2WAMA

Crystal structure of mycobacterium tuberculosis unknown function protein rv2714
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
294
Chain Sequence
b'AREYEPGQPGMYELEFPAPQLSSSDGRGPVLVHALEGFSDAGHAIRLAAAHLKAALDTELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRDSIGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPITMTAHSNNRELISDFQPSISEIQVPGSASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLGAEFERFLAQQAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN
publication title Structure of Mycobacterium Tuberculosis Rv2714, a Representative of a Duplicated Gene Family in Actinobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 97
structure length 294
sequence length 307
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2wamA02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wamA01
1NH2B 5CA3A 3GAAA 3WZ2A 4HAMA 3W7UA 4G4SP 3E35A 3W7TA 1NVPB 2P90A 3VR0A 1YTFB 3W7SA 3D3IA 3MNFA 3BY6A 2HR3A 2WAMA 3W7WA 5GW7A 1S3JA 3IC7A 1RM1C 3W7XA
chains in the Genus database with same CATH superfamily
1DWPA 2P9YA 5DYTA 1IK4A 3GJQA 1CETA 3I6MA 4DK0A 3GC6A 1I80A 2Y1OA 3O8OA 1XRPA 4BMSA 2DF8A 3DULA 1M10A 4Y1RB 5CPBA 3PCRB 2I9KA 5G4LA 3R40A 1E3MA 5EE0A 3H1JH 3ND6A 4WLVA 1T34A 1MHTA 1RJWA 2AD5A 1D4ZA 1JEQB 4TWIA 2IT1A 5AMXA 1JQ5A 1WXWA 3ZE1B 2BDEA 2GCEA 3NGLA 1HNXB 1J90A 4F86A 4HN9A 4Y6GB 4IOJA 1UXKA 4WVLA 1OCOB 3DUFA 4DR7O 1Q7TA 1Q0RA 4IIJF 3L7NA 1N0HA 1OPRA 1TJPB 3TLXA 1LX7A 2BFCA 1ZFNA 3VI3B 2BHSA 1ZN9A 2AHRA 1KMIY 1YK0A 1I7FA 3NOXA 4CWAA 3A4NA 4Z4CA 1H6DA 2C2KA 3DZBA 2VPWA 2N04A 4HATA 2YXEA 1W2WB 1Q12A 1V71A 1MO2A 5B1HA 2UVPA 2RGWA 5LSAA 4CM4A 5CDFA 1USWA 1WB9A 5A71A 3F5QA 1MJHA 4AJEA 2I34A 4O4HF 5DBHX 2GN0A 2BF4A 5DEDA 1T3LA 2PANA 1TGOA 4UVAA 4LPSA 4AY6A 5AW9A 2ZUBA 1UDWA 5KNDD 2G7MC 1NXXA 2WSLA 3RUEA 1VJCA 3CUTA 4KHPB 1PVVA 3QNWA 3CX4A 3NV9A 3SPGA 1GSOA 2QNIA 1XXHE 3BSFA 5GTHZ 1C0IA 2QTMA 5ITZA 1E2UA 1YKGA 3H83A 4PWYA 2WJ6A 4EITA 2H1IA 3O47A 3LXXA 2NVBA 1MG5A 5THQA 3Q3VA 5FA8A 1ZIPA 1BX1A 3UPDA 1L7QA 4RVNA 4NPCA 2VH5R 2XQIA 2QAJA 2HJWA 4NYKA 2HKOA 1G21E 2HF2A 1N5LA 2AFIB 3IE2A 2NLOA 1TYCA 2YJ4A 4XQ0A 1SQ5A 1POWA 4GKKO 1A77A 1EBOA 3KSZO 4YCSA 1JH9A 1DIRA 4M8SA 1Q5PA 2ACWA 2C5FA 4DLZA 3J7AC 4FD2A 4LYFA 1LRLA 1GIAA 1ZSPA 3A3PA 4B3SB 3LH5A 1U7XA 3BZUA 1Z62A 1Z73A 3R9KA 1GUBA 2ILTA 4TSKA 3AHJA 3G13A 4HEQA 3DVSX 4G1EB 4CF4A 2C54A 4N7BA 2I3ZA 1PM9A 3MWLA 1Y7TA 1TQHA 2GH1A 2PIDA 1UJCA 5CYGA 4FS3A 3S2ZA 4PGMA 4HJRA 4QGAA 4I9WA 3UXMA 3HB9A 5JTTA 2JGNA 4BLQA 3VR4D 4FQ5A 4KK3A 3RHFA 3CFYA 2RBGA 1ONBA 5GONF 4HRAA 1A9SA 3OJCA 2DUUA 1JPXA 2A9OA 3DO8A 1TUBA 1SUWA 2ZT6A 4N7MA 1EVJA 4GNRA 2RD2A 3WO1A 3WLOA 2Z3WA 4QWWA 3MIIA 1P9WA 5CB4A 3DSRA 1EQ2A 2D0OB 4PX3A 5ALUA 5DGDA 4RPLA 5LJLA 2EW2A 4A5UB 4KH0A 1JDVA 2C5GA 4D98A 4YA6A 1ZM3A 1D07A 2D2XA 2VWJA 3CZPA 2FPPA 2DJVA 1TCVA 1DG1G 4UPEA 3I62A 3T5DA 4ZOQI 2AXNA 3K5WA 1F2VA 4J9ZB 4MMXB 5A9SB 4OXRA 3K71B 3DPIA 4OHKA 5EZYB 3FZEA 1KAMA 2HYIC 3UWDA 3C3AA 2FQWA 2GJ4A 2X13A 2PZAA 4M2LA 5BV8A 1I2CA 5FO0A 3TDNA 2V55B 1I51A 1SU4A 2FGKA 1AH2A 1X1DA 2CB9A 4RPKA 3I1IA 1I5EA 4PFSA 4ZMBA 1JBEA 4ZGWA 5M7EA 1MNGA 1UP7A 1JA1A 3K59A 4YGYA 2ZI9A 3KQLA 5E7JA 5C8YA 3W7WA 1MAUA 2ZCUA 3NEJA 3EQ2A 1VJDA 2JAOA 1L9KA 4BCDA 3Q7QA 4C4AA 2ODNA 5CLFA 3TG2A 4PHTA 4PGFA 4G1VA 4WIAA 4EPYA 5HFMA 3KEQA 3NZEA 1J0CA 5CX1B 4QT4A 2V45A 2XW6A 2RG7A 4WBXC 1QHEA 2Q5OA 3B20A 3UPTA 3RN4A 1B3BA 1WZIA 1Y8QA 3PITA 2NTVA 3OPVA 2Y1FA 2XEDA 4UEWA 5HK9A 1I7SB 1WZEA 1CY7A 5A3QA 1MO6A 2P2LA 1E8DA 1RBMA 5TXGA 3OFNG 1OZFA 1ZK3A 4CVNA 3LLVA 1Z38A 3FUVA 1PFQA 1Z9BA 4MUFA 3FUTA 4MRMA 3FKQA 1K97A 3HBJA 3THXA 1E3QA 5FBKA 3DBVO 4S04A 2EEZA 4G41A 4PO3X 1B0AA 2HJRA 1G3IA 4OCZA 1RE1A 3RQSA 2HPVA 4N49A 1TVKB 5A62A 1POXA 1TQDA 1MP0A 2QBYA 2KE5A 721PA 1GSIA 3PC8C 1MB2A 2RMKB 4JXKA 4HJXA 2WUDA 3ZNQA 2VK2A 1P7GA 3LFHA 1NPTO 4B6OA 2XXBA 3C3BA 5JHGB 1NM5C 4DO2A 4CL8A 3KEFA 4ZXFA 1USUA 5CUQA 3KZ1E 4Q4DA 3G5TA 4G5HA 4ZPJA 4FLMA 3NBYC 2VAVA 4XA8A 3KQUA 3TQTA 2QZZA 2FLVA 5KOJA 1ZUHA 4X64O 1Q7RA 5EKTA 3T9DA 2FPUA 5IT0A 3WDKA 5A7HA 3HNPA 4BKRA 1ZGAA 3A1EA 4P3OA 3DDCA 3ILYA 4WDQA 2OGTA 4ZMSA 3L6OO 1BVUA 3IQHX 1YQGA 4Y9TA 1PL0A 4XARA 2WTUA 2CXPA 4CKCB 1Q6ZA 5LXTB 3FSJX 4Q9DA 3JSLA 1XVAA 4EVQA 3WLNA 3H7AA 4EY8A 1HM5A 5KZMB 4KE6A 1VQPV 1TK3A 4CL2A 4MTOA 3QHAA 3JVVA 2JDIG 1FFXB 3KB1A 1GGFA 2ZE5A 1QGZA 5DM2A 4FLEA 1UXJA 4E0BA 1N1MA 3U13A 1S3SA 4WZBA 1SUIA 2WA1A 4TTTS 2CTQA 3GLSA 2NSYA 5I48A 1NY6A 2VR1A 1BKSB 4B8ZA 3VZBA 3NUGA 2A4MA 4RKEA 4AB1A 1E7MA 3CVOA 4RD6A 2X6QA 4UTNA 4O4JF 5H80A 4YLYA 4BVEA 4TOIA 3THSA 2I3DA 3KVVA 3MHSC 2HDHA 4JOBA 5JV5A 4L73A 4DHWA 1DAMA 5FUMA 4Q4CA 3RW0A 2EV9A 5A5GA 3ABLB 1E9FA 1Q0PA 3U7GA 3W8RA 1BMFG 3GRKA 1KU6A 4FC6A 3BE8A 2AF4C 3KBBA 3PLAE 1NN3A 2HSGA 2P40A 4JEUA 3CVXA 1OBFO 1EN4A 3SDBA 2PKQP 2ZITA 3ZW9A 5F1PA 4KI0A 1MO3A 2VPIA 4B3CA 1E2LA 5K9ZA 1NSYA 1W47A 5CB8A 3Q9LA 1CS0A 2B8JA 1L7PA 3FYEB 5K6AA 2RGEA 1KVUA 1Y8ZA 2PRJA 2AW9A 4S1PA 3NDRA 1OX4B 2GPTA 4MSWC 1DO8A 3AB7A 5KJEA 2ZVDA 1BWPA 3NEPX 4LSGA 3KFVA 1PNQA 4WJLA 2XB9A 2FDRA 1W1IA 2AX4A 5AI5A 1JILA 4HT3B 5D1HA 2Q7HA 3UJCA 