2WAMA

Crystal structure of mycobacterium tuberculosis unknown function protein rv2714
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
294
Chain Sequence
AREYEPGQPGMYELEFPAPQLSSSDGRGPVLVHALEGFSDAGHAIRLAAAHLKAALDTELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRDSIGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPITMTAHSNNRELISDFQPSISEIQVPGSASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLGAEFERFLAQQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium Tuberculosis Rv2714, a Representative of a Duplicated Gene Family in Actinobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN
total genus 97
structure length 294
sequence length 307
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2wamA02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wamA01
3BY6A 4G4SP 2WAMA 3WZ2A 3W7XA 3W7WA 1NH2B 1YTFB 5CA3A 3W7SA 3E35A 3D3IA 4HAMA 1RM1C 3MNFA 3W7UA 3W7TA 5GW7A 1S3JA 3IC7A 1NVPB 2P90A 2HR3A 3VR0A 3GAAA
chains in the Genus database with same CATH superfamily
2YYSA 2AZXA 2AJBA 3I0ZA 4RSGA 2IZOA 5B7QA 4LS3A 5D84A 2KQUA 4K2HA 4L6IA 2QM0A 2Y4UA 2C4UA 3PXXA 4HX2A 3RVDA 1OW3B 2FWBA 2W0XA 1MOPA 5SZHB 3NH6A 1G2QA 3L8FA 3EXAA 2ZR3A 4Z3DA 3TVYA 1VJ0A 3ZYZA 3OUSA 2L19A 1Q0PA 2IU0A 2IH1C 2DOKA 2AW5A 2GCNA 2NVWA 2E55A 3KB2A 3L7LA 4L9SA 4U5XA 2O2ZA 4AJHA 1HOXA 1XPJA 1PPJH 1JG1A 3A0HZ 1P77A 2IBMA 3DNPA 3ETLA 3K31A 2F8TA 1GDDA 1TM3E 4K8XA 3IT1A 4XPZA 5AMXA 4GDFA 1YSCA 3COPA 2CHVA 3GROA 4RTLA 4HNUA 1HDEA 1UPFA 5CHEA 1MJGM 4MQ6A 3AESA 3CG0A 3M81A 5F9FA 4ATNA 4HR7A 4A73A 1A7AA 1QH0A 3K4PA 3VJMA 3UEOA 1F2TB 3IAS6 2IHBA 2NZ2A 3P0JA 4ARAA 2ADOA 3QO8A 2D7CA 2I1QA 5H6QA 1VKNA 2AOTB 2BFMA 2ERYA 5I7VA 5JIBA 2J7KA 1E64A 4LDPA 1NX9A 4P4LA 4EPXA 4NFHA 1PCXA 3R3ZA 2NVBA 3NHYA 2UUPA 1ZEJA 2EHDA 1L8OA 2CV0A 2QBYA 2P1DA 4RADA 3Q0TA 4JC8A 3ZV5A 4M0UA 2XMCA 1MENA 2Y1EA 3ZKWB 1NTZH 4BNFA 3K0HA 5JY1A 4OBEA 4JWTA 1FXWA 3IIIA 5FAKA 5JJCA 2HU5A 4IO1A 1K7SN 2YIDA 3NT2A 4CUKA 3KVRA 2YH2A 1ULBA 1CR1A 2ZXFA 1ADJA 3VAAA 2BFDB 5CYPA 9ATCA 4CEJB 4MITA 5A05A 4XGNA 5ALQA 4IWYA 1N6RA 3PJEA 1J0BA 5AJXA 1E9RA 4CM8B 5TS3A 2QLLA 3B09A 1CUGA 3EULA 1H8ED 4DMFA 4F4HA 1BKYA 2GI4A 2ID9A 2W2PA 1C8KA 5EUBA 3GLGB 3T4DA 2O8FA 4B4VA 3L6OO 2YN2A 3L43A 2EERA 4OO3A 3DZIA 1H9CA 3ELWA 5A1TA 1X8XA 3T06B 4EHKA 1M9NA 2PL3A 3RVRA 1VLMA 4DR7B 2I71A 1KEZA 4ZALA 2ETXA 3GOHA 1U90A 1EFVA 3E3NA 1WU8A 1IDSA 2ODQA 2I6XA 1T24A 2V7VA 3GUCA 3O74A 1YTLA 1E4EB 1IZ8A 2W6OA 1P7WA 2ZRFA 4UAUA 3HKEB 3PEVA 4B5LA 4MS2A 2DWUA 2G80A 1A5BB 4OHUA 4A27A 4BLQA 2JS3A 1H6DA 1P1RA 1YJCA 1GSHA 2C7GA 3RVPA 1YQTA 3T4PA 3KQVA 4R40A 3HXQA 2Q7XA 4TMYA 1H2FA 4F56A 1V1RB 2PV7A 5DRYA 3FX2A 2XB6A 1YF2A 3QVKA 4NG5A 5HEKA 4F91B 3NPAA 1K6EA 2I7TA 2Z0AA 1E9BA 1G18A 1I0IA 1Z33A 5CW1A 4BJ1A 2O05A 3TQIA 1YZVA 4OYLA 1GL3A 3WIEA 1R3LC 5JAPA 2X7RB 3VOSA 2PKCA 4OQXA 4RFSA 4YIKA 3V8BA 2EIMB 4QPCA 3SWWA 2XNSA 4LE2A 3H1JH 2NX2A 5CLQA 1YBFA 4TVBA 1TVCA 5BY2A 5KJEA 4DSUA 1EKXA 5J63A 1A76A 1M6VA 4HUJA 5AFSA 1IY1A 2WU8A 1W6RA 1XZCA 3SFZA 3IFSA 3L0PA 1A50B 2HA5A 4XVRA 2JIRA 4GPEA 3B48A 4KYIB 3REQB 5A3JA 1J8QA 2I4TA 4MQFA 3B82A 4Z0TA 3SOPA 4Y2RA 3OFNG 2HJVA 2CMGA 3I4CA 2PWZA 3GG9A 3RNOA 2JEOA 1OCOB 4B3XA 1Y3CE 2YC4C 3I6BA 4WK4B 2HBYA 3ZDYB 4F2DA 2I6QA 4YBZA 3FE2A 1IZ3A 2G76A 3AM5A 2NUTA 3WY9A 2LFRA 2JHCA 5B7PA 1EFDN 3ACCA 1HG1A 3PC4A 4FK8A 4FYPA 3MWYW 2CT8A 4M7RA 1Z7EA 5FWYA 2GBLA 4FZ1A 1XL6A 1T5DX 4JI6B 3ZJ4A 1S9HA 1WMDA 4B32A 4FLWA 2CNOA 3I73A 4QJBA 1C7JA 3SDBA 3VPFA 1H0HA 1G2IA 2WU1A 4ARUA 2A9PA 4ME6A 2UVPB 5BXZA 1VLQA 1AGYA 2JJ2A 4IHQA 5E6RA 4ZT3A 3VI3B 2COKA 3GMDA 3R3JA 5LGNA 3B51X 4NU5A 4PINA 3TOCA 1H0RA 4ZD6A 5IYZA 1BCSB 4EY4A 3K9FC 2VF7A 3Q7EA 1O6BA 1Q50A 2Z08A 2W2LD 3ZGYA 4HF7A 3TKAA 1MHTA 4YWJA 1P3JA 2BMDA 5FADA 4CMGA 3DLHA 4WERA 2YMPA 2IOHA 3A4TA 2C4MA 3HCDA 2VP6A 5J9FA 4CM9A 1Y98A 2HHCA 3VMFA 2H59A 1KUQA 1NVUQ 4JJZA 1X7HA 3K05A 3CRRA 2ACKA 1I4DD 1KFEB 1MQAA 2F9LA 2WVJA 3D02A 3D6FA 5EP1A 4KR2A 4J07A 1O89A 5K4GA 4KQFA 2R97A 3BEDA 1QRUA 1D2EA 1UFVA 2BBTA 5BW8A 1WIWA 1GNVA 4MVJH 4F4IA 5JCOA 4JI4B 1LJ8A 4I9FA 3T3GA 3CC8A 4N0MA 1PV1A 4QQRA 5ILOA 1X7ZB 1W30A 4GQIA 4ZWNA 4KPUA 4RANA 4M1YA 1IZZA 3FWHA 2Q4PA 5EXTA 2JI4A 4LXQA 3S27A 5L9AA 4A23A 4H1TA 3THWA 1L5WA 1N2XA 5ARCA 1HTWA 1QKIA 3OLVA 4PZYA 2ZJ6A 1HDXA 4FPPA 3AYXB 1K9MW 1VPTA 3R23A 4HUQB 4TYWA 2BLNA 1O95D 1RE0A 2QQ5A 3AUSA 4NR1A 1BG6A 2F48A 4RD4A 2BELA 4P86A 4AJEA 4EUSA 2DFPA 1VZ2A 1OHHA 1CJUC 1YO6A 2UU9O 3DDCA 4L4ZA 2MT9A 1VMIA 2R1TA 5C32A 4GIBA 3HCCA 3RQSA 5LP6B 1P1CA 1ZL0A 3GFBA 3BSFA 3UMCA 2X9NA 3NYIA 5A2GA 4IYIA 2AHOA 4IL5A 1VGQA 5AI5A 4JELA 5KPJA 3QK7A 3A9RA 1L4LA 1G38A 1LDNA 3NIWA 4W9NC 1VP7A 1V3QE 1SVMA 3W7UA 1K8RA 4JR1A 4XIYA 2O8EA 5BQFA 1JLKA 4JKYA 5ITVA 1XRRA 2F43B 1FXWF 1M1NA 4LZLA 3R5FA 4H18A 4FMBB 3U11A 1D2DA 1D8AA 5DTRA 1PS0A 4LF9O 2H18A 4RKQA 5KKCA 3KKKA 1O54A 4NBVA 5CNKA 5GGXA 1U2ZA 1TVEA 4KR9A 2AFIE 1PP4A 1COWD 4LZJA 1FS5A 1HL7A 1Z56C 3R3YA 4XQ9A 5JSFA 1OHHG 3KSZO 3GDHA 4DV6O 4I5FA 1V5FA 3FPBA 1ZI8A 2HA3A 2I2XB 1XCLA 1QORA 1XG5A 3NHJA 4DLUA 4Q05A 5AWFC 3VMMA 2IEIA 5K8TA 1YZNA 1X86B 