2WAQG

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2waqG00
3AFPA 5HY6A 4JI8L 3I4MH 1KXLA 1KIXA 3GTPH 2BH8A 3OTOQ 4GKJL 5C0XI 4DR4Q 1U0LA 3E9HA 4LF8Q 3S2HH 1K0RA 5GAGC 2A19A 4DNIA 4DV4L 1K9MC 4JI3Q 1X6OA 1YHAA 4Y7NH 2FXQA 2YTVA 1L1OC 4JI6L 1UEBA 3D0FA 3ULJA 4AQYQ 1XTDA 2ZM6L 2N8NA 3W1GA 3M9BA 5C3EH 4J15A 1SFOH 4BBRH 3SGIA 1PH9A 1EFWA 1N32Q 4B3RQ 4JI1Q 4A3FG 4TVAB 2UUBL 5IWAQ 4ME3A 3K7AH 1J5EQ 4A3MG 2EIFA 2B63G 4MZ9A 4OWWB 3GTMH 2Z6KA 3UDFA 2KHIA 4GLVB 1G51A 3T1HL 4NB3A 5E7NA 4OO1I 3M4PA 5M3MG 2D0PA 5FJ8H 2EQSA 3HOXH 1VQ4A 4BA2I 2CWAA 1VS0A 4L5SA 4BA1I 1TXYA 1VQEA 3JC66 1VQLA 3H0GH 4DV3Q 4B3TL 4P74A 3G48A 1D7QA 2VZAA 1YI2A 1IBLQ 1TWCH 3FKIG 1N33Q 3CCVA 1SE8A 2CWPA 3EN2A 4RG1A 1HZCA 3M85A 1A8VA 4GOPB 4JOIC 1PHJA 4DR7Q 2A1AA 3S24A 3M3YH 1C0AA 4MNOA 1IBKQ 5C0XJ 5M5XH 2K5NA 2NZOA 1CKNA 1YEZA 4X66Q 1FVIA 4IPHA 4X65Q 2PQAB 5GQOA 4LF7Q 3JAMc 1XNQL 4L5QA 3T1YQ 4DR1L 2VW9A 3F2DA 3B6YA 3VDYA 2JA7H 3CD6A 1X3FA 2N78A 4QIWE 1BKBA 1JJCB 2RCNA 1XNRQ 3PO3H 1PYBA 4PMWA 4HIDA 2QEXA 4A3EH 5GAEC 2VQEQ 4JI8Q 1MIUA 3CCJA 4R4QA 1YJ9A 1XPOA 1N34L 1I94L 3HOVG 2HQLA 1HR0L 5JJLA 1JB7A 1EQRA 2MNAA 1ASYA 4DV2L 3HOWH 4A93G 4GKJQ 3I4OA 2JK8A 3PSIA 3CCSA 3TRZA 3S16H 4DV4Q 1Q81C 1M1KC 5IE8A 1Y1VG 4JI6Q 2VUMG 3HOUG 2I5MX 2HHHQ 4DKAC 1XMOL 1UE1A 5IP7G 2ZM6Q 2NVXH 2OQ0A 3CQZH 5GAHC 3U50C 2QGQA 5FLMH 4GNXB 4LF9Q 3I4NG 3E0EA 1BBWA 3PUVA 3FHWA 5AJ3L 2IHEA 2JA9A 2VL6A 4A3CG 4GKKL 4LUOA 1S40A 1OXSC 1RL2A 4DAYB 3T1HQ 3A74A 2R92H 2R7ZG 4TQUS 4A75A 1HNZL 3UDGA 2VNUD 2AWNA 4DV5L 3L0OA 3M4QA 4A3IG 1XPRA 4BY1H 4AYBG 4OWTB 3E9IA 5LMNW 1PH2A 4HIOA 3A0JA 3L2PA 1WCMG 4HJ8A 4B3TQ 2ZTEA 1I5FA 1Q7YC 2E5LL 2I0QA 2R93H 1KD1C 1DGSA 3EIVA 3AQQA 4YCWA 4OWXB 4BXXH 1Q12A 2Y0SE 4O0AA 1E3PA 1KHIA 4BBSG 1OXUA 3K7UC 1B7YB 3PCOB 3Q8DA 2JEAI 4A3JG 5EAYA 3BJUA 4UPAA 5IP9H 4L5TA 3CC2A 2UU9L 1I50H 4A3LG 1XNQQ 1IXRA 1JT8A 1BVSA 4DR1Q 2UXBQ 1HJPA 4HIMA 4PG3A 1K73C 1G291 1QVFA 3PO2G 1SR3A 3CPFA 1YJWA 3S17H 4X6AH 2D0OA 3F1ZA 2AKWB 1GD7A 1UE6A 1N9WA 2AMCB 1I94Q 1OTCA 4LFCL 1HR0Q 2DGYA 3EBEA 3ZJYC 4YWLA 4POGA 4DV2Q 3J81c 1JJ2A 2Q2UA 4IFDG 2NN6G 5JEAG 4P71A 4IJLA 4NXML 3GTKH 3BZKA 1Q86C 1Y1WH 1AE2A 3K8AA 5GADC 2ES2A 2OQKA 2BH2A 1B8AA 1VQ9A 3CCLA 3KDFA 4R4CA 3OYYA 4LFBL 2RHQB 4LUVA 3M4OH 4X64L 2WAQG 3F8TA 3CC7A 4R4TA 2A8VA 3GD7A 1WI5A 1S72A 1VQBA 1PYSB 1YITA 2E2HH 4IPDA 3HKZE 1PH3A 4LNQA 3CAMA 2L15A 4DR6L 1KQSA 2WB1E 5AJ3Q 3I4MG 4GKKQ 4AH6A 1KL9A 2YV5A 3RNUA 4B3SL 5C4XH 2HIXA 4DV7L 3M7NA 1HNZQ 1X55A 4YWMA 3I56A 4LUZA 4DR5L 4DV5Q 1WYDA 4JI0L 4IPCA 4JG2A 2QA4A 1IBML 4A4IA 5ELNA 3KJPA 2JJQA 1W3SA 3AFQA 1P16A 1EUJA 1YHBA 1V1QA 2MO0A 3GO5A 5C3EG 4EX5A 4BBRG 4DR2L 1LM0A 4YWKA 2DUDA 4GN3B 2UXDL 4DK6C 4DV1L 1ASZA 4JI2L 1TWAH 5FLXc 2E8GA 3K81C 5IYCH 4QQBX 1V9PA 3U4VA 3GTQH 5IYBH 4B3ML 4C3JH 3TEHB 5FJ8G 3HOXG 2JA8H 3KF6A 2UU9Q 3W1BA 1QUQA 2K4KA 3H0GG 2B29A 3NEMA 4YY3L 1K83H 1X54A 4IPGA 3RN2A 2JE6I 2N49A 3I7FA 5K36G 3CF5A 1YIJA 1VQ8A 3PV0A 2Z6KC 3ER0A 4LFAL 2UUAL 1VCIA 3GTJH 4DAMA 4DUYQ 4LF4L 4LFCQ 1D8LA 4PZ8A 3UDXA 1XJVA 5JJKA 4JCVE 1GO3E 2RHSB 3HFZB 4C3IH 5IYDH 4PZ6A 3CCUA 1TWFH 3PF5A 2V1CC 1SN8A 2IHFA 4GOPA 5JJIA 1R9TH 4OXPA 1EYGA 1KAWA 1UE5A 3STBD 1E1TA 3UE0A 4LFBQ 2MO1A 5C44H 2JA7G 2LXJA 2YTXA 1WJJA 3GTLH 3U58A 1P8LA 4LF6L 1C7YA 3OW2A 3PO3G 4P73A 2WP8J 4BY7H 1KRSA 3S14H 1JE5A 4DR6Q 4GN4B 4A3EG 3HKZG 3BU2A 5IY0A 2Q2TA 2B3GA 2WB1G 4O2DA 4X62L 2KENA 2UUBQ 4B3SQ 2GVAA 3HOWG 3G4SA 4DR5Q 2JA5H 4A3DH 4JI0Q 1LTLA 1NY4A 4GLXA 4POFA 1SRUA 2UUCL 1BBUA 2C35B 1X9NA 3TS2A 2PNHA 1IBMQ 2BA0A 3CCQA 3BZCA 3I2ZA 4GN5A 3ULLA 5BR8L 4IFDJ 2UXCL 4GLAC 2AHOB 3HOYH 2JA6H 4A3GH 2KHJA 4UP8A 2H5XA 3A5UA 5LMUL 1OXTA 4P75A 4DR2Q 2K75A 1YVCA 5FLMG 4JI7L 4R4OA 4APVA 4JBMA 1B70B 2UXDQ 1MJEA 2R7FA 4JI2Q 4WJ4A 1GVPA 4KHZA 2KBNA 4Y52H 1VQFA 1VQPA 2NVTH 4B3MQ 1K8AC 4R4IA 3JAMi 2R92G 1G6PA 1YBYA 4GNXA 1NBWA 2Z0SA 3J81j 5C0XG 1HNXL 4BY1G 3CC4A 1S3OA 3CCRA 3TQYA 2CKZB 1IZ6A 3RLOA 1XPUA 3NBHB 1JMCA 4QL5A 4JBKA 4A3BH 1PH4A 1T9HA 3KOJA 1VQOA 1Y14B 1CKOA 2YYZA 4LW1A 4HIKA 2GN5A 1SROA 2KCTA 4LFAQ 1NE3A 2UUAQ 4BXXG 1X3GA 4LF4Q 3S1QH 3H3VI 3HOZH 3PGZA 1KRTA 3UDIA 1FJGL 4IOCA 4DV0L 2ZTDA 1AH9A 1N34Q 3RZDH 2OTLA 2VY3A 4P72A 1Z47A 5IP9G 4OO1G 5M3FH 3PUZA 4YCVA 3J80c 3RR5A 2R6GA 1X3EA 3KDFB 3MXNB 5DLQE 1NTGA 1L1OA 3S1MH 1AE3A 2K52A 4YHHL 5IT9c 4LF6Q 2N3SA 1HH2P 3K0XA 2LXKA 3A5ZB 4OONA 1XMQL 1XMOQ 1JJGA 4X66L 1N36L 2BA1A 3HKSA 3GDEA 2F4VL 4UP7A 4X65L 3CW2C 1VQMA 1YNXA 3KLWA 1CKMA 2ATWA 4A3KG 2AWOA 1QVGA 2NZHA 5J3BA 2UUCQ 3MEFA 4XIGS 1Y1WG 1LYLA 3PIOA 4HJAA 1YHQA 1XNRL 3CCEA 1HNWL 1C9OA 3RLFA 3STBC 2UXCQ 5BR8Q 4HJ5A 3H15A 2IY5B 3J7A5 3CP0A 4IJHA 2PI2E 1CSQA 4NXNL 1I3QH 4HJ7A 1K8GA 1HR0W 5LMUQ 2YTYA 3F2CA 4A3FH 2K14A 4R1JA 1Q46A 4JI7Q 5LMNL 4A3MH 4KI0A 2B63H 1U5KA 1PFSA 1SLJA 3LGJA 4JC0A 4JV5L 4JOIA 1MJCA 1EWIA 2Q2IA 4DUZL 2E5LQ 4DV6L 5M3MH 3PUYA 5C4XG 2HHHL 4JYAL 1VQIA 3L7ZC 3CMAA 1FL0A 2Y0SG 4DK3C 2VQFL 1HNXQ 5H1SE 4LF9L 1HZAA 3KF6B 4MTNA 4IO9A 3S1NH 1QUQB 1OXXK 3FKIH 1Q82C 1CKNB 1X56A 1LUZA 2WFWA 3NENA 1PH1A 1K3RA 1UE7A 2CQOA 1I6HH 2K5HA 4AYBE 1VQAA 4FDBA 3J80i 3J81i 2IX0A 2NN6I 4IFDI 3G71A 1Q8KA 4L5RC 2Q2HA 2XGTA 4NPSA 1FJGQ 4DV0Q 5IYCG 4QGUA 5IYBG 4JI4L 2HIVA 1V43A 4H02A 4LF5L 4OX9L 1EOVA 1L2FA 2EXDA 5HGQA 2XTIA 2ZJRA 1W2BA 2JA8G 4K0KL 2OTJA 3AEVA 1FGUA 1WFQA 5GROA 5C4JH 4NXMQ 4DR3L 1Z9FA 3TREA 1YJNA 4PZ7A 3FP9A 1N8RC 4YHHQ 1IL2A 1PH7A 1PH5A 2I5HA 1XMQQ 5ELOA 4X64Q 1NMGA 2NVQH 1VQ5A 3HOVH 1N36Q 2YU9H 4UP9A 3DLLA 4A93H 2F4VQ 1QZHA 1PVOA 4JBJA 1OXVA 1UWVA 4JBWA 5IYDG 1PV4A 3H3VH 1SMXA 2UXBL 3PIPA 1WOCA 2PQAA 3PF4A 1HNWQ 1Y1VH 1VQHA 3KF8B 2D62A 3I55A 2VUMH 2E2IH 3HOUH 4JI5L 4DV7Q 5IP7H 4RMFA 1CUKA 1VQCA 1A62A 1VQKA 5C44G 2E2JH 4NXNQ 4WJ3M 4KHPL 3I4NH 3PUXA 2HT1A 2LSSA 1GM5A 1Q1BA 2IX1A 4EQ5A 5LMNQ 2VQEL 3CPWA 5JEAJ 2PI2A 4BY7G 4A3CH 4JV5Q 3RLNA 1J6QA 1EIFA 4XTCS 4ALPA 4DUZQ 1O7IA 2OCEA 1HZ9A 4DV6Q 1NMFA 2R7ZH 2RF4A 4KLKA 3OTOL 2WAQE 4GOPC 4UY8C 4DR4L 3CMEA 4JYAQ 4DV1Q 4LF8L 4A3IH 3ULPA 2JA5G 4A3DG 4JI3L 2VQFQ 1WCMH 1PH6A 1A0IA 2R7DA 2K50A 2NVYH 2F3IA 2ZJPA 3ICEA 1E7ZA 4AIMA 4DPGA 4AQYL 2ASBA 4IOAA 1N32L 3KFUA 3HOYG 3GTOH 4A3GG 4QY7A 2KCMA 4HJ9A 2JA6G 4B3RL 4JI1L 3AYHB 2JQOA 2OWOA 5IWAL 1J5EL 4YY3Q 4BBSH 4YCUA 3S2DH 4LWCA 4A76A 3KYHC 1PH8A 4A3JH 2VS1A 1QZGA 2R93G 1Q1EA 1E22A 4JI4Q 3NELA 3U4ZA 4LF5Q 4OX9Q 1IYJB 4C2MH 3CCMA 4K0KQ 4A3LH 1VQ6A 4C3HH 1TWHH 5M5WH 4QJFA 2ALYB 1VQDA 2JEBI 4DV3L 1E1OA 1EQQA 3PO2H 4DR3Q 1QVCA 1VQGA 4GS3A 1A63A 2K5VA 2MQHA 1IBLL 1N33L 1RIPA 3RN5A 1H95A 3CXCA 1E24A 1L1OB 1VQNA 1EIYB 3DM3A 1VQJA 1YZ6A 1X65A 2PMZE 3KJOA 4A3BG 4DR7L 1GKHA 3UE1A 1HZBA 2F52A 3RZOH 3S15H 1IBKL 3HOZG 3TS0A 3WWVA 3F2BA 4GNXC 1KC8C 3K80C 2CCZA 1M90C 3IRBA 5M5YH 1VQ7A 1PA6A 2GVBA 4LF7L 1L0WA 4X62Q 2CFMA 3T1YL 4JI5Q 5M3FG 1TWGH 2I5LX 1CSPA 2ZJQA 2IT1A 3PUWA 1MKHA 2ID0A 3S1RH 3G6EA 2ZTCA 4KHPQ 3W5OA 4DUYL 3D31A 4A3KH 3J7ZC 3GTGH 1NJIC 2MFIA 3ERSX
chains in the Genus database with same CATH superfamily
3AFPA 1QE6A 1STEA 3D4WA 5C0XI 1XXGA 3HEJA 1VF5C 3OHXC 2YTVA 4K14A 3ULJA 2N8NA 1ENCA 4J15A 5C3EH 1C48A 1SFOH 3SGIA 4JK1C 4A3FG 3W2DA 2UUBL 4A3MG 1K8OA 2F3VA 5M3MB 3M4PA 2D0PA 4BA2I 1HPCA 1TWAB 2LY7A 4TRDA 1GUGA 4P74A 2O4XA 1SE8A 2CWPA 4RG1A 5BN3A 3M85A 4JOIC 2EYFA 4DR7Q 2IX3A 1LO5D 5C0XJ 1F2YA 1LV9A 1YEZA 4HMJA 3HG9A 4LF7Q 2EXZA 1SYFA 2VW9A 4KY7A 2DY7A 3B6YA 3VDYA 3CD6A 4ULLA 3PO3H 1R9TB 3GV3A 1HXYD 3OIQA 5GAEC 5C44B 4DA2A 3PIP3 2HQLA 1HR0L 2BE5C 2EPBA 1ASYA 4A93G 4DV2L 2F1MA 2B2UC 3I4OA 2L9HA 3FPUB 1LTGD 3M4YA 3TRZA 2EY1A 2ZT9C 2VUMG 2B2VC 3ND9A 5I2YA 2NVXH 4A3DB 2OQ0A 3I4NG 4DK0A 3A8IE 1HUNA 1LT5D 5LHY1 4A3CG 4LUOA 5ELBA 2EJMA 1RL2A 3P20A 4DAYB 2R92H 3R2TA 5G3LF 3UDGA 4DV5L 3L0OA 1XPRA 2G9HD 4BY1H 3E9IA 1R4QB 1WCMB 3L2PA 1Y69U 1PFBA 2ZTEA 1U4PA 3NTIA 1KD1C 2KVMA 3AQQA 1GHKA 3H3VC 2B2TA 4BBSB 4A3BB 1Y8PB 1GOZA 1EWHA 2Q8RE 3A7AB 4OO1H 1TU2B 1SMYD 1F9RA 3NP8A 1SYGA 3I90A 4M8AA 1IXRA 1EOTA 2UXBQ 3NBHA 4PG3A 3TP7A 4HIMA 2M9VA 1LT3D 1IW7D 3CPFA 3S17H 1B1ZA 1EY9A 2AKWB 1N9WA 3MFGA 3VA5A 1HR0Q 3KLSX 4YWLA 5D14A 4DV2Q 1JJ2A 3I4LA 4IUTA 4NXML 3BZKA 1HTLD 3CKIB 1SNMA 4IN3A 4LFBL 4YIJA 2F0PA 1FD7D 1VQBA 1NR2A 2DNEA 3HKZE 3CAMA 1SNOA 2WB1E 1WTQA 3J7AF 3RNUA 3A54A 4DV7L 5JPNC 4DV5Q 4IPCA 5IIFA 1JICA 1W3SA 1P16A 1KAAA 4IQZA 3GO5A 5EBCA 1SFOB 4BBRG 3L3OC 2UXDL 4GZYC 3TZUA 4DK6C 4DV1L 1ASZA 3FKIB 5FLXc 2EOTA 5D65A 3K81C 4ZCKA 3GTQH 5IYBH 4FYDA 2CW0C 2A68C 4B3ML 1BCPD 2PMZB 3HOXG 2JA8H 3KF6A 3A8KE 1Y8NB 2K4KA 3H0GG 3OMCA 2B2WA 3SK8A 4DNRB 5T1GA 2EZVA 4N9PA 3X3NA 1H9MA 5G3LD 4NP5A 1H9JA 3UDXA 1XJVA 1F2LA 2RHSB 4C3IH 1ILQA 3GP7A 1ZXTA 3HOVB 5JJIA 1H9RA 4OXPA 4QCLA 4LFBQ 2MO1A 2EYHA 4K8IA 4FF2A 3KBGA 2JA7G 3QOJA 3GTLH 1PRTD 3HOUB 3PO3B 2E2IB 1A2TA 2WP8J 1JE5A 4A3EG 1SJHD 1S4ZA 2Q2TA 1TS4A 4O2DA 1TY0A 1GXDC 1DZ1A 2KEDA 4GLXA 1NY4A 1BBUA 1X9NA 3I2ZA 4GN5A 2UXCL 4IFDJ 1D2BA 2N88A 5CYUA 4GLAC 2NVXB 4A3GH 3Q6SA 2H5XA 3TMEA 2O5IC 1B53A 3BVMA 2K75A 4APVA 2UXDQ 1EIHA 4WJ4A 1GVPA 1I4HA 2KBNA 3LX0A 4B3MQ 4R4IA 5ISRA 3IAYA 2R92B 3VA7A 4GNXA 1G6PA 2Z0SA 1EZ8A 5C0XG 3J81j 4BY1B 3CC4A 4A3JB 5IGFA 3RLOA 3NBHB 1PH4A 5M5WB 1Y14B 2YYZA 4HIKA 5A2QE 3UDIA 1FJGL 1EYDA 2ZTDA 1N34Q 3RZDH 2VY3A 3OSOA 2R6GA 2PNRC 1NTGA 1L1OA 1Z6HA 3S1MH 4YHHL 1EEID 2FJ2A 4LJZC 1HH2P 2CH4A 2L4NA 2B2TC 4RHSA 5FLXE 