2WAQG

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2waqG00
2PMZE 1X56A 3FP9A 4HJAA 4A3DH 1E3PA 4OO1I 3CCMA 3AQQA 1LTLA 3PUVA 2B3GA 4YY3L 2VW9A 2B63H 4AYBE 3MEFA 4X65Q 3I4NG 4HJ7A 1P16A 1HNXQ 1Q1EA 4DKAC 2HIXA 2WAQE 3E0EA 2F4VQ 2VNUD 2UXDQ 4GKKQ 4A3KH 3B6YA 4XIGS 4DR3L 1PH7A 4L5TA 1JJGA 2Z0SA 2HHHQ 2E8GA 2DGYA 1KXLA 1KQSA 4B3TQ 1KD1C 3UDFA 5C44H 2WAQG 1LUZA 4A3GG 1CKNA 2DUDA 1I3QH 3GTLH 3S2HH 3LGJA 2K75A 1IXRA 2NVXH 4IFDI 1BKBA 1YHQA 5AJ3Q 4APVA 4YWLA 1L1OB 3G48A 1NJIC 3GTPH 1UE7A 4IJHA 1Q82C 2JEBI 2CKZB 2MO1A 4A4IA 1YI2A 2VQFL 4POGA 4YCWA 1IBKL 3S24A 3CCJA 5C4XG 1A8VA 2AHOB 4QIWE 3UDXA 4DV1Q 4DR5L 3G4SA 4BBRG 4DK6C 4AH6A 1HNWL 1Y1VH 5IE8A 3KJPA 1EIYB 2UXCL 3HKZG 4X62Q 1WFQA 2E5LL 2JA7H 3PIOA 3DM3A 4P75A 1HZBA 4QY7A 1Q86C 1ASZA 3HOYG 1CUKA 1YBYA 4GOPA 2MQHA 4JI2Q 1PFSA 5M5XH 4JBWA 5GROA 3RLOA 3SGIA 3CMEA 1VQ5A 1VQNA 2R92G 3S14H 2GVBA 2I5LX 4JI0Q 2ZJQA 1FL0A 1EIFA 1Q46A 2VZAA 4GLVB 5M3MH 3J7ZC 1PH5A 1G291 4NXMQ 2B29A 4LUVA 4IPDA 4DV3Q 2GN5A 4BA1I 5JEAG 2CCZA 3I4NH 4DR4Q 1GKHA 3PSIA 5JJKA 4HIOA 4Y7NH 4LUZA 3NENA 2JEAI 4A3EH 1J5EL 2IX0A 4JI7L 3J80c 2K50A 1UWVA 2VY3A 5GQOA 2K5VA 4GKKL 3GTJH 2AMCB 1YHAA 1KRSA 5FJ8G 2Q2UA 4O2DA 3STBC 4OXPA 1KIXA 3AYHB 4LFAL 3HKSA 2UXBL 5GAGC 4MTNA 1OTCA 3ICEA 2FXQA 2ZTEA 4B3MQ 1QVCA 4JYAL 3PO3G 4QQBX 2LSSA 4GN5A 2JA8G 2KCTA 4A3IG 4QL5A 4A3JG 1JE5A 3J7A5 4KLKA 4LFBQ 1CKNB 3GDEA 2QGQA 4BBRH 1L0WA 4HJ5A 4TQUS 2Z6KC 1PH8A 3F8TA 1VQAA 3GTMH 2CWPA 2C35B 1XNQQ 4LF5L 1QZGA 3HOYH 2JK8A 3FKIH 1K73C 4BBSH 2ZM6L 1LM0A 3GTQH 1VQ7A 4DR6L 3PUYA 2CFMA 5IWAL 3S17H 2WB1G 1XMOQ 1VQ4A 4GNXC 4AQYL 2R7DA 3U50C 1G6PA 3UE0A 3TS2A 2NN6I 4OWWB 1VQIA 3PF4A 4C3HH 4YCVA 4PZ6A 3MXNB 1FVIA 1VS0A 3S1RH 4X65L 3M3YH 1E22A 3CCEA 1RL2A 1TWAH 1HZAA 1W2BA 3UDGA 4JI1L 4DV5Q 4YWKA 2MO0A 4JCVE 1YJWA 4DV1L 1UEBA 1NMGA 4IPCA 3STBD 1PH3A 3H0GG 1Q81C 1SE8A 1S3OA 3M4PA 4JOIA 4LF6L 3CCVA 3I2ZA 2IX1A 2JA8H 1PVOA 4R4OA 4H02A 1Q8KA 2K14A 2BH8A 2NN6G 1SLJA 4A3KG 2YTYA 2Q2IA 2VQEL 4LF9Q 2JA6G 1TWCH 3AFQA 4JBKA 3T1YL 1IBLL 2ID0A 4HIMA 1HR0Q 2UUBQ 1K8GA 4R4QA 1XMQL 3DLLA 4BXXG 1U0LA 4LFCL 1FJGL 2V1CC 1X3GA 1KHIA 1YZ6A 4A3JH 3J81i 2VQEQ 2E2IH 4NXML 2QA4A 2IHEA 3E9HA 2OQ0A 3T1HL 3H0GH 1EQRA 4R4CA 3CF5A 5LMNW 1HR0L 3GTOH 2UU9L 3CXCA 4A3LH 2NZOA 5BR8L 4DV7Q 3ULPA 1RIPA 3CCSA 3PCOB 3K81C 4R1JA 4JG2A 4BBSG 3OTOQ 2JA6H 1K9MC 2KHJA 1O7IA 1V43A 3HOVG 3ULLA 2WP8J 2I5HA 1VQMA 4QJFA 5J3BA 5DLQE 5GAEC 4R4IA 1YNXA 3F2CA 3KOJA 1IL2A 2A8VA 1DGSA 1JJCB 3U58A 3CC2A 4C3JH 4O0AA 5M3MG 3G6EA 3CCRA 4JI5Q 4JI4L 4X6AH 2UUBL 5H1SE 4GN4B 3KF6B 4IJLA 4KHPQ 3I4OA 1CKMA 1B8AA 3I56A 3OW2A 1GM5A 1CSQA 1BVSA 4KI0A 3EIVA 3HOVH 3E9IA 4JOIC 4DR2L 2OCEA 4PZ8A 1XNQL 3H3VI 3KFUA 1EWIA 3HOZG 2JA9A 5FLMG 2UUCQ 1QVFA 2VUMG 3KYHC 1MKHA 1N34Q 1HH2P 4UP8A 4IFDG 1HNXL 4IPGA 1N36L 4A3MH 3HOXG 4JI3Q 3S2DH 3I4MH 1WI5A 2OTJA 1A0IA 1T9HA 4JI6L 2RHSB 1N34L 4GOPB 4LF8Q 4B3ML 4JYAQ 1E24A 4GNXA 2Y0SG 3KF6A 1EOVA 3Q8DA 4BY1H 2OTLA 3PO3H 3CP0A 4K0KL 4A93G 4X64L 2PI2E 3L0OA 4FDBA 1KRTA 5JEAJ 4MZ9A 1E7ZA 3CD6A 1A63A 2IY5B 3EBEA 1NE3A 3PUXA 2ES2A 1K0RA 4A3MG 1VQHA 5HGQA 1IBMQ 4GNXB 3PUWA 4JI7Q 1N32L 4DR7Q 1Z47A 2ALYB 1JJ2A 3I4MG 1XJVA 4YHHQ 4A3CG 1Y14B 5LMNL 3PO2H 2I0QA 4DAMA 2IT1A 4PMWA 1OXXK 3RN5A 5FLMH 2BA0A 3H15A 3CMAA 2YTVA 3CPFA 4X66Q 3W1GA 4LF9L 2N3SA 1PH4A 3BZCA 3L2PA 3CAMA 2I5MX 5JJIA 1XNRL 4BY7G 5IP9G 2MFIA 3ULJA 5BR8Q 3ERSX 4JBJA 4ALPA 3PF5A 1VQKA 3I7FA 4L5RC 4LF7Q 1SMXA 2VL6A 2XTIA 3PV0A 3L7ZC 1R9TH 4RMFA 1QZHA 3NEMA 3S1MH 4DV7L 4OWTB 2VQFQ 1PH6A 2R92H 5C4JH 3H3VH 4B3SQ 2AKWB 4C3IH 5LMNQ 5HY6A 4GLXA 4LW1A 1YEZA 2ZTDA 1PHJA 1V9PA 2D0OA 3PIPA 4JI8Q 2HT1A 2JA7G 4DR7L 3D0FA 3TS0A 3GTKH 4BY1G 5IWAQ 3CCUA 1L2FA 2PI2A 4A76A 4A3FG 5GADC 3K80C 4DPGA 2KBNA 4B3SL 4LF4L 4A3CH 1HR0W 1E1OA 1UE6A 4A3EG 4DR1L 1QVGA 2R7ZH 4L5SA 2GVAA 2NVTH 4UP7A 3AFPA 3PGZA 3A74A 1YJ9A 1Q12A 4UP9A 4IO9A 3RZDH 4DV0Q 1GVPA 5IYCH 4JI3L 2WB1E 2YV5A 1IBKQ 3AEVA 4YY3Q 1M1KC 4L5QA 4NXNL 3NBHB 4YCUA 1VQDA 2PQAB 4B3RQ 5JJLA 1HNZL 4A3IH 4AYBG 2NZHA 2IHFA 3M9BA 5GAHC 3TRZA 1D7QA 1SRUA 3HOWH 4J15A 4IOAA 2LXKA 2F3IA 1L1OA 4A3DG 4JI8L 4JC0A 2JQOA 4EX5A 2CQOA 4P73A 3KLWA 5ELNA 2ZM6Q 3CPWA 5M3FG 5IYCG 1M90C 1CSPA 2ZTCA 1C7YA 1IZ6A 1GO3E 5C3EG 4GN3B 2JA5H 1HJPA 4YWMA 2Q2TA 2YU9H 1XPOA 3M4QA 2VUMH 4LNQA 1G51A 2K4KA 4DV2L 1VQCA 3TREA 3UDIA 3G71A 2UXBQ 5IY0A 3K0XA 3WWVA 2R7FA 3FKIG 2Z6KA 4DV4L 4KHPL 4NB3A 4IOCA 1PYSB 2PNHA 4ME3A 3JC66 5C0XI 1N8RC 1PV4A 2E2HH 1WOCA 2K5HA 4P71A 3W5OA 3J81j 3M4OH 4POFA 1NBWA 1EQQA 3RLNA 4R4TA 4GKJL 1QUQA 4A93H 2ZJRA 1GD7A 3ZJYC 5C44G 4LF4Q 2UXCQ 1I6HH 3S1NH 4DR2Q 1E1TA 3KDFA 1J5EQ 3CCLA 1UE5A 1LYLA 2WFWA 2E2JH 3D31A 1WCMG 3F2DA 1U5KA 1Y1VG 1AH9A 4LFCQ 1FJGQ 5AJ3L 4WJ3M 3CW2C 3PO2G 1VQJA 4DUZQ 1BBUA 5IYDH 4IFDJ 1NY4A 4OONA 1TWHH 4DUYQ 4JI2L 3UE1A 5C4XH 4HJ9A 1HNZQ 3CC4A 3S15H 1VQFA 4JI0L 1TXYA 4A3LG 1PYBA 1B7YB 1HNWQ 1VQ9A 2UUAL 2K52A 2F4VL 3NELA 3CC7A 4AIMA 4JBMA 3A0JA 1AE3A 1L1OC 5M5YH 2QEXA 4BXXH 1MIUA 2E5LQ 1SN8A 1WCMH 4WJ4A 4Y52H 5IP7G 1KAWA 3K7AH 5E7NA 1HZ9A 4TVAB 3J81c 2NVQH 3HOUG 1BBWA 1K83H 2ATWA 5C0XJ 2UU9Q 4KHZA 4OX9Q 1D8LA 4DUZL 2PQAA 1W3SA 3FHWA 2AWOA 3U4VA 5FJ8H 1Z9FA 3BZKA 3HFZB 1V1QA 1X6OA 4AQYQ 1XMOL 1EYGA 4A3BH 3F1ZA 3A5UA 2KCMA 2R93G 2JJQA 1S40A 5IP9H 1YITA 3S1QH 2ASBA 4DNIA 5FLXc 3ER0A 5IYBH 2OWOA 4DR6Q 1IYJB 2MNAA 1C9OA 1PH1A 4HIDA 1N33L 4GKJQ 1C0AA 2RCNA 4LFBL 4NPSA 2HHHL 5K36G 3HOZH 3W1BA 3CCQA 5LMUQ 4NXNQ 4LF7L 4P72A 1FGUA 4LF6Q 4A3GH 4DV0L 1NMFA 1Y1WH 4A3FH 4JI6Q 2R93H 5IT9c 1YHBA 3BJUA 4QGUA 2D0PA 4DV2Q 4X66L 4P74A 4EQ5A 4LFAQ 3HOUH 2EXDA 2JE6I 2D62A 2K5NA 1MJEA 1VQGA 5LMUL 2YTXA 1VCIA 1KC8C 1TWGH 2R6GA 4HJ8A 1XTDA 2KENA 3GTGH 1X3EA 2NVYH 2Q2HA 1MJCA 2AWNA 4A75A 1P8LA 3PUZA 3RLFA 1XMQQ 1JMCA 1AE2A 4DV6L 3S16H 2N8NA 4JI4Q 2CWAA 3F2BA 1VQPA 3GD7A 4OWXB 1B70B 4JI5L 2L15A 1K3RA 5C3EH 2JA5G 3BU2A 2RHQB 3M85A 3OYYA 4X64Q 2N49A 4XTCS 3HOXH 1SR3A 1I94L 3TEHB 3K8AA 1I5FA 5IYBG 3K7UC 2A1AA 3J80i 1KL9A 1CKOA 5M3FH 1OXUA 1XPRA 3GO5A 1HZCA 4X62L 4DR1Q 1PH2A 1N36Q 2KHIA 3IRBA 1N33Q 1XPUA 3KF8B 2UUAQ 4DUYL 4IPHA 2Y0SE 3T1HQ 2LXJA 1PA6A 2RF4A 3M7NA 4UPAA 3U4ZA 1JB7A 3RR5A 4BA2I 4JV5L 1J6QA 1X3FA 1Y1WG 1VQ6A 4BY7H 4C2MH 4MNOA 2H5XA 1OXVA 4DV3L 1NTGA 4OX9L 4DR4L 4LUOA 4LWCA 2HIVA 1VQBA 4GOPC 3T1YQ 1IBLQ 1X65A 3RNUA 1WYDA 3A5ZB 1Q7YC 1EUJA 2UXDL 2N78A 1X55A 4RG1A 1Q1BA 5EAYA 5ELOA 4LF8L 1SROA 1VQ8A 4DV4Q 2YYZA 1ASYA 3RN2A 1PH9A 1K8AC 1XNRQ 4GS3A 1TWFH 2EIFA 1WJJA 4JI1Q 5M5WH 1A62A 2HQLA 3TQYA 4DV5L 1YIJA 1YVCA 5IYDG 3OTOL 2BH2A 4PZ7A 3CQZH 5IP7H 1QUQB 2BA1A 4DR5Q 1OXTA 2A19A 2XGTA 2UUCL 3JAMc 1YJNA 1SFOH 2ZJPA 4PG3A 1I94Q 1I50H 4JV5Q 4DV6Q 4YHHL 2R7ZG 3VDYA 1VQOA 1X9NA 1VQEA 1X54A 4HIKA 1IBML 4OO1G 4DK3C 3HOWG 2B63G 1N32Q 1N9WA 4UY8C 4GLAC 4LF5Q 5C0XG 2F52A 1UE1A 3HKZE 3RZOH 3JAMi 4B3TL 2EQSA 4B3RL 1EFWA 1VQLA 3KDFB 4DAYB 4DR3Q 2VS1A 2OQKA 3KJOA 4K0KQ 1JT8A 1S72A 3EN2A 1H95A 1OXSC 4A3BG 3I55A
chains in the Genus database with same CATH superfamily
2EXZA 4A3DH 3AQQA 1LTLA 2A6EC 4X65Q 1F9PA 1HNXQ 5FKAC 4DKAC 2WAQE 2D2CC 4JPBW 4A3KH 3B6YA 5CV5A 4L5TA 1JR0D 2DGYA 1KXLA 1KQSA 1IKMA 4XYOA 3UDFA 5C44H 4K8JA 3EROA 1BKBA 3GTKB 2EJMA 3HGBA 5FLXL 3E3XA 1L1OB 2KJXA 3GTJB 1QNUA 1ZYRD 1GUTA 4IJHA 1Q82C 1YI2A 3S24A 4DV1Q 3UDXA 4DK6C 4QF4A 1Y1VH 3NP8A 2F0QA 2BE5D 2KVMA 2F0DA 3DM3A 3T4AC 1ASZA 1SYEA 5JVH3 5GROA 1VQ5A 1VQNA 2R92G 1FNWA 1D6EC 2GVBA 4P2CB 4NP5A 4A93B 1FL0A 4GLVB 3MTSA 3QJYA 1QJOA 4DV3Q 5KYIA 2GN5A 4BA1I 4R9WA 1VF5C 1B9NA 4Y7NH 3D4RA 2VB2X 4LUZA 5FO8B 1DXMA 1BCPF 1CQFA 2K50A 1UWVA 3K5NA 1E2WA 4OXPA 1D2BA 1WTXA 1LTID 5GAGC 2KHSA 1OTCA 3PO2B 4JYAL 4G57A 1TY0A 2LSSA 3K7AB 3M4OB 2HCCA 1TS3A 4LFBQ 3GDEA 4BBRH 2L0CA 2C35B 1XNQQ 3HOYH 2JK8A 3S1QB 3K5MA 1CZWA 1EYAA 1XMOQ 1MBYA 1TT2A 1VQ4A 2F0TA 1L0XB 2R7DA 4CDEC 2NN6I 3NTHA 5C4XB 5C3WA 4YCVA 4XQJA 1FVIA 1VS0A 3M3YH 2WINB 1HZAA 1W2BA 5T1GA 2KCNA 2MO0A 4JCVE 3OMCA 2R93B 1UEBA 4IPCA 1PH3A 1AZQA 1SE8A 3I2ZA 3ITPA 1PVOA 4H0LC 1GUSA 4H02A 2YTYA 2G5DA 4LF9Q 3T1YL 4C3IG 5FO9B 1KAAA 1PTOH 1K8GA 1XMQL 3HKZB 3GV3A 2V1CC 2E2IH 5BN4A 3FVQA 3S17B 3BDOA 3T1HL 2UU9L 5BR8L 3S2DB 4ULLA 3CCSA 3PCOB 1EY9A 2JA6H 1K9MC 1O7IA 1LV9A 2HCIA 2NZ1D 2WP8J 1ENFA 1VQMA 1QE6A 3WOEA 2A69D 2Q8TA 5C3XA 4R4IA 5KNBA 3BYYB 3KOJA 3NPPA 4O1NA 4CDFC 5M3MG 4X6AH 1X3QA 1IL8A 3TMEA 4IUTA 3I56A 5HURA 1GM5A 1CSQA 2PNRC 4DR2L 3H3VI 4CBVA 3HOZG 5IGEA 5FLMG 2VUMG 3KLRA 1N34Q 3GTOB 3HOXG 1BCPD 3CKIB 2IJ0A 4JI6L 2L5TA 1N34L 5M3FB 4LF8Q 4NKLA 1IYVA 1EOVA 1LTRD 5BN5A 4KMUC 4K0KL 3L0OA 4U673 1E7ZA 5I2XA 1BXTA 4JI7Q 1QG7A 4C2MB 3PUWA 4DR7Q 1Z47A 1JJ2A 1XJVA 5I6YA 3VR5A 4A3CG 2F03A 3PMFA 5NUCA 1D1KA 4PMWA 4BS9A 1OXXK 3H6MA 2GA4B 3CHBD 5FLMH 1LABA 4HCEA 1PH4A 3OIPA 2I5MX 5I2YA 2H1EA 2MFIA 1KABA 5BR8Q 2A74C 4LF7Q 1WD0A 4IQZA 3MC0B 3PV0A 1SMXA 2XTIA 3LWUA 4RMFA 5LHY1 1DJRD 3NEMA 2VQFQ 1PH6A 2AKWB 3I91A 5HY6A 3Q23A 2ZTDA 4JI8Q 2JA7G 3D0FA 3PIO3 5IT9L 1GHKA 2PI2A 2ZXRA 4A76A 1LLRD 4DPGA 2K28A 3EJIA 5DEHA 4DNRB 4A3EG 1A6XA 2NVTH 2SOBA 3MHBA 4UP7A 3A74A 1YJ9A 1Q12A 1FNVA 4UP9A 4A3DB 3AEVA 2WB1E 2YV5A 1PZJD 5G3LF 3OWFA 4L5QA 5IGDA 3K6OA 4B3RQ 4A3KB 4M1UB 4J15A 5COYA 1XWEA 4CDCC 1SE4A 2NVXB 3TP7A 3K0YA 5ELNA 2F0GA 5IYCG 1M90C 1HQMC 4GN3B 2YU9H 4YWMA 2RQXA 1AEXA 3TP6A 3W2DA 1HFGA 2VUMH 2PCFB 3SK4A 3UDIA 5IY0A 1S5FD 1WCMB 