2WAMA

Crystal structure of mycobacterium tuberculosis unknown function protein rv2714
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
294
Chain Sequence
AREYEPGQPGMYELEFPAPQLSSSDGRGPVLVHALEGFSDAGHAIRLAAAHLKAALDTELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRDSIGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPITMTAHSNNRELISDFQPSISEIQVPGSASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLGAEFERFLAQQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium Tuberculosis Rv2714, a Representative of a Duplicated Gene Family in Actinobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN
total genus 97
structure length 294
sequence length 307
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2wamA02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wamA01
3IC7A 1NVPB 2P90A 3GAAA 3WZ2A 3W7WA 3E35A 5GW7A 1RM1C 3W7TA 3W7SA 1S3JA 3MNFA 5CA3A 3W7XA 2WAMA 2HR3A 3VR0A 4G4SP 1NH2B 4HAMA 3W7UA 3BY6A 3D3IA 1YTFB
chains in the Genus database with same CATH superfamily
1WXDA 4FZJA 4E6PA 4AYXA 5DN9A 2HJSA 4HMOA 3ETHA 4KLCA 4RNCA 5B1AB 3I6ZA 4MP6A 4E5MA 3HJAA 2RG7A 2VVTA 4LC9A 1GRQA 2YXPX 3M6UA 4QBFA 1HRDA 5LZ4A 5C80A 4MYTA 1P6QA 3GEDA 1ZRHA 3MTDA 1DB3A 1THTA 4HWSA 3B1FA 4JI6B 2ACEA 1Q3HA 3BB4A 5T3UA 1EFUA 5JS2A 2P6RA 1WRBA 2QE7A 2VK8A 2WP8J 1CY1A 1OTYA 4P93A 2GAJA 5WRFA 3TTYA 4M0LA 1KRWA 4GOMD 4WIAA 1HR0O 2X6BA 1P5ZB 4ZTBA 1SQSA 4DFDA 4D82A 2H5LA 4DLSA 2XBUA 3PNQA 4PQRA 2I5PO 4JSRA 1LK5A 1I6LA 2AHZA 4Z4HA 5CDHA 5BPFA 3EMDA 1KP3A 1RFYA 2FSSA 1IM8A 4XBFA 2ENWA 3WL3A 4I99A 3LX4A 4QJ3A 2J30A 1ZPDA 2A92A 1KXZA 3APQA 1JQJC 5IAKA 3UMGA 1NA5A 3UMMA 1B0UA 3P4XA 1A3CA 1DO0A 5KA6A 5EC2C 2Q5LA 4PZLA 4BNLA 5K4HA 1F51E 4KNYA 5JVDF 3PQEA 3H2YA 4DDMA 1VE7A 2DYRC 1JKIA 5DBHX 3Q3CA 1Z62A 4WERA 3IEXA 3PNMA 4LZWA 5KOJA 2GESA 2IELA 1CX9B 3UMBA 4EPRA 1TUBA 2H7CA 5B3KA 4J1SA 4PHFA 2F95B 8ABPA 3SKXA 4DDTA 5KWSA 2YQZA 2JJ1D 5FR2A 2DR0A 1Y9AA 2HVKC 1C3VA 2VYFA 3HB0A 1F0KA 3B6EA 3IBCA 3EXEA 1OBFO 3L75H 3NVAA 5H70A 1G6OA 1ZYUA 2IHUA 3I01M 1F3OA 1UXGA 3MB5A 1WPGA 1I1HA 1OGJA 2HF8A 3EXFB 3H6GA 2R2AA 1E2EA 1NPDA 1XDSA 4G65A 4ZVPA 4AVYA 4DV6B 1SVOA 3WGYA 1MO2A 4JMPA 4EHJA 1X6VA 3E5RA 3LNMB 1XV5A 4YT8A 3Q9UA 3OR7C 3LRXA 3DKKA 1TYAE 3SHFA 2YOGA 3GPLA 2WG0A 1YJ9V 2P3OA 3ROMA 1H2WA 1Q0PA 4N3NA 3LBHA 5B2ZA 1EYZA 5FIUA 4BU0A 3KE8A 4FFKA 4HX9A 3NGXA 1U9YA 3K1JA 2FPMA 4CM9A 3JWIA 2DZDA 4I1PA 2F8TA 3RK4A 5CEEA 3HM9A 4B7KA 5KHHA 1OOEA 1I4WA 6GPBA 2GF9A 2W6NA 1JFFB 5G0VA 4AG6A 4TYWA 4P38A 3M5CA 1D4FA 1GZ3A 2WG1A 1QLNA 1PN3A 5COAA 1O89A 4ZIRA 4OHZA 4LOKA 2NZWA 3N2ZB 2DLCX 4MGEA 1SBTA 2GHIA 1A95A 4PHZA 1GZ5A 2IJKA 1FYXA 4M9SA 5JH7F 5CD1A 2HYIC 2Y1KA 1DXYA 3AR9A 4ZC8A 3GN1A 4FBGA 1KYQA 2P6NA 2GTAA 2VYQA 2XNDD 3K9QO 4R8CA 4KPEC 4J4BA 5BYAA 3N2KA 4EP1A 3OC6A 4HFJA 5FPQA 4R9UC 2VJYA 3EVGA 3FSGD 4J0QA 4C0WA 1PVDA 2ORVA 2Q7HA 4QOEA 5DHTA 4ZI2A 3D8CA 3N7UA 4DIUA 1P7CA 3DCIA 2XDYA 1HEIA 4A8PA 2Y0DA 3CQ9A 2OZPA 3ENVA 3V3KA 2DWCA 4FM2A 1SPXA 4D4IA 4W9NA 1YI1A 2HMSA 1OYOA 3G8CA 3OEEA 4FCCA 4GNKA 3OQBA 1MNQA 3MSCA 3HUDA 5CUQA 3JQGA 4J8PA 4K2AA 4F71A 1BXZA 4QXAA 1ESEA 3UAOA 3RE1A 2POQX 4EJMA 2OC4A 4FQ7A 2CHVA 2XQGA 4J7UA 3ZGNA 2HQBA 4QJFB 1DAPA 2X40A 2QVBA 3HDQA 2WWRA 3RREA 4RL6A 3RVPA 1IJBA 5AK4A 5JAHA 1J00A 1UAGA 4NBUA 3OOJA 4PTYA 3SSAA 5ALRA 5HG0A 4B79A 1CY2A 1QOZA 3O3CA 5JSFA 2DPMA 2CMKA 2BGUA 3DE5X 1C8KA 1YE3A 3KB6A 3UH0A 1M2NA 4Z7OB 5C32A 2IP2A 2PV7A 4WFHA 1I30A 2FL4A 1SU6A 3ML0A 1JJAA 3DE6X 3JQPA 1OCZC 4I4TF 4KN9S 4A26A 1NX6A 1CRLA 4YAKA 4TWRA 3GGOA 3N8HA 3NRBA 1MZFA 1Q0RA 5CVVA 3LZ6A 1FS0G 1PWEA 3OESA 4OKSA 1BT8A 1UJ6A 3ZLBA 4BV9A 4RHYA 5J23A 5HNKA 1L4LA 1P3Y1 2JCGA 2QX8A 3LHKA 1OCZB 1VIVA 2O05A 3KAQA 4GC9A 5BSVA 1R9GA 4BMCA 4RADA 1H4VB 2Z8YM 3RRFA 5CYPA 4EEQA 1ZG3A 4UD6A 3H99A 5JNUA 2C9DA 1ZD4A 1K86A 3DF9A 4BJHB 4EHFA 4GX1A 2IZ5A 2Z5LA 4NG5A 4TLAA 2V97A 3MJ4A 4IT5A 1JLKA 4ESOA 4X8OA 1GCOA 1G8GA 2WM8A 4DZRA 3I9NA 3V4RA 1GPJA 3GQBB 1Q81W 1GADO 1KFBB 3ZC3A 1SA0B 3LUKA 3QLTA 4JT2A 1IQUA 3X3HA 1E6WA 2UYCA 4F4IA 2XHBA 4D42A 1NLUA 2BM8A 1XJQA 1E92A 2Y1XA 4LXQA 3K8ZA 4GX2A 5J2TB 1NOJA 1UZUA 3A0UA 3GNTA 4YT2A 1A98A 5EGNA 5CB0A 2ESRA 3UCFA 1L7XA 1P73A 3LT5A 4XVUA 5J4VA 1PK8A 1MAWA 1KEVA 4I08A 4HYOA 2IY8A 4DKJA 4RZUA 3JV7A 1AHHA 3H1FA 4TLMB 4Z1OA 1E2QA 4BBJA 5GADl 1E9EA 3OO1A 4EJ6A 2QRLA 3A9TA 3VVBA 3COVA 3UFXB 4YO8A 1EB9A 4GNRA 1J99A 4JSTA 3R8CA 4QGPA 1E2JA 3ECAA 4EF4A 1I4TD 3V1NA 1FDRA 2QLFA 3OZDA 1JQEA 4PS1A 3VV3A 1IDOA 5EAIA 3RABA 4XE5A 4PG7A 1GAEO 2GKOA 3E3NA 1C4WA 4BTEA 1UM9B 5HUQA 3DCJA 4HRVA 4BLPA 2ZJ0A 4US2R 1SU8A 1K3TA 4EEZA 1YQXA 4L6CA 1E1QD 3F67A 1FTYA 3K72B 5EYPA 1I80A 4KQ1A 3CCEV 3K03A 1XP5A 5KB3A 4OI1A 4LFBB 1BNCA 1KFKB 2MU1A 4C03A 3OZEA 1ATIA 1C3XA 4DLYA 4I9HA 1ECFA 3M2TA 4N01A 1DSSG 2IL1A 4F97A 1KH2A 1OYYA 4RSHA 1HNWB 1WDMA 1RSOB 2EP8A 1U0HC 3OF5A 4PXAA 4FQ5A 5C8YB 1O96A 1NFFA 3RYFB 3MAJA 1DQSA 1UH5A 2WWTA 2A1TR 5FLKA 3ZIDA 2H2HA 3NB0A 4GYCB 2DQSA 3AR7A 3NM4A 2CDBA 5IYZF 3T99A 1VQ7V 2L17A 3WG7C 3E18A 3NTOA 4IRMA 4CKEB 4CTNA 3IAM1 3BWCA 3O83A 4HWKA 2O3RA 3ESCA 3TI7A 1BAPA 5UKDA 1RRFA 