2WAMA

Crystal structure of mycobacterium tuberculosis unknown function protein rv2714
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
294
Chain Sequence
AREYEPGQPGMYELEFPAPQLSSSDGRGPVLVHALEGFSDAGHAIRLAAAHLKAALDTELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRDSIGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPITMTAHSNNRELISDFQPSISEIQVPGSASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLGAEFERFLAQQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium Tuberculosis Rv2714, a Representative of a Duplicated Gene Family in Actinobacteria.
pubmed doi rcsb
molecule keywords CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN
molecule tags Unknown function
source organism Mycobacterium tuberculosis
total genus 97
structure length 294
sequence length 307
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2wamA02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wamA01
2HR3A 3W7TA 1YTFB 3W7XA 3W7WA 3MNFA 3W7SA 3WZ2A 1S3JA 4G4SP 3D3IA 3E35A 3GAAA 4HAMA 2P90A 1NH2B 5CA3A 5GW7A 3BY6A 3W7UA 3IC7A 2WAMA 1RM1C 1NVPB 3VR0A
chains in the Genus database with same CATH superfamily
1YZBA 4TX1A 5CJPA 4IG9A 1RPOA 1EK1A 3F74A 5LBUA 2Y1WA 2AOUA 3FIUA 3CSXA 3AHEA 2ZS7A 1QK3A 3CONA 1A9SA 2HCJB 2PMWB 1AZLA 2C2ZA 4C01A 3ODGA 5L6MB 4PO3X 3KTOA 2D2FA 2SKCA 5FFMA 3KS9A 4DMLA 2J9YB 1Q43A 3F5MA 4YB8A 4OP2A 5IUJC 4AMVA 1KK1A 2Z9DA 5E6UA 1YTFB 1V95A 4HNAA 3EC2A 1JFLA 3U4HA 4DLZA 3ZVMA 1CKEA 2YZNA 1QDUA 1YB4A 5EHQA 3H1EA 5E2BA 3KJHA 4DLVA 1IN6A 2AG0A 1VGQA 2Q41A 3R3XA 1Q5OA 4EI7A 1V54C 1I24A 3DBLB 4DV7B 5B3JC 3U7FB 2YBDA 4WJLA 2O7QA 1H93A 3WLIA 3HJBA 1S5HC 4ZK6A 4CEIB 4OPMA 3V7WA 3D7NA 1SZXA 3AM5A 4C07A 1SKUA 2CXXA 4ZARA 1C7IA 1QNFA 3VDRA 4MGKR 3B4SA 4WEOA 2W2VA 3N2ZB 5BSVA 4RS4A 1Q1BA 1EZ1A 2GVZC 4BNJA 3TR0A 4Z8YA 3PJSK 2RBGA 1ECJA 2GF2A 3R0VA 1CEXA 2P2CA 1QOPB 1A5ZA 1ZX3A 4RTOA 3F1LA 3ERCA 3R65A 4AS3A 4MVJA 2EWVA 3FKJA 3K9GA 2C83A 1E5XA 4GXRA 1N5LA 3TRDA 2G82A 2EFGA 3PXCX 4B2LA 4JTCB 5DTIA 1D2EA 4V0NA 1KBQA 3ZE7A 4FE3A 1EU1A 3W8DA 3D8UA 4TRJA 3Q5DA 2VJMB 2XDQB 3VYWA 7ADHA 3QTTA 3H3JA 2Y67A 3AVXA 4XVHA 5F78A 5FQOA 5B1BC 2I6QA 1E7RA 1KDOA 4HHEA 3WLEA 3VH1A 1SS3A 2ZT5A 2B4RO 4Q4AA 1H6DA 3CSUA 3EISA 2Y05A 3GGGA 4AJ2A 4WBNA 3M7MX 3PEUA 1ZS9A 3R3ZA 3ZOZA 1BE1A 3A06A 3E7XA 3KV1A 4HEJA 1EXMA 4C3ZA 4FMCF 3F5TA 3E1SA 3B1ZA 4LVNA 1E0JA 1VA5A 1OLOA 5EJEA 4V0SA 5EMKA 4LIPD 1B8OA 5AJUA 1WPXA 3FPBA 1G8FA 5AXCA 1S5PA 5CJ2A 2WYVA 3B09A 2OMKA 4RA6A 1XTIA 2H4FA 1J9EA 2GCIA 3G5LA 3D4OA 3L41A 1RZ3A 2XNKA 4PCLA 2X4DA 3TGPA 1USVA 2ATIA 3G7NA 3MQ4A 1TAGA 1M8GA 2FB5A 1Z16A 1QQBA 4QYIA 4J0HA 3X2SA 3HUUA 4ZVLA 4AO7A 1O3YA 2HN9A 4DIUA 1MQ8B 3IJEB 1MG5A 2W6ID 4LXQA 1NSTA 4Q3CA 2O2ZA 1S2MA 4OJQA 3FPAA 4I7ZB 3A11A 4WI1A 2Y0EA 1NN3A 3OPXA 5C8VA 1V16A 1CERA 3MUFA 4JVLA 2PKCA 4RQEA 3IVGA 3TFWA 3AJ8A 4RGVA 3QKRB 1WPGA 2GBGA 5E2AA 1QHYA 2UXDB 3L5OA 3X43A 3D31A 4EH1A 5JHGB 1RCTE 2HKIA 2QK4A 3C5VA 1CUAA 2FEOA 1GPYA 1KSHA 4AMBA 2V7PA 3GMTA 4DY6A 3AVOA 4G5OA 3T3DA 1MENA 1KK3A 3U56A 3K6KA 1PM9A 5CXQA 2HHLA 4PGMA 3E7WA 2ZBEA 3R5JA 1QPBA 2M6YA 4FCVA 1D2GA 4DMCA 2VTKA 2XF2A 3E35A 4YIOA 3PJRA 2QVBA 2GD0A 3KOWA 1RBQA 3NWPA 4NG5A 3B6JA 4R8RA 3THWB 5HF9A 4I1OA 5K20A 1RLIA 1RKUA 2PU5A 2YHIA 2EC5A 5E3HA 5FDFA 5EWMB 1XWWA 3X3HA 2Y76A 3QW4B 3ER9A 1PTJC 4IHJA 4BVBA 3S5UA 2JGMA 1KMHA 3KL2A 3VHLB 4EPWA 4KRXA 4PE5B 2WJGA 1WULS 2HWUA 3EASA 1UANA 3OLCX 2VPZA 3PNOA 3QOXA 4J49A 1Y89A 3FVQA 4IVRA 1XN4A 5KOHB 2X5NA 3G5UA 1TCAA 2PVSA 4Q7QA 2GBOA 4WXMA 1PNVA 2HLDG 2OCGA 3U9TA 3FDIA 3ADPA 2DFKB 3HVIA 1CR1A 4CLOA 4TQGA 4MP8A 3WLMA 5BNTA 1M2VB 2ONKA 1Q1AA 1OD6A 2IZZA 3Q8WA 1GKYA 5C8YA 3LWZA 1AURA 5A02A 3VPXA 2OAGA 3NHRA 3QELA 1ZJ5A 3MHSC 1K73W 3BRCA 2GEBA 4LRSB 5EE1A 1HRKA 2YUIA 1HMYA 1CE8A 2WWXA 4F9EA 3J7AU 2JAWA 4QJ5A 4U0JA 4CHGA 2IXTA 2IDKA 2F1OA 3WXBA 2FW7A 2X15A 3KYCB 2WK1A 4QUIA 5SY6A 4Y2JA 1T15A 1WS6A 1YDFA 2VVTA 2SBTA 2P75A 2O14A 1FRFS 5HZHA 1I8TA 3M81A 3QX9A 5EIBC 1C50A 2A86A 2WC1A 1YVDA 4MYHA 2AEFA 1FQJA 4D0LB 2A0YA 1Z0ZA 3OW2U 3K9FC 1LNSA 1HK7A 2QPTA 4Z4FA 4UVHA 2W2MA 5I7AA 2ARHA 4XD7D 2VDVE 2GKGA 1A72A 1Y4UA 4BKUA 3M1LA 4E32A 4BEJA 4XPIB 4DSAA 1KYZA 1RWNA 4DVJA 3GJ4A 1UXHA 4PTLA 2EJTA 1XQ6A 3X44A 4RZQA 1UWKA 3CXRA 3CF4G 4KHPB 5TVKA 2RKOA 3ZWMA 1A1SA 5KZMB 1NQXA 3GRYA 2GEJA 1FVOA 4II7A 1UFKA 6ABPA 3BTOA 1EUQA 5SY9A 1JG6A 4JQZA 2IYQA 1F0YA 5F2EA 1B74A 1DEOA 5SZJA 2QL5A 4XVRA 1NW4A 5LKAA 3KAQA 4H17A 4LDZA 1ZNYA 5EKSA 3R1IA 2ZULA 1D2AA 2G5TA 3EPLA 2BM0A 1J2YA 1EVZA 2C98A 3C87A 4IDFA 2CJFA 2PFGA 4Q4LA 2AFIE 3QHQA 3BJEA 1IIRA 4BAYA 3KEMA 3NHWA 3TQHA 2XMQA 1LXCA 5B3SC 3QMPA 1VIDA 3CH7A 3NRBA 4EY4A 4ENRA 2IJGX 1EK6A 3U48A 3K32A 3E8FA 3T4ZA 4Q9IA 4TLBA 1WTAA 1DXOA 1R4NB 3IP1A 3FWHA 4Z9AA 1R88A 1Z34A 5I9MA 2PZ8A 5FTLA 3PVZA 2GJ4A 3CD6V 5HJ7A 5CMLA 3C3MA 1NX9A 1TT5B 4MVJI 2M6LA 4OB7A 3DEFA 2H2AA 5EEHA 3V2HA 1XZ8A 1ABBA 4NY1A 2I2XB 3K16A 1NIPA 1P7WA 2HDWA 5E8RA 3IPCA 1OV9A 4Y6OA 4A26A 5T4EA 3JQPA 4YMHA 2HO5A 2Q46A 3GFPA 3H8VA 3ISVA 4ZQHA 4Z4GA 2IS4A 4DR5O 5DV9A 1NTZH 4R6WA 4R3UC 2YWJA 3EGIA 3RUEA 1TZKA 2MTBA 2QM7A 2CYCA 4WN3A 5KYVA 