2WALA

Crystal structure of human gadd45gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Gadd45Gamma
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords GROWTH ARREST AND DNA-DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2walA00
2CZWA 3VI6A 3MCAB 5G4VC 3VMFB 3LWVC 3CCEF 3AGKA 3N4YA 3CCJF 3CC4F 3CD6F 3OBYA 3OBWA 4X3MA 1K73H 4BW0B 1CN7A 5IT9M 1GO1A 3PAFA 1JJ2F 3N4ZA 2LBWA 3CCUF 3NVIB 1T0KB 2I6DA 1KQSF 5EWRA 3RA5A 2QEXF 3LWQC 1RLGA 1SDSA 1VQKF 3PLAC 1KC8H 1GO0A 1YI2F 2QI2A 1X52A 1X7PA 2VGMA 1YJNF 3SIUA 3ON1A 3J80M 3JCMM 2OZBA 1W3EX 5FLXM 3J7AR 5A2QM 2AIFA 2KTUA 1VQNF 2BO1A 1Q7YH 1N8RH 2WALA 2KG4A 1W40A 3NMUC 4C4WC 1PXWA 3GYQA 5GIOC 1X7OA 5GIPC 2VGNA 1QVGF 3CPWF 3E20B 1W41A 2OTLF 2HVYD 3LWPC 1YJ9F 1RA4A 4NUTA 4X3LA 2KTVA 1H7MA 1YIJF 1VQ6F 3CC7F 3V7EA 1QVFF 1M90H 3I56F 3I55F 1VQ7F 5EO3A 1Q86H 1NMUB 3CCVF 1NJIH 5DCVA 2FC3A 1YHQF 1Q82H 3O85A 3LWOC 5GANK 3J81M 1VQMF 3CCLF 1M1KH 1VQOF 3IR9A 3CCQF 1VQLF 1KD1H 1K9MH 1VQ5F 3HAXD 4LCKA 5FJ4C 3CCRF 4TZZA 1IPAA 1Q81H 5G4UC 3E1YA 3G4SF 1W2BF 1YITF 3SIVA 2OHWA 3NK6A 1DT9A 3G6EF 3G71F 1E7KA 3NK7A 1GZ0A 3CC2F 1K8AH 3RA6A 1YJWF 5GINC 3CG6A 1VQPF 1W42A 3FFMA 1VQ4F 2ALEA 1CK2A 3CPQA 3WXMB 5GAPK 3OW2F 3NVKE 1ZWZA 4BY9D 2OTJF 3HJWC 2QA4F 1VQ8F 1XBIA 3JAMM 3CXCF 3CCSF 2JNBA 3CMEF 3LFOA 1S72F 1VQ9F 3LWRC 3CCMF 3V7QA 2LBXA 3CMAF
chains in the Genus database with same CATH superfamily
2CZWA 2OTMA 4ZOLA 1U40A 3LWVC 5CA1B 4LNUB 3N4YA 1W5EA 3OBWA 4EB6A 1CLIA 5LYJB 4BW0B 3JATA 1GO1A 2IG8A 3ZOPA 1JJ2F 2LBWA 3VOBA 1TUBA 5J2TB 2HRYA 3L7QA 3UT5A 1RLGA 2HP0B 3BYQA 3LWRC 3JVHA 1SA0B 3KHNA 1YI2F 4O4LB 1SZQA 3ON1A 4E6EA 3S06A 4BT6A 2OZBA 5FLXM 3ZP7A 4LNUA 2KTUA 2HS0A 5LP6C 2ZAUA 1N8RH 1RQ2A 2Z1FA 3P0ZA 1FFXB 4C8GA 5IYZA 1W40A 1JFFB 3CB2A 3GYQA 3QTYA 3FBAA 5GIOC 3N2KB 3S0HA 3RE3A 4R40B 2HVYD 3C9RA 5HXUA 4I55B 3ESJA 3S0WA 4O2AB 4U39A 4X3LA 4O4LA 2NMUA 1YQNA 2KTVA 5KMGA 2ZVYA 5KX5A 3JAKA 2UYNA 3WJQA 3V7EA 4I4TB 4ZHYB 4EI9A 1M90H 1KNKA 1R1MA 3I56F 2HX0A 1XRGA 3JALA 5GANK 1VQOF 1OAPA 5LXTA 1KD1H 5FJ4C 3M1XA 2VAMA 2L26A 3FPIA 