3H75A 2ZAGA 3AUYA 3IUNA 4WASA 1HE4A 3CCLV 1AI7A 2XI4A 4WJKB 3NBXX 4ND3A 2YV1A 1ODJA 1TJPB 3APOA 4L6IA 3DLHA 2Y66A 5CDGA 2FZWA 1M3SA 4FLTA 3U16A 3ICQB 2QN6A 2ZCJA 2V3VA 5INTA 1Z6PA 2AK3A 1YVWA 2IHZA 4LGMA 1KI1A 2REQB 3DB1A 1L4FA 1FPOA 2RSLA 3BMQB 5P8WA 3UB3A 3VDMA 1LVGA 2H7YA 1DG3A 3ZHTA 1D03A 1W30A 1ZXLA 2O0HA 3C87A 2FYTA 4YRDA 4B4DA 3OSUA 4QOGA 2Q4TA 1B15A 2QVXX 2R68A 3MBOA 1SXJC 2BZSA 2NNUA 4ETWA 3DPUA 3QVKA 3VC1A 1T3TA 5D3ZA 5K6AC 2BMFA 4NVPA 6LDHA 1HQYE 3AIMA 4DA9A 1J1IA 4D7TA 4C4OA 3QKSB 1KJ9A 4R2KA 3RS7A 3K70B 1SXJB 3NIGB 4GSLA 4UVGA 4L5BA 3T0FA 3K8QA 1U5BA 2QP9X 1L5GB 2RGBA 2VRZA 2VK2A 5KCMA 1EUYA 5TMBA 2F3PA 4NTYA 1AURA 1X7WA 1XZIA 4NZYA 5I7UA 4RD0A 1FZQA 4D25A 3HBJA 1Z22A 4J16C 4TRJA 2XEDA 4IQGA 3EFBA 1E1CA 1VBFA 3CZRA 1EZ4A 3COPA 6CHYA 3WWOA 3JWJA 1ZL0A 2WPDG 1BFUA 5DIFA 3GMIA 2PZSA 4PU0A 4YP9A 2PXAA 2VJOA 4UAVA 4F3KA 2WD8A 3H04A 3DLTA 4N6GA 4TLBA 1T4DA 2C5HA 2XB6A 3PEUA 3QX9A 2H59A 1S9HA 3IC9A 1JKJB 2C03A 4ZCMA 3WWDA 1D4AA 3VKUA 1FYJA 3WFZA 5LLTA 2Y3IA 5CVCA 5KHOC 4IL5A 4KFUA 3QF7A 3QYAA 1B8VA 5KQLA 3QXHA 2WJVA 3O4HA 1YL5A 4H3SA 2BGWA 4TVSA 5DBIA 5A3RA 3TN7A 2AFRA 4ZVRA 2J0UB 4N7JA 3UJBA 3LV8A 1BMTA 2IP1A 3C0KA 5TEWA 1IMOA 3UK6A 4BVGA 1SG9A 4F6RB 2KW5A 3HGQA 5LQAA 1Q1NA 2Y93A 1F2VA 2YZNA 5JSZA 5AVKA 2QL9A 4QU8A 1PG5A 1D5WA 2TSYB 4MUGA 4UE3S 5JJNB 2E18A 4KLZA 5EFZA 3WQQA 4BFLA 1H3FA 3W8DA 1F8YA 4ARBA 1U8ZA 2D1YA 2FRDC 1J8VA 1KE1A 4IG9A 1CUXA 3KQHA 1JVBA 3HNRA 4CETA 1DUIA 4PAQA 3H5TA 2HYDA 4MGHA 3FHLA 3TNJA 1XMSA 1SF9A 3FPGA 1IN6A 3ZLTA 4C08A 3IT3A 4EMTA 1FTGA 2Z09A 4IIUA 5EIBD 1Z8FA 4KYIB 3EIUA 3DE4X 4JN6B 3MWKA 4L15A 2ZI6A 3GELA 3TRKA 2C3PA 4B32A 3QTTA 3GLUA 3H4TA 1MT3A 2F2TA 4QPPA 1ABBA 3UG7A 3U5ZB 3WIVA 3AVWA 4NU0A 1P2SA 2OMKA 4BO4A 4QIWF 3D8BA 6PFKA 1Z68A 1YZ3A 2QRZA 1N6HA 1TVMA 1XQ9A 3Q5GA 5CDFA 1N77A 1P3DA 1GYPA 1QBZA 1UIRA 1FP4B 1MR3F 1W5FA 1Z4IA 1ZJ6A 3L40A 4HAVA 4P58A 3BY6A 4F6LA 1Y7PA 3O8RA 2ROQA 1ZC4A 3ANXA 1VE9A 3MAGA 4BLQA 1FTSA 4GBED 4DQ0A 3CRAA 1ORVA 2PSDA 1RPTA 2RBGA 4YYZA 3R7BA 4CIXA 1EWVA 2AMLA 3F97A 2Q62A 2ZAYA 4LVUA 2VPWA 3T9FA 2A79B 4LF5B 3LNCA 4I0XA 4HXFB 3BOSA 5JAUA 1BMDA 4MGYR 4DLWA 3QA9A 4TV8A 2RI6A 2O6HA 1AQYA 4I14A 2M7WA 1BHSA 1W34A 2H48A 1E3DA 2BFCB 2VLBA 1T29A 4I5GA 3LHFA 3BD7A 4YRRA 4ZANA 1JPUA 2WLMA 4ISCA 5REQB 2J41A 3WGZA 4BYMA 5EVCA 3V7WA 4MZDA 3DKRA 1Q7RA 2WNSA 5C34B 2VHEA 3KDSE 1JSXA 1QYXA 1S2NA 1E7QA 2GZHA 3NONA 2YHAA 2HGSA 4JCOA 4MIEA 1T8TA 3CLVA 3W06A 4DRZA 4JLOA 4NCAA 4PSDA 2Z98A 5NULA 3Q4GA 5JAIA 2W8BA 1AP5A 1MGPA 1US8B 4D9GA 4ENQA 1CV2A 4YMVA 1KO7A 3FPCA 4DQKA 3EZGA 2BEJA 4IHAA 4P6VF 1US6A 4OHOA 3LL4A 2FMLA 3E35A 2UUBB 1IM5A 2WIFA 1U04A 5AHXA 2H9YA 1NN1A 3CLKA 4IMIB 1V6AA 2ZRCA 3P2EA 4G2KA 4ESHA 5ALFA 3JYLA 2BYTA 1M1NB 4FQ8A 4EBBA 2AN9A 1OFIA 1I4EB 2O0JA 1T0PA 2E4UA 2O3QA 3L7NA 4CG0A 1TIPA 2QM4A 2PT9A 2OSVA 2JS5A 1P0IA 2VUHB 3FUVA 3VR4H 3X44A 4BXOB 3DZJA 3BIFA 1XNQB 1AS2A 1U8EA 2EFCB 4GOJA 2C31A 2CUZA 3HA7A 3UM9A 3WKCA 4ZCIA 1C9JA 4TMZA 1CULC 2HADA 5CITA 1WPQA 3LJKA 5AIAA 5B64A 4YRKA 1G2OA 1E2IA 4QEZA 2HA5A 1RC8A 4Q03A 2YW9A 5CBHA 3OPYI 1GTRA 3O1HB 3WYEA 5H8WA 1M2FA 3AK1A 1G5FA 1NULA 2K2WA 3DL2A 3D8HA 1QK4A 3WYFA 2R8XA 2YBDA 4X65O 1D6MA 4I8IA 5BQFA 4OX9Y 3VC7A 2H0QA 4CIAA 3AM4A 1V6CA 1X7YB 4EY6A 1Z6TA 1UINA 4HB3A 2ECPA 1Q92A 1UANA 2HQOA 3WWCA 5LU9A 2VP3A 5EXEA 3L6RA 1YA4A 3IO5A 1SUSA 4LYDA 4NBKA 3LUBA 4NJEA 2VHCA 2ZUUA 3E1KA 3SYMA 5IFKA 3KM0A 1NMXA 1VQ9V 1TCCA 1Y76B 3C8MA 5EVJA 4B17A 3Q1LA 5FBWB 4GUAA 2QBYB 5J4HA 4EB6B 2I6GA 2YVKA 2JGEA 3RRBA 5A3QA 1VA5A 4BB6A 2HCJB 4ZU1X 4H1HA 3E89A 4V0OA 2LKDA 4Z0TA 1P17A 1XLWA 2DT8A 3UJAA 1M76A 3KFVA 5HEKA 1M1YB 2OYCA 5KS2A 3N39C 1Z28A 2WLTA 4PCAA 2H8KA 5G4KA 5FBRB 1Q16A 2DP4E 1G7SA 1UIMA 3WNZA 4DLNA 5BSEA 4GGMX 2CDYA 1N8KA 4X1IA 3RARA 2Y4OA 2ZSEA 4ZICA 3UH1A 5HKAA 4ZHQA 1XZNA 4FYWA 4MJLA 3GEEA 1K7EB 4ICGA 1FLNA 1UQUA 1H85A 1XVLA 2N47A 2XHEA 4G07A 5IPFA 1X14A 6ABPA 3LNTA 3ZV4A 5CVTA 3IPYA 2AMYA 3E8MA 4L08A 4QQRA 4C89A 1JDBB 4H0FA 2FOLA 4DC1A 1EFCA 4PX3A 5DISB 1FFDA 1Z2AA 3THYB 1R6UA 4FHCA 2BOBC 1GY8A 4HH3C 4IM7A 4KZKA 3ZW7A 1OHHA 3PDWA 4B6RA 4E15A 4F96A 1PF7E 1VYHA 3DDHA 2Z57A 3E3MA 2CB0A 5FWYB 4RVHA 1Z33A 3CJHB 2V65A 3CV3A 3L6OO 3M82A 2ZU0C 2PQ6A 1PZGA 2XASA 1UMCB 1DJMA 3BMQA 4I9NA 2JLYA 3CH7A 5A04A 1AR4A 2AFIE 4BV8A 2YKGA 1LPSA 3CFYA 3E1SA 4DJJA 3JARB 2VO1A 2R60A 3HRIA 3WLPA 3EXHC 5JZSA 5CVJA 3BL8A 1P0CA 3ZGZA 4FD3A 4OD0A 3F4LA 4WN9B 2AB0A 5IBRA 2I9KA 4O2BB 3M4NA 3IP5A 2I3AA 4FVTA 1DRKA 4U9IS 5FQNA 3BWEA 4C5CA 1NF2A 4R6WA 4DNPA 3GFVA 1ZJ5A 5K8IA 2XXAA 4DWJA 3WRYC 1OB5A 4CCWA 4R05A 3M6MD 5D00A 5HGXA 2CXUA 4IDGA 2GN9A 4LYYA 5KKAA 1QK5A 4K35A 4Z1MG 4OM8A 5D8DA 3KKQA 3O65A 4MWTA 3VOUA 4LMRA 4YCAA 1KOGA 1LQUA 3R5TA 1QQ5A 2ZYTX 2OT3B 2FSGA 4UU1A 2A2ZA 4QYXA 1EE1A 3RI3A 2K5UA 2YIMA 1XQXA 5CRIA 2NZ8A 1X80B 2Q7OE 4LJ6A 1OJHA 5TLSA 1P9WA 3RAJA 1ZUD1 4BAYA 4IIJF 5L3DA 3LUDA 4AQYB 3LCCA 4H27A 1AG9A 1CJSA 3FKSD 4PPNA 2QWRB 1GCIA 2OQIA 4Y98A 2YRFA 1JAIA 2FEXA 1XZFA 2G77B 1ISPA 1QKJA 3ONDA 1BQ0A 5BNFA 5TF0A 4QLBA 4OL9A 3UYKA 6NULA 3ENKA 2YHUA 3KD2A 3R3YA 3NUGA 5A4IS 2I4IA 1E6MA 2EU8A 