 A;  4TV8 B;  5CB4 B;  1ODE A;  2RHL A;  1ZWZ A;  3K12 A;  2K1S A;  4X1Y B;  5JCO C;  3V4D A;  3KE1 A;  3JAL B;  1YQN A;  3N2G B;  4B45 A;  5EO3 A;  2I6R A;  5J2T B;  5GIO C;  5EIB D;  4X1I B;  2RHH A;  4U3J A;  3G4S F;  2H8C A;  2CHT A;  5IYZ B;  5HP7 A;  5HY2 A;  2RHO A;  1VQ9 F;  3HKE B;  1JY8 A;  3K0T A;  3C8L A;  3ZO8 A;  3WJQ A;  5LXT B;  2UYK A;  2HVY D;  3LYB A;  2FC3 A;  3I55 F;  5KX5 B;  4IIJ A;  3LDT A;  1YI2 F;  2PHN A;  5EYP A;  3WJP A;  3IEQ A;  1X7O A;  4TUY B;  2BO1 A;  4M8I A;  2Q1Y A;  3RE3 A;  1YJ9 F;  1W42 A;  3E1Y A;  4X3M A;  1H48 A;  2IAF A;  3HKC A;  4BVS A;  3CCL F;  5AVM A;  1SA0 B;  1VQ7 F;  1XV2 A;  1VH8 A;  3TD5 A;  1XRG A;  3E22 B;  4O2A B;  3VTI C;  3VO8 A;  3JCM M;  5JQG B;  2DT4 A;  2I6D A;  2L26 A;  4ZOL A;  5HP8 A;  2ZAU A;  3CB2 A;  5EZY B;  1TUB A;  3KJK A;  4HNA B;  1XBI A;  3VYU C;  3CCU F;  3SIV A;  4NWO B;  1YIJ F;  1FNK A;  3I3F A;  1ONI A;  3RYF A;  2F9Z C;  5IT9 M;  2ZVZ A;  3AGK A;  4LNU B;  5JCO A;  5JVD B;  3S03 A;  3G71 F;  4KWE A;  4G4Z A;  3OW2 F;  5DCV A;  3RYH B;  4BY9 D;  1TVK A;  1CLI A;  4O4J B;  2RHJ A;  4DRX B;  5HXU A;  3E20 B;  2H6L A;  3JAM M;  1VK3 A;  2CW4 A;  4ZI7 B;  1PXW A;  1FFX A;  3CXC F;  3N4Y A;  5LYJ A;  3RA6 A;  4C8E A;  2CHS A;  3S0W A;  1YJW F;  1Q86 H;  3KIZ A;  1VHA A;  1FSZ A;  2R75 1;  3HKB A;  1RQ7 A;  3VI6 A;  3JAT B;  3Q8H A;  5HXZ A;  1CK2 A;  4I4T B;  3EOR A;  3ZOP A;  3JAR B;  4O4H A;  1OAP A;  1CN7 A;  2KTU A;  2Z1T A;  3D54 A;  4BT3 A;  3S0H A;  5LOV B;  4X1K A;  3CCQ F;  3IKF A;  3HTN A;  2OHW A;  5LP6 C;  4O2B B;  1UFY A;  4ZK7 A;  5EB0 A;  1QU9 A;  5G4U C;  3VYT C;  1IV4 A;  4RHA A;  5CA1 B;  1KC8 H;  3QUW A;  4TV9 B;  3JAK A;  5LA6 A;  3WJR A;  5KMG A;  1X52 A;  2OTM A;  3F0D A;  5MN4 A;  1T0A A;  3IKE A;  1PF5 A;  4YJ3 A;  3NK6 A;  4I55 B;  5HY1 A;  3J81 M;  3P10 A;  3LWV C;  3VMF B;  5FNV B;  1VQV A;  2HP0 A;  4U3J B;  3NK7 A;  3OON A;  1VQ6 F;  2UYN A;  4O4I B;  1QVG F;  3DC2 A;  1RA4 A;  1RLU A;  2Z1E A;  3VOA A;  2WAL A;  5C8Y B;  3RYC A;  3FPI A;  2UZH A;  2VGN A;  3OBY A;  3WPW A;  2OTL F;  3N2K B;  3C9R A;  4BVR A;  3LWO C;  1DT9 A;  4IIJ B;  1JD1 A;  4FFB B;  3GHZ A;  4EI8 A;  1S72 F;  3PLA C;  2HRY A;  1W3E X;  3CCR F;  5BMV A;  4I50 B;  1GO1 A;  2H8E A;  2HS4 A;  2ZF8 A;  2ZVY A;  3HKC B;  3ON1 A;  1KD1 H;  3KJJ A;  2CVL A;  2QEX F;  3NVK E;  1K9M H;  3WPX A;  2HP3 A; 
