2WAMA

Crystal structure of mycobacterium tuberculosis unknown function protein rv2714
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
307
structure length
294
Chain Sequence
AREYEPGQPGMYELEFPAPQLSSSDGRGPVLVHALEGFSDAGHAIRLAAAHLKAALDTELVASFAIDELLDYRSRRPLMTFKTDHFTHSDDPELSLYALRDSIGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGTVPMAVPHTRPITMTAHSNNRELISDFQPSISEIQVPGSASNLLEYRMAQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQVQASAEVAQVVAALERQYDAFIDAQENRSLGAEFERFLAQQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSERVED HYPOTHETICAL ALANINE AND LEUCINE RICH PROTEIN
publication title Structure of Mycobacterium Tuberculosis Rv2714, a Representative of a Duplicated Gene Family in Actinobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 97
structure length 294
sequence length 307
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2wamA02
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wamA01
2WAMA 3E35A 1S3JA 4HAMA 1RM1C 3W7WA 3WZ2A 3W7TA 3VR0A 5GW7A 2P90A 4G4SP 3MNFA 1NVPB 1NH2B 2HR3A 3IC7A 3W7UA 3W7XA 3BY6A 3D3IA 3GAAA 3W7SA 1YTFB 5CA3A
chains in the Genus database with same CATH superfamily
4ZZ1A 1SB9A 1KJWA 4ZAVA 4J2TA 2B1JA 2CTRA 3W1VA 2VATA 1YFLA 1ORIA 1E9RA 1QRAA 4C29A 3JRWA 1PM9A 2F4NA 2OMEA 1C0PA 4B6EA 1L5SA 5EJ8A 4ALIA 4TSFA 1K8AW 4EHLA 2YMLA 3VR3D 3U44A 3LDAA 5ADVA 4KXNA 1G20E 5EQFA 5IKXA 5I9IA 2R66A 4ILKA 2QL5A 1QJ4A 3CRNA 1W76A 2ZJBA 3CCMV 4B17A 3RYFA 1QGYA 2VTVA 1YAJA 4W9MC 1GTJ1 3ON5A 3AHJA 3TKAA 4JYBA 3JYNA 1G18A 1OHHD 4BBAA 3MWEA 2LGWA 5EC1C 1WZNA 4MI6A 4DQ0A 4C9BA 2WLNA 3OJLA 5FCDA 3R40A 2MSKA 1POWA 4NZMA 3G79A 1ML3A 5JCOC 3E23A 5DWVA 4H60A 1GO2A 5KEIA 3PNPA 1DHTA 3KJIA 3K1ZA 4KIUA 3L18A 4GQAA 3OQMA 4RK1A 4MR7A 1YZYA 3TBHA 2OORA 1GARA 3PJDA 3K6SB 1FOEB 4X3OA 1VMGA 3HSYA 2ACKA 3GLRA 2F1MA 4J16C 1YRHA 4FJ1A 4OU4A 5AK0A 1G63A 3H9JA 2OMKA 1ZD9A 2ZUCA 2FPKA 2D5BA 2VNIA 1PVVA 5EN4A 4B7KA 1ZUNB 2ZIFA 2DFPA 4GE3A 1AKMA 5F1PA 4MMXB 5E7QA 4BNDA 4YJFA 5EP3A 4YEDA 3LXUX 4B4VA 1ZG3A 2KSQA 4KL1A 1EH5A 4KVGA 4IF4A 2JVIA 3V32A 3CH7A 2QS9A 5GZ3A 1PEYA 2HKOA 3C85A 3E8MA 1S8FA 3AEUB 5FADA 2QSYA 4J9UE 1GAQA 1MZVA 4IVQA 3WZMA 2XSZD 1Q3HA 2JLCA 2OORC 4K9PA 5IDWA 2GVDC 2NX2A 3TAUA 1SHTX 2NMVA 2OCAA 1CY1A 2VDJA 3E84A 5AW2A 2I3DA 2H94A 2R65A 1P9WA 1IM8A 3IKLA 5FTWA 3TJTA 1USGA 3EG9B 4LNUA 3DE6X 4G4SO 2IS6A 3LDUA 5FV7A 3AIMA 4ZI7B 4EOGA 3ZXXA 1KDPA 4BMDA 3YASA 2JJ2A 4PV7A 3I6IA 4P32A 1JH8A 4L8WB 4PNPA 4AKGA 1QOPB 3A4TA 4W5WA 4M99A 4CMEC 2P90A 4QECA 1DT3A 3P9NA 4ODIA 1Q20A 3TPFA 2V9PA 5IT0A 3VKVA 2IZ5A 3RIEA 4BGEA 3F8WA 3VPGA 4EY7A 5B57C 1Y98A 1E2HA 2JI9A 2RJOA 4ZQBA 4CFSA 1E1MA 1NFRA 2GTAA 3VH2A 5HJ2A 5FOTA 3FZNA 2Q5HA 2Q3BA 2AD5A 1T36A 1SHJA 3HQ4O 1FYJA 4C6SA 1JDBC 4M0EA 1UJNA 3LCVB 5IUKC 2BMDA 3ZEIA 1ZJZA 2E7ZA 1JLKA 4P4SA 1GPYA 3S5JA 3TCUA 4CHGA 3AEIA 2PZ8A 4FC6A 2DRIA 3O82A 2N05A 2W58A 4IHAA 5K6AC 4L3VA 4NMXB 4UVEA 3B5JA 5IVIA 2ABWA 4M8NE 1XELA 3LRPA 1CJSA 4B46A 4JLDA 4DM7A 2ODBA 1TMOA 1U81A 5CUQA 2OCGA 3V42A 1PNVA 1I2CA 1H1LA 3V1UA 3LX6A 4ZOLF 1DKLA 3BY6A 3FPHA 4PLVA 3VBEA 4IRUB 3ZR4B 5CH5A 3S40A 1LVGA 5IM4A 4JLBA 4F84A 1YKSA 3L4KA 2YINC 3TOVA 1MJ5A 4WCEV 4B08A 4J0IA 3K15A 4P7GA 2I2FA 3NTXA 3PDUA 2DWQA 1G16A 3Q9UA 1TGYA 4NBUA 4BC1A 3LHKA 2WR8A 2W6CX 1RYFA 2EFEB 3AUUA 5C80A 2H1VA 3B8EA 2PRYA 3BD9A 3VGPA 1Z68A 2F9LA 2QY9A 3VNBA 5AESA 1B0AA 4EHNA 1L0NH 2WIAA 5F9HA 4BVEA 2IYAA 1YBVA 1R74A 4HXFB 3DBVO 1NP6A 3WLOA 4LI0A 2XWQA 1MB3A 4BN4A 2K2WA 5I9TA 3KUKA 3ZE1B 4MVMA 5LGUA 2EINB 2C2GA 1N6PA 3CISA 2H48A 3WWZA 4WE3A 4FW9A 4ABYA 2GEJA 5ED4A 2P40A 1Y3DE 5JUWA 4KX3A 2CJPA 2A9HA 3QJ5A 4DL9A 1M0SA 4RHEA 2BELA 4L72A 4GLLA 2RAFA 3N8HA 1ZOPA 4NECA 1W1WA 1IZ7A 1Y1TA 3MD0A 5FDFA 3WQSB 3O1LA 5EXPA 2GD0A 4JI2B 1COZA 1DJMA 4ZAWA 3ZIAA 3DHEA 3AVQA 3BWEA 4Y9UA 5E8JA 3N1UA 5I7HA 5LL6Y 3NBAA 1QR9A 4BW9A 3EC7A 2VTEA 2RHCA 2ZREA 4I8DA 4Z0NA 3TW4A 4LHZA 4NZ9A 2B34A 3DKRA 3QLVA 5FFMA 3RI3A 4R7CA 4RF5A 5CBPB 5BN5B 4B76A 4URZR 2KMLA 4AIRA 4D9NA 4NENA 1L8OA 3JZDA 1QF9A 4J6EA 3B3QA 3SFVA 3H5NA 3RYFB 3DXYA 2GN0A 3G9XA 3PQEA 3QTTA 3DWGA 4EHKA 4N9WA 4X65B 3PA8A 4ND7A 4TTJA 1YDHA 4H6XA 3GYGA 3THYA 1P18A 1OGJA 3BZBA 4CMAA 3MWEB 3Q3EA 1QP4A 3KHSA 4O4LF 1K9VF 2F9MA 5T4EA 3R3WA 2O8NA 2VO1A 1ZS9A 2H7XA 1WZCA 1XEAA 2B21A 3B36A 2OXRA 5K0EA 1FFGA 4YDRA 5KTTA 1KORA 1W46A 5CLGA 2ARHA 5BV0A 4GECA 2UYCA 3H3JA 4MR7B 4HH3C 2Q27A 5CDFA 4R9VA 3H0KA 7ADHA 1RMTA 3QLVC 3NVKI 3R8CA 1JJ2U 3G80A 4XVRA 3IEUA 3I9LA 3FMIA 4RTOA 3I3SR 3I6ZA 2CCGA 1MP0A 2P9TA 3CHYA 2FOLA 2O3RA 3Q3IA 3ZWAA 1C7EA 1XTUA 2YR0A 2HWWA 4Q3BA 4BNDB 4YJFB 2IDKA 1J1ZA 2IIVA 2NXEA 3VZPA 4BEJA 2OIGA 2UYOA 5JQWA 1XTRA 2XOKD 2VPXA 1TQ4A 2FN7A 2OHFA 4V0ME 3QYPA 1ZUHA 5BSVA 2EZTA 5DLQC 2L0XA 1L7QA 1CEYA 3L0PA 3RFRA 4F92B 4MARA 1YULA 2GHTA 2Z8YA 5JNTA 2XZDA 2XUGA 2A58A 5L95A 2V0CA 2O0MA 2YICA 2R6HA 1XEFA 5LLDA 4OQLA 1GEGA 3AO0B 2V4UA 2QLJA 3HTXA 4IUBS 4N47A 3QK7A 1AHHA 3ACDA 5EIWA 3ZWVA 4KYTA 3T3EA 1E0JA 4V0SA 1USIA 3FTFA 3D2BA 3RRZA 1OOEA 4NPCA 2Y1DA 2QMZA 4TKVB 2Y9MB 2IH4A 3UK0A 1KKCA 3OAAG 2YI9A 2HSZA 4V0KA 4MVUA 1M8JA 4QNMA 2LCFA 1PZHA 4LECA 