1N36L 5AFWA 3GDEA 2EYJA 4XDXA 4CKEA 2F4VL 2FMMA 3MFYA 2OF1A 1CI3M 2EJFC 4HCEA 4A3KG 4CKBA 1QVGA 1F77A 5J3BA 2K5QA 3AU7A 1LYLA 3PIOA 1YHQA 1C9OA 1PYWD 2UXCQ 1UAPA 2XSCA 3CP0A 1I3QH 3S2HB 2YTYA 1SJED 4A3FH 1A15A 4A3MH 1R4PB 4WRDA 4KI0A 3UI2A 4WORA 1TS2A 1EWIA 2Q2IA 2J4XA 1CQVA 4DV6L 2FHTA 5C4XG 3K7AB 4JYAL 1KTKA 1SE4A 3L7ZC 2Y0SG 2AQ1B 2HCCA 3KF6B 3OPOA 1CKNB 1ZYRC 3VYRA 1K3RA 1I6HH 3J81i 4FDBA 2IX0A 1Q8KA 2Q2HA 2XGTA 1FJGQ 5BN4A 3BDLA 5IYCG 2HQEA 1O7LA 1SXTA 4FP5D 2EXDA 3AB9A 2JA8B 2ZJRA 1EL0A 1LT6D 3VYSA 1WFQA 2ICIA 1U4LA 5DEHA 4YHHQ 1IL2A 2EDGA 1PH5A 3NQTA 1N36Q 4XYQA 2QEJC 3NWSA 2F0TA 4UP9A 1WTRA 1RKNA 2F4VQ 4A93H 1PVOA 3TN2A 1UWVA 4JBWA 4IZ8A 3C1EA 2TMPA 1SMXA 2MP1A 1WTPA 4NMZA 3R2IA 5C5LA 3OWEB 2VUMH 1XWEA 2B2WC 4JI5L 4RMFA 1CUKA 2NBFA 3TSSA 2E2JH 4KHPL 3I4NH 3I91A 3PUXA 2HT1A 2Z4HA 1Q1BA 5D3DA 1CHPD 3GTLB 2VQEL 1BCPB 2PI2A 4A3CH 5EJWA 1EIFA 1EU3A 1JORA 1EY4A 4DV6Q 1HZ9A 3NXWA 4DR4L 2A6EC 3CMEA 4JYAQ 1SAPA 2JA5G 1PH6A 2NVYH 2ZJPA 3SHLA 1IKLA 4IOAA 3HOYG 4A3GB 2JA6G 1DJRD 4JI1L 1JE4A 2JQOA 2OWOA 1RTNA 4YY3Q 4XQJA 3MVVA 5CBEE 4LWCA 1G91A 4A76A 4DAVA 2RDFA 3G7LA 1B44D 5ELDA 1PRTB 1TWHH 2JEBI 4KK7A 1FNVA 4DV3L 4OIKA 1VQGA 2K5VA 1IBLL 1N33L 3U9OA 1I50B 1L1OB 4WJWA 4MTKA 1YZ6A 2PMZE 4CJ1B 3UE1A 3DEOA 1SYCA 2F52A 2H1EA 3RZOH 3S15H 2BE5D 1QOHA 3FMCA 3ITPA 3TS0A 3F2BA 4GNXC 4Q5VA 2V4DA 3SXHA 2CFMA 4JI5Q 2I5LX 2D5DA 2ID0A 3H09A 3VR5A 4KHPQ 4DUYL 2B8GA 3GTGH 3OWFA 4G57A 2MFIA 3ERSX 1SNPA 2VQEQ 2X6LA 2RKSA 4KKTA 5E4WC 1KIXA 3GTPH 1LACA 3PIO3 4DR4Q 3Q24A 5CV5A 1YHAA 1L1OC 1X3QA 4JI6L 1UEBA 3V2TA 2ZM6L 1SDFA 4BBRH 1PH9A 2OXPA 2KOLA 4JI1Q 3SR1A 3BS1A 5F2DA 2EIFA 3GTMH 2QCPX 4GLVB 3T1HL 4NB3A 5E7NA 2DJFC 5DM63 3HOXH 4X3TA 3T51B 1VS0A 4L5SA 1GJXA 3JC66 3H0GH 4DV3Q 3URYA 2BDOA 4DXFA 1V1OA 1EZ6A 2EE1A 2VZAA 3DWAA 3NPPA 4C3JB 1IBLQ 1N33Q 3L9AX 3Q0AA 3EN2A 2L0CA 3N6RA 4JPBW 1A8VA 1PHJA 1DM0B 5IGEA 3S24A 1K83B 3M3YH 1C0AA 1AW7A 1EFID 5M5XH 1II3A 2O5JC 1AZPA 2F0NA 3DHQA 3GTJB 4IPHA 4PMBA 3GV6A 3JAMc 2SNSA 3H94A 3C46A 1KDCA 2JA7H 1S5ED 1JJCB 5FO7B 4PMWA 1UNSA 4C1NK 4HIDA 1YJ9A 4A3EH 4ZKCB 3CCJA 1XPOA 1YNJD 3NTKA 3IL8A 1JB7A 2ZXOA 5JJLA 1TR5A 1STAA 4K2LA 2EYOA 2JK8A 2SNMA 3PSIA 3VYTA 3S14B 2RDHA 2XRQD 4ZUJA 4KN7C 2VUMB 1Y1VG 5A2QL 4JI6Q 2NTSA 2RSNA 1XMOL 1UE1A 2EYPA 2ZM6Q 2O2LD 3CQZH 2E2JB 3U50C 3I4NB 4LF9Q 3PUVA 3FHWA 1CZGA 1JWUD 5AJ3L 2JA9A 4H44C 3FDTA 3T1HQ 4A75A 1HNZL 1ESRA 3MWYW 2VNUD 2AWNA 4QMGA 5C0XH 4AYBG 4B08A 1PH2A 4HIOA 1H9SA 1SNDA 5FLXL 2NVYB 1HRJA 2I0QA 4CDEC 2MHVA 1JOOA 4DN4M 3I8ZA 4OWXB 1Q12A 1E3PA 1OXUA 3TP6A 3J7AV 4X3KA 3Q8DA 1D5XC 2JEAI 3E0JA 2EJGC 5JVH3 2X69A 4UPAA 4XT1B 3CC2A 2RVLA 2UU9L 4A3LG 4TSSA 4FNFA 1HJPA 4HMIA 3PO2G 1AFPA 4U68A 5M3FB 1GD7A 1UE6A 1WD1A 2P5ZX 4CBVA 3S15B 2XIWA 3KUPA 2Q2UA 2KHSA 4EGVA 2F0HA 4IJLA 2EYMA 1AE2A 4O42A 2BH2A 1B8AA 2F0UA 1KDAA 3M4OH 4X64L 2WAQG 1CA6A 4R4TA 1ICFB 5JPMC 3FEWX 2E2HH 3GTGB 4IPDA 1ML0D 4LNQA 1DOMA 4DR6L 5C4ZA 4KKUA 5AJ3Q 3I4MG 3HZXA 3K5LA 3GTPB 2YV5A 5C4XH 1HNZQ 1X55A 1WYDA 1BR9A 3JAME 4Z9CB 2QA4A 1J9OA 3AFQA 1HQRD 1HHVA 1EUJA 1YHBA 1U4MA 4BBRB 4EX5A 4DR2L 3T4AC 3KK7A 1RCVD 1EY8A 2E8GA 5IYCH 3MXPA 4QQBX 1V9PA 5C6AA 1HA6A 3QIAA 1STNA 3TEHB 5KYIA 3KLRA 2UU9Q 3E3XA 1IYUA 1LTTD 3H0GB 4F87A 5IGBA 1VMPA 2QKIC 3MHBA 2JE6I 2N49A 2RBMA 5K36G 1YIJA 1BOSA 1SSOA 3PV0A 1C8CA 3ER0A 5C4JB 2G5DA 1VCIA 1K8MA 1CHQD 3M3YB 4PZ8A 2HDMA 2GA4B 4JCVE 1GO3E 1IHZA 4PZ6A 1TWFH 3PF5A 2V1CC 2IHFA 4MN3A 4FVMA 4GOPA 2YU9B 1EQTA 3LWEA 1KAWA 1EYGA 4KJOA 1UE5A 1E1TA 1B3QA 4JVZA 1CQFA 1W6KA 4I65A 3MC0B 4P73A 5C3XA 4DR6Q 4A3EB 2DY8A 4GN4B 3HKZG 3BU2A 2B3GA 2WB1G 3D6WA 2UUBQ 3HOWG 2QDBA 1Q90A 2JA5H 3SK6A 2PNHA 2R7ZB 3BZCA 5BR8L 1H9SB 3BVGA 3HOYH 2JA6H 4K5XA 4UP8A 5KIXA 5LMUL 1ZYRD 4P75A 4DR2Q 3ONAB 1YVCA 5FLMG 3CHBD 1B70B 2NUCA 2R7FA 4DU9A 4KHZA 1LTRD 3GTOB 4RAUC 5CV7A 1NCVA 1VQFA 1S5CD 1VQPA 2NVTH 2NTTA 4KV6A 1LTBD 1JOKA 3T53B 1I4XA 1PFMA 4LK1C 4DAPA 1S3OA 1MD2D 1EQVA 3EQLC 2CH4W 1GHJA 4JBKA 3KOJA 1VQOA 5E3FA 4KN4C 1CKOA 4LW1A 3QJYA 3BDOA 3NHHA 1WTOA 1X3GA 3S1QH 3G6JB 1KRTA 4QIWB 3H6MA 5C5MA 1AH9A 4P72A 3DWPA 4KTAA 3J80c 3MTSA 1TKWB 5BN5A 3T13A 1D1IA 4DXGA 5DLQE 5K5PA 4OONA 1XMQL 3K5OA 5EPLA 3RUZA 5L37A 1MSGA 4X66L 3SVMA 4HAEA 1STGA 3P1HA 4X65L 5KNCA 1CKMA 2A6ED 1VDZA 4A3KB 1ICWA 2ATWA 5KGUA 1YNJC 3MEFA 4K5VA 4XIGS 1Y1WG 2RQXA 4ILWA 4P2CB 1XNRL 1HNWL 3RLFA 2IY5B 5BR8Q 3MA2B 3H15A 4HJ5A 2PI2E 1CSQA 4NXNL 1TS5A 5LMUQ 2K14A 1NAPA 3DWQA 4RWSC 4JC0A 4JV5L 1PMRA 5C3EB 4DUZL 2ICEC 1LTSD 4L63B 3PUYA 4LAAA 2HHHL 3QR8A 2Y0SB 3BZDB 1A2UA 3TDQA 4BWGB 5IGGA 4G4KA 3S1NH 1DD2A 3K57A 1Q82C 3PMFA 1EYAA 5CGKA 1X56A 5TSSA 3OW7A 3CRLC 3NENA 1PH1A 1UE7A 3HS0C 1TS3A 3OIPA 1LABA 4IFDI 2NN6I 3G71A 5EKKA 3VR4A 4L5RC 3I72A 1EWCA 2HIVA 2JYOA 2Q8TA 1L2FA 4V190 5HGQA 2OTJA 3H91A 3AEVA 2BOSA 1AP0A 4NXMQ 4DR3L 3TREA 2K33A 5COYA 1WTHA 4V0BA 2Z4IA 4KY5A 1XMQQ 5ELOA 1A6XA 4ZUIA 2NVQH 1GUSA 1CM9A 1A3UA 3DLLA 1OXVA 3C3LA 3E5SA 2PQAA 1VMCA 1HNWQ 1SE3A 1Y1VH 3DXJC 2D62A 3EFXD 1ILPA 4DV7Q 2NZ1D 5EGTA 4NXNQ 1MSHA 5C44G 4NKLA 1FYCA 4PNYA 3CPWA 4BY7G 4JV5Q 3RLNA 3VYUA 1J6QA 4DUZQ 2OCEA 1QJOA 1NMFA 4GOPC 2PW5A 4DV1Q 4A3DG 2PCFB 3J80E 1A0IA 4HSPA 2F3IA 3HOYB 3KFUA 4LMQD 2JA6B 3LWUA 4QY7A 2KCMA 4S3SA 4B3RL 5IWAL 1J5EL 3IFTA 2H4OA 4YCUA 3S2DH 1CK1A 3V05A 2BCOA 1QZGA 2F0GA 5HURA 1E22A 2I46A 3NELA 3U4ZA 2F0IA 4A3LH 3CCMA 4C2MH 1VQ6A 4C3HH 1G2SA 2ALYB 2XWBB 1EQQA 1PFNA 1RODA 3PO2H 4ID6A 4RFBA 4DR3Q 2RSOA 2KA7A 1RIPA 3RN5A 2XVSA 4FXGC 1EIYB 1VQJA 2NYZD 1X65A 3KJOA 4A3BG 1BDOA 3JAML 3HOZG 3RMHA 3S17B 3K80C 2CCZA 4F7XA 2PW7A 5M5YH 5I2XA 1ONLA 1V1PA 2J0TD 2ZJQA 3ND8A 2IT1A 3PUWA 1MKHA 3S1RH 1G2TA 3G6EA 1RHPA 2IWHA 1D5MC 5ELCA 1NJIC 4JI8L 3I4MH 2KECA 1KXLA 2K1BA 2C5CA 2D9UA 1U0LA 1GUWA 1K0RA 2A19A 1AZQA 4Y7NH 2FXQA 1FR3A 2RDGA 3D0FA 5CBAE 1XTDA 3W1GA 2ZXRA 3M9BA 3WOEA 1WD0A 4B3RQ 5IWAQ 5KNDA 1J5EQ 2B63G 4G7HC 1HA5A 4MZ9A 5JJZA 4U673 2A69C 1G51A 2EQSA 5D3IB 2CWAA 4HR7B 2F0JA 4CGYB 3I70A 4BA1I 2F4IA 3GTQB 4B3TL 1JB3A 1D7QA 3S1NB 1YI2A 1EY5A 5K36H 1TWCH 3FKIG 5I9PA 2QW7A 4HTHA 1F9QA 1JQYD 1HZCA 1E0BA 1X3PA 4ZKBB 2FINB 4KJNA 3C2PA 2K5NA 2NZOA 1FVIA 1KNAA 4EQPA 2AQ2B 2PQAB 4C3IB 3F2DA 3F2UA 1X3FA 1WTWA 4QIWE 1BKBA 2RCNA 2I07B 2QEXA 4JI8Q 1MIUA 2NVQB 3HOVG 1KDBA 2MNAA 3HOWH 1E2WA 2IW3A 3CCSA 3S16H 4OL7A 4X3SA 3HOUG 2I5MX 4DKAC 1O7ZA 1KLGD 2OT2A 2LFNA 5FLMH 4GNXB 2DJGC 2M00A 1BBWA 1PLFA 1FGBD 4FF4A 1S40A 2M2LA 4TQUS 1ESFA 1EY0A 3M4QA 2SEBD 2WKDA 5T1IA 4A3IG 4OWTB 5LMNW 3A0JA 3TP5A 3WDNA 4CJ2C 4HJ8A 4B3TQ 4RGOS 2E5LL 2R93H 3NE5B 1XYIA 1K28A 3BG3A 3EIVA 4QUFA 2Y0SE 1KHIA 5ELFA 5JVG3 2LS01 3K7UC 1PZJD 3NSWA 1K0SA 4A3JG 4N8FA 4DF7A 1MHWC 4C2MB 1EY6A 4XQQA 1BVSA 3X3MA 3ZYYX 1V1PB 1K73C 1QVFA 3RZDB 2JSOA 2XN9C 5KYLA 4MHEA 1YJWA 4X6AH 3OMGA 2F03A 1JR0D 3F1ZA 4KY6A 3IKJA 2Z1CA 1ET6A 4PMCA 3S1MB 1PDQA 2DGYA 3EBEA 1I4RA 3J81c 4IFDG 2NN6G 3GTKH 2K01A 1Y1WH 1EEFD 1PTOF 2OQKA 3CCLA 3OYYA 3F8TA 3CC7A 3S1RB 3GD7A 2QDLA 1S72A 1PYSB 2F0LA 1PH3A 2L15A 1QB5D 1KQSA 2K03A 1I3QB 4CDDC 1STBA 4A3FB 1PZID 4IUUA 5CORA 2HIXA 5IGCA 4A3MB 5IOCA 3I56A 2K5WA 2F0WA 4JI0L 4R8IA 3A55A 4A4IA 2K5DA 5ELNA 4ZRZA 2JJQA 3KJPA 4R9WA 1O7YA 1V1QA 2AQ3B 2D2CC 2MO0A 5EKIA 3WOFA 1LM0A 4YWKA 1SNQA 4FF3A 1F2ZA 1TWAH 3MZ5A 5C4HA 2K6AA 5DM73 3U4VA 1I6HB 4X3UA 5FJ8G 3D3RA 1QUQA 2HUGA 2B29A 5FKAC 4IPGA 2K28A 3CF5A 2K04A 1I6VC 3MEHA 4EQNA 1VQ8A 1AN8A 4LFAL 4DAMA 4DUYQ 3J80L 4LF4L 1D8LA 1JC7A 3HFZB 5KRUA 1A3VA 1SN8A 1O78A 4XQNA 5CV8A 4RGTA 1R9TH 4A93B 1Q3LA 2A6HC 3UE0A 4CDFC 4NDXA 5J1ZA 5C44H 1ENFA 2YTXA 3K6OA 3U58A 1P8LA 4LF6L 1G6ZA 1XTCD 1C7YA 4BY7H 1KLUD 5IY0A 1U4RA 2L1BA 3PQIA 4FF1A 1QNKA 4X62L 2KENA 2KQ3A 2GVAA 2AUJD 3G4SA 4A3DH 4JW0A 4JI0Q 5FOBB 3KF8A 1IKMA 1SRUA 4BS9A 2F0KA 3TS2A 4ODGA 5JOBA 2QF7A 4B9XA 3A5UA 1ENAA 4JI7L 4H0LC 1D5ZC 4JBMA 1G8ZD 4KKSA 4C1NI 1Y8OB 2JP1A 5FO8B 2EVBA 3J81E 5CR3A 4UHVA 1K8AC 1IYVA 4K2KA 1NBWA 2B2YA 3CCRA 4FO2A 2CKZB 1IZ6A 5JAVA 2L55A 4HSVA 2XRSD 1XPUA 2E74C 3TBIB 1TWHB 4C3HG 4A3BH 1T9HA 2KEEA 3A56A 2GN5A 1SROA 4LFAQ 4BXXG 4LF4Q 3H3VI 3HOZH 3PGZA 4KD4A 1RDPD 4IOCA 1QCBD 2SOBA 2KCNA 3SEBA 1Z47A 5IP9G 3RZOB 1STHA 4HN7A 1IL8A 4YCVA 1LTID 1I4PA 5I9OA 1X3EA 1AE3A 2K52A 5IT9c 1PTOH 4LF6Q 2N3SA 3K0XA 3NQIA 3A5ZB 1DCZA 1XMOQ 1LLRD 2BA1A 4UP7A 4K8JA 1NR4A 1YNXA 2B8FA 3KLWA 4RCNA 5LL6S 2AWOA 2DN8A 1CT1D 2ENBA 1Y1WB 4HJAA 3STBC 2IPKD 3J7A5 1U9RA 4PV1C 1K8GA 1HCZA 3HGBA 4HJ7A 3F2CA 4JI7Q 5LMNL 2B63H 3N52A 3LGJA 1PFSA 1SLJA 1RJTA 2VB2X 2F3WA 1MJCA 4DK1A 4FXDA 1VQIA 4UAIA 1FL0A 1WTXA 3GTMB 1HZAA 4MTNA 1QUQB 1OXXK 3FKIH 3HOXB 3NK9A 1HTPA 3BYTB 1LUZA 2CQOA 2K5HA 2PZUA 4AYBE 3J80i 4KHVA 1QWYA 1HFNA 4IUNA 3A7LA 4JI4L 4H02A 1V43A 4C3JG 4OX9L 1M4VA 1EOVA 1NNXA 1W2BA 1E2ZA 5M5XB 1DONA 1Z9FA 4K6LA 1NUCA 2WACA 4PZ7A 5FK9C 1N8RC 4O1NA 3BDCA 1PH7A 2I5HA 1YNNC 3T16A 4X64Q 3HOVH 1VQ5A 1DXMA 2JA7B 3SDZA 3VR2A 3LNNA 2IL8A 4TKOB 1QZHA 1RTOA 1CZWA 2FFKB 5IYDG 1PV4A 2F0MA 2AUKA 2UXBL 3FRPB 4DGZA 4RA8A 1A3TA 1VQHA 2RA4A 3KF8B 5C3WA 3HOUH 2E2IH 1VQCA 4RKLA 4WJ3M 3MXUA 1TIID 4EQ5A 5LMNQ 1LT4D 3K5NA 2F0FA 5JEAJ 4BY7B 4IURA 1RD9D 3CQZB 2A69D 4I7AA 2Z6BA 4KLKA 3OTOL 2WAQE 4UY8C 1BCPF 4LF8L 1CFMA 4WFN3 4A3IH 3ULPA 4JI3L 5EKLA 1MGSA 2K50A 2R7DA 4AIMA 3NBIA 4AQYL 1J8IA 5IT9E 1N32L 4HJ9A 4EQOA 4H7BA 1B3AA 3NTHA 3KYHC 1PH8A 