3UT5B 1ODEA 1YITF 3T80A 2OHWA 5EYPB 3VTIC 1DT9A 4BT7A 5IYZB 2RHHA 3D00A 1DBFA 1FNKA 3MBMA 4O4JB 3FD5A 4ZK7A 1VQPF 3OONA 2UYJA 3E22A 5IJ9B 5AVMA 3KJKA 5HP7A 5HXZA 3RYIB 3KJJA 4EI8A 3OW2F 3F6MA 4NWOB 3RYFA 1ZWZA 5LA6B 3VCZA 2LBTA 3D01A 1IV2A 4BT4A 4O4IB 1H48A 2UYKA 2JNBA 3CCSF 2CWJA 1S72F 4BVRA 1VQ9F 1KNJA 4X1KB 3VI6A 3MCAB 4B46A 3CCEF 3AGKA 1J7HA 1Q8RA 3HKDB 4I4TA 3VYTC 1CN7A 1W5FA 4DRXB 5IT9M 2HQSC 5EZYB 3ELCA 2ZODA 3RYIA 3VO8A 3TD5A 1T0KB 2I6DA 1IV1A 2QEXF 5ITZA 2B33A 2BTQB 1VQKF 3IEWA 3KIZA 4KWEA 2R6R1 3VYSC 3SIUA 4X1KA 1SA0A 3K12A 3J80M 3JCMM 1W3EX 3J7AR 1IV4A 1VQNF 2K1SA 1FFXA 3WPWA 3ERNA 2WALA 4HNAB 2KG4A 3N2KA 4ZHVA 4C4WC 1PXWA 4TUYA 5KX5B 4I50A 3IKEA 1X7OA 3Q8HA 4TV8A 4X1YA 5JVDB 3D54A 1QVGF 1W41A 3LWPC 3M84A 2GVIA 4O2BA 1RA4A 4NUTA 3ZP4A 1QAHA 4BT3A 3HKBA 3MCQA 1H7MA 3LDTA 3K14A 2N48A 5KMGB 4C81A 1QU9A 5LOVB 3CYPB 4YJ2B 3N2GA 3JAKB 3WGJA 3R0PA 5HY1A 3RYCA 2H8EA 2FC3A 4XCQA 3O85A 3CCLF 4ZI7B 2LCAA 4F6RA 4X1IA 4LCKA 5LP6B 2HS4A 3MDOA 3CCRF 5EB1B 3IEQA 3DC2A 3E1YA 3G4SF 1W2BF 3GTZA 2CVLA 4YJ3A 5JH7B 3JASA 2AMTA 2ZVZA 2YYEA 1E7KA 4IIJA 3NK7A 3LYBA 2Z1TA 5LOVA 3RA6A 1YJWF 5GONB 2HRUA 3WPXA 1JD1A 1W42A 3FFMA 3HKCB 3U0OA 2IAFA 5HY2A 5MN5A 4O2BB 3P10A 5GONA 2ALEA 1CK2A 5GAPK 2OTJF 2CW4A 1GX1A 3WGMA 4B62A 3HJWC 2QA4F 4O4HA 2UZHA 3JAMM 3CXCF 3TD4A 4G4VA 4YJ3B 3LFOA 3M4SA 5IJ0B 1ONIA 3V3TA 3HTNA 3C9TA 3CCMF 4O4HB 2H8CA 3VMFB 3JAWA 1VQVA 3JARB 5C8YB 5HWEA 4ZI7A 1T0AA 4DRXA 3B6NA 4X3MA 1K73H 2V9YA 2P6YA 1QD9A 3HKEA 3WJRA 3CCUF 2RHLA 4BT5A 4M8IA 3NVIB 1TVKA 4FFBA 3WGKA 4I55A 4IIJB 2YXZA 2Z1UA 1GO0A 3GHZA 1X7PA 4BVSA 1YJNF 5MN4A 4C8IA 2QTPA 5EIBC 2CSLA 5A2QM 2AIFA 3F0GA 4BVTA 4IHJB 3I3FA 5CB4B 3HKEB 5EAZA 4U3JB 5CA0B 3S02A 2VGNA 4FFBB 4EI7A 5CB4A 1W581 3JAWB 5JCOA 3CPWF 2CHTA 2VXYA 2OTLF 1YJ9F 2CHSA 2HP0A 1U3PA 4G88A 3QHDA 4DXDA 1W55A 3LMEA 3JATB 4O2AA 3CC7F 1QVFF 5MN6A 4G4XA 3I55F 5EO3A 3KE1A 5B8FA 1NMUB 3EORA 3TD3A 3JASB 1YHQF 1Q82H 3LWOC 3J81M 3IR9A 3CCQF 1W5BA 3HAXD 4IHJA 4TZZA 1IPAA 3VYUC 1Q81H 2PMPA 5JQGB 2DYYA 4C8EA 5G4UC 4U3JA 5CA0A 1W59A 5BMVA 