4KDEA 5EJ9A 4MO2A 3QWAA 2O3TA 4LVOA 3T34A 3C3CA 3O8BA 1U8EA 3UT5B 3L6BA 1FP4B 3AU8A 5EP3A 1OWLA 4HSGA 2PPVA 4DJTA 4KIWA 3IOYA 4EPVA 3OY7A 4RXTA 1G18A 2EIMC 4MA0A 2ZQMA 1X3LA 1SC6A 3PCRB 1O2DA 2YYZA 3PDIA 4IKEA 5JDCA 4HK4A 5FWYA 1ZSNA 1PL0A 3I83A 5B6PA 4BTLA 3W2TA 2ZJ6A 2XGSA 5AKHA 2OD9A 5ETJA 2BLLA 2HVJC 3LRPA 4CBCA 4B7AA 4CM8B 3PNPA 3G2HA 2C9YA 3MT8A 3OG9A 3QSYA 4BQOA 3NHJA 2J33A 3BMCB 4PHFA 3TOSA 1J0CA 5ALKA 3DXRA 5KS2A 2AUTA 1DINA 4N23A 4UNIA 2CXPA 2CLFB 3N87A 4BGUA 3CRAA 1MEOA 3O5AA 5LNK6 5K4HA 4OLFA 1L4MA 3T3EA 1Z8HA 4WMLA 3WS7A 3BA9A 2BGUA 1FFGA 1T2UA 2DWCA 3KV3O 4B3SB 1OOEA 4MA4A 4CIVA 1UBNA 1PR0A 1U5BB 1DKOA 3HBFA 1BGVA 4BLQA 1YCDA 1JNXX 1E2QA 3M6UA 4R68A 3RRZA 3EXAA 2DPHA 2DPGA 4HL6A 1YJNV 4FR2A 4B5LA 3OUTA 3WQBA 1FCJA 2DW4A 4O33A 2GZSA 4GH5A 1ZITA 2ZPTX 3A4VA 3DZFA 1Y7HA 1XNGA 4LYDA 1QTRA 3LQ2A 3DLTA 2ODMA 3UOGA 4RK1A 5PNTA 1I13A 3S2FA 3IP8A 3CCMV 2GCOB 5GV7A 2C54A 3EOAI 1CUSA 1VRWA 3HLYA 1I7NA 3QIVA 4OMCA 4GX5A 2PA3A 3WWZA 3VPCA 3NTUA 2JGDB 5A4IS 4BECA 3FUXA 1LLQA 2CLIB 4ZI7B 1TYAE 1GL9B 1ZUHA 2R8ZA 1MR3F 4B0PA 1TFUA 4TUYA 3MS4A 4RZ3A 1XCOA 3BZBA 1DP4A 4MCAA 4B08A 4ZO4A 1PV2A 3WIUA 2FJUA 2OXFA 4P2ZA 4R0VA 2TMKA 3P3PA 1MOZA 3DV0B 4MO9A 4O02B 2CCGA 2IH3C 2ZI3A 2XA1A 4DIDA 2PYIA 4ETNA 2O07A 5IJ0A 1M0SA 3VKGA 3AZOA 4KN6A 4UATA 1MQ9A 1BW9A 1A7KA 1MW9X 1ML3A 2WSBA 2Y0CA 3T7DA 2VZ0A 4B3RB 4BQQA 2ZJ7A 3UK6A 1WNSA 5DCUA 2JVJA 2ZUDA 4IIYA 3MWEB 4IV8A 1JE1A 4QELA 1Z7EA 1ORTA 3EA0A 3G9TA 4BUZA 3R23A 3FJYA 1V25A 4C9BA 2WIDA 2HXGA 3FUVA 1GKIA 1JT2A 1U02A 4BZZA 5B4UA 1OCOC 4P3XA 3DT9A 4C7KA 3WWCA 2O19A 3PUKA 3E27A 1UKEA 1QFMA 5H4HA 3ASVA 4XD7A 2DSTA 2XCIA 5CURA 3DMPA 3TPCA 1XR3A 1SIBE 3OKAA 4TTPA 1GNSA 1F7UA 1UXGA 4LGMA 2CHQA 4XJSA 2EULA 1PJ3A 3AEZA 5CVJA 1O89A 2JK1A 3UMBA 3G0DA 1MTZA 2NVWA 4E7PA 4NATA 5GGYA 4LBZA 1UXOA 2FMTA 4G0UA 4P6VF 4JZGA 4DXWA 3RABA 1ADGA 3ESXA 1YJQA 1UINA 5JSYA 5G41A 3N2EA 1TO2E 3HWWA 4PLHA 4IO1A 4LYFA 3B3AA 1U7XA 4Q3BA 4Y6SA 3TD6A 4GPZA 1ISFA 3S99A 1K8YB 2OQRA 5FBQB 5CEFA 4A1OA 2UKDA 2Q2NA 5LNK1 4L0QA 4L5IA 3DF9A 2HRDA 5FO0A 1ESZA 4J7AA 3VJLA 3WK6A 1FFEA 3DZGA 4G23A 1QRUA 3K09A 5K4AA 2PDAA 1CY0A 4MLDA 3BVOA 5ALFA 2W0MA 3JYOA 3U1BA 4P92A 2H2FA 3BEOA 2AW3A 3EXIA 2QKCA 5B64A 1H2SB 1QS0B 4IXWA 2YYAA 3RJZA 1G4UR 4CJXA 3S55A 3SZLA 1QVGU 4V0ME 4XARA 1JN0A 5KHGA 2EIJB 1N6OA 5AOCA 2VTDA 4MV9A 2ILMA 4NIMA 5ALHA 3M7IA 4TYNA 4LXXA 3NP7A 4BNNA 5DLYA 4IEFB 2PGGA 3K9NA 4Q05A 5E1MA 1E0AA 5FTNA 3BHJA 4NL4H 5CCEA 1NW3A 1YU6A 3WMFA 4TL9A 1NYRA 1ZXXA 1I7QB 1C8LA 4MAAA 2OHIA 3GLUA 2F1JA 1G55A 3F47A 3RYTC 3V32A 2WD7B 4BNLA 5DM70 4Q4HA 1JHUA 4RVDA 1W1IA 2NVUB 4KUHA 2XA9A 3IBCA 1NXXA 1VBFA 2AFVA 2Q4EA 4CF7A 4B3TB 5I7SA 1FDRA 3IBTA 5KDDA 2PWYA 4J90A 1AM4D 1Q15A 1ENVA 4WFGA 1QU3A 3JARB 4FGZA 3BMQB 4ZI7F 4UJ5A 1N34O 3K1TA 4BP8A 4GUNA 3MAAC 6PFKA 3LPMA 2C07A 2PTMA 5MGNA 2UV8A 1JWLA 3QIAA 5FV7A 4L3VA 5K8JB 4X64O 1NN0A 1K08A 5BVGB 2Q45A 1D0SA 3QLVA 1SC3A 2WKQA 3I2HA 1GO3F 1ZW1A 1TM4E 4MMXB 2PGIA 4Q1EA 3FOCA 4B4OA 5A2GA 1YUBA 2EIHA 2QT1A 2Y66A 5KTPA 4Z2AA 2FYTA 4MPTA 1JSCA 5C1OA 1KKLA 2BI8A 2IH2A 1PX2A 3EUEA 1XILA 4YRTA 2C04A 3TCXB 4GYWA 4ZN6A 3CRZA 3N58A 1A7JA 4CUJA 5DM60 2YWXA 1KFEB 1KHTA 3E2MA 3NHPA 4TMXA 1FD9A 4CFZA 2BFWA 5LD2C 3X2QB 3PGA1 1TRHA 3TAXA 5JARA 2WVJA 1EB9A 4GUDA 4QGHA 4Q18A 1RAHA 4K6KA 3C8MA 3CMAV 4F9FA 4L4UA 2IBTA 4S2EA 5LLDA 4BVKA 2VTVA 1K7YA 3NDBB 5H70A 2IP4A 5E9WA 1JU3A 3H75A 2IYEA 1BCCH 3BFRA 1DTWB 3GLSA 1J24A 3C6BA 3L8YA 1EGVB 2CL5A 5CLFA 3ZMSA 5DNAA 3DP7A 3GD5A 3T38A 3AHGA 4RSGA 2NPOA 4DQLA 5AJHA 5KMGB 4C6TA 1VJ0A 3DDSA 4YFYA 3W1VA 3MBOA 1IY0A 4D0SA 2WOOA 4FLZA 3GRRA 2PL3A 2O23A 3HI4A 4M1WA 2P40A 4DUYB 3ZE0B 2A33A 3ZWDA 1AJPA 2RHJA 3EDMA 3HJTA 4V1CA 4ARAA 4IDGA 4KLRA 4DIEA 4KFSA 4WK0B 1WLYA 3UXHA 3CT4A 1JVMA 1XLWA 2G5PA 3P32A 5H0IA 2H00A 3LCMA 3FAVA 4IR7A 3OPMA 2EERA 3CU5A 3KEGA 1W4ZA 4NABA 4V2IA 1LVHA 2H9IA 2I55A 2XYPA 1XMVA 3UJPA 2E21A 5CIWA 3ZZMA 1TUEA 1K0UA 1EJ2A 2I2DA 5CD1A 2QBYA 3WG9A 2BGLA 3FOWA 3X1ZA 2R6R1 4ZT5A 1NP3A 2W6QA 4W63A 1FYFA 5E6RA 3P0HA 2QM3A 1GG8A 3VNVA 4RACA 1PCXA 2H6EA 3KLPX 5ILQA 3AF2A 3QV2A 5LMNB 1Z6QA 4MW3A 1SXQA 2A06H 3QKIA 3ZR4B 1JR4A 1HLFA 2FLWA 3VSEA 2CJWB 1IULA 1JJOA 4QUKA 4DM3A 1RBMA 4YDQA 3SSAA 3KKMA 1MABG 4PZYA 3K4HA 4XYLA 4RTKA 5I5EA 3TE6A 4L85A 2ITDC 2BI7A 1A77A 3T6KA 3V1MA 5KSYA 3WK4A 1GGMA 2P1DA 1OFUA 4TS4A 3I76A 3ZDQA 2GFIA 3CKYA 1ESNA 4BE9A 5DBFA 1ULHA 4G1VA 5SZIA 3INYA 3TMKA 3P20A 2G9QA 4O3FA 5A3QA 2CF6A 5JWRA 3PLRA 1UJ5A 1T9DA 3K6JA 3OWOA 4YY3O 4EL0A 5ERYA 2JIBA 2Q0AA 3A6HA 3GLRA 4YCSA 2Q9UA 3D4IA 4CR8A 5KJFA 1WZUA 2C5EA 3A37A 2JJMA 5AHOA 5JLAA 2H2WA 2ZR7A 4OO3A 1UEXC 1PKEA 1CF4A 4OIMA 4C7UA 5FXMA 1ADJA 3DKIA 5KI6A 1LA2A 4D6YA 3STLC 3EDYA 5CFOA 4E14A 1T43A 4PVDA 4JJKA 3DAPA 2ADOA 2B69A 1S3FA 2EV9A 2RHMA 3HM9A 3Q8XB 4PSDA 1E5QA 2H85A 3KCXA 5KHKA 4N6NA 5IZCA 4ZVMA 3MLEA 2ZVJA 2YMPA 2ZRGA 3U7IA 1PQUA 4U1RA 2GZ1A 2QRVB 1F14A 3RC1A 3N2KB 3A3YA 2J5XA 3TUJC 2JKYA 5FUVA 3BWMA 5AESA 5L3QA 5EZ6B 2XR1A 1LKZA 4F38A 2B2CA 2IX3A 4PN7A 3QUCA 3HKDB 3Q7TA 2X8JB 5D3QA 4DBZA 5TMPA 4PYLA 1F6DA 3ONEA 1T0UA 1TECE 1KWGA 3W2FA 5JQWA 2X2PA 