4O4IB 1E32A 2GBGA 3DEIA 1HQDA 1QLHA 1V0JA 1XVUA 2EZ4A 4NNJA 3STWA 3WK8A 3ZE8A 3JAWA 3NTLA 1MMMA 4K0RA 3VHQA 3KQPA 5EL0A 1JQ3A 3S3WA 3VZDA 2X3UA 3L9WA 5F35A 4GECA 1BD4A 2P4QA 2PX5A 2DY0A 4WFAV 4YDHB 5JFOA 4GMFA 2B8TA 2BGNA 3HEBA 2BI8A 2AWNA 3O93A 4TQAA 5AXDA 521PA 3TCUA 1ZCJA 1N3BA 3REQA 2BOCC 3ZMVA 2X0IA 3EGXB 5JMPA 3CF2A 1IHUA 2GM9A 1EBBA 3MT0A 3SX2A 5KHKA 2NNWB 3LIIA 4TV9A 4UXNA 3FSGA 1NONA 1XCPA 2ZETA 1Y9EA 1B4DA 1H5UA 1E9AA 1L7AA 3F98A 1PPJH 4CS3A 3H11B 3K8YA 4S0ZA 4D8XA 4AU1A 2P06A 1LLCA 1N7JA 3A4IA 3BF8A 1PJ3A 3GN2A 2XMSA 4MVJF 1ZLZA 5ALJA 2GASA 5IMBA 3U4CA 4DA8A 2HR1A 2KPOA 2X22A 1L4UA 1YBMA 4R9VA 2WJWA 4KRXA 2NO1A 5THKA 4A5SA 4QFMA 4K9OA 1L5KA 3TH5A 3VU9A 4HEQA 1HI9A 4FHZA 3T3HA 3NBFA 4F04A 4CBCA 2OCGA 2JIDA 4L16A 4NBTA 5A4JA 2C58A 2JK5C 2CNDA 2EV9A 1NW3A 3BRWA 3LPCA 3QI2A 3MTJA 1VEWA 2A58A 2ISSD 4RAQA 2QN7A 5EJ5A 3C3KA 4I55F 2VYND 3BX1A 2HVJC 4HWOA 4P92A 3S8MA 3BXEA 1UT6A 1TA8A 3U9LA 1UFOA 2RHLA 4FM9A 3CRRA 1ZK2A 3J81A 4RPIA 4TGLA 1IB0A 4MIKA 5BW4A 3WZLA 3VNSA 1JE0A 4AY6A 2WE7A 2OB2A 3N28A 3D59A 4EFMA 2JKZA 4F11A 3EY4A 5BQ5A 2XUAA 1ZIXA 4NYKA 1QE5A 1IOVA 3KWLA 2CSXA 4QUIA 4RV9A 5A6VA 3SBDA 1VF6A 1JQ0A 1Z45A 3TD9A 4CF4A 3QE9Y 1GV1A 5EP3A 5TXGA 2YJ4A 1SBHA 2CBXA 4MVSA 1NXVA 4NYIR 2WA2A 5M5BA 4J6FA 1JPXA 1CDEA 3EVFA 3RHFA 1AO0A 1XMQB 2GPNA 2G9QA 3H5RA 3K9CA 4OYRA 2ASVA 1EZ1A 5JSUA 3KOUA 3GUYA 4REMA 3HB7A 4RW0A 4RCYA 1Y8QA 2CY0A 1SIWA 1J9GA 2P2SA 3AI3A 5GAJA 2VWPA 2FQXA 2BISA 5E6UA 2I62A 5JQGB 1VDMA 2W6CX 3WWEA 3CBGA 3DZHA 4Z5XA 1FEZA 4MPRA 2N04A 3ZI0A 5JSQA 3SE0A 3LOQA 4DMHA 1LW7A 1K7CA 3ELYA 4X1IB 3OZ7A 1C0LA 4Q1VA 2GYYA 3MCWA 2Z6AA 3ZHOA 3F6CA 3WHLA 5B1SA 2AQ8A 2Q5CA 1X8JA 2B69A 1PL4A 2FU5C 4K0KB 3NS7A 4BZXA 3CX5F 1RWWA 1UJMA 3IMEA 5C51B 1SPBS 3CIFA 1JQAA 5HR5A 4OP2A 1JT9A 1RJ9B 3RB8A 4QAQA 2E0IA 3E0XA 4BKPA 2LFSA 1QLJA 5IK2A 4IV0A 3KP1A 4ER0A 2VPQA 4Q7KA 2YJGA 4KQWA 1KSFX 1RFLA 3OM3B 5DASA 3E3AA 1SKYB 2WHQA 1QC5A 4CM5A 3OZRA 4UXIA 2VNIA 5K0GA 2G06A 2GA8A 1I9GA 1T0BA 3M81A 5H3LA 3GFRA 4A0HA 3S1SA 3F71A 1AS3A 3GDWA 8ADHA 4G0UA 3MWLA 2K9PA 2QQGA 3HVKA 4Q0MA 3B20A 5DCYA 4QPCA 3VM6A 3VSDA 2HLDG 2OM2A 5DM6V 3C4VA 1H66A 1XPUA 4ZARA 1WIWA 4U2CA 1MEEA 2H63A 1Q6UA 4YIOA 2VDWB 3EYAA 3OJCA 3QE4A 4IQ8A 4XIGS 3UZUA 1IN4A 1YIAA 4BVEA 2EX4A 1HE3A 1T1EA 3HB1A 5DWVA 3EH2A 2F66C 3QYJA 5ED0A 5DHSA 3EVEA 1GZVA 2QTNA 4CKWA 2P91A 2WLLB 2R97A 1KAEA 1M6VB 4H1UA 3H4VA 1AOXA 3TSWA 1KJYA 3VKVA 2PUJA 3NTQA 1EIWA 2ZIFA 3T6KA 3GRRA 3A3KA 4QGGA 2Q3JA 1IQ0A 1N0UA 4GVXA 1JNYA 3WNCA 5LIPA 4F6EA 4LAFA 2GLUA 4GPTA 2AZ2A 5CM8B 5G53C 3RD5A 5AVZA 3D4LA 2DFNA 1N78A 2K7ZA 3LU1A 5HF6A 3C4JA 4FYXA 1KYZA 4L8YA 3AHIA 5CLQA 3B85A 5EPOA 2E55A 2QQEA 1QCEA 2CV1A 1EK0A 3C3XA 3OO0A 2W0FC 2P7HA 4NCIA 5CHEA 3RSFA 1L0LH 3CRMA 3VH1A 1WQ1R 5D5QA 3GEMA 3SI7A 1N2BA 3D6VA 3O3MB 3WLQA 1TT5A 4XPIA 3J7AC 4O4IA 4FZ3A 2EQBA 3WFVA 1AKWA 1B74A 1QANA 3KLNA 3CLSD 1ODSA 4GQIA 4WFQA 1Y42X 4Y9RA 3KVOA 3ZI4A 4MKIA 3ZWAA 4R6ZA 1BMFA 2OFFA 1IAQA 4BLSA 3I2JA 4YUVA 4JR0A 3SD7A 3SFVA 2N46A 3OZXA 5A02A 2I2AA 3OEEG 3IX7A 4LDRA 3UT5B 2Q69A 4G25A 1XF9A 4XDGA 4EF6A 3ES9A 5B3JC 2PV0A 3ZE9A 3ZUGA 2JFFA 2Q0OC 1SJ9A 2R86A 2V4ZA 3DFMA 3OETA 1BKDR 1X38A 4UHJA 4Y6GB 3ADBA 3WA7A 2X7JA 1H2GA 4D9KA 2FSPA 4M1OA 1F7VA 2M6YA 1IEXA 1C3LA 1OA1A 1TZMA 1J49A 1E96A 4JOSA 4YPOA 4JYZA 3N2IA 4G0MA 1EDBA 2FQQA 3MFYA 5D1HA 4ESEA 4S3MA 5L45A 2G0TA 3T12A 4E31A 2DUUA 4BRUA 3UY4A 5FOUA 2PGIA 4G37A 3FMOB 4MW0A 1NM5C 1AUQA 3EAQA 1YQDA 4Y67A 4J7ZA 1Z7EA 3R7WB 2PUEA 1W36D 1S0VA 2QJFA 3W2FA 1C0IA 1XRRA 1E2PA 2A94A 2GJSA 1K5QA 1MX5A 3GVHA 3I8OA 4M36A 3FMPB 5ECWA 1C0PA 4RD3A 1D5CA 5EHXA 5D3QA 4GI7A 3ETQA 4NOLA 2Z8XA 5CA1B 3SF8A 4QYIB 2YZKA 3G49A 1GFIA 1TI7A 4LHWA 4V02A 1JJBA 3BEOA 4UMDA 1FXKC 2B1GA 2QX9A 1JA9A 4FJ2A 3W6ZA 3VSAA 4EFNA 4ZCTA 4CKXA 3KELA 3FG9A 3WIBA 2FJPA 1C7JA 2AHOA 4B09A 3BEDA 4FYIA 4FDVA 1R3KC 2Z5UA 5LL6Y 3ESDA 3KAPA 2IY9A 5EQJB 3V00A 4DLXA 2NPOA 2OHXA 4D4JA 1Q1ZA 4YO7A 2HCTA 5BW6B 2VF7A 3VR3A 3NIWA 1WXGA 1ICIA 1Z2NX 1CB7A 3N7TA 1DDGA 4X90A 4L27A 5DIZA 4ETNA 1FFAA 3G5TA 4EJSC 1N0WA 3MG9A 1S77D 4A3SA 3K5IA 5FLXN 4LWQA 2O3SA 1QHNA 1JYSA 1OZFA 1SG0A 4TLDA 4C43A 3GJ3A 2B30A 2WWIA 1YULA 2P3LA 3SQWA 1LPMA 4KUGA 3PNYA 3JSXA 4L28A 3MHTA 1XTPA 1Z3CA 3GRVA 4DMKA 5EBWC 2PH1A 3TFWA 4TRNA 4BV2A 4H59A 2X13A 3S2SA 4DLUA 1N2CE 4HDRA 3DB2A 4ER5A 2Q41A 2Z30A 3ICPA 4E7PA 4EUKA 1WOYA 3V80A 3BMCB 1T5EA 2B7LA 2P41A 2V7WA 4PV7A 4B0OA 2QMHA 3U6KA 2WVAA 3BRCA 2E74B 2PPLA 3WP1B 1GHTA 4TM7A 2G4LA 4CFZA 1J22A 1KRHA 1UFQA 2FQYA 3B70A 4LCEA 2RK4A 3QELB 2XKAA 4QBIA 3SYLA 3LQQA 1Q7GA 1VYVA 4IVPA 4KK4A 4XVCA 3KO8A 4LY9A 3GGDA 3IAYA 4AY3A 3NKFA 3DL7A 3QYPA 4JITA 5BSMA 4ZO4A 4D9CA 1SURA 3EZ9A 3AY0A 2XBLA 1XKLA 3K05A 1B3BA 3PS9A 3CHXA 1SM4A 3PC4A 3QLEA 2JAOA 4CV0A 2P6OA 1GAXA 3OJLA 1R8QA 3E05A 2OFWA 3PGJA 4GLBA 1J4AA 3BZWA 2OSBA 3UMYA 2DMXA 4INAA 3CCBA 2DQZA 1EDDA 3DTTA 2WF5A 3OLZA 1Z08A 2H00A 5BN5B 4KFCA 1XRMA 3LLUA 4YRBA 1X1SA 2ACVA 1W4RA 3NQ41 4LI3X 4OPMA 5BRJA 4GKKB 4WZAE 2OO5A 3RTAA 1MPTA 3OWHA 1GPUA 2HA7A 4KPUA 2PZAA 4OI2A 4ER6A 5ER6A 1E1RG 1UXJA 4HN4B 5K4AA 4R2LA 4ZBMA 4ZVSA 