2G1JA 3CNLA 4M9SA 1CY6A 4I0XA 4G5XA 3DWFA 4WQMA 3C5CA 2YMMA 9LDTA 3SEQA 5JCZA 4FYKA 2C8JA 4AQYB 2BMEA 4LXUA 3CMCO 1FU4A 3AV3A 3U3RA 3CCVV 4CM9D 5FUYA 1EZZA 3NTOA 3ZVKA 2AXPA 3K30A 2O8CA 1T4GA 4P4SB 1CR2A 1NVAA 4EI9A 4C89A 1HTWA 2AYZA 2HSGA 1HEUA 1IOLA 2H7YA 3ABRB 4PAQA 4LDZA 1MZFA 4P53A 4PDVA 1UAAA 3K5OA 2LWIA 4FIPC 4JI1O 1H1LB 3N58A 1C80A 1JEJA 4I6GA 3PUWA 3AG1C 1E5QA 3CA8A 4B6PA 1H8HD 1DC7A 4XGIA 1NU8A 1LBIA 5AVTA 1YZGA 2F90A 1Q5PA 4CLHA 2YVAA 1REQA 3TXQA 4I7ZB 3OP1A 5HCNA 3KHKA 3ESAA 2KI5A 3KHTA 3N8DA 1FQOA 2R8EA 3I62A 3PX3A 3ZBQA 1GTRA 4EPWA 4FFVA 2FSIA 1DTEA 1I7PA 3BILA 4J90A 5I3ZA 3IELA 4KGDA 2WLTA 1BN7A 4UU8A 4A92A 4RF2A 3DB2A 4H37A 4D0GA 2G9RA 4NZOA 3KPWA 5EJEA 1LSOA 5JMWA 4B8WA 2FEAA 3QY0A 1BMQA 1DBQA 1RJ9A 3WNDA 5B58C 3WA6A 4QBHA 1GGFA 3BTUA 1M6VA 2OCHA 2HD4A 3MMPA 3ND6A 2OHJA 4INAA 4JVNA 4E15A 5IJ9A 3NAZA 3RJMA 5IZCC 2ONJA 5DBEX 3Q0TA 4NXNB 1MO3A 4NTWA 3TNYA 1LLFA 2G4CA 2JLBA 1VCHA 2JDID 2NXWA 1W47A 1CNFA 2H1FA 3AYXB 2JGEA 4H1TA 5JIBA 2B1QA 3ZS8C 4B6OA 5HXAA 1CC1S 1P29A 4QYXA 3AL0C 3X1JA 1MB4A 4A9AA 3DXXA 4DLLA 3K0HA 3S8EA 5I7AA 1KBHA 4UBJA 2X86A 1EVZA 1G5HA 4PZ9A 1BC5A 4QU9A 4KLAA 4CTKA 3CCLV 1A8UA 3C39A 1S0UA 4YK7A 1K3FA 3M1YA 1X1EA 5B4UA 3ZY4A 4WGGA 5FQOA 3B2EE 1YNOA 3K72B 3PS9A 3D8UA 2LKDA 3EPJA 3KNZA 2IKQA 1KFCB 4GZ3A 2Z0MA 421PA 4NENB 3NEPX 4NE7A 4PLHA 2IHJA 4JC8A 1L1RA 1LTQA 2QDOA 5F76A 1KQSU 1L8LA 4DCUA 2VRZA 5B7QA 2IPNA 5HKOA 5AVKA 2JFYA 3PKJA 1GZ3A 5KUTA 3GJQA 1TQ2A 3IX7A 4PZLA 3THYB 2ZRKA 3K35A 1Z0FA 1FP4A 1IXMA 2IPOA 2I8CA 5K1XA 3OU7A 2Y1XA 5KKAA 3HUEA 1OHHG 1DKQA 1YR7A 4UTZA 1P1FA 2LQTA 4FNAA 5F7ZA 2I80A 1IUOA 2LW1A 5KU7A 3FSRA 2LIPA 1OCOC 4ICGA 1IG0A 3LQFA 4EI2A 1USWA 5FJIA 1F5NA 2OT3B 1W75A 1X8KA 4JQSA 4MA4A 1E18A 4QGHA 2M6YA 1CR4A 1X7YA 2F3PA 3GEIA 3MJSA 2X6AA 1LLQA 3QXGA 3KKOA 1X3LA 2VUHB 1DJPA 4B34A 4HC4A 2UXCO 4I4NA 1QZTA 5ALDA 4MRRA 1F23A 3PDJA 2ZBEA 3WSWA 1F14A 4LYHA 1TM4E 1L9KA 1NGSA 2R6GA 3THOA 2X8JA 1X1DA 3ELYA 1YCDA 4JYAO 1CEZA 4E7PA 3DHVA 3WLQA 1HOXA 2AQHA 2PI4A 1GAEO 2X22A 5AXAA 2WWGA 3TLGA 5CW1A 4JOQA 3HY4A 1XMVA 3W5CA 2WM9B 2CYCA 5FP0A 2COEA 4HB2A 4QPDA 2CFOA 4QNHB 1W6RA 4Q19A 1KOLA 3VYUB 3CURA 4UVBA 4WOCA 4WL0A 4B3SO 4MI1A 1NP7A 1L4NA 5HRAA 5G4LA 5A4IS 1FTNA 1XVAA 3I9OA 4HPJB 1LWOA 1RMQA 1K98A 4DG8A 2AMYA 2YBDA 4R9SA 1OC2A 3UT5A 3C3PA 1C7IA 2YSUB 2FCRA 6CHYA 1D6NA 1FLVA 4H16A 4IDPA 2RJZA 5K0FA 1N34O 1XDDA 4KXUA 1J07A 2XUFA 2A0XA 3O21A 2CLLB 1H0SA 2MSDB 3ME5A 2FR8A 3Q7RA 3WNZA 2ZIUB 1EJ0A 4I0XB 4FMCB 2CCKA 4DLRA 1FKAO 1KTVA 2YL2A 1LQ2A 3NNNA 2FMTA 1A5ZA 2CE2X 4UHKA 3LPDA 3CVXA 2QEQA 5I4IA 4QLAA 2OCIA 2MHCA 1OLXA 2C3OA 3SWWA 3EQ7A 2HYIC 2BEWA 1UC8A 2MSCB 1X38A 2FUG6 1L4BA 3F7TA 4TWRA 4ZPJA 1SGWA 3VDRA 2XVXA 1ES9A 4IIYA 3CNOA 1WZ2A 4Z51A 2O8CB 3MJDA 1EDEA 3ZRXA 4X63A 3THSA 4X84A 3QEBZ 4G24A 4IIHA 3ZN2A 3HCAA 4EGSA 4KN9S 1R50A 4ZEWA 5K7SA 1WP4A 4L8JA 4MKGA 5CMLA 4L8LA 2Z5UA 4LH7A 3PRHA 4FYVA 2ZI4A 2FR8C 4E5DA 2CGNA 1ZN9A 3F6BX 4RVDA 4P2BA 3PRYA 2QK4A 3EWIA 1M1YA 4CEHA 1DFGA 4YIHA 2W2MA 1TMGE 1H2NA 3KYJB 1VE3A 3AR2A 1E64A 4UHBA 1N2IA 4BXOA 1OI4A 3A6JA 1UFQA 1ISMA 1I32A 2FEXA 4JYPA 1REQB 4YCLA 1ZBDA 4H7IA 4G8JA 2IEDA 4YMWA 3GT3A 1GN6A 3FLMA 4HCJA 3AQ4A 5LCXA 4CM8B 4LXXA 1H9CA 1V3TA 2ZNJA 1ZHHA 3A28A 3HDJA 1E3WB 3N87A 4PIMA 1KXZA 4GPBA 4MWBA 4EHHA 1H6AA 2UUBB 5IE9A 4ZEVA 4F2DA 1Z33A 4C0KA 4E1BA 1PN3A 2FJUA 3NJRA 1TU3A 3LK7A 1IOVA 1RWXA 4KXMA 2WHQA 4S0XA 1M6VB 3F8SA 2PX6A 5LMCA 3CGGA 1UWCA 3BTVA 1P5HA 3V9AA 1YJWV 4DMMA 5IJ9B 5TE9A 1R4NA 4K05A 3VPSA 3B3FA 4UFZA 4X66O 13PKA 4GS5A 2C2WA 1GXSA 3MG9A 4DR5B 3I3OA 5FPOA 3K5MA 2P7IA 4RETA 3SHWA 4YRNA 3AHGA 4PO9A 2F3SA 1S72V 2Q2WA 3AH8A 1HH4A 2E3JA 4IDOA 4TLBA 1RADA 3MT0A 2J7PD 3N6RA 5B2FA 2FR0A 3QMPA 2XGGA 4GPTA 3OLYA 1QNLA 4KEAA 4LYFA 2WVGA 2X40A 1MENA 3I34X 4KUMA 3KFXA 3UOWA 1L7PA 3COPA 1Y1QA 2P62A 2XGMA 4FCVA 4QQRA 3D59A 1NUUA 4BQEA 3I55V 1C3VA 2WM2A 3UK6A 2NN4A 3FOWA 3TX2A 1CF2O 4AQ7A 1H9AA 5EGNA 1EFDN 3VV3A 2FV8A 1OLUB 5KTPA 4IDFA 1YS2X 2PKRA 3O8BA 3TOXA 3ITNA 3AVVA 2C83A 4GOJA 2G08A 3VM6A 2J0QA 2UYGA 5D3QA 3QO8A 1FP4B 4M7RA 3OT4A 2HIHA 2O2IA 3IJEB 4QE9A 3DO8A 4RL6A 2X2OA 2HFJA 1ISIA 3IODA 4JI6O 1IM5A 5L4SA 1Y1PA 2YV5A 1Z83A 1QRDA 3MINA 4B3RB 3DVRX 2WYIA 3NAGA 3H99A 4RSHA 5U1PA 1RHUA 1X7YB 2WPDA 3L6CA 3DTYA 1OWNA 3I9MA 1G2QA 4WI1A 2J3QA 1TM5E 4RKRA 2G09A 4CTJA 2YDEA 3F1KA 3D5EA 1NI5A 2PWYA 2QVXX 4KK4A 3S1AA 4I4LA 4L9AA 4IDNA 2VK4A 1I4LD 5I5GA 2X8JB 1L2TA 3NBMA 1G6HA 3T4EA 3ZJ4A 4C4OA 2I87A 2JZOA 1NYTA 1PZMA 1TI7A 4RVCA 4XRGA 4M4SA 1XZJA 2WQZA 1VRVA 1L4KA 4JXJA 1D2RA 4W5QA 2XOKG 4J7AA 4JP8A 3TLGB 2O48X 5EFOA 1E3DA 1T8WA 4EMBA 1AO3A 2ZIOA 2XE6A 3HVJA 4L15A 3OMXA 3QXHA 4ZAXA 5KCMA 3AI1A 3VH3A 3K06A 2P6MA 2WF6A 3C3AA 4RVFA 4H4EA 4FMCF 4H7KA 4QWWA 2X9QA 3IPCA 5JXJA 3HP7A 4QLBA 1TCBA 3T5TA 4F3YA 3WIDA 1S6YA 3M70A 2AJDA 5D85A 2WWTA 2J87A 1YONA 4G2NA 3DTNA 1JE1A 2RMKA 3LUAA 2YHUA 2PK3A 2ZRPA 1KHHA 4ZZ0A 3GH1A 1A8HA 3U3XA 1QAQA 2CFRA 3IV6A 4OGKA 4B6GA 3ROKA 4JTDB 1XXLA 2AN9A 3GRFA 1QLEC 4DK1A 4FFDA 1YL7A 4BKQA 1EFPA 1RQNA 3IR6A 4FONA 1FFAA 5FI3A 1JAHA 1OLXB 1NVDA 1WMSA 3O92A 2J31A 4UFOA 1OCRC 2BEWB 3AFGA 