2R7FA 2AUKA 4PNYA 4KHPL 4JI3Q 4ME3A 2PNHA 2K5HA 3W5OA 3AB9A 2HD3A 1NBWA 3RLNA 4PV1C 4A93H 4ZUJA 1GD7A 5C44G 1LACA 4KKUA 3GTMB 3S1NH 5EKLA 2WFWA 1F77A 2J4XA 1U5KA 1YNJC 4L6TB 3I90A 1HCZA 1VQJA 3FRPB 3OWEB 5IYDH 1STHA 4ZRZA 4JI2L 3VYTA 2EJGC 3CC4A 2KUMA 1SAPA 3NBIA 1BQQT 1EY6A 1B7YB 4QUCA 1RHPA 2F4VL 2LY7A 5IGFA 3KBXA 2D9UA 1HUNA 1W6JA 4Y52H 2NVQH 1HZ9A 3J81c 1JCKB 1BBWA 2D5DA 1K83H 2ATWA 5C0XJ 4OX9Q 5KGUA 1Z9FA 3BZKA 4AQYQ 1EYGA 3F1ZA 3OHXC 5IP9H 1YITA 3ER0A 5IYBH 1LTTD 5C3EB 2OWOA 5JAVA 1IYJB 1DOMA 1BOSA 3RMHA 4MHEA 3NE5B 1C0AA 1RKNA 1QOHA 2HHHL 3CCQA 2CQAA 1FGUA 3NTIA 4RWSC 5CV9A 4LF6Q 4A3GH 2SNSA 4G7OC 4DV0L 2EYLA 1NMFA 2R93H 5IT9c 1HTLD 2D0PA 4X66L 4K2LA 1ILQA 2D62A 5C4HA 4KJOA 3KBGA 1F2MA 1I4RA 1KC8C 2FJ2A 3Q24A 1X3EA 1PRTB 1AE2A 3R2IA 4DV6L 3K57A 5ELDA 5IGCA 2CWAA 1VQPA 3I3CA 4O42A 2B2TA 3K58A 1R4PB 3BU2A 4KV6A 3TP8A 2N49A 2OEOA 4XTCS 1I94L 2F0NA 1AW7A 1FNUA 4LAAA 1I5FA 4FF1A 5IYBG 4YIJA 3DXJC 5EJWA 1KL9A 1TS4A 1XPRA 3GO5A 1HZCA 4X62L 3PO3B 1Y8PB 1N33Q 1PA6A 2IX3A 1EWCA 1ZEQX 3R8BA 4UPAA 3J81E 2P5ZX 1BUVT 3R2TA 2BE5C 4DR4L 4OX9L 3L9AX 2HIVA 1BF4A 1BCPC 3CRLC 5J39A 3RNUA 5FLXE 2L1BA 2N78A 1X55A 1KLUD 3U9SA 3IFTA 2C5CA 3I4MB 1K8AC 3RN2A 1TWFH 4DV5L 4ID6A 1YVCA 3UI2A 2R61A 4JK1C 1AN8A 4CKBA 2K5QA 2BA1A 4DR5Q 2UUCL 1YJNA 1R9TB 3QO2A 2K03A 2X69A 1I50H 1ZYRC 2XVSA 2LMCB 4DV6Q 4YHHL 3VDYA 3ND9A 1VQOA 1X9NA 3IFDA 1RDPD 4OO1G 2F0PA 1STGA 1UE1A 2KEEA 4QB4A 3JAMi 4FP5D 2EQSA 2QILA 2L4NA 1HFNA 3H09A 1JT8A 1K8MA 2MHVA 2NBFA 5K36G 1H95A 2PMZE 3BVGA 4WFN3 4F88A 3SE0A 1E3PA 2C9OA 2B3GA 4YY3L 1I4XA 3QOLA 2B63H 3MEFA 3I4NG 4XDXA 3E0EA 2F1MA 2QCPX 3BYTB 4GKKQ 4XIGS 2OF1A 1JJGA 2HHHQ 2E8GA 5C4JB 3V2TA 3TN2A 1SYGA 1YHQA 2L12A 4YWLA 5A2QL 4MIUA 2Z8LA 3WDNA 2PO4A 2CKZB 1IBKL 5C4XG 2MGSA 4G7HC 1PTOF 1RTOA 3NTKA 4BBRG 4HMJA 1HNWL 1EIYB 1JB3A 2E5LL 2JA7H 1HZBA 3HOYG 5M5XH 2I5LX 5M3MH 3J7ZC 1PH5A 3GQBA 4BBSB 1G2TA 4NXMQ 3QR8A 4LUVA 2PZUA 3K59A 5JEAG 5AFWA 4HIOA 2JEAI 2JA5B 2F0OA 4HN7A 1GOZA 5GQOA 2VY3A 3S15B 3A55A 2K5VA 4G4KA 3LWEA 4GKKL 3GTPB 2AMCB 1KRSA 1U4MA 4O2DA 3STBC 1KIXA 4KD4A 2UXBL 5A2QE 1FR3A 2ZTEA 4QUFA 1UAPA 1QVCA 2K6AA 1A3TA 2EY1A 3URYA 2KCTA 2RA4A 4DN4M 4ZKCB 5JPMC 2A73B 1MSHA 3NWTA 4HJ5A 3NXWA 1L0WA 2E76C 1PH8A 1VQAA 4CGYB 3GTMH 4TSSA 4NMZA 1T5EA 2F0FA 2Q8IB 4FF3A 1STYA 4DR6L 5EBCA 1A15A 1KLGD 5IWAL 3I4NB 4WRDA 5J1ZA 1GJXA 2WACA 3PF4A 4C56C 4A3EB 1D5MC 3MXNB 4XT3B 5KEEA 3F2UA 1EWHA 1RODA 1Y1WB 1NMGA 3STBD 4LF6L 1S3OA 4K5VA 3M4PA 4JOIA 3OIQA 3CCVA 2JA8H 3FMCA 2BH8A 5EPLA 5HGTA 2Q2IA 3AFQA 1ZKOA 2DNEA 1Y8NB 1IBLL 2ID0A 4HIMA 1HR0Q 1UEAB 5LL6S 5BN3A 1DONA 4R4QA 1DZ1A 3DLLA 3S16B 3SHLA 3L3OC 4A3JH 3J81i 2IHEA 3CF5A 3GTOH 5CR3A 4BBSG 2NUCA 3HOVG 3R93A 2HDLA 1PXUA 2I5HA 1TWAB 4QJFA 5J3BA 4HMIA 1CT1D 3MA2B 2E75C 1F2YA 3U58A 3OPOA 3G6EA 3CCRA 3NQTA 4KY5A 2WAQB 1IW7C 2LKVA 2A69C 5H1SE 2B8FA 3KF6B 4BWGB 1B8AA 1CKMA 3OW2A 3HOVH 1CHPD 2A6HC 2G9DA 4PZ8A 3KFUA 2JA9A 1MKHA 4IPGA 4A3MH 1VMCA 2CHBD 1WI5A 5M5WB 1A0IA 1T9HA 2OTJA 2RHSB 5C0XH 2B2TC 2RVLA 4B3ML 3PO3H 3Q8DA 3J80L 3FPUB 1ENAA 5E4WC 4A93G 4RFBA 4X64L 2R92B 2L55A 2LFNA 1I4HA 1O7ZA 1SBBB 3CD6A 1A63A 2IY5B 1K8OA 5FOBB 1IBMQ 4A3MG 1S4ZA 2ALYB 2BDOA 3I4MG 5EBDA 5D14A 5LMNL 2IT1A 1SEBD 3RN5A 2PMZB 2PZTA 2BA0A 1MSGA 2YTVA 4X66Q 1SJED 2N3SA 4IUUA 1QNKA 3L2PA 1XNRL 4K6LA 4BY7G 5IP9G 1HHVA 1EY4A 1F9RA 3I7FA 4XT1B 1EQVA 2KECA 2RSNA 3A8IE 2EY6A 1R9TH 5KIXA 3S1MH 4DV7L 4KN7C 5ELFA 1NAPA 4C3IH 5LMNQ 4J6HA 1YEZA 4OGQC 2B2UC 4ZCKA 2NYZD 3X3NA 4Z9CB 5GADC 2WIIB 2KBNA 1GHJA 2VUMB 1UE6A 2F0MA 2FHTA 4FO2A 1QVGA 3PGZA 3RZDH 1DOKA 4OHJA 4DV0Q 4J1MA 1IBKQ 1U4RA 4JI3L 3C3LA 1CTMA 4FYDA 3A8JE 4CKEA 2F4IA 1VQDA 5JJLA 3I4LA 1Z7TA 4I7ZC 1O80A 3H3VC 1WTHA 2ZXOA 2NZHA 5GAHC 2CH4A 1SRUA 3A7AB 1BNZA 4IOAA 2F3IA 4A3DG 4JI8L 2JQOA 3TDQA 2IX1A 3KLWA 4RHSA 4JV5L 1B50A 1IZ6A 4DXGA 5IGGA 1XPOA 4LNQA 4DV2L 4C3HG 3TREA 1A2UA 3SVMA 3GP7A 3K0XA 3RD4A 2Z6KA 1PYSB 4QQBX 2RDGA 1PV4A 5KNDA 4B08A 4DK1A 4POFA 5CV8A 1AP0A 3VR6A 1SYCA 5M3MB 2AUJD 2ICEC 4RGOS 4LF4Q 3VR4A 1E1TA 3KDFA 2PPBC 2E2JH 2A5HA 1WCMG 1AH9A 3GTQB 1JE4A 3X3MA 1FYCA 4DUZQ 3TP5A 1SMYD 1NY4A 5DM73 4IFDJ 2Q8RE 3E5SA 4RCNA 4HJ9A 1TKWB 3QWNA 4JI0L 1PYBA 2WV6D 1SNOA 1YNJD 1STEA 1VQ9A 1HNWQ 3FDTA 3NELA 3CC7A 4JBMA 3A0JA 1AE3A 1L1OC 2KA7A 1OO9B 1F2LA 4WJ4A 1SNMA 5EPKA 1BR9A 3K7AH 5IP7G 4TVAB 3HOUG 2BDNA 2E2HB 1EOTA 2JXMB 2BCOA 2QF7A 3OW7A 4KHZA 4DUZL 2PQAA 1W3SA 3GTGB 1V1QA 3M4YA 2FFKB 4L8JA 1CI3M 1S40A 3HOYB 3S1QH 5FLXc 1ZXTA 2MNAA 2EVBA 5CGKA 1C9OA 1PH1A 4HIDA 1N33L 4JVZA 4GKJQ 2RCNA 4LFBL 1LT4D 4NXNQ 2F0IA 3MVVA 1C8CA 4LK1C 1WTPA 4A3FH 3EFXD 4HCSA 4QGUA 4DV2Q 3DM1A 1F9SA 3RUZA 2K5NA 1MJEA 4C1NI 5LMUL 2F0LA 1EY8A 4ZKBB 1TWGH 1AFPA 4ZAIA 2KENA 4K8IA 1Z6HA 1EL0A 2Q2HA 1P8LA 1XMQQ 2KEDA 3S16H 3CU7A 1STNA 2VXWA 4OWXB 1B70B 4JI5L 1K3RA 1EY7A 4IALA 1DCZA 1E2VA 3V96A 5J22A 2QKIC 1SJHD 2FINB 1STBA 1ML0D 1O7YA 1CKOA 2KQ3A 1OXUA 4OELB 1QILA 2DNCA 2F0EA 1PH2A 2EJFC 1N36Q 4BY1B 1JOQA 4WORA 3BDCA 5F2DA 4DUYL 4IPHA 1UNSA 2LXJA 4X3KA 2RF4A 3M7NA 3U4ZA 1JB7A 3PQIA 1CM9A 5ELBA 1J6QA 1X3FA 3BVMA 2RSOA 1O78A 4MNOA 3NWSA 4IUVA 2ZT9C 2NVYB 4LWCA 2XRSD 4Q0FA 3MWYW 1VQBA 1F9QA 3T1YQ 1X65A 1EEID 1Q7YC 1A2TA 3DWQA 1KDCA 2K32A 4RG1A 3QG1A 5EAYA 1LTGD 1VQ8A 3HOXB 4DV4Q 2YYZA 1PH9A 3P7JA 3DHQA 2EIFA 5M5WH 1A62A 2BH2A 2I46A 4R8NA 5T1IA 2K05A 2QDLA 1WD1A 1OXTA 2A19A 1SFOH 3OMGA 2B39A 4CJ0B 3I73A 5JPNC 1M8AA 5C44B 1PFMA 3T51B 1VQEA 1X54A 1Y69U 3HOWG 2F0WA 1N9WA 4UY8C 2K01A 4LF5Q 2F52A 4BY7B 3HKZE 4DK0A 1ESRA 1M4VA 3KDFB 4RGNA 4DAYB 2QEJC 4RH6A 1WTRA 3EN2A 2R7ZB 1STAA 1G6ZA 2JA7B 2N55A 3PUVA 2DY7A 4AYBE 2KCCA 2L11A 1P16A 1FGBD 1SXTA 2HIXA 1PYWD 3ND8A 2VNUD 4A3IB 4DR3L 4IUNA 1PH7A 1PFNA 1KNEA 4FXKC 1B9MA 1KD1C 4A3GG 1MD2D 1LUZA 2WAQG 2DUDA 3S2HH 2H4OA 4Y7NB 3LGJA 5AJ3Q 3G48A 1NJIC 3GTPH 4A4IA 2VQFL 2E74C 3C1FA 4UAIA 2XRQD 2AHOB 4QIWE 3HRZC 3A7LA 5IE8A 3HKZG 2MP1A 1WFQA 4X62Q 4QY7A 3DEPA 1CUKA 1JICA 4U68A 4JI2Q 1PFSA 3LX0A 5EGTA 1SNCA 3SGIA 3S14H 1G8ZD 2IWHA 1EIFA 1Q46A 1G291 4I65A 2M2LA 2B2VA 4IPDA 4DR4Q 3MXPA 1XXGA 2CCZA 3I4NH 2O2LD 3I8ZA 3PSIA 4A3EH 1J5EL 2IX0A 1JWSD 4JI7L 4H7BA 3J80c 3M3YB 3GTJH 1YHAA 5FJ8G 3AYHB 4HSVA 5C4ZA 4LFAL 4MTNA 3BDLA 5M5YB 3ICEA 1EEFD 2JA8B 4B3MQ 1Y1VB 3PO3G 4GN5A 2JA8G 3E6ZX 4A3JG 1ENCA 1JE5A 3J7A5 4CJ1B 2QGQA 1B4OA 4TQUS 2A6ED 2Z6KC 1SMYC 3S1NB 1NNXA 2CWPA 5D65A 1QZGA 1K73C 1ET9A 1LM0A 4EQPA 1VQ7A 3GTQH 3PUYA 3S17H 2ZXPA 3U50C 1G6PA 3UE0A 3TZDA 4QCLA 3S1RH 4TRDA 1E22A 4ABNA 3JAME 1RL2A 3CCEA 3UDGA 4JI1L 1K3BC 1GXDC 1S5DD 4KTAA 3U9OA 4DV1L 2WB1B 3H0GG 1Q81C 2XSCA 1J8IA 2B2WA 1HQRD 4B9WA 1B2TA 4R4OA 1U9RA 1Q8KA 2JN4A 2NN6G 1SLJA 2VQEL 1TWCH 2K7VA 1PZID 1H9RA 4IFDH 2K33A 3HOVB 3T13A 4BXXG 3TZUA 4LFCL 1FJGL 1X3GA 1YZ6A 2QA4A 3H0GH 1EQRA 4R4CA 4JW0A 3HS0C 5LMNW 1IHZA 1HR0L 4A3LH 4NW2A 2NZOA 2B8GA 4DV7Q 1JOOA 5G3LD 4CDDC 3K81C 4R1JA 4JG2A 4C3HB 2KHJA 1V43A 3ULLA 3D6WA 4QMGA 3NSWA 1J9OA 1YNXA 3F2CA 1IL2A 1SYFA 2K5DA 4C3JH 1VMPA 4O0AA 4JI4L 2UUBL 2IPKD 4F87A 1HRJA 1KTKA 3I4OA 2HQEA 3J80E 4KI0A 1WTOA 3E9IA 4IZ8A 1S5CD 2OCEA 1XNQL 2EYPA 4EVOA 4C1NK 2E2IB 3KYHC 4UP8A 4IFDG 1HNXL 1E2ZA 1SYDA 3S2DH 3D8GA 3NHHA 2CW0D 3A8KE 1E24A 4ILWA 2Y0SG 3CQZB 3KF6A 3N6RA 4HR7B 4WJWA 2OTLA 3S1MB 1JWUD 3T16A 5JEAJ 4FVMA 3MXUA 5I9OA 1EY0A 4KK7A 3PUXA 1K0RA 1VQHA 5HGQA 1WVLA 4GNXB 1N32L 3KK7A 5IGBA 1EYCA 4K14A 2TMPA 5IOCA 3CPFA 3W1GA 4FNFA 3BZCA 3CAMA 1QB5D 1TWFB 2EY2A 3ULJA 4HAEA 3ERSX 4JBJA 1VQKA 3PF5A 4L5RC 3NUCA 1BBXC 3C2PA 2VL6A 3HG9A 3L7ZC 1SNQA 5E3FA 1QZHA 4MN3A 4OWTB 5D3IB 2EY5A 3H3VH 4B3SQ 4GLXA 4LW1A 5CC4A 1V9PA 2D0OA 3PIPA 2HT1A 1HPCA 4RA8A 4BY1G 4DU9A 2VB3X 3I70A 4B3SL 4A3CH 1A3VA 3IL8A 1JOKA 1E1OA 3MXNA 4KHVA 1SNDA 5JJZA 4IO9A 2EZVA 1AZPA 2RCFA 5I9PA 5IYCH 1NSNS 4YY3Q 4NXNL 3DWAA 3NBHB 1SYBA 4YCUA 4RKBA 2PQAB 3BG3A 4A3IH 4N9PA 2IHFA 3M9BA 2XWBB 2FMCA 3HOWH 1YNNC 4HSPA 1HUMA 1I4PA 1TY2A 2LXKA 1WTQA 4EX5A 2CQOA 2NB0A 4P73A 2ZM6Q 5M3FG 2ZTCA 1C7YA 1HJPA 3EQLC 2OT2A 1SSOA 5FK9C 5LL6X 2K4KA 4NB3A 4IOCA 2A68C 3PO2H 1N8RC 5C0XI 4FF2A 4V0BA 4PMBA 3J81j 3M4OH 1EQQA 1HTPA 1VDZA 3S14B 4GKJL 1QUQA 2EE1A 3HEJA 1I6HH 4DR2Q 3DWPA 1UE5A 4ZK9B 5CV4A 1LYLA 3D31A 3FKIB 3MAQA 2AQ1B 5AJ3L 3HP3A 1LTAD 3CW2C 3HZXA 3PO2G 2F0KA 4OONA 1TWHH 1EFID 4KKSA 4DUYQ 3UE1A 5C4XH 3S15H 2YU9B 1VQFA 4RKLA 1KDAA 4A3LG 4A3GB 4DAYA 2UUAL 2QEXA 4BXXH 3Q6SA 1XX8A 1WCMH 1GUNA 3QIAA 1KAWA 2F0JA 3ZYYX 3SDZA 4DA2A 4AYBB 3C1EA 2WKCA 5DM63 1B44D 3J7YW 2UU9Q 1CQVA 1FD7D 2AWOA 3MFGA 3U4VA 4FXDA 4X3SA 3HFZB 1X6OA 4A3BH 5C6AA 1ICFB 3QOJA 2JJQA 1V1PA 2N88A 4N8FA 4GZYC 2ASBA 4DR6Q 1LT3D 1JC7A 4UDUC 1DM0B 1KNAA 1D5XC 4NPSA 5KYLA 3HOZH 5LMUQ 4LF7L 4P72A 4Q5VA 1TS2A 1GUGA 5CORA 3LNNA 1Y1WH 1RCVD 1YHBA 1JQYD 2OXPA 4ZQ3A 4EQ5A 2SNMA 3HOUH 2JE6I 2NVQB 1BCPB 3N52A 1V1OA 1VCIA 1G91A 1LT6D 2R6GA 3W3AA 4HJ8A 4H13C 3SXHA 1MJCA 2AWNA 4A75A 1JMCA 1NCVA 1QCBD 2B2WC 2K04A 2XWJB 3MXGA 4JI4Q 2MUYA 4A3JB 3GD7A 1H9SA 2RHQB 2XN9C 2Z4IA 3OYYA 1SR3A 1TU2B 3TEHB 1V1PB 4DXFA 2A1AA 1II3A 5M3FH 4DR1Q 1BO0A 1I50B 1XPUA 1S5ED 2B2YA 3KF8B 2UUAQ 2Y0SE 4C3JB 3T1HQ 3H91A 5E1FA 3RR5A 4DAPA 4ZUIA 1VQ6A 2NWGA 4BY7H 1IYUA 1PDQA 1Q3LA 4DV3L 2R3ZA 4GOPC 1H9JA 2F0VA 1IBLQ 4FF4A 3SK5A 2BOSA 3A5ZB 4CHTB 4KY6A 3SK6A 4E6IA 5I6WA 5ELOA 4A3MB 1K0SA 1SE3A 2A6HD 2B63B 1ASYA 3P75A 