5C8ZA 3SYOA 2PVSA 4ZYYA 1CBUA 4NTZA 1RP7A 4OJYA 1TF5A 1CUFA 1MSDA 5HQJA 2V8OA 3RUAA 3UHPA 3U6BA 3U26A 1S8FA 3QPCA 2BGJA 1DTSA 3QEAZ 3N70A 4IKPA 1VQMV 3C8ZA 1NUUA 4TTPA 2FKNA 1N1EA 4HQ6A 4QUGA 3SJCA 3VR6A 3K08A 1C7RA 1FXWA 2OESA 2ZTUA 4KE7A 2CXTA 5MF6A 5HE9A 4DV7O 3LT0A 5AK0A 5FD8A 4GM1A 1Q1AA 4BQPA 1PSWA 4LRTB 4IZIA 1JDSA 1WZIA 1X3SA 1WTAA 1ZD1A 2FHPA 2JW5A 3MBIA 1YS1X 2IZ7A 3O4IA 3SXJA 5CT6A 3GLHA 9LDBA 3PJRA 3F3MA 1T5HX 3NJ8A 1GT6A 2PM8A 3IMGA 4YIHA 2AOWA 3K0GA 4KR6A 1FIUA 2JLQA 1KJQA 4HN2A 4J9YB 1I1NA 3TPCA 3DOJA 2XD9A 2EIHA 2F1RA 1KC8W 2F4VB 1Z2CA 2AN4A 3DO8A 3LLSA 4HHEA 4WFKA 2WA3A 5EIBC 1P1JA 2X8WA 2GHQA 3MERA 5BV8A 1YR8A 1ULHA 4CMBA 1IXRC 3CA8A 5CURA 2O5CA 3QKUA 1PJZA 3A28A 4E2YA 4P22A 4ALNA 4BQRA 5ABPA 4XRRA 1ZN8A 2YNMC 3AR5A 3FD8A 4TZ6A 2OK7A 3JD3A 2ZYGA 1L4MA 3EOBI 1ZMXA 1YFKA 3FCAA 4QPNA 4RDIA 5E2AA 4JSYA 2AJCA 2HUNA 4LZNA 1B3RA 3G5MA 1XIVA 3MINB 5I47A 3FMGA 4D3ZA 1KI6A 1NW4A 3HM2A 2KQUA 4JROA 1YQQA 5HXAA 4XB1A 5ALLA 3VKFA 1ZVQA 4X93A 4PXSA 1Y76A 1SC4A 4N3AA 4WDQA 2ZKOA 1ZAYA 1KARA 3WGJA 1N6PA 3HZRA 4QHTA 3PFFA 4HEA1 3N87A 4RK5A 5M04A 3ZGXA 3KQSA 4X7PA 4NENA 2WYOA 4YRMA 1J90A 3ADOA 4CCAA 4MW4A 5DTEA 2Z5GA 4BNUA 2EFHB 1LWNA 3CW9A 3OZGA 5CFQA 4FMTA 1LLDA 1RMQA 2GEJA 2IPNA 2Q1SA 4OX9O 2RH4A 3AR6A 3JRNA 4LXHA 2ZVDA 4Z2AA 3KS9A 3ZWPA 1F7YA 2KBFA 1VLQA 3DZFA 2R4UA 1J8FA 4PBSA 4TSRA 3HDVA 2CT8A 1EUCB 1K08A 5A3VA 1XNRB 2BKXA 2NIPA 3IBSA 2ZULA 4YCNA 1IN1A 3BC1A 5E7JA 1C7FA 1X7ZB 5FTWA 4U5XA 2UUAB 2IYSA 2GK4A 2ZSFA 3KQYA 1QHSA 2V9CA 3GAAA 3O2NA 3RVJA 1QIDA 3CGWA 3SQMA 3ZXYA 4DCOA 4ZJUA 5HUHA 4AKIA 4GE0A 4ODIA 4DQLA 3LHIA 3TMYA 4F7DA 2YDXA 1YKFA 3VH4A 2G82A 2E7ZA 4KYTA 1YDXA 4UNNA 1QK3A 1E89A 2I6SA 3FUWA 4C3OB 1AI4A 2Q5OA 1P5RA 1X1EA 3QLUC 5EWJA 5FA6A 4DABA 1CEYA 1Y9JA 1ZLXA 5HF8A 3GGPA 3I1JA 4TQDA 5J1TB 3GNSA 5DBFA 3I28A 2XGGA 1F48A 4IINA 3CCVV 1MHPA 2NUPA 3NP9A 1B42A 1CR4A 1BS2A 3B6MA 2WQ7A 4MS2A 2PZKA 2J31A 3C6ZA 3QUBA 1G7TA 2YN4A 1VL5A 3H3XA 3ZBPA 1FTQA 2VR1A 4Z9FA 3WTBA 1WF6A 1K98A 3MRVA 3ZH2A 4ZK6A 5U9CA 2XXAB 1FTWA 2W2NA 1P2VA 5TVKA 2GPYA 4FYVA 2W6IA 1GPAA 4NMMA 4R84A 5JBQA 2DT5A 2GFQA 2JH3A 3MGBA 2C8KA 3TXSA 1YVUA 4RTRA 1SHUX 4MCIA 4Q18A 1BKSB 2VHYA 2X5XA 2ZCVA 5G1NA 2JEYA 1PKXA 2LIVA 2Z4SA 3PA6A 4JODA 3VBEA 1M0SA 3CW8X 2G25A 1GCAA 3KJZA 2JBAA 3RSZA 2E9SA 2YWGA 2HPAA 5BSKA 1V11A 3MJHA 1X9HA 4CTKA 2FDCA 1WXEA 3OLWA 3M8AA 2EIXA 4ZMBA 1JAXA 4WK2B 2B61A 3EGWA 3GBPA 1I08A 5SZHB 2PS9A 4P0PB 1O9GA 1DCFA 1KFCB 3LZCA 5DN6A 2WTMA 3QITA 3WA6A 2OY0A 4DQUA 1MDBA 4PPQA 3WYGA 1C9EA 1YK0A 2WOOA 1GITA 3F1KA 4X95A 4AIRA 4AQDA 4DEXA 2NP6A 3OZAA 2OM6A 2YYAA 3D3KA 3TTUA 1EHCA 4Q7LA 1KI6B 1VJRA 3A10A 4I3FA 3EJ6A 4FM0A 1FSSA 4B46A 1FYFA 1NT2B 3LNNA 2PDAA 4J3JA 1QKKA 1S1CA 1YONA 2X7HA 1E3TA 1KNXA 2J3EA 4QRIA 5I9TA 1PE0A 3U62A 4C6TB 2EQ5A 2FSHA 3TJTA 1YR9A 4TROA 4PDVA 4OB8A 3JTEA 4AXBA 3WQSB 5JTTA 4OQFA 1H9AA 5C5DA 1FJ2A 3JYQA 4NY1A 4YRAA 1NW8A 3GOQA 1QR6A 2ZYWX 3OD4A 1X1QA 2B35A 3BUSA 4RABA 5AHWA 1VJ0A 3DMDA 2QTSA 3OBIA 1RSZA 2IHVA 1GZSA 1PR3A 3TETA 4CHGA 2IU4A 4BO6A 1QU3A 2QM7A 3IIMA 3RS8A 1Y8ZA 5AYVA 3K57A 1T3LA 1T4BA 1UK9A 2WFLB 2FB9A 2BGGA 3J7TA 3IEPA 2CL6X 3S28A 2AE1A 3C5VA 2F93B 4LY3A 4O33A 4ILKA 5FNZA 1V1RB 2YWCA 2XAQA 5CA0F 1U0FA 5C4MA 3PWTA 3SS8A 1WBDA 1JH9A 1ZXBA 4P7FA 4F8JA 2FOXA 3CSUA 4KFTA 2WTEA 2UU9O 4NCNA 3SQOA 4YT5A 3TFOA 3BHPA 2RHCA 2ZB8A 3AY3A 1OGIA 2JAXA 3KZKA 2C5AA 4P08A 3UWDA 4FLUA 1C1XA 1ENYA 1PS9A 2QIOA 2Q6TA 4IDHA 3ZGYA 3OPXA 1BVUA 1XR3A 4OP1A 1L5FA 2X6CA 1D2HA 2HWUA 3PICA 3SU8A 3EGCA 3I5MA 1Y1PA 2EJCA 4PDMA 2JC3A 4G0ZA 2EX1A 4BGIA 4C7KA 3U1TA 4LCBA 3AI1A 4UDNA 4BVBA 5B6PA 3ZHXA 3NUZA 1KVSA 1Y98A 2Z5VA 1CZOA 4B1FA 3O8LA 4XDYA 2QAGA 1ZK4A 5AHOA 4BNDA 16PKA 2Z04A 4DQXA 5CB4F 1MX3A 3MCUA 4F2PA 2NYAA 2R9RB 2Q7XA 2WA1A 2PTGA 4RBNA 4RTNA 1BX0A 1P62B 1G5QA 5BYKA 3EPJA 3MVEA 4OCZA 2IIQA 4LHSA 2RAUA 5DECA 2PF4E 3QV2A 1LR1A 4AZ3A 1SMKA 2FZVA 4I5EA 4K9LA 3SC6A 1MC8A 4GZ3A 1S2OA 2DFPA 4E7OA 3SZ3A 3M70A 1BCCH 2RBKA 1Q14A 2GJKA 1NVFA 1F0PA 1ACLA 2X2FA 3IGFA 4QASA 1PX2A 4ZXFA 2ZSIA 3SPCA 3NV7A 3Q5DA 3EIOA 4X8LA 4E5YA 5IXYA 5ALWA 1JEQB 5ALMA 4IL6Z 2JCVA 2HO5A 4QUHA 4ALKA 3TNDA 3BG5A 4ZVOA 1G3RA 3K35A 2GO7A 3KC2A 5IZCA 4JI3B 3HKDB 1Y6JA 3HZZA 1LSJA 2XYPA 1LRLA 2I3BA 1LD3A 3ZR4B 4E33A 4EELA 3FDZA 4H7IA 1QBKC 3VDQA 4XUCA 4EYQA 4CLXA 1A7JA 4JP3A 3T5GA 3ZNQA 1HZZC 2C0CA 5B1NA 4AYTA 2WYUA 4B2LA 1ACJA 4PCUA 5B66Z 3OTQA 3DEKA 4KDCA 4MUAA 4UTXA 4MR8A 5C8XA 3P5BA 3F3KA 5K3EA 5KCZA 2RK3A 4DJFC 1QS0B 2NLJC 4QPDA 1DL5A 1UDWA 3N3BC 2HXYA 4R2MA 2GN4A 5JJEB 4W7IA 4ZYVA 1CRWG 3IFXA 1R5BA 5GINE 4YMWA 1R6XA 4QE7A 4JBWA 1XYVA 4OHKA 2FTKA 2ALJA 2DR3A 4TL9A 1LQTA 2XT6A 4QTXA 5LB4A 4DEYA 4I66A 5KVAA 1NMSA 5FR1A 4H3VA 1EE9A 2J8ZA 3EOAI 3GHYA 4ZDWA 1TEVA 3P96A 3NWPA 3TOXA 4CNQA 2X3FA 1GAWA 4ZEVA 4BNXA 4GYKA 4PIPA 4ABYA 4Q9LA 1ID8A 1KETA 2YIAA 3QW2A 5BORA 2NU9A 4DK0A 1SGWA 2B9EA 2G63A 2GRUA 4TLCA 4DIFA 4XWYA 1PX0A 1V5IA 4V1CB 3LBIA 3O3OB 4P3KA 2VLIA 3ZHUA 3O2SB 3DOEA 1TNDA 4L9AA 4M83A 3K09A 4KTTE 4KPGA 2X9GA 3DZ8A 2RAPA 1KD1W 1P77A 1DCKA 3HEMA 4PR3A 1HYHA 3U61B 5DLYA 3OF2A 2C4HA 3SX4A 