1LTAD 3R8BA 4A3JH 2A5HA 4IUPA 2R93G 1Q1EA 4JI4Q 4OX9Q 1BQQT 1EY7A 5M5WH 2WV6D 1E1OA 5CV9A 3K5MA 1QVCA 1A63A 4GS3A 1HUMA 4DNTB 1PRTF 1E24A 5FO9B 3CXCA 1VQNA 2F0QA 3BYYB 1IBKL 3HOZB 4IFDH 2NN6H 4N8X1 2MPMA 1KC8C 4CKCA 1WVLA 1M90C 2B2YC 3K0YA 5KEEA 3E6ZX 3EJIA 3T1YL 5M3FG 1TWGH 2WINB 3J7YW 1EYCA 2ZTCA 4ZLTF 2PYKA 3W5OA 4A3KH 1PTOB 5HY6A 3M4OB 3K59A 5I4DA 2QILA 2BH8A 3OTOQ 1JOQA 4GKJL 2E2HB 3E9HA 4LF8Q 1GUOA 3S2HH 5GAGC 5KNBA 4DV4L 4DNIA 1K9MC 4JI3Q 1X6OA 5C4XB 4OGQC 4AQYQ 1N32Q 1EFWA 2F0SA 4TVAB 1SEBD 4ME3A 3K7AH 2KJXA 2B63B 1FNWA 1MI2A 4OWWB 1L0XB 2Z6KA 3K58A 3UDFA 2KHIA 5EPJA 4OO1I 5M3MG 5FJ8H 1VQ4A 1ZEQX 5IODA 5I6YA 1TXYA 1VQEA 1VQLA 1PTOC 2E75C 3IFDA 3G48A 3CCVA 2R61A 4GOPB 1Z7TA 3DM1A 2A1AA 4XXEA 1WTVA 4MNOA 1IBKQ 4H13C 1CKNA 1S5DD 4X66Q 2PZTA 1SYEA 4X65Q 5GQOA 3I73A 1XNQL 4L5QA 1BXTA 3T1YQ 1UUPA 1D6EC 4DR1L 1TWFB 3J81L 2N78A 4K6DA 1XNRQ 1PYBA 1D1KA 2K05A 1Q8IA 4R4QA 1I94L 1N34L 5E4XA 1EQRA 1OO9B 2HCIA 4GKJQ 2CVRA 4DV4Q 1Q81C 1M1KC 5IE8A 1BNZA 4ABNA 5I6WA 3MAQA 2HHHQ 5IP7G 2JA5B 2KUMA 1EU4A 2R3ZA 5GAHC 2QGQA 3E0EA 2J7ZA 3KLSA 4RGNA 2IHEA 2VL6A 4GKKL 3HP3A 1OXSC 3DEPA 3TP8A 3A74A 5NUCA 2R7ZG 2L5TA 4M1UB 1RF2D 3QG1A 2FMCA 3BVZA 4A3IB 1ZKOA 2PZWA 1WCMG 2WIIB 2NVTB 1I5FA 1Q7YC 2MGSA 4XYOA 1DGSA 4OIJA 4YCWA 4HEDA 4BXXH 4O0AA 2HDLA 4BBSG 4IUQA 4L6TB 1B7YB 3PCOB 1F2MA 1PXUA 5EAYA 3BJUA 5IP9H 4L5TA 1I50H 3S1QB 1XNQQ 4ZAIA 2A6HD 1JT8A 3D8GA 1F9SA 4DR1Q 3I3CA 3R93A 1G291 4RHRA 1TVXA 1SR3A 5EBDA 2D0OA 3FVQA 5LL6X 2AMCB 3VR6A 1I94Q 1OTCA 4LFCL 4F8MA 3ZJYC 4POGA 1CTMA 2EY5A 4ZYSA 4QUCA 5JEAG 4P71A 1B9MA 2RCFA 4MIUA 1Q86C 2F0VA 2C9OA 3CRKC 3K8AA 5GADC 2ES2A 1VQ9A 3KDFA 3MXNA 4R4CA 2RHQB 1W6JA 1TWGB 4LUVA 2XWJB 2E2DC 2A8VA 1STYA 1WI5A 1YITA 4J1MA 1ET9A 4GKKQ 4HCSA 4AH6A 5J39A 1KL9A 4B3SL 2F0DA 3M7NA 4DR5L 1GUNA 2WKCA 4LUZA 4YWMA 3T56B 4JG2A 3SK4A 1IBML 1DOKA 5C3EG 1SYBA 2DUDA 4GN3B 2EYLA 4FXKC 4JI2L 3QWNA 1KABA 3R3OA 4C3JH 2E76C 1DOLA 3W1BA 1BO0A 3TZDA 3KBXA 2K7VA 3NEMA 4YY3L 1K83H 1X54A 4QB4A 3RN2A 3I7FA 5EPKA 1GUTA 4I7ZC 3RD4A 2Z6KC 2UUAL 3GTJH 1NSNS 3EA6A 4LFCQ 5JJKA 5IYDH 1EIGA 3CCUA 4PQXA 3VR3A 1B4OA 1DYQA 5IT9L 1X32A 3NUCA 1SMYC 3AMUA 3STBD 2XNAC 2LXJA 4QF4A 1IW7C 2VXWA 1WJJA 4IUVA 1Y1VB 3OW2A 3PO3G 1KRSA 3V96A 4UDUC 3S14H 2NWGA 5DNFA 3Q23A 4B3SQ 3ERQA 4DR5Q 1T5EA 2CHBD 2PQEA 3P7JA 1LTLA 2UUCL 4POFA 2C35B 2MUYA 1IBMQ 2BA0A 5HGTA 3CCQA 3ULLA 4C56C 4CHTB 4L8JA 2AHOB 2HD3A 2G9DA 2KHJA 4AYBB 1OXTA 2L11A 4R4OA 1MJEA 2VB3X 4JI2Q 1SBBB 4Y52H 4RH6A 1UEAB 3JAMi 2R92G 1YBYA 3S2DB 1HNXL 1O80A 2EY2A 4BY1G 2CQAA 4G7OC 3TQYA 1SNCA 3P75A 1JMCA 4QL5A 2A73B 4C3HB 3O13A 3GQBA 1TT2A 1YNND 2B39A 2KCTA 3PO2B 1NE3A 2UUAQ 1T5XD 1E2VA 1HQMC 4DV0L 3W3AA 2TSSA 4ZK9B 2A74C 4J8QA 2OTLA 1BCPC 2L12A 3FPPA 4OO1G 2SDFA 5M3FH 4RKBA 3PUZA 3RR5A 1KNEA 3KDFB 3MXNB 5M5YB 1SYDA 2LXKA 2N55A 2WAQB 4NW2A 1JJGA 3HKSA 4IALA 3CW2C 1VQMA 3I4MB 2NZHA 4CJ0B 4KMUC 2UUCQ 4DFAA 1QNUA 3CCEA 1K3BC 3QOLA 4IJHA 1HR0W 2Q8IB 1M8AA 1Q46A 4R1JA 4Y7NB 1PRTC 5CV6A 1TY2A 1H9KA 4RCOA 1U5KA 2Z9HA 1SE2A 4JOIA 4N9TA 2E5LQ 5M3MH 4F88A 2IJ0A 2Z8LA 3CMAA 5J22A 1PZKD 4DK3C 4E6IA 2VQFL 5H1SE 1HNXQ 4LF9L 4IO9A 4B9WA 2KCCA 2WFWA 1VQAA 3D6CA 1QG7A 1TWCB 4Q0FA 4NPSA 4DV0Q 5E1FA 4QGUA 5IYBG 1JWSD 4R8NA 1TQOA 4RGMA 2B2UA 4LF5L 1FNUA 4K0KL 2XTIA 2JA8G 5EQ0A 3DMUA 1FGUA 5GROA 5C4JH 4XT3B 1AEXA 1YJNA 3FP9A 2B2VA 3CU7A 3NWTA 4OELB 1F9PA 2F0OA 1NMGA 4ZQ3A 2YU9H 1JCKB 2BDNA 3DUZA 1V8QA 3EVQA 4JBJA 4C3IG 3H3VH 5CV4A 4OHJA 3Q22A 2MJ8A 3HKZB 1WOCA 3PIPA 3PF4A 1BF4A 2WB1B 2JXMB 3I55A 3S9WA 3SK5A 3HOWB 1L0YB 3QB3A 5IP7H 1VF7A 1A62A 1VQKA 5A35A 5ELEA 3S16B 2LSSA 1GM5A 1I4GA 2IX1A 2OEOA 1I4QA 3MXGA 2F0EA 5CMDA 1HFGA 4XTCS 4ALPA 1O7IA 3EROA 2R7ZH 2RF4A 3D4RA 2X6GA 5DAUA 2VQFQ 2PPBC 1WCMH 1PTOD 3ICEA 5CC4A 3C1FA 1E7ZA 1JWMD 4DPGA 2ASBA 3GTOH 4A3GG 1CA5A 3AYHB 2CW0D 2A68D 2LKVA 1BBXC 1QILA 1B50A 4BBSH 4DAYA 2DNCA 4KD3A 5M9OA 2R93B 2VS1A 4OEMB 4LF5Q 1IYJB 4K0KQ 3A8JE 1B2TA 4QJFA 2K32A 1BUVT 1VQDA 3M7GA 4EVOA 1S5BD 2PO4A 4J6HA 1H95A 2MQHA 4K5WA 3SE0A 3HRZC 3DM3A 2NB0A 4G7ZC 4DR7L 1GKHA 1HZBA 1MBYA 3OOCA 3U9SA 3WWVA 5JEAH 2LMCB 4CDCC 3IRBA 1VQ7A 3QO2A 1PA6A 2GVBA 4LF7L 1L0WA 4X62Q 1XX8A 1S5FD 1CSPA 2EY6A 4ME5A 1C4QA 1B9NA 3GTKB 2JN4A 3D31A 3J7ZC 3D4DA 2ZXPA 5IGDA
chains in the Genus database with same CATH topology
3AFPA 5HY6A 4JI8L 3I4MH 1KXLA 1KIXA 3GTPH 2BH8A 3OTOQ 4GKJL 5C0XI 4DR4Q 1U0LA 3E9HA 4LF8Q 3S2HH 1K0RA 5GAGC 2A19A 4DNIA 4DV4L 1K9MC 4JI3Q 1X6OA 1YHAA 4Y7NH 2FXQA 2YTVA 1L1OC 4JI6L 1UEBA 3D0FA 3ULJA 4AQYQ 1XTDA 2ZM6L 2N8NA 3W1GA 3M9BA 5C3EH 4J15A 1SFOH 4BBRH 3SGIA 1PH9A 1EFWA 1N32Q 4B3RQ 4JI1Q 4A3FG 4TVAB 2UUBL 5IWAQ 4ME3A 3K7AH 1J5EQ 4A3MG 2EIFA 2B63G 4MZ9A 4OWWB 3GTMH 2Z6KA 3UDFA 2KHIA 4GLVB 1G51A 3T1HL 4NB3A 5E7NA 4OO1I 3M4PA 5M3MG 2D0PA 5FJ8H 2EQSA 3HOXH 1VQ4A 4BA2I 2CWAA 1VS0A 4L5SA 4BA1I 1TXYA 1VQEA 3JC66 1VQLA 3H0GH 4DV3Q 4B3TL 4P74A 3G48A 1D7QA 2VZAA 1YI2A 1IBLQ 1TWCH 3FKIG 1N33Q 3CCVA 1SE8A 2CWPA 3EN2A 4RG1A 1HZCA 3M85A 1A8VA 4GOPB 4JOIC 1PHJA 4DR7Q 2A1AA 3S24A 3M3YH 1C0AA 4MNOA 1IBKQ 5C0XJ 5M5XH 2K5NA 2NZOA 1CKNA 1YEZA 4X66Q 1FVIA 4IPHA 4X65Q 2PQAB 5GQOA 4LF7Q 3JAMc 1XNQL 4L5QA 3T1YQ 4DR1L 2VW9A 3F2DA 3B6YA 3VDYA 2JA7H 3CD6A 1X3FA 2N78A 4QIWE 1BKBA 1JJCB 2RCNA 1XNRQ 3PO3H 1PYBA 4PMWA 4HIDA 2QEXA 4A3EH 5GAEC 2VQEQ 4JI8Q 1MIUA 3CCJA 4R4QA 1YJ9A 1XPOA 1N34L 1I94L 3HOVG 2HQLA 1HR0L 5JJLA 1JB7A 1EQRA 2MNAA 1ASYA 4DV2L 3HOWH 4A93G 4GKJQ 3I4OA 2JK8A 3PSIA 3CCSA 3TRZA 3S16H 4DV4Q 1Q81C 1M1KC 5IE8A 1Y1VG 4JI6Q 2VUMG 3HOUG 2I5MX 2HHHQ 4DKAC 1XMOL 1UE1A 5IP7G 2ZM6Q 2NVXH 2OQ0A 3CQZH 5GAHC 3U50C 2QGQA 5FLMH 4GNXB 4LF9Q 3I4NG 3E0EA 1BBWA 3PUVA 3FHWA 5AJ3L 2IHEA 2JA9A 2VL6A 4A3CG 4GKKL 4LUOA 1S40A 1OXSC 1RL2A 4DAYB 3T1HQ 3A74A 2R92H 2R7ZG 4TQUS 4A75A 1HNZL 3UDGA 2VNUD 2AWNA 4DV5L 3L0OA 3M4QA 4A3IG 1XPRA 4BY1H 4AYBG 4OWTB 3E9IA 5LMNW 1PH2A 4HIOA 3A0JA 3L2PA 1WCMG 4HJ8A 4B3TQ 2ZTEA 1I5FA 1Q7YC 2E5LL 2I0QA 2R93H 1KD1C 1DGSA 3EIVA 3AQQA 4YCWA 4OWXB 4BXXH 1Q12A 2Y0SE 4O0AA 1E3PA 1KHIA 4BBSG 1OXUA 3K7UC 1B7YB 3PCOB 3Q8DA 2JEAI 4A3JG 5EAYA 3BJUA 4UPAA 5IP9H 4L5TA 3CC2A 2UU9L 1I50H 4A3LG 1XNQQ 1IXRA 1JT8A 1BVSA 4DR1Q 2UXBQ 1HJPA 4HIMA 4PG3A 1K73C 1G291 1QVFA 3PO2G 1SR3A 3CPFA 1YJWA 3S17H 4X6AH 2D0OA 3F1ZA 2AKWB 1GD7A 1UE6A 1N9WA 2AMCB 1I94Q 1OTCA 4LFCL 1HR0Q 2DGYA 3EBEA 3ZJYC 4YWLA 4POGA 4DV2Q 3J81c 1JJ2A 2Q2UA 4IFDG 2NN6G 5JEAG 4P71A 4IJLA 4NXML 3GTKH 3BZKA 1Q86C 1Y1WH 1AE2A 3K8AA 5GADC 2ES2A 2OQKA 2BH2A 1B8AA 1VQ9A 3CCLA 3KDFA 4R4CA 3OYYA 4LFBL 2RHQB 4LUVA 3M4OH 4X64L 2WAQG 3F8TA 3CC7A 4R4TA 2A8VA 3GD7A 1WI5A 1S72A 1VQBA 1PYSB 1YITA 2E2HH 4IPDA 3HKZE 1PH3A 4LNQA 3CAMA 2L15A 4DR6L 1KQSA 2WB1E 5AJ3Q 3I4MG 4GKKQ 4AH6A 1KL9A 2YV5A 3RNUA 4B3SL 5C4XH 2HIXA 4DV7L 3M7NA 1HNZQ 1X55A 4YWMA 3I56A 4LUZA 4DR5L 4DV5Q 1WYDA 4JI0L 4IPCA 4JG2A 2QA4A 1IBML 4A4IA 5ELNA 3KJPA 2JJQA 1W3SA 3AFQA 1P16A 1EUJA 1YHBA 1V1QA 2MO0A 3GO5A 5C3EG 4EX5A 4BBRG 4DR2L 1LM0A 4YWKA 2DUDA 4GN3B 2UXDL 4DK6C 4DV1L 1ASZA 4JI2L 1TWAH 5FLXc 2E8GA 3K81C 5IYCH 4QQBX 1V9PA 3U4VA 3GTQH 5IYBH 4B3ML 4C3JH 3TEHB 5FJ8G 3HOXG 2JA8H 3KF6A 2UU9Q 3W1BA 1QUQA 2K4KA 3H0GG 2B29A 3NEMA 4YY3L 1K83H 1X54A 4IPGA 3RN2A 2JE6I 2N49A 3I7FA 5K36G 3CF5A 1YIJA 1VQ8A 3PV0A 2Z6KC 3ER0A 4LFAL 2UUAL 1VCIA 3GTJH 4DAMA 4DUYQ 4LF4L 4LFCQ 1D8LA 4PZ8A 3UDXA 1XJVA 5JJKA 4JCVE 1GO3E 2RHSB 3HFZB 4C3IH 5IYDH 4PZ6A 3CCUA 1TWFH 3PF5A 2V1CC 1SN8A 2IHFA 4GOPA 5JJIA 1R9TH 4OXPA 1EYGA 1KAWA 1UE5A 3STBD 1E1TA 3UE0A 4LFBQ 2MO1A 5C44H 2JA7G 2LXJA 2YTXA 1WJJA 3GTLH 3U58A 1P8LA 4LF6L 1C7YA 3OW2A 3PO3G 4P73A 2WP8J 4BY7H 1KRSA 3S14H 1JE5A 4DR6Q 4GN4B 4A3EG 3HKZG 3BU2A 5IY0A 2Q2TA 2B3GA 2WB1G 4O2DA 4X62L 2KENA 2UUBQ 4B3SQ 2GVAA 3HOWG 3G4SA 4DR5Q 2JA5H 4A3DH 4JI0Q 1LTLA 1NY4A 4GLXA 4POFA 1SRUA 2UUCL 1BBUA 2C35B 1X9NA 3TS2A 2PNHA 1IBMQ 2BA0A 3CCQA 3BZCA 3I2ZA 4GN5A 3ULLA 5BR8L 4IFDJ 2UXCL 4GLAC 2AHOB 3HOYH 2JA6H 4A3GH 2KHJA 4UP8A 2H5XA 3A5UA 5LMUL 1OXTA 4P75A 4DR2Q 2K75A 1YVCA 5FLMG 4JI7L 4R4OA 4APVA 4JBMA 1B70B 2UXDQ 1MJEA 2R7FA 4JI2Q 4WJ4A 1GVPA 4KHZA 2KBNA 4Y52H 1VQFA 1VQPA 2NVTH 4B3MQ 1K8AC 4R4IA 3JAMi 2R92G 1G6PA 1YBYA 4GNXA 1NBWA 2Z0SA 3J81j 5C0XG 1HNXL 4BY1G 3CC4A 1S3OA 3CCRA 3TQYA 2CKZB 1IZ6A 3RLOA 1XPUA 3NBHB 1JMCA 4QL5A 4JBKA 4A3BH 1PH4A 1T9HA 3KOJA 1VQOA 1Y14B 1CKOA 2YYZA 4LW1A 4HIKA 2GN5A 1SROA 2KCTA 4LFAQ 1NE3A 2UUAQ 4BXXG 1X3GA 4LF4Q 3S1QH 3H3VI 3HOZH 3PGZA 1KRTA 3UDIA 1FJGL 4IOCA 4DV0L 2ZTDA 1AH9A 1N34Q 3RZDH 2OTLA 2VY3A 4P72A 1Z47A 5IP9G 4OO1G 5M3FH 3PUZA 4YCVA 3J80c 3RR5A 2R6GA 1X3EA 3KDFB 3MXNB 5DLQE 1NTGA 1L1OA 3S1MH 1AE3A 2K52A 4YHHL 5IT9c 4LF6Q 2N3SA 1HH2P 3K0XA 2LXKA 3A5ZB 4OONA 1XMQL 1XMOQ 1JJGA 4X66L 1N36L 2BA1A 3HKSA 3GDEA 2F4VL 4UP7A 4X65L 3CW2C 1VQMA 1YNXA 3KLWA 1CKMA 2ATWA 4A3KG 2AWOA 1QVGA 2NZHA 5J3BA 2UUCQ 3MEFA 4XIGS 1Y1WG 1LYLA 3PIOA 4HJAA 1YHQA 1XNRL 3CCEA 1HNWL 1C9OA 3RLFA 3STBC 2UXCQ 5BR8Q 4HJ5A 3H15A 2IY5B 3J7A5 3CP0A 4IJHA 2PI2E 1CSQA 4NXNL 1I3QH 4HJ7A 1K8GA 1HR0W 5LMUQ 2YTYA 3F2CA 4A3FH 2K14A 4R1JA 1Q46A 4JI7Q 5LMNL 4A3MH 4KI0A 2B63H 1U5KA 1PFSA 1SLJA 3LGJA 4JC0A 4JV5L 4JOIA 1MJCA 1EWIA 2Q2IA 4DUZL 2E5LQ 4DV6L 5M3MH 3PUYA 5C4XG 2HHHL 4JYAL 1VQIA 3L7ZC 3CMAA 1FL0A 2Y0SG 4DK3C 2VQFL 1HNXQ 5H1SE 4LF9L 1HZAA 3KF6B 4MTNA 4IO9A 3S1NH 1QUQB 1OXXK 3FKIH 1Q82C 1CKNB 1X56A 1LUZA 2WFWA 