5C5LA 1JWMD 3TQYA 4KJNA 5IYDG 1R4QB 2K5WA 5JOBA 4PZ7A 3CQZH 4OEMB 5IP7H 1QUQB 2XGTA 1ONLA 3JAMc 2ZJPA 4H44C 1EZ6A 2R7ZG 3S2HB 5EPJA 4XXEA 1IBML 1W6KA 3SEBA 1EU3A 1RJTA 1DOLA 4GLAC 5C0XG 4IURA 3RZOH 4B3TL 4B3RL 1EFWA 3IAYA 1VQLA 4K0KQ 4DR3Q 1I4GA 2PYKA 2OQKA 3ONAB 4A3BG 3I55A 4QIWB 1ESFA 1X56A 2IW3A 3FP9A 3D6CA 3QB3A 1I4QA 4HJAA 4OO1I 3CCMA 1EIGA 1CFMA 2VW9A 4HJ7A 2I07B 4TKOB 1Q1EA 3P1HA 2F4VQ 2UXDQ 4OL7A 3EA6A 1TS5A 5ELCA 3DMUA 1SNPA 2Z0SA 2EPBA 4B3TQ 3S9WA 4WJ3M 5K36H 1CKNA 1I3QH 3GTLH 1F2ZA 2K75A 1IXRA 2NVXH 1PZKD 4IFDI 3NQIA 3MFYA 3R3OA 4APVA 5I4DA 2MJ8A 2B2YC 1UE7A 2CVRA 3VYUA 2FMMA 2JEBI 2MO1A 4POGA 4YCWA 1EU4A 3CCJA 1A8VA 4X3TA 4DR5L 2O4XA 3G4SA 4AH6A 4CKCA 4EQNA 3RZDB 3A54A 1S5BD 3KJPA 4KD3A 4MTKA 3H94A 2TSSA 3PIOA 1Q86C 4P75A 3AMUA 1YNND 1YBYA 2DJFC 4GOPA 2MQHA 2MPMA 4JBWA 4RAUC 4EGVA 3RLOA 3CMEA 2O5JC 3MEHA 2EOTA 1VF7A 4JI0Q 2ZJQA 2VZAA 1LT5D 2Z4HA 3HOWB 2B29A 5EKKA 1PMRA 5CV6A 3A56A 1PFBA 3M7GA 1GKHA 5JJKA 4LMQD 3NENA 1K28A 3S1RB 5L37A 3D4WA 2Q2UA 1PRTF 3HKSA 1RF2D 1Q90A 2FXQA 2DN8A 4IUQA 2RDFA 2HUGA 4A3IG 5IIFA 4QL5A 1TWCB 1K83B 4K5XA 3OSOA 4KLKA 1CKNB 2F3WA 4XQQA 4LJZC 3VR3A 4K5WA 3F8TA 1I6HB 1LTBD 1TVXA 3VA7A 4BBSH 4LF5L 2E2JB 3FKIH 2ZM6L 2CFMA 2WB1G 1KDBA 1Y8OB 3H0GB 5M9OA 4GNXC 1WTVA 4AQYL 3KUPA 2RBMA 3TS2A 4OWWB 1VQIA 3DEOA 5CYUA 4C3HH 5ISRA 4PZ6A 3KLSA 4X65L 1EY5A 4UHVA 1TWAH 4N8X1 4DV5Q 4YWKA 1D1IA 4DNTB 1YJWA 3P20A 2B2UA 4ODGA 2HDMA 1H9KA 3FEWX 2K14A 2EYOA 4A3KG 3VR2A 2JA6G 4JBKA 4DF7A 4BBRB 2UUBQ 2JP1A 1TQOA 3NBHA 4DGZA 1U0LA 4NXML 1KHIA 2VQEQ 4DAVA 1EYDA 3E9HA 2OQ0A 1A3UA 3CXCA 1LO5D 1XYIA 3ULPA 1RIPA 3OTOQ 1U4LA 5K5PA 2PW7A 4A3FB 1L0YB 4HTHA 3Q22A 5DLQE 5GAEC 2AQ3B 1PTOD 3DUZA 3BVZA 2RKSA 1MGSA 1DGSA 1JJCB 3WOFA 2A8VA 3J81L 3CC2A 2E2DC 2SDFA 2JYOA 4JI5Q 1EQTA 3JAML 2DJGC 4GN4B 3SK8A 4IJLA 2AQ2B 4ME5A 1C48A 1UUPA 1XTCD 1BVSA 3EIVA 1PLFA 4JOIC 1EWIA 2UUCQ 1QVFA 2L9HA 5CBEE 4K2KA 1HH2P 3GV6A 4RCOA 1N36L 2Z1CA 5JVG3 3I4MH 1EIHA 5JEAH 1HA5A 4GOPB 4KKTA 1TIID 4JYAQ 5FO7B 4GNXA 1PRTD 4BY1H 3CP0A 4OIKA 2EYFA 2PI2E 1G2SA 4FDBA 4RHRA 1KRTA 4C3IB 5D3DA 4MZ9A 5A35A 3EBEA 1NE3A 3J7AV 1B3AA 2ES2A 1X3PA 4RGMA 4YHHQ 2EDGA 2F0HA 1Y14B 2Z6BA 2I0QA 4DAMA 3H15A 3CMAA 4LF9L 1I6VC 5JJIA 4G7ZC 1HA6A 1T5XD 4ALPA 2SEBD 2G9HD 2V4DA 4XYQA 4X3UA 4J8QA 4F8MA 5CBAE 2R92H 1U4PA 1H9MA 5C4JH 4DFAA 1PHJA 4DR7L 1IKLA 3TS0A 3GTKH 2J0TD 5IWAQ 3CCUA 1L2FA 4A3FG 1B3QA 3E0JA 4IUPA 3K80C 4ZYSA 4LF4L 3RZOB 1QWYA 2F3VA 1HR0W 1EZ8A 4DR1L 2R7ZH 4L5SA 2GVAA 2CH4W 1LTSD 3OOCA 3AFPA 4PQXA 5KRUA 1NR2A 2J7ZA 1GVPA 2Y0SB 1M1KC 3K5OA 3V05A 5M5XB 1TR5A 4I7AA 1HNZL 3PIP3 4R8IA 4AYBG 3TRZA 2IL8A 1D7QA 2NTTA 1B53A 1CZGA 2CW0C 1I3QB 3ERQA 5EKIA 3GTLB 1L1OA 3CRKC 4JC0A 2WKDA 1TWHB 4K6DA 2O5IC 3CPWA 1CSPA 2UXCL 2Q2TA 1GO3E 5C3EG 4B9XA 2JA5H 3KLSX 1SE2A 4HEDA 3M4QA 3D3RA 1G51A 1VQCA 4N9TA 3TSSA 3G71A 2UXBQ 5E4XA 3WWVA 3FKIG 4DV4L 4KY7A 3BZDB 3NK9A 3JC66 2E2HH 1WOCA 4P71A 2M00A 3AU7A 5CMDA 4R4TA 2ZJRA 2M9VA 3T56B 4A3BB 3ZJYC 1B1ZA 4PMCA 4CJ2C 2UXCQ 2PZWA 1GUOA 3CCLA 1J5EQ 1C4QA 5EQ0A 3F2DA 4NDXA 1Y1VG 4XQNA 4LFCQ 1FJGQ 2KOLA 1BBUA 1E0BA 3HOZB 1HNZQ 3SR1A 1TXYA 4V190 2F0UA 3IKJA 1ILPA 2K52A 4KHPQ 4AIMA 5IODA 5M5YH 1MIUA 2E5LQ 1SN8A 3HOUB 5E7NA 1GUWA 2LS01 2ICIA 4EQOA 5TSSA 1MI2A 4KN4C 1TWGB 1D8LA 5DAUA 2K1BA 3G6JB 4C3JG 3FHWA 4FXGC 5FJ8H 1XMOL 1O7LA 3A5UA 2KCMA 4M8AA 2R93G 1PTOB 4DNIA 4F7XA 3VYSA 1WTWA 3J7AF 2Z9HA 3W1BA 2XIWA 1D5ZC 1ET6A 2JA6B 1CHQD 4JI6Q 4L63B 3BJUA 1V8QA 3TBIB 2X6GA 1IW7D 4P74A 4LFAQ 1JORA 2EXDA 1MHWC 3FPPA 3K5LA 1RD9D 1VQGA 2NN6H 2YTXA 1XTDA 3GTGH 1HXYD 2NVYH 4S3SA 3PUZA 3RLFA 2N8NA 3F2BA 2L15A 5C3EH 2JA5G 3M85A 3BS1A 4X64Q 1X32A 3HOXH 1PTOC 3K8AA 2QDBA 1NR4A 5DNFA 3K7UC 1NUCA 2NTSA 3J80i 2B2VC 3D4DA 4OO1H 1SFOB 2KHIA 3IRBA 3MZ5A 2EYHA 1CA6A 2ENBA 4BA2I 2QW7A 2X6LA 3I72A 1Y1WG 3C46A 4C2MH 2H5XA 2A68D 3T53B 1OXVA 2DY8A 1NTGA 5CV7A 4LUOA 5KNCA 2EYMA 1CK1A 2XNAC 2F0SA 1WYDA 1BDOA 1H9SB 1EUJA 2UXDL 1Q1BA 1PRTC 4LF8L 1SROA 2RDHA 4RGTA 1ICWA 1XNRQ 4GS3A 4JI1Q 1RTNA 1WJJA 1YIJA 2HQLA 3OTOL 1CA5A 1DD2A 3EVQA 4PG3A 3VYRA 1I94Q 2EYJA 4JV5Q 4OIJA 3VA5A 3Q0AA 4HIKA 4DK3C 2B63G 1N32Q 2PW5A 1DYQA 3O13A 3KF8A 1SDFA 5C5MA 2JSOA 1Q8IA 4ZLTF 5ELEA 4IN3A 2VS1A 3KJOA 2PQEA 1S72A 2NVTB 1OXSC 3G7LA 5IT9E
chains in the Genus database with same CATH topology
2PMZE 1X56A 3FP9A 4HJAA 4A3DH 1E3PA 4OO1I 3CCMA 3AQQA 1LTLA 3PUVA 2B3GA 4YY3L 2VW9A 2B63H 4AYBE 3MEFA 4X65Q 3I4NG 4HJ7A 1P16A 1HNXQ 1Q1EA 4DKAC 2HIXA 2WAQE 3E0EA 2F4VQ 2VNUD 2UXDQ 4GKKQ 4A3KH 3B6YA 4XIGS 4DR3L 1PH7A 4L5TA 1JJGA 2Z0SA 2HHHQ 2E8GA 2DGYA 1KXLA 1KQSA 4B3TQ 1KD1C 3UDFA 5C44H 2WAQG 1LUZA 4A3GG 1CKNA 2DUDA 1I3QH 3GTLH 3S2HH 3LGJA 2K75A 1IXRA 2NVXH 4IFDI 1BKBA 1YHQA 5AJ3Q 4APVA 4YWLA 1L1OB 3G48A 1NJIC 3GTPH 1UE7A 4IJHA 1Q82C 2JEBI 2CKZB 2MO1A 4A4IA 1YI2A 2VQFL 4POGA 4YCWA 1IBKL 3S24A 3CCJA 5C4XG 1A8VA 2AHOB 4QIWE 3UDXA 4DV1Q 4DR5L 3G4SA 4BBRG 4DK6C 4AH6A 1HNWL 1Y1VH 5IE8A 3KJPA 1EIYB 2UXCL 3HKZG 4X62Q 1WFQA 2E5LL 2JA7H 3PIOA 3DM3A 4P75A 1HZBA 4QY7A 1Q86C 1ASZA 3HOYG 1CUKA 1YBYA 4GOPA 2MQHA 4JI2Q 1PFSA 5M5XH 4JBWA 5GROA 3RLOA 3SGIA 3CMEA 1VQ5A 1VQNA 2R92G 3S14H 2GVBA 2I5LX 4JI0Q 2ZJQA 1FL0A 1EIFA 1Q46A 2VZAA 4GLVB 5M3MH 3J7ZC 1PH5A 1G291 4NXMQ 2B29A 4LUVA 4IPDA 4DV3Q 2GN5A 4BA1I 5JEAG 2CCZA 3I4NH 4DR4Q 1GKHA 3PSIA 5JJKA 4HIOA 4Y7NH 4LUZA 3NENA 2JEAI 4A3EH 1J5EL 2IX0A 4JI7L 3J80c 2K50A 1UWVA 2VY3A 5GQOA 2K5VA 4GKKL 3GTJH 2AMCB 1YHAA 1KRSA 5FJ8G 2Q2UA 4O2DA 3STBC 4OXPA 1KIXA 3AYHB 4LFAL 3HKSA 2UXBL 5GAGC 4MTNA 1OTCA 3ICEA 2FXQA 2ZTEA 4B3MQ 1QVCA 4JYAL 3PO3G 4QQBX 2LSSA 4GN5A 2JA8G 2KCTA 4A3IG 4QL5A 4A3JG 1JE5A 3J7A5 4KLKA 4LFBQ 1CKNB 3GDEA 2QGQA 4BBRH 1L0WA 4HJ5A 4TQUS 2Z6KC 1PH8A 3F8TA 1VQAA 3GTMH 2CWPA 2C35B 1XNQQ 4LF5L 1QZGA 3HOYH 2JK8A 3FKIH 1K73C 4BBSH 2ZM6L 1LM0A 3GTQH 1VQ7A 4DR6L 3PUYA 2CFMA 5IWAL 3S17H 2WB1G 1XMOQ 1VQ4A 4GNXC 4AQYL 2R7DA 3U50C 1G6PA 3UE0A 3TS2A 2NN6I 4OWWB 1VQIA 3PF4A 4C3HH 4YCVA 4PZ6A 3MXNB 1FVIA 1VS0A 3S1RH 4X65L 3M3YH 1E22A 3CCEA 1RL2A 1TWAH 1HZAA 1W2BA 3UDGA 4JI1L 4DV5Q 4YWKA 2MO0A 4JCVE 1YJWA 4DV1L 1UEBA 1NMGA 4IPCA 3STBD 1PH3A 3H0GG 1Q81C 1SE8A 1S3OA 3M4PA 4JOIA 4LF6L 3CCVA 3I2ZA 2IX1A 2JA8H 1PVOA 4R4OA 4H02A 1Q8KA 2K14A 2BH8A 2NN6G 1SLJA 4A3KG 2YTYA 2Q2IA 2VQEL 4LF9Q 2JA6G 1TWCH 3AFQA 4JBKA 3T1YL 1IBLL 2ID0A 4HIMA 1HR0Q 2UUBQ 1K8GA 4R4QA 1XMQL 3DLLA 4BXXG 1U0LA 4LFCL 1FJGL 2V1CC 1X3GA 1KHIA 1YZ6A 4A3JH 3J81i 2VQEQ 2E2IH 4NXML 2QA4A 2IHEA 3E9HA 2OQ0A 3T1HL 3H0GH 1EQRA 4R4CA 3CF5A 5LMNW 1HR0L 3GTOH 2UU9L 3CXCA 4A3LH 2NZOA 5BR8L 4DV7Q 3ULPA 1RIPA 3CCSA 3PCOB 3K81C 4R1JA 4JG2A 4BBSG 3OTOQ 2JA6H 1K9MC 2KHJA 1O7IA 1V43A 3HOVG 3ULLA 2WP8J 2I5HA 1VQMA 4QJFA 5J3BA 5DLQE 5GAEC 4R4IA 1YNXA 3F2CA 3KOJA 1IL2A 2A8VA 1DGSA 1JJCB 3U58A 3CC2A 4C3JH 4O0AA 5M3MG 3G6EA 3CCRA 4JI5Q 4JI4L 4X6AH 2UUBL 5H1SE 4GN4B 3KF6B 4IJLA 4KHPQ 3I4OA 1CKMA 1B8AA 3I56A 3OW2A 1GM5A 1CSQA 1BVSA 4KI0A 3EIVA 3HOVH 3E9IA 4JOIC 4DR2L 2OCEA 4PZ8A 1XNQL 3H3VI 3KFUA 1EWIA 3HOZG 2JA9A 5FLMG 2UUCQ 1QVFA 2VUMG 3KYHC 1MKHA 1N34Q 1HH2P 4UP8A 4IFDG 1HNXL 4IPGA 1N36L 4A3MH 3HOXG 4JI3Q 3S2DH 3I4MH 1WI5A 2OTJA 1A0IA 1T9HA 4JI6L 2RHSB 1N34L 4GOPB 4LF8Q 4B3ML 4JYAQ 1E24A 4GNXA 2Y0SG 3KF6A 1EOVA 3Q8DA 4BY1H 2OTLA 3PO3H 3CP0A 4K0KL 4A93G 4X64L 2PI2E 3L0OA 4FDBA 1KRTA 5JEAJ 4MZ9A 1E7ZA 3CD6A 1A63A 2IY5B 3EBEA 1NE3A 3PUXA 2ES2A 1K0RA 4A3MG 1VQHA 5HGQA 1IBMQ 4GNXB 3PUWA 4JI7Q 1N32L 4DR7Q 1Z47A 2ALYB 1JJ2A 3I4MG 1XJVA 4YHHQ 4A3CG 1Y14B 5LMNL 3PO2H 2I0QA 4DAMA 2IT1A 4PMWA 1OXXK 3RN5A 5FLMH 2BA0A 3H15A 3CMAA 2YTVA 3CPFA 4X66Q 3W1GA 4LF9L 2N3SA 1PH4A 3BZCA 3L2PA 3CAMA 2I5MX 5JJIA 1XNRL 4BY7G 5IP9G 2MFIA 3ULJA 5BR8Q 3ERSX 4JBJA 4ALPA 3PF5A 1VQKA 3I7FA 4L5RC 4LF7Q 1SMXA 2VL6A 2XTIA 3PV0A 3L7ZC 1R9TH 4RMFA 1QZHA 3NEMA 3S1MH 4DV7L 4OWTB 2VQFQ 1PH6A 2R92H 5C4JH 3H3VH 4B3SQ 2AKWB 4C3IH 5LMNQ 5HY6A 4GLXA 4LW1A 1YEZA 2ZTDA 1PHJA 1V9PA 2D0OA 3PIPA 4JI8Q 2HT1A 2JA7G 4DR7L 3D0FA 3TS0A 3GTKH 4BY1G 5IWAQ 3CCUA 1L2FA 2PI2A 4A76A 4A3FG 5GADC 3K80C 4DPGA 2KBNA 4B3SL 4LF4L 4A3CH 1HR0W 1E1OA 1UE6A 4A3EG 4DR1L 1QVGA 2R7ZH 4L5SA 2GVAA 2NVTH 4UP7A 3AFPA 3PGZA 3A74A 1YJ9A 1Q12A 4UP9A 4IO9A 3RZDH 4DV0Q 1GVPA 5IYCH 4JI3L 2WB1E 2YV5A 1IBKQ 3AEVA 4YY3Q 1M1KC 4L5QA 4NXNL 3NBHB 4YCUA 1VQDA 2PQAB 4B3RQ 5JJLA 1HNZL 4A3IH 4AYBG 2NZHA 2IHFA 3M9BA 5GAHC 3TRZA 1D7QA 1SRUA 3HOWH 4J15A 4IOAA 2LXKA 2F3IA 1L1OA 4A3DG 4JI8L 4JC0A 2JQOA 4EX5A 2CQOA 4P73A 3KLWA 5ELNA 2ZM6Q 3CPWA 5M3FG 5IYCG 1M90C 1CSPA 2ZTCA 1C7YA 1IZ6A 1GO3E 5C3EG 4GN3B 2JA5H 1HJPA 4YWMA 2Q2TA 2YU9H 1XPOA 3M4QA 2VUMH 4LNQA 1G51A 2K4KA 4DV2L 1VQCA 3TREA 3UDIA 3G71A 2UXBQ 5IY0A 3K0XA 3WWVA 2R7FA 3FKIG 2Z6KA 4DV4L 4KHPL 4NB3A 4IOCA 1PYSB 2PNHA 4ME3A 3JC66 5C0XI 1N8RC 1PV4A 2E2HH 1WOCA 2K5HA 4P71A 3W5OA 3J81j 3M4OH 4POFA 1NBWA 1EQQA 3RLNA 4R4TA 4GKJL 1QUQA 4A93H 2ZJRA 1GD7A 3ZJYC 5C44G 4LF4Q 2UXCQ 1I6HH 3S1NH 4DR2Q 1E1TA 3KDFA 1J5EQ 3CCLA 1UE5A 1LYLA 2WFWA 2E2JH 3D31A 1WCMG 3F2DA 1U5KA 1Y1VG 1AH9A 4LFCQ 1FJGQ 5AJ3L 4WJ3M 3CW2C 3PO2G 1VQJA 4DUZQ 1BBUA 5IYDH 4IFDJ 1NY4A 4OONA 1TWHH 4DUYQ 4JI2L 3UE1A 5C4XH 4HJ9A 1HNZQ 3CC4A 3S15H 1VQFA 4JI0L 1TXYA 4A3LG 1PYBA 1B7YB 1HNWQ 1VQ9A 2UUAL 2K52A 2F4VL 3NELA 3CC7A 4AIMA 4JBMA 3A0JA 1AE3A 1L1OC 5M5YH 2QEXA 4BXXH 1MIUA 2E5LQ 1SN8A 1WCMH 4WJ4A 4Y52H 5IP7G 1KAWA 3K7AH 