3KOOA 4DR3O 1U0TA 2XSZA 3FVRA 5C1PA 3TUIC 4RY8A 3CMEV 3L71H 3I4FA 3BCHA 1I3CA 2QZZA 5DIZA 1XZBA 4W8OA 3TLBA 2I3ZA 4M8NE 3N6VA 1XDUA 3QW4B 1TAGA 3D2CA 5LP6F 4EF6A 3RTGA 4WKPA 3VNBA 1UBGA 2ZBVA 4HI0E 1U2EA 3UM9A 5KHOC 3ZS8A 4EK9A 5KJCA 1Q57A 2IZ1A 2GESA 4JC4A 5DBFA 3W5IA 3NOQA 3RADC 1UPUA 3FMFA 3H7IA 4AF7A 1T8PA 3HLYA 5CDFA 1TJPB 3Q8KA 2XODA 1YCGA 1MO5A 2FRDA 2GN0A 3HVIA 3N0RA 5JD5A 3HUTA 1QFXA 2Q0XA 5H0IA 4PLPA 2AF4C 5LBIA 3CUEF 3MS2A 2GAFA 3PIRA 1YASA 2BVNA 1K97A 2AYXA 1EE1A 5CFQA 3L2OB 4TWBA 2WINI 4LDQA 4KTVE 3EHDA 3CXUA 3AP1A 4J43A 4NVRA 4WJLA 1Y6JA 4ZCIA 4LZNA 1NLYA 5P21A 5LU9A 2NP7A 1AKUA 4JP8A 3KYJB 4OAQA 4C0KA 2YI8A 2ZIAA 5K1PA 3F8WA 1RLIA 2YHSA 3Q2KA 4YP0A 5EC8A 4OGFA 4NZYA 3H9EO 5B53A 5DKFA 4BFZA 3T7EA 3E7DA 5DYNA 5CM2Z 4D41A 3FCAA 2DYSB 1PLJA 1UAYA 1JI0A 2PX4A 4J3FA 5L3EA 4KGXA 4PLTA 4CPDA 5CR9A 4P7FA 2XUOA 4D81A 2HWXA 3IRUA 3LCCA 3OLQA 1JWBB 2J48A 4RF5A 3EGEA 4C87A 3TLGA 1VPLA 4US1R 1ZDMA 4AF6A 4ZOQI 5L4SA 4D4MA 1AQ6A 2DYSC 4NESA 2F23A 1NDUA 5AI8A 3STWA 3Q3JB 4WVLA 5D3MA 1OBVA 3T1OA 1GV0A 1IPHA 1Q7RA 1UWVA 3F49S 3FNQA 3H2YA 4BNJA 4BVJA 1GMGA 1NUSA 1FVXA 1ZEMA 8ATCA 1W5AA 3TW8B 2XVXA 4X94A 4QVKA 4S05A 3UAZA 4RQEA 2EX1A 3AGQA 4B45A 3EVDA 4K87A 1AN9A 3EEQA 4W1QA 3ZUPA 2CVOA 1GQYA 2BDTA 3ZKAA 3BL6A 3D7LA 1QK3A 4F1KA 2H7XA 1VJDA 2O1EA 3P0FA 1H4QA 2QG6A 4F6RB 2DJ5A 1FFGA 1UBUS 3TFOA 5EJIA 5DTQA 4ZFNA 4OQLA 1Q3EA 2RGDA 4BXOB 3M3DA 5IYZF 4DV7B 1LVGA 3QNEA 1P5FA 2O7VA 3G67A 2Q0HA 2VPYA 2JVKA 4PCUA 5ITZA 1NOKA 3BD8A 4GXTA 3WB2A 4IGAA 4JLPA 1NW8A 2HV9A 1ZNXA 4ZO9A 4TV8F 3VR4D 3I52A 5F23A 1PUJA 2IYVA 5GTHZ 4JJGA 4LF4B 3FZGA 1U0NA 3NETA 3ZYCA 4Z49A 3E1GA 3MXOA 3JYCA 1IWOA 1SVSA 1WSDA 1DCKA 2QUBA 3KVOA 4YRLA 1K9VF 2DBQA 2KYRA 4BNMA 4XR9A 4ND4A 4LRUA 1SKMA 3MWDB 2FYTA 1J5EO 1MB9A 4OP2A 1MLDA 5B37A 5G4KB 2MYPA 2QRLA 4A9AA 2C7VA 4A1OA 4D82A 4U6NA 3Q8WA 3QU7A 4YP5A 2Y4NA 1P1BA 3UPUA 3DTUB 1PNKA 1OWNA 4FMCF 3X43A 1TDJA 3OD1A 4RFVA 5KX5F 4D2IA 3ANMA 1B0UA 5HIJA 3A2FA 1CIVA 4YR9A 4XVHA 4ALMA 1M0TA 4YASA 1W4BA 4X5OA 1NY5A 2YBDA 3EMKA 4FZJA 2L18A 1IDN1 5GONB 3IQZA 4RUFA 3QXXA 1CJVC 3F73A 2XUKA 4AZ0A 4HWKA 3LA8A 1R6BX 2ZRJA 1WXWA 5CNMA 3BIFA 3GXOA 2VSFA 2NP6A 1DRUA 1GUAA 2YNMC 5HUHA 4W5QA 1Z0AA 1JDSA 2A1UB 3Q7SA 5T67A 4JQYA 1QVWA 1TL7C 1QIKA 1X42A 4UCQA 2I0FA 2P4EA 2R9VA 3D6NB 3DYBA 2HIMA 2ZVJA 5IM4A 4RMIA 4KOEC 4UCVA 5T64A 1KWKA 2ZXWC 1JZTA 1M2FA 1ADBA 3LW8A 4CMEC 2XCTB 5F73A 1Z38A 3FPLA 1EVEA 4I7EA 2Q0OC 4AMVA 1N6NA 1DBPA 4FKBA 4CT5A 3AR2A 2L2QA 5LDHA 4DDVA 5CB4B 1FTYA 5FLXN 4HADA 3WL5A 4CLRB 1PGPA 4F5DA 4GLFA 4L16A 3M2TA 5C34B 1PZEA 2VVTA 4JVSB 4TL7A 1C2TA 4ZT7A 4C89A 5DBGA 4YUAA 4E4RA 1IXRC 1UM9B 2KW5A 4DV1B 1AR1B 1G8FA 3CCLV 2WIBA 3KZMA 4KAXA 4H7KA 1PDVA 1IB0A 4RO0A 4NARA 1BT8A 1L4MA 1JXMA 2WIDA 3HO6A 3JWGA 1XYYA 4FFNA 2PQ2A 2BH2A 5IXYA 5DHAA 4E88A 4FB4A 1JG2A 1EM1A 1ZLZA 1MR3F 3QIVA 3CS5A 1VA4A 5BT8A 4HWOA 4JZYA 4AJOA 3K2IA 3PT9A 4F6CA 3ABTA 2VJMA 4FLZA 3VA7A 2QY6A 4HH4A 3FB7C 3B70A 4CZZA 3FG9A 5DGXA 2GZDA 2WG2A 4UVHA 1N32O 3FYDA 5FORA 2PD3A 3UJPA 5EIOA 3A6HA 4C4PA 1VG8A 3IAXA 3UWMA 3ERCA 2CMDA 1I7SB 2VRNA 4IIUA 3LFHA 4C9BA 2A0WA 4U6QA 1GRCA 5CD9A 2ZUDA 3H4VA 3VU8A 1M2JA 1XJWA 1HKHA 1MG1A 1Q19A 2B3TA 2HA6A 5GONA 2GEDA 1LK7A 2CK3A 2RFLA 2XGGA 4PANA 1USIA 10MHA 3MLBA 1M75A 1DZIA 4MKZA 3G9ZA 1NUTA 4LGCA 1CUZA 1ENOA 4QVGA 3W9BA 2BGTA 2IUTA 2JGAA 4QFMA 3UT5A 4GWLA 3ZN0A 4DIKA 2AMVA 3DVRX 1M2GA 4GLXA 1K63A 3B13B 4YIOA 4TRJA 4CFSA 4QJFB 1N6PA 4U3JA 1WDTA 1H8HD 1D9XA 2JGFA 3DAYA 1GT91 1UBEA 3D36C 5BN4A 4PDMA 1V16B 4RD3A 1P5JA 4DLYA 3OKAA 3RUPA 5IVKA 3WWZA 3U4DA 1NSYA 2EQBA 3IUPA 2O2YA 3OTOB 5JCOC 2C2MA 5FUMA 1L8AA 3AFIA 1S2MA 1GM8A 2WKSA 4NDAA 5L3DA 4P32A 2E4VA 1IY8A 1T0UA 2UAGA 1YBHA 1NULA 3M6WA 4L0DA 1V9SA 2CXSA 1Z5WA 3OM3B 5KSPA 1JI3A 4QHTA 4ZYXA 2G6TA 5GQSA 1RWNA 5EG5A 4JBHA 5FOVA 3W90A 5KVAA 2Q62A 2NU9B 2WLNA 4BEVA 2FSVC 2A0KA 3T9FA 2ODEA 4E5KA 3HCPA 1GR1A 1VKJA 1PEDA 5DT2A 2H2WA 2WAMA 3ZOKA 3B6MA 1Z8HA 1X1BA 5FNZA 4B34A 4MQMA 2VDRB 2RNBA 4OQMA 3CMAV 5B4TA 3D59A 2QOEA 4JLSA 3LAWA 1FYVA 2ODAA 2A4KA 3AYZB 4Q4JB 5D51S 2JVJA 3VVCA 3VZCA 2ESRA 1IY9A 4KQKA 2GM9A 3OR6C 3GN1A 1EEXB 4HAOA 1RMYA 2G38A 4QQ8A 5EJ9A 1D5CA 2R66A 2Q45A 4GGMX 1W96A 3VM6A 4C14A 4MVUA 5K8UA 5KYXB 5JCPA 2PX0A 1AN0A 3ZI7A 4XCQA 1ZZGA 4D7SA 3X1WA 1QM5A 4OFBA 1B41A 4DIEA 1DCMA 3ICWA 2QK4A 3IIEA 3PRJA 5B1EA 5IH7A 5BYKA 4BNLA 1WY5A 2IY7A 4BVEA 4WXEA 5KHAA 4YRNA 1ORTA 4OP3A 2PJDA 4PC2A 3P9XA 4HDKB 3AMVA 3K5LA 1FP1D 4AG5A 4BZQA 3B7WA 1AQYA 4DRYA 1KJJA 3X1JA 2PX8A 1N6IA 2J0UB 6Q21A 2ALJA 4D74A 4LJKA 3BJRA 4N5DA 5EFOA 2AW9A 1G4AE 1WOMA 2FW1A 2NXCA 2OBLA 2PUHA 2FF7A 1V4NA 2ASVA 3DPSA 4M9SA 4JL8A 1QGUB 4I5IA 1EGHA 4N76A 2ZTLA 2F1JA 3NX4A 4LCUC 3LPCA 3W34A 2IS4A 1JQJC 5HQJA 1XRPA 2WC1A 4WLOA 4DUYO 3BFXA 1ZM3A 3IAUA 5EWMA 5AVYA 1RCFA 3PPVA 1EFKA 3TOZA 2BKAA 1E8NA 4L8GA 4FYJA 1GM7A 1G5PA 2IYPA 2PR2A 3CZ5A 4YACA 4GECA 4XX0B 3WLNA 4F4FA 3DBHA 4QHYA 3UMMA 2HP8A 4NULA 1A5SB 1I4EB 4QBHA 3NC4A 2JLRA 1JFFB 3O9OA 3ACBA 4KGDA 4B7AA 3G0IA 4D0RA 3I9JA 3CF2A 3A58B 3OOHA 1HNZO 1KH3A 2O7RA 3RSQA 3GW8A 4EG6A 4MEBA 3H5IA 1BW9A 4HQFA 