3NENA 1PH1A 1K3RA 1UE7A 2CQOA 1I6HH 2K5HA 4AYBE 1VQAA 4FDBA 3J80i 3J81i 2IX0A 2NN6I 4IFDI 3G71A 1Q8KA 4L5RC 2Q2HA 2XGTA 4NPSA 1FJGQ 4DV0Q 5IYCG 4QGUA 5IYBG 4JI4L 2HIVA 1V43A 4H02A 4LF5L 4OX9L 1EOVA 1L2FA 2EXDA 5HGQA 2XTIA 2ZJRA 1W2BA 2JA8G 4K0KL 2OTJA 3AEVA 1FGUA 1WFQA 5GROA 5C4JH 4NXMQ 4DR3L 1Z9FA 3TREA 1YJNA 4PZ7A 3FP9A 1N8RC 4YHHQ 1IL2A 1PH7A 1PH5A 2I5HA 1XMQQ 5ELOA 4X64Q 1NMGA 2NVQH 1VQ5A 3HOVH 1N36Q 2YU9H 4UP9A 3DLLA 4A93H 2F4VQ 1QZHA 1PVOA 4JBJA 1OXVA 1UWVA 4JBWA 5IYDG 1PV4A 3H3VH 1SMXA 2UXBL 3PIPA 1WOCA 2PQAA 3PF4A 1HNWQ 1Y1VH 1VQHA 3KF8B 2D62A 3I55A 2VUMH 2E2IH 3HOUH 4JI5L 4DV7Q 5IP7H 4RMFA 1CUKA 1VQCA 1A62A 1VQKA 5C44G 2E2JH 4NXNQ 4WJ3M 4KHPL 3I4NH 3PUXA 2HT1A 2LSSA 1GM5A 1Q1BA 2IX1A 4EQ5A 5LMNQ 2VQEL 3CPWA 5JEAJ 2PI2A 4BY7G 4A3CH 4JV5Q 3RLNA 1J6QA 1EIFA 4XTCS 4ALPA 4DUZQ 1O7IA 2OCEA 1HZ9A 4DV6Q 1NMFA 2R7ZH 2RF4A 4KLKA 3OTOL 2WAQE 4GOPC 4UY8C 4DR4L 3CMEA 4JYAQ 4DV1Q 4LF8L 4A3IH 3ULPA 2JA5G 4A3DG 4JI3L 2VQFQ 1WCMH 1PH6A 1A0IA 2R7DA 2K50A 2NVYH 2F3IA 2ZJPA 3ICEA 1E7ZA 4AIMA 4DPGA 4AQYL 2ASBA 4IOAA 1N32L 3KFUA 3HOYG 3GTOH 4A3GG 4QY7A 2KCMA 4HJ9A 2JA6G 4B3RL 4JI1L 3AYHB 2JQOA 2OWOA 5IWAL 1J5EL 4YY3Q 4BBSH 4YCUA 3S2DH 4LWCA 4A76A 3KYHC 1PH8A 4A3JH 2VS1A 1QZGA 2R93G 1Q1EA 1E22A 4JI4Q 3NELA 3U4ZA 4LF5Q 4OX9Q 1IYJB 4C2MH 3CCMA 4K0KQ 4A3LH 1VQ6A 4C3HH 1TWHH 5M5WH 4QJFA 2ALYB 1VQDA 2JEBI 4DV3L 1E1OA 1EQQA 3PO2H 4DR3Q 1QVCA 1VQGA 4GS3A 1A63A 2K5VA 2MQHA 1IBLL 1N33L 1RIPA 3RN5A 1H95A 3CXCA 1E24A 1L1OB 1VQNA 1EIYB 3DM3A 1VQJA 1YZ6A 1X65A 2PMZE 3KJOA 4A3BG 4DR7L 1GKHA 3UE1A 1HZBA 2F52A 3RZOH 3S15H 1IBKL 3HOZG 3TS0A 3WWVA 3F2BA 4GNXC 1KC8C 3K80C 2CCZA 1M90C 3IRBA 5M5YH 1VQ7A 1PA6A 2GVBA 4LF7L 1L0WA 4X62Q 2CFMA 3T1YL 4JI5Q 5M3FG 1TWGH 2I5LX 1CSPA 2ZJQA 2IT1A 3PUWA 1MKHA 2ID0A 3S1RH 3G6EA 2ZTCA 4KHPQ 3W5OA 4DUYL 3D31A 4A3KH 3J7ZC 3GTGH 1NJIC 2MFIA 3ERSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFP A;  5HY6 A;  4JI8 L;  3I4M H;  1KXL A;  1KIX A;  3GTP H;  2BH8 A;  3OTO Q;  4GKJ L;  5C0X I;  4DR4 Q;  1U0L A;  3E9H A;  4LF8 Q;  3S2H H;  1K0R A;  5GAG C;  2A19 A;  4DNI A;  4DV4 L;  1K9M C;  4JI3 Q;  1X6O A;  1YHA A;  4Y7N H;  2FXQ A;  2YTV A;  1L1O C;  4JI6 L;  1UEB A;  3D0F A;  3ULJ A;  4AQY Q;  1XTD A;  2ZM6 L;  2N8N A;  3W1G A;  3M9B A;  5C3E H;  4J15 A;  1SFO H;  4BBR H;  3SGI A;  1PH9 A;  1EFW A;  1N32 Q;  4B3R Q;  4JI1 Q;  4A3F G;  4TVA B;  2UUB L;  5IWA Q;  4ME3 A;  3K7A H;  1J5E Q;  4A3M G;  2EIF A;  2B63 G;  4MZ9 A;  4OWW B;  3GTM H;  2Z6K A;  3UDF A;  2KHI A;  4GLV B;  1G51 A;  3T1H L;  4NB3 A;  5E7N A;  4OO1 I;  3M4P A;  5M3M G;  2D0P A;  5FJ8 H;  2EQS A;  3HOX H;  1VQ4 A;  4BA2 I;  2CWA A;  1VS0 A;  4L5S A;  4BA1 I;  1TXY A;  1VQE A;  3JC6 6;  1VQL A;  3H0G H;  4DV3 Q;  4B3T L;  4P74 A;  3G48 A;  1D7Q A;  2VZA A;  1YI2 A;  1IBL Q;  1TWC H;  3FKI G;  1N33 Q;  3CCV A;  1SE8 A;  2CWP A;  3EN2 A;  4RG1 A;  1HZC A;  3M85 A;  1A8V A;  4GOP B;  4JOI C;  1PHJ A;  4DR7 Q;  2A1A A;  3S24 A;  3M3Y H;  1C0A A;  4MNO A;  1IBK Q;  5C0X J;  5M5X H;  2K5N A;  2NZO A;  1CKN A;  1YEZ A;  4X66 Q;  1FVI A;  4IPH A;  4X65 Q;  2PQA B;  5GQO A;  4LF7 Q;  3JAM c;  1XNQ L;  4L5Q A;  3T1Y Q;  4DR1 L;  2VW9 A;  3F2D A;  3B6Y A;  3VDY A;  2JA7 H;  3CD6 A;  1X3F A;  2N78 A;  4QIW E;  1BKB A;  1JJC B;  2RCN A;  1XNR Q;  3PO3 H;  1PYB A;  4PMW A;  4HID A;  2QEX A;  4A3E H;  5GAE C;  2VQE Q;  4JI8 Q;  1MIU A;  3CCJ A;  4R4Q A;  1YJ9 A;  1XPO A;  1N34 L;  1I94 L;  3HOV G;  2HQL A;  1HR0 L;  5JJL A;  1JB7 A;  1EQR A;  2MNA A;  1ASY A;  4DV2 L;  3HOW H;  4A93 G;  4GKJ Q;  3I4O A;  2JK8 A;  3PSI A;  3CCS A;  3TRZ A;  3S16 H;  4DV4 Q;  1Q81 C;  1M1K C;  5IE8 A;  1Y1V G;  4JI6 Q;  2VUM G;  3HOU G;  2I5M X;  2HHH Q;  4DKA C;  1XMO L;  1UE1 A;  5IP7 G;  2ZM6 Q;  2NVX H;  2OQ0 A;  3CQZ H;  5GAH C;  3U50 C;  2QGQ A;  5FLM H;  4GNX B;  4LF9 Q;  3I4N G;  3E0E A;  1BBW A;  3PUV A;  3FHW A;  5AJ3 L;  2IHE A;  2JA9 A;  2VL6 A;  4A3C G;  4GKK L;  4LUO A;  1S40 A;  1OXS C;  1RL2 A;  4DAY B;  3T1H Q;  3A74 A;  2R92 H;  2R7Z G;  4TQU S;  4A75 A;  1HNZ L;  3UDG A;  2VNU D;  2AWN A;  4DV5 L;  3L0O A;  3M4Q A;  4A3I G;  1XPR A;  4BY1 H;  4AYB G;  4OWT B;  3E9I A;  5LMN W;  1PH2 A;  4HIO A;  3A0J A;  3L2P A;  1WCM G;  4HJ8 A;  4B3T Q;  2ZTE A;  1I5F A;  1Q7Y C;  2E5L L;  2I0Q A;  2R93 H;  1KD1 C;  1DGS A;  3EIV A;  3AQQ A;  4YCW A;  4OWX B;  4BXX H;  1Q12 A;  2Y0S E;  4O0A A;  1E3P A;  1KHI A;  4BBS G;  1OXU A;  3K7U C;  1B7Y B;  3PCO B;  3Q8D A;  2JEA I;  4A3J G;  5EAY A;  3BJU A;  4UPA A;  5IP9 H;  4L5T A;  3CC2 A;  2UU9 L;  1I50 H;  4A3L G;  1XNQ Q;  1IXR A;  1JT8 A;  1BVS A;  4DR1 Q;  2UXB Q;  1HJP A;  4HIM A;  4PG3 A;  1K73 C;  1G29 1;  1QVF A;  3PO2 G;  1SR3 A;  3CPF A;  1YJW A;  3S17 H;  4X6A H;  2D0O A;  3F1Z A;  2AKW B;  1GD7 A;  1UE6 A;  1N9W A;  2AMC B;  1I94 Q;  1OTC A;  4LFC L;  1HR0 Q;  2DGY A;  3EBE A;  3ZJY C;  4YWL A;  4POG A;  4DV2 Q;  3J81 c;  1JJ2 A;  2Q2U A;  4IFD G;  2NN6 G;  5JEA G;  4P71 A;  4IJL A;  4NXM L;  3GTK H;  3BZK A;  1Q86 C;  1Y1W H;  1AE2 A;  3K8A A;  5GAD C;  2ES2 A;  2OQK A;  2BH2 A;  1B8A A;  1VQ9 A;  3CCL A;  3KDF A;  4R4C A;  3OYY A;  4LFB L;  2RHQ B;  4LUV A;  3M4O H;  4X64 L;  2WAQ G;  3F8T A;  3CC7 A;  4R4T A;  2A8V A;  3GD7 A;  1WI5 A;  1S72 A;  1VQB A;  1PYS B;  1YIT A;  2E2H H;  4IPD A;  3HKZ E;  1PH3 A;  4LNQ A;  3CAM A;  2L15 A;  4DR6 L;  1KQS A;  2WB1 E;  5AJ3 Q;  3I4M G;  4GKK Q;  4AH6 A;  1KL9 A;  2YV5 A;  3RNU A;  4B3S L;  5C4X H;  2HIX A;  4DV7 L;  3M7N A;  1HNZ Q;  1X55 A;  4YWM A;  3I56 A;  4LUZ A;  4DR5 L;  4DV5 Q;  1WYD A;  4JI0 L;  4IPC A;  4JG2 A;  2QA4 A;  1IBM L;  4A4I A;  5ELN A;  3KJP A;  2JJQ A;  1W3S A;  3AFQ A;  1P16 A;  1EUJ A;  1YHB A;  1V1Q A;  2MO0 A;  3GO5 A;  5C3E G;  4EX5 A;  4BBR G;  4DR2 L;  1LM0 A;  4YWK A;  2DUD A;  4GN3 B;  2UXD L;  4DK6 C;  4DV1 L;  1ASZ A;  4JI2 L;  1TWA H;  5FLX c;  2E8G A;  3K81 C;  5IYC H;  4QQB X;  1V9P A;  3U4V A;  3GTQ H;  5IYB H;  4B3M L;  4C3J H;  3TEH B;  5FJ8 G;  3HOX G;  2JA8 H;  3KF6 A;  2UU9 Q;  3W1B A;  1QUQ A;  2K4K A;  3H0G G;  2B29 A;  3NEM A;  4YY3 L;  1K83 H;  1X54 A;  4IPG A;  3RN2 A;  2JE6 I;  2N49 A;  3I7F A;  5K36 G;  3CF5 A;  1YIJ A;  1VQ8 A;  3PV0 A;  2Z6K C;  3ER0 A;  4LFA L;  2UUA L;  1VCI A;  3GTJ H;  4DAM A;  4DUY Q;  4LF4 L;  4LFC Q;  1D8L A;  4PZ8 A;  3UDX A;  1XJV A;  5JJK A;  4JCV E;  1GO3 E;  2RHS B;  3HFZ B;  4C3I H;  5IYD H;  4PZ6 A;  3CCU A;  1TWF H;  3PF5 A;  2V1C C;  1SN8 A;  2IHF A;  4GOP A;  5JJI A;  1R9T H;  4OXP A;  1EYG A;  1KAW A;  1UE5 A;  3STB D;  1E1T A;  3UE0 A;  4LFB Q;  2MO1 A;  5C44 H;  2JA7 G;  2LXJ A;  2YTX A;  1WJJ A;  3GTL H;  3U58 A;  1P8L A;  4LF6 L;  1C7Y A;  3OW2 A;  3PO3 G;  4P73 A;  2WP8 J;  4BY7 H;  1KRS A;  3S14 H;  1JE5 A;  4DR6 Q;  4GN4 B;  4A3E G;  3HKZ G;  3BU2 A;  5IY0 A;  2Q2T A;  2B3G A;  2WB1 G;  4O2D A;  4X62 L;  2KEN A;  2UUB Q;  4B3S Q;  2GVA A;  3HOW G;  3G4S A;  4DR5 Q;  2JA5 H;  4A3D H;  4JI0 Q;  1LTL A;  1NY4 A;  4GLX A;  4POF A;  1SRU A;  2UUC L;  1BBU A;  2C35 B;  1X9N A;  3TS2 A;  2PNH A;  1IBM Q;  2BA0 A;  3CCQ A;  3BZC A;  3I2Z A;  4GN5 A;  3ULL A;  5BR8 L;  4IFD J;  2UXC L;  4GLA C;  2AHO B;  3HOY H;  2JA6 H;  4A3G H;  2KHJ A;  4UP8 A;  2H5X A;  3A5U A;  5LMU L;  1OXT A;  4P75 A;  4DR2 Q;  2K75 A;  1YVC A;  5FLM G;  4JI7 L;  4R4O A;  4APV A;  4JBM A;  1B70 B;  2UXD Q;  1MJE A;  2R7F A;  4JI2 Q;  4WJ4 A;  1GVP A;  4KHZ A;  2KBN A;  4Y52 H;  1VQF A;  1VQP A;  2NVT H;  4B3M Q;  1K8A C;  4R4I A;  3JAM i;  2R92 G;  1G6P A;  1YBY A;  4GNX A;  1NBW A;  2Z0S A;  3J81 j;  5C0X G;  1HNX L;  4BY1 G;  3CC4 A;  1S3O A;  3CCR A;  3TQY A;  2CKZ B;  1IZ6 A;  3RLO A;  1XPU A;  3NBH B;  1JMC A;  4QL5 A;  4JBK A;  4A3B H;  1PH4 A;  1T9H A;  3KOJ A;  1VQO A;  1Y14 B;  1CKO A;  2YYZ A;  4LW1 A;  4HIK A;  2GN5 A;  1SRO A;  2KCT A;  4LFA Q;  1NE3 A;  2UUA Q;  4BXX G;  1X3G A;  4LF4 Q;  3S1Q H;  3H3V I;  3HOZ H;  3PGZ A;  1KRT A;  3UDI A;  1FJG L;  4IOC A;  4DV0 L;  2ZTD A;  1AH9 A;  1N34 Q;  3RZD H;  2OTL A;  2VY3 A;  4P72 A;  1Z47 A;  5IP9 G;  4OO1 G;  5M3F H;  3PUZ A;  4YCV A;  3J80 c;  3RR5 A;  2R6G A;  1X3E A;  3KDF B;  3MXN B;  5DLQ E;  1NTG A;  1L1O A;  3S1M H;  1AE3 A;  2K52 A;  4YHH L;  5IT9 c;  4LF6 Q;  2N3S A;  1HH2 P;  3K0X A;  2LXK A;  3A5Z B;  4OON A;  1XMQ L;  1XMO Q;  1JJG A;  4X66 L;  1N36 L;  2BA1 A;  3HKS A;  3GDE A;  2F4V L;  4UP7 A;  4X65 L;  3CW2 C;  1VQM A;  1YNX A;  3KLW A;  1CKM A;  2ATW A;  4A3K G;  2AWO A;  1QVG A;  2NZH A;  5J3B A;  2UUC Q;  3MEF A;  4XIG S;  1Y1W G;  1LYL A;  3PIO A;  4HJA A;  1YHQ A;  1XNR L;  3CCE A;  1HNW L;  1C9O A;  3RLF A;  3STB C;  2UXC Q;  5BR8 Q;  4HJ5 A;  3H15 A;  2IY5 B;  3J7A 5;  3CP0 A;  4IJH A;  2PI2 E;  1CSQ A;  4NXN L;  1I3Q H;  4HJ7 A;  1K8G A;  1HR0 W;  5LMU Q;  2YTY A;  3F2C A;  4A3F H;  2K14 A;  4R1J A;  1Q46 A;  4JI7 Q;  5LMN L;  4A3M H;  4KI0 A;  2B63 H;  1U5K A;  1PFS A;  1SLJ A;  3LGJ A;  4JC0 A;  4JV5 L;  4JOI A;  1MJC A;  1EWI A;  2Q2I A;  4DUZ L;  2E5L Q;  4DV6 L;  5M3M H;  3PUY A;  5C4X G;  2HHH L;  4JYA L;  1VQI A;  3L7Z C;  3CMA A;  1FL0 A;  2Y0S G;  4DK3 C;  2VQF L;  1HNX Q;  5H1S E;  4LF9 L;  1HZA A;  3KF6 B;  4MTN A;  4IO9 