5E7NA 1HZ9A 4TVAB 3J81c 2NVQH 3HOUG 1BBWA 1K83H 2ATWA 5C0XJ 2UU9Q 4KHZA 4OX9Q 1D8LA 4DUZL 2PQAA 1W3SA 3FHWA 2AWOA 3U4VA 5FJ8H 1Z9FA 3BZKA 3HFZB 1V1QA 1X6OA 4AQYQ 1XMOL 1EYGA 4A3BH 3F1ZA 3A5UA 2KCMA 2R93G 2JJQA 1S40A 5IP9H 1YITA 3S1QH 2ASBA 4DNIA 5FLXc 3ER0A 5IYBH 2OWOA 4DR6Q 1IYJB 2MNAA 1C9OA 1PH1A 4HIDA 1N33L 4GKJQ 1C0AA 2RCNA 4LFBL 4NPSA 2HHHL 5K36G 3HOZH 3W1BA 3CCQA 5LMUQ 4NXNQ 4LF7L 4P72A 1FGUA 4LF6Q 4A3GH 4DV0L 1NMFA 1Y1WH 4A3FH 4JI6Q 2R93H 5IT9c 1YHBA 3BJUA 4QGUA 2D0PA 4DV2Q 4X66L 4P74A 4EQ5A 4LFAQ 3HOUH 2EXDA 2JE6I 2D62A 2K5NA 1MJEA 1VQGA 5LMUL 2YTXA 1VCIA 1KC8C 1TWGH 2R6GA 4HJ8A 1XTDA 2KENA 3GTGH 1X3EA 2NVYH 2Q2HA 1MJCA 2AWNA 4A75A 1P8LA 3PUZA 3RLFA 1XMQQ 1JMCA 1AE2A 4DV6L 3S16H 2N8NA 4JI4Q 2CWAA 3F2BA 1VQPA 3GD7A 4OWXB 1B70B 4JI5L 2L15A 1K3RA 5C3EH 2JA5G 3BU2A 2RHQB 3M85A 3OYYA 4X64Q 2N49A 4XTCS 3HOXH 1SR3A 1I94L 3TEHB 3K8AA 1I5FA 5IYBG 3K7UC 2A1AA 3J80i 1KL9A 1CKOA 5M3FH 1OXUA 1XPRA 3GO5A 1HZCA 4X62L 4DR1Q 1PH2A 1N36Q 2KHIA 3IRBA 1N33Q 1XPUA 3KF8B 2UUAQ 4DUYL 4IPHA 2Y0SE 3T1HQ 2LXJA 1PA6A 2RF4A 3M7NA 4UPAA 3U4ZA 1JB7A 3RR5A 4BA2I 4JV5L 1J6QA 1X3FA 1Y1WG 1VQ6A 4BY7H 4C2MH 4MNOA 2H5XA 1OXVA 4DV3L 1NTGA 4OX9L 4DR4L 4LUOA 4LWCA 2HIVA 1VQBA 4GOPC 3T1YQ 1IBLQ 1X65A 3RNUA 1WYDA 3A5ZB 1Q7YC 1EUJA 2UXDL 2N78A 1X55A 4RG1A 1Q1BA 5EAYA 5ELOA 4LF8L 1SROA 1VQ8A 4DV4Q 2YYZA 1ASYA 3RN2A 1PH9A 1K8AC 1XNRQ 4GS3A 1TWFH 2EIFA 1WJJA 4JI1Q 5M5WH 1A62A 2HQLA 3TQYA 4DV5L 1YIJA 1YVCA 5IYDG 3OTOL 2BH2A 4PZ7A 3CQZH 5IP7H 1QUQB 2BA1A 4DR5Q 1OXTA 2A19A 2XGTA 2UUCL 3JAMc 1YJNA 1SFOH 2ZJPA 4PG3A 1I94Q 1I50H 4JV5Q 4DV6Q 4YHHL 2R7ZG 3VDYA 1VQOA 1X9NA 1VQEA 1X54A 4HIKA 1IBML 4OO1G 4DK3C 3HOWG 2B63G 1N32Q 1N9WA 4UY8C 4GLAC 4LF5Q 5C0XG 2F52A 1UE1A 3HKZE 3RZOH 3JAMi 4B3TL 2EQSA 4B3RL 1EFWA 1VQLA 3KDFB 4DAYB 4DR3Q 2VS1A 2OQKA 3KJOA 4K0KQ 1JT8A 1S72A 3EN2A 1H95A 1OXSC 4A3BG 3I55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ E;  1X56 A;  3FP9 A;  4HJA A;  4A3D H;  1E3P A;  4OO1 I;  3CCM A;  3AQQ A;  1LTL A;  3PUV A;  2B3G A;  4YY3 L;  2VW9 A;  2B63 H;  4AYB E;  3MEF A;  4X65 Q;  3I4N G;  4HJ7 A;  1P16 A;  1HNX Q;  1Q1E A;  4DKA C;  2HIX A;  2WAQ E;  3E0E A;  2F4V Q;  2VNU D;  2UXD Q;  4GKK Q;  4A3K H;  3B6Y A;  4XIG S;  4DR3 L;  1PH7 A;  4L5T A;  1JJG A;  2Z0S A;  2HHH Q;  2E8G A;  2DGY A;  1KXL A;  1KQS A;  4B3T Q;  1KD1 C;  3UDF A;  5C44 H;  2WAQ G;  1LUZ A;  4A3G G;  1CKN A;  2DUD A;  1I3Q H;  3GTL H;  3S2H H;  3LGJ A;  2K75 A;  1IXR A;  2NVX H;  4IFD I;  1BKB A;  1YHQ A;  5AJ3 Q;  4APV A;  4YWL A;  1L1O B;  3G48 A;  1NJI C;  3GTP H;  1UE7 A;  4IJH A;  1Q82 C;  2JEB I;  2CKZ B;  2MO1 A;  4A4I A;  1YI2 A;  2VQF L;  4POG A;  4YCW A;  1IBK L;  3S24 A;  3CCJ A;  5C4X G;  1A8V A;  2AHO B;  4QIW E;  3UDX A;  4DV1 Q;  4DR5 L;  3G4S A;  4BBR G;  4DK6 C;  4AH6 A;  1HNW L;  1Y1V H;  5IE8 A;  3KJP A;  1EIY B;  2UXC L;  3HKZ G;  4X62 Q;  1WFQ A;  2E5L L;  2JA7 H;  3PIO A;  3DM3 A;  4P75 A;  1HZB A;  4QY7 A;  1Q86 C;  1ASZ A;  3HOY G;  1CUK A;  1YBY A;  4GOP A;  2MQH A;  4JI2 Q;  1PFS A;  5M5X H;  4JBW A;  5GRO A;  3RLO A;  3SGI A;  3CME A;  1VQ5 A;  1VQN A;  2R92 G;  3S14 H;  2GVB A;  2I5L X;  4JI0 Q;  2ZJQ A;  1FL0 A;  1EIF A;  1Q46 A;  2VZA A;  4GLV B;  5M3M H;  3J7Z C;  1PH5 A;  1G29 1;  4NXM Q;  2B29 A;  4LUV A;  4IPD A;  4DV3 Q;  2GN5 A;  4BA1 I;  5JEA G;  2CCZ A;  3I4N H;  4DR4 Q;  1GKH A;  3PSI A;  5JJK A;  4HIO A;  4Y7N H;  4LUZ A;  3NEN A;  2JEA I;  4A3E H;  1J5E L;  2IX0 A;  4JI7 L;  3J80 c;  2K50 A;  1UWV A;  2VY3 A;  5GQO A;  2K5V A;  4GKK L;  3GTJ H;  2AMC B;  1YHA A;  1KRS A;  5FJ8 G;  2Q2U A;  4O2D A;  3STB C;  4OXP A;  1KIX A;  3AYH B;  4LFA L;  3HKS A;  2UXB L;  5GAG C;  4MTN A;  1OTC A;  3ICE A;  2FXQ A;  2ZTE A;  4B3M Q;  1QVC A;  4JYA L;  3PO3 G;  4QQB X;  2LSS A;  4GN5 A;  2JA8 G;  2KCT A;  4A3I G;  4QL5 A;  4A3J G;  1JE5 A;  3J7A 5;  4KLK A;  4LFB Q;  1CKN B;  3GDE A;  2QGQ A;  4BBR H;  1L0W A;  4HJ5 A;  4TQU S;  2Z6K C;  1PH8 A;  3F8T A;  1VQA A;  3GTM H;  2CWP A;  2C35 B;  1XNQ Q;  4LF5 L;  1QZG A;  3HOY H;  2JK8 A;  3FKI H;  1K73 C;  4BBS H;  2ZM6 L;  1LM0 A;  3GTQ H;  1VQ7 A;  4DR6 L;  3PUY A;  2CFM A;  5IWA L;  3S17 H;  2WB1 G;  1XMO Q;  1VQ4 A;  4GNX C;  4AQY L;  2R7D A;  3U50 C;  1G6P A;  3UE0 A;  3TS2 A;  2NN6 I;  4OWW B;  1VQI A;  3PF4 A;  4C3H H;  4YCV A;  4PZ6 A;  3MXN B;  1FVI A;  1VS0 A;  3S1R H;  4X65 L;  3M3Y H;  1E22 A;  3CCE A;  1RL2 A;  1TWA H;  1HZA A;  1W2B A;  3UDG A;  4JI1 L;  4DV5 Q;  4YWK A;  2MO0 A;  4JCV E;  1YJW A;  4DV1 L;  1UEB A;  1NMG A;  4IPC A;  3STB D;  1PH3 A;  3H0G G;  1Q81 C;  1SE8 A;  1S3O A;  3M4P A;  4JOI A;  4LF6 L;  3CCV A;  3I2Z A;  2IX1 A;  2JA8 H;  1PVO A;  4R4O A;  4H02 A;  1Q8K A;  2K14 A;  2BH8 A;  2NN6 G;  1SLJ A;  4A3K G;  2YTY A;  2Q2I A;  2VQE L;  4LF9 Q;  2JA6 G;  1TWC H;  3AFQ A;  4JBK A;  3T1Y L;  1IBL L;  2ID0 A;  4HIM A;  1HR0 Q;  2UUB Q;  1K8G A;  4R4Q A;  1XMQ L;  3DLL A;  4BXX G;  1U0L A;  4LFC L;  1FJG L;  2V1C C;  1X3G A;  1KHI A;  1YZ6 A;  4A3J H;  3J81 i;  2VQE Q;  2E2I H;  4NXM L;  2QA4 A;  2IHE A;  3E9H A;  2OQ0 A;  3T1H L;  3H0G H;  1EQR A;  4R4C A;  3CF5 A;  5LMN W;  1HR0 L;  3GTO H;  2UU9 L;  3CXC A;  4A3L H;  2NZO A;  5BR8 L;  4DV7 Q;  3ULP A;  1RIP A;  3CCS A;  3PCO B;  3K81 C;  4R1J A;  4JG2 A;  4BBS G;  3OTO Q;  2JA6 H;  1K9M C;  2KHJ A;  1O7I A;  1V43 A;  3HOV G;  3ULL A;  2WP8 J;  2I5H A;  1VQM A;  4QJF A;  5J3B A;  5DLQ E;  5GAE C;  4R4I A;  1YNX A;  3F2C A;  3KOJ A;  1IL2 A;  2A8V A;  1DGS A;  1JJC B;  3U58 A;  3CC2 A;  4C3J H;  4O0A A;  5M3M G;  3G6E A;  3CCR A;  4JI5 Q;  4JI4 L;  4X6A H;  2UUB L;  5H1S E;  4GN4 B;  3KF6 B;  4IJL A;  4KHP Q;  3I4O A;  1CKM A;  1B8A A;  3I56 A;  3OW2 A;  1GM5 A;  1CSQ A;  1BVS A;  4KI0 A;  3EIV A;  3HOV H;  3E9I A;  4JOI C;  4DR2 L;  2OCE A;  4PZ8 A;  1XNQ L;  3H3V I;  3KFU A;  1EWI A;  3HOZ G;  2JA9 A;  5FLM G;  2UUC Q;  1QVF A;  2VUM G;  3KYH C;  1MKH A;  1N34 Q;  1HH2 P;  4UP8 A;  4IFD G;  1HNX L;  4IPG A;  1N36 L;  4A3M H;  3HOX G;  4JI3 Q;  3S2D H;  3I4M H;  1WI5 A;  2OTJ A;  1A0I A;  1T9H A;  4JI6 L;  2RHS B;  1N34 L;  4GOP B;  4LF8 Q;  4B3M L;  4JYA Q;  1E24 A;  4GNX A;  2Y0S G;  3KF6 A;  1EOV A;  3Q8D A;  4BY1 H;  2OTL A;  3PO3 H;  3CP0 A;  4K0K L;  4A93 G;  4X64 L;  2PI2 E;  3L0O A;  4FDB A;  1KRT A;  5JEA J;  4MZ9 A;  1E7Z A;  3CD6 A;  1A63 A;  2IY5 B;  3EBE A;  1NE3 A;  3PUX A;  2ES2 A;  1K0R A;  4A3M G;  1VQH A;  5HGQ A;  1IBM Q;  4GNX B;  3PUW A;  4JI7 Q;  1N32 L;  4DR7 Q;  1Z47 A;  2ALY B;  1JJ2 A;  3I4M G;  1XJV A;  4YHH Q;  4A3C G;  1Y14 B;  5LMN L;  3PO2 H;  2I0Q A;  4DAM A;  2IT1 A;  4PMW A;  1OXX K;  3RN5 A;  5FLM H;  2BA0 A;  3H15 A;  3CMA A;  2YTV A;  3CPF A;  4X66 Q;  3W1G A;  4LF9 L;  2N3S A;  1PH4 A;  3BZC A;  3L2P A;  3CAM A;  2I5M X;  5JJI A;  1XNR L;  4BY7 G;  5IP9 G;  2MFI A;  3ULJ A;  5BR8 Q;  3ERS X;  4JBJ A;  4ALP A;  3PF5 A;  1VQK A;  3I7F A;  4L5R C;  4LF7 Q;  1SMX A;  2VL6 A;  2XTI A;  3PV0 A;  3L7Z C;  1R9T H;  4RMF A;  1QZH A;  3NEM A;  3S1M H;  4DV7 L;  4OWT B;  2VQF Q;  1PH6 A;  2R92 H;  5C4J H;  3H3V H;  4B3S Q;  2AKW B;  4C3I H;  5LMN Q;  5HY6 A;  4GLX A;  4LW1 A;  1YEZ A;  2ZTD A;  1PHJ A;  1V9P A;  2D0O A;  3PIP A;  4JI8 Q;  2HT1 A;  2JA7 G;  4DR7 L;  3D0F A;  3TS0 A;  3GTK H;  4BY1 G;  5IWA Q;  3CCU A;  1L2F A;  2PI2 A;  4A76 A;  4A3F G;  5GAD C;  3K80 C;  4DPG A;  2KBN A;  4B3S L;  4LF4 L;  4A3C H;  1HR0 W;  1E1O A;  1UE6 A;  4A3E G;  4DR1 L;  1QVG A;  2R7Z H;  4L5S A;  2GVA A;  2NVT H;  4UP7 A;  3AFP A;  3PGZ A;  3A74 A;  1YJ9 A;  1Q12 A;  4UP9 A;  4IO9 A;  3RZD H;  4DV0 Q;  1GVP A;  5IYC H;  4JI3 L;  2WB1 E;  2YV5 A;  1IBK Q;  3AEV A;  4YY3 Q;  1M1K C;  4L5Q A;  4NXN L;  3NBH B;  4YCU A;  1VQD A;  2PQA B;  4B3R Q;  5JJL A;  1HNZ L;  4A3I H;  4AYB G;  2NZH A;  2IHF A;  3M9B A;  5GAH C;  3TRZ A;  1D7Q A;  1SRU A;  3HOW H;  4J15 A;  4IOA A;  2LXK A;  2F3I A;  1L1O A;  4A3D G;  4JI8 L;  4JC0 A;  2JQO A;  4EX5 A;  2CQO A;  4P73 A;  3KLW A;  5ELN A;  2ZM6 Q;  3CPW A;  5M3F G;  5IYC G;  1M90 C;  1CSP A;  2ZTC A;  1C7Y A;  1IZ6 A;  1GO3 E;  5C3E G;  4GN3 B;  2JA5 H;  1HJP A;  4YWM A;  2Q2T A;  2YU9 H;  1XPO A;  3M4Q A;  2VUM H;  4LNQ A;  1G51 A;  2K4K A;  4DV2 L;  1VQC A;  3TRE A;  3UDI A;  3G71 A;  2UXB Q;  5IY0 A;  3K0X A;  3WWV A;  2R7F A;  3FKI G;  2Z6K A;  4DV4 L;  4KHP L;  4NB3 A;  4IOC A;  1PYS B;  2PNH A;  4ME3 A;  3JC6 6;  5C0X I;  1N8R C;  1PV4 A;  2E2H H;  1WOC A;  2K5H A;  4P71 A;  3W5O A;  3J81 j;  3M4O H;  4POF A;  1NBW A;  1EQQ A;  3RLN A;  4R4T A;  4GKJ L;  1QUQ A;  4A93 H;  2ZJR A;  1GD7 A;  3ZJY C;  5C44 G;  4LF4 Q;  2UXC Q;  1I6H H;  3S1N H;  4DR2 Q;  1E1T A;  3KDF A;  1J5E Q;  3CCL A;  1UE5 A;  1LYL A;  2WFW A;  2E2J H;  3D31 A;  1WCM G;  3F2D A;  1U5K A;  1Y1V G;  1AH9 A;  4LFC Q;  1FJG Q;  5AJ3 L;  4WJ3 M;  3CW2 C;  3PO2 G;  1VQJ A;  4DUZ Q;  1BBU A;  5IYD H;  4IFD J;  1NY4 A;  4OON A;  1TWH H;  4DUY Q;  4JI2 L;  3UE1 A;  5C4X H;  4HJ9 A;  1HNZ Q;  3CC4 A;  3S15 H;  1VQF A;  4JI0 L;  1TXY A;  4A3L G;  1PYB A;  1B7Y B;  1HNW Q;  1VQ9 A;  2UUA L;  2K52 A;  2F4V L;  3NEL A;  3CC7 A;  4AIM A;  4JBM A;  3A0J A;  1AE3 A;  1L1O C;  5M5Y H;  2QEX A;  4BXX H;  1MIU