2WAQG

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2waqG00
4GNXB 1UEBA 4GOPC 2Z6KA 4DUZL 4JOIA 3GTQH 1XNRQ 3IRBA 4X6AH 4LFCQ 5JJLA 1V9PA 3U4ZA 5GAGC 1YITA 2KCMA 1EQRA 4IO9A 4B3MQ 1UE7A 1FGUA 3PUVA 3KJPA 1A8VA 2LXKA 4DV2L 3ICEA 2D0OA 1TWGH 1Y1VH 4DV4L 5GQOA 3TEHB 4R1JA 1FVIA 3K0XA 4C3IH 5C3EG 3PUWA 2ZJPA 1SROA 4BY1H 3OYYA 2I5LX 4LUVA 5JJKA 1U5KA 3PIOA 1HNZL 1JMCA 4DR1Q 3CF5A 3PO3H 3J81c 5ELOA 1KHIA 3RLOA 2QEXA 1PA6A 3F2BA 4DUZQ 4AQYQ 4MNOA 1BKBA 2E5LL 5LMNQ 4KHZA 2C35B 3KF6B 1JJ2A 3L2PA 4EQ5A 4XIGS 1X6OA 4A93H 3BZKA 1MJCA 4DV2Q 1NJIC 4LF4L 4NXNQ 3JAMi 3M7NA 1XTDA 1PFSA 2AMCB 2D62A 3UE1A 1Y1WH 1MKHA 3T1HL 1TXYA 4OO1I 2MQHA 2NVTH 2UUCQ 3T1YL 5LMUQ 1HNWL 4YCWA 4IFDJ 2R7ZG 4NXML 2ATWA 1OXUA 3M4PA 4JI2Q 1K9MC 5IP7G 2UUAL 2A1AA 2JK8A 4R4OA 3G48A 4K0KQ 2E5LQ 1VQJA 4DR5Q 1HR0W 4RMFA 1OXSC 1SLJA 2ZTCA 4R4TA 3EN2A 2VS1A 1CKOA 2NVYH 3CW2C 4DR4L 4LF4Q 4A3GG 2RHQB 2I5MX 1Y14B 1VQOA 2BH8A 1YZ6A 1A62A 2VW9A 3F8TA 1GKHA 3NELA 4DR3L 1S40A 4IFDI 4JYAQ 2HT1A 1BBWA 4XTCS 3T1YQ 1IBKL 3K80C 4QIWE 3GTPH 2OWOA 4QQBX 4IFDG 4BBSH 2XGTA 1W3SA 4DAYB 3GTGH 3HOVH 4DV7L 3TS2A 2UXBQ 4HIKA 2UUAQ 3AYHB 2IHFA 3CC4A 3B6YA 2R92G 1I94Q 1K8GA 2JA5H 1VCIA 2NVQH 3STBC 1JJCB 4DR4Q 3CC7A 1HJPA 1X55A 1J5EQ 1L1OB 5C0XJ 1NBWA 4QGUA 1C7YA 4A76A 1H95A 5C4XG 1Q82C 4KHPL 1Y1VG 3S16H 1YHAA 3M9BA 3U50C 4DR3Q 1FJGL 1L1OC 2LXJA 3RNUA 4DR7Q 2HIXA 5M3FH 1N32L 1MIUA 2MFIA 3FHWA 2VQEQ 3W1GA 5C3EH 1WI5A 4A3FG 1VQ7A 4JBJA 4JI7L 4O0AA 5C0XI 2UXDL 2Q2HA 5AJ3L 4DK3C 1S3OA 1N34L 2CWPA 1PH6A 3VDYA 1CKNB 1RIPA 2V1CC 2HQLA 4LUOA 5IWAL 1VQ4A 1K8AC 2VQFQ 1WYDA 4X65Q 3I55A 1HR0L 2PQAB 1KQSA 3S1QH 2F3IA 1N32Q 1D7QA 4MZ9A 1KAWA 1TWAH 5LMNW 1D8LA 1E1OA 1WFQA 2EIFA 1HZAA 2JE6I 2ASBA 2WP8J 3CP0A 1YIJA 1VQ6A 5H1SE 4A3LH 2R93H 4JI4L 4NB3A 4Y7NH 1ASZA 1VQPA 4LF7Q 2UU9L 4KI0A 3K8AA 3CCMA 1UWVA 3H0GH 1VQIA 5IWAQ 3CQZH 4PZ7A 1QUQB 4JI0L 4JI3Q 4WJ4A 4X64Q 2JEBI 1N9WA 4JG2A 1IXRA 4PZ6A 3OTOQ 1XMQQ 4A3GH 2A19A 4JI8L 2YTVA 4JI6L 4BBSG 3BZCA 1YHQA 2E2JH 2Y0SE 4DV0L 3OW2A 1PH8A 4DUYL 4ALPA 1I5FA 3STBD 1UE5A 2JA5G 2IT1A 4JI4Q 1XNQQ 2K5HA 3KLWA 2PI2E 4IPCA 1YJ9A 1VQ9A 1M90C 2R92H 2E8GA 3I7FA 1MJEA 4R4IA 4DV1Q 4JBMA 2ZTEA 4DK6C 4GNXC 4LNQA 3GTJH 1NTGA 1QVFA 4DV6Q 1PH9A 3S14H 3RN2A 1AH9A 4GKKL 1PVOA 5C4XH 4YWKA 5M3FG 3ER0A 4EX5A 1KRSA 2LSSA 3RZDH 1K83H 3KJOA 3MEFA 2B63G 1X56A 2WB1G 4B3SQ 4OX9L 1NMFA 4JV5L 2JA6H 4LWCA 5ELNA 4LFAL 1SE8A 3S15H 4A3FH 1B8AA 4H02A 3AFPA 5E7NA 1HZBA 1J6QA 1BVSA 4DNIA 4QY7A 1WCMG 2IX0A 3KDFB 3F2CA 4BY7H 2IHEA 4DAMA 1QZHA 4LFBL 1VQHA 2HIVA 1LTLA 1K73C 4B3TL 5HY6A 3S17H 1Q8KA 2JEAI 5GROA 4POGA 4GKKQ 3RR5A 1IYJB 2N78A 4LF9L 1Z47A 2CWAA 4AYBG 3M3YH 3DM3A 3J81i 4DV4Q 3G6EA 2YYZA 2YTYA 2I5HA 1TWHH 1HNZQ 2MO1A 5GAEC 1K3RA 4OX9Q 4A3LG 1VQBA 3AFQA 4YWMA 1N8RC 2RHSB 4JV5Q 4OO1G 4LFAQ 2R93G 3SGIA 4A3JG 1R9TH 4C2MH 1PYBA 5IP9H 1A63A 2Z6KC 2PI2A 1O7IA 3H0GG 1CUKA 4A3DG 1QVCA 4LFBQ 3PUXA 1C9OA 1N33L 3PCOB 3U58A 2DGYA 4GN5A 3CD6A 2YTXA 1E24A 1Q1EA 3TREA 1TWCH 4JCVE 3T1HQ 2FXQA 4LUZA 3E0EA 3PO2H 1YJWA 1VQDA 1HNWQ 2VZAA 1Q1BA 1E22A 3NBHB 2HHHL 2UUBL 3TQYA 4LF5L 3CCLA 4NXMQ 3CCVA 4HJ9A 3L7ZC 3CXCA 1Q86C 1GM5A 1JJGA 3FKIH 2AKWB 5EAYA 2RF4A 2VY3A 3CMEA 4BA1I 4C3JH 4P72A 4J15A 1U0LA 3PGZA 3HKZG 2BA1A 3CCEA 2R6GA 2OCEA 3S1NH 2N3SA 2RCNA 1NE3A 2F52A 1N33Q 3LGJA 3GO5A 4OWWB 1EYGA 1SN8A 4R4QA 4GLVB 1HZ9A 3HKSA 2CQOA 4Y52H 5GAHC 1NY4A 1G51A 3CCUA 1IBKQ 2WAQG 1SMXA 4X62L 3M4QA 2CKZB 2GN5A 1LYLA 4IJLA 3A5UA 2IX1A 2JA6G 4DV7Q 3HOXG 1G6PA 2OQKA 2MNAA 2NVXH 5M5YH 3EIVA 2B63H 3HOWH 4BY7G 4L5SA 3CAMA 4A3EH 5K36G 4KLKA 5BR8L 4HJ8A 4YY3L 3RZOH 5C0XG 3CC2A 1V1QA 2Q2TA 2F4VL 4KHPQ 1WCMH 2KHIA 2K14A 1PV4A 4OWXB 1EWIA 1XMOL 1E3PA 4TQUS 3I4OA 1FJGQ 4BXXH 3RLNA 3RLFA 1Q12A 1A0IA 2N49A 2B29A 5IYCH 4X62Q 1UE1A 1Q81C 1VQNA 2EXDA 2JQOA 3UDXA 1OTCA 4IOCA 1SR3A 3NENA 2BH2A 5FLXc 4DV3L 4HJ5A 1AE3A 2YU9H 4DR6L 3HOZG 4JI7Q 4BBRH 1VQKA 1CKMA 2XTIA 5IP9G 2UXDQ 5AJ3Q 3H15A 3H3VI 4YCUA 3K81C 5BR8Q 1PYSB 3HOYG 1N34Q 1HNXL 4A3JH 4DR2L 4GOPA 4DPGA 2AHOB 2ZM6L 4LF8L 2K5VA 5HGQA 3ERSX 3A0JA 3PUYA 4DV5L 3BU2A 4A3DH 1RL2A 1VQEA 4GNXA 1IBML 2R7DA 1IL2A 3PO2G 2GVBA 1HR0Q 2QGQA 3UE0A 1XJVA 5IY0A 3JC66 3PSIA 2ZJRA 1Z9FA 4FDBA 2ID0A 4JI5L 1W2BA 1X3FA 4A3BH 4DV3Q 4A3CH 2A8VA 4DR6Q 3FKIG 1B7YB 4L5TA 4DKAC 3E9IA 1XPRA 2JA7G 4QL5A 4P75A 4A4IA 3M85A 4QJFA 1P8LA 1N36L 1HNXQ 2OTLA 3I4NH 2UU9Q 4DV5Q 1XNRL 3NEMA 4LFCL 3GD7A 3GTOH 1PH5A 4JI0Q 4WJ3M 4GKJL 4LW1A 1YNXA 4OONA 4P74A 2N8NA 1KL9A 4JI8Q 1PH2A 4JI6Q 3KF6A 1M1KC 4A3MH 4LF6L 1WJJA 1K0RA 3S1MH 4DV0Q 4BA2I 4IJHA 4DUYQ 1QZGA 3S24A 2DUDA 1CSPA 3CCJA 3BJUA 3KF8B 3J81j 3HOWG 4A3EG 4AIMA 1Q46A 3CCSA 2L15A 4DR1L 1JB7A 2VUMH 3HOXH 4JBKA 1VQAA 1GVPA 3Q8DA 3CMAA 5IYDG 4RG1A 4AQYL 4L5RC 1BBUA 3ZJYC 5LMNL 4BXXG 4GKJQ 1EIFA 2E2IH 3PUZA 1PHJA 2JA8H 1X3GA 5IYCG 1WOCA 5FJ8G 4LF6Q 3G4SA 2QA4A 4HIMA 1YI2A 2OQ0A 4NXNL 3W1BA 1T9HA 1VQCA 1VS0A 2JJQA 5IYBG 5JJIA 1OXTA 2UXCL 1L2FA 3ULLA 1SRUA 3J7ZC 2UUCL 4BBRG 4B3RL 3PF5A 2K75A 5LMUL 1KXLA 3JAMc 2Q2UA 1OXXK 2E2HH 4JI2L 1JT8A 1AE2A 2B3GA 4TVAB 3HOZH 4P71A 1X65A 2PMZE 4K0KL 4DR5L 1YEZA 4JOIC 4PMWA 1EIYB 3E9HA 4B3TQ 2PNHA 3CPFA 3HOYH 2K50A 3ULJA 3CPWA 3RN5A 3UDFA 2WB1E 4UP9A 4A3KH 1EQQA 2I0QA 1CSQA 4LF9Q 3H3VH 2D0PA 1HH2P 3A74A 5IE8A 1VQFA 1Q7YC 4A3BG 2KHJA 1FL0A 4A3IH 4A3CG 1L1OA 1KD1C 1SFOH 3J7A5 2UXCQ 3KOJA 4JYAL 3I2ZA 2NN6I 3GDEA 4B3RQ 4YHHL 4IPDA 3ULPA 1GO3E 4PG3A 1XPOA 1OXVA 1JE5A 1I50H 2NN6G 3J80c 5M5XH 1EFWA 3HOUG 3KFUA 4IOAA 1TWFH 3I4NG 2UXBL 4AYBE 4JBWA 1I94L 2JA7H 1PH7A 1UE6A 4L5QA 2Z0SA 3I4MG 1X54A 1PH1A 1J5EL 1V43A 3G71A 1B70B 1LUZA 1P16A 2K5NA 4GN4B 5DLQE 2YV5A 4A3MG 1YJNA 2ZJQA 4A75A 2VL6A 4YWLA 3J80i 3PF4A 5JEAJ 2K4KA 5C44G 5M5WH 2GVAA 1I6HH 1CKNA 1EOVA 4HIDA 2H5XA 4P73A 3GTKH 3MXNB 3PV0A 4YHHQ 1VQ5A 2HHHQ 2UUBQ 4LF5Q 4DR7L 1X3EA 5M3MG 2VUMG 3F2DA 2PQAA 2VQEL 3M4OH 3FP9A 3KYHC 4GLAC 3I56A 1KIXA 2NZOA 1YBYA 3D31A 5FLMH 1X9NA 4UY8C 2K52A 2MO0A 2EQSA 1ASYA 3K7UC 4X66L 1YHBA 3CCQA 2JA8G 4JI1L 5GADC 1G291 4IPGA 1VQMA 1QVGA 2OTJA 2WFWA 1EUJA 5IYDH 1XPUA 4OWTB 2CFMA 5J3BA 2BA0A 5JEAG 3CCRA 1VQGA 2VQFL 4BY1G 5FJ8H 1IBLL 2AWNA 3UDIA 4X65L 3AQQA 3HKZE 4YCVA 1QUQA 4AH6A 4UP7A 3AEVA 1LM0A 5IYBH 3PO3G 4ME3A 1KC8C 4GLXA 1DGSA 2ES2A 1VQLA 3L0OA 3HFZB 5IT9c 3U4VA 2WAQE 4YY3Q 4X66Q 4JI1Q 4R4CA 2Y0SG 2R7FA 4A93G 3A5ZB 4A3KG 2F4VQ 4LF7L 1E1TA 4MTNA 4O2DA 3F1ZA 3S2HH 1XMOQ 4UPAA 3GTMH 1Y1WG 4A3IG 1PH3A 3K7AH 4JI3L 4X64L 1IBLQ 4NPSA 3OTOL 4HJ7A 1XMQL 4POFA 4HIOA 2JA9A 2ZTDA 1C0AA 2KENA 3TS0A 3TRZA 2AWOA 2R7ZH 3HOUH 2IY5B 1HZCA 1YVCA 4JC0A 4DR2Q 1L0WA 3DLLA 1PH4A 1XNQL 4GN3B 5IP7H 2ZM6Q 4LF8Q 4HJAA 1I3QH 3WWVA 1VQ8A 1IZ6A 4OXPA 2Q2IA 3W5OA 4C3HH 4IPHA 2KBNA 4UP8A 2KCTA 4DV1L 1IBMQ 5C4JH 2ALYB 3I4MH 4B3ML 4DV6L 2CCZA 3KDFA 3GTLH 3UDGA 2NZHA 1GD7A 3D0FA 4APVA 4JI5Q 1E7ZA 3HOVG 1S72A 5C44H 1KRTA 2VNUD 3PIPA 3S1RH 4GOPB 3EBEA 1NMGA 4B3SL 5FLMG 1N36Q 3S2DH 5M3MH 4PZ8A 4GS3A