3EMVA 3U0BA 4F4UA 4FGUA 4QREA 1SBCA 1GN4A 4CEIB 5AUQA 1GTVA 2Y0PA 3B4SA 3KPWA 3C3EA 3NDIA 3PGMA 1I10A 4YCSA 4CODB 3R9XA 3INRA 3P27A 5JVDF 3Q3CA 2BHRA 1I1OA 4NBTA 3H6HA 3OAAG 1JLLA 3PFNA 1UWKA 3F6CA 4TRMA 4EFBA 3UYKA 5LOVF 1NDQA 1S8FA 4XYLA 3UMJA 4F21A 2JBHA 5A9SB 4Y6QA 2FMHA 3HKBB 1HDYA 4IMIB 3UXYA 1IN5A 5C80A 5SYAA 4RE6A 4K35A 1WVGA 2EFYA 3UFBA 2W5UA 3TNJA 4B6EA 5IABA 1S77D 2AJTA 2V1UA 5CX4A 1DPFA 1U0RA 1JHXA 2OPBA 2QZ9A 3D6HA 3IJPA 4NIMA 4PYNA 5KYUB 5KNDH 3MERA 1R0WA 3LLVA 2D0PB 4MCIA 5A9TA 1RPZA 3O8BA 3ASUA 3TGPA 3SZOA 3C3BA 4XWYA 1E7YA 2R2GA 3WMFA 4F2HA 1NJGA 2VP3A 4CMEA 4FC7A 1K4DC 5EWMB 1YI0A 2XT6A 2FMTA 1YDGA 2LKCA 2G08A 2IYQA 4XPIA 4FFOA 3EDYA 3U7QA 2HV8A 4KBGA 1NPDA 2BFFA 3TCUA 2G40A 1NW6A 1RC0A 1O9HA 2BBOA 3E2MA 4KQWA 5E6UB 1MVLA 4JJIA 5CLGA 2X0IA 4YRTA 2RCYA 3HB5X 4LBWA 1XD9A 4EATA 1U8ZA 121PA 1EHCA 4WGGA 2QUHA 4AC9A 4RJTA 1EZZA 4RH3A 3ML0A 3OGCC 3D5TA 3Q87B 3QVSA 1KETA 3F3MA 3KP1A 3OX3A 4TVSA 1YA8A 1YR2A 2D1YA 5GP1A 3ZCVA 3CCRV 3IBCA 1JA0A 4RTKA 1C3VA 1G20B 2AKAB 4KN8A 1HMYA 3OJWA 3UHPA 5KDOA 3AVTA 2A6PA 4F04A 2RMKA 5E9AA 3TW8A 1N0NA 4G2TA 5LBUA 3PC8C 2IL1A 4QPKA 1XTJA 3GZ4A 1CUSA 4Q9KA 3ZD6A 4MVZA 1RLTA 1YD7A 1THZA 1IBMB 1F20A 4ZCSA 4ARZB 7GPBA 1SC3A 3LPNA 4HEHA 1XEXB 3ENWA 1DQRA 1C1DB 5A6VA 3UMYA 1XQXA 2E7ZA 1KR5A 2GYVA 2HPVA 3N8NA 3QH4A 4IOJA 4P1ZA 2FPPA 4FI3C 5DX8A 2XXAB 1SXHA 1M5UA 1NQXA 2XMBA 1MC5A 2VHZA 4IJMA 3IL2A 4TTTS 1YWGO 2RJNA 1K4YA 5CVVA 4UVCA 4X7PA 1TCBA 5IM5A 3K70D 2Q68A 1Z36A 2PRIA 4LOIA 3FLMA 3ORHA 4NDNE 3B9BA 4GPZA 2I80A 2PN1A 3UC5A 4A3SA 3TAHA 1XD2B 4EJ6A 2QM3A 4YWHA 3TD2A 3WGZA 3WLEA 4RK4A 3Q7RA 3STYA 2GXQA 2WKRA 1NX6A 1NBOA 4HEA1 4YHBA 3JTEA 3ASVA 2H3HA 4TGLA 2AEJA 1GGKA 2JASA 1F4MA 2H5EA 4URUR 4OLBA 1I33A 1Y9JA 1TC1A 3JSXA 3LQ4A 2P41A 3CX8A 3PCRB 4X71A 3CYOA 1JAIA 4JX9A 4UD6A 4IS2A 2VPPA 3OM1A 3TN7A 1YB1A 5B3JA 2A9HA 2D5BA 2HJHA 3K20A 1SR8A 2IYWA 2R11A 4BMNA 1UDCA 3DZJA 1AUPA 1ZC3A 1E2EA 2J59A 1BD4A 1Z0SA 1Q3KA 3PQ4A 2ZIZA 1NKTA 3THOA 4RD1A 2B30A 2Z09A 1ZGBA 2FN4A 4MVJM 4GX1A 3TRHA 2IYSA 1CETA 4NVPA 1YONA 3C7DB 3D7KA 1R50A 3DR5A 2FP3A 4LRYA 5TEVA 4PN3A 2GEJA 1JAZA 3IUSA 2H8GA 1EWKA 1JQKA 5JZBA 2JEZA 4C0AC 2AFIA 1DGSA 2C42A 2ZRGA 2OCBA 1TVKA 3AR8A 3DW1X 3HRKA 5KU7A 3DP9A 3H3XA 4D8TA 2D1TA 3F7VC 2H4WA 5DF1A 3UGKA 2C58A 2GDSA 2H2HA 3OESA 4M38A 5GV8A 4OLHA 3WB0A 5GJWC 3H83A 3RBAA 3V4LA 1LI4A 3T7CA 2JGJA 3E70C 2HKOA 3ZNOA 4EGJA 4FM9A 4MGIR 3JARA 3A4MA 1JFTA 2QT0A 3BCRA 5ERGB 4FNMA 5ER9A 2BJHA 2MK3A 3BDVA 4IBOA 1WCWA 5BQ5A 3VYTB 5C51B 1K7CA 4FE3A 5HZMA 3HR0A 5GW7A 3SZRA 2VZ0A 3P9YA 2JZOA 3BTOA 3MS7A 2YMMA 4AKHA 1V6AA 3MJVA 4B40A 4NAVA 4OA8A 5KQPA 4D4JA 1SZTA 3DD5A 3B8NA 1KMIZ 2Y0BA 1XZJA 4XYEA 2E18A 3CSDA 2XYGA 1RAFA 4Z2WA 4D9BA 3DAHA 3KKYA 2J4CA 5HG0A 5L3VA 1FNSA 2G8LA 3PQCA 4WCVA 1RPRA 4BW5A 3ZBPA 1H2RS 4N7RA 4DKJA 3PHJA 1ILEA 3KZ1E 4WUVA 4C3ZA 5LYJB 1F12A 1XJQA 2HRCA 4BN4A 3OECA 1GXSA 3SKYA 3MMSA 2A9QA 3KZOA 3G2MA 5JVDA 4GGPA 1AKWA 3EQ6A 3CP1A 2PL9A 3D6MA 3W1VA 3GEMA 1TLFA 2ZDQA 4E07A 2O7QA 4FCCA 5CRIA 5L4LA 1WDWB 3C8MA 5HFNA 2HW8A 1SCJA 2C29D 1JEAA 1M6HA 4NXNO 4P81A 3LDFA 3GCGA 3JRNA 5FOUA 1X1RA 3ZU3A 5IE9A 5T7BA 1AA9A 1U5AA 3GJ3A 3WGUA 1QO9A 2PSHA 2Z3ZA 2GA8A 2WLHA 4BNXA 2P2YA 1ZIPA 4I6JA 1YBAA 3PFFA 5F3DA 2WJYA 4FD2A 1K8QA 1EDOA 1XJ0A 2HF9A 3HXPA 3ZIUA 3N2IA 2QR2A 1NU8A 2WHPA 4BFWA 3O9ZA 1BFUA 3GWGA 3L8HA 4TSFD 2G77B 1N34O 3T9EA 4A0GA 1A9SA 3IH5A 3CCFA 3IDQA 3OH8A 2VNSA 2DBZA 2V7QA 2OHJA 3A1UA 2VSXA 2WIJA 3SC4A 5F33A 4DYDA 1BS2A 1OI4A 1JQ3A 2QA5A 4QPJC 2YNMA 3FYUC 1O4WA 3RWBA 3UWOA 1JAHA 1Z26A 2CH7A 3L5OA 5HQ3A 1CBUA 3THYB 1WXEA 3RS9A 3ZOZA 3RANA 2FRVA 3WDSA 1PT9A 1XWIA 3PB3A 4GMDA 4R3NA 4AO8A 3W4IA 4F4CA 5JNTA 3DEFA 2R4QA 3RTBA 1Z17A 4G89A 1SY7A 5A0VA 2X6AA 3C24A 4QU9A 1AXRA 4TKMA 1NW7A 4IZHA 5IJWA 4D26A 3B9PA 3AL3A 3T5PA 4OI2A 2BCEA 1Q17A 3HBNA 1Z83A 3CLVA 3WG7C 1NG9A 3NEAA 2HLHA 1A96A 1P9OA 2VQ3A 4MHOA 2QKYA 2ZTSA 3UCEA 2VNHA 5JARA 3JCUZ 1AU9A 2BF7A 2Q73A 1OXXK 3QO7A 4R0VA 3VSCA 2ZTHA 2WF7A 3RFVA 3DV9A 4PIPA 4O33A 2IJJA 3G1WA 2I22A 1GGEA 5JWPA 3U9LA 1ICEA 2J31A 4K03A 4TVOA 3S4YA 4J03A 3HM9A 4MA0A 1EUCB 5HIMA 3GP8A 4B31A 1G9TA 3AK1A 3GRFA 3EXG1 3LK6A 2MYTA 2PIAA 1UQRA 3O1JC 5GJVC 1ZMRA 5C1DA 1F7UA 4D46A 3I04M 2LGWA 2PUFA 5CA1B 3KR1A 3UJNA 1TA9A 5I47A 1FUKA 2HMTA 3I1YA 3JYHA 1OX6A 3CVWA 2ZR8A 4DDMA 4C3UA 4KUGA 3AB7A 5BW5A 3CRZA 4LWQA 3TRDA 1F2UA 4BO1A 2C3YA 3KR9A 3RLFA 4NBSA 1QCDA 4K88A 1U1CA 3Q0EA 2ZWPA 3CZMA 3HHEA 1ISHA 5CN0A 5J59A 3FAKA 3E9MA 5KC8A 4EKIA 4XSVA 4DXDA 1HFEL 1WPBA 2RAPA 3W6OA 5HM8A 3HCBA 3LNNA 2PYJA 4MA4A 4ZHSA 4P53A 2M7WA 3AG1B 4NHEA 2QSUA 3KYDB 1UP7A 2QPLA 4EVSA 1FQKA 1KQNA 3HC7A 2ROQA 3O4JA 3OMWA 1XXHE 3KJQA 1BN7A 2FQYA 4XJVA 5LLDA 3RJMA 3E9RA 4AZ3B 3EPRA 4CM4A 4IHJA 3EQ7A 2GF0A 1MU0A 4WUTA 4OK6A 2PGOA 2V7UA 1WCV1 3F4LA 4UM5A 1NKVA 2PTMA 1Q20A 2EFEB 3JYNA 4ESHA 2WHEA 2DWDC 4HDMB 5IDYA 4AIRA 4TMVA 2FR1A 4X9QA 1RAHA 4YFVA 3A11A 5EFZA 4AP6A 2F8SA 3EQ8A 2X4IA 2JDIG 2WNSA 1RMQA 5EE0A 1UXKA 1OASA 4NDZA 1JR2A 2FW8A 5FKJA 4F8EA 1HSOA 1OTXA 1HV8A 1EM8B 1OGIA 1TM4E 5CT8A 4LVUA 1Y3BE 4KH1A 1O0CA 2FPGA 1ZGZA 1TIPA 