2LIPA 1YA6A 3JQ8A 1AB6A 2A7QA 5B2EA 3K09C 2I87A 4UAGA 5AJZA 3RFXA 5T4HA 1I14A 3GLSA 5FHQA 2OCCC 3GW8A 3WXBA 1VPWA 4KRFA 3G9QA 3MCTA 1FYDA 4X84A 5FTLA 3BPZA 4OK5A 1XREA 3L8FA 4KIWA 2OCIA 2XSZD 1KP2A 3UK0A 1SVWA 3B9RA 1T6ZA 3CWZA 3RTGA 4Z4EA 1QVGU 1WCIB 1Y33E 1GQQA 2A5DA 2P4SA 1KKMA 4R9NA 1T25A 4I3HA 1QQTA 1Z4OA 3KOWA 3WRYA 4MQLA 1RQRA 1YWGO 3JQCA 1TAHA 1XNQO 2WE8A 4JAVA 3ER9A 4UASA 3TM4A 2X0EA 1N5MA 4LOHA 5DTJA 6ADHA 3QJGA 4HLUA 2CLCX 1QGUB 3PJDA 1HL3A 1RHKA 2B98A 2Y1CA 3A4VA 1NVWQ 3N76A 4N65A 4UHCA 4CIVA 5LQJA 2GAFA 3T1QA 1VF6C 3PT9A 2Z2ZA 2HK7A 1A96A 2PMFA 3AFNA 3X43A 3I9V1 5EUMA 1HX7A 1JNXX 1W0CA 3COYA 2G9UA 3LUAA 4BQOA 3EEFA 3MXOA 3VQVA 2GDZA 3VO8A 2GXQA 1RRKA 3M6LA 2JK0A 3RS2A 4FPPA 1Z7YA 2EZ8A 2ZT9B 1OX6A 4X44A 3MWDA 3FNQA 3FX7A 2NM0A 1R50A 3U40A 1DWQA 1M83A 3RC2A 3ZGVA 3U7HB 3OZTA 4D9FA 3CJQA 3A25A 4O4HF 1BC5A 3AVPA 3F7TA 4R1NA 2ZUDA 1P7YA 3DUFB 1ZO8A 4EGFA 1D04A 3QUTA 1W25A 5BWMA 2ZE5A 3A1VA 2QF7A 3QVLA 5EJAA 5IASA 2OTJV 2P79A 5IUKC 3KD3A 2JDIG 5CFLA 1BE8A 2YY5A 1EEHA 1IHOA 3M49A 5JQGF 2WJ3A 1LBQA 4DDWA 1NUQA 4UMEA 1ODFA 4Y9SA 5JE8A 3AJDA 1H8ED 5DWQA 1CKEA 2L19A 5C35A 2NO4A 1TQ6A 3DOIA 4P82A 4XDKA 2V6GA 3M3DA 1BWPA 8GPBA 4RA6A 3IEIA 4U7TB 4WESB 3A6EA 4R69A 1X42A 3E0QA 3UANA 2AX3A 5LQRA 4DSAA 3C7AA 5BVGB 1C1DB 1Y7HA 3DLBA 3ANYB 4D9EA 5C2JB 5KQGA 4O08A 1DOAA 5EE9A 1LDEA 1TCVA 4EGSA 3J81k 2ZBQA 3AW9A 3A70A 3DTVD 5EZYB 1EQ2A 2CDCA 5E0OA 3BH7A 1WCWA 2DKNA 3U4DA 4YJHB 2ZPAA 3GA7A 3OIUA 5COBA 2Q4EA 2WJPA 2I91A 1P84F 1QFXA 1OBCA 2TS1A 3N3AC 4LRUA 1BD3A 1ZOOA 1BU5A 2HD4A 2IYPA 2NT4A 4KWCA 3VBCA 2HHCA 3VPXA 3X0DA 3OHPA 5H81A 3LA6A 4B2YA 2Q1UA 1KSHA 3E48A 3ICCA 3INYA 4MW1A 6YASA 4J7JA 3PCTA 1C8LA 3I2GA 5KHGA 4IOJA 1TM1E 1SCUB 2BCEA 1IX9A 2G80A 3GLFA 2B5UA 5A1TA 4GMXA 4JBXA 3D6JA 1XLVA 1MJNA 1C7IA 2HTEA 1XHZA 3BEHA 3DF7A 4O2RA 1DBQA 3IKMB 4DJAA 4CF5A 2CJFA 2Q1XA 4HUTA 4LV8B 2ONCA 2PA3A 2R5WA 4UUPA 4N0MA 2Z2JA 3FVRA 3F5TA 4IKOA 2VOEA 3BD6A 4ARZB 1V11B 3QELA 2IH1C 3MTBA 4I4NA 5ANRB 1FJXA 1CNFA 2PZBA 2FK8A 1XNGA 2PZEA 4G1BA 4PYQA 4QQ8A 1U7UA 1IUPA 1GTL1 2CE7A 2QTOA 4YAJA 3D43A 4HX2A 5DGIA 3RJ9A 3E9CA 5LD2B 1C4KA 1R4MA 3TLZA 4DKXA 4MYRA 1Y8QB 1CVRA 1ZUWA 1PFUA 3TDNA 2WSSG 4HK4A 2HRZA 2FPIA 3GB7C 2R9VA 2HWKA 3HPRA 4FS8A 1OKKA 4E4YA 3ABIA 1SK8A 3AVUA 3PB3A 1FSFA 1TVKB 1G16A 2ZLBA 121PA 1GZUA 2FUKA 5KHJA 2OFXA 2WMDA 3AZPA 5J2TA 1OFHA 3N9IA 4FE7A 4LXXA 5TGTA 3VC2A 1BE0A 3FLAA 4X6YA 3VYUB 3BSWA 4AJEA 2AS0A 2WBLC 3Q15C 5I6DA 3FDXA 3UKMA 3R66A 1LB1B 2ODNA 2BFFB 3MLEA 3EXIB 3HKDA 1G1MA 3IPRA 3RVKA 5LZ5A 4DHWA 2QT1A 2X6AA 1N6OA 1EQUA 2JAUA 4URZR 2BSKA 2PZ8A 5C4GB 3LYUA 3W2IA 4XYBA 4JXXA 4FEAA 4DR5O 3VNRA 2G1UA 2P9BA 3AYXB 5CB8A 3SNKA 5IDWA 3R3JA 1DRUA 2ECFA 4KAXA 3UXYA 3FCYA 3D0OA 3GIDA 4RZIA 3IMFA 3IXLA 1QB7A 4JS0A 3OLQA 3SDSA 2PYZA 1K73W 1CETA 3MHSC 1CIPA 1CP2A 2NX2A 3H2SA 4Q1EA 4BX0A 3SJQC 2RHWA 5JEEA 5ALYA 5LMCA 1S2IA 3ZRVA 2IEAA 1E61A 3RWBA 5B4VA 4Q7QA 1LF5A 3MWYW 4WVFA 4KTVE 3K0FA 4PRZA 3WL6A 3AP2A 2V1DA 4BMYA 3PR3A 1SUCA 5BWNA 4RLQA 2GSMB 1T1SA 2AC4A 3DBVO 1TRHA 4GZ5A 4IR7A 4MWOA 5EZYF 3M89A 3DS8A 4NB5A 1SULA 5I3CA 1QZXA 1XMQO 1J23A 1UC5B 4GOKA 1CQIA 1FRNA 4MULA 3TVYA 4CJXA 4V3BA 2F6RA 4YCDA 2XODA 2YDYA 1XRLA 4LRWA 2G3YA 5IEJA 3STVA 1U7OA 4BNZA 3K16A 4JMLA 3C3EA 1ZCBA 4J0DA 4U0KA 5HPYB 1M72A 4OBWA 3NHLA 2W2MA 5CLIA 2CUGA 1PLLA 1UWVA 5ALXA 1NVGA 4CM6A 4ZK2A 1PEDA 3W4JA 2I3GA 4YRIA 4IGAA 2C0QA 3IP6A 1FD9A 9ATCA 3L4JA 1EFRG 4QOJA 3QSYA 5BOVA 3QVUA 5B3SC 2XOKA 4UBNA 1SQ6A 2ZGVA 1GTOA 3G79A 1N4AA 4ZT4A 4OMCA 3AEUA 3Q7IA 5C52B 3WHIA 1YHNA 3N58A 2WAXA 3T3PB 4HZ3A 2ERXA 1RIFA 1XMOB 1XP8A 4CMEC 1V4BA 1T34A 3CSSA 4JGGA 3SQXA 1B76A 2ENUA 2JEXA 2FN4A 5FQOA 4Y2GA 2D7DA 4V0ME 1SCQA 1O2DA 1EJ6A 3K79A 3UC9A 1RYYA 4WPGA 1FSGA 4JLAA 1CCWA 1JJVA 3HACA 5AUPB 3DYVA 1DEOA 3NETA 4UM9D 1Z8NA 3ZYCA 2JZCA 1OBHA 4HD8A 2IDJA 4UM9B 4J41A 3RYHA 1P7ZA 1ZI6A 5DNVA 1Z73A 4UNIA 2XDAA 1C7EA 2W2QA 1VFPA 3BGOS 1CY0A 4LCUC 3F0TA 1H42A 4CKBA 4XX0A 1Y9DA 1LNQA 4B48A 4CEIB 4NESA 4NZ9A 3AG3C 4IKEA 1S9DA 4MWCA 2HO4A 3MF4A 1I7DA 1H4SA 3HQ4O 1TFUA 1XTBA 2Q73A 3EG9B 3G0BA 3FLEA 1TZCA 2W6JD 4MWBA 2F9FA 3TZLA 4YJ3A 1YRLA 2X77A 3LC2O 4ZYWA 2A9HA 1K2WA 4I81A 3ZZ0A 4M1MA 4EKDA 2R6AA 4DCCA 1VKNA 3MJRA 5K0JA 4LJYA 1RNLA 1GKFA 2WWXA 2VJCA 4DUPA 5EMNA 4YUZA 1X1BA 1TMYA 2EOAA 4J1TA 4LZPA 4CU5A 2IF2A 4UTPA 2WFMA 3N0XA 4ENRA 2Z2XA 5AICA 4MROA 4RO2A 3IA2A 3UBTA 4Y9DA 3PRHA 2OLEA 1KKDA 5K0SA 2GK6A 4G0XA 4CFYA 1SOUA 1EZZA 2VJAA 3ZU2A 5LGNA 1AK9A 2CBZA 5ILOA 3UJHA 4EY7A 1WE2A 3BB1A 2VTKA 2CUTA 3NCTA 1M90W 3C14C 4HQFA 4TS1A 3TDMA 4J76A 4N39A 3BFJA 1R0LA 3EDOA 1SBZA 3O4FA 3QFFA 4YUYA 3OWXA 2HT1A 1ISSA 2EWVA 4JT4A 1B6QA 2CKMA 2YEVA 1GDDA 3RUDA 3EC2A 2FMFA 4G8JA 4MV6A 3HP1A 1KYXA 5G4KB 5BYBA 4DA6A 2ZUBA 3HJHA 1XHFA 4P3PA 5BP7A 1H8HD 1FMFA 4LG1A 3N74A 3JD1A 1A9XB 3T1HB 4B4KA 3N2KB 2RGNC 2QNBA 3WLKX 2ZI3A 4PX2A 2JFZA 4BFSA 4YREA 3B8HA 1TKRA 2A35A 2XUPA 2H2GA 3D8RA 3RU3A 2D54A 4ARSA 3WK6A 1NWCA 3D3WA 4OHCA 2BSKB 4OQZA 4EMSA 2EIKB 1V3UA 3CXHF 1HT1E 2GR9A 3MWEB 4FDMA 1CDZA 3PNVA 4PG5A 1VPTA 1KKLA 2H0AA 4Y9UA 1BGWA 1EGHA 4LMPA 4RH3A 4ATNA 