chains in the Genus database with same CATH superfamily
4V0BA 4GOPC 2Z6KA 4JOIA 5I4DA 3IRBA 1YITA 5GAGC 1IYVA 3C1EA 4KD3A 1PTOC 3TEHB 5EGTA 5A2QL 2ZXRA 3A55A 5EPKA 4BY1H 1CM9A 3OYYA 1Q3LA 4LUVA 1T5XD 3K57A 1HNZL 4KY7A 1A3UA 1RJTA 5AFWA 1E0BA 2ZT9C 2Q8IB 2E5LL 3A8JE 5LMNQ 5CV9A 4A93H 2F0NA 4PV1C 4DV2Q 4NXNQ 3A7AB 2AMCB 2A73B 1GOZA 2UUCQ 3T1YL 1TWGB 5KGUA 5LMUQ 2IW3A 4YCWA 5EBCA 4C3IB 1STHA 2K28A 4XYQA 5KNCA 3T16A 1K9MC 2R7ZG 1A15A 3IFDA 2A1AA 2JK8A 4R4OA 1GHKA 4K0KQ 4DR5Q 1HR0W 4RMFA 1YNJC 4F88A 2PZUA 4R4TA 3EN2A 1CKOA 1GUTA 3BVMA 4DR4L 1LTGD 1VQOA 1A62A 4IFDI 3NELA 4KJOA 2HDMA 4FF3A 2AQ3B 4FF4A 2KVMA 1EU4A 4PMCA 3HOVH 1K3BC 1RTNA 2UUAQ 3CC4A 2IHFA 2R92G 1K8GA 1FD7D 3HRZC 2NVQH 4C2MB 1JJCB 2PW5A 4FO2A 1Y1VG 1YHAA 4DR3Q 1F2LA 4WJWA 4NKLA 3SHLA 1NSNS 4DR7Q 1MIUA 4IUVA 4J1MA 2VQEQ 1RHPA 4J6HA 2DY7A 5AJ3L 4FNFA 4K14A 1N34L 1WVLA 2FMMA 5BN5A 3NWSA 2A69C 2HQLA 4LUOA 5IWAL 1K8AC 3A56A 1HR0L 2F3IA 4MZ9A 3I4LA 1TWAH 1E2WA 1TKWB 4IUUA 5M3FB 1HZAA 1C8CA 4A3LH 1ZKOA 1JWMD 2PCFB 2B63B 4Y7NH 4XDXA 2V4DA 1HFGA 2AUKA 4N9PA 3DWQA 1QUQB 1QCBD 4JI3Q 4RCNA 1PLFA 1WCMB 1IXRA 4PZ6A 4RKBA 2A19A 5D3IB 4ILWA 4K2LA 1BUVT 1YHQA 3S1QB 4ALPA 1QNUA 2EJFC 3DM1A 1UE5A 2PI2E 4IPCA 1M90C 2R92H 4A3JB 4GNXC 2XRQD 4DV6Q 3K5LA 4C1NK 3H0GB 3RN2A 1AH9A 2Z4IA 4YWKA 3I72A 2A6EC 1HHVA 2O2LD 4ZCKA 1VF5C 1HQRD 5KYIA 2E2JB 2F0MA 2JA6H 5ELNA 1Q8IA 3RUZA 3F2CA 1ET9A 4B3TL 1K73C 5HY6A 5C0XH 5G3LF 4GKKQ 3HKZB 2CWAA 2FMCA 4JPBW 1RKNA 2YYZA 2YTYA 3JAML 1SNCA 4FF2A 4HCSA 3RZDB 4OX9Q 5I6WA 1VQBA 2F4IA 4YWMA 4OO1G 2RHSB 2NUCA 2KEDA 1PZJD 2P5ZX 3HOXB 1AEXA 1O7IA 4LFBQ 2SNMA 4ZLTF 3CD6A 4QUCA 4ZUIA 2RDFA 4XT3B 2QCPX 3MVVA 1D5ZC 4HJ9A 2CH4W 3OSOA 5TSSA 3CXCA 5EAYA 4G57A 4KTAA 3D4DA 2VB2X 4KV6A 3PGZA 3CCEA 3S1NH 2PZWA 2RCNA 1NE3A 4HR7B 4KY6A 3SEBA 3LNNA 4R4QA 1DOLA 3I91A 3PIO3 2FJ2A 4MIUA 3CCUA 3EA6A 3M4QA 5I9PA 3MZ5A 1SFOB 4RHSA 2K05A 2KCNA 4DV7Q 1WTXA 1G6PA 2A68D 2NVXH 1DONA 1UAPA 1SNPA 4XQNA 2J7ZA 4L5SA 3E6ZX 4KLKA 5BR8L 1FYCA 3TP7A 3VR4A 4YY3L 3RZOH 2B8GA 2Q2TA 1TS5A 2KHIA 1PV4A 1E3PA 1Q12A 1A0IA 1IYUA 1KABA 1VQNA 2EXDA 2JQOA 1JC7A 1G6ZA 2J4XA 4H13C 2A6HD 4OHJA 3GTKB 1AE3A 4ODGA 3UI2A 1VQKA 2UXDQ 5G3LD 2OT2A 4YCUA 3HOYG 1HNXL 2D5DA 5CR3A 5ELDA 2AHOB 1O7ZA 2K5VA 3ERSX 3PUYA 4FP5D 5IIFA 1VQEA 1IBML 1JE4A 3PO2G 3SDZA 4RH6A 3ONAB 4FDBA 5IGGA 1W2BA 4B08A 5C3WA 3FKIG 2RKSA 4DKAC 2JA7G 3TMEA 4P75A 4QJFA 1P8LA 1STGA 3AB9A 2UU9Q 4IN3A 3NQTA 3P20A 4JI0Q 1YNXA 2F0IA 2XIWA 4P74A 5IGFA 1PYWD 3QOLA 1PH2A 4JI6Q 3K7AB 5JVG3 1EYCA 2DUDA 3KF8B 3HOWG 1GXDC 4AIMA 3DMUA 1Q46A 2G5DA 2L15A 1BCPD 4EQOA 1F9PA 1U4MA 3WOEA 1VQAA 1GVPA 3CMAA 2EJGC 4F7XA 1CA5A 5C4HA 1MGSA 5IYDG 5LMNL 4GKJQ 1EIFA 2E2IH 2F3WA 2JA8H 1X3GA 5IYCG 1WOCA 1ICFB 2BE5D 4LF6Q 2F3VA 2QA4A 1YI2A 4NXNL 3I4MB 3Q0AA 1SYGA 1JOOA 1OXTA 3GTLB 3A8KE 3ULLA 1DXMA 1HA5A 4PQXA 2UUCL 2K6AA 3J81L 5LMUL 1PRTC 5C44B 1KXLA 1LT4D 3JAMc 5T1GA 1XWEA 2B3GA 3SK5A 4P71A 4RFBA 2PMZE 4K0KL 4DR5L 1YEZA 4PMWA 1EIYB 1PFBA 2HD3A 3E9HA 2PNHA 3HOYH 2I0QA 3H3VH 1NR4A 2D0PA 2QDBA 2X69A 2UXCQ 4B3RQ 4PG3A 4X3TA 4BY1B 3HOUG 3KFUA 4IOAA 4JBWA 2JA7H 4IURA 4L5QA 1LTID 1X54A 5CBEE 3G71A 1RTOA 1LT5D 1LUZA 2PW7A 3PF4A 3M7GA 4A75A 4YWLA 1O78A 3J80i 4F8MA 2WIIB 4A3KB 4A93B 1Y8PB 2GVAA 2HCCA 1TS3A 4YHHQ 2UUBQ 4DR7L 3SK4A 3H3VC 4QMGA 3F2DA 2VQEL 1I6VC 4L8JA 2B2VC 1G8ZD 2A74C 5M5XB 1YBYA 3D31A 1X9NA 5IODA 4X66L 5GADC 1VQMA 1QVGA 2OTJA 1EUJA 5IYDH 3VR2A 2RA4A 2RDGA 1SYCA 2IJ0A 5JEAG 3S15B 1IBLL 1TY0A 3O13A 1QUQA 4AH6A 4UP7A 4ME3A 1PZKD 2QW7A 3KLSX 3NSWA 2RDHA 2PO4A 3HOVB 2ES2A 1VQLA 3L0OA 3HFZB 2AQ1B 1H9SB 2NVQB 1BOSA 1XMOQ 4TSSA 4JI3L 4KMUC 5CBAE 2E74C 5DNFA 3OWFA 3EFXD 1C0AA 2QKIC 1RCVD 4I7AA 2SOBA 1DJRD 1MSGA 1R4QB 2AWOA 3R2IA 3HOUH 1YVCA 1RODA 1RF2D 1L0WA 3DLLA 5IP7H 1Z7TA 1IZ6A 4OXPA 2Q2IA 4C3HH 5C4JH 1H9MA 1PTOF 4G7OC 4IUPA 4DV6L 2CCZA 3OMGA 1R4PB 5LL6X 3D0FA 4APVA 1V1PB 4JI5Q 1S72A 5A2QE 1TWAB 4ZYSA 1LO5D 5FLMG 3N52A 4GNXB 1UEBA 4CDCC 4KN7C 4Y7NB 1EWCA 1PDQA 2D2CC 1CZWA 2KCMA 2L9HA 1FGUA 1JR0D 5JEAH 5E4WC 1II3A 4R1JA 1F9RA 4DK1A 1STEA 4HN7A 3FMCA 2XVSA 1U5KA 3PIOA 3TDQA 3J81c 5ELOA 2DJFC 1UNSA 2L1BA 1T5EA 4DUZQ 5CV5A 4MNOA 1BKBA 4KKTA 4KHZA 1TT2A 1GUSA 3HGBA 3KF6B 4HMIA 3L2PA 1JJ2A 4EQ5A 3AMUA 2R92B 3GTQB 5KEEA 1MJCA 3QWNA 4LJZC 1NJIC 3JAMi 2EDGA 2D62A 1JICA 2NVTH 4FXGC 4B9WA 2ATWA 4JI2Q 1H9JA 1QJOA 4NDXA 2XWJB 2ZTCA 3CW2C 1XX8A 2NVYH 4LF4Q 4A3GG 1M4VA 2BH8A 4H0LC 3F8TA 1GKHA 1MD2D 2L5TA 3VA7A 1S40A 4X3SA 3K80C 4QIWE 3TBIB 2OWOA 3VYTA 4QQBX 4IFDG 4BBSH 2XGTA 4B9XA 4DAYB 3GTGH 3TS2A 4DV7L 2UXBQ 1PTOD 2QDLA 4BS9A 2JA5H 1VCIA 4YIJA 2WV6D 3CC7A 1V1OA 3NBIA 3LX0A 1L1OB 4N8X1 1F77A 3L9AX 4QGUA 2F0VA 4ID6A 5KIXA 3S16H 3U50C 2LXJA 3BVZA 2HIXA 4A3FG 1ESRA 4JBJA 3TP5A 1EQVA 2UXDL 2CVRA 3LWEA 2Q2HA 4NP5A 1PH6A 3T53B 4KHVA 1CKNB 1EIGA 2V1CC 3S1NB 1VQ4A 2VQFQ 2JP1A 2KA7A 2NBFA 2OEOA 4X65Q 1KQSA 1MI2A 1N32Q 5K5PA 5FLXL 3T51B 1YNJD 1KAWA 1D8LA 1Y8OB 4EVOA 1GJXA 2EIFA 5C5LA 5JPNC 2EY2A 5IT9L 2WP8J 5ISRA 2R93H 2XRSD 4NB3A 2E76C 1D2BA 1UEAB 3KF8A 4FXDA 1IL8A 1VQPA 2UU9L 4KI0A 3K8AA 1UWVA 3K6OA 3RZOB 2IPKD 4K5XA 4JI0L 4WJ4A 1N9WA 4A3GH 2WINB 2YTVA 4XYOA 4JI6L 3J7AV 2Y0SE 1DM0B 1LTTD 1PH8A 4RKLA 3HP3A 2K04A 3HZXA 3QR8A 4FVMA 4IFDH 3DEOA 2IT1A 4JI4Q 2K5HA 1Z6HA 3KLWA 1YJ9A 3I7FA 2LFNA 1EOTA 3GTJH 4MTKA 5EJWA 3NK9A 3S14H 3CQZB 3ER0A 5C5MA 1KRSA 4OL7A 2DNEA 3JAME 4OELB 2WB1G 1HPCA 2LMCB 4JV5L 1NNXA 4LWCA 4A3FH 1J6QA 1BVSA 3URYA 4QY7A 4K8IA 1GUOA 1LTLA 2L4NA 3QB3A 3M3YH 3J81i 3P1HA 3G6EA 1PXUA 5DEHA 4ZK9B 1TWHH 1K83B 4A3LG 3KBGA 1AW7A 4LFAQ 1B3QA 1S5FD 2Z6KC 1A63A 4CHTB 5IGEA 4A3DG 2NTSA 1C9OA 5CORA 4DAPA 3PCOB 3U58A 1LTSD 1S4ZA 1DOKA 2ICIA 3PIP3 1Q1EA 3OIPA 2E2IB 1TWCH 5KYLA 1HNWQ 3J80L 4RA8A 2UUBL 5ELBA 3TQYA 3L7ZC 1Q86C 2XN9C 1GM5A 4KKUA 