1FEZA 2IE8A 1N5RA 2PS3A 1OCCB 2ZTUA 3CF6R 3CSUA 4R2WA 2Z6VA 1V8DA 2W2MA 2B4QA 5HFMA 2SBTA 1IXSB 2FNAA 2WZQA 5T4EA 1HO3A 1NOJA 4NK4A 2D2EA 2WSIA 1XU4A 1U9ZA 4J7AA 5GZ6A 2H4YA 3HU5A 4F3TA 1S0VA 3EF3A 2OTJV 1JEEA 1S3JA 2D3TA 3FVWA 5GONF 2FJ0A 4UEJA 3QYAA 3K5NA 1JHDA 1F2DA 2XX3A 4WZAE 4EZEA 1G3IA 2VXCA 1H42A 1Q7EA 3PJDA 1HNXB 1IBKO 2GPBA 4RAQA 5JDIA 2CTWA 4JYCA 3E9YA 4GCZA 2FPGB 2J3MA 1T0IA 2O8DB 2OCCC 1DKPA 2CK3D 3A7EA 4ZEWA 4H16A 1FYFA 3DMDA 1E1RA 4JUIA 4CJXA 4BAYA 3PD0A 5AW8A 1HE2A 2HCRA 3VPCA 4B7XA 2E74B 2OBXA 3WLTA 1SWVA 4LXIA 1XPUA 3ZC3A 4N3GA 5B6IA 3G0HA 3GGOA 1O8BA 4CI0B 5KYYB 1CRLA 3T5CA 2WM3A 3VNAA 5C46F 1MBZA 2X6CA 1JHOA 1FNMA 2D1QA 1J06A 1QYVA 4FB5A 4B43A 3TLKA 2O59A 3O8OA 1WXGA 3WISA 1EIWA 2VF5X 4KRFA 1M83A 2B82A 4AKSA 1NNEA 3PLNA 3L40A 3MJTA 4CM8A 2WYVA 2QE6A 4E21A 4YIPA 2BGUA 5KTKA 2HU7A 1GAEO 4YA6A 3JAWA 2Y6UA 4MMYB 1RXWA 1KZ7B 3BTVA 3GLHA 5IPFA 3SF8B 3HMKA 4O1MA 3HK2A 1EUZA 5J2UF 1S72V 4HUTA 5JS7A 1YR7A 1U9CA 3SX4A 3O2NA 4NZ9A 3ZZ1A 5JSUA 4N3CA 4NBLA 3LSUA 1KFCB 2PT9A 4L5CA 2NPFA 1RWVA 1PWHA 4PNPA 4BKUA 4XUGB 3SHTA 4GR5A 4K7JA 3QTCA 4R8MA 4DSNA 1Y5LA 2V7XA 3AHDA 5HKLA 1UBRS 1OD6A 4M0PA 1KE1A 2Y0DA 3HR8A 2LD4A 1YB2A 1E2IA 2PD4A 2EC5A 2R1UA 3BREA 3OKPA 2QAIA 3GFOA 4JLNA 4MWOA 5DO9A 3CR3C 4A2QA 1RLJA 5DSXA 2RJ3A 2BMEA 1KEWA 2IC5A 2MMCA 1H05A 4GPBA 2VYVD 4UKDA 3GR6A 4UE6A 4CV3A 4YUWA 4W63A 4K9RA 3PE3A 5ECGC 4D3XA 1JJFA 1J39A 2EBWA 3C16C 1B2LA 1X7DA 2JLBA 1XMQB 1PFUA 5JYEA 2ES4A 4CFYA 2ZDGA 4ZMRA 5IYZB 3ANTA 3RRYA 5JW6A 1E6UA 1HDCA 2P6OA 3K1AA 4LC0A 3LK7A 1G3MA 5EEHA 5EQTA 4PQFA 2NG1A 1XIVA 1GZSA 2O8NA 5HFLA 3B40A 1JLHA 3E7XA 3N2EA 2JEUA 1LA2A 1ZD4A 1EVQA 2G4LA 2W7TA 2GKGA 3FPFA 2WKWA 5KOIA 1UDAA 1VF6C 3C8DA 4UBNA 3R7LA 3UCFA 5TLSA 3O4IA 5D2CA 4N8DA 2FMIA 4D8WA 3THYA 2AW3A 1AV6A 1LJLA 2I5PO 1P73A 3HEAA 4B9EA 1IIBA 2VTKA 3PA8A 4NOJA 4D9EA 3OQHA 5B2EA 3FM9A 1FDRA 3GI1A 2EX3A 3N2KB 1NF3A 2FPXA 1ZHFA 3QXSA 1TOAA 2E48A 2OGZA 4UV9A 4FD3A 1WUIS 4HAUA 4KWEA 3SIWA 1T36A 3SZLA 1VCOA 1U28C 1KJZA 2K9PA 1FTQA 1X7GA 1CFZA 2JZNA 2P7TC 1UIMA 2Y1WA 1JSCA 3DHNA 3QLTA 5H16A 4YXWD 9GPBA 4OJNA 2DQSA 3I6IA 2QD2A 1LDMA 3BAAA 2F3SA 4K81B 3EGXA 3ISJA 4ZVPA 2JLCA 2QROA 4DQVA 3V4SA 3R40A 3KZXA 4WVFA 3QE9Y 1NT2B 4LF6B 1NURA 2DBVO 2XJ4A 3NBMA 3BZBA 3V4FA 4ND5A 3IP8A 3BGVA 4MI9A 4PIVA 4DCOA 5F2EA 3WG9A 1E5VA 1C3XA 1XFAA 3K8OE 5MN4A 3KS9A 3JAMA 4EPWA 1QP8A 4RMNA 5AVJA 4MVMA 5JPDA 2HD4A 3RAFC 2HA4A 3PXAA 3K3PA 1U2SA 2BSKB 4Q34A 2XB9A 3CJHB 1H94A 2ZIVB 1V48A 3P9QA 2BAGA 2H06A 4KUMA 1NUHA 4HO1X 4LJRA 2AXEA 2WZCA 3IHKA 1E1YA 5AJHA 4YYEA 4DN6A 5JS1A 1U94A 1KK3A 4J7UA 5EZ5A 3HV2A 4IHJF 3FVQA 4Q7KA 3SCZA 4BFVA 1O6GA 2I4OA 5I9MA 5B3LA 3CYFA 1HNNA 2UV8A 4JP2A 8MHTA 2V7QD 2JLWA 5HP4A 2UUCO 4R8VA 1NZFA 1SC1A 3HWRA 5ANRB 2Q8VA 3OY7A 1KFJB 4RK1A 3C8UA 5B1BB 3E48A 4WEOA 3ZU5A 5FP0A 4D3SA 2WE7A 1PJBA 4Y9TA 2G5PA 4UUAA 3CC2V 3K9QO 3SAJA 1JV2B 4P34A 3WNQA 3ED5A 3CS3A 2M6YA 3Q9UA 1R1DA 3ZDXB 3GBSA 2IHKA 4M4SA 1L3BA 1N2JA 5B5EZ 1PNTA 1W0KA 1RYFA 2QAGC 4HAXA 4ZPJA 5BNFA 5TQ0B 2OA0A 1N2GA 5KQGA 3IODA 4BEWA 5IANA 1K66A 1C80A 4X63A 2XHEA 2IJIA 1QPGA 3IPYA 5GM1A 4EMTA 2H8KA 2J1LA 3ZHOA 2AMYA 3VR6D 4F86A 3CUVA 5KOJA 1RJGA 3JALA 1T1RA 5FTLA 4L0QA 1FFSA 1JQEA 2MYNA 2QHXA 2WF8A 1SMKA 3MFYA 4J0EA 1WA8B 4QC2A 4XX0A 5DWQA 1SIUA 3PUZA 2BFNA 1EK6A 1DUSA 1RPJA 3BE4A 3DFZA 1ZMTA 4PQEA 3UXMA 4EP1A 5ED4A 1OCZB 1KA9H 1R9JA 3NU1A 5IKPA 2Q3BA 2Q5OA 4ZDJA 1S8NA 2YCBA 3UO8B 5K5EA 3OZGA 2MR5A 4IIJA 4KITB 3LUDA 2OILA 1T2DA 2X5JO 3NBZC 4BFXA 4RTNA 1U4SA 2HRQA 3QWAA 2J5RA 1NKSA 1I1NA 5AUNB 4AN4A 4L85A 4MQEA 1UUFA 1Z08A 3RSFA 3U3JA 5IULC 2DJIA 5AK6A 1G7TA 3KZVA 3B60A 3PTZA 4AN0A 4LWPA 2HQOA 5ISMA 3IKJA 1VG1A 3OETA 4MUHA 2ARKA 3QYPA 4Q4JA 2YQ4A 3OX4A 4KUEA 4I4TF 3RAEC 5FJIA 1XEQA 2HSZA 2IPLA 4QTUB 3NFYA 2VH2A 5E3HA 1TVKB 4FQ8A 3FW1A 1L3CA 5KYXA 4QATA 1YI2V 3GLIA 1VPVA 2VAXA 1X4TA 2ZRNA 1WUKS 3QUCA 3TVDA 4YUZA 4LZOA 3HCEA 2E2WA 2WUVA 4ID9A 4IIJB 4UUQA 3AESB 2ZANA 1JJ7A 1XN4A 4KO4S 4MCHA 1B93A 1PJRA 2JK0A 1WTAA 2W48A 1G5RA 2WU4A 4JJ6A 3GFFA 3N7UA 5CH5A 1OY1A 2XJ9A 3BMXA 2DKOA 4DJJA 5CJJA 3JWPA 3S2GA 1E0AA 3ZV7A 1STOA 1B3BA 1U7OA 2KS6A 3NWOA 1JIUA 1ZSNA 1Z88A 4UCWA 3R76A 4P93A 1GM9A 2IZ6A 1GR0A 2GN2A 2V7GA 3AZOA 5CT5A 5EK0A 4CUZA 1PKXA 2RHDA 4MQ5A 5ENDA 1G7RA 5JNUA 1X7YB 4LUCA 2CVZA 1K92A 1BS3A 4JYBA 2ISSD 2ZUUA 3WX0A 3FNEA 1MRSA 5L4NA 5TVGA 2VQEO 5IM4F 4H7JA 3OQNA 3A10A 1GCUA 1PS9A 2QXTA 3I6ZA 5DNAA 3V33A 1JEYA 4MUBA 1GITA 1KGDA 5TR9A 1JHZA 5BWMA 5BURA 2AHRA 2N04A 4KQMA 4CF3A 4IFEA 2FW9A 5CT9A 5BPFA 1GTMA 2FKXA 1LDBA 4MW2A 4EQZA 1L7NA 1OFHA 1W4LA 4R0NA 1EVKA 4YVFA 3GGSA 3FD9A 1HE3A 3FLBA 2K87A 5CGZA 3WGJA 4MV5A 521PA 3TOSA 1KZ9A 1M1UA 1KFBB 4RVNA 5THXA 2VQSA 3NORA 4WFHA 1L7XA 5LHHA 2C1ZA 2WKPA 3WQSB 4BMVA 4FWBA 3WSTA 3K53A 1MO3A 2RHLA 1JEQB 3I9V1 5FR2A 4PXSA 1MO2A 3OE7G 1F8FA 1Q2XA 2H5JA 4YCMA 4NEQA 5BR8O 3GVIA 5LMCA 4R8KA 1J99A 2YV3A 3B89A 3A1CA 4KQ2A 4NH4A 3W5SA 5JQGB 3D81A 2Z3VA 2PA3A 3C5CA 5CBPA 2JKZA 5LSAA 2XKJE 3BJMA 3KYDA 3OIYA 1FMFA 1UBLS 5DHSA 2WLKA 1CY7A 3QVUA 1K06A 3T38A 1NMSA 4WXMA 2OAQ1 4DV4O 1VBKA 1KYVA 2BM8A 