A;  3S1N H;  1QUQ B;  1OXX K;  3FKI H;  1Q82 C;  1CKN B;  1X56 A;  1LUZ A;  2WFW A;  3NEN A;  1PH1 A;  1K3R A;  1UE7 A;  2CQO A;  1I6H H;  2K5H A;  4AYB E;  1VQA A;  4FDB A;  3J80 i;  3J81 i;  2IX0 A;  2NN6 I;  4IFD I;  3G71 A;  1Q8K A;  4L5R C;  2Q2H A;  2XGT A;  4NPS A;  1FJG Q;  4DV0 Q;  5IYC G;  4QGU A;  5IYB G;  4JI4 L;  2HIV A;  1V43 A;  4H02 A;  4LF5 L;  4OX9 L;  1EOV A;  1L2F A;  2EXD A;  5HGQ A;  2XTI A;  2ZJR A;  1W2B A;  2JA8 G;  4K0K L;  2OTJ A;  3AEV A;  1FGU A;  1WFQ A;  5GRO A;  5C4J H;  4NXM Q;  4DR3 L;  1Z9F A;  3TRE A;  1YJN A;  4PZ7 A;  3FP9 A;  1N8R C;  4YHH Q;  1IL2 A;  1PH7 A;  1PH5 A;  2I5H A;  1XMQ Q;  5ELO A;  4X64 Q;  1NMG A;  2NVQ H;  1VQ5 A;  3HOV H;  1N36 Q;  2YU9 H;  4UP9 A;  3DLL A;  4A93 H;  2F4V Q;  1QZH A;  1PVO A;  4JBJ A;  1OXV A;  1UWV A;  4JBW A;  5IYD G;  1PV4 A;  3H3V H;  1SMX A;  2UXB L;  3PIP A;  1WOC A;  2PQA A;  3PF4 A;  1HNW Q;  1Y1V H;  1VQH A;  3KF8 B;  2D62 A;  3I55 A;  2VUM H;  2E2I H;  3HOU H;  4JI5 L;  4DV7 Q;  5IP7 H;  4RMF A;  1CUK A;  1VQC A;  1A62 A;  1VQK A;  5C44 G;  2E2J H;  4NXN Q;  4WJ3 M;  4KHP L;  3I4N H;  3PUX A;  2HT1 A;  2LSS A;  1GM5 A;  1Q1B A;  2IX1 A;  4EQ5 A;  5LMN Q;  2VQE L;  3CPW A;  5JEA J;  2PI2 A;  4BY7 G;  4A3C H;  4JV5 Q;  3RLN A;  1J6Q A;  1EIF A;  4XTC S;  4ALP A;  4DUZ Q;  1O7I A;  2OCE A;  1HZ9 A;  4DV6 Q;  1NMF A;  2R7Z H;  2RF4 A;  4KLK A;  3OTO L;  2WAQ E;  4GOP C;  4UY8 C;  4DR4 L;  3CME A;  4JYA Q;  4DV1 Q;  4LF8 L;  4A3I H;  3ULP A;  2JA5 G;  4A3D G;  4JI3 L;  2VQF Q;  1WCM H;  1PH6 A;  1A0I A;  2R7D A;  2K50 A;  2NVY H;  2F3I A;  2ZJP A;  3ICE A;  1E7Z A;  4AIM A;  4DPG A;  4AQY L;  2ASB A;  4IOA A;  1N32 L;  3KFU A;  3HOY G;  3GTO H;  4A3G G;  4QY7 A;  2KCM A;  4HJ9 A;  2JA6 G;  4B3R L;  4JI1 L;  3AYH B;  2JQO A;  2OWO A;  5IWA L;  1J5E L;  4YY3 Q;  4BBS H;  4YCU A;  3S2D H;  4LWC A;  4A76 A;  3KYH C;  1PH8 A;  4A3J H;  2VS1 A;  1QZG A;  2R93 G;  1Q1E A;  1E22 A;  4JI4 Q;  3NEL A;  3U4Z A;  4LF5 Q;  4OX9 Q;  1IYJ B;  4C2M H;  3CCM A;  4K0K Q;  4A3L H;  1VQ6 A;  4C3H H;  1TWH H;  5M5W H;  4QJF A;  2ALY B;  1VQD A;  2JEB I;  4DV3 L;  1E1O A;  1EQQ A;  3PO2 H;  4DR3 Q;  1QVC A;  1VQG A;  4GS3 A;  1A63 A;  2K5V A;  2MQH A;  1IBL L;  1N33 L;  1RIP A;  3RN5 A;  1H95 A;  3CXC A;  1E24 A;  1L1O B;  1VQN A;  1EIY B;  3DM3 A;  1VQJ A;  1YZ6 A;  1X65 A;  2PMZ E;  3KJO A;  4A3B G;  4DR7 L;  1GKH A;  3UE1 A;  1HZB A;  2F52 A;  3RZO H;  3S15 H;  1IBK L;  3HOZ G;  3TS0 A;  3WWV A;  3F2B A;  4GNX C;  1KC8 C;  3K80 C;  2CCZ A;  1M90 C;  3IRB A;  5M5Y H;  1VQ7 A;  1PA6 A;  2GVB A;  4LF7 L;  1L0W A;  4X62 Q;  2CFM A;  3T1Y L;  4JI5 Q;  5M3F G;  1TWG H;  2I5L X;  1CSP A;  2ZJQ A;  2IT1 A;  3PUW A;  1MKH A;  2ID0 A;  3S1R H;  3G6E A;  2ZTC A;  4KHP Q;  3W5O A;  4DUY L;  3D31 A;  4A3K H;  3J7Z C;  3GTG H;  1NJI C;  2MFI A;  3ERS X; 
#chains in the Genus database with same CATH topology
 3AFP A;  1QE6 A;  1STE A;  3D4W A;  5C0X I;  1XXG A;  3HEJ A;  1VF5 C;  3OHX C;  2YTV A;  4K14 A;  3ULJ A;  2N8N A;  1ENC A;  4J15 A;  5C3E H;  1C48 A;  1SFO H;  3SGI A;  4JK1 C;  4A3F G;  3W2D A;  2UUB L;  4A3M G;  1K8O A;  2F3V A;  5M3M B;  3M4P A;  2D0P A;  4BA2 I;  1HPC A;  1TWA B;  2LY7 A;  4TRD A;  1GUG A;  4P74 A;  2O4X A;  1SE8 A;  2CWP A;  4RG1 A;  5BN3 A;  3M85 A;  4JOI C;  2EYF A;  4DR7 Q;  2IX3 A;  1LO5 D;  5C0X J;  1F2Y A;  1LV9 A;  1YEZ A;  4HMJ A;  3HG9 A;  4LF7 Q;  2EXZ A;  1SYF A;  2VW9 A;  4KY7 A;  2DY7 A;  3B6Y A;  3VDY A;  3CD6 A;  4ULL A;  3PO3 H;  1R9T B;  3GV3 A;  1HXY D;  3OIQ A;  5GAE C;  5C44 B;  4DA2 A;  3PIP 3;  2HQL A;  1HR0 L;  2BE5 C;  2EPB A;  1ASY A;  4A93 G;  4DV2 L;  2F1M A;  2B2U C;  3I4O A;  2L9H A;  3FPU B;  1LTG D;  3M4Y A;  3TRZ A;  2EY1 A;  2ZT9 C;  2VUM G;  2B2V C;  3ND9 A;  5I2Y A;  2NVX H;  4A3D B;  2OQ0 A;  3I4N G;  4DK0 A;  3A8I E;  1HUN A;  1LT5 D;  5LHY 1;  4A3C G;  4LUO A;  5ELB A;  2EJM A;  1RL2 A;  3P20 A;  4DAY B;  2R92 H;  3R2T A;  5G3L F;  3UDG A;  4DV5 L;  3L0O A;  1XPR A;  2G9H D;  4BY1 H;  3E9I A;  1R4Q B;  1WCM B;  3L2P A;  1Y69 U;  1PFB A;  2ZTE A;  1U4P A;  3NTI A;  1KD1 C;  2KVM A;  3AQQ A;  1GHK A;  3H3V C;  2B2T A;  4BBS B;  4A3B B;  1Y8P B;  1GOZ A;  1EWH A;  2Q8R E;  3A7A B;  4OO1 H;  1TU2 B;  1SMY D;  1F9R A;  3NP8 A;  1SYG A;  3I90 A;  4M8A A;  1IXR A;  1EOT A;  2UXB Q;  3NBH A;  4PG3 A;  3TP7 A;  4HIM A;  2M9V A;  1LT3 D;  1IW7 D;  3CPF A;  3S17 H;  1B1Z A;  1EY9 A;  2AKW B;  1N9W A;  3MFG A;  3VA5 A;  1HR0 Q;  3KLS X;  4YWL A;  5D14 A;  4DV2 Q;  1JJ2 A;  3I4L A;  4IUT A;  4NXM L;  3BZK A;  1HTL D;  3CKI B;  1SNM A;  4IN3 A;  4LFB L;  4YIJ A;  2F0P A;  1FD7 D;  1VQB A;  1NR2 A;  2DNE A;  3HKZ E;  3CAM A;  1SNO A;  2WB1 E;  1WTQ A;  3J7A F;  3RNU A;  3A54 A;  4DV7 L;  5JPN C;  4DV5 Q;  4IPC A;  5IIF A;  1JIC A;  1W3S A;  1P16 A;  1KAA A;  4IQZ A;  3GO5 A;  5EBC A;  1SFO B;  4BBR G;  3L3O C;  2UXD L;  4GZY C;  3TZU A;  4DK6 C;  4DV1 L;  1ASZ A;  3FKI B;  5FLX c;  2EOT A;  5D65 A;  3K81 C;  4ZCK A;  3GTQ H;  5IYB H;  4FYD A;  2CW0 C;  2A68 C;  4B3M L;  1BCP D;  2PMZ B;  3HOX G;  2JA8 H;  3KF6 A;  3A8K E;  1Y8N B;  2K4K A;  3H0G G;  3OMC A;  2B2W A;  3SK8 A;  4DNR B;  5T1G A;  2EZV A;  4N9P A;  3X3N A;  1H9M A;  5G3L D;  4NP5 A;  1H9J A;  3UDX A;  1XJV A;  1F2L A;  2RHS B;  4C3I H;  1ILQ A;  3GP7 A;  1ZXT A;  3HOV B;  5JJI A;  1H9R A;  4OXP A;  4QCL A;  4LFB Q;  2MO1 A;  2EYH A;  4K8I A;  4FF2 A;  3KBG A;  2JA7 G;  3QOJ A;  3GTL H;  1PRT D;  3HOU B;  3PO3 B;  2E2I B;  1A2T A;  2WP8 J;  1JE5 A;  4A3E G;  1SJH D;  1S4Z A;  2Q2T A;  1TS4 A;  4O2D A;  1TY0 A;  1GXD C;  1DZ1 A;  2KED A;  4GLX A;  1NY4 A;  1BBU A;  1X9N A;  3I2Z A;  4GN5 A;  2UXC L;  4IFD J;  1D2B A;  2N88 A;  5CYU A;  4GLA C;  2NVX B;  4A3G H;  3Q6S A;  2H5X A;  3TME A;  2O5I C;  1B53 A;  3BVM A;  2K75 A;  4APV A;  2UXD Q;  1EIH A;  4WJ4 A;  1GVP A;  1I4H A;  2KBN A;  3LX0 A;  4B3M Q;  4R4I A;  5ISR A;  3IAY A;  2R92 B;  3VA7 A;  4GNX A;  1G6P A;  2Z0S A;  1EZ8 A;  5C0X G;  3J81 j;  4BY1 B;  3CC4 A;  4A3J B;  5IGF A;  3RLO A;  3NBH B;  1PH4 A;  5M5W B;  1Y14 B;  2YYZ A;  4HIK A;  5A2Q E;  3UDI A;  1FJG L;  1EYD A;  2ZTD A;  1N34 Q;  3RZD H;  2VY3 A;  3OSO A;  2R6G A;  2PNR C;  1NTG A;  1L1O A;  1Z6H A;  3S1M H;  4YHH L;  1EEI D;  2FJ2 A;  4LJZ C;  1HH2 P;  2CH4 A;  2L4N A;  2B2T C;  4RHS A;  5FLX E;  1N36 L;  5AFW A;  3GDE A;  2EYJ A;  4XDX A;  4CKE A;  2F4V L;  2FMM A;  3MFY A;  2OF1 A;  1CI3 M;  2EJF C;  4HCE A;  4A3K G;  4CKB A;  1QVG A;  1F77 A;  5J3B A;  2K5Q A;  3AU7 A;  1LYL A;  3PIO A;  1YHQ A;  1C9O A;  1PYW D;  2UXC Q;  1UAP A;  2XSC A;  3CP0 A;  1I3Q H;  3S2H B;  2YTY A;  1SJE D;  4A3F H;  1A15 A;  4A3M H;  1R4P B;  4WRD A;  4KI0 A;  3UI2 A;  4WOR A;  1TS2 A;  1EWI A;  2Q2I A;  2J4X A;  1CQV A;  4DV6 L;  2FHT A;  5C4X G;  3K7A B;  4JYA L;  1KTK A;  1SE4 A;  3L7Z C;  2Y0S G;  2AQ1 B;  2HCC A;  3KF6 B;  3OPO A;  1CKN B;  1ZYR C;  3VYR A;  1K3R A;  1I6H H;  3J81 i;  4FDB A;  2IX0 A;  1Q8K A;  2Q2H A;  2XGT A;  1FJG Q;  5BN4 A;  3BDL A;  5IYC G;  2HQE A;  1O7L A;  1SXT A;  4FP5 D;  2EXD A;  3AB9 A;  2JA8 B;  2ZJR A;  1EL0 A;  1LT6 D;  3VYS A;  1WFQ A;  2ICI A;  1U4L A;  5DEH A;  4YHH Q;  1IL2 A;  2EDG A;  1PH5 A;  3NQT A;  1N36 Q;  4XYQ A;  2QEJ C;  3NWS A;  2F0T A;  4UP9 A;  1WTR A;  1RKN A;  2F4V Q;  4A93 H;  1PVO A;  3TN2 A;  1UWV A;  4JBW A;  4IZ8 A;  3C1E A;  2TMP A;  1SMX A;  2MP1 A;  1WTP A;  4NMZ A;  3R2I A;  5C5L A;  3OWE B;  2VUM H;  1XWE A;  2B2W C;  4JI5 L;  4RMF A;  1CUK A;  2NBF A;  3TSS A;  2E2J H;  4KHP L;  3I4N H;  3I91 A;  3PUX A;  2HT1 A;  2Z4H A;  1Q1B A;  5D3D A;  1CHP D;  3GTL B;  2VQE L;  1BCP B;  2PI2 A;  4A3C H;  5EJW A;  1EIF A;  1EU3 A;  1JOR A;  1EY4 A;  4DV6 Q;  1HZ9 A;  3NXW A;  4DR4 L;  2A6E C;  3CME A;  4JYA Q;  1SAP A;  2JA5 G;  1PH6 A;  2NVY H;  2ZJP A;  3SHL A;  1IKL A;  4IOA A;  3HOY G;  4A3G B;  2JA6 G;  1DJR D;  4JI1 L;  1JE4 A;  2JQO A;  2OWO A;  1RTN A;  4YY3 Q;  4XQJ A;  3MVV A;  5CBE E;  4LWC A;  1G91 A;  4A76 A;  4DAV A;  2RDF A;  3G7L A;  1B44 D;  5ELD A;  1PRT B;  1TWH H;  2JEB I;  4KK7 A;  1FNV A;  4DV3 L;  4OIK A;  1VQG A;  2K5V A;  1IBL L;  1N33 L;  3U9O A;  1I50 B;  1L1O B;  4WJW A;  4MTK A;  1YZ6 A;  2PMZ E;  4CJ1 B;  3UE1 A;  3DEO A;  1SYC A;  2F52 A;  2H1E A;  3RZO H;  3S15 H;  2BE5 D;  1QOH A;  3FMC A;  3ITP A;  3TS0 A;  3F2B A;  4GNX C;  4Q5V A;  2V4D A;  3SXH A;  2CFM A;  4JI5 Q;  2I5L X;  2D5D A;  2ID0 A;  3H09 A;  3VR5 A;  4KHP Q;  4DUY L;  2B8G A;  3GTG H;  3OWF A;  4G57 A;  2MFI A;  3ERS X;  1SNP A;  2VQE Q;  2X6L A;  2RKS A;  4KKT A;  5E4W C;  1KIX A;  3GTP H;  1LAC A;  3PIO 3;  4DR4 Q;  3Q24 A;  5CV5 A;  1YHA A;  1L1O C;  1X3Q A;  4JI6 L;  1UEB A;  3V2T A;  2ZM6 L;  1SDF A;  4BBR H;  1PH9 A;  2OXP A;  2KOL A;  4JI1 Q;  3SR1 A;  3BS1 A;  5F2D A;  2EIF A;  3GTM H;  2QCP X;  4GLV B;  3T1H L;  4NB3 A;  5E7N A;  2DJF C;  5DM6 3;  3HOX H;  4X3T A;  3T51 B;  1VS0 A;  4L5S A;  1GJX A;  3JC6 6;  3H0G H;  4DV3 Q;  3URY A;  2BDO A;  4DXF A;  1V1O A;  1EZ6 A;  2EE1 A;  2VZA A;  3DWA A;  3NPP A;  4C3J B;  1IBL Q;  1N33 Q;  3L9A X;  3Q0A A;  3EN2 A;  2L0C A;  3N6R A;  4JPB W;  1A8V A;  