4ONEA 2QWXA 3TLZA 4FR0A 5G0UA 1VLHA 1U90A 4BC0A 2P91A 4INOA 2V7UA 2KS6A 4K2HA 1SU7A 1DKQA 1EFKA 1XCGB 2BT4A 4F21A 1WQ1R 1CLUA 5E7MA 1VHQA 2X8BA 4K0KO 2B0CA 4TVSA 2NZJA 1CCWA 4CZ2A 2GXUA 3DGFC 4PG7A 3K6RA 5FBHA 4X7MA 4ZYLA 2B6NA 4D92A 3HL4A 5EFZA 3R44A 1K4KA 3W6NA 1EBOA 2CSXA 2WJAA 5CA3A 1YA4A 1QCEA 2PLWA 1H69A 4EEXA 1KXZA 4DA4A 4O4JB 1XK7A 4R41A 1OREA 3F9IA 3M82A 5AJWA 2CF5A 4LDPA 3RYCB 2WU1A 1QV6A 5EXSA 1TAQA 2IEZA 2HSZA 2WP8J 3C45A 1EB8A 1Q16A 1U6IA 4N41A 3GZJA 3CTMA 3IV6A 1W0JG 3GJ8A 1YQWA 3AKCA 1NXPA 3K1AB 3IURA 3O1HB 3JQGB 3DQQA 2EP5A 2FPIA 4FBLA 1DG3A 3OZEA 8GPBA 2VF2A 4AJEA 2PPLA 1N7JA 2D00A 2HQSA 1OGYA 4F4JA 1H23A 3SQWA 2YMLA 1VQ4V 1L8LA 1M6HA 1L4HA 4BUJA 5IW8A 4NE2A 5EG5A 4P7JA 5IHXA 4L4SA 3OPQA 3DC6A 1UM8A 4EJSB 2OSBA 3ELUA 1UXJA 2DHRA 1XE3A 1E96A 1KPIA 4D98A 1AN9A 1STOA 4J4TA 3I6YA 5JXWA 1YR9A 3ZRXA 4Q4JA 2Q1YA 1TLTA 1V55B 3ZIUA 2HQ1A 4JI5B 4B7KA 3JALA 2BD0A 3K0BA 4PV7A 2JEUA 2VHQA 3Q6NA 4YI5A 1ID8A 2Z98A 2WLLA 2PSHA 4YECA 2HSWA 4OLHA 1PAUA 4HNRA 1KMQA 5G1OA 4IMPA 4JUDX 1ZK2A 4IIXA 2WJHA 3FMOB 5DI3A 1EFVA 3TLBA 4COKA 2FPPB 4RS3A 4DR4B 4NFLA 2NO7A 4JVNA 2HRBA 3ANSA 2O2SA 3FY4A 5IARA 2VJAA 3NWJA 3RUDA 1BWRA 1YVRA 4L5YA 1UH5A 1A9PA 2X9LA 2GSMB 4WNIA 3L8HA 1NKTA 2X6RA 3RLIA 2J5KA 2VH1A 5BQFA 2BONA 4S05A 4I5FA 3JAWA 4MQ6A 2XUFA 5JCPA 3PIIA 4V1CI 4LOJA 1FDUA 3JQ9C 4F91B 4X0EA 1CVLA 5K0ZA 1SQPH 4BNUA 3G2LA 2KI5A 4R69A 1FDWA 2R96A 2C4VA 4LP8A 3FOEC 1DQNA 4DLUA 2HLDD 2CUTA 3RTCA 1HKUA 4HVCA 3L0SA 3UAGA 1JILA 1HL3A 5E0OA 1MC4A 2IHKA 3WNBA 1VL2A 5TPWB 4JWKA 2VYQA 2QTVA 4K3VA 1GUZA 1WA8B 3F67A 1BE8A 2OC4A 2RB4A 1OLSA 2VNIA 1HE5A 3LX6A 4OHFA 3P2JA 4QATA 2XIQA 3CLSD 2FFHA 3OMWA 2P4EA 1AB3A 1W94A 5KEIA 1FNBA 2W93A 4PLGA 2EKZA 3E82A 4KQEA 2P5UA 2AOXA 1TMYA 3LYHA 3NT5A 1E2PA 1DG1G 4CKXA 3WLNA 3ANNA 4QUHA 2CH7A 4YT2A 2YN2A 1H8HG 4J11A 1JW9B 4WLFA 1D03A 4Y9SA 1UC9A 4EMTA 2HBZA 2Q1UA 4QBGB 1N2IA 3V8VA 3K94A 5KCMA 2GKSA 3T1YO 2ZATA 1CR0A 1Z0DA 4KWIA 3UKOA 2BZ1A 4V38A 1QCCA 2I4IA 3GL9A 2HFKA 2BF4A 1YB7A 4HR7A 4FM9A 5C7LO 1IQPA 2ZJOA 5A4KA 4XWTA 4DJDC 3ZBTA 2H5IA 2WUEA 2VF8A 1RQXA 4K2AA 5FWNA 2XKBA 5BSUA 4BO5A 3DZBA 3OHSX 4TRNA 2PQ0A 4BMZA 5GWXA 3FNBA 2E9SA 1ZNWA 5HJEA 3O7WA 4XM2A 3OCZA 1GT6A 5TMEA 1Q74A 3IAYA 3KT3A 1S1CA 3A27A 4H60A 3QBEA 2JASA 4E12A 4RE5A 1RXSA 1WZEA 1DIOB 3B5JA 3BABA 4GBGA 5I8WA 4BFWA 3BN3A 2WUFA 2WHPA 3JQ7B 2PSJA 4Q9HA 4WOKA 5KQLA 3V4LA 2GBLA 3AF4A 1CDZA 2I2WA 4PC1A 3SX4A 3BGOS 3OKPA 2HM7A 1MKYA 1PBNA 3FN4A 1BKSB 1VJRA 4BEVA 4EQ6B 1CV2A 5ESDA 2G1JA 5FI1B 5EHGA 1H1LB 5HBRA 3EQ8A 3RTDA 4O1IA 4PX5A 3AIKA 3I9NA 3NWBA 1PZGA 1DX6A 5B1HA 5U4XA 2BE9A 1QIGA 1KI8A 3OVMA 3PCTA 3PQ6A 3OP4A 1WMBA 4ZO8A 4AWXA 1AK1A 3PR1A 4P33A 1XCPA 4MV8A 4AZ0A 3AM3A 4L73A 4BO2A 1PT6A 4RLFA 3VVBA 1F0PA 1VMIA 2XYVA 4FDLA 3OFVA 3PENA 2GZAA 4XGNA 1MPXA 4IOLA 2V9PA 1ZI9A 1H4TA 4BAZA 4B6EA 5JO0A 1EZJA 5CNJA 4QDKA 1EESA 3TEMA 1SY7A 3C4VA 3R7AA 4LDRA 3BZWA 1VPTA 2F3QA 4XWKA 1H3FA 3EIWA 2VXYA 3TFOA 5DNEA 3O9MA 3SEZA 4LBVA 4DDKA 2ZR8A 1W36D 2DMXA 1KOJA 3RC2A 3S0JA 4KL1A 3WGLA 2OIEA 3D9QX 1MIOB 3CZ9A 2PTGA 3DQPA 3EVEA 3AF6A 2GPJA 5C51B 1VBMA 3CVYA 2GD2A 3R24A 2YIBD 3OHMA 4OHKA 1LBSA 3C6QA 2Q5FA 3KIPA 3TTWA 4OH7A 4K1LA 5G4LA 2PWAA 3HKBB 5T4HA 3IQZA 1JHOA 3ZE8A 3NNSA 1FIUA 5J4HA 1KPGA 5GV8A 1LC0A 4FYIA 5D00A 4PX2A 3HP7A 1ZHFA 4DA9A 2I99A 2WQZA 3TZHA 1ZBDA 4X9XA 4ZXFA 2QTTA 3MJSA 3H87A 1BWSA 5F5XA 1US6A 2LDBA 1LR1A 3V3KA 2CZGA 5EIHA 3KEFA 2ZRNA 1HURA 1G4AE 2VP6A 1XEXA 4WBXC 3OR6C 2ZUVA 4HZIA 3BWCA 3HC7A 3VR2D 2L17A 1K4DC 1E89A 3ELDA 3EWNA 3R7LA 2O1XA 1DOHA 1YZKA 1KAEA 2FLKA 1GIAA 2QMYA 3MIZA 2ECKA 4R7ZA 1II8A 1OFUX 5AOAA 3HU2A 4H08A 3I1IA 4NLLA 3UWPA 2JIRA 2PKQP 4DKJA 3MJCA 4E15A 1UJNA 2DN9A 3RBZA 4M0CA 3TGLA 1T5TA 3TW6A 1YZNA 2B9ZA 3L6DA 4WF9V 5JCOA 4J16A 1CY2A 4OXSA 5E95A 2BBTA 3M9LA 3EFBA 1XNJA 2QNIA 2FN4A 4MQMA 3MTEA 2NO5A 1V11A 2C7PA 3H3FA 3DL2A 4MVUA 2JJ1G 2ZRMA 1VRVA 4TL6A 5LUBA 1RVDA 4FHGA 2VP5A 1I4DD 5DK4A 1CQWA 2D7JA 4KU4A 1AQ6A 1P0MA 5DBIA 4FJ2A 1XA0A 1B0PA 1UKBA 4LOHA 1G0OA 3A25A 3JQDA 1Q1QA 1BJKA 1NVDA 5HF8A 1VFNA 3WJAA 4CDNA 1N8KA 2HLDA 5JISA 5ALLA 4PA3A 1M57C 2D5BA 4FZRA 1GPAA 1AF7A 5CDGA 3K06A 5GAJA 4MWZA 1N75A 2NQ8A 3ONNA 3JYPA 1KJYA 2FZLA 4UQLA 1XHXA 2C58A 2JK0A 2VDPB 1Q3EA 5AK3A 5E1DA 3AR7A 2PS1A 4BRZA 3RGWS 3GF4A 4PGAA 4KWHA 1R1BA 2YC2C 2GILA 3DEKA 4P80A 5TXGA 3EIOA 4H0CA 1HDOA 2WOJA 2PUDA 4Q9LA 1T5EA 4GNKA 4H3KB 1N7GA 4WLNA 3MS2A 5BOSB 2BVNA 4MW1A 2WG2A 4B4VA 2XAHA 3V55A 4HFRA 4AECA 3I72A 3PC7A 1K34A 2ADMA 4IJWA 1UJMA 3Q9SA 3RT3C 4QBIA 2HMAA 4YCJA 5LBQA 2NN4A 1XF9A 5B7NA 3RAPR 3RWMB 3OJEA 4DNPA 4R2LA 3EZNA 3WRYA 1TA4A 4EAQA 4LRWA 2OCLA 2CUZA 1NOKA 1RYMA 1M1ZA 3CF4A 1WO8A 4DR3O 1B3RA 4HVLA 3G5AA 5DT9A 3I5YA 3E0XA 3G9UA 2XF8A 4KPGA 5MFPA 3PZBA 3K15A 4MUEA 1NXVA 5BSRA 1I1NA 4DGSA 3ILVA 2H1CA 3PPYA 2C57A 1NT2B 2ZSBA 3KSBC 4Q16A 3EZ2A 2P90A 2XD4A 4UM5A 2E1RA 3SQNA 2E5LB 2QORA 4JI2B 1V5FA 2Q3BA 7ABPA 2CXHA 3L1HA 2RDCA 4JFRA 4AK9A 1U28A 3VOSA 3KQVA 2C95A 3C8HA 1LEHA 2YXEA 5DRYA 1FW6A 3LCVB 3OJOA 2I34A 3LKZA 1IAVA 4XDGA 3EZ7A 3TZKA 1SUWA 3SMVA 2Q3FA 1TDJA 1NP7A 3L04A 4MB2A 4RHFA 2ZOSA 3PCXA 