2JHFA 4KLRA 3NQ41 2YOGA 3ZDCA 2XUKA 4BZXA 1Z25A 3IMKA 2HEIA 2O2XA 3LAWA 5KX5A 4J1QA 3H99A 2YS8A 4JB0A 1AN0A 1XSEA 1QBZA 1GILA 2IV3A 5HNKA 1QYRA 5DN6A 1I1NA 3QKSA 2KQXA 2X5XA 4EGFA 4RS3A 1V43A 1IZ9A 4P4SB 3VAAA 1TCAA 2AMVA 4M36A 4BLUA 4IJKA 2JIRA 1DO0A 3U4HA 4D4KA 1I3LA 2X0EA 3GJZA 3BSSA 4WPGA 1RWKA 4EG5A 1SKBA 3F8WA 1RAAA 1Z8FA 4HWGA 4WNIA 5FPYA 4L50A 4DQVA 1BGVA 4D9MA 4PDRA 4MVCA 3AWIA 2QPAA 3SYRA 1J0AA 5F2OA 4OHCA 1JJFA 2GX6A 1YI1A 3TLZA 4NZ9A 2YIBA 2EX1A 1H2ZA 2P5TB 2H1FA 1QJ4A 4Q3EA 1U9YA 2HWKA 5C35A 3G0IA 3D36A 2X6RA 1GN9A 2QMOA 1UMBA 3ER9A 1W4RA 1EXMA 2YN2A 2GN9A 1YDFA 4KSCA 1I7DA 1K73W 3M5WA 2X3UA 3QXGA 2ZRGA 2AKAB 5F5LA 1YU6A 3BZBA 2Q3MA 9LDTA 4U7GA 1REQB 3NATA 3CG4A 3SG0A 2SKDA 1NL3A 3OIDA 2HRDA 5IF3A 1XKXA 3K8OE 3PFHA 4XH9B 4FI3F 3OWOA 4EFKA 1C7JA 1G2OA 1KZHA 2VHZA 4B71A 1LRKA 1K8QA 4LP8A 2AN5A 2YZ2A 1X3LA 1RAHA 4EG7A 2FG6C 3UC5A 1K6XA 1ZK2A 3NW9A 4I9GA 1E63A 5KYNA 3HVIA 2JHAA 2AG6A 4ZI7F 1ZI6A 2QRVB 3L7MA 1USVA 3IP5A 5D00A 3RW9A 1I0HA 1HORA 1AE1A 4S1WA 4O4LA 4P38A 3SPHA 3TBHA 4TMYA 4RA6A 4CQMA 1H0RA 4LJ9A 1P80A 4IVNA 4FSXA 5E1OA 4KGVA 4BUCA 2AZDA 2HU5A 1KSJA 4H3VA 3PGXA 1SVWA 1O3YA 2OXTA 4Q9IA 3UKOA 4RD1A 1IY0A 3MUNA 1KK1A 3L8GA 1VL6A 3OY7A 1ZK1A 821PA 4B3JA 2P2CA 4KWCA 3BICA 3W2GA 5HIMA 3UWKA 3PD7A 4J4BA 1V5IA 4M8IA 2BEUA 4YMIA 1ROPA 3L8ZA 3ZWCA 4P93A 2F8TA 5KPJA 3PQCA 2IH4A 2E4ZA 1Z2GA 2CGEA 2WT8A 2XQVA 4LBYA 2PXXA 3ZWWA 2YVQA 1U7HA 4EKEA 3KB6A 1UMDB 3PZBA 5L40A 2O57A 4Q18A 5EJ8A 3Q12A 2BW0A 4QTZA 2HSEA 3OZDA 4PW0A 4CTMA 1DP4A 5K2OA 3RIYA 1PT7A 3GGJA 3ZV6A 1M6WA 2GTAA 1I10A 1Z07A 4J03A 3IXMA 2QRUA 4QPJA 3A6KA 2P7TC 2PZMA 1LVHA 3UCXA 1W36B 4E5KA 2G82A 2VYCA 2FN3A 2BTOA 3D3KA 3OEYA 3V1UA 3QG5A 2QYOA 2JAPA 1CNEA 4LHZA 3QNMA 1NX6A 2ILMA 5BSWA 3U6KA 4I55B 4IZIA 4YB8A 5FB3A 1N5JA 3VU9B 5FOUA 2NZJA 2HA4A 1Z2AA 3RG8A 2NUAA 1VGVA 2GA9A 2ZXUA 4RMGA 3BWYA 2IIVA 2UUCB 1TU3A 5CTJA 5I9LA 3DBLA 4NCBA 3OOEA 5INTA 2YZMA 5D6OA 2HIGA 2O2YA 3EMBA 4C5CA 2ZWOA 5HBGA 2VUSA 4XM1A 4GOOD 1N0WA 1E2HA 1OSNA 3AIOA 1LV7A 5G0TA 1BQ4A 3D3WA 4X92A 4OREX 1SRYA 4KPUA 1QRRA 5FOXA 3V1KA 1K33A 1SPXA 4RZQA 2FJPA 5BYAA 4AMZA 4UULA 2RB5A 1A9XA 2Y1GA 1OIVA 2O5EA 3O91A 1V95A 2B98A 1RU3A 4CR6A 2AHYA 4V1CI 1UBSB 1X8XA 3DEHA 4YCCA 2EIKB 2GFQA 1R5NA 4N4AA 2VRCA 2BFPA 4MLCA 1OOEA 4F38A 1Z39A 2Q5CA 3GXBA 3QLEA 2G5GX 4ND8B 5FL3A 2Y76A 2HC9A 1AQUA 1JG2A 2EWMA 2UVQA 1RWOA 3II6X 3RAEC 2QR2A 1Q15A 2KW5A 2VQDA 1T3HA 3DGFC 2VH2A 1EG2A 4D3FA 2FMTA 3X1JA 1QK5A 4B6FA 1O95A 4EEXA 2X1MA 3KUCA 4DK1A 2QL9A 1WPGA 4ID9A 3F74A 1YDGA 1R6VA 4U7WA 2V59A 4KJZA 2YBEA 2HQOA 3GPCA 3ESQA 3RC9A 3OPYI 1JDPA 3EIOA 1EZ1A 1WJGA 1DO2A 1VMDA 4WFEA 4E14A 3VGJA 3RFRA 2YKGA 3S2GA 3G85A 2EOAA 5IMBA 2Z3YA 3TAUA 4I4TA 3AUJB 3NPAA 3IOMA 1MB9A 4G67A 4X62O 2ZRMA 5AJYA 2OV6A 1T4CB 3CXRA 3NU1A 4X24A 4Z2WA 2G38A 1AR5A 4DY6A 4YJDA 3CSUA 2RGBA 3FW1A 1T36A 5JXJA 1K75A 1N5KA 4LCJA 2ZRDA 1HMPA 1X92A 4A27A 1IWPB 2IZZA 4KMSA 1SQ0A 2EQAA 4I99A 3KC2A 5AKZA 3VJRA 1GOTA 3UPUA 1L7BA 3EF3A 2BI8A 5IHPA 1ULAA 1MFZA 2EBUA 3HV0A 2W2XA 2ZM6O 1T29A 3ITEA 3QGMA 5A3SA 1U31A 3EY4A 1UZMA 2ZTUA 3L0IB 3HFRA 3U3JA 3AEQB 1YXBA 2W2TA 2BSKB 2HYDA 3IR7A 2EFCB 4W5JA 1Z16A 2VDMB 5D84A 1LFAA 2OLJA 4QGPA 3N6XA 3X2EA 5IT9N 5DJ5A 1IN7A 4CT4B 2TECE 4DYLA 2C8KA 1XLWA 3BN3A 2QKYA 2AEMA 4M1QA 3F5DA 2MSKA 1WB5A 4HNGA 1ATIA 3HO1A 1U4OA 4H33A 1LJ8A 3RRNA 1WTAA 1RJFA 1ZVMA 3HGQA 3PNQA 4PLTA 5C3MA 3K4PA 3MWYW 1L5RA 3WGIA 1KBHA 1W85A 4FX2A 2ZIAA 1DTEA 2AZ4A 1UF9A 4X8OA 4MROA 1XL6A 2D2FA 3KT0A 2B82A 3K0AB 1GQ2A 2X6AA 3F8SA 3UHPA 4IKEA 3KR9A 4DG9A 1DJQA 2WQZA 3AOGA 4Q4JA 1JEJA 2YC0A 5FUXA 3MBKA 3AR3A 2YRWA 1W96A 4L5AA 5L6LB 3C3PA 4EG1A 3KUXA 4LXIA 1BX0A 3DP7A 3LX8A 1RP1A 4F11A 3F6SA 2L42A 4KNYA 4M89A 2MIIA 1TTPB 2J5RA 3CKLA 3W5JA 1M54A 1J56A 1E3EA 2VEOA 2Y92A 2X15A 1WULS 1BS3A 5BP7A 2XUGA 3I6QA 4LXGA 3GWOA 1U9CA 2QR3A 4B0PA 4R7ZA 4BVAA 4LFBO 1T4BA 3FPJA 1AO3A 4PA9A 2J59A 2V3WA 1LPNA 4OD0A 3DHVA 1RYEA 1RC0A 2A3QA 3BUSA 2QWXA 4FS8A 4P30A 1R1BA 4UUNA 3GXOA 5KAIZ 2NG1A 3IBSA 3WAKA 2HSZA 1D6MA 3KFLA 3ZRSA 3ETGA 2W48A 1E77A 3GLIA 3A4TA 3CWBH 2M32A 4DEYA 1DF4A 3QFRA 4UM9D 1W44A 5KOIA 2XUIA 1UUFA 1XVVA 3NANA 1JW9B 3OFJA 5LP6C 1X1CA 3KSRA 1TFUA 1BHJA 2VPQA 4LA4A 1HV8A 4S1OA 3U9LA 2NVOA 2REOA 3HS3A 1H4TA 2WAYA 4EKDA 4L02A 1QO0D 1QE3A 1C0LA 3WK5A 4WQMA 4NFSA 3PHLA 5KQRA 3ETHA 2BEWB 5JNUA 2PQ2A 3V9AA 4X8LA 3OTOO 2R6DA 3O83A 4FOTA 4A82A 1DAOA 1FP6A 4F4CA 1KEVA 5EWMB 2GTSA 2UUAO 4KQ2A 2LGJA 2AN3A 1E4EA 5JG7A 1HTWA 2DLNA 1U0BB 3FBTA 5HCIA 1EH5A 1OA0A 3G79A 2B1QA 1NZJA 1S8AA 4HRYA 5DBGA 3B7GA 2J0EA 1XROA 4DLTA 3GPLA 2Z1NA 3TAXA 4LBZA 3S4YA 2YIVX 3BHPA 1PWYE 1VE3A 5LN1A 4DCGA 4J9VA 4GZ6A 2AVDA 3FF1A 1ISJA 3TR0A 4DIOA 2HPAA 2BKXA 2C1EA 5HIJA 1YFLA 4M21A 3RS7A 4CIDA 2YXNA 1WCXA 4QVKA 3W7TA 2D62A 5HS4A 3OCWA 1JUDA 1C3OA 4QICA 3F6BX 3ZD7A 3TL3A 1OHHG 3LLSA 1E6MA 3C7KA 4F04A 1JT2A 4LYDA 4HLCA 3GQBB 3VYVA 1OLXB 3IT2A 2XRMA 2QTBA 1SESA 3W5VA 2WSMA 1JQ3A 2XAHA 3TJTA 3WRYA 3VPCA 1SU7A 4ICIA 5B64A 2HHCA 1W0JD 4Z8XA 3MERA 3T3GA 1TF2A 1OTYA 1O1YA 1W0JA 2CBZA 5F33A 4ALLA 2WWYA 4ZEOA 4Q47A 3BMNB 4TZTA 2YXYA 1E98A 