4ENRA 3AY0A 1CFJA 2C3PA 1GH6A 1JKJA 3BMQB 4ZODA 4EUNA 2UUAO 1LRJA 4RIFA 3S2ZA 5IMBA 4MIEA 1UINA 3RR2A 4IEIA 4BUJA 1JEQA 4CHGA 4BV3A 3O93A 3RVQA 3WL3A 1U2PA 1E3LA 3H1KH 4I0XB 3KT8A 2G70A 3O1IC 1Y5RA 4H7IA 4HGZA 4DCCA 3QVOA 2H1OA 3UKJA 1XZEA 4R1PA 1QVFU 2JRCA 3JAMN 4KTTE 4ZU6X 2HK9A 2II6A 1E6LA 3FY4A 3E7PA 4G8CA 4EW3A 4H59A 1M8JA 3QKUA 3DWFA 3T99A 5DBHX 3HDJA 3ZY3A 2AK2A 1N7JA 1BVHA 3ZLVA 2EWMA 1YRWA 1XVIA 3NVKI 1O97C 1BDIA 1MFPA 2AXQA 3M6MD 1E6KA 2OVBA 3ILSA 1T5SA 2XVZA 5LD2C 1V1JA 2GZ3A 3BVPA 3GVCA 2IBTA 5FWXA 3ZLJA 3IBTA 2BFWA 2CLSA 2RBKA 4PRLA 2I6GA 2J5KA 4JXJA 4DLZA 1BX1A 3VVLA 1IN7A 3NT5A 4YXFA 2XVMA 5DHFA 1Y7PA 3RIGA 3AVVA 3B8EA 3FMGA 1KY5A 2J85A 1N2HA 3KOXA 3O8LA 4FCVA 4IV5A 1RBZA 3BWDD 1L7BA 3PC8A 4RK0A 4XVCA 1QRTA 3ZLBA 2CDCA 5IJ9B 2B92A 2Q5LA 1C1HA 3WRWA 4AF8A 2CAZC 1N1GA 1VHWA 4GT1A 3FPCA 4KXYA 4EUEA 3DFKA 2Y1FA 2VK8A 3WRYC 1OVMA 4YK7A 2C00A 4HQKA 3TMAA 1CUXA 1JPVA 1KI4A 3LY7A 3J80A 5CVJA 2YWRA 2SKCA 1Z47A 3VYWA 2VNIA 4OHCA 2FZLA 2HHHO 2FAXA 4RM3A 2RQ6A 1Z4PX 1GSIA 1WXIA 2F9MA 4QDUA 2ZBEA 2C4HA 3IR5A 4ZU1X 4AWBA 3SBOA 3NBQA 1A1VA 4ZC1A 2HZ7A 5DEIA 4YRKA 2WJJA 1TM5E 4N6GA 4BJ6A 1MQ9A 1JALA 5KTPA 2VJAA 1QGDA 3BD7A 4TMKA 4GX2A 4K9PA 1XRMA 3KKLA 3FDZB 4Y1RA 2CSXA 4NJMB 1XT6A 1UM8A 9MHTA 2O9JA 3IPRA 3P19A 4TQAA 4B6PA 5IEJA 3U7FB 2QTSA 3ORFA 1S5JA 4PZ0A 3WR5A 4C4ZA 3KETA 3BCSA 3CUWA 2WABA 4KR6A 1L7EA 3AR4A 1H4SA 4V0LA 1O08A 3UJ3X 1NXTA 2MCFA 2A1UA 4BFLA 4D9JA 3GUZA 5J2UB 3DYVA 1QP4A 1EX1A 1UJCA 2VOEA 3U48A 2H1RA 4ITUA 4MSUA 4K2AA 1W5TA 4CWAA 1COZA 3BX1A 2N9UA 2QYHA 1M5TA 2VJDA 1Q1GA 2PKXA 2AEFA 2QTNA 4R41A 5CJ2A 3SQDA 4TWKA 1DBIA 1YMVA 4G24A 5A7GA 1ESNA 2DXIA 5FOWA 1DC4A 3V7FA 4B6QA 2BPOA 1WQ4A 2PSJA 4ND1A 3DZBA 1W0JD 4TWIA 2HLDG 1X7ZA 1VF6A 1C4KA 1VSQA 3G88A 2CCGA 3ODGA 3JAKB 3IT2A 4MPJA 1ZSYA 5TMDA 5KOHA 4IXTA 4YGYA 3SC3A 1CR6A 2GHTA 2CJFA 2GCIA 2I1VB 4BN0A 1U0FA 3ZWWA 3U7EB 4R71A 1OKKD 3KBBA 4MI6A 1D2NA 3D7RA 4DZRA 2J46A 4E6PA 1YEWA 3HO8A 1IBLO 5IJ0A 1S8OA 4BATA 3PGA1 4U9IS 3VR1A 2ZVDA 4CL8A 2Q0SA 1H2YA 4MW7A 4ZV9A 3B2EE 1W8DA 3NASA 3SJUA 2Q1TA 2J9FB 3GDGA 4BX8A 3CGWA 1C0PA 3DFUA 4V0OA 4IDHA 1HNWB 4DLSA 2VQFO 5A1JA 4RXTA 3KJXA 3MILA 2QY9A 2EIKB 2YVAA 3FWKA 3GPLA 4EYOA 1ABFA 1Z15A 3AZPA 1X9HA 3FPSA 2R7MA 2ZS8A 1ZK2A 4GPAA 4HFRA 4A6EA 1VL6A 4N5HX 4PZPA 4ES6A 3LIPA 3P4UA 3TPCA 3VU9A 2J5XA 1NH2D 1LFAA 1CX9B 1XEFA 1N2BA 2PFKA 1KGSA 3N28A 3OIGA 4L3OA 4MR8B 5EXSA 1QHTA 3RUCA 2JIZG 3K9CA 4MYUA 3W05A 1N2CB 4MUNA 1XK7A 5F2KA 2O1SA 1DO0A 1YTFB 4HTFB 4KPEC 2QSZA 3HYLA 1U8CB 3V3KA 2VLBA 3NHWA 2UVDA 2I55A 4IVPA 1E7RA 4NU8X 3RAGA 1EUDB 1G66A 4M1WA 1J8YF 1CJKC 3PL5A 5IJZA 5GJBA 1QO0A 3AG4B 1U0GA 3AB3A 4QIHA 4PZ9A 4YUYA 5CB0A 2A0XA 3CRW1 4OB7A 5NULA 4DR5B 5AUOB 5KNBA 3ZGZA 1JE1A 1UM9A 5CT6A 5BWCA 1OLXA 1U6KA 2HWYA 1GL9B 3G23A 3UK6A 2CNNA 2W2KA 2PLFA 1TQDA 4PBSA 5LUAA 4Z4GA 1CRPA 3R3SA 2JFFA 2PRJA 3QLVA 1YQWA 1F6DA 3WLOA 3DQZA 5DM4A 3HS3A 1X92A 1XZGA 2PBLA 1NJ6A 1VHJA 3K72B 4R2XA 5KKNB 4J1TC 2KB0A 3WFVA 2D3OW 1ZBDA 2O3UA 2UYYA 3IQIX 3GOQA 3P96A 4KXUA 2IYNA 2HMUA 1I4OA 1YR1A 1ZIDA 4Y9SA 4WHMA 3SU8A 2GNAA 1JB9A 3M83A 1TO1E 2QS9A 2WJ4A 3T35A 2WTUA 3NP7A 2ZS7A 3BL8A 2A7WA 3K08A 1BXKA 2XI4A 4WA8A 2O7NA 4QGGA 4XM2A 2BCJQ 4QUDA 5ERYA 1CY6A 1T2UA 1Q16A 5JD4A 4RTMA 3VTAA 5JAUA 5F98A 4GEGA 2DKNA 3R9KA 1BGYH 1S5LZ 3UUGA 2IIVA 2ZXUA 2LTAA 4I9GA 3KPJA 4JLOA 1UOQA 4UB8Z 2QI9C 4JBXA 4HPWA 1GU7A 1O5TA 4YCDA 1E3IA 2CYBA 2PBFA 1MPTA 4FLMA 4Q7QA 2R4UA 1EYZA 3H4MA 3HJNA 4NX2A 1IEVA 1W9MA 4W1RA 4EYGA 4H0NA 2A5FA 4DDWA 2ZU0C 4NCXA 1XD8A 4YJGB 3KQLA 2GZMA 4C7UA 1JKIA 1HA3A 4LK2A 5CLJA 1GP2A 2F9FA 3D9QX 4HAWA 2HR1A 3MAJA 1MZFA 1XDSA 3CEPB 3DS8A 4Q15A 2GBPA 2OWDA 4FUQA 4ARZA 2BR4A 1GFIA 2FSUA 2QJTA 3KB8A 3SM3A 2QG9A 2XYRA 4FOLA 5IJXA 1E1QA 2H16A 3IEUA 1T8SA 3TAUA 3V80A 2PQ6A 1BX3A 4UXIA 1BE8A 3EGIA 1JJ2U 2AC4A 1DP4A 1NQOA 1ZOPA 3ORRA 1K68A 2GVNA 4GI5A 2D5CA 2FPMA 2VWPA 2LQTA 5LQSA 3S99A 1SG9A 4NL4H 4QRDA 3MCVA 4X91A 5HOEA 4U2FA 1YS4A 3KD2A 5IJAA 2EIMC 1ZI9A 2PXXA 4EH1A 3SS8A 4DDTA 2LGQA 1K7XB 3BRCA 1ZOLA 2BY4A 3KT6A 4GPTA 4Z9YA 1SURA 1DCTA 1UBCA 1SBYA 5GM2A 3CMCO 3RRZA 2Q6AA 1FJHA 2Y6VA 3JQDA 4JV5B 3C7KA 4TXNA 5EA2A 5AW9A 1DSSG 3LCRA 3VZRA 3GL9A 3HZRA 1JP7A 1P4JA 3OEED 3OPYB 3DTTA 1JJIA 2YWJA 1PNVA 2XA9A 3LZ6A 1I7FA 4UHKA 1W87A 2ONJA 2NO7A 4EYQA 2XUZA 3QRWA 2NAFA 3ELDA 1P75A 2OB1A 3QE3A 1G9XA 3ZH2A 4UBLA 4C0WA 1CEQA 1WHTB 2XQKA 4EKNB 5HZKA 1JUDA 1SZCA 2GEUA 2NU7A 4HH0A 4LHWA 1E3WA 2QW1A 1KEPA 1ENYA 2DGDA 3ENKA 2ZI4A 5GMOA 1ND5A 1ZRNA 4GUAA 4RLHA 4NBNA 1U81A 4MWGA 1T91A 1CZRA 2ZWAA 3GRZA 4RJLA 4WTOA 4JI5B 2B7CA 1AB6A 4JHLA 3RVLA 1OLUB 1T3HA 1ZU4A 2CL7X 3K96A 4V24A 1GQQA 2QR4A 2EDCA 3O3MB 2P78A 5DLPA 4D43A 5JAIA 3KQOA 2R6ZA 3R9IA 4HDOB 2QAGB 2VRCD 1AH2A 4JI3B 1W0JA 1COWA 4HAYA 1P9WA 2R6AA 3DHVA 2BEUA 3I92A 3EIWA 5I4CA 4HLCA 5L3SA 3SC2B 5FULA 1JAYA 3NHRA 2XAGA 1Z5NA 2EZ4A 3E0XA 1GPAA 3S6JA 5LD2B 1I3OA 1ULUA 2ZAMA 3PENA 5TMBA 4JBWA 3NTLA 3RDPA 4IZOA 3ZDEA 3F1LA 1XMIA 3WKBA 3EF0A 1C81A 3UK1A 2WOOA 1Z34A 2LIVA 4OHRA 5C93A 4GMFA 1NYTA 1E8DA 3GAFA 3T5BA 2NO5A 4DKXA 2IGTA 4B3FX 3SFTA 2PANA 3O4RA 5DI3A 