2WT4A 4P4UA 3FOBA 4EEKA 4MARA 4ABMA 4HTFB 2QMHA 1EDBA 1T9KA 4P35A 1JDJA 2CTRA 1ZW6A 4X6YA 3S44A 4CKBB 1GRNA 4UHDA 2DLNA 2OBFA 1UC4B 5B57C 5JH7F 4QXAA 1DARA 3IAUA 3DD1A 3QJYA 4KWTA 3N76A 4HBNA 8ATCA 1WVGA 1SZCA 3C3WA 1ZA2A 1L5ZA 4HNQA 1A9XB 1LWOA 5AJVB 4TTQA 1SVKA 4J3FA 4ARVA 4L08A 1ZEMA 1O54A 3UHPA 4BMPB 2J41A 4XQEA 1E2BA 2Z5UA 4Q6GA 5TARA 3IMEA 2Q49A 421PA 3PIRA 4TV8A 5JSZA 4JJ6A 4QNRA 3CISA 1V8OA 4BVGA 3JZIA 3MBKA 3SGIA 4F97A 1JZSA 3PJEA 1SOUA 3MUNA 1FFDA 4ZGWA 1G7CA 3A32A 2V7XA 1U2DA 3GDOA 3H04A 2JLWA 2G71A 3DEYX 3GLHB 3I30X 1KY5A 1EDEA 5HFLA 1DDOA 5K8TA 2AMJA 4GKJO 3NDPA 3FAKA 2AC2A 1WV0A 2E55A 3EGDB 2A88A 4IDEA 3HCOA 4RJ2A 3ZJYA 2OK8A 1RLJA 1ZN8A 1AF4A 3NOVA 2L0XA 3HB3B 4ZZ0A 1DX4A 3K70C 3A6FA 5KJ1A 4NPCA 4Q9DA 1PNTA 3PI7A 2XMGA 5ECGC 5FH9A 5HIAA 4ARZA 2VK1A 2YIBA 2AOUB 1JSZA 2L82A 4TMYA 1ZGBA 3VNUA 1YWGO 2XWJI 2HYDA 1MW8X 5ERXA 2F17A 2G6TA 2WTMA 5H5JA 2WSSG 2WFLA 3PEEA 3WFJA 4B47A 1F12A 1F8UA 1PJ8A 3PHBE 2WMNB 4X89A 1BMFD 3D02A 5E6UB 4HNAB 4OI0A 3D3JA 4R9NA 4LF5O 4MH0R 3DF7A 4R9VA 2Q62A 4DDMA 3CSDA 2AT1A 4GI5A 2IUTA 1ZD2P 3CPHA 3VOBA 3GDWA 1C29B 1BDBA 3LDUA 3VR2A 4MYUA 3Q1KA 2HLPA 3SHQA 1DV1A 4G9BA 2XB2A 4EY6A 4RH0A 1EAMA 4NHOA 1Y5NA 5AM0A 1NX6A 1QH8A 3P96A 1Y76A 2C2BA 3MW8A 1QQAA 4JKYA 3GNTA 4LE0A 1MV8A 1CP3A 2OG1A 2X1VA 4GVPA 3HV2A 4L02A 2ZNJA 1QGZA 5HCIA 2QN8A 1IEXA 3V8EA 5ER6A 4BV3A 4DOMA 3R66A 2VO1A 1JSRA 2UZ3A 1OAKA 3G2PA 3NG1A 2B21A 3IAEA 3ILXA 4KEAA 1I5EA 4GX1A 4IH1A 1DBIA 2H9YA 3N7AA 1VQ8V 1YRBA 4O1HA 1A9ZA 3KD2A 1DEAA 4HNSA 2Y0BA 4GOLD 3A0BZ 1SELA 4IH9A 3VR5H 4K6FA 1XTKA 2WB4A 1QFYA 3M34A 4IUDS 1GAWA 4NC9A 3I9MA 1VLJA 2H07A 4GL4A 4Q4AB 1VHJA 2QV7A 3D8SA 5ISMA 4WBNB 1GTSA 3U40A 5EXPA 3G85A 4Y6LA 3U6KA 4MGIR 5B1SA 2J3DA 3RFUA 3PNQA 1G6Q1 3C5CA 5I47A 4KYUA 5BYBA 3B8NA 2EGGA 3EQ7A 3MOIA 2VCYA 3J81N 5TQ0A 1J0DA 4I1IA 5BXYA 1KSFX 5F5NA 1CQIA 2QTNA 1J1ZA 3AL2A 3O7MA 4RA6B 4ND6A 4J0GA 2EYUA 4XDLA 2E5FA 1D4OA 3ZDRA 5IMSA 2F1KA 2D13A 3D5EA 3KUCA 5JS8A 2ZRBA 1PQYA 2FTKA 2AOTA 1AGRA 2PRJA 4U7HA 5F2OA 2H4WA 4QYIB 4C4ZA 1CULC 1VQPV 2Q7OE 3H2JA 5JJEB 1YAHA 1Z15A 1HTBA 1OZFA 1SZPA 4JT8A 5HFNA 1GTJ1 2ATEA 4WOJA 3WSWA 4U4AA 2QQFA 1NVBA 4W4KA 3IUMA 4C14A 4FYVA 2I2CA 1V16B 1IBRA 3DA8A 5IVIA 4FPPA 4L9WA 3TCNA 3ZNQA 5H80A 2C78A 4ZU3A 3A58B 2JARA 1TA9A 2ZITA 3K0DA 2NO0A 4ENUA 2CN1A 3SJZA 2FN9A 4ZI2A 4Q48A 2X23A 1Z6YA 2QX6A 2D1FA 1K5PA 3FI0A 4XUGB 3RHFA 2HIHA 5HF6A 3SJQC 4GOJA 5D84A 2ZTLA 5HTOA 1W29A 3OU6A 1ZVQA 4H77A 1E18A 2G4LA 2XHBA 4JJEA 1G7RA 2DETA 4LMPA 2QSJA 3COJA 2VEDA 4YMWA 3E58A 1RE1A 2PEZA 4G56A 1ZVJA 1W85A 6LDHA 1JHXA 2YHIB 2QLBA 4Y6RA 3CINA 4TQAA 4W9NC 4PFKA 4D0NA 1HFEL 1YR3A 3CPJB 5JAQA 1HE3A 5GTHZ 1L5RA 4ZU6X 4IHJB 2WLTA 4RCZA 3WISA 4YRLA 1KMHB 4OXYA 4H7PA 3A1UA 4DTIA 1R4MA 1BFDA 2XAUA 4IDBA 2GRJA 2H3EA 1QFXA 2CE2X 2PYZA 1K4CC 2GM4A 2EIKB 3QH4A 4OSOA 3ANMA 1ZAYA 3L8DA 3QNEA 1DLBA 2XUKA 2SKEA 1PL7A 2VWKA 3OMAB 4YAGA 5EBWC 1N6NA 3FLEA 5K3FA 1VKOA 2H7XA 4MWEA 2WWTA 3RANA 3BRSA 2R6ZA 4XYMA 2XW6A 3VOAA 3NHFA 1VIYA 5JBIA 1D9ZA 2MCFA 3ZEAA 4G8JA 3B2EA 4CLOB 3WLOA 2A9KA 3IXMA 2H1IA 4WIAA 3E3NA 5C8YB 1UPXA 3KKOA 4KIUA 4XDYA 3QELB 4F8JA 3RKSA 4DLLA 3T94A 5BV7A 1IJEA 4LZWA 3FMGA 4WBNF 2VYFA 3KZXA 4RTJA 1HDYA 4KXFB 4J9VA 1CE8B 3C3TA 3D4NA 3RCBA 3ST7A 4EGCB 4CT0A 4H6PA 4EGQA 3L8ZA 3OQJA 5SYNA 3ZH9B 3FA2A 1SK8A 1CEYA 1O95D 3GCGA 5F1KA 2FY8A 5A7HA 1KSJA 3E8HA 4LCJA 4HWTA 5G0VA 3NYWA 2HMUA 4RY2A 1PR2A 5F33A 5EP4A 3OTGA 3DHEA 1NTOA 1C0EA 1SRYA 4F9TA 3GEPA 1W0JD 1IUPA 2K87A 5IE9A 3DBRA 1ADBA 4GWKA 4Q3OA 1CW2B 3IAS1 4YWHA 4UTXA 3GLGA 3IQXA 3PFWO 1NTKH 1BMFA 5KC9A 5AQ1A 3EF3A 1CRWG 4KKXB 4BFSA 2R85A 3CNQS 5HMLA 3UF0A 5JADA 4CYMA 4JEMA 4GXTA 4ZVPA 2LO1A 2VDQB 1IQRA 4AVYA 5CT4A 4MIYA 3VJRA 2W6IA 1JALA 2CEKA 3FFBA 4YIPA 4IMIB 4S1WA 4RDHA 2XUZA 4MVZA 1CUEA 2F3RA 3W04A 1XVAA 4FMPA 4S1VA 2HSJA 1KKDA 3NT4A 4LFBB 1RM1B 1LNQA 3FCOA 4LDQA 1X86B 221PA 2GEKA 3HVRA 2A3QA 4JI1O 4UVGA 3ESCA 3W3AD 5KLVH 5A1TA 1X1EA 4BNHA 1Z0KA 1QQ6A 3VTKA 2VDWA 5L4LA 3CLVA 1R0ZA 2BGRA 1UDAA 5K3SA 3QI2A 5DIFA 1R74A 1HMPA 5CYFA 3VZCA 4JQOA 3K35A 4FFOA 4DR6O 3FCAA 3IJRA 2CDCA 1YJ8A 3W2HA 1MO6A 4DQXA 1RU3A 1PYOA 3L46A 1EFRG 1ZN2A 3ZHVA 3UCEA 2X42A 1EDOA 4BO4A 4ZV4A 3ZJVA 3E2EA 1YE3A 2GPAA 4B48A 2XJ4A 1AA6A 3G5MA 4LHZA 2CUKA 1JPNA 5ILGA 1Q0QA 4O2BA 4BFTA 4D5EA 4WGGA 4YP5A 1RXEA 1FEZA 4CH3A 1OPRA 2GXSA 3HB1A 4QOFA 3K9LA 5EHXA 3V4ZA 5F2NA 3H65A 2QTBA 3RU2A 1WUTA 3WK9A 4H3HB 4DM4A 2DVMA 2ID4A 5JBNA 3ECCA 4K81B 1VJ1A 4UEKA 1POWA 3QVVA 3RW0A 3FSEA 1ZD4A 4URZR 4EHFA 3EA5A 4ITRC 3VBCA 2FFRA 4J07A 2DWUA 1IZ7A 1YSCA 3E5HA 1KEEA 4FFBA 1O97C 4A73A 1YVWA 4XEHA 3NFYA 3MCVA 2IH4A 3RUFA 4F6LA 3KOOA 3TVTA 3BAAA 1FDVA 3EPJA 2HHHO 1P29A 4WV3A 2LW1A 3CS3A 3IOMA 2Q5HA 4J3NA 1MAUA 4MDEA 5C8YF 3SZRA 4IV5A 4XGQA 5IEBA 4LQLA 3I5XA 1JVNA 3STTA 1K6XA 3PC4A 2JS3A 3I5UA 1IN8A 3COVA 3CWCA 1Z5VA 2C3YA 4G0QA 5EZSA 3N5KA 3PDIB 5FWYB 4MWTA 4RTPA 4CG2A 3QE0A 1T5SA 1YITV 4F8YA 3SJAA 4TQDA 1H8HD 4N7RA 1EWRA 1T2VA 2AN4A 1KVTA 4QAQA 4LFCO 1A1VA 1XEWX 2Y1KA 3HSSA 3IIJA 1EHIA 2PMBA 4H33A 5TMBA 1NRJB 3QM1A 3DXRB 2NO4A 3ZBQA 1H0SA 3R9XA 2P2GA 1SB8A 2XGGA 4LXTA 