3GIDA 4LJSA 1K4KA 1XPOA 2G28A 2VF8A 3LNNA 2P3SA 4DRXB 3Q0EA 1Y74A 4ZIRB 3RVJA 3E70C 3LNMB 5CA0F 1NF9A 1HR0B 1H5NA 3FI0A 3TVTA 3W04A 3ZYZA 3X44A 4NU5A 3DGEC 4U2CA 3NCHA 2VH1A 2DWPA 4WY2A 2Q6VA 2PKYX 4H35A 4D8VA 1NWHA 1I4OA 1MHPA 4OXSA 4RJTA 4UDXX 1L5HA 1BD3A 4FVMA 3K0FA 3CLKA 4DJ5X 2NSJA 3CB4A 3MTGA 1U1DA 3FY4A 1JL3A 4QXQA 1QIMA 1FDSA 1BE6A 1VSUA 2QD2A 1QWOA 1AXEA 2W6ZA 1KECA 1TTHA 3E3LA 2XI4A 5IJXA 3OOHA 1J99A 1O8BA 1E79G 2NO5A 3I1FA 2F9LA 1FAFA 4L08A 5JY1A 2YJ3A 2B5UA 6AT1A 3ZPXA 1XAGA 5JROA 3L02A 1CUXA 4ZARA 5H9WA 1TAGA 1S3IA 3T3PB 4H1UA 4TTQA 3AESB 3HUUA 4Q93A 3K2EA 3NM4A 4FFNA 1HG1A 4BN4A 2IYPA 3GLFA 1A95A 4WK4B 3K5NA 1P1BA 3R1IA 3S8YA 1GQFA 4URXR 1ST2A 2ZIXA 2J07A 3RRMA 4AX4A 2WTBA 2WG2A 1IZ0A 2H7XA 2XVYA 3HDQA 4HTAA 1Q0TA 5AXCA 4REMA 5LVAA 3OEHG 3M81A 1ZO8A 4U0KA 1TEHA 2PLAA 1F2TA 3JSXA 2IXGA 4TV8F 3A2KA 5DTRA 2UZAA 4A8HA 2OO5A 5J4HA 5BY1A 3ONEA 4KE8A 3EFHA 4DUYB 4AQYB 4Q5IA 2FPWA 4BATA 3Q6MA 1E3WB 1L5SA 1J21A 2ATXA 3VUEA 3A3KA 3R6WA 4KQHA 5JPCA 3F73A 3DFFA 4CS2A 2OG1A 2WHQA 2V96A 3LBAA 3KPUA 4EZBA 2GBGA 1NBIA 1IUNA 4MDHA 1R66A 4KMMA 4D42A 4JYMA 2HV8A 1RZRD 5I3ZA 2G1AA 3B51X 3TTYA 2MINB 1Z12A 1B23P 3Q3IA 4F2WA 2PY6A 1WIWA 4GZLA 3PHBE 2PKEA 3T1VA 4OSEA 2PS9A 2CLLB 1RYHA 2XRZA 1T15A 5CM9C 4CDNA 4EYOA 2QE7G 1FQKA 1G5QA 3U7EB 2QZSA 3WGKA 2C98A 4HUQB 3KJIA 2ADMA 2C2WA 3T3IA 3BTUA 4RUFA 4S35A 3B2EA 3FFQA 2XZPA 1E2PA 3W2FA 4E21A 3ECAA 4EW3A 1ODSA 5FUVA 3P0EA 4D0SA 4GLXA 1OI2A 5AM0A 2GUGA 2LD4A 2IHNA 4CEHB 4FDAA 3ONFA 5E2BA 2UXNA 3SS7X 3I58A 4X44A 5B12A 1PR3A 3B78A 2WEKA 1UKVY 2LWIA 3PHJA 2PFSA 1JIQA 1DHTA 4DV3O 2ZRCA 2X41A 3SX0A 2FWIA 1KNXA 3UJBA 1HLFA 1ZEJA 2XECA 1XWWA 2CD9A 3DLHA 4FR5A 5HVNA 2ZR8A 4TUYB 1BW9B 3HCCA 1QRUA 3IQDB 3C6QA 1FB5A 1YDEA 3QU7A 1RS0A 2Q3LA 2ZATA 2J8ZA 1X87A 4BLOA 3WJ1A 3RU2A 1H8HD 2XUZA 2JIDA 1M1ZA 3W6ZA 1HDYA 1QUFA 4EGCB 1GL7A 4HTFB 2ZT9B 3W78A 3LJKA 4HMQA 1TB4A 2HA3A 4UVCA 4QBIA 5DP1A 1DG3A 3UGJA 2DFPA 3LHSA 4AKEA 3UUFA 4BQRA 4L5CA 2HIMA 2IHZA 2YYAA 4EK9A 4JL8A 1JHMA 1RYMA 5FH9A 2C2HA 2E5WA 4G1UC 3EISA 3VO2A 1NF2A 2AEEA 3QEMA 3O94A 5A0VA 2JLZA 1QP7A 4K1LA 2P6UA 2OYCA 1C7ZA 4C0WA 3R24A 1W4BA 5HKAA 1Z2EA 4UCOA 3SC2B 2WA4A 4G8BA 1MABG 3S3XA 4DA4A 4R2JA 3A2MA 1CE8A 1G1AA 3W2IA 4LVNA 2DETA 3PVZA 2QPLA 1KJZA 4ZYTA 3LM8A 1ONSA 1P60A 3L77A 2PUBA 1NC1A 3E1GA 2VRBA 2R4TA 5JJLA 1LH0A 1ULHA 3P9RA 4MPPA 2O8CB 3VKHA 2C2GA 3HBNA 3SJCC 2V4ZA 1SOUA 3QZUA 3VHRA 3UT6A 4KO3S 2H8KA 3E9QA 2LFRA 2PO7A 1I1OA 2QQFA 3X43A 3L7JA 1KAOA 5FBRB 5C53B 3QVTA 5T4HA 3E5RA 3P9PA 2NACA 3QVUA 4NZZA 2A1UB 3PUZA 2C07A 3TQRA 3HE3A 4AKTA 1T1RA 3M1IA 4OHXA 2AB0A 5IFKA 2GBCA 2E4YA 2OBXA 2E89A 2HGZA 5TVKA 3ORFA 3PQ4A 4G84A 1L7VC 2R751 3CCSV 1MD9A 1KMIZ 4P08A 2EJUA 2L18A 2C9YA 3MJSA 1JGTA 3D0QA 1I33A 4CG3A 2ODTX 4QL3A 5HGJA 3G0HA 2Q3DA 1L4UA 3GRPA 3LY7A 4H6WA 2I54A 2WE8A 521PA 3OE1A 4XM0A 3HY4A 3K1TA 5B1AC 3TQQA 1Y1LA 3NJ8A 2X58A 5AW7A 4GBGA 1IUOA 4PLVA 5ALHA 4ZREA 2A58A 4PZLA 4O3MA 2D7DA 3FRIA 3WGJA 2AOTA 3RABA 3CJHA 4KXWA 4Z9FA 4DV0B 5FADA 1LZLA 4XPIA 2H0QA 5K3AA 1XMOB 1XNQO 4CTOA 1MUUA 1V9CA 4UCTA 2G4LA 2Z0AA 2A4KA 4BIZA 3MTJA 3PD1A 5A4JA 1JN0A 3NBMA 1T8RA 1JU3A 5A3RA 3R7DA 1Q11A 1YQEA 4TT3G 2LRHA 2O8BA 4IIJB 3IBFA 3KWLA 4XJSA 1J23A 2EKPA 1GUAA 1G38A 2XA9A 3KNZA 4ILEA 1GMGA 4BNLA 3KZKA 3FR8A 1E0KA 3BC1A 5EWJA 3LT1A 1LD3A 1X1QA 2XCSB 1YB2A 1A4IA 3TGWA 3M9XA 1KAQA 1QH1A 1YKFA 4QTUB 2NU8B 3INNA 1PJRA 3UG7A 4UB6Z 4JQOA 4PDMA 3E2EA 3WLQA 3MRSA 3RNLA 4AXBA 2OB1A 3DLAA 2I4TA 2ZYRA 3LGAA 1AQ6A 2QOEA 3I6YA 2OGZA 4XWTA 2CMGA 3G2OA 1S8NA 2ZYAA 4O4HB 5A4KA 1U3TA 3ZZ1A 3IP3A 1KFEB 2OVBA 3AF6A 4JC0A 1GPJA 4L16A 4JA0A 1CR4A 1JEEA 1LUVA 2TS1A 3KKQA 4PR3A 5JSZA 2R5NA 3TXXA 4EMTA 4JV5O 1FTYA 2X0IA 1Q17A 4S1TA 4C89A 3SZ3A 4BNGA 1GPYA 4M76B 3I3OA 3PTLA 3GNSA 3LGXA 2Q69A 4YJ2A 4KOAA 1RI3A 1LUWA 3CHYA 5I9SA 3GMTA 5T41A 2P2DA 3C3MA 5J2TA 4S12A 4LFAB 2HCRA 2QM8A 4Q7EA 2Z95A 1WXEA 3H2YA 2N9UA 4AMVA 1NQ5A 1D7AA 1EJ0A 5HEKA 4CT5A 4CS3A 2XE7A 5TJHA 4BRZA 1BD4A 1E66A 3GRVA 4TQAA 2RB4A 3Q11A 3A05A 2NU9A 3MAQA 1KEPA 3KSAC 3ZGLA 4R1QA 2OCAA 2CUTA 2I4LA 1GITA 1B41A 5HRCA 4ALIA 1Y4UA 1JHUA 4A26A 5FWXB 2YVKA 3FUUA 2J4CA 2YWGA 2DTXA 2FN7A 1GN8A 5L3SB 2YYYA 1WW3A 1BE8A 2YXDA 5CLHA 3Q7SA 2FPLA 5H7XA 4EYKA 1I6WA 4GPZA 3NHKA 4GX2A 4GR9A 1SN7A 3DEIA 4YDHB 1WD7A 5FP0A 5FO1A 3VU3A 2VZ0A 2QR4A 1KZ9A 2H2DA 3VOBA 2QXUA 3JZMA 4G1BA 1NUSA 1SOMA 1N75A 1NSTA 4LWZA 5GVRA 3ZWMA 4MUEA 1AMNA 3H2IA 3FGPA 1GR0A 1HUQA 1BS1A 3UK6A 3FPKA 4NF2A 3KEGA 5A2QN 5E6UA 5I9IA 2B83A 2W6IG 4ZV4A 3PDUA 2O06A 4RZIA 2VTKA 3KCNA 5B57C 3F78A 3LLCA 1Z0DA 1NNLA 1EFAA 2NUTB 5K99A 5BZBA 3T4XA 5GONB 1GFWA 3SYMA 4JT8A 2YICA 2NNWB 5C8YF 2NAPA 5HJEA 1ZNXA 4PYKA 3RUAA 1XI2A 2AUTA 1KXZA 3MBIA 5FEMA 1QRDA 1H8EA 3DAFA 1ZA2A 1ZMRA 4B7UA 1P62B 4Q3BA 4JF3A 1PRYA 3OWXA 5FWNA 3S99A 2BOCC 4J11A 5KTSA 3GJ5A 3U40A 4M8KA 5CLJA 4RY8A 3LQQA 4DSNA 1XXHB 3V2UA 1AJNA 3OQVA 4KXQA 1H2FA 5TEVA 1T1GA 4NTYA 5F5XA 3VYWA 4KE9A 2JAQA 4H4EA 1R3JC 5AVZA 1P8JA 5C34B 3JALA 4X95A 3R3UA 5JCOA 1Y8RA 3C41J 1TM3E 2IHVA 5IVHA 2Q1TA 3KJQA 1LBTA 2A9PA 1ILWA 1PVOA 5KOHB 1G21B 1I32A 1C7RA 4EW6A 