3F7NA 1AV6A 1RM0A 1QGOA 2P5TB 5J5VA 4N3BA 1RSZA 2HU8A 4G56A 1KYWA 1UAGA 3ZGNA 4RU1A 1BHSA 2DWEC 1W34A 4LQ4A 2BHRA 5JI3E 4MW9A 3WXBA 4L74A 1YUMA 1OYYA 2WUVA 3BXEA 2YFKA 1E2EA 1JNXX 2GN6A 2YWCA 3JCZA 2VJCA 3FI0A 2WDPA 5DFAA 2LCQA 5L3BA 3U1BA 4I81A 4F0JA 2DQ0A 3H2YA 4BO4A 2J30A 1TF5A 1M1YB 2WAXA 3QVMA 2COUA 3HDVA 5GWXA 4CEHB 3KAJA 2R7AA 5J4HA 1ZH4A 4MWSA 2HLPA 2WUWE 3VR4H 3WRVA 2JASA 1QYCA 1II0A 2JD2A 1H8HG 3PPXA 1YI8A 2VP3A 1F0KA 2AEMA 1VHJA 3H1TA 4BXOB 3D7MA 3ASNC 5MHTA 4WFFA 4KR3A 1ZEMA 3K9LA 2Q1UA 2Y0CA 4ZO6A 3B6MA 3RF6A 3HUUA 4LYAA 2R6JA 2WTAA 2O19A 2WLJA 2PGOA 5EWLA 1TA0A 1VLZA 4NONA 4WNAA 2P0EA 1ZU5A 3IPYA 5KUKA 5H2FZ 4OQEA 1L5GB 1FNDA 1Q43A 5D86A 2G0NA 4Y2SA 3I2GA 3V8NA 1U2TA 5J59A 4HPXB 1R9NA 1BXRB 4DVJA 4E08A 4B9AA 4C4TA 1VQNV 1SC4A 3C3JA 4R01A 1Z2CA 1R4NB 1FSSA 1ZJ4A 1K5QA 3L82B 1KI8A 4OA8A 3RSLA 2PU5A 1NE7A 2HLDA 3K9HA 1T4MA 3PR1A 2OTJV 4LY0A 4C4XA 3OHMA 3L5KA 3GBPA 2JDIG 1X4TA 2WK1A 3PXBA 4YRGA 4TWIA 4OIMA 4D3ZA 5EVJA 4JH0A 4EJFA 3ASUA 4B48A 4LSGA 4TKUA 2C9YA 2B1IA 3LPMA 3T15A 5HF9A 4MQUA 4OHUA 2GJ8A 1U2RA 4QVGA 1H4TA 3KFVA 1T3SA 1W7AA 3ILYA 1QQCA 2IH2A 2EW1A 1VHQA 4I1YA 1CIPA 1GKLA 3RR2A 1SHZA 5ELLA 4E94A 4Y6LA 4GOKA 2I3AA 1I7FA 3HNOA 3ZNQA 5G0UA 3ZWMA 5K05A 4KPEC 3L4SO 4X62B 3BL5A 1YQXA 3L8HA 4P93A 4E09A 5EIEA 1UPAA 3VR5A 4TT3A 2CXOA 3N86A 1L7NA 1JHUA 3QEKA 1V37A 5JQGF 3ROQA 1XNHA 2WOOA 2ZIVB 1CRWG 3FA2A 5TMEA 5KIAA 4MUIA 1LNSA 4FWIB 3ABZA 1QKIA 3ZWDA 2GBLA 2REOA 3E9MA 3NDBB 3KQQA 1T5SA 1J0BA 1RP7A 1YCHA 2BHNA 4I0WB 2CNDA 3L1KA 4B2LA 2MSLA 3PPWA 2KHZA 1V3VA 1M1XB 1HETA 3EFBA 1ZMXA 3P4XA 4U7FA 4KR9A 4QT4A 1G0OA 1PW7A 5EXTA 2P1RA 4TWZA 3V6MA 2BI4A 4QIHA 3ZGLA 2VHYA 3GFOA 3KM0A 4IZHA 3KT0A 4NQRA 5K3CA 4UM7A 3L7KA 5KNCA 2WHXA 1A9QA 2HK6A 2FWRA 2RONA 3DLHA 4HAVA 1TM2A 3GQBA 1YA8A 5FTKA 1BHAA 3NYQA 3FN4A 5LXTF 1AKQA 1K5GA 1RPJA 2A8YA 3TS1A 1RWPA 4CL8A 3L8DA 4WUVA 2AXEA 3LVRE 3EUFA 3BRWA 1QIKA 3UKMA 3EIFA 5BRNA 2B36A 3A31A 1RZRD 1FQJA 3QNMA 2FN8A 4JZKA 5KNBD 3OCXA 2EYQA 1EFVA 1KWGA 3QQPA 3X0DA 3ZN1A 3X2EA 1Z82A 1YCFA 5EOVA 3TQCA 1ORHA 3UV7A 1KUQA 3IQZA 3WISA 1QLJA 2QNIA 5EKTA 2GOYA 1JHPA 3BCUA 5GGXA 3HB3B 2X5NA 2JF0A 1AG9A 2RMKB 4OMDA 5C7IO 2HV9A 1JQBA 2J4DA 3AM1A 1A5BB 4YXWD 4ISBA 5CBGA 3SR2C 2ZR0A 3UAOA 4MHTA 1JLMA 3MWFA 1C4WA 3DS8A 4OV6B 3KJZA 2QWNB 1JBKA 1EB8A 1WUKS 4C0SA 2YUAA 3EZLA 3V34A 3KXKA 2DTEA 4IZ6A 4ZO9A 2O20A 5F2VO 4O4LA 1K6XA 3GFGA 2P9GA 1QH9A 1T8PA 1PWHA 5AK4A 4P2ZA 1AC5A 1KJIA 4RS4A 2AN3A 2ZYRA 1UOOA 1VG9B 1YHYA 1DIAA 2IH5A 2BBTA 2ZZMA 4LOHA 3X43A 1P7YA 2YJTD 2AI2A 4UFNA 5EE1A 3F5WC 1D0IA 3E03A 1P6UA 3AEUA 2DFVA 2F95B 3MXTA 1R00A 5ILGA 5LQMA 1LTKA 2BEVA 1N2ZA 4B44A 3SN6A 5FWXA 4ETNA 2KBEA 1G5FA 4YBZA 3VDQA 4HYOA 4AZ3A 3E2IA 4TQDA 2Z8XA 1VZ2A 2IEZA 2P22C 2ZIMA 5JNRA 4KFTA 1MABA 1E9DA 2JAXA 1CJKC 1U28A 3CW2A 5CH8A 5EWLB 4M3NA 4X6YA 2JI4A 1PFGA 3CWZA 2P4HX 2X7HA 3HJAA 1KMHA 3DMRA 3M7IA 2VN8A 1D2MA 4D92A 1Q22A 2IV7A 3EBOA 5TY0A 1U7HA 1DDGA 1QRUA 2V7PA 2C04A 4AMUA 1V2HE 2AG1A 2C29D 3CZQA 1S1MA 3VPCA 1B41A 2FKXA 1ZC3A 5DEOA 4NSNA 4M9ZA 4KQHA 4JB2A 5HA5A 3ZXIA 1PR0A 4U9HS 2IEGA 1ADGA 2HHCA 4PBSA 1VHDA 1JJ7A 2R6CA 4LZWA 3A25A 1ZINA 1X1TA 4DNXA 5KTOA 2QJFA 3I01M 2O1XA 1ODKA 1P4RA 3MS7A 3F6PA 2QQ0A 4RANA 1U28C 4JD5A 3TLYA 2IZ6A 4Z2WA 4KJZA 1SUPA 1KZ9A 1MQ8B 1VCNA 4MYHA 1ZIDA 4TKUB 4ZC1A 2FB5A 3FYCA 2XMZA 4A91A 3RGGA 4EVIA 4DRXA 4PAMA 4DYHA 2XF8A 2VDUE 2AIRA 5KYVA 1R27A 3B1VA 2I6TA 5CYFA 4JLVA 2ZWIA 3RWMB 5G0WA 4AK9A 1LQUA 1LDMA 1IPEA 3MVEA 1Z5ZA 1P5ZB 1SQGA 4NE9A 2WSIA 5D5PA 2XCOA 4D25A 5CFMA 1E2QA 4ZRNA 5ICFA 4JLUA 2Q67A 2V7QD 1ISPA 3OD1A 4LWZA 3CEMA 4ZJYA 2X6TA 4EA6A 4NARA 3GRYA 2OVFA 2CVOA 4MGIR 1IBMO 1YOBA 2JBWA 1P4SA 1X3SA 5HVNA 3ROPA 3ZX6A 2UUCO 3E8BA 4HP8A 1B1CA 1W87A 1W93A 1VPDA 1CE8B 4YLEA 4AYXA 3T4DA 3IEPA 1FDVA 1H2HA 3VYRB 4BZPA 1PKXA 3WMGA 1RAHA 1TVKA 1Z4OA 3GJ0A 2XCTB 4K6FA 1TU4A 1DF5A 2XV1A 3L92A 1Y6GA 1OTYA 1PHRA 3Q2OA 4C5AA 3GF4A 4MA0A 3HGTA 3BF7A 1WSAA 3WV4A 2ZRBA 1H2SB 2FZVA 4MP3A 4PWZA 2PMDA 4ZKEA 3IJ5A 2WUFA 3OWOA 2RJ3A 2CJFA 3CR7A 3FIJA 2OT5A 4INZA 3OEYA 4L50A 1A76A 3ZEDA 5DNAA 3U4HA 1DKNA 3GRVA 5C5DA 4M1KA 1UBNA 4ER7A 3P9SA 3DP7A 2D4HA 4EG6A 1PGPA 3K9NA 2QRVA 3RT1A 1K9SA 1EM8A 1XJCA 3LPCA 1QHEA 4QEKA 1NN1A 2H65A 3ZNOA 4BBPA 2XNDA 1URPA 1WV0A 2FSVC 3GQBB 1MV5A 1XTQA 5BSEA 1TGOA 4QL3A 1KARA 3QUAA 4CMCA 1YZVA 1TPYA 2W8BA 3KOXA 2Q1SA 4HXYA 2J3MA 3OFND 1TZ2A 4AULA 1E1RA 2EINC 5CBPA 1I51A 5EUMA 5BN5A 2C94A 1EFVB 4RESA 4OFZA 1SH7A 2IHTA 2PSEA 2HR3A 2XNSA 2Y1EA 1GNQA 2VBFA 1V5IA 1NC1A 2D1QA 3FRJA 2Z3ZA 2Z6VA 5CNKA 2PSJA 2H4JA 4FJCC 2LR0A 2IZ7A 3W7UA 1HWYA 2P3SA 4BV2A 3RS0A 1Z5OA 2X1MA 4NR0A 1KOJA 1N0WA 1FFBA 2HCBA 2Z1NA 4F1WA 4CI9A 2BGUA 3FG9A 4QLOA 4HMOA 3WGQA 2ZSFA 5CTJA 5IN4A 2IXTA 4QTXA 3KLMX 3DAYA 3VI4B 4XKJA 1AUOA 1ZHFA 1ZXBA 4F5DA 3H8VA 1G7TA 1W44A 3DA8A 5AFSA 1I5RA 4MS2A 2XAUA 4PQGA 1YR2A 4O4LB 1UZAA 1NPDA 3HPQA 1VLMA 4BGUA 1MDFA 4TVKA 3WGGA 1K8YB 1L4UA 1Y9DA 3EVGA 4I50F 1I13A 2F55A 1QG4A 4W7HA 2EFDB 4F3CA 4LFCO 1XK6A 2V1XA 4GMGA 5E4YA 5D51S 3G9QA 4N5IX 5BRAA 3U4DA 2BEVB 4F45A 2VS1A 1SRYA 1JT2A 2FGJA 5FWXB 3LPNA 1AT1A 1YHZA 5B1SA 3NATA 