1COMA 4WBNB 3G6EF 3G71F 2Q1XA 2IQQA 3C9UA 2Q1YA 3CC2F 2UYNB 1K8AH 4X1IB 5GINC 5FNVA 3IKFA 3F0FA 2GLZA 1Z5WA 2Z01A 3CPQA 4RHAA 3WXMB 4X20A 3NVKE 4BY9D 5ITZB 5JCOC 4ZHQB 2RHOA 5JQGA 4G4YA 1IV3A 1XBIA 3DDNA 4X20B 4WBNA 2MQEA 2VAPA 1PF5A 2PHNA 3V7QA 5J2TA 3C8LA 3JARA 5C8YA 5G4VC 4ERHA 4G4WA 3IMPA 3CCJF 3CD6F 3CC4F 3HKBB 3OBYA 3VIUA 2AIZP 4TUYB 3ZO8A 3E22B 5IJ9A 2KGWA 3PAFA 3N4ZA 4TV8B 1KQSF 5EWRA 3RA5A 2R751 4G4ZA 5LA6A 3LWQC 1SDSA 2HP3A 2UYPA 4YJ2A 1TVKB 5HY4A 3PLAC 1KC8H 4O4IA 2QI2A 3K2XA 1X52A 2VGMA 3V4DA 4F6RB 2ZOVA 5LYJA 5HY0A 3P4EA 2BTOA 4B45A 2BO1A 3VOAA 4PWTA 1Q7YH 5J2UA 4X1YB 3K0TA 4ZHQA 3NMUC 5EZYA 1RQ7A 3F0EA 1XV2A 1UI9A 1W5AA 5GIPC 4HNAA 1X25A 3RYHA 3E20B 5LP6A 4BT2A 3C9SA 4ZHWA 3RYFB 2FGYA 2Z1EA 1W57A 1OFUA 5HP8A 2I6RA 5JVDA 1U43A 3I7TA 3RYCB 5CA1A 5JH7A 2VAWA 1YIJF 1VQ6F 1JY8A 1XHOA 3HWUA 2EWCA 1VQ7F 3MQWA 3WJPA 1Q86H 3CCVF 1NJIH 5DCVA 5EYPA 1U3LA 3HKCA 4TV9B 3HKDA 1VQMF 1M1KH 5IJ0A 1VQLF 1K9MH 1VQ5F 2GZLA 4ZOLB 3S03A 5LXTB 3S0YA 5BMVB 2W8BC 3CYQA 4C82A 1NQ3A 5EIBD 4I50B 3SIVA 3QUWA 3JALB 1YGYA 3NK6A 2HS3A 4O4JA 4BVQA 1RLUA 3RYHB 1GZ0A 4RQOA 3FD6A 1H47A 3N2GB 1FNJA 3CG6A 2RHJA 2ZF8A 3WGNA 1VHAA 1FSZA 2DT4A 5J2UB 3F0DA 2F9ZC 1VQ4F 3CMAF 4NQ3A 1JN1A 1TUBB 4B5CA 1VK3A 2RB9A 4TV9A 3WGLA 1VQ8F 2H6LA 2BTUA 1VH8A 3CMEF 5FNVB 2G9IA 1JFFA 1UFYA 1Z5VA 4EB6B 2LBXA 5EB0A
chains in the Genus database with same CATH topology
2CZWA 3VI6A 3MCAB 5G4VC 3VMFB 3LWVC 3CCEF 3AGKA 3N4YA 3CCJF 3CC4F 3CD6F 5HWEA 3OBYA 3OBWA 4X3MA 1K73H 4BW0B 1CN7A 5IT9M 1GO1A 3PAFA 1JJ2F 3N4ZA 2LBWA 3CCUF 3NVIB 1T0KB 2I6DA 1KQSF 5EWRA 3RA5A 2QEXF 3LWQC 1RLGA 1SDSA 1VQKF 5HY4A 3PLAC 1KC8H 1GO0A 1YI2F 2QI2A 1X52A 1X7PA 2VGMA 4BVSA 1YJNF 3SIUA 3ON1A 5HY0A 3J80M 3JCMM 2OZBA 1W3EX 5FLXM 3J7AR 5A2QM 2AIFA 2KTUA 1VQNF 2BO1A 4BVTA 1Q7YH 1N8RH 2WALA 2KG4A 1W40A 3NMUC 4C4WC 1PXWA 3GYQA 5GIOC 1X7OA 5GIPC 2VGNA 4EI7A 1QVGF 3CPWF 3E20B 1W41A 2OTLF 2HVYD 3LWPC 1YJ9F 5HXUA 2FGYA 1RA4A 4NUTA 4X3LA 2KTVA 1H7MA 1YIJF 1VQ6F 3CC7F 3V7EA 1QVFF 4EI9A 1M90H 3I56F 3I55F 1VQ7F 5EO3A 5HY1A 1Q86H 1NMUB 3CCVF 