1FRQA 4CLDA 4L5JA 4CW7A 3JVEA 1Q0QA 5EIOA 2I22A 2EJ7A 1A1VA 1R5JA 2DQ0A 3GOHA 4N8DA 3THXA 1ILEA 2R751 3C41J 4RQAA 4E4EA 2XIJA 3QUAA 2H92A 2VRNA 2YZ7A 1DWUA 2HJFC 1I33A 2NYRA 4JAAA 3GVCA 3PPVA 3GWKC 3GDGA 1I5XA 4JASB 1VQLV 4MKGA 4U9UA 3HYLA 4H9GA 4ZEXA 1YSCA 1Q84A 1SERA 1OHHG 2AYYA 3H9GA 1IJEA 4OXSA 3RFUA 3VGPA 4WF9V 2X5NA 1TT7A 4OX9B 1BH6A 3CH4B 2ZSUA 4AX4A 4CDMA 2Z6QA 3E58A 2IP4A 2BCJQ 3K0AB 3TM5A 3ULKA 4W1SA 4C2AA 4UTVA 3FFTA 4EKWA 1G17A 2CNBA 5ELLA 3W05A 4DQDA 4B4UA 2OV1A 3EGDA 4Z4CA 1COWD 4JENA 2RK6A 3C7DB 1O6GA 3IJRA 3NBYC 3L7DA 4IHQA 1C9KA 3W7AA 5J63A 3ZW9A 1K89A 1N2EA 4MB0A 4Q4JA 5FLYA 3U7JA 3D36C 3ITNA 2JLZA 1JHQA 1KQNA 4KXFB 3AY7A 5I7RA 4H7DA 2QWXA 2BBWA 2EYUA 1EFPB 3FHOA 4NXNO 1X3LA 3L5KA 4PYLA 4PI0A 2IGBA 2HPHA 2OCXA 4N18A 1IXMA 1XTVA 3FCOA 3ML1A 4D96A 1K2VN 1L1QA 3H19A 3LDFA 2CK3D 4QRDA 1TKCA 5CMLA 2P40A 4YJKA 5D7BA 1PGQA 2MINA 4GSKA 1K6XA 1SUEA 2C20A 2ZWPA 4NFLA 4OHBA 1E2MA 4PINA 1DWOA 4DDVA 5B5SA 3TS1A 5NLLA 3E8BA 2X5OA 4LTMA 4QAJA 1EAMA 2AFHA 3KT6A 2IUEA 4FGWA 3H1JH 3QVVA 4ISBA 4EL5A 4D6XA 4DTIA 3WS7A 4BEWA 3E2MA 4Q3NA 4TTVA 4DUZO 1W96A 1AJQA 4XW2A 3T9BA 1RD4A 4X7BA 1E62A 2IYRA 5KNBH 1NVBA 2GXUA 4UBIA 1QH1A 1N33B 3U39A 3PJEA 1JBEA 4JJ7A 2G40A 4QPZA 4YACA 4ZCSA 2HJDA 2OYRA 5L3VA 3I56V 3ME5A 3OOEA 1T9KA 4PSUA 3EG5A 1FS6A 4MVMA 5JAOA 3UPTA 1LDNA 5EQFA 1YS2X 3PL1A 4RJLA 3FWZA 1EHYA 4BJ6A 3LCRA 3B40A 2V74B 3FROA 3ZNPA 2XXJA 1V55C 4O1IA 4KXVA 1P7BA 2A9FA 2PAAA 2WIDA 3N2GB 1DFHA 1JA8A 1X74A 3F3SA 1UBJS 1VI2A 1Y48E 3W3AA 4D7SA 3FMVA 3H6KA 1S5JA 5J9PC 2A1UB 3NYQA 4QLOA 1G2QA 5DYNA 3QX3A 4PYJA 4B2IA 2NZUG 2EP7A 4EI2A 2FR0A 1V45E 3ZKAA 3CUTA 2UZ4A 4XR4A 3EXG2 4NR0A 1T35A 3O0TA 2IZ1A 2BPOA 4MV7A 4NG4A 4B76A 4DLAA 1QF7A 4V03A 4C0JA 4DV4O 5A0TA 5EJ8A 1DGQA 2CF6A 2OG2A 3ZHZA 4TKVA 1H8HA 1CJCA 3C90A 4U3JB 2Z8YA 3G1WA 4GKAA 1YJCA 3OZFA 4KE8A 5IF3A 1MUUA 1P9RA 2ZROA 4YEDA 1RAFA 2ON6A 4A8JB 4RZHA 1NYLA 1K8RA 5TISZ 4UCSA 1I7PA 1EK5A 1FX0B 2ZM6O 5ESXA 1PTJC 2I34A 4QBGB 1Z4QA 2C4VA 3IERA 3GJ7A 3SICE 3BT7A 3QKRA 3Q7SA 4BVFA 5CXXA 1T5BA 2HBRA 4TMVA 2V7EA 4J49A 5F5XA 2H9IA 4WBNB 3QMVA 2BONA 4GM0A 1IZ8A 1I2BA 1OLOA 2O7VA 3AU8A 4INPA 2OAEA 3DMFA 3N07A 4WVLA 3W7TA 3QU2A 1SRRA 3ONEA 5FB3A 1L5HA 3ZE0B 1AKNA 1IXSB 2EATA 3L74H 2R6R1 5LFAA 2YSUB 1YZFA 3DP7A 1E9CA 2PE5A 3PXEA 2RKOA 1Y0BA 2AE2A 4AS2A 2DETA 1Q6IA 5GTHZ 3GCGA 3BN3A 1Z5WA 4LWOA 4X89A 3GVXA 3PQDA 3Q72A 2W70A 2W58A 4JLPA 5BVHB 2WRZA 3I1FA 1ZMRA 4S1TA 3UK1A 3JCUZ 3OT5A 4QDOA 4QECA 5BUCA 1G21A 1U1EA 1VIBA 1FC0A 1L4NA 1ZOIA 3SJAC 2GUGA 2I6TA 3DONA 4RKEA 1PO7A 1L3CA 2UUCO 2ZS7A 4W1RA 1Y6XA 2YINC 4WKBA 1KDVA 4EO7A 1O8CA 1GN6A 3T4PA 1M2OA 2PS0A 2ZXUA 1RJFA 4ABTA 5CAEA 2WU4A 1N25A 4LYHA 1T36B 3FVWA 2XNDA 4G9BA 2ZUTA 2FJUA 3QLVC 4GPIB 4HMPA 2E6KA 4I9FA 1E6LA 4Y6QA 3ZBTA 3NRJA 1A5AB 2VF2A 3FKQA 3GEBA 3GRUA 4FC7A 4BFZA 2O8FB 3FFBA 2VZEA 3K06A 5HCNA 4C4PA 1QP0A 1JG4A 4NMWA 1CY4A 1HMPA 4TZ0A 4CH5A 4QUEA 3WMGA 1GZ4A 3AEQB 4ZVQA 4E09A 2IIPA 3WADA 3EGDB 2O8EA 3KZNA 1PFQA 1ADJA 1ZGBA 2BSQA 4KSYA 5KNCH 2GZ3A 4WUTA 7GPBA 5K8CA 4R9SA 2PZMA 2BTOA 1G8FA 3KEQA 4XAQA 4G2TA 3WICA 1F9EA 1ILWA 1AY0A 4R1OA 4QT4A 1DIRA 3O26A 2ZUSA 2IUUA 4BNFA 2BM9A 1M2EA 1DCTA 2DRIA 2FUG1 1CJTC 2ZRAA 3PEYA 3W4IA 3R7DA 1BVHA 3ZN0A 2VG8A 3ZE6A 1S7CA 1H6BA 5KINB 3QVXA 3DGEA 1CUWA 4RMHA 4BX2A 1UBCA 5DLDA 4WA7A 3KHTA 4F6RA 1FAFA 4R31A 2VKTA 2X41A 4D0GA 2C92A 4TV8B 1FW8A 3WLHA 3E5HA 4FIDA 4XJSA 2GF2A 1H23A 2FUNB 2HHLA 2V0GA 2YV5A 4EPWA 3IAS1 1ZUNA 2NV2B 3PD7A 4PCVA 2OV6A 3MELA 4BKRA 5TRTA 2P77A 3NH9A 2EZUA 3SDLA 3L92A 3AK4A 1J2TA 2QR3A 3FAKA 2X6RA 1EVQA 2IK8A 3BPSA 3GFGA 3I6QA 4EG0A 2EIMB 3RN4A 2O23A 3SLRA 4HV4A 2XA9A 1N2ZA 1AO3A 3KL4A 3GBSA 3WIOA 3V97A 3R9WA 2YUAA 1U7HA 1C50A 3OTIA 3DWFA 4X20B 3JYOA 3LH5A 4YUAA 5KUTA 5KX5F 3OZWA 2YBEA 4E46A 4AY2A 2Q9BA 4MB6A 4ZEOA 4M0CA 2X2OA 4KDEA 1OH8A 4AF6A 4AKTA 4LJ7A 2CD7A 2IYWA 3H1TA 1YB4A 1MPXA 3LO5A 3I8SA 3FCUB 3USCS 1F8UA 2G0NA 3H9CA 5CM9C 2DHDA 3II6X 1M74A 1SQPH 5CXSA 1ZWIC 4C9BA 2GN0A 4DNFA 5CJPA 2XT9A 4CL2A 4YBRA 1PUJA 2J1LA 5FL7A 5J59A 2AT1A 3TTVA 2PD3A 4YJFB 4YBZA 1P29A 2WM3A 2CXQA 1Q91A 1A1SA 1R0RE 1E5XA 3IUEA 3TIVA 4CV3A 2EFYA 2QTFA 1HFJA 2IC5A 1WA8B 5IKPA 1BCRB 2CLFB 3NHZA 4P31A 1OUMA 3IP3A 4TN1A 1G60A 1IBCA 2H4ZA 3KPJA 2PIDA 5FBKA 5KNLA 4QFDA 5B37A 4WKGA 5J47A 1BH2A 3LI2A 1FYWA 1DX4A 3L05A 3TR6A 3IP9A 3LCVB 4RIHA 1EFRA 1GGVA 2R6ZA 4MTCA 2O8EB 1VGVA 4KQEA 1G8JA 3PX3A 4YN3A 4LPSA 2YC4C 2HSZA 2BOVA 2FH5B 3WZMA 2ZCUA 3TOSA 1R5OA 4U7JA 1A9XA 1NUPA 2WIGA 3U17A 4WZBE 4KHZA 4H37A 2KSQA 2R79A 5HMMA 5A9SA 2CB9A 4RDCA 3AL0C 1IC6A 2FW7A 2GQ0A 1A04A 1SKYE 1POXA 2CXSA 3FRIA 3V1MA 4BQNA 5CG1A 4CKZA 2FEMA 4CTMA 5HK9A 2CNNA 2JIBA 2AEMA 4H4EA 4MX8A 2L18A 1PJ4A 4JL6A 1SBNE 3IKLA 2NZYA 5LWHA 2O2DA 5KYGA 4MPDA 1MQ8B 3ID6C 1V3VA 5LA6A 3A0HZ 4BDSA 4IGGA 1CVLA 4HDRB 2QE6A 1E8MA 1OSNA 1IUOA 1DBSA 1EVEA 2J5QA 3ZNOA 3CONA 2O57A 1XYYA 2V4UA 1JEDA 2PNJA 4XUEA 1NJGA 1K68A 5IF9A 4JP8A 1U2DA 4AMBA 4I2VA 2OXIA 1NU6A 1FFXA 1L5ZA 3HCRA 3VQWA 3N8DA 4DYVA 4MDEA 3ZBUA 3DV2A 2BD0A 1M6HA 1YR7A 1S7GA 5IAJA 3SY8A 3FB6C 4QEDA 2E4YA 1ZN2A 1FMLA 1I32A 1TUIA 