2C1EA 1S6YA 3PC8A 5LU8A 4DV1B 1SM4A 2JFHA 3LF2A 1NSYA 1VIBA 1C7EA 2I3DA 3T7AA 3RAEC 4EKDA 4F7WA 4LZAA 4CKWA 3AZQA 1E92A 1IXKA 5IXJA 4GC9A 3TI7A 3GT0A 1Y5RA 4FUQA 2NZUG 1BHAA 2Q6TA 1NYLA 1ID1A 4D4JA 3VKFA 4OGLA 4B6FA 2YFYA 2AD1A 3LTNC 2BFEA 3PIDA 4HN2A 5TQ2A 2MYUA 4J1TC 3FDZA 1GPBA 1RI3A 2WF5A 4IWXA 1JAZA 3AOEC 2BRUA 3T3GA 1J25A 1E2IA 3OE7G 3WAGA 3NAZA 3GP8A 2MT9A 4K9PA 4BX9A 2PV0A 1T1IA 3DXFA 2V6IA 3HB0A 4BBPA 4TYQA 2WBLC 4RZIA 1MQAA 5KVCA 4DLXA 4TUYB 3EX7C 5IDWA 1PR6A 3W5SA 1SGWA 4BNMA 4MR8A 4RV9A 1OYVA 4XM1A 5FWXA 1RLTA 3GEMA 3NORA 4NXMO 2XT9A 5AW4A 5BRNA 4KACA 3T1HO 2L35A 4BMCA 2WZDA 5G0WA 4L57A 4KREA 2ACWA 1AH2A 2R6GA 3G49A 4J0FA 4U2KA 4HT3B 1M1YA 4PS1A 4Q0MA 1ZI6A 1FUIA 4AURA 1VLLA 4QEDA 2GZMA 1F4NA 2C4HA 1SVUA 2WICA 5IJ0B 2B8EA 5F2KA 1UWCA 3ZN0A 4JF3A 1XUQA 3GJYA 4J0EA 1BW9B 3GA5A 4Y1FA 1TM1E 1RWOA 4RD6A 4PVCA 2LE0A 4P4LA 1EVIA 1YXBA 5JIBA 3NEYA 1U6KA 1GU0A 4N40A 1C8VB 1O95A 4Q93A 1U0GA 1YFZA 4Y98A 3O8CA 1VMKA 3NKLA 2ZREA 1PGPA 3C4JA 1B42A 1SKYE 3HFRA 2KHZA 5M3BA 4ZHSA 1E3SA 2NPFA 3TW0A 4Y30A 1XZPA 5AVZA 4D9MA 2EXXA 1I10A 2W9XA 2F9MA 1W0JA 2X2FA 4B09A 4G1EB 2VF7A 1YIOA 5AI9A 2CUNA 1O8BA 1B3QA 2P6JA 3CEAA 5DTRA 7GPBA 3S2YA 3AP3A 3DOUA 2D1TA 3TQFA 1PR5A 4NBSA 3R40A 3L0YA 4RQUA 2FPRA 3A0RA 5CHYA 1DIAA 1RMTA 2WDPA 3KZ1E 1N6RA 2P9HA 1OCZB 1ZRSA 1ZD3A 3EZLA 3J7AC 3VHRA 4GOOD 1TPYA 4KXQA 1VCOA 1MJGA 1NKSA 3AF0A 4OM7A 4NQRA 1F0KA 4V24A 5KTSA 2A3NA 2Y48A 5AUOB 1HWYA 2DQKA 3GLKA 4IG4A 1ZIYA 2AK3A 1NR7A 3ONFA 4CM5A 1G20E 5KJ6A 3QTBA 1N0HA 5KAPA 3O92A 3W3AA 1PJAA 4C78A 4EABA 4PG6A 2FSVA 4MLPA 3EXIB 3PYXA 3GC6A 5CH5A 3MUEA 2VSYA 3OIFA 2HEIA 3CT6A 4OFWA 2Q0XA 1PQWA 3ZGZA 2BCGY 4MEAA 1N7HA 3TLCA 5CBGA 3DAFA 2G0AA 5KU7A 4JMLA 4PCUA 5EIOA 2JS7A 1Z17A 2NU8A 1UPTA 2FFAA 1P4HA 4RV4A 4WT7A 3OQNA 2GPYA 3QFCA 5BQ5A 4A23A 3JV7A 2OBNA 1V7ZA 4TSKA 1HV8A 4BRSA 1E8NA 3FETA 4Q4HB 3M8KA 1K0FA 1M83A 3CW2A 3RB8A 3CKMA 2OXIA 4X91A 1YQGA 3OEEG 4AZSA 3N07A 3O3MB 3Q5GA 3O26A 2V6JA 3K8YA 3IEMA 1LQTA 1OXTA 4M7WA 1MOQA 2P69A 4TUYF 1P8JA 1VXRA 4G65A 4MUNA 2DECA 2E4AA 3HJGA 1VJCA 3DZIA 4Q34A 1KQSU 4ENQA 3N8KA 2N04A 5CCDA 2W2TA 1UBEA 4WEQA 3LWBA 5JJNB 3ZNOA 3AG4C 4X41A 1RYDA 1K9VF 4C2UA 4ROTA 2VK2A 4R3NA 4RTNA 4X66B 1OJHA 4LRTB 1B8UA 4R2WA 1R5BA 2DJ5A 4A2WA 3S2IA 4PQFA 3EC7A 3FGOA 4KQKA 5HIKA 3UTDA 3L2OB 1UODA 4TTTS 3U6BA 2A1TS 2IJIA 1WMEA 3OZWA 3WHKA 3D7LA 1MUUA 1RBZA 1H8HA 1E1DA 2AJBA 2A9VA 2QL7A 2QE7G 4WRRA 3BORA 1IAQA 4LVCA 3ZY2A 2XH8A 1W75A 1AI6A 3REOA 3ZWCA 5C32A 4CL2A 1T0BA 2POCA 2E6KA 3KT6A 3L6UA 2Y0IA 3ZN2A 3BVPA 1E9RA 4IZ6A 4EHIA 5DM4A 1A2BA 2CMFA 5IBRA 4YRMA 1Y1RA 3WGZA 1FXKC 4PCVA 1T36A 4G2NA 1H9CA 2J3MA 3O4FA 1LS1A 2H1RA 1I9GA 1T8PA 5C1DA 2HI0A 4QDTA 1SBCA 4HBGA 1YIDA 4UUJC 1SXHA 2XOXA 3D64A 3PK0A 3VH2A 3I64A 4IFTA 2E74B 6Q21A 1L7NA 3ILSA 1NT4A 1DIRA 1DF4A 2WPDG 2ABWA 4HFMA 1NVMB 5CX1A 1VDMA 4P4GA 4C6TB 1GTG1 3LMKA 4F86A 5DJ5A 1X0VA 1GARA 1JTVA 2ZJFA 4NMXB 5FADA 1JCHA 2J9RA 2P5OA 2X0LA 2W37A 1FTGA 1J1UA 4E1VA 1LPMA 1SUCA 4D9HA 4MVWA 1C8KA 3JD2A 4V1CB 1LSUA 1HNXB 4AJIA 1IPEA 1ZH2A 4ENTA 2YC0A 1JH8A 5DHSA 2HFEC 5K3DA 5B7PA 3H7IA 3GNQA 1WW3A 2G8LA 1QG2A 2ONYA 4XWYA 1CZUA 3FAVB 4UUQA 1C3LA 2WF7A 3K53A 2R3SA 4PZCA 1AV6A 1KMIY 1APBA 5CVVA 5TSDA 1JFTA 2GN2A 1DGQA 1TUEB 1LZKA 3H8WA 5LOVA 4DBLE 3STWA 1WSWA 2QBYB 1YZQA 2XRMA 2IXDA 2HDNB 1SZDA 1FRNA 5E6RB 4UFZA 1I5OA 1N2CE 3VQYA 2AZDA 2VF5X 3NC0C 4R7GA 1A2KC 4HNHA 2BSQA 2NACA 1RJWA 5BPFA 2CVQA 5EJ8A 3NH6A 3Q7IA 1S8FA 4N0EA 4LXIA 1PVOA 5JAHA 4R1PA 1Y6GA 4YJ3A 1U7UA 1D2CA 3L4EA 3UK1A 2H52A 2C77A 1RAAA 3ET4A 4O59O 1H2XA 1QYCA 1P17A 1BIFA 3RVBA 3M3HA 3ELBA 2GXAA 4C1BA 1MZFA 4AAYA 3ZGYA 3IQGX 1FE8A 1QRAA 1QJ4A 1LSOA 4BATA 2EATA 5BR8O 2WSSD 4PANA 2C1XA 4B6JA 2B78A 3ETDA 3SSNA 4OLAA 1UC8A 2AFHE 3A1VA 3WKEA 3NFRA 1QK5A 2JLVA 3RUAA 1QONA 2I03A 3OFSA 4G4JA 1VQKV 1FUKA 2YZ2A 4XOIA 4YN3A 5AKEA 2OAQ1 3PGXA 1S2OA 2ZBPA 3L0OA 1ETHA 3VU8A 3T61A 2RKWA 2E85A 3QYFA 3CGGA 3UJ7A 3DE3X 3PYLA 4ZRMA 2IYPA 2UU9O 4C3VA 2BV3A 2G06A 2XDWA 1TTTA 3RSOA 3IIMA 1QCZA 1H2LA 3CE6A 4Z5XA 3ZD6A 1IZYA 2BJVA 1RDFA 5J4YA 3RRFA 4O4IA 2REQA 1JB1A 3VNRA 4EX6A 4NMWA 1U9IC 2WT8A 3DS8A 3SG0A 1SXJD 3O65A 1WMSA 4TTIA 3J7TA 4W5HA 4QDXA 4CV0A 5L3QB 2FUEA 2WTBA 4MRMA 1ZNXA 4CNBA 2YZMA 4NVRA 2P77A 1EAYA 1PZMA 1FDIA 4D8TA 3U3ZA 3MB5A 1NU6A 1FMLA 1WU7A 5ALDA 4TYYA 1U9YA 3LT2A 1HFJA 5FOVA 1A4UA 1AQNA 1JVSA 3VSCA 4BN4A 1VPDA 2J67A 3F7OA 1JQLB 1SVNA 4Z1VA 1TU3A 3NUZA 4S0XA 2MIIA 3NPMA 4G1UC 4M89A 4EF6A 3OBIA 2N1BA 4INJA 5ICCA 4CEHA 2R5FA 1Y4MA 4GICA 2JIDA 3ZZTA 1VMGA 2C9ZA 2V9ZA 1J8DA 5FWAA 3PD7A 1L5FA 1W48A 4GLJA 3HPRA 1K6EA 1ZRNA 3ZBUA 1NU1H 5CFLA 3JAMN 1PT8A 4DV6O 3RVKA 3PTLA 2FPLA 4HXFB 3V3TA 1K8QA 1OGIA 1YS6A 1UZAA 1ZOIA 4G0XA 5ITVA 3QRWA 4DA6A 4IDPA 5AOVA 2PMCA 3W7TA 2VYVD 3WLPA 5CW1A 1EXDA 3SEAA 2G70A 1Z0IA 5AIBA 5MN4A 3TZ6A 1G9TA 4GRIA 3SJCC 3F7MA 1KJIA 3CZPA 5AKGA 1JFRA 2O54A 3P9SA 4FX5A 2I4MA 5CEJA 3Q8MA 5AHXA 4A03A 1SCJA 1AS0A 4OVKA 1W9MA 3ENVA 5JI3E 2C7VA 5K9ZA 2FPIB 2O7RA 2ISCA 3ACCA 5CCBA 4FLTA 2F43G 3WNQA 4JP5A 1TW3A 1F7YA 4CS3A 3HRHA 4LRXA 2GN9A 3QE4A 4C05A 1ZM4A 1I2MA 3REFA 3JD0A 3ROQA 1ZSVA 2C61A 