3SOZA 2Y69C 3D5QA 1QAMA 4BBAA 5B7PA 3RLFA 5ALPA 1XAIA 4TVOA 4O6VA 1QVWA 5GTDA 1CY0A 4XI9A 3PE6A 1JP7A 4EOGA 1M2OA 4RQUA 1VSVA 3EGVA 4ZEWA 1ISHA 3BMCA 1LNSA 3KQNA 1XU7A 2GCGA 3FB1A 4AJJA 3O75A 2Y27A 2C00A 5KQPA 2WMDA 5CM2Z 2AHOA 1CY2A 1QQTA 5IXSA 1HOXA 1V45E 2MW2B 1IM8A 1DTSA 4UE2A 1N33B 3M8AA 3DFZA 4CU2A 3NTOA 4KO1S 3FTDA 3KYDB 1AKNA 2Y1EA 1NVMB 2PZKA 3EIWA 5JWRA 7REQA 1L5LA 3Q5GA 1K6EA 2DT5A 1FYVA 3JZDA 3ON5A 3LHFA 2WVJA 3D8CA 3KKNA 1NVWQ 1GNVA 3ANYB 4R7CA 4Q4AB 1C1XB 2FSSA 4KNVA 3P9ZA 1NV9A 3AG5A 3RJ9A 5DM6V 4DR6B 2SNIE 3BPZA 3DV2A 1JTEA 4TLDA 3A1VA 3EZGA 3EARA 3MS2A 3DZGA 5TE9A 3R5TA 4HMOA 4UAVA 4F60A 3GMDA 1YRAA 2OG2A 3ZK7A 1N6OA 4PTZA 3UT5B 5BN4A 3KHKA 3MUOA 2VRWA 5J5AA 3CEHA 2DWQA 1MIHA 4MS3B 3PGVA 5BYBA 2E74B 2NP7A 1W25A 1GQSA 5CVTA 4KIGA 4ZGBA 4ZYYA 3L7OA 1NOJA 3UWOA 1RHMA 2G5CA 4C7KA 3E7FA 4IIVA 4OPAA 5D6NA 1Q0SA 1YQ9A 4W8OA 3LVQE 3V7YA 1IK6A 1NJ8A 4QECA 2ZQYA 2I99A 4Q3NA 1EZJA 4KK4A 1H2NA 2UVDA 3V4VB 2XUFA 4YREA 3HVUA 2HK7A 2XA2A 3ESDA 4CMGA 5FTJA 1HNWB 4YHBA 2PBZA 1PR9A 4LY0A 4A1OA 4V3BA 1HKHA 3FTEA 1CR1A 4IFEA 1NW6A 5F1YA 4BNYA 4KKVA 2JJYA 4RIIA 3G02A 4CLOA 1GZUA 3RC2A 1YA4A 2C5EA 4MAAA 5IVDA 4FFBB 2QLLA 3V7NA 3GU3A 3VPHA 5FWDA 4H7DA 3LW7A 2UYQA 3DE3X 2VKTA 5GTIZ 4BNIA 1JEAA 4JODA 1XZEA 10MHA 1IM2A 4B7XA 5FBLB 3PNLA 4O4JB 1E4VA 3PSAA 3L41A 3CZ5A 1ZL2A 4EW2A 3UJ8A 1AROP 2LVBA 4NOMA 5AVUA 3ID6C 5HKKA 3ODGA 2CL6X 4QEDA 4P33A 4FJ2A 5IUNC 3N8IA 3G0CA 1ZR4A 1A50B 4XIFA 1XIVA 2EWVA 1BXGA 3T6KA 4QBHA 4U7TB 3I92A 4ZAFA 5KX5F 4UVDA 2EWWA 1SO8A 2YXPX 4YFVA 1EQUA 4FMDF 4H7EA 3MK31 4D9KA 1FP1D 2Z2XA 4GICA 1J5EB 3P9SA 3ND8A 3M6MD 5LZ8A 1LW6E 1IY2A 1L3IA 1J0BA 1E2FA 5FBHA 5DHSA 5AQ1A 3UAWA 4KPGA 2FH5B 4BZPA 3CLHA 4CDMA 2PWZA 2JAUA 3K5IA 3OJXA 1YACA 2ZUSA 1IFXA 3P30A 2BCJQ 2E2WA 4LMBA 1P45A 1LQTA 4GS5A 3VJKA 1G20E 3RUIA 1FFWA 3GFGA 4YRLA 4MJLA 1WOMA 1K7EB 4DM4A 3GVHA 1UADA 3N58A 4FBLA 2FPSA 2ZUTA 2B35A 2DYSB 2X0DA 4DUZB 1LBHA 2EF1A 3C39A 3JQ7A 1VCNA 1LSUA 2HQBA 4LRUA 1PEAA 2Z8ZA 2QKCA 3TE7A 4ENUA 2VO1A 3CPJB 3ZCUA 3MMSA 4GSYA 3N0RA 1FMCA 3AHCA 3E61A 1NDUA 1SXPA 5DXJA 3VOAA 1XB2A 1VMKA 2XWJI 1RQXA 3FCYA 1KDYA 2P9EA 2LBPA 4E2YA 3ZU5A 3J80A 2H2GA 1MH9A 4FYMA 1BXRA 1W59A 1U99A 1YS7A 1U7OA 4DT1B 2GAOA 3EDMA 2Q1XA 4I5DA 5TQ2B 1GZDA 4WKPA 5DW0A 1FYXA 3EGDB 1MBZA 4IHKA 4QRHA 1GV0A 3WLFA 3IQWA 4F9FA 3UQYS 3JWHA 5DCYA 2A8YA 5FTNA 4ARUA 1EK1A 3LFTA 4L75A 2MSWA 2CY0A 3D4BA 4I1YA 2NU6A 1GL9B 4J0DA 5LD2C 3CP1A 2RAPA 3OI7A 2ZR0A 2VQEO 4YIHA 2H00A 1J2UA 2H1WA 3BD8A 4G37A 2ZVQX 4HDNA 2LZ0A 3RWBA 3KWMA 4B6JA 1Z4KA 1OREA 2ECQA 1KC3A 1H1LA 4FYJA 3QPDA 3SS8A 5JSKA 2I78A 4UTZA 3V7FA 1NU1H 4BBJA 5BUSA 3KQSA 3SVLA 3QFTA 5HM6A 1NW7A 1U9JA 3O8LA 2H4JA 5IVPA 5BQFA 1P1IA 2PGIA 1ZWLA 5ELMA 3UMRA 1Z6GA 1T0PA 4PHGA 2GCIA 2AZXA 2R11A 3EQ7A 2FZEA 5AKJA 2GNPA 3ZDQA 4ID3A 3FNFA 1XZCA 2WLJA 4C2UA 3PVCA 3AUTA 4WN3A 4NZYA 3F97A 4BNMA 2A92A 2FPGA 4Q1EA 2RARA 1Y4MA 5D51S 2OY0A 3EUEA 1MJFA 3M1LA 3F7TA 4YRSA 3LUBA 4ZI7B 2KB1A 4TTRA 3CNQS 1EMDA 5HPYB 2EULA 3NAZA 2JLBA 4U2GA 2F3RA 3MTAA 1H2GA 4H6PA 2H9IA 3LECA 4B44A 3H9BA 3QK7A 4FTWA 4MKFA 2M1XA 5F78A 1AV6A 4CCYA 4P34A 4ZEXA 1HTBA 3DOEA 1KFCB 3V8NA 3DJYA 4C5BA 4LBWA 3EWSA 1DQSA 3OFSA 1OWOA 5B58T 3IV9A 5H83A 1GQRA 1QC5A 3MD0A 5K6AC 1O6BA 1SKUA 1YA8A 3GHYA 5DN6D 4OQQA 3ZWAA 5G3YA 4GC5A 4AL4A 1ISPA 1J9GA 3GWKC 1CB7A 2CVPA 4RF4A 4JBGA 5K01A 3KL4A 2NLJC 3SK0A 4YAWA 5EGNA 3TD9A 4KGXA 4NONA 2CK3A 3BTVA 1J70A 4BC0A 2DERA 3G67A 2HTEA 4MARA 1IBCA 3FAVA 1TIPA 4IHAA 3ZUPA 4QBKA 1NJ1A 4RGBA 1FPQA 1T9GR 1ACMA 1JEDA 4Q00A 1E60A 3OE7G 3H4MA 1S01A 1C3LA 4B2LA 1DMSA 1ZICA 3S1AA 2ZWIA 4H44B 1PX2A 3EX7C 5ALZA 1HC7A 1AGYA 1KVTA 1NQXA 5ICSA 5C5DA 3FD9A 2RAUA 3E2PA 4B43A 1DAHA 3W6NA 4DXDA 1UKAA 2RJZA 2WI8A 3GX1A 1JJBA 4DMUB 1X7ZB 2DQYA 3UZUA 4Q6BA 2W22A 2OV4A 3OCUA 2YIBD 4JVLA 4WBSA 1SBTA 1N78A 3GUHA 1IOZA 1DU4A 3REFA 4CFYA 1D2DA 4KQ6A 5TQVA 1DVRA 4ZTUB 3SJZA 2FX5A 3IUMA 4QASA 4QLOA 1M1NA 2WSSG 3JQBA 2MWMA 3F7VC 4K86A 2VXBA 3WRXA 1XFAA 2VAXA 2E4WA 1XJ0A 1X80B 1HRDA 1UBMS 4URVR 2R68A 1T26A 4GPTA 3G1TA 1OU0A 2JFFA 3T1QA 5ELXA 3KJFA 4AWAA 4MDEA 2ZUWA 1XD9A 2ZKOA 5AVOA 3MYYA 2XHEA 3RWRD 2D00A 3UA4A 3THYB 3OVMA 1LCIA 1I3NA 3WBBA 3ZV4A 3QE9Y 4N9QA 1YDXA 3LV8A 2C58A 1T2AA 1NOKA 1Q95A 3D36C 4UKDA 3ICXA 5C37A 3DP9A 4C88A 4BP1A 1G2PA 1SIWA 5KKNB 3EDRA 5D3MB 3EVFA 1YE3A 4J9UE 1KVQA 3MRTA 4R01A 3A9WA 1RXIA 1X9HA 2QVZX 4Y2HA 4GNKA 4LF8O 1T2FA 3B8NA 4GMXA 2JFGA 3RVNA 2NP6A 3RH0A 1HTTA 5F2NA 4KXVA 2YDXA 2A9HA 3HUDA 5BSVA 1AF4A 4OKSA 3IDOA 3EW9A 421PA 3FVTA 3EBOA 3PFKA 5JCZA 4CQMD 3ORHA 3JW8A 1BQZA 4Q4HB 3EAQA 3RTDA 3V00A 5DHAA 1ORIA 2K1EA 4KHZA 2WUWE 1WO8A 4GGOA 3DCYA 2XCTB 1Y1PA 2Z2KA 3TL6A 3QVLA 1YUBA 1F8YA 1B26A 1KVSA 3E5MA 2GPBA 1R37A 2IKQA 4DA0A 5ESRA 3IT1A 2ON6A 1XE3A 2QMQA 4IXDA 1K7DA 2XRYA 5AHWA 4MVSA 2RHDA 3T1NA 2FPXA 1T0UA 3E81A 3S44A 2JLYA 4BWFB 4GRAA 3BQ9A 1ZHFA 3FPCA 3NRBA 1SJ9A 1I7QB 3TINA 3N7UA 4A73A 5FNVF 1TZ2A 1XP5A 4PDVA 4RXUA 5CH8A 4V02A 2NWQA 5ALLA 2IHJA 1FFAA 5E7QA 4FX5A 1OF1A 1Q86W 3SYOA 5K3OA 1VLJA 1RM5A 4L74A 3RJMA 2VG8A 4L57A 1CXZA 2Q5EA 5EVJA 3IUBA 4ZVQA 2ZAIA 3E9MA 2Z3ZA 