1NJIH 5DCVA 2FC3A 4XCQA 1YHQF 1Q82H 3O85A 3LWOC 5GANK 3J81M 1VQMF 3CCLF 1M1KH 1VQOF 3IR9A 3CCQF 1VQLF 1KD1H 1K9MH 1VQ5F 3HAXD 4LCKA 5FJ4C 3CCRF 4TZZA 1IPAA 1Q81H 5G4UC 3E1YA 3G4SF 1W2BF 1YITF 3SIVA 2OHWA 3NK6A 1DT9A 3G6EF 4BVQA 3D00A 3G71F 1E7KA 3NK7A 1GZ0A 3CC2F 1K8AH 3RA6A 1YJWF 5GINC 3CG6A 1VQPF 1W42A 3FFMA 2GLZA 2F9ZC 1VQ4F 5HXZA 5HY2A 3CCMF 4NQ3A 4EI8A 2ALEA 1CK2A 3CPQA 3WXMB 5GAPK 3OW2F 3NVKE 1ZWZA 4BY9D 2OTJF 3HJWC 2QA4F 1VQ8F 1XBIA 3JAMM 3CXCF 3CCSF 2JNBA 3CMEF 3LFOA 1S72F 4BVRA 1VQ9F 3LWRC 3V3TA 3V7QA 2LBXA 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZW A;  3VI6 A;  3MCA B;  5G4V C;  3VMF B;  3LWV C;  3CCE F;  3AGK A;  3N4Y A;  3CCJ F;  3CC4 F;  3CD6 F;  3OBY A;  3OBW A;  4X3M A;  1K73 H;  4BW0 B;  1CN7 A;  5IT9 M;  1GO1 A;  3PAF A;  1JJ2 F;  3N4Z A;  2LBW A;  3CCU F;  3NVI B;  1T0K B;  2I6D A;  1KQS F;  5EWR A;  3RA5 A;  2QEX F;  3LWQ C;  1RLG A;  1SDS A;  1VQK F;  3PLA C;  1KC8 H;  1GO0 A;  1YI2 F;  2QI2 A;  1X52 A;  1X7P A;  2VGM A;  1YJN F;  3SIU A;  3ON1 A;  3J80 M;  3JCM M;  2OZB A;  1W3E X;  5FLX M;  3J7A R;  5A2Q M;  2AIF A;  2KTU A;  1VQN F;  2BO1 A;  1Q7Y H;  1N8R H;  2WAL A;  2KG4 A;  1W40 A;  3NMU C;  4C4W C;  1PXW A;  3GYQ A;  5GIO C;  1X7O A;  5GIP C;  2VGN A;  1QVG F;  3CPW F;  3E20 B;  1W41 A;  2OTL F;  2HVY D;  3LWP C;  1YJ9 F;  1RA4 A;  4NUT A;  4X3L A;  2KTV A;  1H7M A;  1YIJ F;  1VQ6 F;  3CC7 F;  3V7E A;  1QVF F;  1M90 H;  3I56 F;  3I55 F;  1VQ7 F;  5EO3 A;  1Q86 H;  1NMU B;  3CCV F;  1NJI H;  5DCV A;  2FC3 A;  1YHQ F;  1Q82 H;  3O85 A;  3LWO C;  5GAN K;  3J81 M;  1VQM F;  3CCL F;  1M1K H;  1VQO F;  3IR9 A;  3CCQ F;  1VQL F;  1KD1 H;  1K9M H;  1VQ5 F;  3HAX D;  4LCK A;  5FJ4 C;  3CCR F;  4TZZ A;  1IPA A;  1Q81 H;  5G4U C;  3E1Y A;  3G4S F;  1W2B F;  1YIT F;  3SIV A;  2OHW A;  3NK6 A;  1DT9 A;  3G6E F;  3G71 F;  1E7K A;  3NK7 A;  1GZ0 A;  3CC2 F;  1K8A H;  3RA6 A;  1YJW F;  5GIN C;  3CG6 A;  1VQP F;  1W42 A;  3FFM A;  1VQ4 F;  2ALE A;  1CK2 A;  3CPQ A;  3WXM B;  5GAP K;  3OW2 F;  3NVK E;  1ZWZ A;  4BY9 D;  2OTJ F;  3HJW C;  2QA4 F;  1VQ8 F;  1XBI A;  3JAM M;  3CXC F;  3CCS F;  2JNB A;  3CME F;  3LFO A;  1S72 F;  1VQ9 F;  3LWR C;  3CCM F;  3V7Q A;  2LBX A;  3CMA F; 