1TVKA 3ZHXA 2REXB 5EP2A 3JWHA 3H1JH 4YCBA 3HPQA 4K8ZA 1EFCA 3UMRA 1Z74A 1B06A 1POXA 5KOJA 4JIMA 4Q4JB 4FOSA 2WSYB 1P45A 4Y0AA 2P6NA 3JALB 4OAQA 3MHTA 7YASA 4OV6B 1TUGA 4CIBA 2QD2A 3U3XA 4EGSA 2WLLB 1FSGA 2DKNA 4HP8A 3WMGA 4O4JF 2W11A 4CN8A 1TTQB 3UXMA 2OHVA 4NPAA 4ALLA 4KFCA 5DI3B 1C0KA 4WX2B 1EFVB 5H82A 3HR4A 3MERA 1PNMA 4X6XA 3VMFA 3CUTA 1WVMA 4I4LA 1QVWA 2BSKA 2FWPA 4TTJA 1JEAA 3FJOA 1U3VA 3D8BA 3F6CA 3IDQA 4M37A 2WJYA 3B9RA 1TOAA 3JAWB 4HI0E 2GA8A 3UGJA 1XLUA 2I8LA 4NKGB 4EBBA 3Q3HA 3V8QA 4ES6A 1FUYB 4UTPA 3NHSA 3PDUA 1Z73A 4KN5A 1P9NA 1UDBA 1P2TA 3W6UA 3PDJA 2BFOA 3Q88A 4B71A 1DCKA 3AVQA 3QE3A 3ELYA 1V39A 3VVMA 2OCPA 1KI6A 3ZYZA 3KXPA 3K0SA 1U96A 1SZTA 3SJ7A 2Z2JA 3H5RA 3ZLBA 3H9CA 2QZ4A 1KORA 2JFVA 4KR9A 3A3OA 1G38A 1TVMA 1F4VA 1DO8A 2VSQA 2QTVB 4BDSA 2EHJA 2FEAA 1YRAA 1WB4A 4OP1A 3ZD9A 1OLSB 1H85A 1QO0D 5J4VA 4GLBA 2WKSA 4E2XA 4PPNA 3A0UA 3DTYA 1SVSA 4MJXA 1QU2A 4KO2S 1RTTA 4GLFA 4GBMA 4PI2A 1FJ2A 4AY3A 2IGBA 4LNUB 2CHUA 3NRJA 3I01A 4X3PA 1AZWA 2C20A 3KYDA 4HVAA 3LCUA 2UVDA 4ZCTA 4HLDA 1UIRA 3OD5A 2HR3A 1I3NA 2CH7B 2H1WA 4H7JA 1EZVH 2OKCA 3RROA 5J1TB 1I6MA 1L3BA 3SLRA 3E48A 2WSSA 5EJGA 2YS7A 1L0LH 4ALJA 3VM6A 4FYKA 4NYMR 2IEYA 3NOQA 1JLHA 1TF5A 1WKBA 1BH2A 1BGWA 3OPYA 2ZT7A 4YIHA 2Y3IA 1G5IA 1Y8RA 3ZW9A 5BSTA 1MX3A 2AWNA 4PXSA 2JI4A 1FMTA 3NUGA 4K5QA 2CBXA 5DM6V 1ZK0A 2XBUA 1BMTA 4Y9UA 4JLPA 4DZZA 4B34A 3KEQA 3MRTA 1VBKA 4HZGA 4YNBA 3MZ0A 4JUCA 4FW8A 3RPEA 1UF9A 4R51A 1YA8A 2HMYB 4C6SA 1E2EA 1QGYA 4BVEA 3UHOA 1OWOA 1BD3A 3AG3B 3MD9A 1COWG 3GLVA 3MPUA 5LC1A 4TMVA 2WHPB 2VDUE 5EKUA 4BNVA 4HWRA 4YRBA 5BWLA 3K0KA 4X93A 2OHFA 2B1RA 1FVFA 3AMVA 4QRDA 4DR1B 3HNPA 1GKFA 4HDKA 5FA5A 2F8SA 4E6PA 5LGNA 4OA8A 2CB9A 4C4RA 1RLUA 1PWXA 2OUIA 4AJJA 2CXRA 4YLEA 3TLEA 5AM4A 1EFRD 3V4PB 3ISTA 3ZY5A 4AKSA 3U26A 3V8BA 5DCYA 2F64A 2WG0A 1LCIA 9LDBA 4TN1A 3IPXA 1ZFNA 4MVQA 3X2EA 1X7GA 3NBYC 3G0HA 2GD6A 4AZ0B 1T9CA 3P94A 4TTVA 1DK1A 4HY3A 4CODB 5ALTA 2P5TB 3VR3D 3WL3A 1UBTS 2P1RA 4JN6B 1UFIA 3FUCA 3QU4A 4W5WA 4A0SA 2O9JA 4DWVA 4KC0A 5CLLA 3A1SA 2QD5A 1XRRA 5J2UB 2GNOA 2VYVA 3RT9A 4JYYA 1VL6A 5EKDA 1JOYA 1R6VA 4HOYA 3LU1A 4E30A 2BBSA 3PZRA 4RY9A 4EIWA 3GEBA 2OCIA 3AV3A 4MVXA 4MRPA 4MRSA 3IDOA 4UU0A 3THRA 2QAIA 1RAIA 4LJ6A 2JCBA 5JXJA 2W4QA 3CIFA 3BE5A 1TNDA 4LY6A 4C43A 4QPJA 5DMHA 3CCQV 1UMKA 2GO7A 3S28A 5HXAA 4KMMA 5A0VA 3QA9A 2AA3A 1KAHA 1NUSA 3IPLA 3OX1A 2BEUA 4WY5A 3T3IA 4CMGA 1TJNA 1RPNA 3WK7A 2D4AA 3H5TA 1L5OA 3ANXA 3TZLA 2ATXA 1LK5A 2YFHA 2H0AA 3KUXA 4JVMA 3LIPA 4ZWNA 1Z2GA 1KHHA 5L3SA 2PKQO 2NX2A 1U98A 4JI8O 5EE5B 4D44A 3CKKA 1XEXB 2RK3A 3K9BA 2J30A 2WF9A 5D3KA 1N2BA 4KK3A 3D3KA 1G8YA 1CK4A 4FC7A 3UHJA 4G5SA 1LTHR 4LZZA 4B3DA 3B77A 1II8B 1RPRA 2WY2D 4QRHA 2X19A 3V00A 3PV0A 5EKTA 3KELA 4Q21A 2UXXA 1I30A 4U39A 4YV7A 3CTPA 4DQVA 1DAPA 1K6MA 1Z37A 2QGFA 1V11B 4KRGA 5EE0A 4NBKA 5AI0A 3K8ZA 1DRKA 3ID6C 3MT0A 4HX5A 4JQYA 2PVPA 3NONA 1XD8A 3L9WA 4OKIA 4DGQA 3NYRA 4ZANA 1CDOA 3KB6A 2C97A 3OE7D 2AF3C 3TRJA 4L8FA 2QTFA 3SXJA 4QTZA 1GVNB 1C81A 2A0UA 3NJ8A 1CEQA 3ADBA 4KO4S 3P97A 4R2MA 4PYRA 1ORHA 3A70A 3AVWA 4P08A 4E2YA 3HVJA 1NNEA 4E2WA 5IXYA 1XEAA 1A5BB 3TQCA 3BT7A 4ZEWA 2C0CA 5FPOA 3DBOB 3L7OA 4QWMA 2C2WA 4NARA 4JUIA 1SIWA 3IELA 2RH5A 4RAIA 2H51A 1ZHHA 3LVRE 3OTFA 2HBRA 1G98A 3QLUA 5LIRA 3ZDXB 4RGYA 5FBZA 2QGZA 3AFGA 3ETQA 2VDMB 3OC6A 2XAAA 1N6HA 5JNVA 1QSGA 3M1YA 2MMCA 3RBVA 2OHGA 4GZMA 4KNWA 1E64A 1P6QA 5LB2A 3TQTA 1I3KA 4U6NA 1CUUA 1E2DA 5FKJA 5KNLA 5JJBA 4MQ4A 4QEKA 4JLUA 2JK5C 1UBFA 3UANA 1D1QA 4AYXA 4IEIA 2ZSUA 2FMXA 2NQ2C 1XZQA 2B5UA 3O73A 4X92A 3DVSX 5K09A 3QENA 1RADA 1UWLA 5J2UF 3L72H 2PXCA 5A1JA 2HK9A 2BGMA 2DULA 5D3MA 1U8ZA 1VE9A 4YJ2A 4JP3A 4J29A 4KXMA 1LLCA 2ID7A 3SBXA 4UHFA 5EN4A 3ABMB 4BL5A 1A8SA 3LPCA 5EC2C 1ACLA 1KI2A 1HYEA 4XXHA 3NGXA 3NI2A 4F3CA 1XZMA 1NVEA 4A8JA 2JIMA 4BQSA 3HYSA 1OX4A 4BAUA 1G3IA 1CJBA 3VDMA 1Z0FA 4G0NA 4WFJA 4ZO7A 2Z2ZA 3Q8KA 4RDIA 4RL6A 1DKPA 3F3MA 2F66C 2P0AA 2ID8A 4IIDA 2LRHA 4C0KA 3OPYI 4NX2A 5HKLA 2ZUUA 2FZ4A 1KOGA 2CMDA 4WTOA 3R9KA 1YI0A 3ZWPA 1VJDA 3WAJA 1X87A 2O8CA 2PRKA 2PKRA 3ZQ6A 1W87A 3C2QA 4UNNA 5DZSA 3GHYA 1SXIA 1AKTA 2W4IA 2DTXA 3EDQA 1H2HA 3JVEA 3JQCA 4EF5A 4M8SA 5C9ZA 1E20A 4UD2A 5NLLA 3TQRA 3HTXA 1E2UA 5I4IA 2RH4A 1URPA 2R8RA 4IUCS 4MX8A 2W7TA 4GX0A 5IS2A 2PRSA 3UMFA 1E0DA 5LZ4A 2VK4A 4KAXA 4KPUA 4ZZ3A 4OMUA 1OY1A 4RZ2A 4NZ9A 2KB1A 2O0JA 1IZ8A 3G2QA 3PNVA 1EFRA 1YDGA 3ZU5A 2GHYA 3BA1A 3O4VA 3CMMA 9ABPA 5AK4A 3QYAA 2AZ2A 1LTQA 2QD1A 4NONA 2JGAA 5FI0B 1LUAA 1V35A 4LQDA 4IZOA 1WUHS 3V1YA 3WBBA 3NIGB 4TV8B 5JSZB 4EUKA 4RAOA 1JH9A 3B9QA 3UMSA 1T13A 2VSFA 3OEED 1RR6A 4QX6A 3N28A 3APOA 3CJHA 4GP9A 4RKRA 3IKLA 1GH6A 5HQJA 3HY6A 3ND9A 4MB0A 4HWOA 2HL6A 2Q3LA 1ICEA 4J2TA 1J00A 4Y6PA 2PT9A 4U3FH 1CIPA 1CUHA 3CX3A 3D36C 2YKGA 4LJAA 1EN6A 1V6AA 5DU2A 4WAUA 1FYJA 2F3PA 5FORA 1W36B 3GPDG 2CFSA 5L95A 2FR0A 2XWBF 3NTQA 1DQRA 3DGEC 4TN5A 3C41J 1M1NA 2JKVA 4OXKA 4BB5A 1A0OA 3VC2A 1TYZA 4ARZB 4YV0A 3SQOA 5DM2A 5THKA 2PF4E 3TJTA 1JFFA 3CCBA 3TXQA 3WIDA 3TZQA 4LYAA 2WFMA 3QPAA 2WFLB 2QUJA 3RIMA 1I3MA 4L9SA 2LXNA 5E1AC 2W0SA 2QE7D 2PJUA 3WBKA 3ZGLA 4N7BA 