1TS2A 4CDFC 3CMEA 2RF4A 2VY3A 4P72A 5J1ZA 1MHWC 4J15A 2OCEA 3T4AC 2A6ED 1N33Q 3ERQA 3FEWX 3GO5A 4IALA 3HOYB 4GLVB 1H9SA 3HKSA 4Y52H 1FNVA 1IBKQ 2WAQG 1SMXA 3KBXA 1NR2A 3A54A 3V96A 2GN5A 2F0GA 3PO2B 1LYLA 3A5UA 2JA6G 3DHQA 5CV6A 4FYDA 5M5YH 1ILPA 1FR3A 2B2WA 4A3EH 3FKIB 4HJ8A 4DXGA 1BCPB 5C0XG 2JA7B 1V1QA 4KHPQ 2CW0C 5FO7B 2K14A 2B39A 3BYYB 1XMOL 3BVGA 3MA2B 1FJGQ 4BXXH 3RLNA 4X62Q 2B29A 1UE1A 2KQ3A 1J8IA 3UDXA 3NENA 2BH2A 5FLXc 4DR6L 1TS4A 1NCVA 1V1PA 1CKMA 2XTIA 5EKIA 3H15A 1PYSB 2HQEA 4IUTA 3HOWB 3DEPA 1LTBD 1CQFA 1CT1D 5EBDA 1BXTA 1CQVA 4DV5L 3BU2A 4A3DH 4GNXA 3DUZA 2B8FA 3U9SA 2OF1A 2QGQA 2X6LA 4J8QA 4TRDA 1BQQT 1XJVA 5IY0A 3QO2A 4A3BH 4JI5L 2ID0A 4DV3Q 2A8VA 3BYTB 4UAIA 4L5TA 3T56B 2YU9B 3I4NH 2K33A 3U9OA 2EYPA 1JCKB 1IW7C 3KF6A 4A3MH 1WJJA 1KTKA 4DV0Q 2H4OA 4IJHA 4DUYQ 1QZGA 3D6WA 3P75A 1K8OA 4RGMA 1PRTF 2VB3X 3FRPB 3J81E 3J81j 1WD0A 3CCSA 1JB7A 2VUMH 4ZAIA 3Q8DA 1G2SA 1OO9B 3HOUB 1O7YA 4L5RC 1BO0A 2RSOA 1B2TA 3HS0C 5COYA 2KOLA 3TZDA 1PVOA 1RDPD 5C4JB 2PQEA 5IYBG 1AN8A 1GUGA 3K0YA 4CKEA 1QOHA 1SRUA 3PF5A 2K75A 3Q6SA 5DAUA 4ZRZA 3E3XA 1WTRA 3OW7A 2E2HH 4JI2L 1S5DD 2K5WA 1X65A 1D1IA 4DAYA 2TMPA 3CPFA 1QE6A 4HTHA 2K50A 1CZGA 3D4WA 1YNNC 1CSQA 1A3TA 3A74A 3H91A 5IE8A 2KHJA 3Q23A 2KJXA 1QWYA 1C4QA 3QIAA 1L1OA 4OIKA 4A3IH 5C6AA 2B2UC 4IPDA 3IAYA 3OHXC 5BN4A 1JE5A 2IX3A 1XPOA 3J80c 2UXBL 4AYBE 1UE6A 5EPJA 4O1NA 1GUNA 2N88A 4E6IA 1PH1A 1V43A 4GN4B 1B70B 3KUPA 3WOFA 5DLQE 2EZVA 1BCPF 2YV5A 1YJNA 2ZJQA 1S5ED 2K4KA 5M5WH 1QILA 3GV6A 1CKNA 1I6HH 4HIDA 4P73A 3MXNB 3PV0A 2JXMB 2NVTB 5M3MG 3M4OH 4KJNA 3I56A 2J0TD 1SNOA 2EY6A 4S3SA 1EYAA 1HTLD 2K52A 3NXWA 1YHBA 2JA8G 4C1NI 4IPGA 3N6RA 1XPUA 5KNDA 1PRTD 2NVYB 5J3BA 3CCRA 2VQFL 2AWNA 4X65L 2D9UA 3AQQA 3HKZE 4KD4A 2EE1A 5IYBH 1BBXC 1EZ6A 4GLXA 5CC4A 1DGSA 3J7YW 3GTGB 2RSNA 1EIHA 1EY4A 2Z4HA 3U4VA 4JI1Q 4R4CA 3A5ZB 5L37A 4MTNA 2Q8RE 2RCFA 3GTMH 1Y1WG 3MHBA 1PH3A 3VR6A 3S16B 1LLRD 5I2XA 2JA9A 2ZTDA 5CYUA 4N8FA 1EEFD 3K5NA 3TRZA 1EQTA 1XTCD 4HAEA 2Z6BA 2HCIA 4GN3B 1LTRD 4HJAA 3H94A 3EROA 2KBNA 1ZYRC 4ZKBB 2ALYB 2B2TC 3MXGA 2CH4A 3S2HB 1U4LA 3CHBD 2R61A 1E7ZA 3A8IE 3C2PA 3NUCA 1SYBA 3IFTA 2VNUD 3PIPA 3S1RH 2FHTA 4GOPB 3EBEA 4K5VA 5FOBB 1NMGA 1N36Q 5M3MH 3GQBA 2NZ1D 4NW2A 4PZ8A 4CJ0B 1A3VA 1F2YA 1PTOB 1XNRQ 4LFCQ 5JJLA 1V9PA 3U4ZA 1F9SA 1C48A 1EQRA 4B3MQ 1UE7A 4WRDA 3PUVA 2LXKA 4DGZA 4DV2L 1SEBD 2QILA 5FK9C 2B2YC 2RVLA 2WKDA 1TWGH 4A3GB 1FVIA 3K0XA 4C3IH 5CMDA 5C3EG 1SROA 4JVZA 2I5LX 4CDDC 1JMCA 3CF5A 3EJIA 3SK6A 4AQYQ 2F1MA 3I8ZA 2TSSA 4MN3A 2EYFA 4XIGS 1FGBD 1X6OA 5C4ZA 1SJED 2F0JA 4X3KA 3Q22A 3CRKC 1XTDA 1PFSA 2L11A 3TP6A 3UE1A 1Y1WH 4LK1C 4R8IA 4OO1I 1B50A 1EY7A 1HNWL 3M4PA 1B44D 4R9WA 5IP7G 2UUAL 2N55A 3G48A 4ZKCB 2E5LQ 1EY6A 4C3HG 1ILQA 1OXSC 4A3FB 4WORA 1CHQD 2VS1A 4RGTA 4K8JA 1KDBA 1Y14B 2I5MX 1YZ6A 1GHJA 4IUQA 1KAAA 3G6JB 2VW9A 4DR3L 2HT1A 3M3YB 1MSHA 4CKBA 3T1YQ 1IBKL 3GTPH 3MAQA 1SYEA 1TWHB 1HFNA 3L3OC 2F0UA 1I94Q 2F0OA 3STBC 4I7ZC 1Y69U 4DR4Q 1HJPA 1X55A 1H95A 3OMCA 5C0XJ 4RGNA 5C4XG 1Q82C 4KHPL 2A5HA 2MHVA 1S5BD 2R3ZA 1FJGL 4PMBA 1F9QA 2ENBA 2WACA 1TWCB 1MBYA 5FLXE 5M3FH 4HMJA 1SAPA 3X3MA 2DY8A 1L0YB 1VQ7A 5C3EH 1WI5A 1TR5A 4M1UB 5HGTA 1ESFA 3K5MA 2RQXA 4DK3C 2K7VA 1S3OA 2CWPA 2NTTA 1FNWA 1RIPA 2K01A 2KEEA 1J9OA 2X6GA 1WYDA 3I55A 3S1QH 2PQAB 1U4PA 4QB4A 5FKAC 1CFMA 1W6JA 1E1OA 1VQ6A 1AZQA 5M5YB 2WB1B 4LF7Q 1HUNA 1WD1A 3H0GH 1VQIA 5IWAQ 1LT3D 3OTOQ 1XMQQ 4BBSG 2XWBB 3BZCA 5LL6S 3D3RA 4CBVA 2E2JH 4DV0L 4DUYL 1QNKA 4C3JG 2JA5G 3TZUA 2E8GA 3DWAA 1MJEA 4DV1Q 2EYLA 4JBMA 2ZTEA 1LT6D 4LNQA 3OIQA 1NTGA 5DM63 1QVFA 1PH9A 4A3DB 4GKKL 5C4XH 4CGYB 4EX5A 1EY5A 3RZDH 3KJOA 3MEFA 4B3SQ 1JB3A 4OX9L 1SE8A 1B8AA 3E5SA 5E7NA 1HZBA 4BY7H 2IX0A 3KDFB 2IHEA 1QZHA 4LFBL 1VQHA 1SSOA 3S17H 1Q8KA 2JEAI 1GUWA 1IYJB 1NUCA 2N78A 1Z47A 2ZXPA 3DM3A 4DV4Q 2I5HA 3J80E 5DM73 5GAEC 1K3RA 1I4GA 2R93G 1N8RC 2WAQB 3MXNA 4N9TA 1R9TH 2MJ8A 2JA6B 4ZUJA 5IP9H 4CJ1B 3PUXA 1B53A 2F0WA 2EY1A 3F2UA 2DGYA 4GN5A 2YTXA 3TREA 3T1HQ 2FXQA 4LUZA 1O80A 1YJWA 1VQDA 4U68A 4DN4M 1TIID 2VZAA 1Q1BA 1E22A 3NBHB 4NXMQ 2EYMA 3CCLA 1U4RA 2G9DA 2MPMA 4IUNA 3CCVA 4HSPA 5A35A 2E2HB 4BA1I 4C3JH 1KDAA 1PFMA 2BA1A 1DYQA 2N3SA 2F52A 2K1BA 3C1FA 3LGJA 4OWWB 1EYGA 1SN8A 1LV9A 2CQOA 2KHSA 4LMQD 2CKZB 4A3IB 4IJLA 2MP1A 2OQKA 2MNAA 4KN4C 2Z1CA 3DWPA 2F0EA 3CAMA 4DAVA 4DNRB 2KECA 4OIJA 4C56C 3RD4A 2AQ2B 3CC2A 2CQAA 5D65A 1JORA 4OWXB 3I4OA 5ELCA 1V8QA 1S5CD 5IGBA 1Q81C 4DFAA 5M5WB 1IKLA 3K5OA 3OWEB 2O5JC 3HOZG 1I4QA 4JI7Q 4BBRH 4K6DA 1SMYC 1HQMC 2NVXB 3M4OB 5BR8Q 3TP8A 1SXTA 5C3XA 4GOPA 2BCOA 3QG1A 1I4RA 2F0HA 5CGKA 2BDOA 3A0JA 2R7DA 3CRLC 1IL2A 2F0DA 1WTHA 4DA2A 3IKJA 3JC66 3PSIA 1EY8A 1W6KA 1X3FA 4A3CH 2Z8LA 2E2DC 3E9IA 1XPRA 1LTAD 3I73A 4QL5A 3M85A 1N36L 1HNXQ 3D6CA 5IOCA 1XNRL 2LY7A 3NEMA 4LFCL 3GD7A 3GTOH 1PH5A 4WJ3M 4GKJL 4LW1A 1TY2A 2M00A 2N8NA 1KL9A 1EZ8A 3BG3A 3W3AA 2WKCA 4JI8Q 4LF6L 3GTMB 1M1KC 2DNCA 3VA5A 1KNEA 3S1MH 3FDTA 2LKVA 3C3LA 3S24A 1CSPA 3CCJA 4IQZA 3BJUA 5E3FA 4A3EG 3KLRA 5EPLA 2A69D 4RCOA 1EU3A 1Q90A 1HA6A 4AQYL 3J7AF 1BBUA 3ZJYC 4BXXG 2EYHA 2MUYA 2MGSA 3PQIA 2VXWA 3R8BA 3G4SA 2NB0A 1T9HA 1CI3M 2JJQA 1PRTB 1VS0A 1HCZA 2HUGA 3ND9A 4EGVA 2UXCL 1L2FA 4B3RL 1CA6A 3S1RB 4PNYA 4TVAB 3HOZH 5IGCA 5M3MB 4JOIC 5E4XA 4HSVA 2NYZD 3ULJA 3TN2A 3CPWA 3UDFA 1WTPA 4ULLA 2ICEC 4A3KH 1EQQA 4LF9Q 1HH2P 1Q7YC 5CV4A 2JA8B 4A3BG 3EQLC 1KD1C 3I2ZA 2NN6I 3GDEA 2IL8A 2NWGA 4KKSA 4YHHL 3ULPA 1GO3E 3K59A 1I50H 4X3UA 5M5XH 1U9RA 1EFWA 1TWFH 3I4NG 4IZ8A 1I94L 1IW7D 4CJ2C 3VR5A 2Z0SA 1DOMA 1AP0A 2K5NA 3S15H 1P16A 4A3MG 2VL6A 1DCZA 4RAUC 5JEAJ 2L55A 5ELFA 1JQYD 2H5XA 1Y1WB 4ZQ3A 1VQ5A 2HHHQ 4XQQA 4LF5Q 1X3EA 3WDNA 2VUMG 2DJGC 2PQAA 2I46A 4UY8C 2MO0A 4ME5A 3K7UC 1G291 4G7HC 3A7LA 4OWTB 1B1ZA 5KNBA 1VQGA 3VYUA 5EKLA 3UDIA 1E2VA 1H9RA 1EEID 1LM0A 3PO3G 1TU2B 3GTPB 1YNND 4OEMB 2EPBA 5IT9c 4X66Q 1VF7A 2Y0SG 2R7FA 2F4VQ 1EYDA 3R3OA 3KLSA 5CV8A 4LF7L 1B4OA 4A3IG 2K03A 1IBLQ 2Z9HA 3OTOL 1XMQL 2QEJC 2M2LA 1K8MA 1BDOA 2Q8TA 4TKOB 2EOTA 3TS0A 3QOJA 2B2WC 4H7BA 5C3EB 2R7ZH 1HZCA 4DR2Q 3NTIA 1B9MA 3H6MA 2ZM6Q 5T1IA 4LF8Q 1I3QH 3TSSA 3WWVA 2FFKB 5CV7A 5EQ0A 4CDEC 4DV1L 1VMCA 4UHVA 2K5QA 3NTKA 4G7ZC 5D3DA 4FXKC 3KDFA 4DNTB 2NZHA 1GD7A 3KK7A 4WFN3 2E75C 2K32A 4AYBB 4B3SL 3S2DH 2IY5B 3BZDB 1SYDA 2CHBD 4DUZL 2JSOA 3SE0A 3GTQH 4X6AH 3P7JA 4IO9A 3KJPA 