A;  2E5L Q;  1SN8 A;  1WCM H;  4WJ4 A;  4Y52 H;  5IP7 G;  1KAW A;  3K7A H;  5E7N A;  1HZ9 A;  4TVA B;  3J81 c;  2NVQ H;  3HOU G;  1BBW A;  1K83 H;  2ATW A;  5C0X J;  2UU9 Q;  4KHZ A;  4OX9 Q;  1D8L A;  4DUZ L;  2PQA A;  1W3S A;  3FHW A;  2AWO A;  3U4V A;  5FJ8 H;  1Z9F A;  3BZK A;  3HFZ B;  1V1Q A;  1X6O A;  4AQY Q;  1XMO L;  1EYG A;  4A3B H;  3F1Z A;  3A5U A;  2KCM A;  2R93 G;  2JJQ A;  1S40 A;  5IP9 H;  1YIT A;  3S1Q H;  2ASB A;  4DNI A;  5FLX c;  3ER0 A;  5IYB H;  2OWO A;  4DR6 Q;  1IYJ B;  2MNA A;  1C9O A;  1PH1 A;  4HID A;  1N33 L;  4GKJ Q;  1C0A A;  2RCN A;  4LFB L;  4NPS A;  2HHH L;  5K36 G;  3HOZ H;  3W1B A;  3CCQ A;  5LMU Q;  4NXN Q;  4LF7 L;  4P72 A;  1FGU A;  4LF6 Q;  4A3G H;  4DV0 L;  1NMF A;  1Y1W H;  4A3F H;  4JI6 Q;  2R93 H;  5IT9 c;  1YHB A;  3BJU A;  4QGU A;  2D0P A;  4DV2 Q;  4X66 L;  4P74 A;  4EQ5 A;  4LFA Q;  3HOU H;  2EXD A;  2JE6 I;  2D62 A;  2K5N A;  1MJE A;  1VQG A;  5LMU L;  2YTX A;  1VCI A;  1KC8 C;  1TWG H;  2R6G A;  4HJ8 A;  1XTD A;  2KEN A;  3GTG H;  1X3E A;  2NVY H;  2Q2H A;  1MJC A;  2AWN A;  4A75 A;  1P8L A;  3PUZ A;  3RLF A;  1XMQ Q;  1JMC A;  1AE2 A;  4DV6 L;  3S16 H;  2N8N A;  4JI4 Q;  2CWA A;  3F2B A;  1VQP A;  3GD7 A;  4OWX B;  1B70 B;  4JI5 L;  2L15 A;  1K3R A;  5C3E H;  2JA5 G;  3BU2 A;  2RHQ B;  3M85 A;  3OYY A;  4X64 Q;  2N49 A;  4XTC S;  3HOX H;  1SR3 A;  1I94 L;  3TEH B;  3K8A A;  1I5F A;  5IYB G;  3K7U C;  2A1A A;  3J80 i;  1KL9 A;  1CKO A;  5M3F H;  1OXU A;  1XPR A;  3GO5 A;  1HZC A;  4X62 L;  4DR1 Q;  1PH2 A;  1N36 Q;  2KHI A;  3IRB A;  1N33 Q;  1XPU A;  3KF8 B;  2UUA Q;  4DUY L;  4IPH A;  2Y0S E;  3T1H Q;  2LXJ A;  1PA6 A;  2RF4 A;  3M7N A;  4UPA A;  3U4Z A;  1JB7 A;  3RR5 A;  4BA2 I;  4JV5 L;  1J6Q A;  1X3F A;  1Y1W G;  1VQ6 A;  4BY7 H;  4C2M H;  4MNO A;  2H5X A;  1OXV A;  4DV3 L;  1NTG A;  4OX9 L;  4DR4 L;  4LUO A;  4LWC A;  2HIV A;  1VQB A;  4GOP C;  3T1Y Q;  1IBL Q;  1X65 A;  3RNU A;  1WYD A;  3A5Z B;  1Q7Y C;  1EUJ A;  2UXD L;  2N78 A;  1X55 A;  4RG1 A;  1Q1B A;  5EAY A;  5ELO A;  4LF8 L;  1SRO A;  1VQ8 A;  4DV4 Q;  2YYZ A;  1ASY A;  3RN2 A;  1PH9 A;  1K8A C;  1XNR Q;  4GS3 A;  1TWF H;  2EIF A;  1WJJ A;  4JI1 Q;  5M5W H;  1A62 A;  2HQL A;  3TQY A;  4DV5 L;  1YIJ A;  1YVC A;  5IYD G;  3OTO L;  2BH2 A;  4PZ7 A;  3CQZ H;  5IP7 H;  1QUQ B;  2BA1 A;  4DR5 Q;  1OXT A;  2A19 A;  2XGT A;  2UUC L;  3JAM c;  1YJN A;  1SFO H;  2ZJP A;  4PG3 A;  1I94 Q;  1I50 H;  4JV5 Q;  4DV6 Q;  4YHH L;  2R7Z G;  3VDY A;  1VQO A;  1X9N A;  1VQE A;  1X54 A;  4HIK A;  1IBM L;  4OO1 G;  4DK3 C;  3HOW G;  2B63 G;  1N32 Q;  1N9W A;  4UY8 C;  4GLA C;  4LF5 Q;  5C0X G;  2F52 A;  1UE1 A;  3HKZ E;  3RZO H;  3JAM i;  4B3T L;  2EQS A;  4B3R L;  1EFW A;  1VQL A;  3KDF B;  4DAY B;  4DR3 Q;  2VS1 A;  2OQK A;  3KJO A;  4K0K Q;  1JT8 A;  1S72 A;  3EN2 A;  1H95 A;  1OXS C;  4A3B G;  3I55 A; 
#chains in the Genus database with same CATH topology
 2EXZ A;  4A3D H;  3AQQ A;  1LTL A;  2A6E C;  4X65 Q;  1F9P A;  1HNX Q;  5FKA C;  4DKA C;  2WAQ E;  2D2C C;  4JPB W;  4A3K H;  3B6Y A;  5CV5 A;  4L5T A;  1JR0 D;  2DGY A;  1KXL A;  1KQS A;  1IKM A;  4XYO A;  3UDF A;  5C44 H;  4K8J A;  3ERO A;  1BKB A;  3GTK B;  2EJM A;  3HGB A;  5FLX L;  3E3X A;  1L1O B;  2KJX A;  3GTJ B;  1QNU A;  1ZYR D;  1GUT A;  4IJH A;  1Q82 C;  1YI2 A;  3S24 A;  4DV1 Q;  3UDX A;  4DK6 C;  4QF4 A;  1Y1V H;  3NP8 A;  2F0Q A;  2BE5 D;  2KVM A;  2F0D A;  3DM3 A;  3T4A C;  1ASZ A;  1SYE A;  5JVH 3;  5GRO A;  1VQ5 A;  1VQN A;  2R92 G;  1FNW A;  1D6E C;  2GVB A;  4P2C B;  4NP5 A;  4A93 B;  1FL0 A;  4GLV B;  3MTS A;  3QJY A;  1QJO A;  4DV3 Q;  5KYI A;  2GN5 A;  4BA1 I;  4R9W A;  1VF5 C;  1B9N A;  4Y7N H;  3D4R A;  2VB2 X;  4LUZ A;  5FO8 B;  1DXM A;  1BCP F;  1CQF A;  2K50 A;  1UWV A;  3K5N A;  1E2W A;  4OXP A;  1D2B A;  1WTX A;  1LTI D;  5GAG C;  2KHS A;  1OTC A;  3PO2 B;  4JYA L;  4G57 A;  1TY0 A;  2LSS A;  3K7A B;  3M4O B;  2HCC A;  1TS3 A;  4LFB Q;  3GDE A;  4BBR H;  2L0C A;  2C35 B;  1XNQ Q;  3HOY H;  2JK8 A;  3S1Q B;  3K5M A;  1CZW A;  1EYA A;  1XMO Q;  1MBY A;  1TT2 A;  1VQ4 A;  2F0T A;  1L0X B;  2R7D A;  4CDE C;  2NN6 I;  3NTH A;  5C4X B;  5C3W A;  4YCV A;  4XQJ A;  1FVI A;  1VS0 A;  3M3Y H;  2WIN B;  1HZA A;  1W2B A;  5T1G A;  2KCN A;  2MO0 A;  4JCV E;  3OMC A;  2R93 B;  1UEB A;  4IPC A;  1PH3 A;  1AZQ A;  1SE8 A;  3I2Z A;  3ITP A;  1PVO A;  4H0L C;  1GUS A;  4H02 A;  2YTY A;  2G5D A;  4LF9 Q;  3T1Y L;  4C3I G;  5FO9 B;  1KAA A;  1PTO H;  1K8G A;  1XMQ L;  3HKZ B;  3GV3 A;  2V1C C;  2E2I H;  5BN4 A;  3FVQ A;  3S17 B;  3BDO A;  3T1H L;  2UU9 L;  5BR8 L;  3S2D B;  4ULL A;  3CCS A;  3PCO B;  1EY9 A;  2JA6 H;  1K9M C;  1O7I A;  1LV9 A;  2HCI A;  2NZ1 D;  2WP8 J;  1ENF A;  1VQM A;  1QE6 A;  3WOE A;  2A69 D;  2Q8T A;  5C3X A;  4R4I A;  5KNB A;  3BYY B;  3KOJ A;  3NPP A;  4O1N A;  4CDF C;  5M3M G;  4X6A H;  1X3Q A;  1IL8 A;  3TME A;  4IUT A;  3I56 A;  5HUR A;  1GM5 A;  1CSQ A;  2PNR C;  4DR2 L;  3H3V I;  4CBV A;  3HOZ G;  5IGE A;  5FLM G;  2VUM G;  3KLR A;  1N34 Q;  3GTO B;  3HOX G;  1BCP D;  3CKI B;  2IJ0 A;  4JI6 L;  2L5T A;  1N34 L;  5M3F B;  4LF8 Q;  4NKL A;  1IYV A;  1EOV A;  1LTR D;  5BN5 A;  4KMU C;  4K0K L;  3L0O A;  4U67 3;  1E7Z A;  5I2X A;  1BXT A;  4JI7 Q;  1QG7 A;  4C2M B;  3PUW A;  4DR7 Q;  1Z47 A;  1JJ2 A;  1XJV A;  5I6Y A;  3VR5 A;  4A3C G;  2F03 A;  3PMF A;  5NUC A;  1D1K A;  4PMW A;  4BS9 A;  1OXX K;  3H6M A;  2GA4 B;  3CHB D;  5FLM H;  1LAB A;  4HCE A;  1PH4 A;  3OIP A;  2I5M X;  5I2Y A;  2H1E A;  2MFI A;  1KAB A;  5BR8 Q;  2A74 C;  4LF7 Q;  1WD0 A;  4IQZ A;  3MC0 B;  3PV0 A;  1SMX A;  2XTI A;  3LWU A;  4RMF A;  5LHY 1;  1DJR D;  3NEM A;  2VQF Q;  1PH6 A;  2AKW B;  3I91 A;  5HY6 A;  3Q23 A;  2ZTD A;  4JI8 Q;  2JA7 G;  3D0F A;  3PIO 3;  5IT9 L;  1GHK A;  2PI2 A;  2ZXR A;  4A76 A;  1LLR D;  4DPG A;  2K28 A;  3EJI A;  5DEH A;  4DNR B;  4A3E G;  1A6X A;  2NVT H;  2SOB A;  3MHB A;  4UP7 A;  3A74 A;  1YJ9 A;  1Q12 A;  1FNV A;  4UP9 A;  4A3D B;  3AEV A;  2WB1 E;  2YV5 A;  1PZJ D;  5G3L F;  3OWF A;  4L5Q A;  5IGD A;  3K6O A;  4B3R Q;  4A3K B;  4M1U B;  4J15 A;  5COY A;  1XWE A;  4CDC C;  1SE4 A;  2NVX B;  3TP7 A;  3K0Y A;  5ELN A;  2F0G A;  5IYC G;  1M90 C;  1HQM C;  4GN3 B;  2YU9 H;  4YWM A;  2RQX A;  1AEX A;  3TP6 A;  3W2D A;  1HFG A;  2VUM H;  2PCF B;  3SK4 A;  3UDI A;  5IY0 A;  1S5F D;  1WCM B;  2R7F A;  2AUK A;  4PNY A;  4KHP L;  4JI3 Q;  4ME3 A;  2PNH A;  2K5H A;  3W5O A;  3AB9 A;  2HD3 A;  1NBW A;  3RLN A;  4PV1 C;  4A93 H;  4ZUJ A;  1GD7 A;  5C44 G;  1LAC A;  4KKU A;  3GTM B;  3S1N H;  5EKL A;  2WFW A;  1F77 A;  2J4X A;  1U5K A;  1YNJ C;  4L6T B;  3I90 A;  1HCZ A;  1VQJ A;  3FRP B;  3OWE B;  5IYD H;  1STH A;  4ZRZ A;  4JI2 L;  3VYT A;  2EJG C;  3CC4 A;  2KUM A;  1SAP A;  3NBI A;  1BQQ T;  1EY6 A;  1B7Y B;  4QUC A;  1RHP A;  2F4V L;  2LY7 A;  5IGF A;  3KBX A;  2D9U A;  1HUN A;  1W6J A;  4Y52 H;  2NVQ H;  1HZ9 A;  3J81 c;  1JCK B;  1BBW A;  2D5D A;  1K83 H;  2ATW A;  5C0X J;  4OX9 Q;  5KGU A;  1Z9F A;  3BZK A;  4AQY Q;  1EYG A;  3F1Z A;  3OHX C;  5IP9 H;  1YIT A;  3ER0 A;  5IYB H;  1LTT D;  5C3E B;  2OWO A;  5JAV A;  1IYJ B;  1DOM A;  1BOS A;  3RMH A;  4MHE A;  3NE5 B;  1C0A A;  1RKN A;  1QOH A;  2HHH L;  3CCQ A;  2CQA A;  1FGU A;  3NTI A;  4RWS C;  5CV9 A;  4LF6 Q;  4A3G H;  2SNS A;  4G7O C;  4DV0 L;  2EYL A;  1NMF A;  2R93 H;  5IT9 c;  1HTL D;  2D0P A;  4X66 L;  4K2L A;  1ILQ A;  2D62 A;  5C4H A;  4KJO A;  3KBG A;  1F2M A;  1I4R A;  1KC8 C;  2FJ2 A;  3Q24 A;  1X3E A;  1PRT B;  1AE2 A;  3R2I A;  4DV6 L;  3K57 A;  5ELD A;  5IGC A;  2CWA A;  1VQP A;  3I3C A;  4O42 A;  2B2T A;  3K58 A;  1R4P B;  3BU2 A;  4KV6 A;  3TP8 A;  2N49 A;  2OEO A;  4XTC S;  1I94 L;  2F0N A;  1AW7 A;  1FNU A;  4LAA A;  1I5F A;  4FF1 A;  5IYB G;  4YIJ A;  3DXJ C;  5EJW A;  1KL9 A;  1TS4 A;  1XPR A;  3GO5 A;  1HZC A;  4X62 L;  3PO3 B;  1Y8P B;  1N33 Q;  1PA6 A;  2IX3 A;  1EWC A;  1ZEQ X;  3R8B A;  4UPA A;  3J81 E;  2P5Z X;  1BUV T;  3R2T A;  2BE5 C;  4DR4 L;  4OX9 L;  3L9A X;  2HIV A;  1BF4 A;  1BCP C;  3CRL C;  5J39 A;  3RNU A;  5FLX E;  2L1B A;  2N78 A;  1X55 A;  1KLU D;  3U9S A;  3IFT A;  2C5C A;  3I4M B;  1K8A C;  3RN2 A;  1TWF H;  4DV5 L;  4ID6 A;  1YVC A;  3UI2 A;  2R61 A;  4JK1 C;  1AN8 A;  4CKB A;  2K5Q A;  2BA1 A;  4DR5 Q;  2UUC L;  1YJN A;  1R9T B;  3QO2 A;  2K03 A;  2X69 A;  1I50 H;  1ZYR C;  2XVS A;  2LMC B;  4DV6 Q;  4YHH L;  3VDY A;  3ND9 A;  1VQO A;  1X9N A;  3IFD A;  1RDP D;  4OO1 G;  2F0P A;  1STG A;  1UE1 A;  2KEE A;  4QB4 A;  3JAM i;  4FP5 D;  2EQS A;  2QIL A;  2L4N A;  1HFN A;  3H09 A;  1JT8 A;  1K8M A;  2MHV A;  2NBF A;  5K36 G;  1H95 A;  2PMZ E;  3BVG A;  4WFN 3;  4F88 A;  3SE0 A;  1E3P A;  2C9O A;  2B3G A;  4YY3 L;  1I4X A;  3QOL A;  2B63 H;  3MEF A;  3I4N G;  4XDX A;  3E0E A;  2F1M A;  2QCP X;  3BYT B;  4GKK Q;  4XIG S;  2OF1 A;  1JJG A;  2HHH Q;  2E8G A;  5C4J B;  3V2T A;  3TN2 A;  1SYG A;  1YHQ A;  2L12 A;  4YWL A;  5A2Q L;  4MIU A;  2Z8L A;  3WDN A;  2PO4 A;  2CKZ B;  1IBK L;  5C4X G;  2MGS A;  4G7H C;  1PTO F;  1RTO A;  3NTK A;  4BBR G;  4HMJ A;  1HNW L;  1EIY B;  1JB3 A;  2E5L L;  2JA7 H;  1HZB A;  3HOY G;  5M5X H;  2I5L X;  5M3M H;  