1PHJ A;  1DM0 B;  5IGE A;  3S24 A;  1K83 B;  3M3Y H;  1C0A A;  1AW7 A;  1EFI D;  5M5X H;  1II3 A;  2O5J C;  1AZP A;  2F0N A;  3DHQ A;  3GTJ B;  4IPH A;  4PMB A;  3GV6 A;  3JAM c;  2SNS A;  3H94 A;  3C46 A;  1KDC A;  2JA7 H;  1S5E D;  1JJC B;  5FO7 B;  4PMW A;  1UNS A;  4C1N K;  4HID A;  1YJ9 A;  4A3E H;  4ZKC B;  3CCJ A;  1XPO A;  1YNJ D;  3NTK A;  3IL8 A;  1JB7 A;  2ZXO A;  5JJL A;  1TR5 A;  1STA A;  4K2L A;  2EYO A;  2JK8 A;  2SNM A;  3PSI A;  3VYT A;  3S14 B;  2RDH A;  2XRQ D;  4ZUJ A;  4KN7 C;  2VUM B;  1Y1V G;  5A2Q L;  4JI6 Q;  2NTS A;  2RSN A;  1XMO L;  1UE1 A;  2EYP A;  2ZM6 Q;  2O2L D;  3CQZ H;  2E2J B;  3U50 C;  3I4N B;  4LF9 Q;  3PUV A;  3FHW A;  1CZG A;  1JWU D;  5AJ3 L;  2JA9 A;  4H44 C;  3FDT A;  3T1H Q;  4A75 A;  1HNZ L;  1ESR A;  3MWY W;  2VNU D;  2AWN A;  4QMG A;  5C0X H;  4AYB G;  4B08 A;  1PH2 A;  4HIO A;  1H9S A;  1SND A;  5FLX L;  2NVY B;  1HRJ A;  2I0Q A;  4CDE C;  2MHV A;  1JOO A;  4DN4 M;  3I8Z A;  4OWX B;  1Q12 A;  1E3P A;  1OXU A;  3TP6 A;  3J7A V;  4X3K A;  3Q8D A;  1D5X C;  2JEA I;  3E0J A;  2EJG C;  5JVH 3;  2X69 A;  4UPA A;  4XT1 B;  3CC2 A;  2RVL A;  2UU9 L;  4A3L G;  4TSS A;  4FNF A;  1HJP A;  4HMI A;  3PO2 G;  1AFP A;  4U68 A;  5M3F B;  1GD7 A;  1UE6 A;  1WD1 A;  2P5Z X;  4CBV A;  3S15 B;  2XIW A;  3KUP A;  2Q2U A;  2KHS A;  4EGV A;  2F0H A;  4IJL A;  2EYM A;  1AE2 A;  4O42 A;  2BH2 A;  1B8A A;  2F0U A;  1KDA A;  3M4O H;  4X64 L;  2WAQ G;  1CA6 A;  4R4T A;  1ICF B;  5JPM C;  3FEW X;  2E2H H;  3GTG B;  4IPD A;  1ML0 D;  4LNQ A;  1DOM A;  4DR6 L;  5C4Z A;  4KKU A;  5AJ3 Q;  3I4M G;  3HZX A;  3K5L A;  3GTP B;  2YV5 A;  5C4X H;  1HNZ Q;  1X55 A;  1WYD A;  1BR9 A;  3JAM E;  4Z9C B;  2QA4 A;  1J9O A;  3AFQ A;  1HQR D;  1HHV A;  1EUJ A;  1YHB A;  1U4M A;  4BBR B;  4EX5 A;  4DR2 L;  3T4A C;  3KK7 A;  1RCV D;  1EY8 A;  2E8G A;  5IYC H;  3MXP A;  4QQB X;  1V9P A;  5C6A A;  1HA6 A;  3QIA A;  1STN A;  3TEH B;  5KYI A;  3KLR A;  2UU9 Q;  3E3X A;  1IYU A;  1LTT D;  3H0G B;  4F87 A;  5IGB A;  1VMP A;  2QKI C;  3MHB A;  2JE6 I;  2N49 A;  2RBM A;  5K36 G;  1YIJ A;  1BOS A;  1SSO A;  3PV0 A;  1C8C A;  3ER0 A;  5C4J B;  2G5D A;  1VCI A;  1K8M A;  1CHQ D;  3M3Y B;  4PZ8 A;  2HDM A;  2GA4 B;  4JCV E;  1GO3 E;  1IHZ A;  4PZ6 A;  1TWF H;  3PF5 A;  2V1C C;  2IHF A;  4MN3 A;  4FVM A;  4GOP A;  2YU9 B;  1EQT A;  3LWE A;  1KAW A;  1EYG A;  4KJO A;  1UE5 A;  1E1T A;  1B3Q A;  4JVZ A;  1CQF A;  1W6K A;  4I65 A;  3MC0 B;  4P73 A;  5C3X A;  4DR6 Q;  4A3E B;  2DY8 A;  4GN4 B;  3HKZ G;  3BU2 A;  2B3G A;  2WB1 G;  3D6W A;  2UUB Q;  3HOW G;  2QDB A;  1Q90 A;  2JA5 H;  3SK6 A;  2PNH A;  2R7Z B;  3BZC A;  5BR8 L;  1H9S B;  3BVG A;  3HOY H;  2JA6 H;  4K5X A;  4UP8 A;  5KIX A;  5LMU L;  1ZYR D;  4P75 A;  4DR2 Q;  3ONA B;  1YVC A;  5FLM G;  3CHB D;  1B70 B;  2NUC A;  2R7F A;  4DU9 A;  4KHZ A;  1LTR D;  3GTO B;  4RAU C;  5CV7 A;  1NCV A;  1VQF A;  1S5C D;  1VQP A;  2NVT H;  2NTT A;  4KV6 A;  1LTB D;  1JOK A;  3T53 B;  1I4X A;  1PFM A;  4LK1 C;  4DAP A;  1S3O A;  1MD2 D;  1EQV A;  3EQL C;  2CH4 W;  1GHJ A;  4JBK A;  3KOJ A;  1VQO A;  5E3F A;  4KN4 C;  1CKO A;  4LW1 A;  3QJY A;  3BDO A;  3NHH A;  1WTO A;  1X3G A;  3S1Q H;  3G6J B;  1KRT A;  4QIW B;  3H6M A;  5C5M A;  1AH9 A;  4P72 A;  3DWP A;  4KTA A;  3J80 c;  3MTS A;  1TKW B;  5BN5 A;  3T13 A;  1D1I A;  4DXG A;  5DLQ E;  5K5P A;  4OON A;  1XMQ L;  3K5O A;  5EPL A;  3RUZ A;  5L37 A;  1MSG A;  4X66 L;  3SVM A;  4HAE A;  1STG A;  3P1H A;  4X65 L;  5KNC A;  1CKM A;  2A6E D;  1VDZ A;  4A3K B;  1ICW A;  2ATW A;  5KGU A;  1YNJ C;  3MEF A;  4K5V A;  4XIG S;  1Y1W G;  2RQX A;  4ILW A;  4P2C B;  1XNR L;  1HNW L;  3RLF A;  2IY5 B;  5BR8 Q;  3MA2 B;  3H15 A;  4HJ5 A;  2PI2 E;  1CSQ A;  4NXN L;  1TS5 A;  5LMU Q;  2K14 A;  1NAP A;  3DWQ A;  4RWS C;  4JC0 A;  4JV5 L;  1PMR A;  5C3E B;  4DUZ L;  2ICE C;  1LTS D;  4L63 B;  3PUY A;  4LAA A;  2HHH L;  3QR8 A;  2Y0S B;  3BZD B;  1A2U A;  3TDQ A;  4BWG B;  5IGG A;  4G4K A;  3S1N H;  1DD2 A;  3K57 A;  1Q82 C;  3PMF A;  1EYA A;  5CGK A;  1X56 A;  5TSS A;  3OW7 A;  3CRL C;  3NEN A;  1PH1 A;  1UE7 A;  3HS0 C;  1TS3 A;  3OIP A;  1LAB A;  4IFD I;  2NN6 I;  3G71 A;  5EKK A;  3VR4 A;  4L5R C;  3I72 A;  1EWC A;  2HIV A;  2JYO A;  2Q8T A;  1L2F A;  4V19 0;  5HGQ A;  2OTJ A;  3H91 A;  3AEV A;  2BOS A;  1AP0 A;  4NXM Q;  4DR3 L;  3TRE A;  2K33 A;  5COY A;  1WTH A;  4V0B A;  2Z4I A;  4KY5 A;  1XMQ Q;  5ELO A;  1A6X A;  4ZUI A;  2NVQ H;  1GUS A;  1CM9 A;  1A3U A;  3DLL A;  1OXV A;  3C3L A;  3E5S A;  2PQA A;  1VMC A;  1HNW Q;  1SE3 A;  1Y1V H;  3DXJ C;  2D62 A;  3EFX D;  1ILP A;  4DV7 Q;  2NZ1 D;  5EGT A;  4NXN Q;  1MSH A;  5C44 G;  4NKL A;  1FYC A;  4PNY A;  3CPW A;  4BY7 G;  4JV5 Q;  3RLN A;  3VYU A;  1J6Q A;  4DUZ Q;  2OCE A;  1QJO A;  1NMF A;  4GOP C;  2PW5 A;  4DV1 Q;  4A3D G;  2PCF B;  3J80 E;  1A0I A;  4HSP A;  2F3I A;  3HOY B;  3KFU A;  4LMQ D;  2JA6 B;  3LWU A;  4QY7 A;  2KCM A;  4S3S A;  4B3R L;  5IWA L;  1J5E L;  3IFT A;  2H4O A;  4YCU A;  3S2D H;  1CK1 A;  3V05 A;  2BCO A;  1QZG A;  2F0G A;  5HUR A;  1E22 A;  2I46 A;  3NEL A;  3U4Z A;  2F0I A;  4A3L H;  3CCM A;  4C2M H;  1VQ6 A;  4C3H H;  1G2S A;  2ALY B;  2XWB B;  1EQQ A;  1PFN A;  1ROD A;  3PO2 H;  4ID6 A;  4RFB A;  4DR3 Q;  2RSO A;  2KA7 A;  1RIP A;  3RN5 A;  2XVS A;  4FXG C;  1EIY B;  1VQJ A;  2NYZ D;  1X65 A;  3KJO A;  4A3B G;  1BDO A;  3JAM L;  3HOZ G;  3RMH A;  3S17 B;  3K80 C;  2CCZ A;  4F7X A;  2PW7 A;  5M5Y H;  5I2X A;  1ONL A;  1V1P A;  2J0T D;  2ZJQ A;  3ND8 A;  2IT1 A;  3PUW A;  1MKH A;  3S1R H;  1G2T A;  3G6E A;  1RHP A;  2IWH A;  1D5M C;  5ELC A;  1NJI C;  4JI8 L;  3I4M H;  2KEC A;  1KXL A;  2K1B A;  2C5C A;  2D9U A;  1U0L A;  1GUW A;  1K0R A;  2A19 A;  1AZQ A;  4Y7N H;  2FXQ A;  1FR3 A;  2RDG A;  3D0F A;  5CBA E;  1XTD A;  3W1G A;  2ZXR A;  3M9B A;  3WOE A;  1WD0 A;  4B3R Q;  5IWA Q;  5KND A;  1J5E Q;  2B63 G;  4G7H C;  1HA5 A;  4MZ9 A;  5JJZ A;  4U67 3;  2A69 C;  1G51 A;  2EQS A;  5D3I B;  2CWA A;  4HR7 B;  2F0J A;  4CGY B;  3I70 A;  4BA1 I;  2F4I A;  3GTQ B;  4B3T L;  1JB3 A;  1D7Q A;  3S1N B;  1YI2 A;  1EY5 A;  5K36 H;  1TWC H;  3FKI G;  5I9P A;  2QW7 A;  4HTH A;  1F9Q A;  1JQY D;  1HZC A;  1E0B A;  1X3P A;  4ZKB B;  2FIN B;  4KJN A;  3C2P A;  2K5N A;  2NZO A;  1FVI A;  1KNA A;  4EQP A;  2AQ2 B;  2PQA B;  4C3I B;  3F2D A;  3F2U A;  1X3F A;  1WTW A;  4QIW E;  1BKB A;  2RCN A;  2I07 B;  2QEX A;  4JI8 Q;  1MIU A;  2NVQ B;  3HOV G;  1KDB A;  2MNA A;  3HOW H;  1E2W A;  2IW3 A;  3CCS A;  3S16 H;  4OL7 A;  4X3S A;  3HOU G;  2I5M X;  4DKA C;  1O7Z A;  1KLG D;  2OT2 A;  2LFN A;  5FLM H;  4GNX B;  2DJG C;  2M00 A;  1BBW A;  1PLF A;  1FGB D;  4FF4 A;  1S40 A;  2M2L A;  4TQU S;  1ESF A;  1EY0 A;  3M4Q A;  2SEB D;  2WKD A;  5T1I A;  4A3I G;  4OWT B;  5LMN W;  3A0J A;  3TP5 A;  3WDN A;  4CJ2 C;  4HJ8 A;  4B3T Q;  4RGO S;  2E5L L;  2R93 H;  3NE5 B;  1XYI A;  1K28 A;  3BG3 A;  3EIV A;  4QUF A;  2Y0S E;  1KHI A;  5ELF A;  5JVG 3;  2LS0 1;  3K7U C;  1PZJ D;  3NSW A;  1K0S A;  4A3J G;  4N8F A;  4DF7 A;  1MHW C;  4C2M B;  1EY6 A;  4XQQ A;  1BVS A;  3X3M A;  3ZYY X;  1V1P B;  1K73 C;  1QVF A;  3RZD B;  2JSO A;  2XN9 C;  5KYL A;  4MHE A;  1YJW A;  4X6A H;  3OMG A;  2F03 A;  1JR0 D;  3F1Z A;  4KY6 A;  3IKJ A;  2Z1C A;  1ET6 A;  4PMC A;  3S1M B;  1PDQ A;  2DGY A;  3EBE A;  1I4R A;  3J81 c;  4IFD G;  2NN6 G;  3GTK H;  2K01 A;  1Y1W H;  1EEF D;  1PTO F;  2OQK A;  3CCL A;  3OYY A;  3F8T A;  3CC7 A;  3S1R B;  3GD7 A;  2QDL A;  1S72 A;  1PYS B;  2F0L A;  1PH3 A;  2L15 A;  1QB5 D;  1KQS A;  2K03 A;  1I3Q B;  4CDD C;  1STB A;  4A3F B;  1PZI D;  4IUU A;  5COR A;  2HIX A;  5IGC A;  4A3M B;  5IOC A;  3I56 A;  2K5W A;  2F0W A;  4JI0 L;  4R8I A;  3A55 A;  4A4I A;  2K5D A;  5ELN A;  4ZRZ A;  2JJQ A;  3KJP A;  4R9W A;  1O7Y A;  1V1Q A;  2AQ3 B;  2D2C C;  2MO0 A;  5EKI A;  3WOF A;  1LM0 A;  4YWK A;  1SNQ A;  4FF3 A;  1F2Z A;  1TWA H;  3MZ5 A;  5C4H A;  2K6A A;  5DM7 3;  3U4V A;  1I6H B;  4X3U A;  5FJ8 G;  3D3R A;  1QUQ A;  2HUG A;  2B29 A;  5FKA C;  4IPG A;  2K28 A;  3CF5 A;  2K04 A;  1I6V C;  3MEH A;  4EQN A;  1VQ8 A;  1AN8 A;  4LFA L;  4DAM A;  4DUY Q;  3J80 L;  4LF4 L;  1D8L A;  1JC7 A;  3HFZ B;  5KRU A;  1A3V A;  1SN8 A;  1O78 A;  4XQN A;  5CV8 A;  4RGT A;  1R9T H;  4A93 B;  1Q3L A;  2A6H C;  3UE0 A;  4CDF C;  4NDX A;  5J1Z A;  5C44 H;  1ENF A;  2YTX A;  3K6O A;  3U58 A;  1P8L A;  4LF6 L;  1G6Z A;  1XTC D;  1C7Y A;  4BY7 H;  1KLU D;  5IY0 A;  1U4R A;  2L1B A;  3PQI A;  4FF1 A;  1QNK A;  4X62 L;  2KEN A;  2KQ3 A;  2GVA A;  2AUJ D;  3G4S A;  4A3D H;  4JW0 A;  4JI0 Q;  5FOB B;  3KF8 A;  1IKM A;  1SRU A;  4BS9 A;  2F0K A;  3TS2 A;  4ODG A;  5JOB A;  2QF7 A;  4B9X A;  3A5U A;  1ENA A;  4JI7 L;  4H0L C;  1D5Z C;  4JBM A;  1G8Z D;  4KKS A;  4C1N I;  1Y8O B;  2JP1 A;  5FO8 B;  2EVB A;  3J81 E;  5CR3 A;  4UHV A;  1K8A C;  1IYV A;  4K2K A;  1NBW A;  2B2Y A;  3CCR A;  4FO2 A;  2CKZ B;  1IZ6 A;  5JAV A;  2L55 A;  4HSV A;  2XRS D;  1XPU A;  2E74 C;  3TBI B;  1TWH B;  4C3H G;  4A3B H;  1T9H A;  2KEE A;  3A56 A;  2GN5 A;  1SRO A;  4LFA Q;  4BXX G;  4LF4 Q;  3H3V I;  3HOZ H;  3PGZ A;  4KD4 A;  1RDP D;  4IOC A;  1QCB D;  2SOB