2X15A 1PR6A 3OKAA 4MI6A 1RLIA 1SEVA 3AOEA 3PXDA 2HBZA 3KEGA 3RV3A 4B44A 3SSOA 4BGEA 4EI7A 1VIDA 4MWDA 2WIKA 2PSHA 1H8EA 1KYWA 2HPVA 2VTEA 3DPSA 4RHXA 5FBZA 2V3WA 4YMUA 1M66A 5DK6A 1OH5A 5EUCA 3L04A 1UBGA 4UM5A 4ZO7A 2UZ3A 3TMKA 1LDMA 1APBA 3LLCA 2I99A 3CG0A 2HCFA 3K32A 4WEOA 2LP7A 2VDWA 1NLZA 1YHYA 1SXIA 2PKYX 3VOBA 4BNWA 1USVA 2E4WA 2ZAIA 3T5DA 4LYJA 1MC4A 2GCOB 4B7ZA 1GU1A 4X6LA 3D5TA 1M8PA 1VHJA 4IWXA 4JEIA 4JHXA 3AF6A 3V2GA 4PVDA 4FW9A 1L7EA 1QV6A 4M9XA 2WLJA 3AEIA 2F59A 3LGXA 3MMZA 4YAOA 5K5EA 4RM2A 1Z5ZA 4DV0B 1P2UA 4DV2B 1EFVA 2QZ4A 1TJNA 3KCNA 3PQ7A 5DM4A 5EHQA 5AVOA 3CN7A 4GZ6A 5C1IA 5K8UA 1DPFA 2EW8A 4MYHA 1J95A 3WQRA 5LHIA 3M6AA 5JSZB 4ZI7B 1D2AA 4AKHA 1KDTA 3TLBA 3H6HA 4OGKA 4HNAB 3MJCA 3DBHA 3KUKA 5LB2A 3W9YA 1J8QA 1GGNA 4ALIA 2FEPA 2WJHA 1U98A 2I4RA 1P81A 1WOMA 3IAUA 4L74A 3PKJA 3WJ2A 2XGJA 4QYSA 1XTQA 5T8KA 1DTWB 3K15A 4DR1B 1T2EA 3FMFA 4ID3A 1T2FA 4TV8F 4LI0A 3C16C 1MO6A 2V7QD 2QX6A 2QRHA 2Q50A 1XDWA 3F7VC 4W5JA 2QXYA 3WV5A 1BKYA 2GCEA 2ZI5A 4O0MA 1J24A 3F7NA 5CM2Z 2BFEB 3PD0A 1Z63A 1PNTA 4AECA 2ZDIC 5B1EA 1BDBA 3OHSX 4CMCA 1L4YA 3JRXA 4OA5A 2VEOA 2IE0A 2BFDA 2H17A 2D0OB 4DL9A 2FWMX 4GZMA 2BGIA 1R4NB 3AIOA 2UZ1B 4Z4QA 1SVKA 1GO2A 4S2UA 1WXFA 4S35A 4P9NA 3VISA 5JRDS 3J80A 4QYWA 3QM1A 3NEJA 1WCYA 3T41A 1HSZA 1B0AA 2M9MA 1BGXT 3SEQA 1BJRE 3U7QB 2YZMA 1RHMA 2W2KB 3W6NA 2OXRA 2ZIUB 1VQOV 5EXSA 3W5SA 1AKTA 3U0ZA 2A84A 5F9MA 5CAEB 1U8XX 4RXMA 2R5FA 1PIWA 1WMEA 3EVZA 4ZYXA 1W0JG 4IG4A 3TZEA 5HJ7A 4URUR 1C14A 4JU8A 2HLDD 3H42B 3HADA 2P4KA 1B8NA 2FPPB 1T26A 5I4IA 3K2EA 1SCJA 2WD7A 4FFSA 3OTGA 4BNTA 3K5OA 4JI3O 3CTMA 3FBWA 4L07A 4II2A 4US1R 4ASUA 2H54A 3MOSA 3CCQV 2A78A 2HGZA 2YJZA 3H17A 3KYDA 1NBMG 3R3VA 5EIAA 3V4LA 1BWRA 4Q19A 2JRCA 3VYTB 3GVMA 5A6SA 3ZY3A 5KC8A 3ZJ4A 1WV0A 2GUWA 4MQ5A 4DCUA 5E6SA 1M1ZA 4JYCA 2IE8A 5AKHA 4Z4FA 2XJ4A 4FD2A 3M34A 4CQMD 1JVMA 3O92A 1TVKA 4ZIRB 3X2FA 3E4CA 3G2PA 1CQZA 2MT9A 1BDIA 5YASA 1STOA 2H9AA 2J6IA 4PF1A 2WZCA 1OFUX 4JVOA 2JBWA 5HKLA 2QPOA 4RA6B 5E1DA 4OHVA 1RDFA 1EU1A 2ZS8A 1U11A 5H1YA 2IW3A 5DGXA 3Q8MA 4ENUA 1WCV1 3MHHC 4A16A 1Q7YW 1GCGA 4G5QA 5HZHA 4GU5A 5JY1A 1CUZA 2G7ZA 5FFFA 3CY6A 2WMNB 2XB4A 5KO2A 2B20A 2QTLA 4DILA 4GFDA 3BAAA 1K34A 3AB3A 3HA2A 1Y4MA 2ECKA 2PX6A 2PNFA 3F9IA 4HNTA 1P0MA 4P4UA 1JB9A 1N2SA 4J90A 4PLCA 3V32A 3ZXIA 3GLKA 1C9MA 4XWGA 3QBEA 4IJKA 3E83A 2IBTA 3RYHB 2Y4UA 5LBTA 1ZX1A 2OTCA 5JC1A 2AXNA 2COUA 2EQAA 3CCUV 1ECLA 3VPGA 1SCUA 2O48X 4L3OA 1R6NA 3P5SA 4EYOA 1ORHA 2F1HA 4P0QB 1Z3IX 2GM4A 1JLLB 1ZJJA 3WDKA 2ZBUA 2GZAA 1M1YE 5AI0A 5IULC 3O4VA 1UC8A 2NQ2C 3I9LA 5ADWA 5LYJA 3R0VA 3LZDA 5E8JA 5LQKA 1KY3A 3NHPA 1FPQA 2GFHA 3H0CA 3OQIB 5JWHA 4FGJA 1HH4A 1TK9A 1W85B 2NV0A 3WK7A 4GR5A 3GLIB 4RPKA 3LOPA 3AFOA 4A92A 3EPKA 4G0YA 1RJWA 2BRUA 4NZOA 4YFVA 4LXUA 2IYYA 4PANA 1Q57A 1ZMTA 1FOEB 3H0EA 1TQ4A 2DY1A 2X0FA 3UC5A 1WB4A 4AJ9A 3C43A 4F86A 4EFBA 2EJBA 1Q3EA 1CPYA 4KUMA 3JWPA 1F4NA 5I7EA 2ZM6B 3G5UA 1NJ2A 2JJ2D 4G81A 2YR0A 2PBLA 1PP4A 4M8NE 2EGHA 1LSOA 2O7NA 2P1ZA 2XQJA 3QXJA 1QH9A 3UT6A 4X92A 1ESMA 3G0HA 1JX6A 2PKQO 5JOQA 2ZB3A 4CC6A 1V48A 3QF4A 1HXHA 1VZ3A 1X7XA 4WHMA 5FAXA 3QBTA 1L7NA 3Q85A 4OUDA 4DV4B 3U7GA 1S3IA 3HFRA 5ELMA 4IIJA 5E2IA 4PAGA 2W71A 5CW1A 4EDHA 4OGLA 5AVVA 2DWEC 2IQIA 3H2GA 4M3NA 3OM1A 3NALA 1BEUB 4X20A 3EIFA 1FXVA 3U13A 2DQ3A 1QH8B 2YN2A 2OXTA 2R6CA 4AULA 1W7AA 2QLBA 4TTIA 2ZIWB 4MS1B 4LMAA 1Z16A 1GUFA 3NHUA 4GDMA 3W7SA 4XD7D 3R7LA 2J0QA 2Z6UA 4LDAA 3BXGA 1IFXA 1KC3A 5AHKA 2VHUA 3CLTC 1G4UR 3HHPA 3F2VA 3ZY4A 1P1KA 2FPLA 3VZSA 3ZRSA 1KERA 1NDQA 2QKAA 3Q6MA 4NSNA 3TEMA 1CEQA 2VSNA 3C3BA 1K4YA 3BHMA 3OF3A 4BUZA 2PX2A 1LFAA 3P0RA 1I3KA 5DE3A 1GSAA 1YQUA 3KHSA 5A4AA 2GD6A 5C1OA 1WXWA 3V2HA 4YHHB 5B1BB 4UB8Z 3JWGA 2X7RB 4M1SA 1MAUA 3DEFA 1ZEMA 3JQAB 2R7LA 3LSUA 1QU2A 1G8MA 1V9CA 1KYOF 1P9OA 2BM0A 1RYFA 3L4BC 1W4BA 3PE3A 3QXGA 1V43A 2BFWA 3HSYA 4HQOA 4JP5A 3STHA 1DBVO 4ZOLF 3LX5A 2QTRA 1CUYA 4C6SA 2YWJA 3OA0A 3M3HA 3ZIUA 5HFMA 2VJLA 4FJCC 2DAPA 3L7JA 4BL5A 1MEJA 1IUKA 5BMVA 2AI1A 3E8XA 5JXIA 4FVMA 3AG2C 4KIGA 5J43A 2X9LA 1N5JA 2J0EA 3KFXA 4G8DA 3OCXA 4JJKA 4KO3S 1RQXA 1VQ4V 4MVXA 2C4UA 5FI1B 4YRGA 1AQNA 1JHXA 1Y1QA 1A8QA 5L6LB 2VTBB 2IHTA 4IS3A 1RI5A 1N7IA 2EHJA 4OY3A 5KVQA 3R7NA 3VJKA 1LPPA 4TT3A 4GC5A 1U6IA 2O7QA 1WKVA 3EFOB 5KIAA 2B5WA 3L0IB 1UP7A 3ABMB 4YXWA 4WK4B 3PNBA 4ZGBA 1FJHA 3DVAB 5TB5A 5K6AA 3IR6A 3UHFA 5MHTA 3ERCA 5TGDA 1ZOLA 1RM1C 4URYR 3JQFA 4WZZA 3PQ8A 3S7ZA 5K0BA 3A14A 1AQIA 1E77A 1Y3HA 2CDRA 2OZKA 2ZTLA 1E2NA 3G4SV 2ZJ1A 3JS5A 4IOMA 2B94A 2Z08A 4K1LA 4UUAA 5K09A 1GG5A 1KIAA 1PFGA 3M4ZA 4OO3A 1Q7CA 2YMQA 4GGPA 4H4CA 3QOFA 1IXKA 1XWWA 1F2UA 1L7PA 2ZIXB 3G6WA 3UCEA 1QRTA 1ES9A 1M1NA 2Y69B 4US0R 5M34A 1XNHA 3ZIAD 2FETA 4G0QA 4MS4B 5CLLA 4ARAA 5JW6A 1Y1LA 5SICE 4OXIA 5LMNO 2PJRA 2CFIA 2WEKA 2IUYA 3PG5A 1DXOA 5EBLC 1H65A 1J1UA 1S8AA 2VUUA 1OWLA 3DQPA 4MVRA 4MUIA 1WN7A 3G67A 1UPBA 4JI0O 4Q1DA 3N59A 4P86A 4RA9A 1H2MA 4QYTA 4K3VA 3LQKA 1C3OA 5AI8A 3FBGA 1V5WA 3LUJA 3NPMA 5DPMA 3ZVKA 4D8YA 2TRSB 1K7XB 5TX7A 5JNVA 2BP7A 1YOBA 3G2JA 5E1BA 2D4AA 2EWWA 1GTVA 2R1UA 2GKSA 5EE1A 1H2ZA 