#chains in the Genus database with same CATH topology
 2CZW A;  2OTM A;  4ZOL A;  1U40 A;  3LWV C;  5CA1 B;  4LNU B;  3N4Y A;  1W5E A;  3OBW A;  4EB6 A;  1CLI A;  5LYJ B;  4BW0 B;  3JAT A;  1GO1 A;  2IG8 A;  3ZOP A;  1JJ2 F;  2LBW A;  3VOB A;  1TUB A;  5J2T B;  2HRY A;  3L7Q A;  3UT5 A;  1RLG A;  2HP0 B;  3BYQ A;  3LWR C;  3JVH A;  1SA0 B;  3KHN A;  1YI2 F;  4O4L B;  1SZQ A;  3ON1 A;  4E6E A;  3S06 A;  4BT6 A;  2OZB A;  5FLX M;  3ZP7 A;  4LNU A;  2KTU A;  2HS0 A;  5LP6 C;  2ZAU A;  1N8R H;  1RQ2 A;  2Z1F A;  3P0Z A;  1FFX B;  4C8G A;  5IYZ A;  1W40 A;  1JFF B;  3CB2 A;  3GYQ A;  3QTY A;  3FBA A;  5GIO C;  3N2K B;  3S0H A;  3RE3 A;  4R40 B;  2HVY D;  3C9R A;  5HXU A;  4I55 B;  3ESJ A;  3S0W A;  4O2A B;  4U39 A;  4X3L A;  4O4L A;  2NMU A;  1YQN A;  2KTV A;  5KMG A;  2ZVY A;  5KX5 A;  3JAK A;  2UYN A;  3WJQ A;  3V7E A;  4I4T B;  4ZHY B;  4EI9 A;  1M90 H;  1KNK A;  1R1M A;  3I56 F;  2HX0 A;  1XRG A;  3JAL A;  5GAN K;  1VQO F;  1OAP A;  5LXT A;  1KD1 H;  5FJ4 C;  3M1X A;  2VAM A;  2L26 A;  3FPI A;  3UT5 B;  1ODE A;  1YIT F;  3T80 A;  2OHW A;  5EYP B;  3VTI C;  1DT9 A;  4BT7 A;  5IYZ B;  2RHH A;  3D00 A;  1DBF A;  1FNK A;  3MBM A;  4O4J B;  3FD5 A;  4ZK7 A;  1VQP F;  3OON A;  2UYJ A;  3E22 A;  5IJ9 B;  5AVM A;  3KJK A;  5HP7 A;  5HXZ A;  3RYI B;  3KJJ A;  4EI8 A;  3OW2 F;  3F6M A;  4NWO B;  3RYF A;  1ZWZ A;  5LA6 B;  3VCZ A;  2LBT A;  3D01 A;  1IV2 A;  4BT4 A;  4O4I B;  1H48 A;  2UYK A;  2JNB A;  3CCS F;  2CWJ A;  1S72 F;  4BVR A;  1VQ9 F;  1KNJ A;  4X1K B;  3VI6 A;  3MCA B;  4B46 A;  3CCE F;  3AGK A;  1J7H A;  1Q8R A;  3HKD B;  4I4T A;  3VYT C;  1CN7 A;  1W5F A;  4DRX B;  5IT9 M;  2HQS C;  5EZY B;  3ELC A;  2ZOD A;  3RYI A;  3VO8 A;  3TD5 A;  1T0K B;  2I6D A;  1IV1 A;  2QEX F;  5ITZ A;  2B33 A;  2BTQ B;  1VQK F;  3IEW A;  3KIZ A;  4KWE A;  2R6R 1;  3VYS C;  3SIU A;  4X1K A;  1SA0 A;  3K12 A;  3J80 