2XRZA 1YV9A 2DG2A 4KUGA 3PI6A 4RA9B 3H6GA 5K1PA 3KXLA 1S7CA 2W6PA 4AZ3B 3DMTA 1T25A 1IMJA 3F7VC 4UDXX 4AFNA 3D6JA 4AMZA 4QBKA 5E2BA 3W2EA 3WIVA 4HX9A 4X1KB 2QEXV 1MABB 4DG5A 3KYCA 4UZEA 2UXXA 1VM6A 3ZE2B 4QUEA 4LF5O 4HQ6A 1Q0SA 5CNJA 4TKVA 4E5PA 5J58A 2HHHO 2JAUA 1KMHB 4II2A 1S8NA 2JL1A 4BS9A 2VA8A 3FDFA 5LZ5A 5BPFA 4OPAA 5K8LA 1IQRA 1RVV1 4DPKA 4EG8A 2G25A 5EHXA 1EGVB 2IEYA 1XDSA 5EIFA 4PR0A 5BMOA 3EW9A 3I61A 5EJFA 3PQ6A 4ID9A 4BP3A 3OJFA 3HC7A 3HL4A 2ZRIA 4Z54A 2IYVA 3FVRA 5I01A 1KEKA 2GVNA 3NOOA 1E9BA 4JOBA 2OENG 3IH5A 1DBWA 4FOSA 1I1OA 2OGZA 5ENZA 4QPZA 3Q41A 3VAAA 5DECA 3II6X 3LT0A 4PONA 2GBCA 2Z3YA 1TJNA 1TD9A 3FMPB 2WEKA 1W59A 4DRXB 1FD9A 3D7KA 2IEAA 4GM4A 2QTZA 4LHSA 1OFTA 1ZZGA 3MYRA 1LSUA 4LBYA 3AEQA 2G06A 2I2CA 4PAGA 1E69A 2PFSA 2AN5A 4YMTA 2FVXA 3AF3A 3RSQA 1DKMA 4HG2A 3ZCPA 3P94A 1YJXA 1K8ZB 1PJ8A 5FI0B 4K8XA 1EFUA 5C5IA 5DM2A 3BQ9A 3TQOA 3WLSA 2EJUA 2F17A 3MFQA 2GETA 5BWMA 1GTG1 5JECA 1I9CA 2EKQA 2Y1FA 4KOAA 3M81A 4ZT6A 2I6UA 2ODPA 2QD1A 2WA1A 2QUIA 4HDSA 1NN0A 2R6R1 1GN3A 2QR4A 4C2AA 3B2QA 4FYHA 4OJMX 1JQJC 1Y8QA 3OOEA 1T2CA 2X3YA 4QRDA 2ECFA 4YO8A 4DV3B 4OXIA 1TVKB 1TYCA 2D1FA 2BW0A 3A6LA 3N3BC 3RBVA 5FB3A 5F4BA 4ENRA 2GN9A 5DNEA 2PI5A 3T9AA 1U0FA 5DX1A 1VCIA 2Q6AA 4FHEA 1PZFA 4G86A 3WKDA 2M6RA 1W5AA 1LI4A 2O4CA 3PXXA 1ACLA 3GEMA 2Q8QA 3A58B 1XRSB 1GOTA 4O6VA 1Z36A 3I39X 4C0AC 5KYTA 1CJBA 1CIJA 3RYHA 5B1EA 2YJGA 5KJCA 3ENWA 2CNWA 1VYTA 3DUFA 3HHPA 4BVFA 1IHYA 3DDZX 3KTAB 2QRVB 1AJQA 1QZ3A 1EM8B 3MMNA 3C45A 4G1EB 4FFPA 3DBHA 1ID1A 4HGZA 4TUYB 5LQNA 3FZYA 1QPGA 1GSAA 1BAPA 2UUOA 5LZ9A 4ARUA 2XOXA 2EBWA 1S8OA 1Z7WA 3OQIB 2PFGA 3L0ZA 2W8BB 1S3SA 2Z09A 1Q77A 2IHZA 2VJQA 3KPVA 4E7OA 1USKA 4GKKB 4GF5A 4JUFA 1L4EA 2XBMA 4TMXA 3TLKA 1G7SA 2GBPA 3CPEA 5M3BA 4M1TA 2YEVA 3WFZA 3ZCRA 3SM3A 4G3XA 3MJCA 2EERA 1E1QD 2QKSA 2GLTA 1TF2A 5EMJA 1KSFX 5H0IA 4DA0A 3FPCA 4P2GA 5JZBA 4ZALA 4KQ6A 1SKVA 4CV0A 3Q1KA 3KQLA 1YJNV 1ADFA 1XKXA 5BSFA 1SBTA 4HDOB 3I8XA 4DQUA 2ATEA 4HB0A 1Z5PA 2OQVA 4C1NA 1CZRA 1KAEA 1TIBA 4H1HA 4BV3A 4HN4B 4TTIA 3B1ZA 1JQEA 4HDNA 4NWIA 4YCAA 5TJHA 5TJ9A 1U8XX 1MW9X 1QIDA 4YXWG 1GPJA 2CUKA 2H07A 2YNMA 3K2EA 5K8JB 2R1UA 4K86A 1GPNA 4PXSA 1MQAA 1J20A 3E9NA 2AR9A 4JEMA 4KACA 3BEOA 4PJ0Z 4Q4DA 1ZRHA 3I9V6 2DHRA 4Z1MG 4KHZA 3Q87B 5J4KA 4B6QA 3DGEA 4EKNB 4FVMA 4DUYB 3HSKA 1CUIA 2EYUA 4BPRA 3A1VA 1VLQA 4WZ6A 4DRYA 1M5TA 3UW3A 4EVQA 1CUYA 1GO3F 1U9YA 3VKUA 1L8XA 3ZU6A 2PMFA 2GAFA 4DV4O 4U7WA 3ONVA 3EVNA 2FKNA 2BM8A 3FOZA 3QX7A 4JJFA 1R2QA 2VHUA 4O63O 1DX4A 1KR5A 1ZCFA 1Z2OX 1NNUA 3Q9NA 1VL0A 4R1MA 1WAMA 2IH1C 1SUEA 1NHWA 3HJUA 2KLBA 1WB4A 3AINA 3MTJA 4PZYA 3OZXA 4PYOA 1BX3A 3ETJA 2WSBA 4GMFA 4XUEA 3MWDA 3NHUA 1Y7HA 2JFPA 3DDOA 4R6WA 4MS4A 5B53A 1XLTA 1QQBA 3AEZA 2NZUG 3INGA 4C0XA 2WJYA 2BFMA 2OCLA 3CVUA 4U5QA 5DLPA 3RK1A 3CPWU 1GGEA 3ZD7A 3KYCB 4CV2A 3P9PA 2F8SA 5T3UA 1CFZA 4UVAA 1KQNA 4IOJA 4RVHA 2HR1A 2Z9CA 4ITVA 2AH5A 1Y67A 1L7VC 4C7XA 1RFGE 4P34A 3BA8A 2VNSA 4KB5A 2X4DA 1XRRA 1NJ5A 3O5AA 3RFVA 2WYHA 1AN0A 2ISSD 2JANA 2AJLI 2WWYA 2OZVA 3FTCA 1LFAA 5KDLA 4F56A 1TAUA 4YP5A 1BN6A 2OL4A 3NQ41 3QQ5A 5F2KA 5B7PA 3QW4B 1PR5A 1XLTC 3OFSA 2R44A 2PVSA 4F93B 1MC5A 2UYYA 4YQZA 4WKCA 4J0EA 4LHYA 4WXRA 2CAZC 3DE1X 3GCGA 4IIEA 1KRWA 1X7WA 2Z2JA 4R0VA 1X0XA 4N5DA 4FDUA 3RF7A 2QDKA 5KB3A 3LVFO 4J3JA 5F73A 2WIDA 1IYZA 2RGGA 3ICOA 2MYUA 1UKEA 2GXUA 3C2QA 2XVZA 5GW7A 1NVPB 4EENA 4I14A 4D98A 3DDWA 4HH0A 5IF9A 2BEUA 4RKFA 2HREA 5A2QA 3U56A 4D3YA 3AVYA 1Y7LA 2BIFA 4DIEA 4OCZA 4G1UC 4DLXA 1TTQB 3AEQB 3RRJA 3WB9A 3UGKA 3EC1A 1G6OA 3PQ2A 1BS9A 4Y67A 1BE8A 2RHWA 1N8NA 2FDXA 1UM8A 4TVBA 5DI3A 1POXA 3BTOA 1RQ2A 4XDJA 2D3TA 4WTOA 2V7QG 3I04M 1WDLA 4GR5A 4CM8A 1SVUA 4I19A 4HDSB 3LA6A 4RD3A 3FD8A 4NCKA 4F9EA 1E3WA 1Y8QB 4Q9KA 2E82A 1ZU4A 3H9GA 5FHQA 1NBAA 2IJJA 3EDOA 2FWPA 3MWGA 4CKCA 3KLOA 1RHRA 2JGJA 1G20A 3B8MA 2JVJA 3WWEA 4BDSA 4ML3A 3R1IA 1BH2A 1FNNA 1QTQA 2AF3C 4D0LB 3O73A 4BNWA 5E9WA 3HLTA 1WXHA 5H1YA 3UHFA 4TUYF 1XMQO 1J6UA 2AQ8A 1YKGA 2H7VA 2V5VA 2ZYVX 3T3NA 1EP2B 1O03A 1M8GA 3OQ1A 4OMFG 2Y1CA 1IRIA 4LF9O 1I30A 1UZUA 3CRRA 4TN5A 1SB8A 4GX2A 3RYHB 3LUFA 2O5VA 4WCVA 3Q8XB 1ETUA 3E3AA 3DUFB 3KV1A 2C5GA 1C2TA 1PS0A 3NBYC 1NYQA 4YTEA 1UINA 2PZJA 3DBHB 5AW9A 2YYYA 5CA1F 4H77A 2FPOA 1CYEA 2ZWPA 1RXYA 3ZVNA 1TO1E 1I3NA 4AP5A 5DRTA 1D8AA 1T1IA 4YCSA 2HC9A 4EO7A 3GZ4A 1PJRA 1XEWY 4U6QA 1L5VA 4LYEA 4HLDA 3CN7A 1ZISA 3CLUC 4DYLA 3OFNG 2GPAA 2YEVB 1EHYA 4EKIA 2NVBA 4WJZA 5AKIA 1CUXA 1OLUA 5EJIA 1Z6AA 1SWVA 3DZGA 2AZMA 3P1JA 4ZVOA 4HNGA 4XYLA 4B3HA 1TCVA 3HABA 2O0JA 3ZIUA 4K6OA 3OU6A 1Y6JA 4LP8A 4BQNA 4UOQA 2NZXA 2VI5A 3K0FA 4TLCA 2RNBA 3G7NA 4JQYA 4HDNB 2KQUA 4JX8A 1PGNA 5AUPB 4XIGS 3EZ7A 1EVLA 1EJBA 4Z0TA 3WL6A 1T15A 5CH3A 3FHLA 3GJZA 1EFRA 1COWA 1G9SA 5FOWA 3OOWA 5KU1A 2JS3A 2AB0A 2QV7A 1WQ3A 2Y69B 3EGDB 2OB1A 5EWMA 2VP9A 5D3MA 4PZEA 5JQGA 2ZTMA 1IJFA 1PR4A 4KO4S 4F21A 1GZDA 2W90A 3CBGA 2JJ1A 1P1JA 1GFWA 3QI7A 1U3FA 3WAKA 4AJ9A 1J5XA 2PUCA 4F96A 3HYLA 3EAGA 4MTCA 1ZXXA 2QOEA 4BFWA 2JZNA 3TQQA 1I4EB 2BHTA 1EUZA 3MBOA 2QF7A 4E5YA 3HBAA 3JR7A 4MLZA 3CTMA 3TH5A 4CBCA 1N33O 3TFWA 1H6CA 1NATA 5AM1A 5DCWA 