3J7Z C;  1PH5 A;  3GQB A;  4BBS B;  1G2T A;  4NXM Q;  3QR8 A;  4LUV A;  2PZU A;  3K59 A;  5JEA G;  5AFW A;  4HIO A;  2JEA I;  2JA5 B;  2F0O A;  4HN7 A;  1GOZ A;  5GQO A;  2VY3 A;  3S15 B;  3A55 A;  2K5V A;  4G4K A;  3LWE A;  4GKK L;  3GTP B;  2AMC B;  1KRS A;  1U4M A;  4O2D A;  3STB C;  1KIX A;  4KD4 A;  2UXB L;  5A2Q E;  1FR3 A;  2ZTE A;  4QUF A;  1UAP A;  1QVC A;  2K6A A;  1A3T A;  2EY1 A;  3URY A;  2KCT A;  2RA4 A;  4DN4 M;  4ZKC B;  5JPM C;  2A73 B;  1MSH A;  3NWT A;  4HJ5 A;  3NXW A;  1L0W A;  2E76 C;  1PH8 A;  1VQA A;  4CGY B;  3GTM H;  4TSS A;  4NMZ A;  1T5E A;  2F0F A;  2Q8I B;  4FF3 A;  1STY A;  4DR6 L;  5EBC A;  1A15 A;  1KLG D;  5IWA L;  3I4N B;  4WRD A;  5J1Z A;  1GJX A;  2WAC A;  3PF4 A;  4C56 C;  4A3E B;  1D5M C;  3MXN B;  4XT3 B;  5KEE A;  3F2U A;  1EWH A;  1ROD A;  1Y1W B;  1NMG A;  3STB D;  4LF6 L;  1S3O A;  4K5V A;  3M4P A;  4JOI A;  3OIQ A;  3CCV A;  2JA8 H;  3FMC A;  2BH8 A;  5EPL A;  5HGT A;  2Q2I A;  3AFQ A;  1ZKO A;  2DNE A;  1Y8N B;  1IBL L;  2ID0 A;  4HIM A;  1HR0 Q;  1UEA B;  5LL6 S;  5BN3 A;  1DON A;  4R4Q A;  1DZ1 A;  3DLL A;  3S16 B;  3SHL A;  3L3O C;  4A3J H;  3J81 i;  2IHE A;  3CF5 A;  3GTO H;  5CR3 A;  4BBS G;  2NUC A;  3HOV G;  3R93 A;  2HDL A;  1PXU A;  2I5H A;  1TWA B;  4QJF A;  5J3B A;  4HMI A;  1CT1 D;  3MA2 B;  2E75 C;  1F2Y A;  3U58 A;  3OPO A;  3G6E A;  3CCR A;  3NQT A;  4KY5 A;  2WAQ B;  1IW7 C;  2LKV A;  2A69 C;  5H1S E;  2B8F A;  3KF6 B;  4BWG B;  1B8A A;  1CKM A;  3OW2 A;  3HOV H;  1CHP D;  2A6H C;  2G9D A;  4PZ8 A;  3KFU A;  2JA9 A;  1MKH A;  4IPG A;  4A3M H;  1VMC A;  2CHB D;  1WI5 A;  5M5W B;  1A0I A;  1T9H A;  2OTJ A;  2RHS B;  5C0X H;  2B2T C;  2RVL A;  4B3M L;  3PO3 H;  3Q8D A;  3J80 L;  3FPU B;  1ENA A;  5E4W C;  4A93 G;  4RFB A;  4X64 L;  2R92 B;  2L55 A;  2LFN A;  1I4H A;  1O7Z A;  1SBB B;  3CD6 A;  1A63 A;  2IY5 B;  1K8O A;  5FOB B;  1IBM Q;  4A3M G;  1S4Z A;  2ALY B;  2BDO A;  3I4M G;  5EBD A;  5D14 A;  5LMN L;  2IT1 A;  1SEB D;  3RN5 A;  2PMZ B;  2PZT A;  2BA0 A;  1MSG A;  2YTV A;  4X66 Q;  1SJE D;  2N3S A;  4IUU A;  1QNK A;  3L2P A;  1XNR L;  4K6L A;  4BY7 G;  5IP9 G;  1HHV A;  1EY4 A;  1F9R A;  3I7F A;  4XT1 B;  1EQV A;  2KEC A;  2RSN A;  3A8I E;  2EY6 A;  1R9T H;  5KIX A;  3S1M H;  4DV7 L;  4KN7 C;  5ELF A;  1NAP A;  4C3I H;  5LMN Q;  4J6H A;  1YEZ A;  4OGQ C;  2B2U C;  4ZCK A;  2NYZ D;  3X3N A;  4Z9C B;  5GAD C;  2WII B;  2KBN A;  1GHJ A;  2VUM B;  1UE6 A;  2F0M A;  2FHT A;  4FO2 A;  1QVG A;  3PGZ A;  3RZD H;  1DOK A;  4OHJ A;  4DV0 Q;  4J1M A;  1IBK Q;  1U4R A;  4JI3 L;  3C3L A;  1CTM A;  4FYD A;  3A8J E;  4CKE A;  2F4I A;  1VQD A;  5JJL A;  3I4L A;  1Z7T A;  4I7Z C;  1O80 A;  3H3V C;  1WTH A;  2ZXO A;  2NZH A;  5GAH C;  2CH4 A;  1SRU A;  3A7A B;  1BNZ A;  4IOA A;  2F3I A;  4A3D G;  4JI8 L;  2JQO A;  3TDQ A;  2IX1 A;  3KLW A;  4RHS A;  4JV5 L;  1B50 A;  1IZ6 A;  4DXG A;  5IGG A;  1XPO A;  4LNQ A;  4DV2 L;  4C3H G;  3TRE A;  1A2U A;  3SVM A;  3GP7 A;  3K0X A;  3RD4 A;  2Z6K A;  1PYS B;  4QQB X;  2RDG A;  1PV4 A;  5KND A;  4B08 A;  4DK1 A;  4POF A;  5CV8 A;  1AP0 A;  3VR6 A;  1SYC A;  5M3M B;  2AUJ D;  2ICE C;  4RGO S;  4LF4 Q;  3VR4 A;  1E1T A;  3KDF A;  2PPB C;  2E2J H;  2A5H A;  1WCM G;  1AH9 A;  3GTQ B;  1JE4 A;  3X3M A;  1FYC A;  4DUZ Q;  3TP5 A;  1SMY D;  1NY4 A;  5DM7 3;  4IFD J;  2Q8R E;  3E5S A;  4RCN A;  4HJ9 A;  1TKW B;  3QWN A;  4JI0 L;  1PYB A;  2WV6 D;  1SNO A;  1YNJ D;  1STE A;  1VQ9 A;  1HNW Q;  3FDT A;  3NEL A;  3CC7 A;  4JBM A;  3A0J A;  1AE3 A;  1L1O C;  2KA7 A;  1OO9 B;  1F2L A;  4WJ4 A;  1SNM A;  5EPK A;  1BR9 A;  3K7A H;  5IP7 G;  4TVA B;  3HOU G;  2BDN A;  2E2H B;  1EOT A;  2JXM B;  2BCO A;  2QF7 A;  3OW7 A;  4KHZ A;  4DUZ L;  2PQA A;  1W3S A;  3GTG B;  1V1Q A;  3M4Y A;  2FFK B;  4L8J A;  1CI3 M;  1S40 A;  3HOY B;  3S1Q H;  5FLX c;  1ZXT A;  2MNA A;  2EVB A;  5CGK A;  1C9O A;  1PH1 A;  4HID A;  1N33 L;  4JVZ A;  4GKJ Q;  2RCN A;  4LFB L;  1LT4 D;  4NXN Q;  2F0I A;  3MVV A;  1C8C A;  4LK1 C;  1WTP A;  4A3F H;  3EFX D;  4HCS A;  4QGU A;  4DV2 Q;  3DM1 A;  1F9S A;  3RUZ A;  2K5N A;  1MJE A;  4C1N I;  5LMU L;  2F0L A;  1EY8 A;  4ZKB B;  1TWG H;  1AFP A;  4ZAI A;  2KEN A;  4K8I A;  1Z6H A;  1EL0 A;  2Q2H A;  1P8L A;  1XMQ Q;  2KED A;  3S16 H;  3CU7 A;  1STN A;  2VXW A;  4OWX B;  1B70 B;  4JI5 L;  1K3R A;  1EY7 A;  4IAL A;  1DCZ A;  1E2V A;  3V96 A;  5J22 A;  2QKI C;  1SJH D;  2FIN B;  1STB A;  1ML0 D;  1O7Y A;  1CKO A;  2KQ3 A;  1OXU A;  4OEL B;  1QIL A;  2DNC A;  2F0E A;  1PH2 A;  2EJF C;  1N36 Q;  4BY1 B;  1JOQ A;  4WOR A;  3BDC A;  5F2D A;  4DUY L;  4IPH A;  1UNS A;  2LXJ A;  4X3K A;  2RF4 A;  3M7N A;  3U4Z A;  1JB7 A;  3PQI A;  1CM9 A;  5ELB A;  1J6Q A;  1X3F A;  3BVM A;  2RSO A;  1O78 A;  4MNO A;  3NWS A;  4IUV A;  2ZT9 C;  2NVY B;  4LWC A;  2XRS D;  4Q0F A;  3MWY W;  1VQB A;  1F9Q A;  3T1Y Q;  1X65 A;  1EEI D;  1Q7Y C;  1A2T A;  3DWQ A;  1KDC A;  2K32 A;  4RG1 A;  3QG1 A;  5EAY A;  1LTG D;  1VQ8 A;  3HOX B;  4DV4 Q;  2YYZ A;  1PH9 A;  3P7J A;  3DHQ A;  2EIF A;  5M5W H;  1A62 A;  2BH2 A;  2I46 A;  4R8N A;  5T1I A;  2K05 A;  2QDL A;  1WD1 A;  1OXT A;  2A19 A;  1SFO H;  3OMG A;  2B39 A;  4CJ0 B;  3I73 A;  5JPN C;  1M8A A;  5C44 B;  1PFM A;  3T51 B;  1VQE A;  1X54 A;  1Y69 U;  3HOW G;  2F0W A;  1N9W A;  4UY8 C;  2K01 A;  4LF5 Q;  2F52 A;  4BY7 B;  3HKZ E;  4DK0 A;  1ESR A;  1M4V A;  3KDF B;  4RGN A;  4DAY B;  2QEJ C;  4RH6 A;  1WTR A;  3EN2 A;  2R7Z B;  1STA A;  1G6Z A;  2JA7 B;  2N55 A;  3PUV A;  2DY7 A;  4AYB E;  2KCC A;  2L11 A;  1P16 A;  1FGB D;  1SXT A;  2HIX A;  1PYW D;  3ND8 A;  2VNU D;  4A3I B;  4DR3 L;  4IUN A;  1PH7 A;  1PFN A;  1KNE A;  4FXK C;  1B9M A;  1KD1 C;  4A3G G;  1MD2 D;  1LUZ A;  2WAQ G;  2DUD A;  3S2H H;  2H4O A;  4Y7N B;  3LGJ A;  5AJ3 Q;  3G48 A;  1NJI C;  3GTP H;  4A4I A;  2VQF L;  2E74 C;  3C1F A;  4UAI A;  2XRQ D;  2AHO B;  4QIW E;  3HRZ C;  3A7L A;  5IE8 A;  3HKZ G;  2MP1 A;  1WFQ A;  4X62 Q;  4QY7 A;  3DEP A;  1CUK A;  1JIC A;  4U68 A;  4JI2 Q;  1PFS A;  3LX0 A;  5EGT A;  1SNC A;  3SGI A;  3S14 H;  1G8Z D;  2IWH A;  1EIF A;  1Q46 A;  1G29 1;  4I65 A;  2M2L A;  2B2V A;  4IPD A;  4DR4 Q;  3MXP A;  1XXG A;  2CCZ A;  3I4N H;  2O2L D;  3I8Z A;  3PSI A;  4A3E H;  1J5E L;  2IX0 A;  1JWS D;  4JI7 L;  4H7B A;  3J80 c;  3M3Y B;  3GTJ H;  1YHA A;  5FJ8 G;  3AYH B;  4HSV A;  5C4Z A;  4LFA L;  4MTN A;  3BDL A;  5M5Y B;  3ICE A;  1EEF D;  2JA8 B;  4B3M Q;  1Y1V B;  3PO3 G;  4GN5 A;  2JA8 G;  3E6Z X;  4A3J G;  1ENC A;  1JE5 A;  3J7A 5;  4CJ1 B;  2QGQ A;  1B4O A;  4TQU S;  2A6E D;  2Z6K C;  1SMY C;  3S1N B;  1NNX A;  2CWP A;  5D65 A;  1QZG A;  1K73 C;  1ET9 A;  1LM0 A;  4EQP A;  1VQ7 A;  3GTQ H;  3PUY A;  3S17 H;  2ZXP A;  3U50 C;  1G6P A;  3UE0 A;  3TZD A;  4QCL A;  3S1R H;  4TRD A;  1E22 A;  4ABN A;  3JAM E;  1RL2 A;  3CCE A;  3UDG A;  4JI1 L;  1K3B C;  1GXD C;  1S5D D;  4KTA A;  3U9O A;  4DV1 L;  2WB1 B;  3H0G G;  1Q81 C;  2XSC A;  1J8I A;  2B2W A;  1HQR D;  4B9W A;  1B2T A;  4R4O A;  1U9R A;  1Q8K A;  2JN4 A;  2NN6 G;  1SLJ A;  2VQE L;  1TWC H;  2K7V A;  1PZI D;  1H9R A;  4IFD H;  2K33 A;  3HOV B;  3T13 A;  4BXX G;  3TZU A;  4LFC L;  1FJG L;  1X3G A;  1YZ6 A;  2QA4 A;  3H0G H;  1EQR A;  4R4C A;  4JW0 A;  3HS0 C;  5LMN W;  1IHZ A;  1HR0 L;  4A3L H;  4NW2 A;  2NZO A;  2B8G A;  4DV7 Q;  1JOO A;  5G3L D;  4CDD C;  3K81 C;  4R1J A;  4JG2 A;  4C3H B;  2KHJ A;  1V43 A;  3ULL A;  3D6W A;  4QMG A;  3NSW A;  1J9O A;  1YNX A;  3F2C A;  1IL2 A;  1SYF A;  2K5D A;  4C3J H;  1VMP A;  4O0A A;  4JI4 L;  2UUB L;  2IPK D;  4F87 A;  1HRJ A;  1KTK A;  3I4O A;  2HQE A;  3J80 E;  4KI0 A;  1WTO A;  3E9I A;  4IZ8 A;  1S5C D;  2OCE A;  1XNQ L;  2EYP A;  4EVO A;  4C1N K;  2E2I B;  3KYH C;  4UP8 A;  4IFD G;  1HNX L;  1E2Z A;  1SYD A;  3S2D H;  3D8G A;  3NHH A;  2CW0 D;  3A8K E;  1E24 A;  4ILW A;  2Y0S G;  3CQZ B;  3KF6 A;  3N6R A;  4HR7 B;  4WJW A;  2OTL A;  3S1M B;  1JWU D;  3T16 A;  5JEA J;  4FVM A;  3MXU A;  5I9O A;  1EY0 A;  4KK7 A;  3PUX A;  1K0R A;  1VQH A;  5HGQ A;  1WVL A;  4GNX B;  1N32 L;  3KK7 A;  5IGB A;  1EYC A;  4K14 A;  2TMP A;  5IOC A;  3CPF A;  3W1G A;  4FNF A;  3BZC A;  3CAM A;  1QB5 D;  1TWF B;  2EY2 A;  3ULJ A;  4HAE A;  3ERS X;  4JBJ A;  1VQK A;  3PF5 A;  4L5R C;  3NUC A;  1BBX C;  3C2P A;  2VL6 A;  3HG9 A;  3L7Z C;  1SNQ A;  5E3F A;  1QZH A;  4MN3 A;  4OWT B;  5D3I B;  2EY5 A;  3H3V H;  4B3S Q;  4GLX A;  4LW1 A;  5CC4 A;  1V9P A;  2D0O A;  3PIP A;  2HT1 A;  1HPC A;  4RA8 A;  4BY1 G;  4DU9 A;  2VB3 X;  3I70 A;  4B3S L;  4A3C H;  1A3V A;  3IL8 A;  1JOK A;  1E1O A;  3MXN A;  4KHV A;  1SND A;  5JJZ A;  4IO9 A;  2EZV A;  1AZP A;  2RCF A;  5I9P A;  5IYC H;  1NSN S;  4YY3 Q;  4NXN L;  3DWA A;  3NBH B;  1SYB A;  4YCU A;  4RKB A;  2PQA B;  3BG3 A;  4A3I H;  4N9P A;  2IHF A;  3M9B A;  2XWB B;  2FMC A;  3HOW H;  1YNN C;  4HSP A;  1HUM A;  1I4P A;  1TY2 A;  2LXK A;  1WTQ A;  4EX5 A;  2CQO A;  2NB0 A;  4P73 A;  2ZM6 Q;  5M3F G;  2ZTC A;  1C7Y A;  1HJP A;  3EQL C;  2OT2 A;  1SSO A;  5FK9 C;  5LL6 X;  2K4K A;  4NB3 A;  4IOC A;  2A68 C;  3PO2 H;  1N8R C;  5C0X I;  4FF2 A;  4V0B A;  4PMB A;  3J81 j;  3M4O H;  1EQQ A;  1HTP A;  1VDZ A;  3S14 