M;  3JCM M;  1W3E X;  3J7A R;  1IV4 A;  1VQN F;  2K1S A;  1FFX A;  3WPW A;  3ERN A;  2WAL A;  4HNA B;  2KG4 A;  3N2K A;  4ZHV A;  4C4W C;  1PXW A;  4TUY A;  5KX5 B;  4I50 A;  3IKE A;  1X7O A;  3Q8H A;  4TV8 A;  4X1Y A;  5JVD B;  3D54 A;  1QVG F;  1W41 A;  3LWP C;  3M84 A;  2GVI A;  4O2B A;  1RA4 A;  4NUT A;  3ZP4 A;  1QAH A;  4BT3 A;  3HKB A;  3MCQ A;  1H7M A;  3LDT A;  3K14 A;  2N48 A;  5KMG B;  4C81 A;  1QU9 A;  5LOV B;  3CYP B;  4YJ2 B;  3N2G A;  3JAK B;  3WGJ A;  3R0P A;  5HY1 A;  3RYC A;  2H8E A;  2FC3 A;  4XCQ A;  3O85 A;  3CCL F;  4ZI7 B;  2LCA A;  4F6R A;  4X1I A;  4LCK A;  5LP6 B;  2HS4 A;  3MDO A;  3CCR F;  5EB1 B;  3IEQ A;  3DC2 A;  3E1Y A;  3G4S F;  1W2B F;  3GTZ A;  2CVL A;  4YJ3 A;  5JH7 B;  3JAS A;  2AMT A;  2ZVZ A;  2YYE A;  1E7K A;  4IIJ A;  3NK7 A;  3LYB A;  2Z1T A;  5LOV A;  3RA6 A;  1YJW F;  5GON B;  2HRU A;  3WPX A;  1JD1 A;  1W42 A;  3FFM A;  3HKC B;  3U0O A;  2IAF A;  5HY2 A;  5MN5 A;  4O2B B;  3P10 A;  5GON A;  2ALE A;  1CK2 A;  5GAP K;  2OTJ F;  2CW4 A;  1GX1 A;  3WGM A;  4B62 A;  3HJW C;  2QA4 F;  4O4H A;  2UZH A;  3JAM M;  3CXC F;  3TD4 A;  4G4V A;  4YJ3 B;  3LFO A;  3M4S A;  5IJ0 B;  1ONI A;  3V3T A;  3HTN A;  3C9T A;  3CCM F;  4O4H B;  2H8C A;  3VMF B;  3JAW A;  1VQV A;  3JAR B;  5C8Y B;  5HWE A;  4ZI7 A;  1T0A A;  4DRX A;  3B6N A;  4X3M A;  1K73 H;  2V9Y A;  2P6Y A;  1QD9 A;  3HKE A;  3WJR A;  3CCU F;  2RHL A;  4BT5 A;  4M8I A;  3NVI B;  1TVK A;  4FFB A;  3WGK A;  4I55 A;  4IIJ B;  2YXZ A;  2Z1U A;  1GO0 A;  3GHZ A;  1X7P A;  4BVS A;  1YJN F;  5MN4 A;  4C8I A;  2QTP A;  5EIB C;  2CSL A;  5A2Q M;  2AIF A;  3F0G A;  4BVT A;  4IHJ B;  3I3F A;  5CB4 B;  3HKE B;  5EAZ A;  4U3J B;  5CA0 B;  3S02 A;  2VGN A;  4FFB B;  4EI7 A;  5CB4 A;  1W58 1;  3JAW B;  5JCO A;  3CPW F;  2CHT A;  2VXY A;  2OTL F;  1YJ9 F;  2CHS A;  2HP0 A;  1U3P A;  4G88 A;  3QHD A;  4DXD A;  1W55 A;  3LME A;  3JAT B;  4O2A A;  3CC7 F;  1QVF F;  5MN6 A;  4G4X A;  3I55 F;  5EO3 A;  3KE1 A;  5B8F A;  1NMU B;  3EOR A;  3TD3 A;  3JAS B;  1YHQ F;  1Q82 H;  3LWO