3S55A 1KXZA 5JE8A 3E7FA 2GPAA 3MAQA 1GXSB 1L5QA 3LM8A 3N2NA 3WOHA 1S76D 3IOEA 3ZDDA 2R6JA 3QELB 5EIXA 1X80A 2ZYGA 2ADFA 3U17A 3JY6A 2Q3EA 3WZLA 4D5EA 2DCUA 1MAAA 2FFRA 3II6X 2VSOA 3RJTA 1BCSA 1D1PA 4G28B 1E6CA 1GGHA 2GBIA 2P4QA 2QZPA 3KQTA 4FGJA 4G1MB 4MUMA 4RD6A 4R8RA 4WEQA 4BKRA 4B2PA 4J0QA 3T5DA 3QWHA 1H6AA 5GOTA 3LJKA 2EF1A 3CLUD 3CV3A 1I6MA 3ANLA 2OP1A 4K46A 1NUQA 2NU7B 3I09A 5IAAA 3EXIB 2OXIA 1C5KA 1VG9B 3C6MA 1E9EA 1P31A 4LISA 4A2WA 4CV0A 1OROA 1SG0A 3Q11A 1ONNA 1J1ZA 2FX3A 1DT5A 2P2ZA 3QVLA 3COWA 4MWCA 3UJAA 4PHZA 1RYMA 4WWHA 4BNVA 3P9NA 4RX1A 2XDQB 1P4RA 2X8WA 2Y71A 4I1UA 1WNSA 1SRYA 3E3AA 4B3DA 4BWYA 3IQEA 4U3FH 1LF0A 1M2WA 3BQMB 3MCWA 4YP9A 2WSLA 4OCZA 3PN1A 1D4OA 1L4HA 1NAIA 3PNOA 5B1BC 5G53C 4RVFA 4IH4A 1DEHA 3NHMA 1N36B 3VGPA 3GIWA 3T3OA 2WT4A 3H97A 1VJRA 3OPXA 3FJOA 3SKVA 5ICGA 1GYRA 2EBFX 3EXFA 3K8ZA 3TIVA 2FPUA 4D9IA 4TRNA 1O9GA 2N0SA 5LIRA 2O5EA 1UBNA 2AX3A 2CHGA 3G02A 1ZO8A 4RHCA 5D3KA 4BAZA 3E27A 5A06A 5C5IA 5CP8A 1Z7GA 1O7JA 3KQPA 1K08A 1GN9A 2R5WA 1Y3DE 2IV3A 3FF1A 3SMVA 3VHQA 1VQPV 4PPGA 5I8PA 3X1XA 2CNDA 2IZ0A 4ML3A 3TM5A 5BMVB 4O4HF 3B3AA 2NVOA 3H0EA 2WNHA 2DUMA 3IUEA 4MRPA 5G3YA 3UHFA 3WDKA 5ALKA 3KCYA 1N0WA 3NUZA 2PKYX 4RD0A 4E30A 2AUTA 5LWHA 3EYAA 2C3MA 1DAOA 2YJTD 4WK6A 4Z99A 5C5CA 3TIIA 1G6OA 2OORA 4WY2A 3EQ9A 4WNYA 2HAEA 3NHSA 5T41A 3AHIA 4BLUA 5KYYA 4DM7A 4OQPA 3F2IA 4RH0A 1DQNA 2XMDA 4YRZA 4ADSG 1N5MA 3QF4A 2BL4A 4IAOA 3FAVA 3ED1A 4BIUA 1GLGA 1V55B 2QM8A 3AJEA 1YJAA 1TK2A 4M0FA 1N7IA 1ONPA 5JLAA 1XKXA 5ESRA 1BJTA 4HEJA 4BDSA 4C3OB 2VDJA 3LQKA 1F2UB 5LZ7A 3ZK7A 5LMUO 3QWIA 5LQDA 3CU5A 1C1DA 5EEGA 3TZ6A 5E8JA 4CH6A 1GNSA 3MUEA 4Q3CA 1RAEA 1T4GA 3DLTA 4MUAA 4FYKA 5IT4A 4LOKA 1QH1B 1D0SA 1Z4IA 2XHBA 2RMKB 3ONDA 5AVTA 4OH7A 5COQA 2P22C 2WOJA 3A0RB 1O96B 5CT4A 2WLIB 2LDXA 5J3JA 4XSGA 3E8SA 3DD1A 3EZNA 3KC2A 2Q8NA 3EIQA 5E4YA 4OYHA 1NATA 4BDTA 1E9AA 2W4IA 3KZKA 4KPGA 1KVQA 4GWGA 4HVAA 1BEEA 4IY1A 2IH2A 5CFRA 1JPJA 1T1IA 4QU5A 3RRNA 1Y1TA 5LM3A 3QMWA 1L1QA 3A3YA 1TD1A 3H1HH 3NTVA 2QE7G 3MELA 1BXRB 1RHJA 5KINB 4NV0A 4P31A 4R01A 2VYQA 3LPAA 4G37A 2MR6A 2OQRA 4KSBA 4TSFA 5EJFA 4J0CA 4DCPA 2RDMA 3KUUA 4EYKA 4WKGA 4AXXA 2DETA 1PR5A 4ZVTA 1PQPA 2R8ZA 3ZWCA 2GPTA 4L73A 4XLTA 5D1HA 1KOFA 1S3IA 4AW9A 4XDGA 5LYJA 3PR1A 1LPOA 3T0GA 4IO0A 3PDJA 3QU2A 4B3IA 4MVJP 3KSDO 3LKBA 4RY9A 2O5CA 4RHUA 2ZYRA 1C30A 4M9UA 1J6UA 1A0OA 2P3QA 3FNRA 3I28A 4JYZA 1CUAA 2I2AA 4F1JA 3QKRA 2ZZMA 4PCVA 4ZIRB 2IHNA 1P2DA 2PA0A 3H04A 1BAPA 4HGYA 3BICA 1XZHA 3FFAA 1DX6A 1QYCA 3NH9A 4K6GA 3ZBUA 5BSRA 1IN1A 3RARA 2IPOA 2R44A 2R8YA 1TYDE 1ZNYA 2VA9A 2XMZA 4L4SA 3INGA 5FWYB 4QQFA 4QX6A 3R7AA 3P7MA 3M9WA 5EQJB 3CLSD 1VRCA 2C88A 5LA6F 5LMNB 5LCXA 3ZUGA 4B2LA 3VO9A 4F9FA 4XWKA 3IE1A 2PKWA 4S1PA 4X0EA 5SY6A 1PF7E 4QYXA 3UAVA 3WK7A 4DSAA 3L74H 1KEKA 2C9MA 3EIHA 1MX3A 2GA9A 4U39A 4GR9A 5KNBH 3MYYA 1OYVA 4OSEA 5C52B 1VIMA 2E49A 3VTZA 4HL6A 2HIGA 1NAHA 3BRWA 2XNKA 2V58A 3I76A 3JARB 3R3WA 4Q5IA 5HMMA 2BDEA 1YJNV 3JZFA 3RUEA 1P9NA 2A2ZA 2VXBA 4BWFB 3U13A 1HG0A 3HZOA 1FMTA 3G8DA 1Y8ZA 4JYPA 1QKKA 4DBZA 5J43A 4LF5B 2YY5A 2Z9CA 3BIWA 2H4XA 1JRLA 3GLTA 4DVJA 2QMEA 4LI0A 2VT6A 3NOVA 4Q20A 2BKLA 3KHTA 3ZXSA 1MB4A 5BV8A 1H4VB 2LCFA 3VZSA 1CY2A 3WWDA 5B58C 3ZHCA 1NQVA 3SGLA 1A8PA 1PKEA 1Q0ZA 1RQXA 2IEGA 3FLAA 1KQFA 5BN3A 1FXSA 1TRHA 2IUEA 1W36C 1OHHD 1JYEA 4YI5A 4RW0A 2R6CA 3JAKA 3MHHC 2W8BB 5KOHB 4NTXA 1K3TA 3RM3A 4CEIA 3UHJA 4QM6A 2ENUA 2IIPA 5EHGA 3FKQA 1LD3A 1RQ2A 4P80A 4FFWA 4QDKA 4FWTA 4CKBA 4L6CA 2JAQA 2I33A 1K34A 1ZVKA 4RPIA 2C61A 2V8BA 1D4ZA 2YZGA 3I5MA 3R3VA 5AKJA 3KAPA 3U7RA 4DG5A 3OP1A 3ZY4A 1PDOA 4UMVA 2UXDB 4EJMA 4NCHA 3VYSB 2HADA 3BWXA 4Q4AB 2AJDA 3HR4A 1NVTA 3MGGA 4CCAA 3NEYA 1NBMA 6LDHA 4U7OA 3F5MA 2FR8C 4TT8A 2R25B 2HMAA 5AXDA 4L4UA 3DPIA 1FY2A 1IQPA 2AFHA 4JYMA 2WPDG 4TV9B 1IM8A 3PZRA 4MS4A 5FQNA 4K26A 3VR6H 2Z2XA 1GZ7A 3PGVA 3OM9A 2OLKA 1WB9A 4QGAA 1QKJA 4AXBA 1X19A 1HDJA 5JH7A 1E69A 1IEXA 2ZSHA 4JOQA 1AZWA 4Q3OA 4QBFA 3V2IA 3D6JA 3ICVA 5DCWA 4AG3A 4BKMA 4BB9A 2C98A 2ZYHA 4UAVA 1GKUB 1V5IA 3TBHA 1BCCH 1KAMA 1SUFA 2Q9CA 4IIEA 3TFQA 5KBYA 3DONA 3HY4A 3WBJA 4QOIA 3ZDRA 4PNHA 4BQEA 3GLUA 1DCFA 3AUJB 2BGNA 1T9AA 2OT5A 3HUFA 2XUMA 3M3HA 2VAPA 1Z6XA 1I7LA 3D0RA 3HCRA 1E79A 1QBKC 3QPAA 1P2BA 4TTRA 4W1SA 3ZHXA 821PA 3JWHA 4P2GA 4PR0A 5BSUA 3CN7A 3KX2A 3MUFA 4UVEA 3K15A 1UOEA 3CLRC 4BO7A 1RE1A 4LKOA 5IT9A 4MKIA 1SA0B 4PS1A 3BWVA 1XP5A 1DDOA 3FBWA 1XD2A 4D6TH 1VSBA 2Q28A 3BIXA 1HFKA 2AGVA 1BE1A 4H6PA 1YKSA 3SR3A 3BHMA 4MQLA 4I81A 2O2SA 1OZFA 2AA3A 2QX9A 1E4VA 4HGNA 4DMKA 2YDXA 2ZE5A 1VGRA 4WJZA 3ZGLA 2YXHA 5B3JC 3TAXA 5TC4A 2R68A 3B3GA 3LO5A 1L5LA 3DZKA 2G5TA 4EL5A 5C4GB 3KR2A 3LUAA 3RBVA 5BW4A 1BFDA 2FEPA 1I4LD 2OZVA 2F43G 2BHTA 3L1HA 4NHOA 5HF9A 2P2SA 3AFGA 1W2WB 4UZFA 2P2GA 3P4XA 3ZLTA 2CNKA 1YI1A 2XASA 2ZVQX 2YL2A 2WLTA 1QR2A 4LTDA 1SQVH 2GUZA 2P0EA 3BXOA 1X0VA 3SLRA 3UUFA 1BXGA 1KSFX 4CT0A 3B1WA 4G41A 2O8CA 3FPJA 1DZ3A 1MT0A 2NZWA 3A04A 3AONB 2UYCA 4URXR 3ONEA 3ZXXA 4BP8A 4RTSA 2PZKA 2C4TA 3AT1A 3MXTA 1FB5A 4UTOA 4Y0VA 1IOLA 1ACJA 3JTMA 3PYMA 4IDPA 2QKAA 1QIIA 2ZUEA 2UXBB 2VATA 