4C3HB 1A8VA 3ICEA 2F03A 2D0OA 1Y1VH 1PZID 4DV4L 5GQOA 1ENFA 1JWSD 3E0JA 3PUWA 2ZJPA 2B2UA 5JJKA 4DR1Q 2EYJA 3PO3H 1KHIA 3RLOA 1HXYD 3NBHA 2QEXA 3T13A 3NPPA 1PA6A 3F2BA 4OGQC 1EY9A 2C35B 2ZXOA 1CTMA 2KCCA 3HG9A 1WTVA 3BZKA 4LF4L 1SBBB 1ZEQX 1AZPA 1K0SA 3M7NA 1VDZA 1MKHA 3T1HL 1TXYA 3VYRA 2MQHA 5C4XB 2SNSA 4EQPA 4IFDJ 4NXML 1OXUA 4L6TB 1ZYRD 4ABNA 5I2YA 3QJYA 3BS1A 1VQJA 3I90A 1SLJA 2F0QA 2C9OA 3PMFA 2K5DA 4BY7B 2RHQB 1SYFA 3S17B 2PPBC 3BDOA 4JYAQ 1BBWA 4XTCS 5M9OA 1W3SA 1STAA 4HIKA 3AYHB 3B6YA 2BDNA 1LACA 3GP7A 2I07B 1R9TB 1J5EQ 1C7YA 1NBWA 4A76A 1QG7A 3M9BA 5F2DA 1L1OC 4C3IG 3RNUA 1N32L 4L63B 2MFIA 4HCEA 3FHWA 4DK0A 3W1GA 4BBSB 3W2DA 4JK1C 4JI7L 5HURA 4O0AA 5C0XI 2F0KA 4C3JB 2JA5B 3VDYA 4CKCA 1D5XC 2B2TA 1PMRA 3BDCA 1D7QA 1PFNA 3MXUA 5IGDA 1KDCA 5LMNW 1WFQA 1M8AA 2JE6I 2PMZB 1SNMA 2EXZA 3CP0A 3Q24A 5JPMC 5H1SE 1YIJA 2ASBA 4OO1H 4JI4L 3NE5B 5JOBA 4V190 3CCMA 2HDLA 3CQZH 4PZ7A 4X64Q 2JEBI 4JG2A 3NTHA 1BNZA 4JI8L 4EQNA 2B2YA 3OW2A 1I5FA 3STBD 3MFYA 2H1EA 1I4HA 5JJZA 4Q0FA 1XNQQ 3R2TA 4BBRB 5D14A 1VQ9A 3FPPA 2R93B 3X3NA 1D6EC 4R4IA 4DK6C 5I6YA 1D5MC 3NHHA 3M4YA 1WTQA 5M3FG 2LSSA 3NWTA 1K83H 1SJHD 2B63G 4DU9A 1X56A 1NMFA 5FO8B 2F0SA 1WTOA 3ND8A 4LFAL 4H02A 3AFPA 2JN4A 4DNIA 4RHRA 1WCMG 4DAMA 2A68C 2HIVA 1F2MA 5ELEA 1ENCA 5GROA 1WTWA 4POGA 3RR5A 4LF9L 3GTOB 3GTJB 4AYBG 3RMHA 5J39A 3S14B 1JWUD 2JYOA 1K28A 3S1MB 4XQJA 2MO1A 1HNZQ 3AFQA 4JV5Q 2AUJD 1IHZA 3MEHA 3SGIA 4A3JG 1ONLA 2B2VA 4C2MH 1PYBA 3I3CA 2PI2A 1KLUD 1CUKA 3H0GG 1QVCA 2A6HC 5I9OA 1N33L 1EL0A 5BN3A 1E24A 4JCVE 3E0EA 3PO2H 4P2CB 2HHHL 4LF5L 1JJGA 3FKIH 2AKWB 1HTPA 2PZTA 1ICWA 1D1KA 3CKIB 1U0LA 3G7LA 3HKZG 5NUCA 3HOZB 2R6GA 1BR9A 3SVMA 1STBA 1HZ9A 5GAHC 5KRUA 1G51A 1NY4A 1SNDA 4BWGB 4X62L 2M9VA 2PYKA 3SR1A 2XSCA 2IX1A 1NAPA 3VYSA 1XXGA 2BOSA 1G91A 3HOXG 2XNAC 3BDLA 5IT9E 3V2TA 3EIVA 3SXHA 2B63H 2SEBD 3HOWH 1I50B 1X3QA 4BY7G 4R8NA 5JAVA 5K36G 1TWFB 1IKMA 1UUPA 2F4VL 1WCMH 1AFPA 1EWIA 2F0LA 1BCPC 4TQUS 3RLFA 4K2KA 2N49A 5IYCH 1OTCA 4IOCA 4F87A 1SR3A 1X32A 2FINB 1SE4A 1SNQA 4DV3L 4HJ5A 2YU9H 1SE3A 2BE5C 5IP9G 1I4PA 1TVXA 4QUFA 5AJ3Q 3H3VI 3K81C 4XT1B 2SDFA 4K5WA 1N34Q 4A3JH 4DR2L 4DPGA 4A3EB 2ZM6L 4LF8L 5HGQA 1ET6A 1RL2A 4KY5A 1DD2A 1DZ1A 2GVBA 1HR0Q 3LWUA 1KNAA 3UE0A 2ZJRA 3V05A 1Z9FA 3K58A 3OPOA 4DF7A 4DR6Q 1B7YB 3R93A 1STNA 2DN8A 5JVH3 4A4IA 3MWYW 2OTLA 1VMPA 5E1FA 4DV5Q 1LABA 2EYOA 4OONA 2PNRC 1TQOA 1CK1A 4QIWB 3D4RA 4KK7A 1B9NA 3H09A 1K0RA 4BA2I 2F0TA 4A3BB 2GA4B 4Z9CB 4DR1L 3FVQA 3HOXH 4JBKA 3MFGA 2R7ZB 4RG1A 3IL8A 5K36H 2RBMA 3I4NB 4JW0A 5EKKA 2G9HD 3PUZA 1I3QB 2EJMA 1PHJA 3I70A 1F2ZA 5FJ8G 3C46A 4HIMA 2OQ0A 3W1BA 5JJIA 1VQCA 1SMYD 3SK8A 3ZYYX 4RGOS 4A3MB 1HRJA 3MC0B 3J7ZC 4BBRG 3CU7A 5J22A 1JOQA 2KUMA 3EVQA 2Q2UA 1OXXK 5LHY1 1JT8A 1AE2A 3GV3A 4RWSC 3S2DB 2VUMB 1KLGD 1HUMA 2L12A 5FO9B 4B3TQ 4HEDA 2F0PA 3RN5A 2WB1E 4UP9A 2IWHA 4LAAA 4MHEA 1VQFA 1FL0A 4A3CG 4XXEA 1SFOH 3J7A5 3KOJA 4JYAL 1Y1VB 2O5IC 1Y8NB 1OXVA 2NN6G 2OXPA 3PO3B 1PH7A 1QB5D 3I4MG 1J5EL 2EVBA 1ASZA 1EWHA 1EFID 1SE2A 2Y0SB 3HEJA 4QF4A 5C44G 1X3PA 1EOVA 3GTKH 4O42A 3MXPA 4M8AA 1H9KA 1ML0D 3FP9A 3KYHC 4GLAC 3NQIA 1KIXA 2NZOA 2LS01 1BF4A 5FLMH 1ASYA 2EQSA 3CCQA 4JI1L 2F0FA 2WFWA 1EY0A 2CFMA 2BA0A 3OOCA 4BY1G 5FJ8H 4G4KA 4H44C 4I65A 3AU7A 4YCVA 1ZXTA 3AEVA 1I6HB 1O7LA 1KC8C 1RD9D 1CHPD 4U673 2C5CA 1JOKA 3D8GA 1ENAA 1FNUA 1E2ZA 1I4XA 2WAQE 3FPUB 4YY3Q 4A93G 4A3KG 1E1TA 4NMZA 4O2DA 3F1ZA 3S2HH 4UPAA 1B3AA 1L0XB 2EY5A 1SDFA 3K7AH 4X64L 3NP8A 2O4XA 4NPSA 4HJ7A 3ITPA 3MTSA 4K6LA 1A6XA 1A2UA 4POFA 4QCLA 4HIOA 4Q5VA 1G2TA 2KENA 2NN6H 1PH4A 4JC0A 1PTOH 1XYIA 1XNQL 2L0CA 4DXFA 1VQ8A 3W5OA 4IPHA 4UP8A 1IBMQ 2KCTA 4GZYC 3I4MH 4B3ML 3S9WA 1STYA 2QF7A 4UDUC 3GTLH 3UDGA 4FF1A 1A2TA 3HOVG 5C44H 1KRTA 3DXJC 3VR3A 2CW0D 4GS3A
chains in the Genus database with same CATH topology
4GNXB 1UEBA 4GOPC 2Z6KA 4DUZL 4JOIA 3GTQH 1XNRQ 3IRBA 4X6AH 4LFCQ 5JJLA 1V9PA 3U4ZA 5GAGC 1YITA 2KCMA 1EQRA 4IO9A 4B3MQ 1UE7A 1FGUA 3PUVA 3KJPA 1A8VA 2LXKA 4DV2L 3ICEA 2D0OA 1TWGH 1Y1VH 4DV4L 5GQOA 3TEHB 4R1JA 1FVIA 3K0XA 4C3IH 5C3EG 3PUWA 2ZJPA 1SROA 4BY1H 3OYYA 2I5LX 4LUVA 5JJKA 1U5KA 3PIOA 1HNZL 1JMCA 4DR1Q 3CF5A 3PO3H 3J81c 5ELOA 1KHIA 3RLOA 2QEXA 1PA6A 3F2BA 4DUZQ 4AQYQ 4MNOA 1BKBA 2E5LL 5LMNQ 4KHZA 2C35B 3KF6B 1JJ2A 3L2PA 4EQ5A 4XIGS 1X6OA 4A93H 3BZKA 1MJCA 4DV2Q 1NJIC 4LF4L 4NXNQ 3JAMi 3M7NA 1XTDA 1PFSA 2AMCB 2D62A 3UE1A 1Y1WH 1MKHA 3T1HL 1TXYA 4OO1I 2MQHA 2NVTH 2UUCQ 3T1YL 5LMUQ 1HNWL 4YCWA 4IFDJ 2R7ZG 4NXML 2ATWA 1OXUA 3M4PA 4JI2Q 1K9MC 5IP7G 2UUAL 2A1AA 2JK8A 4R4OA 3G48A 4K0KQ 2E5LQ 1VQJA 4DR5Q 1HR0W 4RMFA 1OXSC 1SLJA 2ZTCA 4R4TA 3EN2A 2VS1A 1CKOA 2NVYH 3CW2C 4DR4L 4LF4Q 4A3GG 2RHQB 2I5MX 1Y14B 1VQOA 2BH8A 1YZ6A 1A62A 2VW9A 3F8TA 1GKHA 3NELA 4DR3L 1S40A 4IFDI 4JYAQ 2HT1A 1BBWA 4XTCS 3T1YQ 1IBKL 3K80C 4QIWE 3GTPH 2OWOA 4QQBX 4IFDG 4BBSH 2XGTA 1W3SA 4DAYB 3GTGH 3HOVH 4DV7L 3TS2A 2UXBQ 4HIKA 2UUAQ 3AYHB 2IHFA 3CC4A 3B6YA 2R92G 1I94Q 1K8GA 2JA5H 1VCIA 2NVQH 3STBC 1JJCB 4DR4Q 3CC7A 1HJPA 1X55A 1J5EQ 1L1OB 5C0XJ 1NBWA 4QGUA 1C7YA 4A76A 1H95A 5C4XG 1Q82C 4KHPL 1Y1VG 3S16H 1YHAA 3M9BA 3U50C 4DR3Q 1FJGL 1L1OC 2LXJA 3RNUA 4DR7Q 2HIXA 5M3FH 1N32L 1MIUA 2MFIA 3FHWA 2VQEQ 3W1GA 5C3EH 1WI5A 4A3FG 1VQ7A 4JBJA 4JI7L 4O0AA 5C0XI 2UXDL 2Q2HA 5AJ3L 4DK3C 1S3OA 1N34L 2CWPA 1PH6A 3VDYA 1CKNB 1RIPA 2V1CC 2HQLA 4LUOA 5IWAL 1VQ4A 1K8AC 2VQFQ 1WYDA 4X65Q 3I55A 1HR0L 2PQAB 1KQSA 3S1QH 2F3IA 1N32Q 1D7QA 4MZ9A 1KAWA 1TWAH 5LMNW 1D8LA 1E1OA 1WFQA 2EIFA 1HZAA 2JE6I 2ASBA 2WP8J 3CP0A 1YIJA 1VQ6A 5H1SE 4A3LH 2R93H 4JI4L 4NB3A 4Y7NH 1ASZA 1VQPA 4LF7Q 2UU9L 4KI0A 3K8AA 3CCMA 1UWVA 3H0GH 1VQIA 5IWAQ 3CQZH 4PZ7A 1QUQB 4JI0L 4JI3Q 4WJ4A 4X64Q 2JEBI 1N9WA 4JG2A 1IXRA 4PZ6A 3OTOQ 1XMQQ 4A3GH 2A19A 4JI8L 2YTVA 4JI6L 4BBSG 3BZCA 1YHQA 2E2JH 2Y0SE 4DV0L 3OW2A 1PH8A 4DUYL 4ALPA 1I5FA 3STBD 1UE5A 2JA5G 2IT1A 4JI4Q 1XNQQ 2K5HA 3KLWA 2PI2E 4IPCA 1YJ9A 1VQ9A 1M90C 2R92H 2E8GA 3I7FA 1MJEA 4R4IA 4DV1Q 4JBMA 2ZTEA 4DK6C 4GNXC 4LNQA 3GTJH 1NTGA 1QVFA 4DV6Q 1PH9A 3S14H 3RN2A 1AH9A 4GKKL 1PVOA 5C4XH 4YWKA 5M3FG 3ER0A 4EX5A 1KRSA 2LSSA 3RZDH 1K83H 3KJOA 3MEFA 2B63G 1X56A 2WB1G 4B3SQ 4OX9L 1NMFA 4JV5L 2JA6H 4LWCA 5ELNA 4LFAL 1SE8A 3S15H 4A3FH 1B8AA 4H02A 3AFPA 5E7NA 1HZBA 1J6QA 1BVSA 4DNIA 4QY7A 1WCMG 2IX0A 3KDFB 3F2CA 4BY7H 2IHEA 4DAMA 1QZHA 4LFBL 1VQHA 2HIVA 