4EDHA 3WB1A 3WDLA 2H18A 2IX9A 2X4LA 3OHPA 4B7AA 3ZGZA 2I03A 2J67A 1MOSA 1NP7A 1UBHS 4IEEA 1F6DA 1UBLS 3ZHOA 2FKAA 4FXPA 5I7OA 3BDAA 4XDGA 1TVMA 1EDBA 4GMGA 1SHJA 2Y0BA 3HXKA 1JLMA 3BF7A 4QPJC 2V0NA 2D2VA 4C7UA 3JASA 1IJKA 3UUEA 1CP9A 5E4YA 5C7LO 3K1YA 4TKVB 5CJ2A 3LWBA 4TMFA 4HNAA 2FFAA 4B6QA 3SR0A 4ARCA 4F5DA 1Y6QA 5J43A 4F5YA 4L8JA 5A05A 3VRHA 5KUKA 1Z5GA 3UW3A 1F7YA 1EPUA 3NONA 2DTEA 4WK2B 4YT4A 4H7PA 5LP6F 4CMEA 4RM2A 3ANNA 5MFPA 3JYOA 1ICIA 4RNDB 4JP3A 4LXXA 1VJ0A 4I66A 5EJ5A 1Z45A 4BO7A 2XUAA 1R0CA 4A6PA 2N75A 2I7CA 4G4JA 4X5OA 3TL2A 1DBWA 2VRCD 4XUCA 3G9ZA 3OMWA 4MVJP 3U48A 5LZ4A 3MB8A 1PG0A 4HH1A 4NDZA 3ZJZA 1KDZA 2R72A 1TZJA 4MRAA 4RO0A 1RXYA 3KQKA 1DCKA 2YMLA 1LVGA 3EIXA 5ADHA 3I6BA 4TKMA 2F1HA 2DQ0A 1PCXA 5KHAA 3JARA 4HGPA 3D8BA 2WD8A 3X2SA 3IQIX 1O95D 1UC8A 1EBFA 2ZJ1A 3HVJA 5CJJA 4LV6A 2PZ8A 4FGUA 4Q1AA 1KDPA 3ZS9A 4V2UA 1RXCA 4DA9A 4AW9A 1NURA 5DWDA 4BQFA 2VTBB 4K8OA 5B3SB 4ONEA 1AI4A 1TF7A 3HXTA 4NH4A 5T67A 1V0JA 5C46F 1UQTA 4EAQA 3AF3A 4Y6RA 1S72V 2HH9A 3QELA 1K8YB 2OEPA 2DYRB 5EI5A 2GEKA 1MNAA 3FF4A 3NBXX 3HJBA 4FMCF 3EZFA 5EPUA 1RE0A 3BH6A 1XQ1A 1YGYA 5KHOC 5LU8A 1O95C 1QCZA 5EBLC 3DV0B 1FRNA 2WUFA 4H0NA 3ZLJA 2OPBA 2V97A 3WKBA 1NN5A 2Y6UA 5IAKA 1SCUB 4CM8A 2W2OA 3NKFA 3OZEA 1Z8NA 1JSRA 1VG1A 4R69A 3KVYA 1V8DA 1JHAA 4WXPA 4U0JA 2K5UA 1PGJA 3GLFE 4ODIA 2Z2YA 4LDPA 3WB2A 1ESEA 2RDMA 5AVKA 4FEYA 3E8SA 3R7WB 5EXXA 3GUVA 3QHPA 5KYWA 4KDRA 1URFA 2MTBA 1QHGA 1TQ6A 4KXFB 3U10A 3NPMA 3ESBA 5AHKA 4FM2A 5KC9A 3H7IA 2F1IA 2E1RA 2FRVA 1E3LA 2PEZA 1ZUIA 2J85A 3THWB 3N7TA 4X60A 4BB5A 4OHBA 3I32A 4L2IB 3LKBA 3JAWA 1R18A 1M74A 5KTMA 4BO1A 3IE0A 3WIEA 5E9WA 4RDXA 5UKDA 3SYAA 1NNI1 1X15A 2CTRA 3RSSA 2QMHA 1T9BA 4ZK2A 1AJEA 3WIOA 3KCQA 2G1JA 2QY6A 4Q05A 3HP1A 4GF5A 5EZQA 2NV2B 1G2QA 2I76A 1ZNZA 2WWFA 1JYEA 1XTBA 1NVPB 5I9MA 3TGPA 3VNUA 3RM3A 1S5JA 4JI3B 1WG8A 3H5NA 1CR6A 3L0CA 2E3JA 3F3SA 2EKQA 4ECEA 4GW3A 1QIEA 5ALTA 4JT2A 4V39A 3WMRA 3IDFA 5DBIA 3PQ3A 3KG2A 3HCOA 2XBUA 5F3RA 1MZPA 4N39A 2VYND 1N2XA 4JX8A 3MT8A 2ATVA 5CDYA 1QHXA 4DEXA 3NBKA 1EFDN 3IIEA 1QJCA 2VYNA 5JDCC 4K03A 2BISA 1JXOA 1PS8A 4W63A 3K4HA 1A5BB 3NDJA 2DRIA 5H70A 3H1LH 1E62A 4FIPC 4RFSA 3LTEA 4RANA 1PR0A 3ULKA 1OKKD 4PAQA 2IZ6A 1ZIDA 4KWTA 5JS2A 2AUMA 1JXQA 4LVOA 1OKKA 3OLVA 4INAA 1P7YA 5K8JB 1FSPA 4WERA 2PRKA 1DEKA 4FEEA 5SY6A 4X6YA 3IQEA 2DTDA 3FWKA 5BPFA 2GD1O 3SDSA 2QQEA 4BZWA 1SKAA 3LSUA 2OHXA 1YNOA 5CA0B 2QRHA 4CFZA 4BFWA 2WM3A 1F5NA 3BWCA 1BWQA 4NYIR 5FBQB 3TNFA 5ALDA 3H1TA 3SYQA 1F2UA 1BVYF 3EWIA 2BFAA 4OMCA 2ZYSA 3IPLA 1R5BA 4K05A 1VQMV 3LC2O 2OV2A 3VFDA 3R5FA 4E7OA 4KU4A 1O03A 1VQ6V 1J8MF 1NKTA 2JIPA 3PV0A 2JS3A 1M4UA 3VC2A 3C45A 2ZWVA 4YDRA 2HSJA 4A15A 1YGPA 2A88A 4V1CA 2Z08A 2W2NA 2GEJA 5LDHA 1OH6A 3M6UA 4IRUB 2IBSA 2AL7A 4H17A 2C5BA 1Z88A 3DMHA 4AJHA 2FR8A 3WGNA 2EIHA 3X1KA 3D2BA 2FG7C 4DBLE 4LC1A 1J7JA 4DV5B 1O6GA 3A1TA 3GLHA 3K06A 2SICE 4XQGA 4AROA 2EP7A 4MPTA 3DT8A 1IBMO 1L5VA 2E87A 1ZXXA 4MW9A 4BE4A 2GQ0A 5KHHA 4BVLA 3V97A 4D1YA 4I0XB 1CUCA 3HXQA 4AUNA 2F00A 4R3UC 1MXHA 2QSYA 4DB4A 4UAUA 2LNDA 3P2OA 4EGSA 3V55A 3CX5F 3QHQA 3OPYA 4PYOA 3C8HA 4WX2B 2O50A 1X7WA 1ZUWA 3V1MA 1H4QA 3ACBA 4X1YB 3DZDA 5FWYB 4UAGA 2CWDA 3VZQA 2Z09A 3VYSB 5A4IS 3AM3A 3D7MA 4X94A 3ZN0A 4TV8B 2YEVA 2FJ0A 2CDCA 3UG6A 4FDVA 4L3VA 2PWPA 4ZN6A 4YO7A 3BL6A 1OXKB 4MI3A 3USCS 2GUWA 4X8HA 4YMWA 2GAIA 5CAEA 4EHJA 2EEPA 2ZTHA 2PDAA 4IH1A 4JJEA 5DNEA 3A06A 4OJTA 5HZKA 3AEKB 5BSHA 1L5QA 5IAEA 1CJKC 4P0QB 2Q1YA 1NNUA 1M7BA 1GM7A 4TWBA 2VTEA 2I6QA 4JJZA 2VTVA 1NXWA 4GXNA 2QN3A 3D6TB 1GWNA 3JQAD 3LBYA 2IIBA 4YRMA 1CW2B 3VDRA 1Y76A 5B3AA 5KYGA 4RAIA 1DIHA 5H4GA 3WLHA 3JQAA 1ENYA 2DX7A 1SELA 1WVIA 5EE5B 2V58A 2ZBRA 1KEEA 2WYWA 4XVCA 4CDRA 3O8CA 4C1NA 5PNTA 2DW4A 2HBQA 3DBHB 3B82A 1O5OA 2EYQA 4JB8A 1IE3A 5AR1A 1V8PA 5L4NA 4IPTA 3GT3A 3OURA 5CH5A 4WLNA 2F66C 4LZJA 1FJXA 4PLPA 1CVIA 4MT8A 4Z3OA 3GN1A 1DAPA 1KMQA 2QORA 4JVOA 2FA9A 3IYLW 4LZZA 4BP3A 3UXHA 3NDBB 4QYIA 4UM7A 3GLGE 3Q0TA 3BL5A 1CEXA 4UM5A 3ZHZA 2ID8A 3QBVA 4ZOLF 1FZQA 1NGSA 2Q0AA 1XQ6A 3J81A 2I71A 4EBFA 4L5BA 3NHFA 2I80A 1EGHA 4FZ1A 2XOEA 3A9TA 2GEBA 2E18A 3ZHQA 4US0R 2VRNA 3G89A 2ONCA 2JANA 4DY4A 4KQJA 3BJEA 1OB5A 4LJ6A 3UKJA 1BNCA 1JLLB 2CLMB 1JLSA 3X1WA 4C06A 4IIFA 4IG4A 2G06A 2ZQMA 2ZIGA 1U65A 3GRCA 3EQZA 1KTIA 3PGKA 2OBMA 4LJRA 3IAXA 2WT9A 4PHCA 2CFSA 2W6JG 3REQA 4GI5A 4E30A 4YRIA 2KS6A 1U2ZA 3OTQA 1QNLA 2FVYA 4R05A 2P67A 1CUDA 1V8OA 5ICCA 1HRKA 2GPNA 3T5BA 1TJYA 4FHEA 5AKYA 3NHAA 5IULC 3AR4A 5AW4A 2FMHA 5JS8A 5KMGB 2VPTA 2QRZA 4X84A 1RJ9B 3GJ6A 4KVZA 4D80A 2HXGA 4UFNA 1Q7EA 2W6MA 1XJQA 3ADPA 2W8BB 4N3AA 2PKQO 1NNEA 3ZIAA 4LF7O 3A6DA 4INJA 5CGQB 5B36A 3E3NA 4IXWA 4PAMA 4FYXA 1T1EA 4WXEA 2IEAA 5EWLB 3P8ZA 4JLJA 3L7LA 2AKYA 1RMTA 3OQNA 2ADPA 1NW4A 3HMKA 4JLVA 4BMNA 3TNDA 3U16A 5EJ4A 1ZK0A 4F1JA 2QW8A 4YJ3F 3FZYA 2A9VA 2JLQA 4CH6A 4NWIA 1T9ZA 1U8CB 3DAPA 2K7FA 4YXWG 2P6RA 2OO5C 3P97A 4MP6A 1DLIA 4NDNE 5JC8A 3MGGA 4NK4A 2BBTA 4E2LA 4EI8A 1WD5A 1BKYA 2C4MA 1T8YA 2ZI3A 3GEHA 3DXRA 1DB3A 2CUKA 4ALMA 2AF3C 4YHHB 3UWPA 1QQBA 1HE5A 1DKNA 3EEBA 4BVFA 3U09A 1IN6A 4WFBV 3GG9A 2E85A 2I6GA 3BQNB 3D4PA 2RIRA 3Q2IA 3TNYA 2Y69B 3UA3A 5K8VA 3EIFA 3QVJA 5LWHA 1AMUA 3PNSA 4JY7A 4RIGA 4W6ZA 1N0UA 4OMUA 1VP3A 3T1HO 3OCJA 1R6KA 2JW5A 2IYYA 3LYAA 4B3MB 3VHQA 3BB1A 4IYJA 2JD0A 3EE6A 4YRFA 1XNGA 4R8RA 3QFCA 4ZQBA 4TWZA 1NBAA 3EH1A 4AK9A 5T4FA 1M33A 2IEYA 5AWFC 3GZNB 4NBSA 3EVCA 4LDJA 3T5CA 2M2IA 4YJ2F 1HT2E 2D4AA 1SKQA 2VLIA 4D79A 3E82A 3ZCCA 2B30A 5EN4A 2GAFA 3IJRA 4UEOA 5ITZB 1NFRA 5IK2A 5CDFE 1ULBA 3ANMA 1T3TA 1WXHA 4YIKA 3IQZA 5HOEA 2D1FA 3I3SR 3ABSB 4MYUA 3NOQA 1G1XB 4BYMA 1A3CA 3A1UA 1MKYA 1YEWA 4NH0A 3VOSA 4N82A 2OCIA 1LNZA 1ID8A 5BRNA 1AY0A 4GT1A 3H3JA 2XNDA 5DK6A 5LMNB 4QGHA 1BFKA 3HZHA 3D6VA 1T5LA 5BPHA 2WJGA 2H17A 1K4DC 1B8NA 3EVZA 1UJWB 1ZLYA 5A4DA 1HNZB 1DT5A 1KC8W 3TLJA 4PYIA 1SHKA 3TLEA 2HI0A 3CMAV 2Q7GA 2QMZA 3DLTA 1OYVA 2QTFA 4TGLA 1HL3A 4JI7B 2CLHB 4FN4A 1OILA 2O52A 5K8TA 1DJNA 3L8FA 3LBHA 4WUTA 1YTUA 3ZE6A 3AP1A 4GUAA 4DBLC 1PWXA 3KE8A 4M9UA 4L6IA 4BMPB 1A0OA 3DNFA 1XTUA 5AXDA 3EGWA 1IM5A 3I39X 1TQ8A 2IODA 3T7IA 3U39A 3ISVA 4PSVA 5C7IO 1GAEO 5B66Z 3UH0A 3MAJA 3PDIA 1NI3A 2QJ1A 3ZK8A 3UAOA 4Q19A 4Z51A 1DELA 2HHHO 4BIOA 4AZTA 4CF3A 5F21A 3GUYA 4R41A 1C0KA 3PXXA 1ZLXA 3GA7A 1XPJA 3CJTA 1N8TA 1U6IA 3JATB 2VDQB 4AJ4A 3FWPA 2OTCA 3VM6A 2Q5LA 3AQIA 5DI3A 1QQ6A 4F6RA 4YAJA 4NBNA 1WUTA 4FLWA 2C2OA 1VIVA 2BTQA 3LO5A 4CNBA 5J1SB 5ALQA 1YF2A 1K8AW 5JAQA 1QUEA 3NBZC 2YMPA 3R9XA 3MCUA 1NWCA 1J97A 1IEWA 4DS3A 4O25A 2PYDA 2V7WA 2VXYA 3MCVA 4BV3A 3CRVA 3JD0A 2YWCA 4NMXB 4D57A 1S89A 3KD3A 1PW5A 4QJIA 1QHFA 4F2PA 4POAA 2LDXA 3SFTA 3JSAA 1KY2A 5FEUA 1CF2O 4LIPD 4MQ4A 1AZSC 1PJZA 2AMYA 4IGGA 4JLPA 3N3BC 3OU7A 4EKYA 1D2EA 2QT1A 1QWSA 3LUCA 3DZ8A 3N8KA 1HMYA 1LPSA 5LMUO 1MC8A 5C8YB 3VO8A 4PELA 4WNAB 2A2ZA 1RJDA 3DXXA 5C80A 4DEVA 1Z22A 3CUVA 3H2BA 3I34X 3LBFA 2GETA 1VA4A 5DB4A 1O87A 3DE5X 1XNRB 1CVRA 1HLDA 3RC8A 4NDAA 4MQUA 1K3UB 2H5JA 1EP9A 3B9RA 1UIRA 2JIBA 1AGPA 1WJZA 1IG0A 3H01A 1ZGHA 2RHHA 2LUOA 3ZGNA 1K7SN 2P5UA 4EFEA 3RAFC 1YK1A 5L3ZA 4DDVA 1Z35A 3E4DA 1MGOA 1WPXA 1I94B 3JU3A 5IDYA 3PWSA 4DQDA 1BCSB 3AM4A 3CVJA 1IDSA 1NAHA 3NOOA 2XQFA 3CH4B 1O08A 1V48A 2ZXEA 4HGZA 3DTTA 1CRWG 3SC6A 6LDHA 4MYDA 4PZ9A 1NPYA 4B6EA 2QM7A 3OJLA 1RTKA 4G2NA 4MWOA 3KKYA 1YDHA 2V7XA 4PLCA 4NATA 4BXOB 1ONPA 3M4YA 3GJ0A 4RELA 1W6RA 5JDIA 4P3KA 3M6WA 1OXTA 5ARCA 1YJWV 1OJ7A 3HKBA 1ECCA 2C7GA 2QZJA 5CT5A 3ZOKA 2LIPA 4K8ZA 2NT3A 3GJRA 4RM3A 5ENZA 4L28A 1CS4C 3VVBA 4AFNA 4Y2PA 5BW8A 1NUPA 1QPBA 1PD1A 4D81A 1KYZA 3T52A 3EA4A 4C7BA 4EKGA 5KDOA 2FMKA 3W5BA 5KJ1A 2ZDQA 1TU0A 1Z6TA 2K6GA 2YXHA 3RVDA 5BWBA 5KYTA 2ZQZA 2GLUA 5EFZA 5CB4F 3J81k 4X7PA 1FQWA 4R7TA 4PNHA 1AK2A 3NYRA 1N7JA 3VPDA 5EJEA 5BSGA 5LU9A 5JAOA 2A5GA 3MJDA 1XU4A 1UM9B 1N8SA 2CEAA 1WBDA 4D4IA 4YBZA 1I4LD 1ECPA 2ZT7A 2KSDA 3M1YA 2RI1A 4F91B 3AK3A 2NR5A 5KI6A 1UIMA 5AJXA 4YECA 1QNFA 2IXFA 2V7GA 3OLQA 5SZKB 2QG4A 5I9NA 4GEGA 3U56A 4Z7OB 2Z6VA 1RQLA 5BR4A 2AIRA 2DBRA 2NMVA 4YRAA 5B1BC 2LR0A 3GT7A 1HETA 1HKUA 4YPVA 2PBLA 4EENA 5CMUA 1WNFA 2CUZA 2GYWA 2EHJA 1MEJA 3WNVA 1NONA 1H8ED 3RJTA 1XL1A 4I1SA 4XX0B 4K6CA 4GX5A 4XQCA 1RWWA 2XAGA 4HVLA 2FB9A 2XE4A 3RSOA 3ZW8A 1R74A 1OI7A 5G0WA 4XUDA 4UCUA 4M49A 3PF9A 3Q85A 4WZBE 5DTQA 2QLMA 1UBJS 3QBEA 1N6IA 5FUBA 3NALA 2QPOA 2VYVA 2R8EA 4CKYA 3FRHA 4UUJC 1VHLA 1F17A 3BK7A 2HDOA 1YQQA 4RO2A 2QN7A 3BFRA 3U7IA 4DLAA 2CHUA 2PSJA 3JQGA 3T61A 3GA5A 4RVHA 4EHDA 1V1RB 1EUQA 4LSMA 2MJLA 1FY2A 5JJBA 4R16A 4FM0A 1L7AA 2GEVA 3O4VA 3SXJA 1L7RA 1YFKA 1P3Y1 4E33A 3WZ2A 1L4EA 4M9XA 3GDOA 5H3HA 4X61A 2UXCO 3AHGA 4BC1A 2HMVA 4AS1A 4WVFA 3TTVA 1DC3A 1YVPA 3ZY4A 3WX0A 3T4DA 3AERA 5JCOC 2OCCC 2ZR2A 4G28B 3JQFA 3EEIA 1NT4A 4DDTA 3DB1A 3TLKA 3VSBA 1YFJA 1G17A 1OBHA 3D8UA 4IIEA 3KLNA 4FMDB 5BN3B 4UCQA 5IVIA 3ZH9B 2HV9A 4IDFA 6NULA 3JYLA 1KR5A 4IDEA 1E96A 5BRJA 3ESZA 1T35A 4X20A 2X8BA 2WLIB 1N1EA 5AI0A 3GK3A 4BOYA 3HVKA 3FTCA 1CY4A 3OQBA 1VB3A 2PGAA 1RKXA 3C85A 3W2TA 2DXIA 2CB0A 5EKDA 4PSKA 3OM9A 1Q3EA 3PJFA 4QXOA 2R6R1 2ZUUA 2QROA 1DUSA 3JQEA 1IBRA 5DVZA 4B74A 2EFHB 3UB4A 5HOQA 4FZ5A 5ER6A 621PA 2AN9A 1QE5A 5TJ9A 3OMNB 2Z43A 4C3OB 1Z6AA 1C9MA 4KP4A 4AI8A 4TV9A 2L19A 5L3QA 5DBEX 2XYVA 4AS3A 3KR0A 4BWYA 1BWSA 3A7EA 4G0WA 5IKEA 2YWHA 1FDVA 1HE3A 3TPCA 4PR0A 2BMVA 1SQ6A 3ISJA 4EELA 3I8SA 2GHQA 4BIMA 4N6OA 3TI7A 2I9PA 4QQFA 1YTLA 2GBLA 3QE2A 4L3WA 1ZGJA 1SG6A 2G80A 3IP8A 5DXAA 4QIWF 5LYJA 3Q7EA 1XMQB 1N92A 3WLKX 2BV3A 2ZSDA 3R3ZA 4Y18A 1Z37A 1FDTA 1AI6A 3IHLA 1PS9A 3IKJA 3MOSA 2FZCA 1FS5A 4B4OA 4CM7A 3PFIA 2WJ4A 3GNTA 1E61A 3CCBA 4M38A 2AW3A 3DEJA 4P7JA 2W71A 1FFEA 1JVSA 4JI5O 3ZWKA 3VR3A 4W4LA 2JH3A 3FYUA 2KSQA 2CXSA 5BXYA 1QLJA 2ODPA 2UXXA 5JIBA 3SXPA 1RJEA 4Y2QA 1JKJA 2CYAA 3TW0A 2HU7A 3MBOA 5HKKD 1KO7A 3KTDA 4KIUA 3W1VA 4B83A 3G82C 1G16A 1F60A 4AT1A 4FU0A 4C4SA 1E1LA 5JEDA 2OCXA 2PAFA 3KSDO 1G20B 4FOSA 4PA3A 5ALFA 3KTAB 3I09A 5IJWA 1PE0A 1XGKA 3K9NA 4GXQA 2O3SA 3PBKA 1CIPA 1CQJA 3R8FA 3SS9X 3RAGA 4HGRA 4EL5A 2WYHA 3U4AA 1OT3A 4OQXA 3H1PA 3AGQA 2HO4A 1FNMA 5A3JA 3VZDA 3R3HA 2R1VB 4Q02A 1FLDA 2GB4A 5LB2A 3FMVA 2HT6A 3BH0A 4W5HA 3IVCA 4E5VA 1M8KA 4B79A 4N48A 2YMQA 4GOXA 4GWGA 3W4KA 2DSNA 2R8XA 2IUEA 