B;  4GKJ L;  1QUQ A;  2EE1 A;  3HEJ A;  1I6H H;  4DR2 Q;  3DWP A;  1UE5 A;  4ZK9 B;  5CV4 A;  1LYL A;  3D31 A;  3FKI B;  3MAQ A;  2AQ1 B;  5AJ3 L;  3HP3 A;  1LTA D;  3CW2 C;  3HZX A;  3PO2 G;  2F0K A;  4OON A;  1TWH H;  1EFI D;  4KKS A;  4DUY Q;  3UE1 A;  5C4X H;  3S15 H;  2YU9 B;  1VQF A;  4RKL A;  1KDA A;  4A3L G;  4A3G B;  4DAY A;  2UUA L;  2QEX A;  4BXX H;  3Q6S A;  1XX8 A;  1WCM H;  1GUN A;  3QIA A;  1KAW A;  2F0J A;  3ZYY X;  3SDZ A;  4DA2 A;  4AYB B;  3C1E A;  2WKC A;  5DM6 3;  1B44 D;  3J7Y W;  2UU9 Q;  1CQV A;  1FD7 D;  2AWO A;  3MFG A;  3U4V A;  4FXD A;  4X3S A;  3HFZ B;  1X6O A;  4A3B H;  5C6A A;  1ICF B;  3QOJ A;  2JJQ A;  1V1P A;  2N88 A;  4N8F A;  4GZY C;  2ASB A;  4DR6 Q;  1LT3 D;  1JC7 A;  4UDU C;  1DM0 B;  1KNA A;  1D5X C;  4NPS A;  5KYL A;  3HOZ H;  5LMU Q;  4LF7 L;  4P72 A;  4Q5V A;  1TS2 A;  1GUG A;  5COR A;  3LNN A;  1Y1W H;  1RCV D;  1YHB A;  1JQY D;  2OXP A;  4ZQ3 A;  4EQ5 A;  2SNM A;  3HOU H;  2JE6 I;  2NVQ B;  1BCP B;  3N52 A;  1V1O A;  1VCI A;  1G91 A;  1LT6 D;  2R6G A;  3W3A A;  4HJ8 A;  4H13 C;  3SXH A;  1MJC A;  2AWN A;  4A75 A;  1JMC A;  1NCV A;  1QCB D;  2B2W C;  2K04 A;  2XWJ B;  3MXG A;  4JI4 Q;  2MUY A;  4A3J B;  3GD7 A;  1H9S A;  2RHQ B;  2XN9 C;  2Z4I A;  3OYY A;  1SR3 A;  1TU2 B;  3TEH B;  1V1P B;  4DXF A;  2A1A A;  1II3 A;  5M3F H;  4DR1 Q;  1BO0 A;  1I50 B;  1XPU A;  1S5E D;  2B2Y A;  3KF8 B;  2UUA Q;  2Y0S E;  4C3J B;  3T1H Q;  3H91 A;  5E1F A;  3RR5 A;  4DAP A;  4ZUI A;  1VQ6 A;  2NWG A;  4BY7 H;  1IYU A;  1PDQ A;  1Q3L A;  4DV3 L;  2R3Z A;  4GOP C;  1H9J A;  2F0V A;  1IBL Q;  4FF4 A;  3SK5 A;  2BOS A;  3A5Z B;  4CHT B;  4KY6 A;  3SK6 A;  4E6I A;  5I6W A;  5ELO A;  4A3M B;  1K0S A;  1SE3 A;  2A6H D;  2B63 B;  1ASY A;  3P75 A;  5C5L A;  1JWM D;  3TQY A;  4KJN A;  5IYD G;  1R4Q B;  2K5W A;  5JOB A;  4PZ7 A;  3CQZ H;  4OEM B;  5IP7 H;  1QUQ B;  2XGT A;  1ONL A;  3JAM c;  2ZJP A;  4H44 C;  1EZ6 A;  2R7Z G;  3S2H B;  5EPJ A;  4XXE A;  1IBM L;  1W6K A;  3SEB A;  1EU3 A;  1RJT A;  1DOL A;  4GLA C;  5C0X G;  4IUR A;  3RZO H;  4B3T L;  4B3R L;  1EFW A;  3IAY A;  1VQL A;  4K0K Q;  4DR3 Q;  1I4G A;  2PYK A;  2OQK A;  3ONA B;  4A3B G;  3I55 A;  4QIW B;  1ESF A;  1X56 A;  2IW3 A;  3FP9 A;  3D6C A;  3QB3 A;  1I4Q A;  4HJA A;  4OO1 I;  3CCM A;  1EIG A;  1CFM A;  2VW9 A;  4HJ7 A;  2I07 B;  4TKO B;  1Q1E A;  3P1H A;  2F4V Q;  2UXD Q;  4OL7 A;  3EA6 A;  1TS5 A;  5ELC A;  3DMU A;  1SNP A;  2Z0S A;  2EPB A;  4B3T Q;  3S9W A;  4WJ3 M;  5K36 H;  1CKN A;  1I3Q H;  3GTL H;  1F2Z A;  2K75 A;  1IXR A;  2NVX H;  1PZK D;  4IFD I;  3NQI A;  3MFY A;  3R3O A;  4APV A;  5I4D A;  2MJ8 A;  2B2Y C;  1UE7 A;  2CVR A;  3VYU A;  2FMM A;  2JEB I;  2MO1 A;  4POG A;  4YCW A;  1EU4 A;  3CCJ A;  1A8V A;  4X3T A;  4DR5 L;  2O4X A;  3G4S A;  4AH6 A;  4CKC A;  4EQN A;  3RZD B;  3A54 A;  1S5B D;  3KJP A;  4KD3 A;  4MTK A;  3H94 A;  2TSS A;  3PIO A;  1Q86 C;  4P75 A;  3AMU A;  1YNN D;  1YBY A;  2DJF C;  4GOP A;  2MQH A;  2MPM A;  4JBW A;  4RAU C;  4EGV A;  3RLO A;  3CME A;  2O5J C;  3MEH A;  2EOT A;  1VF7 A;  4JI0 Q;  2ZJQ A;  2VZA A;  1LT5 D;  2Z4H A;  3HOW B;  2B29 A;  5EKK A;  1PMR A;  5CV6 A;  3A56 A;  1PFB A;  3M7G A;  1GKH A;  5JJK A;  4LMQ D;  3NEN A;  1K28 A;  3S1R B;  5L37 A;  3D4W A;  2Q2U A;  1PRT F;  3HKS A;  1RF2 D;  1Q90 A;  2FXQ A;  2DN8 A;  4IUQ A;  2RDF A;  2HUG A;  4A3I G;  5IIF A;  4QL5 A;  1TWC B;  1K83 B;  4K5X A;  3OSO A;  4KLK A;  1CKN B;  2F3W A;  4XQQ A;  4LJZ C;  3VR3 A;  4K5W A;  3F8T A;  1I6H B;  1LTB D;  1TVX A;  3VA7 A;  4BBS H;  4LF5 L;  2E2J B;  3FKI H;  2ZM6 L;  2CFM A;  2WB1 G;  1KDB A;  1Y8O B;  3H0G B;  5M9O A;  4GNX C;  1WTV A;  4AQY L;  3KUP A;  2RBM A;  3TS2 A;  4OWW B;  1VQI A;  3DEO A;  5CYU A;  4C3H H;  5ISR A;  4PZ6 A;  3KLS A;  4X65 L;  1EY5 A;  4UHV A;  1TWA H;  4N8X 1;  4DV5 Q;  4YWK A;  1D1I A;  4DNT B;  1YJW A;  3P20 A;  2B2U A;  4ODG A;  2HDM A;  1H9K A;  3FEW X;  2K14 A;  2EYO A;  4A3K G;  3VR2 A;  2JA6 G;  4JBK A;  4DF7 A;  4BBR B;  2UUB Q;  2JP1 A;  1TQO A;  3NBH A;  4DGZ A;  1U0L A;  4NXM L;  1KHI A;  2VQE Q;  4DAV A;  1EYD A;  3E9H A;  2OQ0 A;  1A3U A;  3CXC A;  1LO5 D;  1XYI A;  3ULP A;  1RIP A;  3OTO Q;  1U4L A;  5K5P A;  2PW7 A;  4A3F B;  1L0Y B;  4HTH A;  3Q22 A;  5DLQ E;  5GAE C;  2AQ3 B;  1PTO D;  3DUZ A;  3BVZ A;  2RKS A;  1MGS A;  1DGS A;  1JJC B;  3WOF A;  2A8V A;  3J81 L;  3CC2 A;  2E2D C;  2SDF A;  2JYO A;  4JI5 Q;  1EQT A;  3JAM L;  2DJG C;  4GN4 B;  3SK8 A;  4IJL A;  2AQ2 B;  4ME5 A;  1C48 A;  1UUP A;  1XTC D;  1BVS A;  3EIV A;  1PLF A;  4JOI C;  1EWI A;  2UUC Q;  1QVF A;  2L9H A;  5CBE E;  4K2K A;  1HH2 P;  3GV6 A;  4RCO A;  1N36 L;  2Z1C A;  5JVG 3;  3I4M H;  1EIH A;  5JEA H;  1HA5 A;  4GOP B;  4KKT A;  1TII D;  4JYA Q;  5FO7 B;  4GNX A;  1PRT D;  4BY1 H;  3CP0 A;  4OIK A;  2EYF A;  2PI2 E;  1G2S A;  4FDB A;  4RHR A;  1KRT A;  4C3I B;  5D3D A;  4MZ9 A;  5A35 A;  3EBE A;  1NE3 A;  3J7A V;  1B3A A;  2ES2 A;  1X3P A;  4RGM A;  4YHH Q;  2EDG A;  2F0H A;  1Y14 B;  2Z6B A;  2I0Q A;  4DAM A;  3H15 A;  3CMA A;  4LF9 L;  1I6V C;  5JJI A;  4G7Z C;  1HA6 A;  1T5X D;  4ALP A;  2SEB D;  2G9H D;  2V4D A;  4XYQ A;  4X3U A;  4J8Q A;  4F8M A;  5CBA E;  2R92 H;  1U4P A;  1H9M A;  5C4J H;  4DFA A;  1PHJ A;  4DR7 L;  1IKL A;  3TS0 A;  3GTK H;  2J0T D;  5IWA Q;  3CCU A;  1L2F A;  4A3F G;  1B3Q A;  3E0J A;  4IUP A;  3K80 C;  4ZYS A;  4LF4 L;  3RZO B;  1QWY A;  2F3V A;  1HR0 W;  1EZ8 A;  4DR1 L;  2R7Z H;  4L5S A;  2GVA A;  2CH4 W;  1LTS D;  3OOC A;  3AFP A;  4PQX A;  5KRU A;  1NR2 A;  2J7Z A;  1GVP A;  2Y0S B;  1M1K C;  3K5O A;  3V05 A;  5M5X B;  1TR5 A;  4I7A A;  1HNZ L;  3PIP 3;  4R8I A;  4AYB G;  3TRZ A;  2IL8 A;  1D7Q A;  2NTT A;  1B53 A;  1CZG A;  2CW0 C;  1I3Q B;  3ERQ A;  5EKI A;  3GTL B;  1L1O A;  3CRK C;  4JC0 A;  2WKD A;  1TWH B;  4K6D A;  2O5I C;  3CPW A;  1CSP A;  2UXC L;  2Q2T A;  1GO3 E;  5C3E G;  4B9X A;  2JA5 H;  3KLS X;  1SE2 A;  4HED A;  3M4Q A;  3D3R A;  1G51 A;  1VQC A;  4N9T A;  3TSS A;  3G71 A;  2UXB Q;  5E4X A;  3WWV A;  3FKI G;  4DV4 L;  4KY7 A;  3BZD B;  3NK9 A;  3JC6 6;  2E2H H;  1WOC A;  4P71 A;  2M00 A;  3AU7 A;  5CMD A;  4R4T A;  2ZJR A;  2M9V A;  3T56 B;  4A3B B;  3ZJY C;  1B1Z A;  4PMC A;  4CJ2 C;  2UXC Q;  2PZW A;  1GUO A;  3CCL A;  1J5E Q;  1C4Q A;  5EQ0 A;  3F2D A;  4NDX A;  1Y1V G;  4XQN A;  4LFC Q;  1FJG Q;  2KOL A;  1BBU A;  1E0B A;  3HOZ B;  1HNZ Q;  3SR1 A;  1TXY A;  4V19 0;  2F0U A;  3IKJ A;  1ILP A;  2K52 A;  4KHP Q;  4AIM A;  5IOD A;  5M5Y H;  1MIU A;  2E5L Q;  1SN8 A;  3HOU B;  5E7N A;  1GUW A;  2LS0 1;  2ICI A;  4EQO A;  5TSS A;  1MI2 A;  4KN4 C;  1TWG B;  1D8L A;  5DAU A;  2K1B A;  3G6J B;  4C3J G;  3FHW A;  4FXG C;  5FJ8 H;  1XMO L;  1O7L A;  3A5U A;  2KCM A;  4M8A A;  2R93 G;  1PTO B;  4DNI A;  4F7X A;  3VYS A;  1WTW A;  3J7A F;  2Z9H A;  3W1B A;  2XIW A;  1D5Z C;  1ET6 A;  2JA6 B;  1CHQ D;  4JI6 Q;  4L63 B;  3BJU A;  1V8Q A;  3TBI B;  2X6G A;  1IW7 D;  4P74 A;  4LFA Q;  1JOR A;  2EXD A;  1MHW C;  3FPP A;  3K5L A;  1RD9 D;  1VQG A;  2NN6 H;  2YTX A;  1XTD A;  3GTG H;  1HXY D;  2NVY H;  4S3S A;  3PUZ A;  3RLF A;  2N8N A;  3F2B A;  2L15 A;  5C3E H;  2JA5 G;  3M85 A;  3BS1 A;  4X64 Q;  1X32 A;  3HOX H;  1PTO C;  3K8A A;  2QDB A;  1NR4 A;  5DNF A;  3K7U C;  1NUC A;  2NTS A;  3J80 i;  2B2V C;  3D4D A;  4OO1 H;  1SFO B;  2KHI A;  3IRB A;  3MZ5 A;  2EYH A;  1CA6 A;  2ENB A;  4BA2 I;  2QW7 A;  2X6L A;  3I72 A;  1Y1W G;  3C46 A;  4C2M H;  2H5X A;  2A68 D;  3T53 B;  1OXV A;  2DY8 A;  1NTG A;  5CV7 A;  4LUO A;  5KNC A;  2EYM A;  1CK1 A;  2XNA C;  2F0S A;  1WYD A;  1BDO A;  1H9S B;  1EUJ A;  2UXD L;  1Q1B A;  1PRT C;  4LF8 L;  1SRO A;  2RDH A;  4RGT A;  1ICW A;  1XNR Q;  4GS3 A;  4JI1 Q;  1RTN A;  1WJJ A;  1YIJ A;  2HQL A;  3OTO L;  1CA5 A;  1DD2 A;  3EVQ A;  4PG3 A;  3VYR A;  1I94 Q;  2EYJ A;  4JV5 Q;  4OIJ A;  3VA5 A;  3Q0A A;  4HIK A;  4DK3 C;  2B63 G;  1N32 Q;  2PW5 A;  1DYQ A;  3O13 A;  3KF8 A;  1SDF A;  5C5M A;  2JSO A;  1Q8I A;  4ZLT F;  5ELE A;  4IN3 A;  2VS1 A;  3KJO A;  2PQE A;  1S72 A;  2NVT B;  1OXS C;  3G7L A;  5IT9 E; 
#chains in the Genus database with same CATH homology