1LTLA 1K73C 4B3TL 5HY6A 3S17H 1Q8KA 2JEAI 5GROA 4POGA 4GKKQ 3RR5A 1IYJB 2N78A 4LF9L 1Z47A 2CWAA 4AYBG 3M3YH 3DM3A 3J81i 4DV4Q 3G6EA 2YYZA 2YTYA 2I5HA 1TWHH 1HNZQ 2MO1A 5GAEC 1K3RA 4OX9Q 4A3LG 1VQBA 3AFQA 4YWMA 1N8RC 2RHSB 4JV5Q 4OO1G 4LFAQ 2R93G 3SGIA 4A3JG 1R9TH 4C2MH 1PYBA 5IP9H 1A63A 2Z6KC 2PI2A 1O7IA 3H0GG 1CUKA 4A3DG 1QVCA 4LFBQ 3PUXA 1C9OA 1N33L 3PCOB 3U58A 2DGYA 4GN5A 3CD6A 2YTXA 1E24A 1Q1EA 3TREA 1TWCH 4JCVE 3T1HQ 2FXQA 4LUZA 3E0EA 3PO2H 1YJWA 1VQDA 1HNWQ 2VZAA 1Q1BA 1E22A 3NBHB 2HHHL 2UUBL 3TQYA 4LF5L 3CCLA 4NXMQ 3CCVA 4HJ9A 3L7ZC 3CXCA 1Q86C 1GM5A 1JJGA 3FKIH 2AKWB 5EAYA 2RF4A 2VY3A 3CMEA 4BA1I 4C3JH 4P72A 4J15A 1U0LA 3PGZA 3HKZG 2BA1A 3CCEA 2R6GA 2OCEA 3S1NH 2N3SA 2RCNA 1NE3A 2F52A 1N33Q 3LGJA 3GO5A 4OWWB 1EYGA 1SN8A 4R4QA 4GLVB 1HZ9A 3HKSA 2CQOA 4Y52H 5GAHC 1NY4A 1G51A 3CCUA 1IBKQ 2WAQG 1SMXA 4X62L 3M4QA 2CKZB 2GN5A 1LYLA 4IJLA 3A5UA 2IX1A 2JA6G 4DV7Q 3HOXG 1G6PA 2OQKA 2MNAA 2NVXH 5M5YH 3EIVA 2B63H 3HOWH 4BY7G 4L5SA 3CAMA 4A3EH 5K36G 4KLKA 5BR8L 4HJ8A 4YY3L 3RZOH 5C0XG 3CC2A 1V1QA 2Q2TA 2F4VL 4KHPQ 1WCMH 2KHIA 2K14A 1PV4A 4OWXB 1EWIA 1XMOL 1E3PA 4TQUS 3I4OA 1FJGQ 4BXXH 3RLNA 3RLFA 1Q12A 1A0IA 2N49A 2B29A 5IYCH 4X62Q 1UE1A 1Q81C 1VQNA 2EXDA 2JQOA 3UDXA 1OTCA 4IOCA 1SR3A 3NENA 2BH2A 5FLXc 4DV3L 4HJ5A 1AE3A 2YU9H 4DR6L 3HOZG 4JI7Q 4BBRH 1VQKA 1CKMA 2XTIA 5IP9G 2UXDQ 5AJ3Q 3H15A 3H3VI 4YCUA 3K81C 5BR8Q 1PYSB 3HOYG 1N34Q 1HNXL 4A3JH 4DR2L 4GOPA 4DPGA 2AHOB 2ZM6L 4LF8L 2K5VA 5HGQA 3ERSX 3A0JA 3PUYA 4DV5L 3BU2A 4A3DH 1RL2A 1VQEA 4GNXA 1IBML 2R7DA 1IL2A 3PO2G 2GVBA 1HR0Q 2QGQA 3UE0A 1XJVA 5IY0A 3JC66 3PSIA 2ZJRA 1Z9FA 4FDBA 2ID0A 4JI5L 1W2BA 1X3FA 4A3BH 4DV3Q 4A3CH 2A8VA 4DR6Q 3FKIG 1B7YB 4L5TA 4DKAC 3E9IA 1XPRA 2JA7G 4QL5A 4P75A 4A4IA 3M85A 4QJFA 1P8LA 1N36L 1HNXQ 2OTLA 3I4NH 2UU9Q 4DV5Q 1XNRL 3NEMA 4LFCL 3GD7A 3GTOH 1PH5A 4JI0Q 4WJ3M 4GKJL 4LW1A 1YNXA 4OONA 4P74A 2N8NA 1KL9A 4JI8Q 1PH2A 4JI6Q 3KF6A 1M1KC 4A3MH 4LF6L 1WJJA 1K0RA 3S1MH 4DV0Q 4BA2I 4IJHA 4DUYQ 1QZGA 3S24A 2DUDA 1CSPA 3CCJA 3BJUA 3KF8B 3J81j 3HOWG 4A3EG 4AIMA 1Q46A 3CCSA 2L15A 4DR1L 1JB7A 2VUMH 3HOXH 4JBKA 1VQAA 1GVPA 3Q8DA 3CMAA 5IYDG 4RG1A 4AQYL 4L5RC 1BBUA 3ZJYC 5LMNL 4BXXG 4GKJQ 1EIFA 2E2IH 3PUZA 1PHJA 2JA8H 1X3GA 5IYCG 1WOCA 5FJ8G 4LF6Q 3G4SA 2QA4A 4HIMA 1YI2A 2OQ0A 4NXNL 3W1BA 1T9HA 1VQCA 1VS0A 2JJQA 5IYBG 5JJIA 1OXTA 2UXCL 1L2FA 3ULLA 1SRUA 3J7ZC 2UUCL 4BBRG 4B3RL 3PF5A 2K75A 5LMUL 1KXLA 3JAMc 2Q2UA 1OXXK 2E2HH 4JI2L 1JT8A 1AE2A 2B3GA 4TVAB 3HOZH 4P71A 1X65A 2PMZE 4K0KL 4DR5L 1YEZA 4JOIC 4PMWA 1EIYB 3E9HA 4B3TQ 2PNHA 3CPFA 3HOYH 2K50A 3ULJA 3CPWA 3RN5A 3UDFA 2WB1E 4UP9A 4A3KH 1EQQA 2I0QA 1CSQA 4LF9Q 3H3VH 2D0PA 1HH2P 3A74A 5IE8A 1VQFA 1Q7YC 4A3BG 2KHJA 1FL0A 4A3IH 4A3CG 1L1OA 1KD1C 1SFOH 3J7A5 2UXCQ 3KOJA 4JYAL 3I2ZA 2NN6I 3GDEA 4B3RQ 4YHHL 4IPDA 3ULPA 1GO3E 4PG3A 1XPOA 1OXVA 1JE5A 1I50H 2NN6G 3J80c 5M5XH 1EFWA 3HOUG 3KFUA 4IOAA 1TWFH 3I4NG 2UXBL 4AYBE 4JBWA 1I94L 2JA7H 1PH7A 1UE6A 4L5QA 2Z0SA 3I4MG 1X54A 1PH1A 1J5EL 1V43A 3G71A 1B70B 1LUZA 1P16A 2K5NA 4GN4B 5DLQE 2YV5A 4A3MG 1YJNA 2ZJQA 4A75A 2VL6A 4YWLA 3J80i 3PF4A 5JEAJ 2K4KA 5C44G 5M5WH 2GVAA 1I6HH 1CKNA 1EOVA 4HIDA 2H5XA 4P73A 3GTKH 3MXNB 3PV0A 4YHHQ 1VQ5A 2HHHQ 2UUBQ 4LF5Q 4DR7L 1X3EA 5M3MG 2VUMG 3F2DA 2PQAA 2VQEL 3M4OH 3FP9A 3KYHC 4GLAC 3I56A 1KIXA 2NZOA 1YBYA 3D31A 5FLMH 1X9NA 4UY8C 2K52A 2MO0A 2EQSA 1ASYA 3K7UC 4X66L 1YHBA 3CCQA 2JA8G 4JI1L 5GADC 1G291 4IPGA 1VQMA 1QVGA 2OTJA 2WFWA 1EUJA 5IYDH 1XPUA 4OWTB 2CFMA 5J3BA 2BA0A 5JEAG 3CCRA 1VQGA 2VQFL 4BY1G 5FJ8H 1IBLL 2AWNA 3UDIA 4X65L 3AQQA 3HKZE 4YCVA 1QUQA 4AH6A 4UP7A 3AEVA 1LM0A 5IYBH 3PO3G 4ME3A 1KC8C 4GLXA 1DGSA 2ES2A 1VQLA 3L0OA 3HFZB 5IT9c 3U4VA 2WAQE 4YY3Q 4X66Q 4JI1Q 4R4CA 2Y0SG 2R7FA 4A93G 3A5ZB 4A3KG 2F4VQ 4LF7L 1E1TA 4MTNA 4O2DA 3F1ZA 3S2HH 1XMOQ 4UPAA 3GTMH 1Y1WG 4A3IG 1PH3A 3K7AH 4JI3L 4X64L 1IBLQ 4NPSA 3OTOL 4HJ7A 1XMQL 4POFA 4HIOA 2JA9A 2ZTDA 1C0AA 2KENA 3TS0A 3TRZA 2AWOA 2R7ZH 3HOUH 2IY5B 1HZCA 1YVCA 4JC0A 4DR2Q 1L0WA 3DLLA 1PH4A 1XNQL 4GN3B 5IP7H 2ZM6Q 4LF8Q 4HJAA 1I3QH 3WWVA 1VQ8A 1IZ6A 4OXPA 2Q2IA 3W5OA 4C3HH 4IPHA 2KBNA 4UP8A 2KCTA 4DV1L 1IBMQ 5C4JH 2ALYB 3I4MH 4B3ML 4DV6L 2CCZA 3KDFA 3GTLH 3UDGA 2NZHA 1GD7A 3D0FA 4APVA 4JI5Q 1E7ZA 3HOVG 1S72A 5C44H 1KRTA 2VNUD 3PIPA 3S1RH 4GOPB 3EBEA 1NMGA 4B3SL 5FLMG 1N36Q 3S2DH 5M3MH 4PZ8A 4GS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX B;  1UEB A;  4GOP C;  2Z6K A;  4DUZ L;  4JOI A;  3GTQ H;  1XNR Q;  3IRB A;  4X6A H;  4LFC Q;  5JJL A;  1V9P A;  3U4Z A;  5GAG C;  1YIT A;  2KCM A;  1EQR A;  4IO9 A;  4B3M Q;  1UE7 A;  1FGU A;  3PUV A;  3KJP A;  1A8V A;  2LXK A;  4DV2 L;  3ICE A;  2D0O A;  1TWG H;  1Y1V H;  4DV4 L;  5GQO A;  3TEH B;  4R1J A;  1FVI A;  3K0X A;  4C3I H;  5C3E G;  3PUW A;  2ZJP A;  1SRO A;  4BY1 H;  3OYY A;  2I5L X;  4LUV A;  5JJK A;  1U5K A;  3PIO A;  1HNZ L;  1JMC A;  4DR1 Q;  3CF5 A;  3PO3 H;  3J81 c;  5ELO A;  1KHI A;  3RLO A;  2QEX A;  1PA6 A;  3F2B A;  4DUZ Q;  4AQY Q;  4MNO A;  1BKB A;  2E5L L;  5LMN Q;  4KHZ A;  2C35 B;  3KF6 B;  1JJ2 A;  3L2P A;  4EQ5 A;  4XIG S;  1X6O A;  4A93 H;  3BZK A;  1MJC A;  4DV2 Q;  1NJI C;  4LF4 L;  4NXN Q;  3JAM i;  3M7N A;  1XTD A;  1PFS A;  2AMC B;  2D62 A;  3UE1 A;  1Y1W H;  1MKH A;  3T1H L;  1TXY A;  4OO1 I;  2MQH A;  2NVT H;  2UUC Q;  3T1Y L;  5LMU Q;  1HNW L;  4YCW A;  4IFD J;  2R7Z G;  4NXM L;  2ATW A;  1OXU A;  3M4P A;  4JI2 Q;  1K9M C;  5IP7 G;  2UUA L;  2A1A A;  2JK8 A;  4R4O A;  3G48 A;  4K0K Q;  2E5L Q;  1VQJ A;  4DR5 Q;  1HR0 W;  4RMF A;  1OXS C;  1SLJ A;  2ZTC A;  4R4T A;  3EN2 A;  2VS1 A;  1CKO A;  2NVY H;  3CW2 C;  4DR4 L;  4LF4 Q;  4A3G G;  2RHQ B;  2I5M X;  1Y14 B;  1VQO A;  2BH8 A;  1YZ6 A;  1A62 A;  2VW9 A;  3F8T A;  1GKH A;  3NEL A;  4DR3 L;  1S40 A;  4IFD I;  4JYA Q;  2HT1 A;  1BBW A;  4XTC S;  3T1Y Q;  1IBK L;  3K80 C;  4QIW E;  3GTP H;  2OWO A;  4QQB X;  4IFD G;  4BBS H;  2XGT A;  1W3S A;  4DAY B;  3GTG H;  3HOV H;  4DV7 L;  3TS2 A;  2UXB Q;  4HIK A;  2UUA Q;  3AYH B;  2IHF A;  3CC4 A;  3B6Y A;  2R92 G;  1I94 Q;  1K8G A;  2JA5 H;  1VCI A;  2NVQ H;  3STB C;  1JJC B;  4DR4 Q;  3CC7 A;  1HJP A;  1X55 A;  1J5E Q;  1L1O B;  5C0X J;  1NBW A;  4QGU A;  1C7Y A;  4A76 A;  1H95 A;  5C4X G;  1Q82 C;  4KHP L;  1Y1V G;  3S16 H;  1YHA A;  3M9B A;  3U50 C;  4DR3 Q;  1FJG L;  1L1O C;  2LXJ A;  3RNU A;  4DR7 Q;  2HIX A;  5M3F H;  1N32 L;  1MIU A;  2MFI A;  3FHW A;  2VQE Q;  3W1G A;  5C3E H;  1WI5 A;  4A3F G;  1VQ7 A;  4JBJ A;  4JI7 L;  4O0A A;  5C0X I;  2UXD L;  2Q2H A;  5AJ3 L;  4DK3 C;  1S3O A;  1N34 L;  2CWP A;  1PH6 A;  3VDY A;  1CKN B;  1RIP A;  2V1C C;  2HQL A;  4LUO A;  5IWA L;  1VQ4 A;  1K8A C;  2VQF Q;  1WYD A;  4X65 Q;  3I55 A;  1HR0 L;  2PQA B;  1KQS A;  3S1Q H;  2F3I A;  1N32 Q;  1D7Q A;  4MZ9 A;  1KAW A;  1TWA H;  5LMN W;  1D8L A;  1E1O A;  1WFQ A;  2EIF A;  1HZA A;  2JE6 I;  2ASB A;  2WP8 J;  3CP0 A;  1YIJ A;  1VQ6 A;  5H1S E;  4A3L H;  2R93 H;  4JI4 L;  4NB3 A;  4Y7N H;  1ASZ A;  1VQP A;  4LF7 Q;  2UU9 L;  4KI0 A;  3K8A A;  3CCM A;  1UWV A;  3H0G H;  1VQI A;  5IWA Q;  3CQZ H;  4PZ7 A;  1QUQ B;  4JI0 L;  4JI3 Q;  4WJ4 A;  4X64 Q;  2JEB I;  1N9W A;  4JG2 A;  1IXR A;  4PZ6 A;  3OTO Q;  1XMQ Q;  4A3G H;  2A19 A;  4JI8 L;  2YTV A;  4JI6 L;  4BBS G;  3BZC A;  1YHQ A;  2E2J H;  2Y0S E;  4DV0 L;  3OW2 A;  1PH8 A;  4DUY L;  4ALP A;  1I5F A;  3STB D;  1UE5 A;  2JA5 G;  2IT1 A;  4JI4 Q;  1XNQ Q;  2K5H A;  3KLW A;  2PI2 E;  4IPC A;  1YJ9 A;  1VQ9 A;  1M90 C;  2R92 H;  2E8G A;  3I7F A;  1MJE A;  4R4I A;  4DV1 Q;  4JBM A;  2ZTE A;  4DK6 C;  4GNX C;  4LNQ A;  3GTJ H;  1NTG A;  1QVF A;  4DV6 Q;  1PH9 A;  3S14 H;  3RN2 A;  1AH9 A;  4GKK L;  1PVO A;  5C4X H;  4YWK A;  5M3F G;  3ER0 A;  4EX5 A;  1KRS A;  2LSS A;  3RZD H;  1K83 H;  3KJO A;  3MEF A;  2B63 G;  1X56 A;  2WB1 G;  4B3S Q;  4OX9 L;  1NMF A;  4JV5 L;  2JA6 H;  4LWC A;  5ELN A;  4LFA L;  1SE8 A;  3S15 H;  4A3F H;  1B8A A;  4H02 A;  3AFP A;  5E7N A;  1HZB A;  1J6Q A;  1BVS A;  4DNI A;  4QY7 A;  1WCM G;  2IX0 A;  3KDF B;  3F2C A;  4BY7 H;  2IHE A;  4DAM A;  1QZH A;  4LFB L;  1VQH A;  2HIV A;  1LTL A;  1K73 C;  4B3T L;  5HY6 A;  3S17 H;  1Q8K A;  2JEA I;  5GRO A;  4POG A;  4GKK Q;  3RR5 A;  1IYJ B;  2N78 A;  4LF9 L;  1Z47 A;  2CWA A;  4AYB G;  3M3Y H;  3DM3 A;  3J81 i;  4DV4 Q;  3G6E A;  2YYZ A;  2YTY A;  2I5H A;  1TWH H;  1HNZ Q;  2MO1 A;  5GAE C;  1K3R A;  4OX9 Q;  4A3L G;  1VQB A;  3AFQ A;  4YWM A;  1N8R C;  2RHS B;  4JV5 Q;  4OO1 G;  4LFA Q;  2R93 G;  3SGI A;  4A3J G;  1R9T H;  4C2M H;  1PYB A;  5IP9 H;  1A63 A;  2Z6K C;  2PI2 A;  1O7I A;  3H0G G;  1CUK A;  4A3D G;  1QVC A;  4LFB Q;  3PUX A;  1C9O A;  1N33 L;  3PCO B;  3U58 A;  2DGY A;  4GN5 A;  3CD6 A;  2YTX A;  1E24 A;  1Q1E A;  3TRE A;  1TWC H;  4JCV E;  3T1H Q;  2FXQ A;  4LUZ A;  3E0E A;  3PO2 H;  1YJW A;  1VQD A;  1HNW Q;  2VZA A;  1Q1B A;  1E22 A;  3NBH B;  2HHH L;  2UUB L;  3TQY A;  4LF5 L;  3CCL A;  4NXM Q;  3CCV A;  4HJ9 A;  3L7Z C;  3CXC A;  1Q86 C;  1GM5 A;  1JJG A;  3FKI H;  2AKW B;  5EAY A;  2RF4 A;  2VY3 A;  3CME A;  4BA1 I;  4C3J H;  4P72 A;  4J15 A;  1U0L A;  3PGZ A;  3HKZ G;  2BA1 A;  3CCE A;  2R6G A;  2OCE A;  3S1N H;  2N3S A;  2RCN A;  1NE3 A;  2F52 A;  1N33 Q;  3LGJ A;  3GO5 A;  4OWW B;  1EYG A;  1SN8 A;  4R4Q A;  4GLV B;  1HZ9 A;  3HKS A;  2CQO A;  4Y52 H;  5GAH C;  1NY4 A;  1G51 A;  3CCU A;  1IBK Q;  2WAQ G;  1SMX A;  4X62 L;  3M4Q A;  2CKZ B;  2GN5 A;  1LYL A;  4IJL A;  3A5U A;  2IX1 A;  2JA6 G;  4DV7 Q;  3HOX G;  1G6P A;  2OQK A;  2MNA A;  2NVX H;  5M5Y H;  3EIV A;  2B63 H;  3HOW H;  4BY7 G;  4L5S A;  3CAM A;  4A3E H;  5K36 G;  4KLK A;  5BR8 L;  4HJ8 A;  4YY3 L;  3RZO H;  5C0X G;  3CC2 A;  1V1Q A;  2Q2T A;  2F4V L;  4KHP Q;  1WCM H;  2KHI A;  2K14 A;  1PV4 A;  4OWX B;  1EWI A;  1XMO L;  1E3P A;  4TQU S;  3I4O A;  1FJG Q;  4BXX H;  3RLN A;  3RLF A;  1Q12 A;  1A0I A;  2N49 A;  2B29 A;  5IYC H;  4X62 Q;  1UE1 A;  1Q81 C;  1VQN A;  2EXD A;  2JQO A;  3UDX A;  1OTC A;  4IOC A;  1SR3 A;  3NEN A;  2BH2 A;  5FLX c;  4DV3 L;  4HJ5 A;  1AE3 A;  2YU9 H;  4DR6 L;  3HOZ G;  4JI7 Q;  4BBR H;  1VQK A;  1CKM A;  2XTI A;  5IP9 G;  2UXD Q;  5AJ3 Q;  3H15 A;  3H3V I;  4YCU A;  3K81 C;  5BR8 Q;  1PYS B;  3HOY G;  1N34 Q;  1HNX L;  4A3J H;  4DR2 L;  4GOP A;  4DPG A;  2AHO B;  2ZM6 L;  4LF8 L;  2K5V A;  5HGQ A;  3ERS X;  3A0J A;  3PUY A;  4DV5 L;  3BU2 A;  4A3D H;  1RL2 A;  1VQE A;  4GNX A;  1IBM L;  2R7D A;  1IL2 A;  3PO2 G;  2GVB A;  1HR0 Q;  2QGQ A;  3UE0 A;  1XJV A;  5IY0 A;  3JC6 6;  3PSI A;  2ZJR A;  1Z9F A;  4FDB A;  2ID0 A;  4JI5 L;  1W2B A;  1X3F A;  4A3B H;  4DV3 Q;  4A3C H;  2A8V A;  4DR6 Q;  3FKI G;  1B7Y B;  4L5T A;  4DKA C;  3E9I A;  1XPR A;  2JA7 G;  4QL5 A;  4P75 A;  4A4I A;  3M85 A;  4QJF A;  1P8L A;  1N36 L;  1HNX Q;  2OTL A;  3I4N H;  2UU9 Q;  4DV5 Q;  1XNR L;  3NEM A;  4LFC L;  3GD7 A;  3GTO H;  1PH5 A;  4JI0 Q;  4WJ3 M;  4GKJ L;  4LW1 A;  1YNX A;  4OON A;  4P74 A;  2N8N A;  1KL9 A;  4JI8 Q;  1PH2 A;  4JI6 Q;  3KF6 A;  1M1K C;  4A3M H;  4LF6 L;  1WJJ A;  1K0R A;  3S1M H;  4DV0 Q;  4BA2 I;  4IJH A;  4DUY Q;  1QZG A;  3S24 A;  2DUD A;  1CSP A;  3CCJ A;  3BJU A;  3KF8 B;  3J81 j;  3HOW G;  4A3E G;  4AIM A;  1Q46 A;  3CCS A;  2L15 A;  4DR1 L;  1JB7 A;  2VUM H;  3HOX H;  4JBK A;  1VQA A;  1GVP A;  3Q8D A;  3CMA A;  5IYD G;  4RG1 A;  4AQY L;  4L5R C;  1BBU A;  3ZJY C;  5LMN L;  4BXX G;  4GKJ Q;  1EIF A;  2E2I H;  3PUZ A;  1PHJ A;  2JA8 H;  1X3G A;  5IYC G;  1WOC A;  5FJ8 G;  4LF6 Q;  3G4S A;  2QA4 A;  4HIM A;  1YI2 A;  2OQ0 A;  4NXN L;  3W1B A;  1T9H A;  1VQC A;  1VS0 A;  2JJQ A;  5IYB G;  5JJI A;  1OXT A;  2UXC L;  1L2F A;  3ULL A;  1SRU A;  3J7Z C;  2UUC L;  4BBR G;  4B3R L;  3PF5 A;  2K75 A;  5LMU L;  1KXL A;  3JAM c;  2Q2U A;  1OXX K;  2E2H H;  4JI2 L;  1JT8 A;  1AE2 A;  2B3G A;  4TVA B;  3HOZ H;  4P71 A;  1X65 A;  2PMZ E;  4K0K L;  4DR5 L;  1YEZ A;  4JOI C;  4PMW A;  1EIY B;  3E9H A;  4B3T Q;  2PNH A;  3CPF A;  3HOY H;  2K50 A;  3ULJ A;  3CPW A;  3RN5 A;  3UDF A;  2WB1 E;  4UP9 A;  4A3K H;  1EQQ A;  2I0Q A;  1CSQ A;  4LF9 Q;  3H3V H;  2D0P A;  1HH2 P;  3A74 A;  5IE8 A;  1VQF A;  1Q7Y C;  4A3B G;  2KHJ A;  1FL0 A;  4A3I H;  4A3C G;  1L1O A;  1KD1 C;  1SFO H;  3J7A 5;  2UXC Q;  3KOJ A;  4JYA L;  3I2Z A;  2NN6 I;  3GDE A;  4B3R Q;  4YHH L;  4IPD A;  3ULP A;  1GO3 E;  4PG3 A;  1XPO A;  1OXV A;  1JE5 A;  1I50 H;  2NN6 G;  3J80 c;  5M5X H;  1EFW A;  3HOU G;  3KFU A;  4IOA A;  1TWF H;  3I4N G;  2UXB L;  4AYB E;  4JBW A;  1I94 L;  2JA7 H;  1PH7 A;  1UE6 A;  4L5Q A;  2Z0S A;  3I4M G;  1X54 A;  1PH1 A;  1J5E L;  1V43 A;  3G71 A;  1B70 B;  1LUZ A;  1P16 A;  2K5N