C;  3J81 M;  3IR9 A;  3CCQ F;  1W5B A;  3HAX D;  4IHJ A;  4TZZ A;  1IPA A;  3VYU C;  1Q81 H;  2PMP A;  5JQG B;  2DYY A;  4C8E A;  5G4U C;  4U3J A;  5CA0 A;  1W59 A;  5BMV A;  1COM A;  4WBN B;  3G6E F;  3G71 F;  2Q1X A;  2IQQ A;  3C9U A;  2Q1Y A;  3CC2 F;  2UYN B;  1K8A H;  4X1I B;  5GIN C;  5FNV A;  3IKF A;  3F0F A;  2GLZ A;  1Z5W A;  2Z01 A;  3CPQ A;  4RHA A;  3WXM B;  4X20 A;  3NVK E;  4BY9 D;  5ITZ B;  5JCO C;  4ZHQ B;  2RHO A;  5JQG A;  4G4Y A;  1IV3 A;  1XBI A;  3DDN A;  4X20 B;  4WBN A;  2MQE A;  2VAP A;  1PF5 A;  2PHN A;  3V7Q A;  5J2T A;  3C8L A;  3JAR A;  5C8Y A;  5G4V C;  4ERH A;  4G4W A;  3IMP A;  3CCJ F;  3CD6 F;  3CC4 F;  3HKB B;  3OBY A;  3VIU A;  2AIZ P;  4TUY B;  3ZO8 A;  3E22 B;  5IJ9 A;  2KGW A;  3PAF A;  3N4Z A;  4TV8 B;  1KQS F;  5EWR A;  3RA5 A;  2R75 1;  4G4Z A;  5LA6 A;  3LWQ C;  1SDS A;  2HP3 A;  2UYP A;  4YJ2 A;  1TVK B;  5HY4 A;  3PLA C;  1KC8 H;  4O4I A;  2QI2 A;  3K2X A;  1X52 A;  2VGM A;  3V4D A;  4F6R B;  2ZOV A;  5LYJ A;  5HY0 A;  3P4E A;  2BTO A;  4B45 A;  2BO1 A;  3VOA A;  4PWT A;  1Q7Y H;  5J2U A;  4X1Y B;  3K0T A;  4ZHQ A;  3NMU C;  5EZY A;  1RQ7 A;  3F0E A;  1XV2 A;  1UI9 A;  1W5A A;  5GIP C;  4HNA A;  1X25 A;  3RYH A;  3E20 B;  5LP6 A;  4BT2 A;  3C9S A;  4ZHW A;  3RYF B;  2FGY A;  2Z1E A;  1W57 A;  1OFU A;  5HP8 A;  2I6R A;  5JVD A;  1U43 A;  3I7T A;  3RYC B;  5CA1 A;  5JH7 A;  2VAW A;  1YIJ F;  1VQ6 F;  1JY8 A;  1XHO A;  3HWU A;  2EWC A;  1VQ7 F;  3MQW A;  3WJP A;  1Q86 H;  3CCV F;  1NJI H;  5DCV A;  5EYP A;  1U3L A;  3HKC A;  4TV9 B;  3HKD A;  1VQM F;  1M1K H;  5IJ0 A;  1VQL F;  1K9M H;  1VQ5 F;  2GZL A;  4ZOL B;  3S03 A;  5LXT B;  3S0Y A;  5BMV B;  2W8B C;  3CYQ A;  4C82 A;  1NQ3 A;  5EIB D;  4I50 B;  3SIV A;  3QUW A;  3JAL B;  1YGY A;  3NK6 A;  2HS3 A;  4O4J A;  4BVQ A;  1RLU A;  3RYH B;  1GZ0 A;  4RQO A;  3FD6 A;  1H47 A;  3N2G B;  1FNJ A;  3CG6 A;  2RHJ A;  2ZF8 A;  3WGN A;  1VHA A;  1FSZ A;  2DT4 A;  5J2U B;  3F0D A;  2F9Z C;  1VQ4 F;  3CMA F;  4NQ3 A;  1JN1 A;  1TUB B;  4B5C A;  1VK3 A;  2RB9 A;  4TV9 A;  3WGL A;  1VQ8 F;  2H6L A;  2BTU A;  1VH8 A;  3CME F;  5FNV B;  2G9I A;  1JFF A;  1UFY A;  1Z5V A;  4EB6 B;  2LBX A;  5EB0 A; 