A;  2KCN A;  3SEB A;  1Z47 A;  5IP9 G;  3RZO B;  1STH A;  4HN7 A;  1IL8 A;  4YCV A;  1LTI D;  1I4P A;  5I9O A;  1X3E A;  1AE3 A;  2K52 A;  5IT9 c;  1PTO H;  4LF6 Q;  2N3S A;  3K0X A;  3NQI A;  3A5Z B;  1DCZ A;  1XMO Q;  1LLR D;  2BA1 A;  4UP7 A;  4K8J A;  1NR4 A;  1YNX A;  2B8F A;  3KLW A;  4RCN A;  5LL6 S;  2AWO A;  2DN8 A;  1CT1 D;  2ENB A;  1Y1W B;  4HJA A;  3STB C;  2IPK D;  3J7A 5;  1U9R A;  4PV1 C;  1K8G A;  1HCZ A;  3HGB A;  4HJ7 A;  3F2C A;  4JI7 Q;  5LMN L;  2B63 H;  3N52 A;  3LGJ A;  1PFS A;  1SLJ A;  1RJT A;  2VB2 X;  2F3W A;  1MJC A;  4DK1 A;  4FXD A;  1VQI A;  4UAI A;  1FL0 A;  1WTX A;  3GTM B;  1HZA A;  4MTN A;  1QUQ B;  1OXX K;  3FKI H;  3HOX B;  3NK9 A;  1HTP A;  3BYT B;  1LUZ A;  2CQO A;  2K5H A;  2PZU A;  4AYB E;  3J80 i;  4KHV A;  1QWY A;  1HFN A;  4IUN A;  3A7L A;  4JI4 L;  4H02 A;  1V43 A;  4C3J G;  4OX9 L;  1M4V A;  1EOV A;  1NNX A;  1W2B A;  1E2Z A;  5M5X B;  1DON A;  1Z9F A;  4K6L A;  1NUC A;  2WAC A;  4PZ7 A;  5FK9 C;  1N8R C;  4O1N A;  3BDC A;  1PH7 A;  2I5H A;  1YNN C;  3T16 A;  4X64 Q;  3HOV H;  1VQ5 A;  1DXM A;  2JA7 B;  3SDZ A;  3VR2 A;  3LNN A;  2IL8 A;  4TKO B;  1QZH A;  1RTO A;  1CZW A;  2FFK B;  5IYD G;  1PV4 A;  2F0M A;  2AUK A;  2UXB L;  3FRP B;  4DGZ A;  4RA8 A;  1A3T A;  1VQH A;  2RA4 A;  3KF8 B;  5C3W A;  3HOU H;  2E2I H;  1VQC A;  4RKL A;  4WJ3 M;  3MXU A;  1TII D;  4EQ5 A;  5LMN Q;  1LT4 D;  3K5N A;  2F0F A;  5JEA J;  4BY7 B;  4IUR A;  1RD9 D;  3CQZ B;  2A69 D;  4I7A A;  2Z6B A;  4KLK A;  3OTO L;  2WAQ E;  4UY8 C;  1BCP F;  4LF8 L;  1CFM A;  4WFN 3;  4A3I H;  3ULP A;  4JI3 L;  5EKL A;  1MGS A;  2K50 A;  2R7D A;  4AIM A;  3NBI A;  4AQY L;  1J8I A;  5IT9 E;  1N32 L;  4HJ9 A;  4EQO A;  4H7B A;  1B3A A;  3NTH A;  3KYH C;  1PH8 A;  1LTA D;  3R8B A;  4A3J H;  2A5H A;  4IUP A;  2R93 G;  1Q1E A;  4JI4 Q;  4OX9 Q;  1BQQ T;  1EY7 A;  5M5W H;  2WV6 D;  1E1O A;  5CV9 A;  3K5M A;  1QVC A;  1A63 A;  4GS3 A;  1HUM A;  4DNT B;  1PRT F;  1E24 A;  5FO9 B;  3CXC A;  1VQN A;  2F0Q A;  3BYY B;  1IBK L;  3HOZ B;  4IFD H;  2NN6 H;  4N8X 1;  2MPM A;  1KC8 C;  4CKC A;  1WVL A;  1M90 C;  2B2Y C;  3K0Y A;  5KEE A;  3E6Z X;  3EJI A;  3T1Y L;  5M3F G;  1TWG H;  2WIN B;  3J7Y W;  1EYC A;  2ZTC A;  4ZLT F;  2PYK A;  3W5O A;  4A3K H;  1PTO B;  5HY6 A;  3M4O B;  3K59 A;  5I4D A;  2QIL A;  2BH8 A;  3OTO Q;  1JOQ A;  4GKJ L;  2E2H B;  3E9H A;  4LF8 Q;  1GUO A;  3S2H H;  5GAG C;  5KNB A;  4DV4 L;  4DNI A;  1K9M C;  4JI3 Q;  1X6O A;  5C4X B;  4OGQ C;  4AQY Q;  1N32 Q;  1EFW A;  2F0S A;  4TVA B;  1SEB D;  4ME3 A;  3K7A H;  2KJX A;  2B63 B;  1FNW A;  1MI2 A;  4OWW B;  1L0X B;  2Z6K A;  3K58 A;  3UDF A;  2KHI A;  5EPJ A;  4OO1 I;  5M3M G;  5FJ8 H;  1VQ4 A;  1ZEQ X;  5IOD A;  5I6Y A;  1TXY A;  1VQE A;  1VQL A;  1PTO C;  2E75 C;  3IFD A;  3G48 A;  3CCV A;  2R61 A;  4GOP B;  1Z7T A;  3DM1 A;  2A1A A;  4XXE A;  1WTV A;  4MNO A;  1IBK Q;  4H13 C;  1CKN A;  1S5D D;  4X66 Q;  2PZT A;  1SYE A;  4X65 Q;  5GQO A;  3I73 A;  1XNQ L;  4L5Q A;  1BXT A;  3T1Y Q;  1UUP A;  1D6E C;  4DR1 L;  1TWF B;  3J81 L;  2N78 A;  4K6D A;  1XNR Q;  1PYB A;  1D1K A;  2K05 A;  1Q8I A;  4R4Q A;  1I94 L;  1N34 L;  5E4X A;  1EQR A;  1OO9 B;  2HCI A;  4GKJ Q;  2CVR A;  4DV4 Q;  1Q81 C;  1M1K C;  5IE8 A;  1BNZ A;  4ABN A;  5I6W A;  3MAQ A;  2HHH Q;  5IP7 G;  2JA5 B;  2KUM A;  1EU4 A;  2R3Z A;  5GAH C;  2QGQ A;  3E0E A;  2J7Z A;  3KLS A;  4RGN A;  2IHE A;  2VL6 A;  4GKK L;  3HP3 A;  1OXS C;  3DEP A;  3TP8 A;  3A74 A;  5NUC A;  2R7Z G;  2L5T A;  4M1U B;  1RF2 D;  3QG1 A;  2FMC A;  3BVZ A;  4A3I B;  1ZKO A;  2PZW A;  1WCM G;  2WII B;  2NVT B;  1I5F A;  1Q7Y C;  2MGS A;  4XYO A;  1DGS A;  4OIJ A;  4YCW A;  4HED A;  4BXX H;  4O0A A;  2HDL A;  4BBS G;  4IUQ A;  4L6T B;  1B7Y B;  3PCO B;  1F2M A;  1PXU A;  5EAY A;  3BJU A;  5IP9 H;  4L5T A;  1I50 H;  3S1Q B;  1XNQ Q;  4ZAI A;  2A6H D;  1JT8 A;  3D8G A;  1F9S A;  4DR1 Q;  3I3C A;  3R93 A;  1G29 1;  4RHR A;  1TVX A;  1SR3 A;  5EBD A;  2D0O A;  3FVQ A;  5LL6 X;  2AMC B;  3VR6 A;  1I94 Q;  1OTC A;  4LFC L;  4F8M A;  3ZJY C;  4POG A;  1CTM A;  2EY5 A;  4ZYS A;  4QUC A;  5JEA G;  4P71 A;  1B9M A;  2RCF A;  4MIU A;  1Q86 C;  2F0V A;  2C9O A;  3CRK C;  3K8A A;  5GAD C;  2ES2 A;  1VQ9 A;  3KDF A;  3MXN A;  4R4C A;  2RHQ B;  1W6J A;  1TWG B;  4LUV A;  2XWJ B;  2E2D C;  2A8V A;  1STY A;  1WI5 A;  1YIT A;  4J1M A;  1ET9 A;  4GKK Q;  4HCS A;  4AH6 A;  5J39 A;  1KL9 A;  4B3S L;  2F0D A;  3M7N A;  4DR5 L;  1GUN A;  2WKC A;  4LUZ A;  4YWM A;  3T56 B;  4JG2 A;  3SK4 A;  1IBM L;  1DOK A;  5C3E G;  1SYB A;  2DUD A;  4GN3 B;  2EYL A;  4FXK C;  4JI2 L;  3QWN A;  1KAB A;  3R3O A;  4C3J H;  2E76 C;  1DOL A;  3W1B A;  1BO0 A;  3TZD A;  3KBX A;  2K7V A;  3NEM A;  4YY3 L;  1K83 H;  1X54 A;  4QB4 A;  3RN2 A;  3I7F A;  5EPK A;  1GUT A;  4I7Z C;  3RD4 A;  2Z6K C;  2UUA L;  3GTJ H;  1NSN S;  3EA6 A;  4LFC Q;  5JJK A;  5IYD H;  1EIG A;  3CCU A;  4PQX A;  3VR3 A;  1B4O A;  1DYQ A;  5IT9 L;  1X32 A;  3NUC A;  1SMY C;  3AMU A;  3STB D;  2XNA C;  2LXJ A;  4QF4 A;  1IW7 C;  2VXW A;  1WJJ A;  4IUV A;  1Y1V B;  3OW2 A;  3PO3 G;  1KRS A;  3V96 A;  4UDU C;  3S14 H;  2NWG A;  5DNF A;  3Q23 A;  4B3S Q;  3ERQ A;  4DR5 Q;  1T5E A;  2CHB D;  2PQE A;  3P7J A;  1LTL A;  2UUC L;  4POF A;  2C35 B;  2MUY A;  1IBM Q;  2BA0 A;  5HGT A;  3CCQ A;  3ULL A;  4C56 C;  4CHT B;  4L8J A;  2AHO B;  2HD3 A;  2G9D A;  2KHJ A;  4AYB B;  1OXT A;  2L11 A;  4R4O A;  1MJE A;  2VB3 X;  4JI2 Q;  1SBB B;  4Y52 H;  4RH6 A;  1UEA B;  3JAM i;  2R92 G;  1YBY A;  3S2D B;  1HNX L;  1O80 A;  2EY2 A;  4BY1 G;  2CQA A;  4G7O C;  3TQY A;  1SNC A;  3P75 A;  1JMC A;  4QL5 A;  2A73 B;  4C3H B;  3O13 A;  3GQB A;  1TT2 A;  1YNN D;  2B39 A;  2KCT A;  3PO2 B;  1NE3 A;  2UUA Q;  1T5X D;  1E2V A;  1HQM C;  4DV0 L;  3W3A A;  2TSS A;  4ZK9 B;  2A74 C;  4J8Q A;  2OTL A;  1BCP C;  2L12 A;  3FPP A;  4OO1 G;  2SDF A;  5M3F H;  4RKB A;  3PUZ A;  3RR5 A;  1KNE A;  3KDF B;  3MXN B;  5M5Y B;  1SYD A;  2LXK A;  2N55 A;  2WAQ B;  4NW2 A;  1JJG A;  3HKS A;  4IAL A;  3CW2 C;  1VQM A;  3I4M B;  2NZH A;  4CJ0 B;  4KMU C;  2UUC Q;  4DFA A;  1QNU A;  3CCE A;  1K3B C;  3QOL A;  4IJH A;  1HR0 W;  2Q8I B;  1M8A A;  1Q46 A;  4R1J A;  4Y7N B;  1PRT C;  5CV6 A;  1TY2 A;  1H9K A;  4RCO A;  1U5K A;  2Z9H A;  1SE2 A;  4JOI A;  4N9T A;  2E5L Q;  5M3M H;  4F88 A;  2IJ0 A;  2Z8L A;  3CMA A;  5J22 A;  1PZK D;  4DK3 C;  4E6I A;  2VQF L;  5H1S E;  1HNX Q;  4LF9 L;  4IO9 A;  4B9W A;  2KCC A;  2WFW A;  1VQA A;  3D6C A;  1QG7 A;  1TWC B;  4Q0F A;  4NPS A;  4DV0 Q;  5E1F A;  4QGU A;  5IYB G;  1JWS D;  4R8N A;  1TQO A;  4RGM A;  2B2U A;  4LF5 L;  1FNU A;  4K0K L;  2XTI A;  2JA8 G;  5EQ0 A;  3DMU A;  1FGU A;  5GRO A;  5C4J H;  4XT3 B;  1AEX A;  1YJN A;  3FP9 A;  2B2V A;  3CU7 A;  3NWT A;  4OEL B;  1F9P A;  2F0O A;  1NMG A;  4ZQ3 A;  2YU9 H;  1JCK B;  2BDN A;  3DUZ A;  1V8Q A;  3EVQ A;  4JBJ A;  4C3I G;  3H3V H;  5CV4 A;  4OHJ A;  3Q22 A;  2MJ8 A;  3HKZ B;  1WOC A;  3PIP A;  3PF4 A;  1BF4 A;  2WB1 B;  2JXM B;  3I55 A;  3S9W A;  3SK5 A;  3HOW B;  1L0Y B;  3QB3 A;  5IP7 H;  1VF7 A;  1A62 A;  1VQK A;  5A35 A;  5ELE A;  3S16 B;  2LSS A;  1GM5 A;  1I4G A;  2IX1 A;  2OEO A;  1I4Q A;  3MXG A;  2F0E A;  5CMD A;  1HFG A;  4XTC S;  4ALP A;  1O7I A;  3ERO A;  2R7Z H;  2RF4 A;  3D4R A;  2X6G A;  5DAU A;  2VQF Q;  2PPB C;  1WCM H;  1PTO D;  3ICE A;  5CC4 A;  3C1F A;  1E7Z A;  1JWM D;  4DPG A;  2ASB A;  3GTO H;  4A3G G;  1CA5 A;  3AYH B;  2CW0 D;  2A68 D;  2LKV A;  1BBX C;  1QIL A;  1B50 A;  4BBS H;  4DAY A;  2DNC A;  4KD3 A;  5M9O A;  2R93 B;  2VS1 A;  4OEM B;  4LF5 Q;  1IYJ B;  4K0K Q;  3A8J E;  1B2T A;  4QJF A;  2K32 A;  1BUV T;  1VQD A;  3M7G A;  4EVO A;  1S5B D;  2PO4 A;  4J6H A;  1H95 A;  2MQH A;  4K5W A;  3SE0 A;  3HRZ C;  3DM3 A;  2NB0 A;  4G7Z C;  4DR7 L;  1GKH A;  1HZB A;  1MBY A;  3OOC A;  3U9S A;  3WWV A;  5JEA H;  2LMC B;  4CDC C;  3IRB A;  1VQ7 A;  3QO2 A;  1PA6 A;  2GVB A;  4LF7 L;  1L0W A;  4X62 Q;  1XX8 A;  1S5F D;  1CSP A;  2EY6 A;  4ME5 A;  1C4Q A;  1B9N A;  3GTK B;  2JN4 A;  3D31 A;  3J7Z C;  3D4D A;  2ZXP A;  5IGD A; 
#chains in the Genus database with same CATH homology