1M2EA 1ISJA 1Q6HA 2Y4TA 1G17A 2E87A 5KVSA 3SSOA 3MWDB 2OAQ1 4WWHA 3KZIZ 1ZGGA 1GZUA 4K5QA 4MS4B 1J99A 2WE7A 3S7ZA 4HNHA 1B93A 3RRBA 3QXJA 5AKXA 3A9WA 2BF7A 4S24A 3MEQA 4OHVA 2O0KA 2CLKB 1UZMA 2RAUA 4FFOA 3URKA 2OLKA 4C88A 2Z2ZA 1PDWA 4KQ1A 1IDOA 1DBSA 1I6LA 1MORA 4O02B 4O25A 2B4KA 1JQ5A 5FTJA 1OV6A 2GKOA 1LZLA 3V4RA 1NP3A 4QOIA 1P2TA 2Y27A 3FGNA 5B6PA 5LXTA 3W8RA 4K6GA 1PNMA 4P58A 1FDOA 1B8VA 5DNUA 2IWRA 1DAKA 4UB6Z 3DMPA 3LQ4A 2WQ7A 3P0HA 1NJ8A 4J7CA 2C98A 2P11A 4FGKA 3TPZA 3PFCA 1LF0A 2E48A 4GMHA 5DEDA 1XVVA 1L5OA 1HYGA 3LRTA 3U0ZA 2R3SA 2L17A 4NB5A 4HTFA 3PV0A 3AUKA 4ZVSA 3C6YA 4K3VA 1JDTA 3FHOA 4YMIA 4CKXA 1X7WB 3LVQE 1JJIA 4H3HB 1DLJA 3TFQA 5DM0A 2RBGA 3EGEA 1H2AS 1PSWA 4C3VA 2XEDA 2GFIA 3B6EA 3ROZA 3BFJA 4BP8A 5IJZA 2FGKA 2IH3C 1WF6A 3HYSA 1CQPA 3W5IA 4YCNA 4KUEA 4W5TA 2X9LA 2XDAA 3HJBA 2BEUB 1GEEA 3H5IA 3RT9A 3LGAA 2GO1A 1R73A 3HVIA 4EHFA 2CFCA 4B47A 4QARA 2WNSA 4GSLA 4MV4A 2WIGA 3LTNC 4LCEA 3I92A 2A5LA 4FUTA 4KPGA 3WFVA 2XIQA 4M2LA 3EGCA 1R5BA 3OZTA 3HB0A 1VLLA 5DI3B 5LYYA 3PLAE 2IHYA 4H1UA 4HY3A 4RO2A 3TG2A 1CRPA 1ULHA 5DM70 1WJGA 3F47A 2GTPA 1EWTA 5AW1A 4PQYA 3OKAA 4NOJA 1WMBA 3ENQA 3F7OA 1L3IA 3JQFA 2RI1A 2DECA 3UOAB 4CCAA 1P5RA 4CKCB 1ONSA 3CUKA 2AW5A 1GQYA 1PFWA 3MGCA 5LBTA 1G20B 5AJUA 2OPHA 3GD5A 1BXRA 2RARA 1ZSVA 3HR7A 1DJOA 4NYJR 5ALZA 1E32A 3V2HA 4W63A 3BVOA 3SFZA 5CFLA 3GHHA 3OPYI 1U99A 2QLTA 3QVUA 1LDNA 4HDKA 1PJ3A 5A4MS 3MMZA 1YBFA 2I33A 4Z3OA 3RVBA 5KSOA 1XP5A 4M86A 3WMRA 2K87A 4A26A 5HNKA 3IAM6 1HLGA 4PX2A 1AQ6A 4RMJA 4W4LA 4RDIA 1FP6A 2JS5A 1QHHA 1CUFA 3WWPA 4QQ8A 2IY8A 3H86A 2V58A 1S3IA 3O2JA 2L42A 3DL2A 3RW9A 2VZ8A 3HPRA 5FOXA 4C0LA 4NESA 4D9KA 1OV9A 5I4CA 1ZI6A 3IHLA 3MQ4A 4E13A 3CT4A 4DIMA 3O2SB 4G9GA 1HYQA 4R05A 1YFKA 5AKHA 1OZAA 4GO1A 3Q7SA 4LFBB 4BAYA 4XWKA 3S70A 1QP8A 3A1WA 3G0GA 2AUMA 1E1QG 3DEJA 1OH8A 1RAFA 1L5LA 5LZ2A 2ZFUA 4GAEA 1KU9A 3R3JA 4MROA 1TX4B 4V0MA 4BTVA 3K0FB 1TYEB 3IHTA 4QASA 3KLNA 4CMGA 2Q4EA 1R4ZA 2ZLBA 1HURA 5DTRA 4DLWA 4H6WA 2BMFA 1CUVA 1GM7A 3ZGVA 3SVZA 3NT2A 1S89A 1Z12A 4AP9A 4AHCA 3M49A 4OSEA 4RHUA 4LVCA 5EWMB 3CPJB 5D3MB 2CTPA 1R8JA 2ANCA 2FN3A 3OIDA 5JQGB 2PAFA 4TTRA 3OCZA 2PTHA 1OBHA 5DP1A 5LNK6 2FW1A 1VIVA 3BYZA 1ZH6A 4K6MA 2PEYA 4BFXA 3CCSV 2P1DA 2MCFA 2RGDA 5BNFA 3WQBA 3LJKA 1SR8A 1T1JA 1T5IA 3K08A 1LH0A 1ADBA 3E53A 4IINA 1HE3A 2GZSA 4LF6O 2GBFA 3PQ7A 4BEWA 1E2NA 4RPIA 4AWBA 5EKUA 3T7DA 5D5QA 1VQ7V 3ECCA 3AK2A 4F1KA 4MZDA 2CL7X 2FFQA 3EGXB 4ZOEA 2RI0A 3BERA 4KWHA 5F51A 4D74A 3DNFA 5ALXA 4RH3A 2IYQA 1SESA 1H85A 2P9ZA 2GUWA 4LZPA 1U4OA 3LXRA 5JDIA 1GNPA 3SF0A 5GIOE 3H84A 5K8CA 3GWKC 1Z07A 2IYFA 4AI8A 2GD1O 3AJDA 2IHVA 2XBLA 4GBGA 8GPBA 1ND6A 1G60A 3IR7A 2OYCA 4MK4A 3QEAZ 5LXTB 4FJ2A 2XDWA 3FH0A 1KC8W 1GZ7A 1UCFA 4X54A 1E8MA 5LR6A 4NR1A 1DGSA 3UXYA 4O2BF 2VXBA 4DSOA 5J9PC 1JYEA 2ZWMA 1S2LA 2EFCB 2F8LA 4EYQA 4ZVUA 1TYBE 2GYYA 2EGGA 3MPUA 5JDIC 2CF5A 1RKBA 3HDYA 2QMHA 4C08A 3BMNA 1P1HA 3W7BA 1EM6A 4HTFB 1NVUQ 2ZBPA 3NTLA 1UJMA 4JAVA 3H17A 1KDRA 1GA4A 3U7QA 3WLHA 3C41J 2Q5EA 3EXFA 2QSAA 2F62A 3GWGA 3WL3A 2V0GA 4NJOA 3A06A 1H0RA 4MEAA 1KE1A 1XQWA 1R3IC 4XLZA 4MAFA 4EABA 1GA6A 4GKAA 1FMTA 3HCWA 3BCSA 4IIDA 3OKPA 1VPEA 2YV1A 2H59A 2QYHA 3L0OA 2OBLA 2H2DA 1JWBB 2X5XA 4Z53A 1MOSA 3OKFA 5ALPA 1LW6E 1JFLA 1TLFA 3AJ9A 4YPFA 3QHQA 4EO9A 4DA7A 1AD2A 3H9VA 2AFHE 2EQBA 3IUQA 1K97A 3SGLA 1IBLB 1KYZA 5DMHA 1CUWA 3KQKA 4I50A 2G5GX 1V7PC 3Q72A 4NU0A 4RSMA 1TMYA 5CLQA 1VIMA 4ZVKA 5JDCA 2SNIE 3VZRA 3MD9A 2YYZA 2AR0A 3IAXA 1WUTA 2PLWA 4MUEA 3ZWNA 4B4WA 5DF1A 1CVRA 4MUGA 3W2HA 1ID8A 4XD2A 3AIKA 1V35A 1NNSA 1MT3A 3B2EA 5DIFA 1ESNA 5BQ3A 4ZV7A 3UJBA 1KK3A 3SPXA 3UAVA 2ZI5A 3VDMA 1ZFNA 2XTZA 4QRIA 3W5AA 4FQ8A 4DR1O 3G67A 2DCMA 1EFTA 3UKOA 4HDKB 1A4RA 4ABTA 2C4HA 2VYFA 1CR1A 3BIOA 3BHPA 1DFIA 2I7VA 4F46A 1HK7A 3NASA 1FMLA 3B09A 3RV3A 3EBPA 2WNIA 4OTZA 4ZT5A 4Y2GA 1EX6A 1QHHB 2VPTA 3TG8A 1H65A 5TGTA 1X0VA 2R8XA 4R2KA 3HKDA 4ECAA 3RD5A 4XUCA 1ZXLA 2GASA 1XZLA 2VS0A 1ADJA 1MFPA 4DNOA 1XNQB 1ULTA 5BNTA 4EK9A 5KQLA 1HKUA 3ETEA 3I4LA 4BCCA 1RYZA 5I48A 4JVLA 2DR2A 1K5SA 3DQPA 1L3CA 1NVWQ 2WJGA 1SG0A 2G8LA 1ABEA 1TZMA 2Q2NA 4LS3A 4WFEA 2C5AA 1U5BA 1Y1LA 3W79A 1RFLA 1G42A 3N7UA 4RDCA 1THMA 4B4OA 2QP3A 2HBQA 3Q15C 3ZGZA 4GKBA 2XMSA 2I7XA 4UCVA 2FFJA 3U61B 3DLCA 1YC5A 1O94D 1CE8A 2JCXA 4L4ZA 1P0CA 1VKOA 4B85A 3ED1A 3J7AC 2XQFA 1WZUA 4P92A 5AOCA 2GJ9A 3DVQX 1Y42X 2NIPA 1A9YA 5A4JA 4RNDB 2QN7A 2BR3A 3LUGA 3NM5A 4S1TA 3SZ3A 3JQQA 4O5AA 3RIHA 2BTEA 2X3FA 4LZAA 3PRJA 4KR2A 2OTLV 1D0VA 1A1SA 1RWKA 3B1WA 5CYGA 3L8YA 4BRWA 3OZBA 1YJBA 5JH7B 4ZJZA 4INPA 1YB4A 1K5HA 2OWDA 5EJ6A 1HNZO 4R51A 1L5KA 4PINA 3CXRA 2XWSA 2IBMA 3IT2A 5FWYA 3HB1A 2Q7HA 4TL9A 2GBLC 3ZVMA 1MA3A 2OUIA 1YB6A 1IEQA 5BVGA 3VTAA 1MC8A 1JA1A 5IUNC 5EHZA 3X1WA 3BUSA 5TPWA 1EDZA 1SCIA 4YT2A 2ONCA 4BYGA 2OEPA 5JYBA 4WFIA 5HP4A 3H9BA 3TM4A 4GBJA 3EE6A 4XARA 1O97D 1TK3A 2OBMA 5FO1A 1KO7A 2D4AA 2EC5A 3OZCA 1DUIA 3MMSA 2IYTA 2R8BA 4DW1A 5HIIA 2B8EA 3B52X 4LYJA 2DPGA 3DNMA 3N28A 3JXEA 3AERA 4R81A 2R11A 2YBEA 3MLEA 2Z1MA 4PCLA 2D8AA 1ULUA 3PUVA 2ITDC 1URFA 3RUFA 1YRBA 2POCA 2FPUA 1A32A 4FR5A 4YUWA 1FUEA 