1QC5B 3WDLA 2F3UA 2QMZA 3IFSA 4PNPA 1CZLA 4HBGA 3AG1C 5JLJA 1GLNA 4YXWG 5EN4A 5EPUA 1QF6A 1GPNA 1G7CA 3CNOA 3LT2A 3DBRB 4OGQB 4P81A 2A8YA 3AHJA 2JLCA 5TQVA 1I3CA 2AMJA 3VNVA 2Y1DA 1D9XA 2JCBA 2PMDA 1H9BA 1FXHA 2J5XA 2FRDA 1QZZA 4RLHA 3TJRA 3CVXA 4ZKDA 4X64O 3QWAA 4PZEA 5J9FA 2QPAA 1ENZA 1QQ7A 2AGVA 4ND8A 3P0JA 4U6SA 4LNAA 3UJ9A 1N34O 4PV1B 1U3TA 3O31A 5J4LA 1RYEA 4KQ9A 5EMHA 1K8ZB 1NJSA 3AM1A 3OX4A 3CISA 2XX3A 4IIJB 1UJBA 1YCGA 1PYGA 3W34A 5IG2A 1CJBA 2EKPA 5JARA 2DKOA 3T5PA 1DAHA 1DKMA 4KWEA 1UQTA 1GZHB 4MYCA 1ZAUA 2DECA 1FFCA 4DHEA 3AP1A 4FBMA 1SZXA 4GX5A 1H1LB 3TLEA 3R1IA 3I05A 3C45A 5MGNA 3FPSA 3ZHCA 4HAYA 2JG3A 2Q0HA 3DC5A 4ID9A 3LSTA 1XJWA 1QGOA 5G0UA 4EQ6B 2D1TA 4DLBA 2HTFA 1Z6ZA 4BWAA 2V98A 2B4TO 1E6CA 4WNAB 2GLXA 1ZU5A 4DZZA 4EM6A 3V8QA 5B4TA 1WZCA 3JALB 4N6OA 3NUQA 4MGZR 8ATCA 5JJLA 3M6WA 4GH5A 2BUAA 4TX1A 2A33A 3PN1A 4H13B 3P45A 4NJMB 1PLKA 2VQEB 3TLCA 1VSQA 4XM2A 2PN1A 3NT5A 4A2CA 5I01A 1R73A 3EULA 4Q12A 3GLQA 4JEUA 1L7BA 1LGYA 3GJRA 3HBAA 2OWOA 1UEJA 3KPWA 1NQUA 2IH2A 4FGLA 1XMOO 2UYOA 4G84A 5AM4A 4JC8A 5F77A 3LA8A 4EYGA 1N2CB 3RRMA 1IATA 3TTSA 1JFRA 4JB3A 4N5MA 1DNPA 2ZUCA 4NZPA 4X24A 1WP7A 2PXHA 5F9FA 5DEOA 2H51A 3SPIA 3EVBA 3P2IA 3ZWXA 5AHRA 4EKEA 4KKVA 3F6PA 3NAZA 3E22A 4RZSA 2R8ZA 2EINB 4D3XA 5EFOA 3KUCA 3PDJA 5KDOA 4LSMA 3Q8XB 2VAPA 5BSTA 3S8EA 1ONOA 5F2OA 3HZHA 5BN5A 4C7XA 2C61A 2XECA 5LKAA 2Y0PA 2R65A 3BM5A 4BQQA 1AGYA 1H2RS 2LCIA 2UDPA 2IHNA 2PUBA 4ZAYA 2A5GA 5D87A 1LVHA 2B8JA 3IJEB 4XXHA 3IB3A 3VPBA 4CR8A 3EDYA 3WG9A 3FTFA 2DSNA 3NHMA 4YTEA 3H86A 2EARA 5DHFA 3DOOA 1YE8A 4E0BA 5DX1A 1JECA 2AFVA 4HO1X 1Y81A 2P4EA 2A86A 1QH1B 1E4EA 2HMYB 4J11A 4DUZB 1IZYA 4LE1A 3ZZTA 4QO7A 2IWRA 1DAKA 3AV0B 2GMWA 4Y2SA 4L22A 1Z4KA 4YI5A 3MWJA 4RHUA 2J9GA 3T7DA 4JA0A 3LFUA 2A0KA 2C3YA 3W7BA 1VHQA 2ETXA 3B1WA 4R3UC 4A6DA 3WGLA 3AMVA 1NUAA 2JA2A 3KYCA 4HLCA 4IIDA 4UXHA 1M5RA 3VX3A 2XOKD 1JHUA 3T4XA 3UKDA 2XTMA 4NU6A 5FADA 1J0DA 3F73A 5TGZA 1KO8A 2VHJA 1O87A 2JLAA 2WM2A 1N2IA 3C3MA 4OHMA 3AB8A 3C3YA 5MGBA 5A4MS 1SVIA 1JBQA 1U6JA 2XXBA 3AJ8A 4F5WA 2FDXA 2JIOA 2VWKA 2D5AA 4AP5A 3MOIA 3PL5A 5DZSA 4M0KA 1A5BB 3G5LA 3OU6A 5H5JA 2R7MA 4U7PB 5HOEA 5CB6A 2RCYA 3CRQA 5FOWA 1KTVA 4P7GA 5AMXA 1BL8A 4J0CA 1KBOA 1KZGB 2O4CA 4NV0A 3ZOZA 3CRNA 3HXLA 2AJDA 1KYIA 1I36A 5B1AC 2HEIA 1YRAA 4IMRA 4LHZA 1BX1A 1UWKA 3DE1X 3RIGA 4DMUB 4AJJA 2SCUA 1W9HA 3GZNA 4G0NA 4YMTA 2AYXA 3BMXA 2ZYSA 1F0NA 2NYUA 4WN9A 4YMLA 2H7VA 3NX4A 5AXCA 5GMOA 3NVMB 1A71A 4MRMB 5C7YA 1A9SA 4PQYA 2XWSA 1JP7A 4ND5A 3NHYA 3SNHA 3JQQA 2VTBA 5FEUA 1SD2A 4EG4A 1DVRA 1S5HC 1OD6A 2FPGA 4U63A 2A5LA 4XEHA 1UL1X 4IDEA 2DB3A 1O8BA 1V54B 4CL8A 3VU0A 2JHFA 2HA4A 2VDRB 2ZRMA 3STTA 4CMGA 1LXCA 2G36A 5JJBA 2LV8A 4KVAA 2UXBB 4CEHA 2NPFA 3UCSC 1X7XB 3SP1A 5JS7A 3AHHA 4XQGA 3NDJA 3GD5A 3A26A 1LK0A 3W6UA 1BSMA 3AG6A 1YNOA 1X1CA 5H59A 4D7AA 3X1XA 3HI4A 2V54A 5DTMA 3EFHA 4AX8A 3OI7A 1P49A 3G5AA 4G9GA 1WKCA 3T61A 4MO9A 1QRUA 3C24A 3FZGA 5JG7A 2VBFA 4DT1A 1ZI8A 3GPBA 2FUEA 2HNBA 3KJEA 1G42A 2DUJA 1ZM3A 1DINA 3C6YA 3EUAA 5HKBA 4DC9A 3RFRA 2IODA 4L8JA 1XDBA 4PBTA 1OKKD 1W35A 3IT2A 5K1PA 1UMCA 4FLMA 4NENB 1XPOA 5L40A 3C1UA 1MZVA 3FJYA 4ABMA 2AJ8A 2NACA 3HP7A 4HTAA 4P2BA 3N27A 2XRZA 3HGMA 3JZAA 3OM9A 1V5GA 1E0AA 4PA4A 5JDIC 1B14A 6REQA 4IHJB 3CZAA 1Q6ZA 4Z9AA 1VARA 4KQMA 1XTJA 3UWSA 4F3CA 3B52X 1DT5A 1ZAKA 2W7TA 3HMQA 1YO6A 1C41A 1FU4A 3F6YA 3IR7A 4KQXA 2V03A 2HSEA 2ZUVA 3FB8C 3KJFA 2CSUA 2HCBA 5DB4A 3FM9A 4GI5A 1OAOC 4GXTA 5LZ7A 4DJTA 1DAFA 2IYUA 4IILA 1AVMA 4OSEA 3FOFC 1RLTA 1W36C 1ESDA 1NR1A 1DHRA 2BE9A 2Q5JA 4WADA 5LR6A 3CC8A 1UXIA 4X66O 1WLYA 4P9OA 3MMXA 1QH0A 1MG5A 4MMZB 2NV6A 4MQ4A 2PEZA 4WH0A 3RRXA 5JALA 1PFYA 3AP3A 2OKGA 3Q7EA 1JIIA 2X8JA 3V42A 5KWEA 5AXBA 5PNTA 1OE0A 3UW3A 4CQMA 2I33A 3HU2A 1LNZA 1JDVA 3FLBA 1WA8A 5F7ZA 4R40A 3ZKWA 1VLZA 3VR6H 4IH1A 3TQIA 1E99A 3VMFA 4B40A 2Q6AA 2ZBGA 3CPEA 1SKBA 2JBAB 4L7QA 3C5EA 4KWIA 3ZDAA 2L82A 5K0TA 2I2BA 2YV4A 5K3AA 3HY6A 3EEOA 4KO2S 3AY6A 3PC2A 3TD2A 5KYTA 2ZI9A 2N0SA 4S04A 2B99A 4M37A 3U7EB 1RR6A 1X77A 4DPMA 1JDTA 4GI2A 1BYIA 3CYOA 3WYNA 5K7SA 3SJZA 4LK3A 1Y37A 2Q9LA 2HLDA 2R7NA 4YV1A 1BWSA 3B53X 3O9MA 3OP1A 4FNAA 1O6ZA 4HUQB 5L7WA 3H2ZA 2AI3A 1M56B 3ZWWA 4D97A 2ZB4A 3N0RA 4QNMA 4LE2A 2ZRJA 4HEJA 5JPIA 5AVXA 4M0DA 2V9PA 2VTDA 2PSSA 3TOCA 1E94E 3JQ9A 5FYQA 1TA4A 2X7XA 1RI4A 1WZUA 2WMOB 1R6KA 4C0SA 2XJ9A 4JAVC 2P9QA 5AI9A 4BASA 2HG5C 3R4VA 4BN5A 1EXNA 3EGOA 1Z83A 2QWNB 3DHVA 3DMYA 3ZBHA 3IBTA 1FFHA 1OW3B 2IDZA 2ZSDA 4IIGA 2DQ4A 4DG9A 2FPWA 3EZ7A 1T2NA 2PGGA 4WCFA 3VU9B 3ZVRA 5CXUA 2FWBA 3A3PA 2DU8A 1O95A 2RJZA 4FN5A 3ZLUA 2O50A 2VT3A 3SLGA 1K5HA 1T5TA 2VA9A 4KQIA 1NDHA 3SQDA 4YJGA 4M0PA 3DAYA 2X4GA 3TINA 3KTAB 4TKUB 4EQ6A 5CIYA 3BWYA 2RDCA 2GBPA 4JQCA 3GJTA 3X1MA 1Y63A 1W2GA 3U49A 5IW8A 2R00A 1HT3A 3L18A 3QU9A 4GP9A 3TQFA 5IKXA 4U3FH 2CXOA 5HIMA 3QPAA 3RK1A 3IDFA 1ODLA 4K8RB 3EQ8A 1KY5A 2H0RA 4HBZA 3KJIA 4H35A 4OH1A 4TSFD 5CLHA 1CJMA 4LSWA 4MW9A 3ZZ1A 4MTFA 1CDOA 1K9MW 2AG0A 3IAFA 3K5MA 2PRJA 4WY2A 4GXNA 4BZQA 3LYLA 4JFRA 3UHJA 2D3OW 3D6MA 3CMEV 3OJFA 5KKCA 4LX0A 1CZRA 2AD1A 3PQ5A 4LOAA