 3AFP A;  5HY6 A;  4JI8 L;  3I4M H;  1KXL A;  1KIX A;  3GTP H;  2BH8 A;  3OTO Q;  4GKJ L;  5C0X I;  4DR4 Q;  1U0L A;  3E9H A;  4LF8 Q;  3S2H H;  1K0R A;  5GAG C;  2A19 A;  4DNI A;  4DV4 L;  1K9M C;  4JI3 Q;  1X6O A;  1YHA A;  4Y7N H;  2FXQ A;  2YTV A;  1L1O C;  4JI6 L;  1UEB A;  3D0F A;  3ULJ A;  4AQY Q;  1XTD A;  2ZM6 L;  2N8N A;  3W1G A;  3M9B A;  5C3E H;  4J15 A;  1SFO H;  4BBR H;  3SGI A;  1PH9 A;  1EFW A;  1N32 Q;  4B3R Q;  4JI1 Q;  4A3F G;  4TVA B;  2UUB L;  5IWA Q;  4ME3 A;  3K7A H;  1J5E Q;  4A3M G;  2EIF A;  2B63 G;  4MZ9 A;  4OWW B;  3GTM H;  2Z6K A;  3UDF A;  2KHI A;  4GLV B;  1G51 A;  3T1H L;  4NB3 A;  5E7N A;  4OO1 I;  3M4P A;  5M3M G;  2D0P A;  5FJ8 H;  2EQS A;  3HOX H;  1VQ4 A;  4BA2 I;  2CWA A;  1VS0 A;  4L5S A;  4BA1 I;  1TXY A;  1VQE A;  3JC6 6;  1VQL A;  3H0G H;  4DV3 Q;  4B3T L;  4P74 A;  3G48 A;  1D7Q A;  2VZA A;  1YI2 A;  1IBL Q;  1TWC H;  3FKI G;  1N33 Q;  3CCV A;  1SE8 A;  2CWP A;  3EN2 A;  4RG1 A;  1HZC A;  3M85 A;  1A8V A;  4GOP B;  4JOI C;  1PHJ A;  4DR7 Q;  2A1A A;  3S24 A;  3M3Y H;  1C0A A;  4MNO A;  1IBK Q;  5C0X J;  5M5X H;  2K5N A;  2NZO A;  1CKN A;  1YEZ A;  4X66 Q;  1FVI A;  4IPH A;  4X65 Q;  2PQA B;  5GQO A;  4LF7 Q;  3JAM c;  1XNQ L;  4L5Q A;  3T1Y Q;  4DR1 L;  2VW9 A;  3F2D A;  3B6Y A;  3VDY A;  2JA7 H;  3CD6 A;  1X3F A;  2N78 A;  4QIW E;  1BKB A;  1JJC B;  2RCN A;  1XNR Q;  3PO3 H;  1PYB A;  4PMW A;  4HID A;  2QEX A;  4A3E H;  5GAE C;  2VQE Q;  4JI8 Q;  1MIU A;  3CCJ A;  4R4Q A;  1YJ9 A;  1XPO A;  1N34 L;  1I94 L;  3HOV G;  2HQL A;  1HR0 L;  5JJL A;  1JB7 A;  1EQR A;  2MNA A;  1ASY A;  4DV2 L;  3HOW H;  4A93 G;  4GKJ Q;  3I4O A;  2JK8 A;  3PSI A;  3CCS A;  3TRZ A;  3S16 H;  4DV4 Q;  1Q81 C;  1M1K C;  5IE8 A;  1Y1V G;  4JI6 Q;  2VUM G;  3HOU G;  2I5M X;  2HHH Q;  4DKA C;  1XMO L;  1UE1 A;  5IP7 G;  2ZM6 Q;  2NVX H;  2OQ0 A;  3CQZ H;  5GAH C;  3U50 C;  2QGQ A;  5FLM H;  4GNX B;  4LF9 Q;  3I4N G;  3E0E A;  1BBW A;  3PUV A;  3FHW A;  5AJ3 L;  2IHE A;  2JA9 A;  2VL6 A;  4A3C G;  4GKK L;  4LUO A;  1S40 A;  1OXS C;  1RL2 A;  4DAY B;  3T1H Q;  3A74 A;  2R92 H;  2R7Z G;  4TQU S;  4A75 A;  1HNZ L;  3UDG A;  2VNU D;  2AWN A;  4DV5 L;  3L0O A;  3M4Q A;  4A3I G;  1XPR A;  4BY1 H;  4AYB G;  4OWT B;  3E9I A;  5LMN W;  1PH2 A;  4HIO A;  3A0J A;  3L2P A;  1WCM G;  4HJ8 A;  4B3T Q;  2ZTE A;  1I5F A;  1Q7Y C;  2E5L L;  2I0Q A;  2R93 H;  1KD1 C;  1DGS A;  3EIV A;  3AQQ A;  4YCW A;  4OWX B;  4BXX H;  1Q12 A;  2Y0S E;  4O0A A;  1E3P A;  1KHI A;  4BBS G;  1OXU A;  3K7U C;  1B7Y B;  3PCO B;  3Q8D A;  2JEA I;  4A3J G;  5EAY A;  3BJU A;  4UPA A;  5IP9 H;  4L5T A;  3CC2 A;  2UU9 L;  1I50 H;  4A3L G;  1XNQ Q;  1IXR A;  1JT8 A;  1BVS A;  4DR1 Q;  2UXB Q;  1HJP A;  4HIM A;  4PG3 A;  1K73 C;  1G29 1;  1QVF A;  3PO2 G;  1SR3 A;  3CPF A;  1YJW A;  3S17 H;  4X6A H;  2D0O A;  3F1Z A;  2AKW B;  1GD7 A;  1UE6 A;  1N9W A;  2AMC B;  1I94 Q;  1OTC A;  4LFC L;  1HR0 Q;  2DGY A;  3EBE A;  3ZJY C;  4YWL A;  4POG A;  4DV2 Q;  3J81 c;  1JJ2 A;  2Q2U A;  4IFD G;  2NN6 G;  5JEA G;  4P71 A;  4IJL A;  4NXM L;  3GTK H;  3BZK A;  1Q86 C;  1Y1W H;  1AE2 A;  3K8A A;  5GAD C;  2ES2 A;  2OQK A;  2BH2 A;  1B8A A;  1VQ9 A;  3CCL A;  3KDF A;  4R4C A;  3OYY A;  4LFB L;  2RHQ B;  4LUV A;  3M4O H;  4X64 L;  2WAQ G;  3F8T A;  3CC7 A;  4R4T A;  2A8V A;  3GD7 A;  1WI5 A;  1S72 A;  1VQB A;  1PYS B;  1YIT A;  2E2H H;  4IPD A;  3HKZ E;  1PH3 A;  4LNQ A;  3CAM A;  2L15 A;  4DR6 L;  1KQS A;  2WB1 E;  5AJ3 Q;  3I4M G;  4GKK Q;  4AH6 A;  1KL9 A;  2YV5 A;  3RNU A;  4B3S L;  5C4X H;  2HIX A;  4DV7 L;  3M7N A;  1HNZ Q;  1X55 A;  4YWM A;  3I56 A;  4LUZ A;  4DR5 L;  4DV5 Q;  1WYD A;  4JI0 L;  4IPC A;  4JG2 A;  2QA4 A;  1IBM L;  4A4I A;  5ELN A;  3KJP A;  2JJQ A;  1W3S A;  3AFQ A;  1P16 A;  1EUJ A;  1YHB A;  1V1Q A;  2MO0 A;  3GO5 A;  5C3E G;  4EX5 A;  4BBR G;  4DR2 L;  1LM0 A;  4YWK A;  2DUD A;  4GN3 B;  2UXD L;  4DK6 C;  4DV1 L;  1ASZ A;  4JI2 L;  1TWA H;  5FLX c;  2E8G A;  3K81 C;  5IYC H;  4QQB X;  1V9P A;  3U4V A;  3GTQ H;  5IYB H;  4B3M L;  4C3J H;  3TEH B;  5FJ8 G;  3HOX G;  2JA8 H;  3KF6 A;  2UU9 Q;  3W1B A;  1QUQ A;  2K4K A;  3H0G G;  2B29 A;  3NEM A;  4YY3 L;  1K83 H;  1X54 A;  4IPG A;  3RN2 A;  2JE6 I;  2N49 A;  3I7F A;  5K36 G;  3CF5 A;  1YIJ A;  1VQ8 A;  3PV0 A;  2Z6K C;  3ER0 A;  4LFA L;  2UUA L;  1VCI A;  3GTJ H;  4DAM A;  4DUY Q;  4LF4 L;  4LFC Q;  1D8L A;  4PZ8 A;  3UDX A;  1XJV A;  5JJK A;  4JCV E;  1GO3 E;  2RHS B;  3HFZ B;  4C3I H;  5IYD H;  4PZ6 A;  3CCU A;  1TWF H;  3PF5 A;  2V1C C;  1SN8 A;  2IHF A;  4GOP A;  5JJI A;  1R9T H;  4OXP A;  1EYG A;  1KAW A;  1UE5 A;  3STB D;  1E1T A;  3UE0 A;  4LFB Q;  2MO1 A;  5C44 H;  2JA7 G;  2LXJ A;  2YTX A;  1WJJ A;  3GTL H;  3U58 A;  1P8L A;  4LF6 L;  1C7Y A;  3OW2 A;  3PO3 G;  4P73 A;  2WP8 J;  4BY7 H;  1KRS A;  3S14 H;  1JE5 A;  4DR6 Q;  4GN4 B;  4A3E G;  3HKZ G;  3BU2 A;  5IY0 A;  2Q2T A;  2B3G A;  2WB1 G;  4O2D A;  4X62 L;  2KEN A;  2UUB Q;  4B3S Q;  2GVA A;  3HOW G;  3G4S A;  4DR5 Q;  2JA5 H;  4A3D H;  4JI0 Q;  1LTL A;  1NY4 A;  4GLX A;  4POF A;  1SRU A;  2UUC L;  1BBU A;  2C35 B;  1X9N A;  3TS2 A;  2PNH A;  1IBM Q;  2BA0 A;  3CCQ A;  3BZC A;  3I2Z A;  4GN5 A;  3ULL A;  5BR8 L;  4IFD J;  2UXC L;  4GLA C;  2AHO B;  3HOY H;  2JA6 H;  4A3G H;  2KHJ A;  4UP8 A;  2H5X A;  3A5U A;  5LMU L;  1OXT A;  4P75 A;  4DR2 Q;  2K75 A;  1YVC A;  5FLM G;  4JI7 L;  4R4O A;  4APV A;  4JBM A;  1B70 B;  2UXD Q;  1MJE A;  2R7F A;  4JI2 Q;  4WJ4 A;  1GVP A;  4KHZ A;  2KBN A;  4Y52 H;  1VQF A;  1VQP A;  2NVT H;  4B3M Q;  1K8A C;  4R4I A;  3JAM i;  2R92 G;  1G6P A;  1YBY A;  4GNX A;  1NBW A;  2Z0S A;  3J81 j;  5C0X G;  1HNX L;  4BY1 G;  3CC4 A;  1S3O A;  3CCR A;  3TQY A;  2CKZ B;  1IZ6 A;  3RLO A;  1XPU A;  3NBH B;  1JMC A;  4QL5 A;  4JBK A;  4A3B H;  1PH4 A;  1T9H A;  3KOJ A;  1VQO A;  1Y14 B;  1CKO A;  2YYZ A;  4LW1 A;  4HIK A;  2GN5 A;  1SRO A;  2KCT A;  4LFA Q;  1NE3 A;  2UUA Q;  4BXX G;  1X3G A;  4LF4 Q;  3S1Q H;  3H3V I;  3HOZ H;  3PGZ A;  1KRT A;  3UDI A;  1FJG L;  4IOC A;  4DV0 L;  2ZTD A;  1AH9 A;  1N34 Q;  3RZD H;  2OTL A;  2VY3 A;  4P72 A;  1Z47 A;  5IP9 G;  4OO1 G;  5M3F H;  3PUZ A;  4YCV A;  3J80 c;  3RR5 A;  2R6G A;  1X3E A;  3KDF B;  3MXN B;  5DLQ E;  1NTG A;  1L1O A;  3S1M H;  1AE3 A;  2K52 A;  4YHH L;  5IT9 c;  4LF6 Q;  2N3S A;  1HH2 P;  3K0X A;  2LXK A;  3A5Z B;  4OON A;  1XMQ L;  1XMO Q;  1JJG A;  4X66 L;  1N36 L;  2BA1 A;  3HKS A;  3GDE A;  2F4V L;  4UP7 A;  4X65 L;  3CW2 C;  1VQM A;  1YNX A;  3KLW A;  1CKM A;  2ATW A;  4A3K G;  2AWO A;  1QVG A;  2NZH A;  5J3B A;  2UUC Q;  3MEF A;  4XIG S;  1Y1W G;  1LYL A;  3PIO A;  4HJA A;  1YHQ A;  1XNR L;  3CCE A;  1HNW L;  1C9O A;  3RLF A;  3STB C;  2UXC Q;  5BR8 Q;  4HJ5 A;  3H15 A;  2IY5 B;  3J7A 5;  3CP0 A;  4IJH A;  2PI2 E;  1CSQ A;  4NXN L;  1I3Q H;  4HJ7 A;  1K8G A;  1HR0 W;  5LMU Q;  2YTY A;  3F2C A;  4A3F H;  2K14 A;  4R1J A;  1Q46 A;  4JI7 Q;  5LMN L;  4A3M H;  4KI0 A;  2B63 H;  1U5K A;  1PFS A;  1SLJ A;  3LGJ A;  4JC0 A;  4JV5 L;  4JOI A;  1MJC A;  1EWI A;  2Q2I A;  4DUZ L;  2E5L Q;  4DV6 L;  5M3M H;  3PUY A;  5C4X G;  2HHH L;  4JYA L;  1VQI A;  3L7Z C;  3CMA A;  1FL0 A;  2Y0S G;  4DK3 C;  2VQF L;  1HNX Q;  5H1S E;  4LF9 L;  1HZA A;  3KF6 B;  4MTN A;  4IO9 A;  3S1N H;  1QUQ B;  1OXX K;  3FKI H;  1Q82 C;  1CKN B;  1X56 A;  1LUZ A;  2WFW A;  3NEN A;  1PH1 A;  1K3R A;  1UE7 A;  2CQO A;  1I6H H;  2K5H A;  4AYB E;  1VQA A;  4FDB A;  3J80 i;  3J81 i;  2IX0 A;  2NN6 I;  4IFD I;  3G71 A;  1Q8K A;  4L5R C;  2Q2H A;  2XGT A;  4NPS A;  1FJG Q;  4DV0 Q;  5IYC G;  4QGU A;  5IYB G;  4JI4 L;  2HIV A;  1V43 A;  4H02 A;  4LF5 L;  4OX9 L;  1EOV A;  1L2F A;  2EXD A;  5HGQ A;  2XTI A;  2ZJR A;  1W2B A;  2JA8 G;  4K0K L;  2OTJ A;  3AEV A;  1FGU A;  1WFQ A;  5GRO A;  5C4J H;  4NXM Q;  4DR3 L;  1Z9F A;  3TRE A;  1YJN A;  4PZ7 A;  3FP9 A;  1N8R C;  4YHH Q;  1IL2 A;  1PH7 A;  1PH5 A;  2I5H A;  1XMQ Q;  5ELO A;  4X64 Q;  1NMG A;  2NVQ H;  1VQ5 A;  3HOV H;  1N36 Q;  2YU9 H;  4UP9 A;  3DLL A;  4A93 H;  2F4V Q;  1QZH A;  1PVO A;  4JBJ A;  1OXV A;  1UWV A;  4JBW A;  5IYD G;  1PV4 A;  3H3V H;  1SMX A;  2UXB L;  3PIP A;  1WOC A;  2PQA A;  3PF4 A;  1HNW Q;  1Y1V H;  1VQH A;  3KF8 B;  2D62 A;  3I55 A;  2VUM H;  2E2I H;  3HOU H;  4JI5 L;  4DV7 Q;  5IP7 H;  4RMF A;  1CUK A;  1VQC A;  1A62 A;  1VQK A;  5C44 G;  2E2J H;  4NXN Q;  4WJ3 M;  4KHP L;  3I4N H;  3PUX A;  2HT1 A;  2LSS A;  1GM5 A;  1Q1B A;  2IX1 A;  4EQ5 A;  5LMN Q;  2VQE L;  3CPW A;  5JEA J;  2PI2 A;  4BY7 G;  4A3C H;  4JV5 Q;  3RLN A;  1J6Q A;  1EIF A;  4XTC S;  4ALP A;  4DUZ Q;  1O7I A;  2OCE A;  1HZ9 A;  4DV6 Q;  1NMF A;  2R7Z H;  2RF4 A;  4KLK A;  3OTO L;  2WAQ E;  4GOP C;  4UY8 C;  4DR4 L;  3CME A;  4JYA Q;  4DV1 Q;  4LF8 L;  4A3I H;  3ULP A;  2JA5 G;  4A3D G;  4JI3 L;  2VQF Q;  1WCM H;  1PH6 A;  1A0I A;  2R7D A;  2K50 A;  2NVY H;  2F3I A;  2ZJP A;  3ICE A;  1E7Z A;  4AIM A;  4DPG A;  4AQY L;  2ASB A;  4IOA A;  1N32 L;  3KFU A;  3HOY G;  3GTO H;  4A3G G;  4QY7 A;  2KCM A;  4HJ9 A;  2JA6 G;  4B3R L;  4JI1 L;  3AYH B;  2JQO A;  2OWO A;  5IWA L;  1J5E L;  4YY3 Q;  4BBS H;  4YCU A;  3S2D H;  4LWC A;  4A76 A;  3KYH C;  1PH8 A;  4A3J H;  2VS1 A;  1QZG A;  2R93 G;  1Q1E A;  1E22 A;  4JI4 Q;  3NEL A;  3U4Z A;  4LF5 Q;  4OX9 Q;  1IYJ B;  4C2M H;  3CCM A;  4K0K Q;  4A3L H;  1VQ6 A;  4C3H H;  1TWH H;  5M5W H;  4QJF A;  2ALY B;  1VQD A;  2JEB I;  4DV3 L;  1E1O A;  1EQQ A;  3PO2 H;  4DR3 Q;  1QVC A;  1VQG A;  4GS3 A;  1A63 A;  2K5V A;  2MQH A;  1IBL L;  1N33 L;  1RIP A;  3RN5 A;  1H95 A;  3CXC A;  1E24 A;  1L1O B;  1VQN A;  1EIY B;  3DM3 A;  1VQJ A;  1YZ6 A;  1X65 A;  2PMZ E;  3KJO A;  4A3B G;  4DR7 L;  1GKH A;  3UE1 A;  1HZB A;  2F52 A;  3RZO H;  3S15 H;  1IBK L;  3HOZ G;  3TS0 A;  3WWV A;  3F2B A;  4GNX C;  1KC8 C;  3K80 C;  2CCZ A;  1M90 C;  3IRB A;  5M5Y H;  1VQ7 A;  1PA6 A;  2GVB A;  4LF7 L;  1L0W A;  4X62 Q;  2CFM A;  3T1Y L;  4JI5 Q;  5M3F G;  1TWG H;  2I5L X;  1CSP A;  2ZJQ A;  2IT1 A;  3PUW A;  1MKH A;  2ID0 A;  3S1R H;  3G6E A;  2ZTC A;  4KHP Q;  3W5O A;  4DUY L;  3D31 A;  4A3K H;  3J7Z C;  3GTG H;  1NJI C;  2MFI A;  3ERS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...