 2PMZ E;  1X56 A;  3FP9 A;  4HJA A;  4A3D H;  1E3P A;  4OO1 I;  3CCM A;  3AQQ A;  1LTL A;  3PUV A;  2B3G A;  4YY3 L;  2VW9 A;  2B63 H;  4AYB E;  3MEF A;  4X65 Q;  3I4N G;  4HJ7 A;  1P16 A;  1HNX Q;  1Q1E A;  4DKA C;  2HIX A;  2WAQ E;  3E0E A;  2F4V Q;  2VNU D;  2UXD Q;  4GKK Q;  4A3K H;  3B6Y A;  4XIG S;  4DR3 L;  1PH7 A;  4L5T A;  1JJG A;  2Z0S A;  2HHH Q;  2E8G A;  2DGY A;  1KXL A;  1KQS A;  4B3T Q;  1KD1 C;  3UDF A;  5C44 H;  2WAQ G;  1LUZ A;  4A3G G;  1CKN A;  2DUD A;  1I3Q H;  3GTL H;  3S2H H;  3LGJ A;  2K75 A;  1IXR A;  2NVX H;  4IFD I;  1BKB A;  1YHQ A;  5AJ3 Q;  4APV A;  4YWL A;  1L1O B;  3G48 A;  1NJI C;  3GTP H;  1UE7 A;  4IJH A;  1Q82 C;  2JEB I;  2CKZ B;  2MO1 A;  4A4I A;  1YI2 A;  2VQF L;  4POG A;  4YCW A;  1IBK L;  3S24 A;  3CCJ A;  5C4X G;  1A8V A;  2AHO B;  4QIW E;  3UDX A;  4DV1 Q;  4DR5 L;  3G4S A;  4BBR G;  4DK6 C;  4AH6 A;  1HNW L;  1Y1V H;  5IE8 A;  3KJP A;  1EIY B;  2UXC L;  3HKZ G;  4X62 Q;  1WFQ A;  2E5L L;  2JA7 H;  3PIO A;  3DM3 A;  4P75 A;  1HZB A;  4QY7 A;  1Q86 C;  1ASZ A;  3HOY G;  1CUK A;  1YBY A;  4GOP A;  2MQH A;  4JI2 Q;  1PFS A;  5M5X H;  4JBW A;  5GRO A;  3RLO A;  3SGI A;  3CME A;  1VQ5 A;  1VQN A;  2R92 G;  3S14 H;  2GVB A;  2I5L X;  4JI0 Q;  2ZJQ A;  1FL0 A;  1EIF A;  1Q46 A;  2VZA A;  4GLV B;  5M3M H;  3J7Z C;  1PH5 A;  1G29 1;  4NXM Q;  2B29 A;  4LUV A;  4IPD A;  4DV3 Q;  2GN5 A;  4BA1 I;  5JEA G;  2CCZ A;  3I4N H;  4DR4 Q;  1GKH A;  3PSI A;  5JJK A;  4HIO A;  4Y7N H;  4LUZ A;  3NEN A;  2JEA I;  4A3E H;  1J5E L;  2IX0 A;  4JI7 L;  3J80 c;  2K50 A;  1UWV A;  2VY3 A;  5GQO A;  2K5V A;  4GKK L;  3GTJ H;  2AMC B;  1YHA A;  1KRS A;  5FJ8 G;  2Q2U A;  4O2D A;  3STB C;  4OXP A;  1KIX A;  3AYH B;  4LFA L;  3HKS A;  2UXB L;  5GAG C;  4MTN A;  1OTC A;  3ICE A;  2FXQ A;  2ZTE A;  4B3M Q;  1QVC A;  4JYA L;  3PO3 G;  4QQB X;  2LSS A;  4GN5 A;  2JA8 G;  2KCT A;  4A3I G;  4QL5 A;  4A3J G;  1JE5 A;  3J7A 5;  4KLK A;  4LFB Q;  1CKN B;  3GDE A;  2QGQ A;  4BBR H;  1L0W A;  4HJ5 A;  4TQU S;  2Z6K C;  1PH8 A;  3F8T A;  1VQA A;  3GTM H;  2CWP A;  2C35 B;  1XNQ Q;  4LF5 L;  1QZG A;  3HOY H;  2JK8 A;  3FKI H;  1K73 C;  4BBS H;  2ZM6 L;  1LM0 A;  3GTQ H;  1VQ7 A;  4DR6 L;  3PUY A;  2CFM A;  5IWA L;  3S17 H;  2WB1 G;  1XMO Q;  1VQ4 A;  4GNX C;  4AQY L;  2R7D A;  3U50 C;  1G6P A;  3UE0 A;  3TS2 A;  2NN6 I;  4OWW B;  1VQI A;  3PF4 A;  4C3H H;  4YCV A;  4PZ6 A;  3MXN B;  1FVI A;  1VS0 A;  3S1R H;  4X65 L;  3M3Y H;  1E22 A;  3CCE A;  1RL2 A;  1TWA H;  1HZA A;  1W2B A;  3UDG A;  4JI1 L;  4DV5 Q;  4YWK A;  2MO0 A;  4JCV E;  1YJW A;  4DV1 L;  1UEB A;  1NMG A;  4IPC A;  3STB D;  1PH3 A;  3H0G G;  1Q81 C;  1SE8 A;  1S3O A;  3M4P A;  4JOI A;  4LF6 L;  3CCV A;  3I2Z A;  2IX1 A;  2JA8 H;  1PVO A;  4R4O A;  4H02 A;  1Q8K A;  2K14 A;  2BH8 A;  2NN6 G;  1SLJ A;  4A3K G;  2YTY A;  2Q2I A;  2VQE L;  4LF9 Q;  2JA6 G;  1TWC H;  3AFQ A;  4JBK A;  3T1Y L;  1IBL L;  2ID0 A;  4HIM A;  1HR0 Q;  2UUB Q;  1K8G A;  4R4Q A;  1XMQ L;  3DLL A;  4BXX G;  1U0L A;  4LFC L;  1FJG L;  2V1C C;  1X3G A;  1KHI A;  1YZ6 A;  4A3J H;  3J81 i;  2VQE Q;  2E2I H;  4NXM L;  2QA4 A;  2IHE A;  3E9H A;  2OQ0 A;  3T1H L;  3H0G H;  1EQR A;  4R4C A;  3CF5 A;  5LMN W;  1HR0 L;  3GTO H;  2UU9 L;  3CXC A;  4A3L H;  2NZO A;  5BR8 L;  4DV7 Q;  3ULP A;  1RIP A;  3CCS A;  3PCO B;  3K81 C;  4R1J A;  4JG2 A;  4BBS G;  3OTO Q;  2JA6 H;  1K9M C;  2KHJ A;  1O7I A;  1V43 A;  3HOV G;  3ULL A;  2WP8 J;  2I5H A;  1VQM A;  4QJF A;  5J3B A;  5DLQ E;  5GAE C;  4R4I A;  1YNX A;  3F2C A;  3KOJ A;  1IL2 A;  2A8V A;  1DGS A;  1JJC B;  3U58 A;  3CC2 A;  4C3J H;  4O0A A;  5M3M G;  3G6E A;  3CCR A;  4JI5 Q;  4JI4 L;  4X6A H;  2UUB L;  5H1S E;  4GN4 B;  3KF6 B;  4IJL A;  4KHP Q;  3I4O A;  1CKM A;  1B8A A;  3I56 A;  3OW2 A;  1GM5 A;  1CSQ A;  1BVS A;  4KI0 A;  3EIV A;  3HOV H;  3E9I A;  4JOI C;  4DR2 L;  2OCE A;  4PZ8 A;  1XNQ L;  3H3V I;  3KFU A;  1EWI A;  3HOZ G;  2JA9 A;  5FLM G;  2UUC Q;  1QVF A;  2VUM G;  3KYH C;  1MKH A;  1N34 Q;  1HH2 P;  4UP8 A;  4IFD G;  1HNX L;  4IPG A;  1N36 L;  4A3M H;  3HOX G;  4JI3 Q;  3S2D H;  3I4M H;  1WI5 A;  2OTJ A;  1A0I A;  1T9H A;  4JI6 L;  2RHS B;  1N34 L;  4GOP B;  4LF8 Q;  4B3M L;  4JYA Q;  1E24 A;  4GNX A;  2Y0S G;  3KF6 A;  1EOV A;  3Q8D A;  4BY1 H;  2OTL A;  3PO3 H;  3CP0 A;  4K0K L;  4A93 G;  4X64 L;  2PI2 E;  3L0O A;  4FDB A;  1KRT A;  5JEA J;  4MZ9 A;  1E7Z A;  3CD6 A;  1A63 A;  2IY5 B;  3EBE A;  1NE3 A;  3PUX A;  2ES2 A;  1K0R A;  4A3M G;  1VQH A;  5HGQ A;  1IBM Q;  4GNX B;  3PUW A;  4JI7 Q;  1N32 L;  4DR7 Q;  1Z47 A;  2ALY B;  1JJ2 A;  3I4M G;  1XJV A;  4YHH Q;  4A3C G;  1Y14 B;  5LMN L;  3PO2 H;  2I0Q A;  4DAM A;  2IT1 A;  4PMW A;  1OXX K;  3RN5 A;  5FLM H;  2BA0 A;  3H15 A;  3CMA A;  2YTV A;  3CPF A;  4X66 Q;  3W1G A;  4LF9 L;  2N3S A;  1PH4 A;  3BZC A;  3L2P A;  3CAM A;  2I5M X;  5JJI A;  1XNR L;  4BY7 G;  5IP9 G;  2MFI A;  3ULJ A;  5BR8 Q;  3ERS X;  4JBJ A;  4ALP A;  3PF5 A;  1VQK A;  3I7F A;  4L5R C;  4LF7 Q;  1SMX A;  2VL6 A;  2XTI A;  3PV0 A;  3L7Z C;  1R9T H;  4RMF A;  1QZH A;  3NEM A;  3S1M H;  4DV7 L;  4OWT B;  2VQF Q;  1PH6 A;  2R92 H;  5C4J H;  3H3V H;  4B3S Q;  2AKW B;  4C3I H;  5LMN Q;  5HY6 A;  4GLX A;  4LW1 A;  1YEZ A;  2ZTD A;  1PHJ A;  1V9P A;  2D0O A;  3PIP A;  4JI8 Q;  2HT1 A;  2JA7 G;  4DR7 L;  3D0F A;  3TS0 A;  3GTK H;  4BY1 G;  5IWA Q;  3CCU A;  1L2F A;  2PI2 A;  4A76 A;  4A3F G;  5GAD C;  3K80 C;  4DPG A;  2KBN A;  4B3S L;  4LF4 L;  4A3C H;  1HR0 W;  1E1O A;  1UE6 A;  4A3E G;  4DR1 L;  1QVG A;  2R7Z H;  4L5S A;  2GVA A;  2NVT H;  4UP7 A;  3AFP A;  3PGZ A;  3A74 A;  1YJ9 A;  1Q12 A;  4UP9 A;  4IO9 A;  3RZD H;  4DV0 Q;  1GVP A;  5IYC H;  4JI3 L;  2WB1 E;  2YV5 A;  1IBK Q;  3AEV A;  4YY3 Q;  1M1K C;  4L5Q A;  4NXN L;  3NBH B;  4YCU A;  1VQD A;  2PQA B;  4B3R Q;  5JJL A;  1HNZ L;  4A3I H;  4AYB G;  2NZH A;  2IHF A;  3M9B A;  5GAH C;  3TRZ A;  1D7Q A;  1SRU A;  3HOW H;  4J15 A;  4IOA A;  2LXK A;  2F3I A;  1L1O A;  4A3D G;  4JI8 L;  4JC0 A;  2JQO A;  4EX5 A;  2CQO A;  4P73 A;  3KLW A;  5ELN A;  2ZM6 Q;  3CPW A;  5M3F G;  5IYC G;  1M90 C;  1CSP A;  2ZTC A;  1C7Y A;  1IZ6 A;  1GO3 E;  5C3E G;  4GN3 B;  2JA5 H;  1HJP A;  4YWM A;  2Q2T A;  2YU9 H;  1XPO A;  3M4Q A;  2VUM H;  4LNQ A;  1G51 A;  2K4K A;  4DV2 L;  1VQC A;  3TRE A;  3UDI A;  3G71 A;  2UXB Q;  5IY0 A;  3K0X A;  3WWV A;  2R7F A;  3FKI G;  2Z6K A;  4DV4 L;  4KHP L;  4NB3 A;  4IOC A;  1PYS B;  2PNH A;  4ME3 A;  3JC6 6;  5C0X I;  1N8R C;  1PV4 A;  2E2H H;  1WOC A;  2K5H A;  4P71 A;  3W5O A;  3J81 j;  3M4O H;  4POF A;  1NBW A;  1EQQ A;  3RLN A;  4R4T A;  4GKJ L;  1QUQ A;  4A93 H;  2ZJR A;  1GD7 A;  3ZJY C;  5C44 G;  4LF4 Q;  2UXC Q;  1I6H H;  3S1N H;  4DR2 Q;  1E1T A;  3KDF A;  1J5E Q;  3CCL A;  1UE5 A;  1LYL A;  2WFW A;  2E2J H;  3D31 A;  1WCM G;  3F2D A;  1U5K A;  1Y1V G;  1AH9 A;  4LFC Q;  1FJG Q;  5AJ3 L;  4WJ3 M;  3CW2 C;  3PO2 G;  1VQJ A;  4DUZ Q;  1BBU A;  5IYD H;  4IFD J;  1NY4 A;  4OON A;  1TWH H;  4DUY Q;  4JI2 L;  3UE1 A;  5C4X H;  4HJ9 A;  1HNZ Q;  3CC4 A;  3S15 H;  1VQF A;  4JI0 L;  1TXY A;  4A3L G;  1PYB A;  1B7Y B;  1HNW Q;  1VQ9 A;  2UUA L;  2K52 A;  2F4V L;  3NEL A;  3CC7 A;  4AIM A;  4JBM A;  3A0J A;  1AE3 A;  1L1O C;  5M5Y H;  2QEX A;  4BXX H;  1MIU A;  2E5L Q;  1SN8 A;  1WCM H;  4WJ4 A;  4Y52 H;  5IP7 G;  1KAW A;  3K7A H;  5E7N A;  1HZ9 A;  4TVA B;  3J81 c;  2NVQ H;  3HOU G;  1BBW A;  1K83 H;  2ATW A;  5C0X J;  2UU9 Q;  4KHZ A;  4OX9 Q;  1D8L A;  4DUZ L;  2PQA A;  1W3S A;  3FHW A;  2AWO A;  3U4V A;  5FJ8 H;  1Z9F A;  3BZK A;  3HFZ B;  1V1Q A;  1X6O A;  4AQY Q;  1XMO L;  1EYG A;  4A3B H;  3F1Z A;  3A5U A;  2KCM A;  2R93 G;  2JJQ A;  1S40 A;  5IP9 H;  1YIT A;  3S1Q H;  2ASB A;  4DNI A;  5FLX c;  3ER0 A;  5IYB H;  2OWO A;  4DR6 Q;  1IYJ B;  2MNA A;  1C9O A;  1PH1 A;  4HID A;  1N33 L;  4GKJ Q;  1C0A A;  2RCN A;  4LFB L;  4NPS A;  2HHH L;  5K36 G;  3HOZ H;  3W1B A;  3CCQ A;  5LMU Q;  4NXN Q;  4LF7 L;  4P72 A;  1FGU A;  4LF6 Q;  4A3G H;  4DV0 L;  1NMF A;  1Y1W H;  4A3F H;  4JI6 Q;  2R93 H;  5IT9 c;  1YHB A;  3BJU A;  4QGU A;  2D0P A;  4DV2 Q;  4X66 L;  4P74 A;  4EQ5 A;  4LFA Q;  3HOU H;  2EXD A;  2JE6 I;  2D62 A;  2K5N A;  1MJE A;  1VQG A;  5LMU L;  2YTX A;  1VCI A;  1KC8 C;  1TWG H;  2R6G A;  4HJ8 A;  1XTD A;  2KEN A;  3GTG H;  1X3E A;  2NVY H;  2Q2H A;  1MJC A;  2AWN A;  4A75 A;  1P8L A;  3PUZ A;  3RLF A;  1XMQ Q;  1JMC A;  1AE2 A;  4DV6 L;  3S16 H;  2N8N A;  4JI4 Q;  2CWA A;  3F2B A;  1VQP A;  3GD7 A;  4OWX B;  1B70 B;  4JI5 L;  2L15 A;  1K3R A;  5C3E H;  2JA5 G;  3BU2 A;  2RHQ B;  3M85 A;  3OYY A;  4X64 Q;  2N49 A;  4XTC S;  3HOX H;  1SR3 A;  1I94 L;  3TEH B;  3K8A A;  1I5F A;  5IYB G;  3K7U C;  2A1A A;  3J80 i;  1KL9 A;  1CKO A;  5M3F H;  1OXU A;  1XPR A;  3GO5 A;  1HZC A;  4X62 L;  4DR1 Q;  1PH2 A;  1N36 Q;  2KHI A;  3IRB A;  1N33 Q;  1XPU A;  3KF8 B;  2UUA Q;  4DUY L;  4IPH A;  2Y0S E;  3T1H Q;  2LXJ A;  1PA6 A;  2RF4 A;  3M7N A;  4UPA A;  3U4Z A;  1JB7 A;  3RR5 A;  4BA2 I;  4JV5 L;  1J6Q A;  1X3F A;  1Y1W G;  1VQ6 A;  4BY7 H;  4C2M H;  4MNO A;  2H5X A;  1OXV A;  4DV3 L;  1NTG A;  4OX9 L;  4DR4 L;  4LUO A;  4LWC A;  2HIV A;  1VQB A;  4GOP C;  3T1Y Q;  1IBL Q;  1X65 A;  3RNU A;  1WYD A;  3A5Z B;  1Q7Y C;  1EUJ A;  2UXD L;  2N78 A;  1X55 A;  4RG1 A;  1Q1B A;  5EAY A;  5ELO A;  4LF8 L;  1SRO A;  1VQ8 A;  4DV4 Q;  2YYZ A;  1ASY A;  3RN2 A;  1PH9 A;  1K8A C;  1XNR Q;  4GS3 A;  1TWF H;  2EIF A;  1WJJ A;  4JI1 Q;  5M5W H;  1A62 A;  2HQL A;  3TQY A;  4DV5 L;  1YIJ A;  1YVC A;  5IYD G;  3OTO L;  2BH2 A;  4PZ7 A;  3CQZ H;  5IP7 H;  1QUQ B;  2BA1 A;  4DR5 Q;  1OXT A;  2A19 A;  2XGT A;  2UUC L;  3JAM c;  1YJN A;  1SFO H;  2ZJP A;  4PG3 A;  1I94 Q;  1I50 H;  4JV5 Q;  4DV6 Q;  4YHH L;  2R7Z G;  3VDY A;  1VQO A;  1X9N A;  1VQE A;  1X54 A;  4HIK A;  1IBM L;  4OO1 G;  4DK3 C;  3HOW G;  2B63 G;  1N32 Q;  1N9W A;  4UY8 C;  4GLA C;  4LF5 Q;  5C0X G;  2F52 A;  1UE1 A;  3HKZ E;  3RZO H;  3JAM i;  4B3T L;  2EQS A;  4B3R L;  1EFW A;  1VQL A;  3KDF B;  4DAY B;  4DR3 Q;  2VS1 A;  2OQK A;  3KJO A;  4K0K Q;  1JT8 A;  1S72 A;  3EN2 A;  1H95 A;  1OXS C;  4A3B G;  3I55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...