3PVCA 4RCZA 2JRCA 1EVEA 2PQ2A 3BMNB 5KPDA 2AW3A 2BEKA 3BXZA 2I4MA 3HGQA 1K2WA 2XGSA 4QPPA 1NULA 2D5IA 3QXCA 1BVUA 3U7QB 3WGYA 5KSWB 2NNWB 3EXFB 2IV2X 2IUEA 2SICE 3HP1A 3JWPA 4DB2A 2YOHA 2JIBA 2YX1A 1HDJA 4Q82A 2TMYA 4ZEOA 2EV9A 2J07A 5CG2A 1JILA 2RBEA 5BQXA 2F23A 3RU9A 4MWTA 3CZPA 5EGSA 5A7FA 2PRSA 4HVCA 4YV0A 3IGAC 5A3JA 1C4OA 2ID9A 3WOHA 1JL3A 4IDGA 2X41A 3L93A 2FE1A 5HF8A 3MB8A 1QHSA 2NT3A 3CZRA 1IXSB 3E9YA 4H33A 3C24A 3DT6A 5D2CA 3NWOA 4LJRA 1NLMA 5IYDO 1R15A 1X8XA 1SEPA 1L8QA 4RTMA 5FR2A 1C7ZA 4P36A 4I50B 4KBFA 5EHNA 5FUBA 1CJVC 4RA9A 3C8HA 3VA7A 3TD9A 4FDAA 2OESA 4B9EA 3NALA 3OEHA 1R10A 1SU8A 2J48A 3W2GA 2HXSA 2QYTA 2PL1A 5KQMA 2AHOA 3L1JA 4X1KA 3EFOB 3AT1A 4KO1S 4CDGA 4MLCA 3EMVA 4ZOAA 4AS2A 2BJVA 2JLAA 4MT8A 2P4QA 4MVOA 5LWHA 1C8LA 2BMVA 1QTRA 3ZDFA 2GO7A 2Q5OA 1RJEA 5CX1A 2BZGA 3ZUGA 1YDGA 4GXTA 1ELOA 1VLHA 2J3EA 4MKIA 1QPZA 5P21A 4LC9A 2NYRA 1SBQA 1U97A 1TTPB 3L8MA 2NOAA 3KDPA 4AO8A 1EZVH 2V65A 4N12A 1YB7A 3D54D 2I3BA 4NCAA 2HRZA 1IBCA 2BEJA 4EHBA 1IXZA 3ELDA 3U81A 1XKTA 1UANA 5DGDA 3FPGA 1YZFA 3SCZA 1WY5A 2QTAA 2JKVA 4RADA 4MV1A 2HT1A 4J0FA 2FRXA 1BS2A 4FDVA 3DMNA 5A06A 2PX4A 1DTOA 2VNHA 5DXFA 2YXHA 4C7VA 2V0NA 2AG8A 4FVTA 2FJPA 1FZQA 3ZDZB 3FNHA 3G8AA 3STXA 4CTNA 3OZFA 4GWGA 3PCRB 3LYLA 4O08A 2P2GA 4UCSA 1CUGA 1FDUA 4IJWA 3OBIA 3JD3A 3ZG6A 5IDQA 4H2DA 1K08A 1NBMD 3WNVA 2WIFA 3HKDB 1M8KA 2Q99A 3TLBA 3EVDA 3SQXA 3GOQA 4NFSA 3NHMA 1GPLA 2CY0A 1HDGO 2B69A 4LG1A 1MF7A 3I56V 4KGZA 3EMDA 2H0AA 4ENQA 3P9RA 2HVKC 4BO2A 3S1SA 3CH5A 2V96A 4YXFA 5CCXA 3HKEA 1U5BB 1GPBA 2WNHA 2AN4A 3WG9A 1UT5A 3ETQA 1WUIS 5DXJA 5LYJB 4F4IA 4ZQFA 1IBKB 1I5OA 1WPBA 3CE6A 3ZMZA 3E7XA 3KEQA 2Y68A 3I2KA 5JH7F 2XLBA 2ZU6A 5AVYA 1FVOA 1HE1C 2J8ZA 2Y77A 2Y93A 4EX7A 3OOHA 2M2IA 3QPCA 4QUIA 3C90A 2X8LA 5ICEA 2C7PA 1GP2A 3OG9A 5IWAB 4XTCS 3ZU2A 1KGSA 1A4XA 4RXTA 3G8BA 2XUAA 1Z47A 2CLCX 4WOKA 4JIMA 2UDPA 4LXIA 1MRNA 1A95A 3WB1A 1WW8A 2P68A 5ETJA 3FW1A 3MT8A 3WE7A 3TPCA 5MFPA 4X64O 3GC6A 4OQFA 2IJIA 3SJBA 2O05A 2OZEA 1U0JA 2Q1YA 4UULA 2R9RB 3KTAA 3FPLA 5AJTA 2BGWA 3UICA 3SC2A 2XCLA 1E2UA 3DYVA 1PWZA 2CLHB 5F64A 2UKDA 1N7IA 1N8RW 5FWYB 1SPXA 5BURA 2XB8A 2AXNA 1RKVA 4TUYA 4OHCA 5LHGA 5BVGB 1MQ9A 2W11A 4MVJM 3QX3A 3D81A 4DMRA 3OOJA 3OQIA 4JROA 1KQFA 4LJYA 3LNMB 1ECJA 5TPWB 4PLFA 2ZJOA 1AURA 5JR3A 1AKYA 3LC7O 5AHOA 1XZIA 4E88A 4C7KA 2XUPA 4FNOA 1DINA 2GN8A 4WFAV 2ILMA 5JBQA 4ZYZA 4ZU1X 4REOA 3UAWA 1RE1A 2XCSB 2YDYA 5CA1A 5HUQA 3K4HA 5EQDA 4MTXA 4BNFA 1CQZA 4GNRA 3AERB 5AM4A 3S28A 3UMRA 3S8MA 2BFWA 5DN9A 1DV2A 4ZTBA 2G1KA 1I3KA 2P77A 5M34A 3GVMA 2YRXA 1R88A 1K06A 4P8RA 4MJLA 1L4LA 4D4LA 3K31A 1IAQA 3QVSA 3NRCA 4LAFA 1YZKA 4PQRA 4FHFA 4YMUA 2X1VA 1S2DA 2HXYA 3LT1A 4R69A 3GEEA 1FLDA 4GZ6A 4P38A 1FTYA 4UATA 3FRHA 4G5HA 4U1RA 1YQTA 1XQ6A 2WF9A 2I78A 4DT1B 1ISHA 2A7WA 3JWGA 2MOKA 1RIIA 4RWEA 1WKVA 3LY7A 4U00A 2CW5A 2Q7GA 3T1NA 4J7UA 1N7GA 2CK3A 3G2LA 1SQ5A 3KETA 4AY3A 4V38A 5C8DA 4ACAA 1G6Q1 3NR7A 3UMMA 1JMKC 4D9HA 3VR2D 4DQLA 4J29A 4YRCA 2XI4A 3N5KA 3R0JA 2JLVA 4TLEA 1M7BA 1QCCA 2B1RA 1QANA 4E2FA 1Q16A 2C2YA 3MS4A 3CG4A 1P6XA 3S68A 3JSLA 1OMOA 1NURA 1GN2A 1I33A 4CR8A 1CZKA 2RSLA 3KT3A 5LKRA 3FMVA 4X93A 4WH0A 3IC9A 1SEVA 3QIAA 4US2R 3VQXA 3RH0A 3IAFA 2ID4A 1GU0A 2K6GA 1BA2A 3Q7IA 4N01A 1KRXA 1OXMA 1EWYA 1PCXA 5TQ2A 3LLMA 2KE5A 2ZXEA 3STWA 1QBZA 4FTWA 5F7OA 4ZIRA 3KOZA 4N8SA 2L35A 3RHFA 1QK5A 1WVIA 2UXDO 3B38A 4B2PA 1W0JD 2CNLA 2AFVA 4HDRA 2WT9A 1CRZA 1MG1A 3L79A 3MWLA 4FKMA 4I7EA 3HJFA 4C3ZA 3EODA 5E79Z 5D00A 3HJGA 5L6LB 4XEUA 5CX1B 4GUDA 1LUVA 1QCDA 2VAXA 2NV0A 5H3LA 2DTXA 3D6HA 1DKOA 3H5VA 4MITA 1KYIA 1UFOA 1O5IA 3SYTA 2BCGY 1E9SA 2ZRNA 3KWMA 4HAZA 2HF9A 4NYJQ 1E2GA 4EG1A 1WBJB 3DMTC 2IBZH 5IW8A 1M7HA 4R40A 2ZQYA 4NEGA 3EIQA 1V1JA 4NMMA 4XCXA 5AW4A 1Z9BA 2OXTA 5I7UA 4DMLA 2WIJA 2BRUA 3UK1A 3IKVA 3ZOKA 5ALWA 3WWOA 1JTVA 4QE7A 4DXDA 1CB7A 2DQ3A 3NYWA 2Q5CA 4XM0A 3ZLTA 2JNWA 3MCVA 2WU1A 3SHTA 4K9LA 1EVQA 1V7CA 2FEMA 4EP1A 2DXIA 2ZD9A 3WYNA 1RP1A 2VHXA 5LYJF 4RUKA 2X0NA 3OC0A 4LOJA 4OJKA 5JSZB 2WU0A 3R7SA 3KYDA 1A9TA 5E4FA 1FRQA 3HI4A 2Q5ZA 3HMQA 3QP9A 1K7EB 1M2WA 3FNFA 3QU9A 2DBQA 3ZV7A 2HU7A 4YAFA 3UV3A 2AW9A 1MIHA 1Q82W 2QR3A 1U3GA 3HKEB 1V5GA 2H4WA 3DYIA 2WLSA 1QUEA 4US1R 4TTVA 1O95A 4WJLA 2GPSA 4Y6RA 2B4QA 1W0KD 4BB9A 5LB4A 2GRAA 1H93A 4B3XA 1KE2A 1W4BA 3CCRV 2Z5GA 1U1DA 3VOBA 3JYPA 3CXCU 3IV7A 2CMKA 4HD8A 2DKNA 4IWNA 5HKAA 3R5KA 1K33A 4IH1A 1RVDA 1KYYA 2QXTA 4HRXA 5M5BA 4I08A 1P3Y1 1O7JA 1Z7EA 3VI3B 4CT5A 1XC7A 1HA3A 1DMRA 3I6MA 3JY6A 3PHCA 2GUGA 2O50A 4R7TA 3EHEA 1WE2A 3D4NA 1EDDA 1I94O 3OQPA 5L3GA 4FLZA 5H16A 4Q9HA 3P9CA 4G1VA 4FYJA 1ZD1A 3SZMA 2R1TA 1A97A 1B6SA 3MMXA 3QUCA 4I3FA 5EE9A 4NXMB 1PJ2A 1C81A 4P22A 1G1XB 3G59A 3NWPA 4KN6A 3ROEA 2X1HA 1CS0B 3NBFA 1TJ5A 2R9VA 3O03A 2HJVA 2BGMA 4UVHA 1AR4A 3PIDA 1OGIA 4ZAYA 1TK2A 3E82A 3SC2B 1MEEA 5E2IA 1NVEA 3A6HA 3AL2A 4QATA 3U80A 5GOTA 3QIVA 1JDSA 2I5PO 3SZRA 2A57A 4EEQA 3GDHA 2JA2A 3ZLUA 3BSFA 1OFVA 5FTMA 1L4GA 3ROFA 3O8DA 3UWKA 4Z4FA 2P79A 2ZBUA 5IPFA 3SXUA 3ND7A 5J1SB 2XY4A 2IXDA 5B5EZ 2ZK7A 4I9QA 3CF6R 3VZCA 3USES 1SIBE 4RL4A 2ZAIA 2J5RA 3H2HA 5C1DA 2C5BA 5AVSA 