1Z62A 2WJGA 1ECBA 2YWDA 4FDAA 2F55A 4JYAB 1P9RA 4RZ2A 1Y4DE 2OG1A 3MYRA 1YULA 2QNRA 1DWPA 4TSRA 1PQ4A 3I01M 1S4QA 3E61A 4OQYA 1W94A 4R1MA 1ISRA 2VS1A 4J0HA 4JUFA 1NLFA 4KI7A 1I51A 2A1TS 4IYHA 1GFSA 3HCWA 3ZRWA 2A57A 2Q7HA 5D1NA 4NJEB 4ZYUA 4ZVNA 2QRVB 4FFSA 4HNQA 3LWDA 1OH8A 2ZW9A 2H7CA 1M57B 3FYIB 1VRWA 1VOTA 4OUDA 1PWXA 1YDHA 3DO6A 3UCSC 1JDBB 3TLCA 1E61A 4DRXB 2CMKA 1GEGA 5K3BA 2WB2A 3K5MA 1TT5B 1JG6A 5CA0A 3EW7A 5CA3A 3AGPA 3DHYA 2B4TO 3RFXA 5AIBA 1YJXA 5AJYA 4BXOA 1IG0A 1IUPA 1TJ4A 2EOAA 1VE5A 2FW0A 2QD4A 6NULA 2JGLA 4J42A 3MMPA 4QUIA 2FZCA 3HCNA 3CBQA 3DW3X 4M2LA 5AG2A 4DMLA 2WAXA 1OZAA 4OKSA 1MB2A 2VK2A 4QG7A 4OMCA 2XMGA 3O4FA 4IJQA 2DR0A 2Z98A 1RYNA 3SFVA 1IDOA 4YXWG 1XVTA 4D3YA 3I9LA 3NQ41 4XE5A 8ABPA 1YJWV 1MB0A 3MF4A 2O8VA 5MN6A 3ET5A 2B1IA 4D7TA 5A0TA 2E4ZA 2HLNA 1ZITA 5TSDA 1J9GA 3K9LA 3FCCA 3ADKA 4QAJA 1BXGB 2JFZA 3DKVA 3LNTA 4FMCB 2EGUA 4AK9A 1Q1EA 2GFHA 2PRYA 2DR3A 2Q1WA 1WZIA 3CRAA 4PA7A 1NFRA 2JVIA 3DM5A 3PRHA 5TPZA 1NI3A 1RRPA 2CVPA 4KMMA 3SEQA 3STVA 3UAGA 5BV2P 2J9FA 8OHMA 4XCVA 2P4UA 2WYOA 1JDPA 3KXIA 4IXWA 2DUNA 1GGJA 1WZCA 2IU6A 3MD9A 1TAEA 3QYJA 2P5SA 4LBZA 1SIOA 4DO2A 4Y7DA 3X1KA 1C3OB 1FP2A 2KSDA 2G5GX 3F5SA 4IJUA 4ALLA 1KKUA 2ZYUX 2IW1A 3M5DA 5FWAA 4C2AA 3B5JA 3ZDFA 5JSQA 3RHSA 3UA3A 3EWAA 1RYYA 4ZI3A 1Q90D 1ORHA 2DT5A 3OIUA 3LUPA 3NVDA 5ALSA 2YRXA 4GL2A 4C4SA 1KO1A 1XNQO 3SJBA 5B1AB 3PPWA 4MB2A 4KREA 3NGMA 1ZLXA 1MQSA 5JJNB 2PO5A 4WN3A 2V4DA 5FNVB 2WSSD 1I94B 1K5DA 3CM0A 3E53A 1HT3A 1JSLA 5ABPA 4BTEA 2QTWB 5A3VA 4LMPA 2ZYTX 4UC0A 5MN5A 4EENA 5CM9C 3ZD9A 1N8RW 3ROMA 1DXOA 3O73A 1OA1A 1T6XA 1W46A 2WKQA 5DM0A 3GC6A 1TQ8A 1LR1A 1MGPA 2DCMA 3TCNA 5HJ7A 1H0SA 3T1HO 1UJ2A 4KE8A 4KYTA 3AERB 2QPAA 5HKKD 1ZLYA 1B2RA 2CXOA 3HU2A 3RIMA 3WFJA 2AX4A 1UXHA 4QA9A 2YXEA 2JJ2D 1WS6A 4O3FA 3NTQA 3A37A 2MWMA 1TU3A 2QMUA 3EPKA 2P8JA 4TV9A 1DQPA 3C3TA 1FNNA 1Y1LA 4HAVA 4MRRA 4TTPA 1E3EA 3RVKA 1C8VB 2Q1UA 5K0JA 1ZMOA 3RW0A 1DLBA 4Z7QB 1XOIA 1RXCA 1YVEI 3ZG6A 3LNMB 3HNRA 1JDNA 1ESCA 1FTWA 1XHEA 2E0IA 2AJ8A 2XTZA 3JWEA 1G42A 2REXB 2VDOB 1VARA 1VSUA 2PSDA 1RI3A 4U9HS 4ENSA 5BUQA 1NN5A 2VF4X 3R0XA 2ZJ3A 5EUQB 1TO6A 1AKYA 1IVSA 4WAUA 5B3SB 3LZDA 2QWQB 4J0IA 4W5WA 2JS5A 5D5QA 1E94E 3BXPA 4IP0A 1JFVA 1XAIA 2W4QA 4PAGA 4Q9LA 2CJYA 1A27A 1L4UA 5E2IA 2PRKA 5EN4A 2IWRA 3HA3A 2RHMA 3DDOA 3ZZTA 4CUJA 1O8CA 1HR0O 4DPLA 5JAHA 5BNIA 1ENVA 4X84A 2WMDA 5KNDD 3AJ9A 2NTEA 5F5XA 5F7XA 1GQFA 3BD6A 4G3XA 3NTUA 3F5TA 4RVHA 4L5YA 3THRA 3GJZA 5D5PA 3MC1A 5CBKA 4HPJB 3FI0A 4BO8A 5BWBA 2X19A 4QUEA 4A7PA 1IX9A 4DR4O 1HTBA 4I1VA 3S1AB 1J5EB 1DAEA 2R9IA 1ECPA 3L6CA 1Q7BA 2QP3A 4F3NA 1SQPH 1Q0SA 4GYWA 2PUDA 2WMNB 2GD2A 5HM6A 2OMEA 3VQYA 5IDJA 4JZ2A 1DLIA 1RRVA 3E7WA 4OOEA 1MC8A 2W2TA 1PZNA 1W44A 5C81A 4QTTB 4XCXA 1T0BA 1ADFA 4KN9S 3DDNA 5ALOA 1T4BA 1EBBA 4WZ6A 5HK9A 1ONSA 3EE6A 1E3TA 1ZFNA 1SHUX 1P80A 2OGUA 2QLTA 3D6UA 3MBIA 3MHPA 3OM8A 1UC9A 4FBMA 2YDEA 1QIHA 3RC7A 4X65O 4DADA 5FTKA 5ADWA 1FS4A 3BHIA 5I5GA 5U4XA 1A7UA 1FPQA 2W6IA 4G26A 2CB0A 4FZ3A 3F9IA 1IFXA 1VE1A 4PLCA 3WO1A 2QJRA 5LLTA 3T1VA 1FP6A 2YX1A 3AW8A 1W52X 3T1QA 2Z2YA 4OKNA 4MGYR 2D2VA 2I7XA 4AKTA 1Z9BA 3P0IA 3SYKA 4UHDA 5DT9A 4CM7A 1KC1A 1NR1A 1FLAA 3LRXA 1IBCA 1ZWKA 2IDJA 4XDYA 3AHJA 4C1BA 2EILC 3OOWA 2JHGA 5I4BA 2H63A 1PLKA 5EVCA 2CLIB 3UMFA 1UF9A 4JASA 3PVZA 5HF6A 3WAKA 2VCEA 5ECWA 4HSGA 4HTAA 1FX0A 4PICA 2P6JA 5CA0F 1X70A 5TJ9A 1JFLA 2UDPA 1NIPA 1XQWA 2XXBA 4G8BA 4YLEA 5CVTA 1Q6YA 2ETNA 1OI2A 4IX1A 3JQQA 2XMPA 3QFHA 4J6FA 1WUYA 5KHJA 2QSYA 4ZJZA 3GA7A 4IQ0A 3WJ7A 4KSYA 4GF5A 3VAYA 3SI7A 2QMOA 1Y8AA 2W6JA 1RQGA 3OLWA 4KH0A 4AICA 1ZUIA 4WCFB 1P0PA 3MGAA 4IHKA 2QXYA 5JBQA 4FT4A 4KQCA 3E89A 4URVR 3VBCA 3T1YB 2Y05A 4BU1A 4HAIA 1E0DA 1CUYA 2GDZA 1ZISA 4LBEC 1DWUA 2ID7A 1UZNA 4LC9A 1K5QA 4KHPB 1P2VA 1E3MA 3BZWA 2A9KA 4H33A 3IFXA 4LFCO 2QQFA 2EBUA 2DQYA 3GG2A 4HDQB 2SHKA 5JV5A 2ICAA 1JHUA 2BZSA 2V65A 2WIFA 5AI9A 1C0EA 1C1YA 2PZSA 1ARZA 4PZDA 4YQFA 1KU6A 3ZMSA 2D8AA 3H5VA 4LQCA 3D7MA 3LY5A 3LBIA 5K03A 4C4RA 1HKUA 1GLVA 2XUDA 1JT2A 1XNJA 4KIFA 3UHOA 1OAAA 3DOJA 3UV6A 3HVRA 3C7TA 3IPXA 4L08A 3TB6A 4YCCA 4GM1A 2C2ZA 2FRXA 4I55B 1FNCA 3BH0A 3A06A 4PPQA 2NW6A 5A4AA 5AW0A 3NI2A 5ULLA 4HJXA 4HQNA 4Y3UA 4QNNA 1W5SA 3OOJA 3OE4A 4BLWA 1KARA 1E92A 4YMIA 3USZA 1PFYA 4J0DA 4QTYA 1G3RA 2HQSA 2WDZA 3CCSV 1CE8A 2ZINA 3KDAA 4LZWA 2VTBA 2ZRCA 3NDBB 1TYAE 2C97A 4BEJA 5CVDA 3CWCA 4Q3LA 4OJQA 4NENB 2XKAA 1I6KA 1VQ1A 1JHAA 3FYUA 1HDGO 1XKLA 3AY7A 1DAIA 2J0VA 1AQLA 2DYRB 1TJYA 2PUWA 1G8MA 4AFNA 1UZAA 3DYIA 4R9UC 4LX0A 4BNYA 5JD6A 3OFND 2R65A 1X59A 1RSOA 2J3KA 3D2LA 5JDCC 221PA 1VQ5V 1LKZA 3QX8A 3OEEG 2GJSA 3HY6A 5KNCH 3R2JA 3H11A 1V8OA 2OHIA 3HA7A 2Q6KA 1HE1C 4QEKA 3IILA 3N07A 3NV9A 4ENVA 1JMVA 5CVEA 2PIDA 4FZ0A 3E8MA 4B0OA 2OCXA 3ORQA 1TCVA 3N8IA 4K6HA 4CCWA 5HW0A 4CEHA 4WBNF 5GTIZ 2ZJ0A 2EG5A 2W22A 1RAAA 3U4QA 2DPHA 1M66A 5JAZA 4ZRDA 5B6PA 1L4KA 4Q82A 4ZTBA 3JR7A 3BULA 1ISJA 4ZZ0A 3GPBA 5IDXA 4CKBB 5LP1A 1F4VA 2CBXA 5I9IA 3H8JA 1PGOA 1A9PA 1EVYA 2O2GA 5DGDA 2HZBA 3MSCA 3DTYA 2X76A 3W3AH 3LGXA 4CCSA 1E79G 1TEZA 2BSQA 1DAFA 2FPRA 4KNVA 2WHXA 