A;  4GN4 B;  5DLQ E;  2YV5 A;  4A3M G;  1YJN A;  2ZJQ A;  4A75 A;  2VL6 A;  4YWL A;  3J80 i;  3PF4 A;  5JEA J;  2K4K A;  5C44 G;  5M5W H;  2GVA A;  1I6H H;  1CKN A;  1EOV A;  4HID A;  2H5X A;  4P73 A;  3GTK H;  3MXN B;  3PV0 A;  4YHH Q;  1VQ5 A;  2HHH Q;  2UUB Q;  4LF5 Q;  4DR7 L;  1X3E A;  5M3M G;  2VUM G;  3F2D A;  2PQA A;  2VQE L;  3M4O H;  3FP9 A;  3KYH C;  4GLA C;  3I56 A;  1KIX A;  2NZO A;  1YBY A;  3D31 A;  5FLM H;  1X9N A;  4UY8 C;  2K52 A;  2MO0 A;  2EQS A;  1ASY A;  3K7U C;  4X66 L;  1YHB A;  3CCQ A;  2JA8 G;  4JI1 L;  5GAD C;  1G29 1;  4IPG A;  1VQM A;  1QVG A;  2OTJ A;  2WFW A;  1EUJ A;  5IYD H;  1XPU A;  4OWT B;  2CFM A;  5J3B A;  2BA0 A;  5JEA G;  3CCR A;  1VQG A;  2VQF L;  4BY1 G;  5FJ8 H;  1IBL L;  2AWN A;  3UDI A;  4X65 L;  3AQQ A;  3HKZ E;  4YCV A;  1QUQ A;  4AH6 A;  4UP7 A;  3AEV A;  1LM0 A;  5IYB H;  3PO3 G;  4ME3 A;  1KC8 C;  4GLX A;  1DGS A;  2ES2 A;  1VQL A;  3L0O A;  3HFZ B;  5IT9 c;  3U4V A;  2WAQ E;  4YY3 Q;  4X66 Q;  4JI1 Q;  4R4C A;  2Y0S G;  2R7F A;  4A93 G;  3A5Z B;  4A3K G;  2F4V Q;  4LF7 L;  1E1T A;  4MTN A;  4O2D A;  3F1Z A;  3S2H H;  1XMO Q;  4UPA A;  3GTM H;  1Y1W G;  4A3I G;  1PH3 A;  3K7A H;  4JI3 L;  4X64 L;  1IBL Q;  4NPS A;  3OTO L;  4HJ7 A;  1XMQ L;  4POF A;  4HIO A;  2JA9 A;  2ZTD A;  1C0A A;  2KEN A;  3TS0 A;  3TRZ A;  2AWO A;  2R7Z H;  3HOU H;  2IY5 B;  1HZC A;  1YVC A;  4JC0 A;  4DR2 Q;  1L0W A;  3DLL A;  1PH4 A;  1XNQ L;  4GN3 B;  5IP7 H;  2ZM6 Q;  4LF8 Q;  4HJA A;  1I3Q H;  3WWV A;  1VQ8 A;  1IZ6 A;  4OXP A;  2Q2I A;  3W5O A;  4C3H H;  4IPH A;  2KBN A;  4UP8 A;  2KCT A;  4DV1 L;  1IBM Q;  5C4J H;  2ALY B;  3I4M H;  4B3M L;  4DV6 L;  2CCZ A;  3KDF A;  3GTL H;  3UDG A;  2NZH A;  1GD7 A;  3D0F A;  4APV A;  4JI5 Q;  1E7Z A;  3HOV G;  1S72 A;  5C44 H;  1KRT A;  2VNU D;  3PIP A;  3S1R H;  4GOP B;  3EBE A;  1NMG A;  4B3S L;  5FLM G;  1N36 Q;  3S2D H;  5M3M H;  4PZ8 A;  4GS3 A; 
#chains in the Genus database with same CATH topology
 4V0B A;  4GOP C;  2Z6K A;  4JOI A;  5I4D A;  3IRB A;  1YIT A;  5GAG C;  1IYV A;  3C1E A;  4KD3 A;  1PTO C;  3TEH B;  5EGT A;  5A2Q L;  2ZXR A;  3A55 A;  5EPK A;  4BY1 H;  1CM9 A;  3OYY A;  1Q3L A;  4LUV A;  1T5X D;  3K57 A;  1HNZ L;  4KY7 A;  1A3U A;  1RJT A;  5AFW A;  1E0B A;  2ZT9 C;  2Q8I B;  2E5L L;  3A8J E;  5LMN Q;  5CV9 A;  4A93 H;  2F0N A;  4PV1 C;  4DV2 Q;  4NXN Q;  3A7A B;  2AMC B;  2A73 B;  1GOZ A;  2UUC Q;  3T1Y L;  1TWG B;  5KGU A;  5LMU Q;  2IW3 A;  4YCW A;  5EBC A;  4C3I B;  1STH A;  2K28 A;  4XYQ A;  5KNC A;  3T16 A;  1K9M C;  2R7Z G;  1A15 A;  3IFD A;  2A1A A;  2JK8 A;  4R4O A;  1GHK A;  4K0K Q;  4DR5 Q;  1HR0 W;  4RMF A;  1YNJ C;  4F88 A;  2PZU A;  4R4T A;  3EN2 A;  1CKO A;  1GUT A;  3BVM A;  4DR4 L;  1LTG D;  1VQO A;  1A62 A;  4IFD I;  3NEL A;  4KJO A;  2HDM A;  4FF3 A;  2AQ3 B;  4FF4 A;  2KVM A;  1EU4 A;  4PMC A;  3HOV H;  1K3B C;  1RTN A;  2UUA Q;  3CC4 A;  2IHF A;  2R92 G;  1K8G A;  1FD7 D;  3HRZ C;  2NVQ H;  4C2M B;  1JJC B;  2PW5 A;  4FO2 A;  1Y1V G;  1YHA A;  4DR3 Q;  1F2L A;  4WJW A;  4NKL A;  3SHL A;  1NSN S;  4DR7 Q;  1MIU A;  4IUV A;  4J1M A;  2VQE Q;  1RHP A;  4J6H A;  2DY7 A;  5AJ3 L;  4FNF A;  4K14 A;  1N34 L;  1WVL A;  2FMM A;  5BN5 A;  3NWS A;  2A69 C;  2HQL A;  4LUO A;  5IWA L;  1K8A C;  3A56 A;  1HR0 L;  2F3I A;  4MZ9 A;  3I4L A;  1TWA H;  1E2W A;  1TKW B;  4IUU A;  5M3F B;  1HZA A;  1C8C A;  4A3L H;  1ZKO A;  1JWM D;  2PCF B;  2B63 B;  4Y7N H;  4XDX A;  2V4D A;  1HFG A;  2AUK A;  4N9P A;  3DWQ A;  1QUQ B;  1QCB D;  4JI3 Q;  4RCN A;  1PLF A;  1WCM B;  1IXR A;  4PZ6 A;  4RKB A;  2A19 A;  5D3I B;  4ILW A;  4K2L A;  1BUV T;  1YHQ A;  3S1Q B;  4ALP A;  1QNU A;  2EJF C;  3DM1 A;  1UE5 A;  2PI2 E;  4IPC A;  1M90 C;  2R92 H;  4A3J B;  4GNX C;  2XRQ D;  4DV6 Q;  3K5L A;  4C1N K;  3H0G B;  3RN2 A;  1AH9 A;  2Z4I A;  4YWK A;  3I72 A;  2A6E C;  1HHV A;  2O2L D;  4ZCK A;  1VF5 C;  1HQR D;  5KYI A;  2E2J B;  2F0M A;  2JA6 H;  5ELN A;  1Q8I A;  3RUZ A;  3F2C A;  1ET9 A;  4B3T L;  1K73 C;  5HY6 A;  5C0X H;  5G3L F;  4GKK Q;  3HKZ B;  2CWA A;  2FMC A;  4JPB W;  1RKN A;  2YYZ A;  2YTY A;  3JAM L;  1SNC A;  4FF2 A;  4HCS A;  3RZD B;  4OX9 Q;  5I6W A;  1VQB A;  2F4I A;  4YWM A;  4OO1 G;  2RHS B;  2NUC A;  2KED A;  1PZJ D;  2P5Z X;  3HOX B;  1AEX A;  1O7I A;  4LFB Q;  2SNM A;  4ZLT F;  3CD6 A;  4QUC A;  4ZUI A;  2RDF A;  4XT3 B;  2QCP X;  3MVV A;  1D5Z C;  4HJ9 A;  2CH4 W;  3OSO A;  5TSS A;  3CXC A;  5EAY A;  4G57 A;  4KTA A;  3D4D A;  2VB2 X;  4KV6 A;  3PGZ A;  3CCE A;  3S1N H;  2PZW A;  2RCN A;  1NE3 A;  4HR7 B;  4KY6 A;  3SEB A;  3LNN A;  4R4Q A;  1DOL A;  3I91 A;  3PIO 3;  2FJ2 A;  4MIU A;  3CCU A;  3EA6 A;  3M4Q A;  5I9P A;  3MZ5 A;  1SFO B;  4RHS A;  2K05 A;  2KCN A;  4DV7 Q;  1WTX A;  1G6P A;  2A68 D;  2NVX H;  1DON A;  1UAP A;  1SNP A;  4XQN A;  2J7Z A;  4L5S A;  3E6Z X;  4KLK A;  5BR8 L;  1FYC A;  3TP7 A;  3VR4 A;  4YY3 L;  3RZO H;  2B8G A;  2Q2T A;  1TS5 A;  2KHI A;  1PV4 A;  1E3P A;  1Q12 A;  1A0I A;  1IYU A;  1KAB A;  1VQN A;  2EXD A;  2JQO A;  1JC7 A;  1G6Z A;  2J4X A;  4H13 C;  2A6H D;  4OHJ A;  3GTK B;  1AE3 A;  4ODG A;  3UI2 A;  1VQK A;  2UXD Q;  5G3L D;  2OT2 A;  4YCU A;  3HOY G;  1HNX L;  2D5D A;  5CR3 A;  5ELD A;  2AHO B;  1O7Z A;  2K5V A;  3ERS X;  3PUY A;  4FP5 D;  5IIF A;  1VQE A;  1IBM L;  1JE4 A;  3PO2 G;  3SDZ A;  4RH6 A;  3ONA B;  4FDB A;  5IGG A;  1W2B A;  4B08 A;  5C3W A;  3FKI G;  2RKS A;  4DKA C;  2JA7 G;  3TME A;  4P75 A;  4QJF A;  1P8L A;  1STG A;  3AB9 A;  2UU9 Q;  4IN3 A;  3NQT A;  3P20 A;  4JI0 Q;  1YNX A;  2F0I A;  2XIW A;  4P74 A;  5IGF A;  1PYW D;  3QOL A;  1PH2 A;  4JI6 Q;  3K7A B;  5JVG 3;  1EYC A;  2DUD A;  3KF8 B;  3HOW G;  1GXD C;  4AIM A;  3DMU A;  1Q46 A;  2G5D A;  2L15 A;  1BCP D;  4EQO A;  1F9P A;  1U4M A;  3WOE A;  1VQA A;  1GVP A;  3CMA A;  2EJG C;  4F7X A;  1CA5 A;  5C4H A;  1MGS A;  5IYD G;  5LMN L;  4GKJ Q;  1EIF A;  2E2I H;  2F3W A;  2JA8 H;  1X3G A;  5IYC G;  1WOC A;  1ICF B;  2BE5 D;  4LF6 Q;  2F3V A;  2QA4 A;  1YI2 A;  4NXN L;  3I4M B;  3Q0A A;  1SYG A;  1JOO A;  1OXT A;  3GTL B;  3A8K E;  3ULL A;  1DXM A;  1HA5 A;  4PQX A;  2UUC L;  2K6A A;  3J81 L;  5LMU L;  1PRT C;  5C44 B;  1KXL A;  1LT4 D;  3JAM c;  5T1G A;  1XWE A;  2B3G A;  3SK5 A;  4P71 A;  