3S0JA 1UKZA 5FLEX 4EW3A 1NMYA 1F7YA 1B1AA 1I4OA 5A7GA 3FLAA 5TX7A 4Y9RA 5CA1B 2MYTA 2VR1A 4RHXA 4WFJA 4Q1FA 1PFVA 3HMKA 4JLOA 4HLCA 3TOCA 1P60A 4EFMA 4M60A 3AJEA 5JJKA 3WLLA 3F6RA 1A0OA 4BIMA 4GWLA 2WZBA 4KTTE 1IN5A 1XDBA 3OIGA 4FW8A 5CK4A 1D4AA 3BICA 3AFOA 3ESCA 2W2XA 3P32A 1WR8A 2OK7A 1Z6TA 2QV0A 4IUCS 1NF2A 2IJKA 3EGDA 1FP1D 1JMYA 3NGLA 1CUAA 5M29A 4FINA 2G38A 2GEKA 5JD5A 4I5DA 4KFCA 4UV8A 2PUSA 4IILA 3KD3A 4BX9A 1A98A 4KSYA 1KZYC 2UU9O 3NJ8A 2AG6A 3SAJA 2GYWA 4IL5A 3FKSD 1QH0A 1PQWA 4UE6A 3I52A 1MVLA 4LGCA 1Y37A 1S4MA 1XZMA 2QNBA 4XUDA 2NVOA 4JUDX 3SYNA 2C4KA 5CT5A 1V11A 2GBGA 2YNMC 3CNNA 3OI7A 2R97A 1BMFD 3QVLA 2IWHA 1AA6A 1KJJA 3VSEA 1CRLA 2IEBA 2FHSA 4NZZA 1TM1E 1B8PA 4GOXA 2Y69C 2XUKA 2YZ7A 3GFVA 2C2HA 4Q47A 4TLAA 1RKUA 3DGEC 1ZCAA 3IQIX 4TWKA 4YP7A 4MQEB 5TQ2B 3VQYA 2QAIA 4EVSA 1ZR2A 1UXHA 1RC0A 4ZIRB 3CUYA 5AM3A 4FSXA 3NUQA 1V6CA 2RHLA 3PEYA 3VX3A 4TS4A 4HDRB 3DONA 1JBEA 5T4FA 4K6HA 3DAHA 4EATA 1N9ZA 1SXJD 3OX4A 1WN7A 2I7CA 4K9DA 3L4JA 4A0HA 2P69A 2VSNA 5CHEA 1T9GS 1RDFA 4DSZA 5K0GA 4IV5A 4IDDA 3NMUF 4C22A 3KSDO 1J90A 5J43A 3Q8MA 3HZOA 4LJ6A 1EFKA 1Q1EA 2GPWA 5ITWA 5HRUA 4D4MA 4PC6A 3JS5A 1IZ0A 3HVRA 3HM2A 2HIMA 2HN9A 2IYPA 3P2YA 4A82A 3GUHA 5CCBA 1FQWA 5IKOA 4JI7O 2PS0A 3K1JA 2UXBO 4ZCLA 1QO7A 2BGNA 5SY4A 2M6LA 4R2IA 5KNDA 1BE6A 1DQPA 3KC2A 1N92A 2HNAA 4YP0A 1KETA 3GDFA 1JXOA 2IUTA 4LDAA 4QJ5A 2Y4OA 1RWBA 1NLFA 4O2BA 3KFLA 3H97A 4B31A 2Q0QA 3I42A 1I7DA 4DAEA 4CM1A 4O59O 1ODFA 1N0IA 3NETA 4JWTA 3RWRD 2A0YA 3HZHA 3UZUA 3PP8A 1TB4A 4RQBA 1XBLA 1NBMG 3KYDB 5A5GA 4O1MA 2Q5LA 1DQRA 5ELMA 5CXUA 1XDWA 5L3QB 5EZYA 1IY1A 1U7XA 3JQ9A 3V4PB 3CMMA 3TRKA 2O8FB 3Q7EA 3DYBA 4FNGA 2BOCC 1E3EA 2QBYA 3OUTA 1YZNA 4KODA 3P52A 4LISA 4UMDA 3DDUA 3D5TA 5ALRA 3VQVA 3NV7A 4DTCA 3VZBA 4ENSA 3E5MA 3E3MA 3GFQA 2WVAA 1ZAUA 2VNAA 2WLMA 4KXQA 1KEWA 3GRAA 1YIOA 3LK6A 4RD4A 4Q6BA 1ONBA 1P7GA 4WA8A 3DCIA 4DPLA 4HGRA 1KJYA 4HL6A 3NWEA 2BF4A 3SP1A 3KZOA 4NVRA 4U2BA 4R8RA 3Q2KA 1SC1A 4QZVA 3COYA 5JCPA 4D9JA 2R1TB 3IBCA 1UT8A 3N05A 3HWWA 4J4TA 1JJAA 3WP0A 4OKNA 3B70A 5K45A 2CLEB 3LCJA 3D1JA 3F67A 2IXBA 1N25A 5JEDA 4GYKA 5ERGB 1DZ3A 4DV6O 4ZYLA 3U4IA 4QC2A 3STHA 5LZ7A 4IMIB 2V45A 2RHMA 1UKBA 3WKCA 3TD6A 3VR4D 5COBA 2P6NA 1ACMA 2WWRA 3PZBA 5IY5B 5JZSA 4MGHA 4JXXA 4K2HA 3TXXA 3CPHA 3Q6MA 4FFLA 4GXQA 1EBUA 1XNRB 3OJOA 3QOYA 1J7JA 3WBBA 4OYRA 1XQYA 2XUHA 3SXUB 5CRIA 1VKRA 2WTBA 2DYRB 1FNBA 3ZBHA 2A88A 1OPRA 2QPLA 2R751 4JI8O 3H4MA 1P7PA 3NOQA 4CF3A 1EP9A 5JEEA 2UZ1A 1PNKA 1JFRA 4FLYA 3BIXA 2PNFA 2WHYA 1EUYA 2VT6A 4NOKA 4E4YA 4ON9A 1QP7A 4LXTA 1HDYA 5CEJA 4UVDA 1DPGA 1ZD3A 2GEVA 2DJ5A 4NAHA 4Z8YA 1LBTA 2ZUSA 2ZUFA 2OBNA 3FYUA 4YJDA 2PLAA 1AB6A 1XUQA 1QHIA 3OBBA 3A2MA 1GL6A 3C4QA 1WXXA 3AXTA 2G9NA 3T7CA 2Q4OA 4NEQA 1ENVA 3OMAB 1T29A 3L04A 3IUSA 2XXAA 5AOAA 1VE7A 1DARA 1XQXA 2P3OA 3DE5X 4JLMA 1AXRA 4RDHA 2BBWA 3Q98A 3DJYA 1KJ8A 4M8LA 3BXGA 3QFSA 3E1SA 1M1ZA 2EQAA 5FR1A 5K2MA 1H2YA 4LF8O 1HT1E 5JHGB 3R9IA 1IATA 3VPXA 2C3MA 1JQAA 1TLLA 4WLOA 1GUAA 1JV2B 3UFXA 1Q86W 4FHCA 3IULA 1GGJA 1OW3B 2OAP1 1K6IA 1M0WA 3IQGX 3ER6A 4YMSA 1V11B 2NU8A 4CF4A 2OILA 4ESVA 3UCXA 3TDKA 4UM9D 3VNQA 3EGXA 2ASVA 4ZQGA 3E3LA 1KPIA 3AI7A 2VPZA 1N9KA 3KL4A 2G0TA 2VHCA 3QYAA 5BP7A 1VL8A 4YCJA 3UIEA 4A2QA 3VVLA 2KSDA 3NHRA 4E22A 2IW3A 4Y98A 2BFBB 3UB4A 3VU9A 5IJXA 2HTEA 4PGAA 3AHFA 1VL1A 4LH6A 4LQCA 8ATCA 5JAZA 2P6JA 4MPTA 5JPDA 4WX2B 1XU9A 5DEIA 4MRVA 1M34E 5FXMA 1G98A 1JVMA 2RH9B 1CUUA 4AZVA 5JW6A 2BR5A 3CH4B 3L4EA 1W1UA 2JH3A 4RYDA 4QXAA 3NKFA 4Z0HO 4L57A 5E7IA 1BXZA 5J9FA 5A5FA 1UMBA 3NEJA 4MQFA 3FB6C 1Y5MA 3C7AA 5BQPA 1JI3A 2XUQA 4F5EA 4J9ZB 3M5CA 4KXRA 4F3TA 3C7DB 3X1YA 1TKAA 4MVJH 4AWAA 4WJKB 3KR9A 1JHOA 3KYBA 1LV8A 4N23A 1L7XA 2CSUA 4MYRA 3SDZA 4J0DA 2GN4A 1G21E 4PAWA 1SD2A 3FM9A 4IOLA 2PWPA 2KJQA 1ENZA 2XASA 3SGIA 4RCVA 4EJ2A 4JBGA 1ONNA 4C6RA 4MB2A 1ZMTA 4HNVA 1Z4LA 3G2QA 4O2BB 1TJ3A 5AHWA 1P5JA 4J42A 3OHPA 5MF6A 3LGXA 1UMKA 2WPNA 4UQOA 3BF8A 4OXYA 2OKCA 4BIIA 3NNSA 1RXVA 4P3PA 3O3MB 5DK4A 4Q3CA 2O52A 3JV7A 3WB0A 4TXNA 3ZU3A 1Y4AE 1XXHE 3ZI0A 3J7TA 1FFEA 2OBYA 3MBKA 4DVGA 5ISMA 2YI8A 2FPGB 4LK2A 3PFBA 4OP3A 4HNAA 3D8CA 2C97A 1JG7A 1RAIA 5EZYB 5EFZA 1E7WA 1K0FA 5HZGA 2B7BA 3MGKA 4OX9B 4M9XA 5H6QA 3GFRA 4QJIA 2F43A 1M8FA 1JAZA 2QBYB 3NIDB 2XZOA 5IAJA 3ZMVA 2G88A 2VQEO 1QGED 3PG5A 2FQXA 3WK6A 1W0KG 4D9IA 1V16A 3GJXC 2ERXA 1HL7A 1BOOA 4M22A 5C5CA 4AJ1A 4L87A 2F2TA 1HO3A 1MJNA 1FC0A 5IU6A 3G0OA 1YA4A 4MB0A 1B04A 1ESZA 1OBCA 1U1CA 1TFRA 3DE2X 4PI2A 1T13A 3NJ4A 1FSPA 1PNLA 3ICWA 1OFUX 4HO1X 2EJVA 1N6IA 4BQSA 4CH6A 1RXSA 2PL3A 3A1NA 1TW3A 2XZTA 3A37A 3HO1A 1C14A 4UU7A 4AS3A 2BFFA 3ET4A 3SBXA 4WFQA 1LX6A 4NKGB 2QX6A 4IAOA 3LG2A 4TPKA 3FSGD 3ZRSA 2I3GA 5IC6A 2FNAA 4CETA 5GTIZ 4BY9E 3ZDRA 4OMUA 1AB3A 3C7CB 2IA5A 2B5WA 2Q4BA 3WMXA 3PENA 2YIDA 1Q7CA 2VYQA 5B2ZA 4FK8A 1SIUA 4AY4A 1ZQ9A 2F93B 4P98A 5IVKA 1GJRA 2FSSA 7GPBA 4V1CI 1S2OA 1OAAA 3BWMA 1NZFA 1ZD5A 3BB1A 5B4VA 3GAMA 3ZE0B 2OP0A 3JQFC 4RE6A 3UT0A 4YHHO 3CCUV 4B6SA 1KI1A 4DADA 3UJ7A 3INNA 3S81A 4BMYA 4PEVA 1JSCA 1KZ4A 1KGDA 3I9JA 2YS7A 2V8BA 4JUIA 3LUHA 4TVSA 4DR4B 1LK7A 4MUKA 1YQ9A 