#chains in the Genus database with same CATH homology
 3PAF A;  1XBI A;  3CCU F;  3SIV A;  1VQL F;  1YIJ F;  2JNB A;  3CC2 F;  1VQO F;  4XCQ A;  3FFM A;  3CMA F;  1W40 A;  2F9Z C;  5IT9 M;  3AGK A;  3SIU A;  1M90 H;  1W2B F;  3HAX D;  4BW0 B;  3LWR C;  3CME F;  2AIF A;  4X3L A;  5HY4 A;  3G71 F;  3HJW C;  3OW2 F;  5DCV A;  4BY9 D;  3RA5 A;  3CCE F;  5FJ4 C;  2OTJ F;  5HXU A;  3E20 B;  3JAM M;  5G4V C;  2QA4 F;  2ALE A;  3V3T A;  3LFO A;  3CPQ A;  3CPW F;  1PXW A;  1T0K B;  3CXC F;  3N4Y A;  1IPA A;  5A2Q M;  5HY0 A;  1JJ2 F;  3RA6 A;  4NUT A;  1GO0 A;  2QI2 A;  1NJI H;  1YJN F;  2CZW A;  1E7K A;  1GZ0 A;  1YJW F;  1Q86 H;  3CD6 F;  1K73 H;  1M1K H;  1VQ4 F;  1X7P A;  3VI6 A;  5GAN K;  3J80 M;  3D00 A;  1CK2 A;  5HXZ A;  1RLG A;  2VGM A;  3NVI B;  1N8R H;  2KTV A;  1KQS F;  1VQM F;  1NMU B;  1YIT F;  3G6E F;  1CN7 A;  2KTU A;  5EWR A;  3I56 F;  5GAP K;  4BVQ A;  3CCQ F;  3CG6 A;  1VQK F;  2OHW A;  3CCS F;  1ZWZ A;  1Q81 H;  3O85 A;  3IR9 A;  4NQ3 A;  5G4U C;  3N4Z A;  2GLZ A;  3J7A R;  1KC8 H;  1K8A H;  1VQ8 F;  5FLX M;  5EO3 A;  5GIO C;  1X52 A;  1Q7Y H;  5GIN C;  3G4S F;  2OZB A;  1VQ5 F;  3LWP C;  1H7M A;  3NK6 A;  3MCA B;  2LBX A;  3CC7 F;  5HY2 A;  3CC4 F;  5HY1 A;  1VQN F;  3J81 M;  3LWV C;  3VMF B;  1VQ9 F;  3WXM B;  3LWQ C;  2KG4 A;  1Q82 H;  3NK7 A;  1YHQ F;  3OBW A;  1VQ6 F;  2HVY D;  1QVG F;  1RA4 A;  2FC3 A;  3I55 F;  2WAL A;  4C4W C;  1YI2 F;  3V7E A;  4EI9 A;  4EI7 A;  2VGN A;  3OBY A;  5HWE A;  1X7O A;  2OTL F;  4BVR A;  2BO1 A;  3GYQ A;  5GIP C;  3LWO C;  1YJ9 F;  1DT9 A;  1W41 A;  1W42 A;  3E1Y A;  3CCJ F;  3CCM F;  4X3M A;  1QVF F;  3V7Q A;  4LCK A;  4EI8 A;  1S72 F;  3PLA C;  4BVT A;  4BVS A;  3CCR F;  1W3E X;  3CCL F;  2LBW A;  1VQ7 F;  1GO1 A;  1VQP F;  1SDS A;  3CCV F;  3JCM M;  3NMU C;  2FGY A;  3ON1 A;  1KD1 H;  3NVK E;  2I6D A;  4TZZ A;  2QEX F;  1K9M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...