1E3TA 2GEDA 3QEJA 2OA0A 1OFGA 4JXXA 2R00A 2ZJ4A 1FEZA 5NLLA 3GOHA 1VCHA 3FNIA 3ZK9A 4IVRA 1N9ZA 3RADC 4I4CA 1X9IA 3DBRB 3HN6A 4HAXA 4NX2A 4BO4A 2E1PA 4JIGA 3WWPA 3EVEA 1D1QA 3ZNOA 1FXSA 2J5XA 2PVSA 2PSEA 4NMMA 3ZQ6A 4FGZA 3U80A 3AHEA 2QTTA 4DBZA 3L0OA 2JS7A 4X1KA 4PNEA 2X6CA 1IXBA 3L1UA 5DLYA 3UTDA 4BRUA 4M9ZA 4N12A 3D8SA 1XQVA 1U1CA 2QRGA 2PUHA 3KJZA 1G18A 2Q3FA 1H38A 4EA7A 2IOYA 1I2BA 5FORA 1X7GA 1B0UA 1W5AA 1ZS9A 2ZJZA 3T3HA 5D3KA 2RHTA 2GF9A 1BIFA 1IMOA 4KPUB 3K5LA 4LTNA 3L0PA 4G81A 4EDFA 2H2WA 1NJIW 1XPUA 1KMCA 4KH1A 5LL6P 4DR1O 4OBWA 1GL3A 3W9YA 1IDN1 3SU8A 2WWGA 3CVYA 2H1HA 2OWDA 1JQLB 1HK7A 3HDVA 3ZBHA 2DKNA 1IVYA 2AZ2A 3M3HA 1MMFB 3A70A 4ANFA 3ANXA 1FNNA 4O4LF 3HZRA 3SE0A 4K1XA 2PKXA 4CDGA 2NT4A 4PRKA 3SGIA 3LDFA 5DLEA 3JAMN 4R6WA 4Z3DA 1XDGA 5IFLA 2QM0A 2W2LA 3DLBA 3GEEA 4HDAA 2C9BA 3FCCA 2YC4C 5B7QA 4R2IA 1IWBB 3SXUB 2PD6A 4MP3A 1PR4A 4FOOA 1CP2A 2DMXA 4CIXA 1YITV 4GR5A 2A1TS 3O93A 3ZMUA 5HF9A 2PQ6A 2QWNB 1X0XA 3CF4A 2F1OA 1NXOA 1X2EA 4CIAA 2IH2A 4DV7O 4C4RA 1IXMA 2LIVA 3PF8A 3DBIA 3F6YA 1B3RA 4FNGA 4XD7A 1D1TA 2JJ1G 1DC8A 1ETUA 4C5AA 1XRSB 1T5DX 4TRNA 3A04A 4YWHA 5K4AA 4L6CA 2CJWA 3DFKA 1VJGA 4OP1A 1Y6XA 1UCFA 1OLSA 2HN9A 3WZLA 3WVNA 2AUNA 4Z86A 4V0QA 3PJSK 5FKJA 4C43A 3P5BA 3M6AA 1VCIA 4XCQA 2OIGA 2RH9B 4C7JA 4KXXA 4P0PB 2VDNB 2IE8A 4BE9A 3KELA 2R97A 4OUKX 3AI2A 4M53A 3OT1A 2GVNA 2DPMA 4PJ0Z 3VC1A 2AOWA 2G88A 1TT5A 3FWNA 4KWEA 4EYEA 4R0VA 3OOJA 4YS6A 3Q9NA 2YR0A 3N2ZB 1L5YA 1U3WA 3H9UA 3RVBA 1ZD2P 3AIIA 2RK4A 5BV1A 5TRTA 4I5FA 1CUJA 3JYQA 2WJWA 2PWAA 3C7AA 1JVBA 3G5UA 5ADWA 2GO7A 1K5SA 4ZRNA 3ZCPA 1YZLA 1EVEA 5GJBA 2CK3D 3K6RA 3L9XA 3QUSA 3CCLV 2EATA 5C52B 5FNVB 1XDCA 4B87A 3C8MA 3BHNA 1UWLA 4XSVA 1JFFB 1ISSA 1C4OA 1JS1X 1W2BU 3H5VA 1GTRA 2TMGA 2FMUA 5ERYA 1QV6A 2O3QA 2CGOA 2WZBA 1MTOA 4FWBA 2QJTA 4WLOA 2PPLA 1WV0A 3ZHXA 3SSOA 3CVUA 1E64A 3V3KA 3QI7A 3UCSC 5ES3A 4GVLA 3KU4A 2RHLA 4L8VA 4N0DA 1KYYA 5GJVC 3WYAA 5EJ9A 4LVUA 4NR0A 2PMKA 3ZX6A 4HY3A 4F96A 2OGWA 2IUFA 3NIWA 1ZD4A 2OBNA 3STLC 2GXAA 4C08A 3X3HA 2FR0A 3MSXA 3IIKA 2RGAA 5LBUA 5C3UA 2PSSA 1GADO 1QOQB 1AB5A 4TMTA 1QHHB 5FWAA 3BABA 3OJOA 4NKRA 2PKCA 4MW7A 2XKAA 5AM4A 1YTFD 2QYHA 9ATCA 2UU9B 2O0MA 3AEUB 2B7CA 2VNHA 3K6KA 3AVQA 1TZCA 5KPDA 4RUEA 1MJNA 4HL6A 2REQB 4YCDA 1LJLA 4UHHA 1QS0A 4MUIA 1VMEA 3ABMC 2PCLA 4MW1A 1K1EA 1T2NA 3PUWA 4DIBA 3QWHA 1XZGA 3JQBC 5LP6B 3WRXC 2QV0A 5J4KA 4I3FA 4JC5A 3VTZA 4UV8A 1UEJA 3AZPA 5DULA 1KRHA 2N3ZA 3W6PA 2A3NA 2QN2A 1B00A 4BO9A 3NHRA 4I4TF 4ZU3A 4OLAA 3AR8A 2W0XA 1EFKA 4AKGA 4Z54A 4N5HX 3P9IA 3FYTA 4H1VA 4G0PA 1RBYA 4OJKA 5G40A 1ZD9A 3KEOA 1Q2XA 1TGVA 3SYLA 3L8HA 2LQTA 5TT0A 3MOIA 3LVFO 5JYDA 4KFMA 2ZRQA 1KSFX 2CLFB 3BRQA 4K3AA 2VQFB 4LUCA 2WLSA 3T3MB 4OSOA 4UM9B 3TLCA 1OGYA 4II2A 3PCXA 1K66A 4Z4EA 1KRWA 1M0EA 2OV1A 4V0SA 1TUEB 2H0RA 4KYIB 2AOXA 1BCRA 1UFIA 3M8KA 1EXVA 1Z47A 1GA1A 4ZDWA 3G2HA 5D8DA 3EZLA 5DWQA 3OF2A 1LB1B 2QM3A 2AH5A 1SOWA 3EBPA 5GAJA 4WN9A 4BS9A 3P0RA 2PS1A 2QTSA 1DKQA 1V5FA 2ZCVA 5ECGC 1CF9A 2DMRA 3GLIE 1M8JA 5JXWA 4PCUA 3ZI0A 4BO3A 2HWWA 3W8DA 2GCPA 5BNIA 1I3KA 4FOLA 3AYZB 2CE4A 3O4HA 6REQB 3C3XA 2H16A 4M0MA 3L1IA 4XKJA 4ED9A 4NFYA 4XR9A 4FMCB 3X1ZA 1K9MW 1IB0A 2YVUA 1JSCA 2WNIA 1II9A 2VP6A 2UYGA 2WIFA 3AHHA 4GIBA 5F73A 1X6VA 3TO5A 1W5BA 2E4VA 4UBJA 5CW1A 5H3LA 2R1TB 1QF9A 2RC6A 1FBNA 5EHQA 2OB2A 1Y5IA 3WOVA 1ECGA 2PI5A 2BHTA 5LQSA 4NEQA 4A5OA 1MC4A 1ZD8A 2NM0A 3CYOA 1BEUB 3C74A 1OE0A 2R8ZA 4XIGS 1XILA 1V47A 2X4GA 3ADKA 4E31A 3UBTA 4F3KA 3FGOA 4AZ3A 3EXIB 1P33A 3BGSA 3LIIA 3M49A 2V3CC 3WGUA 3O73A 4RLQA 4ITRC 2QX9A 4C9BA 2PWBA 2IBMA 4IZOA 4COOA 4N5MA 3V34A 4C4TA 5FAKA 3IJ4A 1Z5OA 2PFKA 1F2DA 2ZTVA 2KX7A 4UNSA 4Q82A 4PXYA 3A1CA 3JYPA 3UAYA 3ORRA 3GB9A 4BWVA 2F2TA 4S24A 5KVQA 2HK9A 2RIPA 4DLYA 4R3WA 5BQOA 4TL8A 1VECA 4DYVA 1SUSA 8ATCA 4YRZA 1EVKA 1OZ0A 3QYFA 4C7MA 4YDQA 2O1XA 4TZKA 2P68A 5CNIA 2CLCX 1QH8B 3BXEA 1PN3A 4RV9A 1XHEA 2XYPA 2VWHA 4IJQA 5I7AA 4Z0NA 4U00A 1H22A 1O9GA 2O7QA 3L1VA 4RK0A 2DHQA 1PJQA 4S0XA 4IUYA 1K86A 4IZ6A 4BU1A 4QGFA 1XKQA 2K2WA 1QIFA 4HBGA 3PRHA 1KQPA 2DR3A 1HT1E 4R68A 1G6Q1 1T6XA 4IH9A 4XEUA 1Z3IX 3Q7PA 5E4FA 3KJXA 1ONOA 2FGJA 1Z7EA 5GGYA 2A5DA 3LS2A 4CGZA 2ZUCA 3DJFA 4LHXA 3K0DA 4CMEC 1RZVA 2A33A 5KKCA 3OFNA 4QIHA 2EERA 4F4UA 2WIDA 4BQQA 4LZWA 1NMSA 3ENKA 1JX9A 5GWXA 4MR7B 3HEMA 4YROA 3RFTA 4H0FA 1AKEA 3LVRE 1K5PA 1VKOA 2V7QG 2G5TA 4RAQA 3LDUA 3BGIA 2C4KA 1TO1E 4CR7A 1FVOA 2F8LA 3QY0A 2ZNIA 1J22A 4E2ZA 2P9BA 1G8YA 4D45A 2R6JA 3MTIA 3OFVA 2H4XA 3IVMA 1N32B 2GD2A 2H2AA 1YVWA 5G4KB 1NLUA 4DV2O 4UXJA 2Y48A 4FW8A 2EW8A 1MQSA 4DV4O 3Q72A 3LNCA 4TWKA 1V8BA 2WAMA 2VHWA 1RWVA 1AT1A 1V6CA 3PGMA 3DVLA 4RPGA 1GSHA 3EOBI 4N01A 1IX9A 4UATA 3WHLA 2ANBA 4LZOA 2JRCA 3K35A 4RQFA 1B76A 2VZLA 2OD9A 1GLGA 1EK0A 3NHYA 4U3JA 1VOTA 2Q3HA 3M70A 3GGOA 4DIFA 1KP2A 2XGMA 4A0FA 1V3VA 3RK4A 4ZWNA 3NVKI 3OX1A 1QYWA 4AZSA 1ZISA 4HDCA 3SKVA 4Y7DA 1T1IA 4RF3A 4NXMB 3PQ2A 3IUSA 4YV0A 4J7KA 3N2KA 2DFNA 2IX3A 2YW2A 3MAAC 1VJ1A 1UK6A 3BAZA 4XWYA 1CX9B 3RVLA 1V25A 4A2WA 2QA4V 1HQKA 5AD1A 3WBJA 4M0KA 4HX2A 2JDIA 4M9SA 2BMWA 4X45A 4JI2O 2FTKA 3CLUD 5E8RA 7MHTA 