2XHZA 1CUJA 1NQAO 1YT5A 3W90A 3T38A 4QYIA 1N4DA 2VQ6A 2D2EA 3OVMA 4LF7B 4ZJUA 1T0UA 2EIJB 1QVZA 1ENPA 2PS3A 2UZ1B 2WOJA 4MTLA 1NTZH 3DKIA 2H9YA 2CE4A 3LCCA 4RIFA 2Q9LA 3QPAA 4D96A 4XDHA 2BC9A 4L4UA 2DSTA 1SVSA 3JU3A 3FYUB 1DQNA 4EA8A 2EAUA 3SPGA 2NV6A 4RFVA 3LQ1A 1Z7YA 2GK3A 4JJKA 3H83A 4DDMA 2L6LA 3LD9A 1W4AA 2ZR2A 1JEYA 3O1IC 2XUIA 5IFLA 2XXAB 5HKKA 5FEMA 1U80A 1LRKA 1VKNA 3KL2A 1LK0A 4FUQA 2NTYC 4C06A 4FFKA 4U5XA 2IVZA 4L76A 5DHAA 4KE7A 2WLHA 3VAYA 4LJSA 4ZMSA 3SC4A 2YY5A 4EFLA 1RI4A 2X6CA 3OIWA 5MN5A 5JH7A 2DWCA 5EMKA 1SKAA 2HSDA 3KP1A 5K51A 4ARSA 5A3SA 4TWJA 3UFXB 3WLIA 4ZU3A 1Z4QA 3OCVA 2E2WA 1N5JA 3ETNA 1BGWA 1EM1A 3FKSG 1B0ZA 4OXRA 1BVHA 1T6XA 1E77A 3AHEA 4GRDA 3PCTA 2NU8B 3KR1A 5EVCA 2JFGA 1U7TA 2F3UA 2DQKA 4M1MA 5DO9A 1Z0KA 3DZIA 4YFYA 1BMFG 4W6ZA 2ZB7A 1H2RS 1O8BA 4DA9A 4QICA 1PZGA 5B7GA 4WVLA 4W99A 1NKSA 3I0ZA 3O93A 2FLKA 1NVTA 2JGFA 1B6QA 2FFBA 3P96A 4ZEXA 1EGMB 2ODQA 1LRJA 4CHTA 1CP9A 4I1VA 2PZKA 3VU9B 1RCFA 3C3DA 1Q3TA 3E7DA 1KIAA 2ZDGA 4MDYA 4YRTA 3LCMA 2VBIA 5K0NA 5JT1A 2N46A 3RASA 3QG5A 1YE8A 3B7WA 1EUQA 3IO3A 3EZ9A 1GAJA 5BYJA 1JDUA 2TYSB 4BVGA 4ZP1A 1UMBB 4MQFB 2J3IA 4DN6A 1A8SA 3W06A 1HOTA 4M0MA 1H2WA 2WYVA 1Z6YA 4Y1EA 1UIRA 3IC7A 2JGIA 3WGKA 3AJRA 4FB5A 4DV5B 5C8XA 1ZOOA 1AJPA 4BAZA 1ZWIC 1ZCJA 3BC1A 2W6OA 1UJWB 5EZYF 3WSTA 2DBZA 4PSDA 2ZM6O 3AKYA 4EKWA 1QE5A 2FWMX 2DLNA 2QU7A 3DFMA 1VHWA 3HM9A 2GMWA 3AOGA 2ZKIA 4BEVA 3RKUA 3MQFA 2C54A 4PLWA 3E61A 4AF8A 4H3SA 1GRJA 1HR0O 1GDHA 1ZIXA 3ABSB 3AG3B 5ALFA 3IPLA 3OJXA 4FYMA 2ZINA 1QQTA 1MAWA 4HNAB 2NUTB 1V71A 2PZSA 4TSRA 1NUQA 4QJBA 2ZJFA 1KU0A 3FETA 2F43B 3V7FA 4RTQA 2QMOA 4CLOB 4JAVC 4RQTA 4NBLA 2O7RA 3RAGA 4C5BA 1TMKA 2AMVA 3R5FA 2AFIE 1MA0A 4I9UA 5K9ZA 4NBKA 4Y2YA 5K3SA 3K05A 1U0NA 3EFOA 3N6VA 2JIOA 1G5QA 1V16B 2QUHA 1QG2A 1SKMA 4FFBB 4R8LA 1V6AA 2DQYA 5BPHA 1D04A 1GD1O 1R6XA 3ZLBA 2HX1A 3IJPA 4IH4A 5E1AC 1QCZA 3OMWA 2XNJA 1PP9H 3BIFA 2Z30A 4IIVA 3EHDA 4FM0A 2BFFB 3SD7A 1QU3A 4YQFA 2QORA 3QLTA 5BY2A 1PD1A 3IMEA 2V6GA 2CT8A 1K4DC 2G28A 4HDMA 2HFKA 3ND8A 1U0TA 4BX8A 1AVTA 5LU9A 3T9DA 4YONB 1U63A 1YJ8A 1GGNA 3DR5A 3FDXA 2VAMA 2YXPX 5JDCC 3T5DA 4FLVA 5A6SA 4C14A 1FTQA 1Y3HA 4LHWA 1XHZA 2PZFA 4FB4A 1LTHR 1EXMA 1RYYA 2CVQA 1PQYA 1DAMA 1RABA 1XZGA 5CT4A 3EF1A 1GU1A 1E6UA 2PLFA 1HE5A 2Y6VA 2FSHA 2E89A 4OI2A 3HRHA 3PXAA 3N8KA 1LB1B 2VWGA 3L8ZA 4L4XA 2IY9A 3DR3A 1WU8A 2A35A 4Y0NA 5HZHA 2ZG6A 2WMOB 5BW5A 4QYIB 1G291 2OGWA 2EL9A 3EAQA 4IMPA 3RQIA 1NW8A 4BNMA 3LW8A 2Q07A 1Y8ZA 4S35A 4CLEA 3H5RA 3DQQA 3JQDA 4QBFA 4IIFA 2QKCA 2B5VA 4JLNA 1MEOA 2G76A 4BBJA 1PK8A 3ZZUA 2YWBA 1Z0AA 2OZPA 3N8NA 4IBOA 5LYJA 4HB4A 3Q1LA 4A8PA 1T35A 3PUKA 5L4LA 2P3QA 1MX1A 1CV2A 4EFNA 1HE4A 1KQGA 4CQMD 2CEKA 2QRUA 2FMLA 2GERA 2P75A 1JEYB 2TMGA 3TWOA 4K81B 4ZO7A 1I9GA 1E3TA 4EYGA 3IAYA 1IDN1 2HHAA 4B3IA 1EBBA 5HUJA 1SCKA 3INTA 5CVCA 1J33A 5IYZB 4TMFA 2CLFB 1R6NA 4WN9B 1CP2A 1JQDA 3V33A 2WJAA 5K3FA 3AF5A 1KY3A 1WCIA 4ZVNA 4YAKA 1V6SA 1E20A 2OO3A 2X8WA 3JVEA 2Y3IA 4H6VA 2H4HA 4FEAA 3IRVA 3F4LA 4X8MA 2FX3A 5HFNA 1YMVA 1RZ3A 5L3FA 4LE2A 1N0HA 3LX8A 4I99A 1U5CA 3GFSA 5FTNA 3JZAA 1S4QA 2CDBA 2XB9A 4EZEA 3L70H 4HZUA 2WFMA 2X0FA 3HJHA 4HXGA 3JWHA 5IARA 4R7ZA 4RPKA 1ZI8A 2QKAA 3PDWA 4Z4QA 3LECA 4CIYA 3AF4A 2YXDA 4WK2B 1W9HA 2EP5A 1V47A 3ONFA 3WNQA 2ONYA 2RH4A 4MZXA 3T2MA 2AEJA 3W1EA 4P81A 2ZDIA 3OEED 2PUTA 5H6RA 1IHUA 3H2KA 2PGAA 4DC0A 1NUHA 4R98A 4KQGA 3T5GA 4QSHA 1G5TA 2X2EA 1ZH0A 4MPPA 4BX2A 4KNYA 3ZBPA 2JRLA 3B78A 3FMGA 2BWJA 4RE5A 4MUJA 2NV2B 3R0ZA 3V4OA 4RPGA 1AX9A 4OM7A 3T4XA 4FCWA 4DXAA 5LA6F 4RIGA 4MUHA 1PL0A 3PFNA 5G0TA 5COAA 4EGAA 1HNWO 2B9VA 4E2LA 1JTEA 4WADA 5TGDA 4DCNA 2VP2A 2ZDIC 4DT1A 2EJBA 5AQEA 5EXEA 1NXSA 4J7KA 1D7AA 2IEIA 4NDAA 4R7GA 1G4YB 2XD9A 1KDYA 2Y8EA 1UBKS 4DEXA 3OW2U 4IRMA 4L07A 4H13B 4JGSA 3BFPA 3AI2A 3MELA 2UXNA 3PGKA 2V5AA 4U39A 3GNTA 2PYIA 3DD5A 1ESDA 1KI4A 4KC0A 1RLTA 4Q6WA 4MUFA 5G41A 5J5AA 3IXLA 3LXXA 4HGPA 4K9KA 5KQGA 3NT5A 2CFSA 2WSSA 5EMLA 1VA4A 5CG1A 2V6FA 3UJ9A 3RC1A 4ROTA 5JWRA 4DE5A 4ZCQA 1UKVY 4P6VF 4ZOQI 1L4HA 1I7SB 2VHWA 1XRPA 1ZVVA 4MVJI 3UJ6A 2XNKA 1SXHA 2DJVA 1ZM4A 2QN8A 2H08A 4CLRA 1M1NA 3AKEA 3NBUA 1PYOA 3SYPA 3OFJA 1GRVA 4CC6A 4EB0A 2GB4A 2ARKA 1XTIA 1JZTA 1Q12A 1GRQA 3L1IA 4M83A 4P0PB 2GAJA 4ZOCA 5I47A 2PZEA 2ORIA 3PYLA 4OY3A 3DE3X 3IGFA 5GJVC 3V4FA 3ROGA 4OHMA 1XQVA 4HEHA 2PVCA 3GNQA 3TXYA 2R8ZA 1TPZA 5J63A 3U2QA 2BSKA 5MN4A 2NTVA 1VZ3A 1K7XB 5INTA 1RHJA 3FYHA 4MV7A 3LOPA 1YZ3A 3MAJA 4HDMB 1XZFA 3IOYA 1V9PA 1E2BA 2G1AA 1QF7A 1M6HA 2J0EA 3R5XA 4KQFA 2GYUA 2YWGA 3EIHA 1DIOB 3K09A 5A6SB 2D00A 4ECEA 2K7ZA 3ZCVA 5JISA 2G5TA 1NVXQ 1DELA 2QPOA 1CP3A 2R79A 4UASA 3QA3E 3SHFA 2HM7A 1OF1A 4ZAFA 3KAQA 4OX9Y 4LF4B 3AB3A 3H7IA 2UZ0A 1NUPA 2PS9A 1QC5A 3MTDA 2C84A 3H9EO 4TYYA 3AUXA 3QF4A 2HIGA 4KIGA 5JALA 3MJTA 3OCUA 2CD7A 3TSZA 4WCFA 1FB5A 3EASA 5JSZA 3WL8A 4DEYA 3R6TA 2WT4A 1F1BA 3NRBA 1EG7A 2ZAYA 2PGJA 3V1YA 4TMKA 1J5EB 4Z99A 3TBFA 2CE7A 2CGOA 2NVWA 5ALJA 1JKMA 5JJIA 1JDNA 1T4DA 1XEQA 2BGJA 1SUCA 1QIMA 4K8OA 3N59A 4DDWA 2RH8A 4TLMB 5IYZF 2BKVA 2PUBA 3EN0A 2HZ7A 3CE2A 1ZGHA 4NCBA 2DEUA 4AUNA 2NSYA 2DULA 1KAHA 4OHWA