1AP5A 3K3WA 1M2HA 4N47A 3WZ2A 3H18A 4BO2A 4EYEA 2QM4A 2C07A 4LNUB 3ZHRA 5LGTA 1CRZA 2FLWA 1VLLA 5LZ2A 3LSSA 3CNEA 4XYGA 3GRAA 4JI2B 5AXAA 2WA4A 3OFVA 1KZ1A 4XD7D 1QHHB 3JYOA 4J0GA 4J4BA 1UEIA 1V1RA 2COEA 2EKDA 3LI2A 4DDKA 4TZ6A 1DTSA 3AVWA 1ZMBA 1U6JA 2OXCA 2HNAA 1H5UA 2XDQA 3E2EA 3C3WA 1BKDR 4Y9DA 3O21A 1BHBA 1P7CA 2MSWA 5AXBA 3BE5A 1VEWA 3OVMA 1R5BA 3ZWMA 1W47A 1VQKV 2FZEA 5J9PC 3U40A 4A26A 5HDQA 3INNA 3W3AD 3FPKA 3OOSA 1ZGAA 3M4NA 1K8AW 3H1FA 4IRMA 2OYQA 4DUYB 1XB2A 2OFWA 3BMCB 3P9KA 4B1FA 4ER6A 3F98A 5MDHA 3ZEDA 3EQZA 1EDDA 2O3SA 3UB2A 3ME5A 1U4NA 4JAVC 1OAOA 5D5HA 5REQA 3CZ9A 1UT8A 1TA4A 1AUXA 1HY3A 2VRBA 4OXXA 3V1UA 3CUKA 3U60B 1PW7A 1TJ3A 3OZRA 2D1RA 4TLAA 4UPDA 3WBBA 4B46A 1F3OA 5GZ3A 3AVOA 3ECAA 5JY6A 5F2VO 3L06A 2I4RA 2Y67A 3HDHA 3E8GA 5AK5A 2G36A 3ZWYA 1YZLA 3X2SA 4MMZB 4CEJA 2WD7B 1XXHB 4YNBA 3AK3A 3ZDCA 2AD5A 3TQSA 5HGJA 3RHTA 4S0ZA 5JCZA 3R7DA 4DAEA 2Q3LA 3JS5A 2NUAA 4CF6A 3NV7A 1I2DA 1AS3A 4GC9A 5EESA 4QOEA 5EKDA 3ZQKA 1AUQA 1KI9A 2FRDC 2H3EA 2HOQA 2IYOA 1DOAA 4BP9A 5K01A 1TQ2A 1Z18A 2G6BA 1SOUA 4R9NA 3GLGA 3AKYA 1WUHS 2AR0A 3CNHA 5T4FA 3HFSA 1E5TA 1H2SB 1M73E 3VHRA 3ORYA 1Z6QA 4QU8A 5JFGA 1FMCA 1FFBA 3AI1A 1E5XA 2OBBA 4P30A 4WNAA 5G41A 5TT1A 3CKLA 2Q3CA 3ODPA 5EGNA 2B34A 1KERA 5GV7A 3WJ2A 5JJ5A 5KUTA 3AEUA 4YUVA 1UDBA 1CWUA 3OPNA 5BXYA 1ZJYA 2B8WA 1N5KA 1IB6A 2H2AA 2WSMA 1HM5A 4K9MA 4B44A 1BDHA 4N0QA 5DRTA 2O2IA 1VKOA 3BXZA 4WBXC 1KBZA 4BO4A 3H4IA 1Q14A 3W0LB 3ET4A 4DY6A 1R4MA 4FR0A 4R1LA 2E75B 3IC5A 1CDDA 2IPXA 3AWDA 3VR4H 4MS1A 2J6CA 1RP1A 3ADPA 3HBLA 3OLCX 3N0TA 5B1DA 3NAMA 3F46A 3T94A 3KQSA 4E03A 5EIEA 3L9XA 3RYHA 3ZNPA 4IUDS 1QK4A 1RLOA 4ZHQF 5A2QA 4TT3A 1NUPA 1DHRA 3QMVA 2Y1GA 4ETWA 1GPUA 4R51A 1Q92A 1L9KA 4GYKA 3HYSA 3IVCA 5ECDA 3W8EA 1ZQ9A 2PPLA 1U0JA 3FOCA 2AOUA 4TS1A 4MW4A 3DC6A 4Q9IA 3UHAA 5AK4A 1MNAA 1I5EA 1HX7A 3STHA 3BFJA 3RRFA 4DANA 4X20A 4KR3A 3FWZA 2FA9A 5F2OA 3ZMUA 1RKQA 3DBVO 3R7WA 1A5TA 1CJMA 1PG5A 3EISA 3NTOA 2YWEA 4FKZA 1X2EA 4O0LA 3AF0A 4IIGA 3TL3A 2FLKA 2FW7A 4DCUA 1R6KA 5K9ZA 1LI7A 1IUKA 4NWIA 2CKMA 1L5FA 1V39A 4HUQA 4KMSA 1KE2A 3DWEX 3UJCA 5ALFA 2GB4A 3PXDA 2CFCA 2Z43A 3FCSB 1KMNA 3KZIZ 5JXIA 5EMHA 1CKEA 1TMYA 3HWWA 4Y6SA 4MRSA 1TU0A 4I1YA 1D5AA 1SUDA 4X00A 5ALYA 1JFFA 4TT3G 4Z0HO 4YAIA 4ZRMA 4IWNA 1M6EX 5G2OA 1XPRA 4HEQA 1EINA 2R1ZA 1YB6A 4X90A 3KLNA 5JBNA 3GHYA 1B8PA 3X0DA 3L04A 3C5WP 5B3SC 2LFSA 4PQRA 4PTYA 2QYOA 5IDWA 1MX9A 4BO3A 3JD4A 3QVGA 2X40A 3BSWA 1JIQA 4FJ2A 5CW2A 1AMNA 1VGVA 4M21A 4M9QA 3GBPA 3UQZA 5I7RA 3PYLA 3KJEA 1AGRA 1D5WA 2BEVA 2ZIXA 1M6VB 2C2HA 2C1XA 3A7DA 3SQLA 4X1YA 4B3MB 1OT5A 4DV2B 1VL8A 4J2TA 3FR7A 3H5OA 1FVHA 1QF9A 5FLKA 3LYLA 4YTEA 3LLCA 1BHO1 1C0KA 3O83A 4QGFA 5I7WA 3C4JA 4AS1A 5KCMA 1DB3A 1P1JA 1SUWA 1VE9A 3OCCA 2XT9A 4WKNA 3V8EA 5JQWA 1KKLA 1KYZA 1R73A 1JZSA 2JJMA 4YJ3B 4XX1A 1UDRA 5LXTF 4BNHA 1S02A 4YRAA 1Q2UA 2GWHA 1TW2A 1Q0QA 4R05A 2ZT5A 4N65A 4TS4A 4PA9A 2WD8A 5DOVA 4JJEA 3BWBA 3SIXA 1S89A 3PQEA 4E2ZA 1VL0A 2UYQA 4HLUA 2D1SA 4E2XA 5K3EA 3RFTA 4R2KA 2QRHA 4HYQA 4G4SP 3V1MA 4RLQA 3VDMA 2BKEA 4BNWA 1MRZA 1NF2A 2YOGA 3CHYA 4OHOA 3GLFA 4DIMA 4YDHB 4AJ2A 3R7BA 3VKFA 2AL7A 4F3CA 3K5IA 2X8LA 2R0QC 4YT4A 5U4QA 4IKEA 2JJQA 4UDNA 2CL5A 1E2LA 1IBSA 1JN0A 3IEIA 5AXCA 1F1JA 4MVYA 4XIFA 1YE3A 2LCIA 4YALA 4FU0A 5EJ7A 1MNGA 4QGPA 3MN1A 1HGXA 2CLFB 2CXRA 3OF2A 1IYZA 4PNZA 2RHJA 3JQ9C 4R2IA 1QF7A 1T8TA 3UN1A 1RM3A 2HBZA 1W4AA 3BFVA 3N5KA 2X42A 2LJ2A 3O65A 1DTOA 1GNPA 2GYYA 3DBRB 3WNZA 1T2EA 4ZA2A 1J5PA 4PQYA 3VNRA 3KB1A 5B3AA 1E32A 1LLDA 5KAPA 3ITEA 4MVJA 1SQ0A 4YQEA 1QAQA 2IXTA 4ZXPA 4EO7A 5AOBA 3IA2A 4IDFA 3C70A 1DBVO 2P2CA 3FRHA 4L76A 3E3MA 3A1EA 1NYQA 2P69A 5DYGA 1MX1A 2VOJA 3LPMA 5F9MA 4Q12A 4IQGA 3NJ8A 3L8YA 4E09A 3FRIA 5AW3A 4B3GA 3LVRE 1V55C 1A95A 4EF4A 1RWKA 1XJCA 2FZ4A 2XRMA 3O0TA 4LDAA 5BSFA 2BGWA 1J7JA 4N5MA 1JYSA 3G5TA 4KQXA 1HI9A 2PUAA 5CVUA 3PJRA 2JIMA 4KIJA 4G0UA 2FQQA 1VKHA 3P5BA 2R72A 1RYHA 4Y1RB 1I0LA 3RBZA 3PHLA 1BSVA 4G84A 4PYJA 1C9NA 1VQNV 5JMPA 3WLPA 4JN6B 2BEUB 2P90A 1ULSA 5EE9A 2BKUA 1FE8A 4HZ3A 3R0VA 4FZVA 4ARBA 4TYNA 1NW5A 4ZOLB 1SEVA 2H54A 1AUVA 3ELBA 3WLAA 3RV4A 1B6QA 5IK2A 2QRZA 2G04A 4M1ZA 1D1SA 1SKAA 1ZNWA 4QXOA 3L7AA 1UKBA 4PG4A 4QSHA 1MABB 1GUZA 1QYRA 2H5LA 5A5VA 5JZ9A 3IGAC 3L7DA 4ZHQB 1FKAO 2DUJA 1SQ6A 2OK7A 1UBJS 1HQKA 1FJGO 2I3DA 4S1OA 3WL8A 2FXIA 1LSOA 3H75A 5HJ2A 5BN1A 1WOYA 4JFRA 2QTLA 4AWXA 3VJLA 3PEUA 2OOKA 4IMJB 3FGZA 5FBHA 3N2ZB 3FKSG 3T4EA 2VDWA 3VHLB 3NWJA 1QU7A 4IGKA 4RVUA 1EFPA 2V6BA 4J7KA 2QN1A 4J7ZA 2C8LA 1H2LA 3ND7A 1TECE 1F4LA 1H2AS 2GCOB 5BSGA 2J3JA 1LTHR 2RGCA 3E3LA 4MI1A 1ID8A 3HB7A 4CQMB 1KYXA 5JO0A 2NQ2C 1DKOA 3RHFA 3ZW8A 4S04A 5AHWA 3V48A 1B7GO 2I76A 5LYJF 3GBVA 2WT9A 3RG2A 1DJLA 4EDHA 3Q3VA 3CX6A 3UBMA 1VF7A 4HYTA 1QYWA 2VCHA 4IMPA 2Z30A 1LPSA 5EY5B 2A88A 1EESA 5K8IA 4KWIA 1L9XA 2ZR9A 1T1GA 3LNCA 2PEZA 3QXGA 4H3HB 3U7GA 4H3KB 2JD2A 2HK6A 3OSUA 2RC6A 1R0BA 2PYDA 3F1KA 3QOWA 4BNIA 2BI8A 2XH8A 3AETA 4DB2A 4Q4LA 1AK2A 1QWOA 3GMTA 1O2DA 3AEKB 3RRBA 1FP4A 4R9RA 1KAGA 1GEEA 1R8XA 5CH3A 2PMEA 1QTQA 3ZBHA 5BUSA 3ZMVA 2P2NA 4GNKA 2V7BA 3CWBH 3A6ZA 4BWGA