4ZVLA 4Z2AA 5DNCA 3LI2A 4L5IA 2HRQA 4DV1B 3RKRA 3T9CA 2AYZA 3FD8A 3I8OA 2NZ8A 3S40A 4ZP1A 4L7VA 2H1VA 5I47A 1JEOA 4JU8A 1JJOA 4J2HA 4L87A 3KPJA 3V8RA 3UBMA 3RF6A 3W0LB 4X1IA 1SG9A 3SD7A 3L6DA 2I4OA 3FFTA 1TKAA 3CLUC 3EHEA 2I1VB 3B2EE 3ROKA 5A4AA 1BMFA 5IKPA 2WK1A 4ZZ3A 1KJYA 3KD2A 4KDEA 2XB6A 3H1FA 3L9WA 4MW4A 4YMHA 2PXHA 2BGTA 1E9BA 2AJ8A 4K26A 3EFEA 2CV1A 1O2DA 4FGJA 4PM4A 1U3DA 4K40A 3NO4A 4EPWA 1BYUA 4EI2A 4YY3O 4LX8A 4MI1A 5JR3A 2DQSA 1AR4A 1OH7A 3OTIA 4CKEB 4FP9A 4BKQA 4PANA 2ECKA 4RHUA 4D99A 2PSDA 1N4CA 1A2BA 1Q74A 2B4KA 1G3UA 6PFKA 3ELYA 4NU8X 3FMGA 3K09A 5EJGA 3LFUA 2V7TA 2JFUA 4ZOLB 3FSRA 2EKDA 3MINA 2HT1A 4MMZB 1E0DA 2X2FA 3V8QA 5FFNA 4X7MA 4F4FA 1G291 2DH5A 4NK5A 2TYSB 1P7VA 4I4IA 3O8BA 4NBVA 3HL4A 1NTMH 3FLAA 2XF2A 4F12A 2QWPB 2G25A 4TMKA 3NETA 3VZSA 1IQRA 3UJ3X 1EUCA 1F9AA 4GUDA 1Q81W 5KYXB 2I6UA 4TRMA 4C3UA 1EE2A 5GW7A 3NVMB 4OSPA 1J09A 3JZFA 5B1AB 3LDDA 4DF3A 1P1RA 5DNWA 1M7HA 4INOA 4F56A 4ER3A 1Z13A 4N47A 1NIJA 1TCBA 2XYQA 1QG4A 4CCSA 4KR0A 1L7MA 4HX5A 2PL3A 2ZI5A 1RP7A 1A1SA 1U7WA 1TC1A 3CT6A 3CKKA 1XDZA 1KKCA 4YLEA 4FLZA 4PLZA 3AUSA 1VYVA 1GPUA 4YR7A 3ADBA 1ADJA 3RAJA 4NAHA 1NQWA 1PHRA 3ZE0B 1WXXA 2P4SA 1E2IA 5E9JA 4I81A 4EMUA 1OLUA 4JJFA 1WR8A 2H59A 3DFUA 3QF4A 3UMJA 2HFEC 4DLUA 1QO7A 1UOOA 2X6TA 2AOUB 4CCWA 3CX6A 1HEUA 4PAWA 4YJ3B 2R5FA 4XPIB 4I8IA 1N34B 1G63A 5BWMA 4GYKA 2DUNA 3ZV7A 4F8YA 1CZHA 3Q5EA 1NW8A 1NBEA 3TTSA 1B15A 3VH3A 2O8BB 4PFQA 3GLGB 3W5DA 4US1R 2PTHA 4INPA 3SHWA 1UR5A 4QUAA 1O96A 1FP7A 1VE7A 2WW8A 2X2PA 5ESXA 2B5VA 1YJ5A 4CKXA 3CF6R 1X7YB 2WZDA 5EWJB 5THKA 2A5YB 3DXZA 3O90A 4K5QA 3STZC 4FR0A 4U2BA 2ZPAA 2QLTA 1JG7A 1WL8A 3E83A 2QJRA 1JU9A 3DVQX 4PLGA 3WRYC 3MWGA 1DLJA 2BI7A 1HL7A 1HDGO 5IHXA 3HRHA 5IY5C 5B1DA 3LE8A 2ZB8A 4ZYUA 2C7VA 5CDGA 3A3YA 2Q6KA 3H5LA 3H11B 2GR9A 4V0KA 1YR8A 2PRYA 4UJ5A 4JMLA 1P39A 4L5YA 3ZKAA 4CGYA 2OZLA 5KDLA 3AI7A 1CUGA 2XAQA 3EXEB 3BGWA 4D97A 1WCIB 1I1QB 4MWSA 2E5FA 2XXAA 3IEMA 1RKBA 2VPXA 3RLIA 3EC2A 1GGEA 5KKAA 4K7JA 1PWZA 2XDYA 1NQAO 3ISTA 4FFVA 3LQYA 3GFSA 2D74A 1N1DA 2PX6A 5KYUA 2ALJA 1T6YA 4CZ2A 5IT9A 4JLAA 4OBEA 2O2CA 4NJOA 3M4XA 4G86A 1HYGA 3O9OA 2QVXX 4G4SP 5L4LA 4PZUA 1QHIA 2YIDA 3OZVA 2OMKA 3LD9A 3TBKA 1KR2A 2V74B 4IBOA 4OVKA 1YS1X 1MF7A 2WE7A 3DNPA 2VHXA 4WTOA 1J2EA 1YBFA 3ZIDA 4YQYA 2O14A 3C3TA 3S8MA 5FOQA 3PGJA 1A76A 1CJSA 4QQ8A 1VPDA 3K20A 3NUZA 4PI2A 1SD1A 3ZIAD 3RPEA 3RFCA 3E9DA 3QPUA 3OZWA 3PJDA 4NBTA 3QPWA 4F45A 1MX3A 2YWRA 4JLBA 4YYEA 5BNZA 4Q21A 3CMCO 3SBDA 1HQCA 1A5SB 4QUJA 3O8OB 3K4QA 2NN4A 1BDJA 5FCDA 1JA0A 1I6KA 3AZOA 4HB4A 5BQXA 3VOTA 3D1VA 4CH4A 4UCVA 2BKLA 3QY9A 1HE2A 4G9GA 5D3ZA 4Y67A 3HJCA 5ED0A 1Q6YA 2PZSA 2BF7A 3SQDA 4BLSA 1XHZA 2FW8A 3JVEA 1HX7A 1O0SA 2CHFA 3WLSA 5DK4A 3VO1A 4LKRA 1T4MA 2DT8A 2ERYA 4YGXB 2HLDG 5JSFA 3W90A 4IIDA 1YBHA 3ZHSA 3DUFB 3H3FA 3KK0A 3FFAA 4YUAA 3W3AH 4E7PA 4LH6A 1UOEA 3FTQA 3AKZA 2QDOA 3QUTA 2BFCB 3HYLA 8GPBA 3VH1A 2QTOA 2MYPA 1XZMA 4Q3CA 5LLSA 3CJRA 3INTA 1GZ3A 1W30A 2G1UA 1G5TA 3AIMA 4LGMA 3GY0A 3LQ1A 3LVBA 5G1PA 1XZIA 3WNBA 2UVPB 3KWFA 1V3TA 3TJMA 4CM4B 1S8FA 3JRXA 4GYYA 4JP5A 5ARBA 2C97A 1AP5A 2AKEA 4JJ4A 3WP0A 3A2FA 4JYAO 4UNQA 2GZHA 4EF5A 3HCBA 4EW1A 4Q9KA 3QNEA 1R9MA 3QXHA 3NKVA 3T5AA 4OX9O 3FBGA 5E6SA 1LDNA 1US8A 2P35A 5T6BA 4HPWA 1I5XA 2F62A 4UZSA 4G4IA 3U3KA 1NIPA 2FB5A 4LQ4A 1MVOA 1VL1A 4KXNA 5HX7A 3H13A 4J7JA 3LT4A 5J2TF 2O7VA 5IZCA 5IK2D 2ZB2A 2Y6VA 1I0LA 3M6LA 1ISGA 2G17A 4G0UA 3UTCA 3I0ZA 1Y3HA 4WA8A 4QA9A 4OPMA 2VUIB 3DOFA 2LCIA 3E58A 1CQXA 1W34A 2XNDD 5ADVA 5LFAA 1SQSA 1ZM2A 5G0VA 2YJGA 4D0GA 3TOXA 1F0NA 4R6ZA 1ADCA 2CL0X 5E38A 2C9MA 5B5SA 2X1LA 3G5MA 3JZIA 3QOYA 1AS0A 3UO2A 4PHZA 1SIBE 1IUPA 3JQQA 5JTUA 5JASA 1S2DA 1M8GA 1Y1RA 3KKEA 1EZVH 2YFKA 1FYEA 3I64A 3SWWA 1MB0A 4RK6A 3NV7A 4Z4GA 7REQB 1YHNA 2Y05A 2W6QA 2XUHA 1L5NA 4ENVA 1FL9A 4O2RA 4MVJG 4BTEA 5K0LA 2O7NA 1V9SA 3PEVA 3DKKA 3LK6A 4HQNA 2ATKC 3H1KH 4WEQA 1IZ8A 1KC1A 1DARA 2FFRA 5IKOA 4DXAA 2C04A 4B75A 3C97A 3PI6A 1CCWA 4RCYA 1M93A 1CUVA 4RPHA 3QLUA 5FPHA 2RH8A 3FH0A 3M4ZA 5EXTA 2YOHA 4JNCA 3U3OA 4MTLA 4ZCTA 2C31A 1M90W 1OJLA 1PK9A 2WP0A 4AXXA 1AQNA 3ADOA 2CBGA 3VPFA 5B3JA 3DBOB 3R41A 1TUBB 3AG2C 4E4TA 2ZZKA 1H5QA 2CDRA 1FTNA 4JI8B 2RCYA 5K8IA 5CB4B 3MRVA 3QKIA 4BV2A 4EEKA 1QGYA 2G09A 2EJBA 2X0FA 4LQLA 4AURA 2PXAA 4E5NA 1RKVA 1WCYA 2ZB3A 2FPPB 4XYMA 2AMJA 3R3YA 3SF8A 5LYYA 3OQ1A 1IOLA 1A5ZA 5JNVA 4DWJA 3S81A 3AY6A 5K2MA 4JVSB 5CYOA 3K92A 4IXTA 5LUBA 4GOJA 4Y2GA 1OU4A 4PG4A 2IITA 5CVVA 1NKDA 4RABA 4HSGA 1VL5A 3LT2A 2P4EA 4X65O 1KMNA 2VDRB 1C3EA 3S7TA 3RV4A 1AMOA 1MZEA 1UANA 1BDHA 3DF9A 5DDIP 3UH1A 1K5HA 1WDMA 1Y67A 4ZT3A 5KUMA 1E1YA 2J48A 4WH0A 2YZGA 2PX0A 3G59A 3VVMA 4L0QA 1R8XA 5DZSA 1DBIA 5JE8A 4ND5A 3GZ4A 2Q07A 3ROQA 4PAGA 3NASA 3V4SA 5FOSA 2GF0A 1W94A 1NJSA 1N6LA 3N7AA 2D13A 4DDUA 2ITCC 3O3CA 1YOVA 1ZNQO 4M55A 3KOWA 5GM1A 4EKIA 4M1SA 2NV6A 3E8MA 4BBPA 4CM5A 4LRQA 4NYJQ 4S05A 1Y8QB 1L5ZA 4IF4A 4CKBA 2QUHA 4OHRA 2Q29A 4ETNA 4U8HA 5B1YA 2WF8A 3EZNA 4MGEA 1HDOA 4WLFA 2YWJA 5K8LA 3NR2A 2EP5A 4BL5A 3CF2A 2VDKB 1GRQA 3Q41A 4JSTA 2GCNA 4MRMB 1OXXK 1ODIA 2OVFA 1QG2A 4I2VA