5H8WA 3TNJA 5CBHA 1YR6A 3ZLTA 1YIJV 1OZHA 2LGQA 4L9AA 5BUCA 1I2DA 4B7CA 2ECOA 5LPNA 4PRZA 1P81A 3B3JA 4AI8A 3X2QC 4C22A 1D2DA 4FN5A 1ZJ4A 1GNRA 4K8OA 4E94A 4EBFA 3AG1B 2UZAA 2LR0A 2VEOA 4MRRA 2DM6A 5CLHA 4S2UA 3IAS6 1Z6AA 2C00A 2WPDD 3MSCA 3DJYA 1G4HA 1WTCA 1QH8B 2ICAA 1FP7A 4LF6O 1Y76B 5AUNB 2IBSA 2VTBA 1GITA 4JYMA 2M6RA 4WOPA 2JFPA 2ZGVA 4EVIA 2IS2A 3E9QA 1LBTA 2WKWA 3L1IA 4YCNA 1QG6A 3HA3A 2X3YA 2VSOA 3DTTA 4LF9O 2WLSA 4DNFA 1XQ1A 2A35A 3OT1A 4QHSA 5B58C 3WTCA 2EX4A 3OE7A 1L4UA 3P52A 4FYJA 4XX1A 3WJ7A 3D6FA 5K8LA 4BN5A 2I4TA 4O4LA 5M7EA 2OMEA 4HJXA 2C59A 2ZSHA 3OQ1A 3RFRA 5AUPB 3C85A 3KTAA 1QLWA 5I9BA 1BO6A 4UCXA 1PWYE 2QV0A 1GQOA 3B3QA 1V1MA 3L93A 1CIJA 1BDHA 1R4ZA 5IN5A 4NI5A 3NIFB 5I3CA 2P2YA 4AN1A 4BVFA 4NPHA 4H1HA 5IY5B 4PO9A 4DDWA 5DLPA 3OT5A 4U2BA 4BFUA 5TQ0B 3VR0A 1Y6JA 2WZCA 4P5DA 1CQIB 1L3IA 3VPBA 4WUVA 2HP8A 1REQA 4QFDA 4F4HA 2ZU0C 2NADA 4CI0B 4TV8F 4F4DA 1LNZA 4GOND 1SB9A 4HGPA 4O29A 4FUTA 1T2NA 1GZSA 3EZ9A 3NYQA 1CU1A 1S2LA 2AOTB 3SYOA 4PDMA 2D2CB 1N1EA 2R79A 5BV8A 2JIZG 4MVJF 4R1UA 3D0RA 4K9DA 3ZEIA 4FDVA 4CMHA 1UDCA 4QOIA 3FTDA 3TDKA 5IWCA 1LBQA 5CVTA 3T1CA 1U6JA 3ZCQA 5E3JA 4LWSA 2VP0A 1VL8A 2A94A 5E7QA 1VQMV 2DOKA 1QFZA 3HDYA 2B1QA 3EC1A 2CB0A 2CDAA 4GHWA 3N74A 5FYQA 2IHUA 1JYFA 3DCYA 3LUJA 3G6KA 2KE5A 4A9AA 3Q3JB 4OLBA 4GPTA 2FR8C 4S0ZA 5FTWA 1J49A 2BPOA 1NBAA 2PKWA 2ZYUX 4E3WA 3HWX1 4DB2A 1YNOA 1D3AA 3KKQA 5JPDA 2Q7DA 3BKWA 4ZVNA 4U2GA 3CZRA 1ZH0A 1KFKB 2GEUA 4QVGA 1AR5A 3WLKX 3BD9A 1Q2UA 1YCGA 5CH3A 1Z68A 3LC7O 2Y1DA 3MWJA 3L7NA 1YD7A 3N8HA 4D8XA 2JFWA 1JXAA 1GNVA 3EPRA 4WN9A 2ZYDA 3CRCA 4KGVA 1W85B 1ORWA 2ZCVA 4ZCLA 3SYAA 2CBZA 4F4UA 4JENA 4F1KA 4CV1A 2UUCO 4MV1A 4JBYA 3UZUA 4RL4A 3KHKA 5ALYA 1I3CA 3MCAA 1ENPA 1C2YA 3OP1A 1JMKC 5J5VA 4JX8A 1SQXH 3H1PA 1R4MB 3P71T 5FBVB 1QCDA 2W90A 1T2AA 2JA2A 3E3OA 4FOOA 3CNHA 2HCRA 1T1SA 4P3OA 1IN7A 5K3FB 3VAAA 2PJDA 5E1OA 4YV2A 3UGTA 2AGAA 1V48A 4QASA 3OEEA 3FGNA 3P2MA 3LUCA 1W8DA 2IVFA 4B7EA 2FLVA 5ALJA 1CS0A 5C93A 3ZN1A 3IP3A 4KE6A 1WB5A 2IHBA 3A6DA 1U2EA 4AULA 1OH5A 3A4MA 4NOLA 1J39A 4IRXA 1GZ5A 1SRRA 4KTTE 1XEWY 3NS7A 1V3VA 3VGJA 3IIKA 3RTEA 3TH5A 3E4CA 1OH8A 3NIWA 3HH8A 4RWEA 4JP2A 3U4AA 1RSOA 1BA3A 1IHOA 3KR9A 2FZCA 5A0FA 2H57A 1VMDA 3V4OA 3FZNA 2FAXA 2BC9A 4IHJF 1ZPDA 1BWPA 2I7CA 3CG0A 2BFAA 4TS1A 3N70A 4RD1A 1R0RE 5K1XA 1NF9A 1F6WA 3DBRB 3ELWA 4ZCSA 3BMNA 5F9FA 2QE7A 4LHWA 3GLGB 4BJ5A 1MG1A 4R9SA 4QE3A 1VM6A 3QBDA 1M10A 3CLRD 4H7FA 1OZAA 3C39A 3QPUA 4EJ2A 3IQIX 3RU9A 2JGEA 3F5FA 1MABA 1X13A 2CDNA 2I6XA 1UJCA 1VB5A 1XTPA 2XCTB 2RAFA 4R1QA 1T4CA 1QO7A 3MELA 4HO1X 4AL4A 4EJSC 3ZRWA 4WY2A 1M0WA 2Y6VA 1FW8A 2ZDQA 5IJZA 2WPDA 3GJQA 1KRXA 4WK4B 1A88A 4RJKA 4Q9NA 4O2LA 4WFEA 2P9YA 4QQRA 4BMYA 2HHCA 2QDXA 4URYR 1XFDA 4HDQB 3A1NA 5J23A 1P5HA 4DCJA 4YMSA 4QE9A 4XKJA 3TIVA 2ZTUA 5T5QA 4TXLA 3UGQA 3GD7A 4B3CA 5F77A 1VRCA 4NXNB 5K6AC 3EEYA 3CWQA 4AY6A 1Z2CA 4B79A 4RIFA 4ZK2A 4EARA 2VDWB 5JMPA 3WIBA 1AT1A 3B53X 1MZPA 2XAGA 2Y69B 1ES9A 2IUSA 1C4WA 2ZZNA 4Q7EA 2WHRA 3V2UA 4YIKA 3F46A 5JASA 1E79G 2XBLA 3G9QA 3FR8A 3KVRA 5E38A 3MJDA 1SPBS 1V3TA 2D2EA 3FPCA 1EX1A 5C3MA 4ZVUA 5A6VA 2BKVA 3Q0EA 1JBEA 1GN6A 1HE2A 4UBOA 1EA5A 2PUSA 1T3LA 2XWPA 4EHAA 5EQTA 4O2BB 1AMNA 1U0JA 2IYYA 1YRHA 1FU8A 2HK6A 1XZNA 3A4TA 1DC7A 1YU9A 2HQBA 1ATIA 2C7OA 2CY0A 3ITDA 3KCNA 4B3FX 4ML3A 2J09A 4BVAA 3BF7A 3NM4A 1V37A 1I4EB 4QYWA 2CV2A 1CD5A 5L4SA 3L7KA 3K9SA 2WA2A 4GGPA 2OD7A 4FMDB 4F1WA 3PLNA 1YFLA 1BXRA 3RC8A 3QXGA 2P27A 1FPMA 1XPRA 2YI9A 3H2YA 1DAMA 1YOVA 3I45A 4MV6A 3KL4A 2M9MA 2AMLA 2QRLA 1EVYA 1O6BA 4ER5A 1KEEB 4FFBB 2FX5A 3I1FA 1M6YA 3K9HA 3D7SA 2PGDA 5EFOA 4A8HA 4QUAA 1KYYA 5J9PC 4JWTA 4X24A 2OK7A 2BGTA 1K68A 4J1QA 3WGHA 5DHUA 4LF7B 1KIAA 1D2RA 2IHYA 3GB7C 1NW7A 1ZJWA 2BUBA 1JG3A 4C6RA 3E4DA 4M0MA 1KO5A 2WM9B 2H8PC 2IZ5A 2VQFO 5IT9A 2FG7C 3HVHA 2E4XA 3BKXA 2Q4OA 2XOKG 3TG8A 2Q4TA 3IC5A 3T9EA 2YVUA 3ORRA 1E3QA 1PLKA 1PWZA 3CLTD 3GUVA 2Y1FA 2PS3A 3U3JA 3I04M 4UNRA 3D2AA 3NASA 3KSZO 4XIFA 4ZAGA 1J5EB 4K9MA 2VATA 1QF7A 5IJWA 3NGMA 2H59A 1PT7A 3R9XB 3AJRA 3D0QA 3OUSA 1HX7A 4RO2A 3D6NB 1EPUA 2HF8A 2Y27A 3R0XA 4C7BA 3AW9A 1G19A 2GAOA 3SNKA 1RJ9A 2HMSA 2FG5A 4RULA 1DHRA 5J58A 1L1EA 1AX9A 4CKWB 3IFSA 4R1MA 2VPTA 3BDIA 3LBHA 3OCJA 1I2AA 4F5ZA 2M7WA 4LQCA 4R1OA 3ORHA 5EIXA 1XREA 5HQTA 4QJ4A 3RJTA 3C90A 1AJQA 4OX9O 2KYRA 3WMXA 3TSOA 4IDDA 4GPAA 4J9ZB 4YR7A 1Z45A 2BFEB 4Q7LA 4I0XA 5DMXA 5TQ2B 4UZEA 1W19A 4UOQA 4OY3A 3VC1A 3FDZB 1COWD 5GMOA 5G4KA 5JD4A 3A2MA 1JHQA 2W5UA 5HKKD 3J80N 4DV5B 2ILVA 2OFPA 5ARDA 4CU2A 1WX1A 1I7LA 2DH6A 4G5RA 3C70A 3PXGA 4BW9A 5B7QA 5LZ8A 2B8TA 3SIWA 1L4BA 3ZQ4A 1SU4A 4PIPA 4BLRA 1U1EA 2WWHA 3QW2A 1BNCA 2O5CA 4MR8B 5FF9A 1SHTX 1YS2X 3UC9A 2PUCA 1T9GS 2YY7A 3VV3A 1G60A 1W2GA 1GQ2A 3U0BA 2C8KA 1MFZA 1VP9A 4HGZA 3KKLA 3R3WA 4OATA 2AZ0A 3WV5A 4MULA 5DCWA 1R9JA 1A9TA 3GVXA 1P2UA 1M1YB 4KI7A 3B1WA 4BO3A 3AI7A 5C1IA 2WDZA 2QM0A 3GCXA 1NM5A 2RHHA 3GRFA 1MX5A 4PZ0A 1H0KA 4O2BF 3OLQA 4NK4A 1SKVA 4G5FA 2X40A 2JJ1D 4JTDB 3WP1B 3AFNA 2R4TA 1U0FA 1UBKS 5NULA 4CQLA 3COPA 5AXBA 3QPCA 3KO8A 4TXMA 5JDIC 4MRAA 4TZ6A 1J33A 4FMDF 3KKKA 1OBHA 1JTFA 