#chains in the Genus database with same CATH homology
 2CZW A;  3VI6 A;  3MCA B;  5G4V C;  3VMF B;  3LWV C;  3CCE F;  3AGK A;  3N4Y A;  3CCJ F;  3CC4 F;  3CD6 F;  5HWE A;  3OBY A;  3OBW A;  4X3M A;  1K73 H;  4BW0 B;  1CN7 A;  5IT9 M;  1GO1 A;  3PAF A;  1JJ2 F;  3N4Z A;  2LBW A;  3CCU F;  3NVI B;  1T0K B;  2I6D A;  1KQS F;  5EWR A;  3RA5 A;  2QEX F;  3LWQ C;  1RLG A;  1SDS A;  1VQK F;  5HY4 A;  3PLA C;  1KC8 H;  1GO0 A;  1YI2 F;  2QI2 A;  1X52 A;  1X7P A;  2VGM A;  4BVS A;  1YJN F;  3SIU A;  3ON1 A;  5HY0 A;  3J80 M;  3JCM M;  2OZB A;  1W3E X;  5FLX M;  3J7A R;  5A2Q M;  2AIF A;  2KTU A;  1VQN F;  2BO1 A;  4BVT A;  1Q7Y H;  1N8R H;  2WAL A;  2KG4 A;  1W40 A;  3NMU C;  4C4W C;  1PXW A;  3GYQ A;  5GIO C;  1X7O A;  5GIP C;  2VGN A;  4EI7 A;  1QVG F;  3CPW F;  3E20 B;  1W41 A;  2OTL F;  2HVY D;  3LWP C;  1YJ9 F;  5HXU A;  2FGY A;  1RA4 A;  4NUT A;  4X3L A;  2KTV A;  1H7M A;  1YIJ F;  1VQ6 F;  3CC7 F;  3V7E A;  1QVF F;  4EI9 A;  1M90 H;  3I56 F;  3I55 F;  1VQ7 F;  5EO3 A;  5HY1 A;  1Q86 H;  1NMU B;  3CCV F;  1NJI H;  5DCV A;  2FC3 A;  4XCQ A;  1YHQ F;  1Q82 H;  3O85 A;  3LWO C;  5GAN K;  3J81 M;  1VQM F;  3CCL F;  1M1K H;  1VQO F;  3IR9 A;  3CCQ F;  1VQL F;  1KD1 H;  1K9M H;  1VQ5 F;  3HAX D;  4LCK A;  5FJ4 C;  3CCR F;  4TZZ A;  1IPA A;  1Q81 H;  5G4U C;  3E1Y A;  3G4S F;  1W2B F;  1YIT F;  3SIV A;  2OHW A;  3NK6 A;  1DT9 A;  3G6E F;  4BVQ A;  3D00 A;  3G71 F;  1E7K A;  3NK7 A;  1GZ0 A;  3CC2 F;  1K8A H;  3RA6 A;  1YJW F;  5GIN C;  3CG6 A;  1VQP F;  1W42 A;  3FFM A;  2GLZ A;  2F9Z C;  1VQ4 F;  5HXZ A;  5HY2 A;  3CCM F;  4NQ3 A;  4EI8 A;  2ALE A;  1CK2 A;  3CPQ A;  3WXM B;  5GAP K;  3OW2 F;  3NVK E;  1ZWZ A;  4BY9 D;  2OTJ F;  3HJW C;  2QA4 F;  1VQ8 F;  1XBI A;  3JAM M;  3CXC F;  3CCS F;  2JNB A;  3CME F;  3LFO A;  1S72 F;  4BVR A;  1VQ9 F;  3LWR C;  3V3T A;  3V7Q A;  2LBX A;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...