1GPJA 1M54A 1NQUA 1BRTA 1GDDA 4ER0A 3IUQA 1QX3A 2Q0QA 2O52A 5IYDO 1P60A 3IQHX 3R3HA 3F8WA 2PZKA 2Z04A 3MUOA 2X8AA 3LLUA 1PI3A 4CZZA 1TCBA 2F43A 4PSUA 5C7OO 1NXQA 2ISSD 1W4RA 3HR8A 2X0DA 2DHEA 1B41A 1ZOPA 4GZ3A 2DFTA 1GPKA 3A0RB 3QQPA 4FB4A 4CKCA 1S3JA 3HMKA 2EQAA 3OZRA 5IM4A 2I0FA 3ITKA 4ESOA 5G0SA 4YPVA 1FS5A 4HDMA 1DIBA 2P3SA 3I6BA 2DT5A 4DBVO 3VQWA 4KVFA 1E7QA 3LV8A 2OXEA 1GPLA 5HGJA 2W8ZA 4ZOBA 1FS0G 2QY9A 1BL8A 2WHXA 3C5HA 2QX9A 3IKTA 1P2BA 2B7LA 1AI7A 1H1DA 3K3WA 3NWEA 2G9NA 4DEVA 2W6ZA 2WUGA 3NWOA 1L5MA 1L7VC 5LXTA 4UPEA 4WCFA 1VF6A 1W30A 2D1RA 3DVQX 1T8YA 3D3QA 3U3MA 4PLCA 3SMQA 1K7FB 3ZXUB 3HXKA 1ZU5A 1V7QA 2IQ5A 4EG3A 3AG6A 1R64A 3UV3A 3VBEA 3AETA 2RJNA 2NU8B 4WHMA 3ZVNA 4ITUA 1NQOA 8LDHA 4K9RA 4FVTA 5A04A 3O8QA 1L5VA 2HSGA 4EY7A 2LTAA 1HKHA 3RTGA 4G4GA 1S8NA 4B3MO 3K4QA 1P7BA 4EI9A 2VR1A 5JRJA 3ICVA 3GRKA 3KJQA 3FPHA 2AUNA 2B9VA 1TVCA 1LX6A 1FNDA 2IYOA 4IYHA 4R83A 1PBTA 2P6MA 3H97A 4ZALA 1H2YA 1M2JA 2JW5A 3MFYA 4NCBA 3AK4A 1K7DA 1FXUA 1YB2A 3MTGA 5JSKA 3LSSA 4M0DA 1EXWA 4GECA 3TTTA 1ZNZA 2D5AA 1KR2A 1R6KA 1WB9A 2H5EA 4MDHA 3WP0A 2IEBA 1KJ8A 5D3ZA 2XRFA 1GUYA 2XRYA 2DU8A 2PUFA 2VHVA 3QUTA 1U3WA 3AONB 1ZM2A 2Z2XA 1PFQA 3M6AA 3SPCA 3MWKA 2O4CA 5ALUA 5BNWA 3QMWA 4EFBA 4C08A 2O2YA 2WWYA 4LDAA 4J7JA 4PHCA 1I1HA 2RN9A 3UVEA 4BIZA 2QRPA 1EA7A 2C8VA 3SICE 3PHIA 2EZUA 3HSKA 1EN5A 1U2TA 4MT8A 3UMCA 3KSAC 4JA0A 1TJ3A 3KQMA 2P2ZA 3HU1A 4FU0A 4Q7JB 5BNFA 3O4HA 4KIFA 4N47A 2A30A 4HXEB 2C0PA 1UK8A 4ND5A 2ONZA 1T36B 1Y82A 3KLBA 3QX3A 1Y66A 4L28A 3DOHA 2Q7EA 2W6CX 3RRMA 2EWMA 3H42B 4N0MA 1J4AA 4PLYA 4EZIA 4YV1A 5F3DA 2C2YA 4GMGA 1HOTA 2TECE 1QYWA 1RXVA 1SD2A 3ZQKA 2VRZA 5CX1B 3OY2A 2I2AA 4YAUA 2WM2A 5HA5A 4Z9FA 2AMFA 4QKQA 2I3GA 4WVFA 5BO5A 2AZ4A 2PMFA 3LA6A 4KR7A 3WHLA 2ZSKA 3FYEB 4PRYA 1J8VA 1COWA 2OILA 4MZDA 1Q1EA 3N6VA 1YJWV 5HKKA 4PV1B 3KVOA 1LX7A 4OGKA 4Z4IA 3OZXA 1F1BA 1MA3A 2JRCA 4ZQIA 2ODQA 3WJ1A 4LJ5A 4PZAA 4RMGA 4RPGA 1N1GA 2YJTD 2DFLA 5KSPA 2P7HA 3UYKA 1WY5A 1YUNA 1SUIA 3GBSA 1E1QG 5KUKA 3TYXA 8MHTA 3K08A 2JFQA 2WM8A 4W7IA 1K98A 2X9QA 6NULA 4B84A 5GOZA 2AKEA 5LOVB 1P4RA 4L75A 2FVXA 4HB2A 4URXR 1LI5A 3ZY4A 2PRIA 3K7EA 1TEVA 2F8TA 4B45A 1FUUA 5C37A 2J31A 3L4JA 2WLJA 1K5GA 4TGLA 2VT7A 3G2MA 2CNLA 4Q7MB 1XKXA 4RJLA 1K7CA 2HCTA 2JJ1A 1OAOA 3LC1O 3VU3A 2Z56A 2FX3A 5GADl 5AQEA 4KGXA 2ZM5A 1JLKA 5ALEA 1IL0A 5JJKA 2C29D 1TJ5A 4Q3NA 3SOPA 4D7AA 5LQSA 2QVXX 3QPDA 3MB8A 1UWVA 4FBGA 1ZH6A 4E5YA 4YJ3B 1O5OA 1CY1A 1LJUA 5I01A 4YMTA 3PFFA 5LDHA 3NEPX 3H8SA 4MITA 1T34A 4BFXA 4RUKA 1NNUA 2X77A 5H7XA 1VQ5V 4RVOA 2G9RA 1EFPA 2PCLA 4RHTA 1GP2A 2XPCA 4RIGA 3ME5A 4H7IA 3R09A 4Y2PA 1QX4A 3CZ5A 4D9IA 3ANYB 2Q28A 2ZSFA 3Q1LA 4JDUA 1HDGO 2FNAA 4QT0A 2JI8A 1MA0A 4KMOA 1KR5A 1HL7A 1IU9A 4BX2A 1NVAA 4M8NE 5SV2A 3KOMA 1F2TA 1FA9A 3DM5A 5B36A 2O20A 4CIYA 4FDMA 2C1ZA 1JDNA 3UC5A 1BAPA 3MYRA 1YE5A 1VYUA 1Z5WA 4QSMA 2PX0A 1D2HA 2UUBB 3WGYA 2RG1A 4B4WA 4XSGA 2QQ0A 1FXWA 2H92A 1WP4A 1BU5A 4QJBA 1P1CA 4O4IB 2REQB 4D2IA 4U7FA 4EHBA 2GN6A 2YV3A 1Q6HA 1FP6A 4CEJA 2XI4A 1YC5A 3UH1A 4D45A 5CXUA 4EOGA 1KZ1A 1YK1A 2V8OA 3AUJB 3HMQA 4MRMB 4L22A 1BMDA 2J8ZA 3OCYA 2YOFA 1IZZA 1Z29A 3RWOA 2Z5GA 4BO6A 2QXTA 3BBLA 3ZS8A 3W2GA 4Q3DA 1TYCA 1YKSA 5EYPA 5LHGA 3RASA 4YUVA 1SCNE 1NNSA 1PYGA 1TPZA 4M9QA 2O59A 2JZOA 1ECFA 1DX9A 1H2KA 3CCLV 1ECGA 3MGCA 1FSPA 1BQ0A 4BMNA 3T15A 5HYVA 1HA3A 3F6YA 2QP3A 3ZUGA 3M2PA 4MRVA 4P32A 3DUFA 3JQBA 4LK2A 3PUVA 1ZSYA 4HEA6 5CGQB 5K8UA 3TM5A 4CEHB 3U3KA 4EB8A 1PNRA 2VQ3A 1J1IA 4S12A 1QTIA 3AI1A 3O9OA 1P19A 3BHIA 3WRWA 2CFRA 1N8NA 3SS9X 3DOJA 3VNQA 2EJWA 1IHYA 4UBNA 1EKXA 4ZQGA 5IEJA 2V3VA 4EWLA 3UJNA 4I4NA 1OXBB 3A3NA 3RUHA 5LOVF 1KEKA 3FB6C 2AYZA 2VN8A 5CDUA 1YJBA 2ZRAA 5I4KA 3GMDA 4OGFA 1MDBA 2GTAA 1J97A 1I4LD 4ARIA 3OLXA 4HKTA 1CB7A 4NCXA 1NBME 2ZCJA 4UM9D 3H2KA 4B8ZA 1SEPA 4YRSA 4BIUA 1XCLA 1MHPA 1T4GA 3WZLA 1RWBA 3CWBH 2LGWA 1K3UB 3CVOA 4FCCA 4D6XA 5JS6A 4L0CA 3A1CA 4TKVA 2OLKA 3SS8A 2XMRA 1FNNA 2GFHA 2NV0A 2QDKA 1KC8W 1EM8A 3NKVA 2O2DA 2PZBA 3N2IA 3R7SA 2H18A 4GQAA 2O50A 5JHHB 4W4LA 1TVKB 4CUZA 1U2GA 4ZT4A 5CPFA 1L4KA 4EENA 3VPSA 3E83A 4OHBA 1H6BA 5F12A 3AC0A 5KOJB 1O4VA 5IT5A 1XWIA 1CF9A 2PT5A 5GONA 4RJTA 2YQ4A 3LQRA 4J6EA 1E2HA 5AFSA 5FOUA 1EFDN 2OV2A 3Q3CA 4GDFA 2FW9A 1A32A 4YAFA 1ND5A 3H5OA 1D5AA 4BNZA 1CNFA 1MVLA 7MDHA 3KJGA 3A9VA 1JKIA 3JWIA 4FNOA 2YBEA 3HN6A 2WLKA 2R1VA 2BSKB 4PO8A 4AKIA 4YRCA 3RRNA 1FXHA 3E61A 4PQGA 3WB1A 4EI8A 1CJSA 1NC1A 2FKXA 2NXEA 3OM1A 4O4IF 1II0A 3BRQA 1XB2A 4FNGA 1IRIA 2BH9A 2IF2A 3DHWC 1ZU4A 2SKDA 1T3SA 5ES3A 1TJYA 1UBHS 2HNKA 2RK4A 3FHTA 3G59A 1JECA 4ZEOA 3GLFE 2WLNA 1XJ0A 2ZWPA 2VSNA 3ADOA 4DV3B 4GBED 1SXJA 1XA4A 1XZJA 2O3UA 1KI6B 2NT3A 2EIKC 1LSSA 2P3QA 4HEA1 2ZRIA 5KQPA 5C8ZA 4RJIA 3CRQA 3UAVA 4ICIA 2WJPA 3DDNA 2BM1A 4OPAA 4HQ6A 4KXLA 2PZFA 3KUDA 3P1JA 3NHMA 3OIUA 3FGZA 1YHZA 4R71A 5ECYA 4BQPA 1T8UA 4LMRA 1GRCA 4ENWA 5FLXN 1HLGA 2QSYA 4KIJA 1J9ZA 3WO0A 1MG0A 4WXYB 4N0QA 1X94A 3ZTTA 5B53A 4N21A 3KYDB 1D6MA 4EFNA 3BTUA 4KV7A 2GAAA 2IY8A 4ALMA 1W59A 4MVSA 2I6SA 3IVRA 1NTMH 3ZGVA 1ZVKA 3IEKA 1NI5A 4X65O 2CYAA 1E69A 2YVKA 5I7HA 3GEHA 1A27A 1Y5MA 1GAJA