4RFB A;  2PMZ E;  4K0K L;  4DR5 L;  1YEZ A;  4PMW A;  1EIY B;  1PFB A;  2HD3 A;  3E9H A;  2PNH A;  3HOY H;  2I0Q A;  3H3V H;  1NR4 A;  2D0P A;  2QDB A;  2X69 A;  2UXC Q;  4B3R Q;  4PG3 A;  4X3T A;  4BY1 B;  3HOU G;  3KFU A;  4IOA A;  4JBW A;  2JA7 H;  4IUR A;  4L5Q A;  1LTI D;  1X54 A;  5CBE E;  3G71 A;  1RTO A;  1LT5 D;  1LUZ A;  2PW7 A;  3PF4 A;  3M7G A;  4A75 A;  4YWL A;  1O78 A;  3J80 i;  4F8M A;  2WII B;  4A3K B;  4A93 B;  1Y8P B;  2GVA A;  2HCC A;  1TS3 A;  4YHH Q;  2UUB Q;  4DR7 L;  3SK4 A;  3H3V C;  4QMG A;  3F2D A;  2VQE L;  1I6V C;  4L8J A;  2B2V C;  1G8Z D;  2A74 C;  5M5X B;  1YBY A;  3D31 A;  1X9N A;  5IOD A;  4X66 L;  5GAD C;  1VQM A;  1QVG A;  2OTJ A;  1EUJ A;  5IYD H;  3VR2 A;  2RA4 A;  2RDG A;  1SYC A;  2IJ0 A;  5JEA G;  3S15 B;  1IBL L;  1TY0 A;  3O13 A;  1QUQ A;  4AH6 A;  4UP7 A;  4ME3 A;  1PZK D;  2QW7 A;  3KLS X;  3NSW A;  2RDH A;  2PO4 A;  3HOV B;  2ES2 A;  1VQL A;  3L0O A;  3HFZ B;  2AQ1 B;  1H9S B;  2NVQ B;  1BOS A;  1XMO Q;  4TSS A;  4JI3 L;  4KMU C;  5CBA E;  2E74 C;  5DNF A;  3OWF A;  3EFX D;  1C0A A;  2QKI C;  1RCV D;  4I7A A;  2SOB A;  1DJR D;  1MSG A;  1R4Q B;  2AWO A;  3R2I A;  3HOU H;  1YVC A;  1ROD A;  1RF2 D;  1L0W A;  3DLL A;  5IP7 H;  1Z7T A;  1IZ6 A;  4OXP A;  2Q2I A;  4C3H H;  5C4J H;  1H9M A;  1PTO F;  4G7O C;  4IUP A;  4DV6 L;  2CCZ A;  3OMG A;  1R4P B;  5LL6 X;  3D0F A;  4APV A;  1V1P B;  4JI5 Q;  1S72 A;  5A2Q E;  1TWA B;  4ZYS A;  1LO5 D;  5FLM G;  3N52 A;  4GNX B;  1UEB A;  4CDC C;  4KN7 C;  4Y7N B;  1EWC A;  1PDQ A;  2D2C C;  1CZW A;  2KCM A;  2L9H A;  1FGU A;  1JR0 D;  5JEA H;  5E4W C;  1II3 A;  4R1J A;  1F9R A;  4DK1 A;  1STE A;  4HN7 A;  3FMC A;  2XVS A;  1U5K A;  3PIO A;  3TDQ A;  3J81 c;  5ELO A;  2DJF C;  1UNS A;  2L1B A;  1T5E A;  4DUZ Q;  5CV5 A;  4MNO A;  1BKB A;  4KKT A;  4KHZ A;  1TT2 A;  1GUS A;  3HGB A;  3KF6 B;  4HMI A;  3L2P A;  1JJ2 A;  4EQ5 A;  3AMU A;  2R92 B;  3GTQ B;  5KEE A;  1MJC A;  3QWN A;  4LJZ C;  1NJI C;  3JAM i;  2EDG A;  2D62 A;  1JIC A;  2NVT H;  4FXG C;  4B9W A;  2ATW A;  4JI2 Q;  1H9J A;  1QJO A;  4NDX A;  2XWJ B;  2ZTC A;  3CW2 C;  1XX8 A;  2NVY H;  4LF4 Q;  4A3G G;  1M4V A;  2BH8 A;  4H0L C;  3F8T A;  1GKH A;  1MD2 D;  2L5T A;  3VA7 A;  1S40 A;  4X3S A;  3K80 C;  4QIW E;  3TBI B;  2OWO A;  3VYT A;  4QQB X;  4IFD G;  4BBS H;  2XGT A;  4B9X A;  4DAY B;  3GTG H;  3TS2 A;  4DV7 L;  2UXB Q;  1PTO D;  2QDL A;  4BS9 A;  2JA5 H;  1VCI A;  4YIJ A;  2WV6 D;  3CC7 A;  1V1O A;  3NBI A;  3LX0 A;  1L1O B;  4N8X 1;  1F77 A;  3L9A X;  4QGU A;  2F0V A;  4ID6 A;  5KIX A;  3S16 H;  3U50 C;  2LXJ A;  3BVZ A;  2HIX A;  4A3F G;  1ESR A;  4JBJ A;  3TP5 A;  1EQV A;  2UXD L;  2CVR A;  3LWE A;  2Q2H A;  4NP5 A;  1PH6 A;  3T53 B;  4KHV A;  1CKN B;  1EIG A;  2V1C C;  3S1N B;  1VQ4 A;  2VQF Q;  2JP1 A;  2KA7 A;  2NBF A;  2OEO A;  4X65 Q;  1KQS A;  1MI2 A;  1N32 Q;  5K5P A;  5FLX L;  3T51 B;  1YNJ D;  1KAW A;  1D8L A;  1Y8O B;  4EVO A;  1GJX A;  2EIF A;  5C5L A;  5JPN C;  2EY2 A;  5IT9 L;  2WP8 J;  5ISR A;  2R93 H;  2XRS D;  4NB3 A;  2E76 C;  1D2B A;  1UEA B;  3KF8 A;  4FXD A;  1IL8 A;  1VQP A;  2UU9 L;  4KI0 A;  3K8A A;  1UWV A;  3K6O A;  3RZO B;  2IPK D;  4K5X A;  4JI0 L;  4WJ4 A;  1N9W A;  4A3G H;  2WIN B;  2YTV A;  4XYO A;  4JI6 L;  3J7A V;  2Y0S E;  1DM0 B;  1LTT D;  1PH8 A;  4RKL A;  3HP3 A;  2K04 A;  3HZX A;  3QR8 A;  4FVM A;  4IFD H;  3DEO A;  2IT1 A;  4JI4 Q;  2K5H A;  1Z6H A;  3KLW A;  1YJ9 A;  3I7F A;  2LFN A;  1EOT A;  3GTJ H;  4MTK A;  5EJW A;  3NK9 A;  3S14 H;  3CQZ B;  3ER0 A;  5C5M A;  1KRS A;  4OL7 A;  2DNE A;  3JAM E;  4OEL B;  2WB1 G;  1HPC A;  2LMC B;  4JV5 L;  1NNX A;  4LWC A;  4A3F H;  1J6Q A;  1BVS A;  3URY A;  4QY7 A;  4K8I A;  1GUO A;  1LTL A;  2L4N A;  3QB3 A;  3M3Y H;  3J81 i;  3P1H A;  3G6E A;  1PXU A;  5DEH A;  4ZK9 B;  1TWH H;  1K83 B;  4A3L G;  3KBG A;  1AW7 A;  4LFA Q;  1B3Q A;  1S5F D;  2Z6K C;  1A63 A;  4CHT B;  5IGE A;  4A3D G;  2NTS A;  1C9O A;  5COR A;  4DAP A;  3PCO B;  3U58 A;  1LTS D;  1S4Z A;  1DOK A;  2ICI A;  3PIP 3;  1Q1E A;  3OIP A;  2E2I B;  1TWC H;  5KYL A;  1HNW Q;  3J80 L;  4RA8 A;  2UUB L;  5ELB A;  3TQY A;  3L7Z C;  1Q86 C;  2XN9 C;  1GM5 A;  4KKU A;  1TS2 A;  4CDF C;  3CME A;  2RF4 A;  2VY3 A;  4P72 A;  5J1Z A;  1MHW C;  4J15 A;  2OCE A;  3T4A C;  2A6E D;  1N33 Q;  3ERQ A;  3FEW X;  3GO5 A;  4IAL A;  3HOY B;  4GLV B;  1H9S A;  3HKS A;  4Y52 H;  1FNV A;  1IBK Q;  2WAQ G;  1SMX A;  3KBX A;  1NR2 A;  3A54 A;  3V96 A;  2GN5 A;  2F0G A;  3PO2 B;  1LYL A;  3A5U A;  2JA6 G;  3DHQ A;  5CV6 A;  4FYD A;  5M5Y H;  1ILP A;  1FR3 A;  2B2W A;  4A3E H;  3FKI B;  4HJ8 A;  4DXG A;  1BCP B;  5C0X G;  2JA7 B;  1V1Q A;  4KHP Q;  2CW0 C;  5FO7 B;  2K14 A;  2B39 A;  3BYY B;  1XMO L;  3BVG A;  3MA2 B;  1FJG Q;  4BXX H;  3RLN A;  4X62 Q;  2B29 A;  1UE1 A;  2KQ3 A;  1J8I A;  3UDX A;  3NEN A;  2BH2 A;  5FLX c;  4DR6 L;  1TS4 A;  1NCV A;  1V1P A;  1CKM A;  2XTI A;  5EKI A;  3H15 A;  1PYS B;  2HQE A;  4IUT A;  3HOW B;  3DEP A;  1LTB D;  1CQF A;  1CT1 D;  5EBD A;  1BXT A;  1CQV A;  4DV5 L;  3BU2 A;  4A3D H;  4GNX A;  3DUZ A;  2B8F A;  3U9S A;  2OF1 A;  2QGQ A;  2X6L A;  4J8Q A;  4TRD A;  1BQQ T;  1XJV A;  5IY0 A;  3QO2 A;  4A3B H;  4JI5 L;  2ID0 A;  4DV3 Q;  2A8V A;  3BYT B;  4UAI A;  4L5T A;  3T56 B;  2YU9 B;  3I4N H;  2K33 A;  3U9O A;  2EYP A;  1JCK B;  1IW7 C;  3KF6 A;  4A3M H;  1WJJ A;  1KTK A;  4DV0 Q;  2H4O A;  4IJH A;  4DUY Q;  1QZG A;  3D6W A;  3P75 A;  1K8O A;  4RGM A;  1PRT F;  2VB3 X;  3FRP B;  3J81 E;  3J81 j;  1WD0 A;  3CCS A;  1JB7 A;  2VUM H;  4ZAI A;  3Q8D A;  1G2S A;  1OO9 B;  3HOU B;  1O7Y A;  4L5R C;  1BO0 A;  2RSO A;  1B2T A;  3HS0 C;  5COY A;  2KOL A;  3TZD A;  1PVO A;  1RDP D;  5C4J B;  2PQE A;  5IYB G;  1AN8 A;  1GUG A;  3K0Y A;  4CKE A;  1QOH A;  1SRU A;  3PF5 A;  2K75 A;  3Q6S A;  5DAU A;  4ZRZ A;  3E3X A;  1WTR A;  3OW7 A;  2E2H H;  4JI2 L;  1S5D D;  2K5W A;  1X65 A;  1D1I A;  4DAY A;  2TMP A;  3CPF A;  1QE6 A;  4HTH A;  2K50 A;  1CZG A;  3D4W A;  1YNN C;  1CSQ A;  1A3T A;  3A74 A;  3H91 A;  5IE8 A;  2KHJ A;  3Q23 A;  2KJX A;  1QWY A;  1C4Q A;  3QIA A;  1L1O A;  4OIK A;  4A3I H;  5C6A A;  2B2U C;  4IPD A;  3IAY A;  3OHX C;  5BN4 A;  1JE5 A;  2IX3 A;  1XPO A;  3J80 c;  2UXB L;  4AYB E;  1UE6 A;  5EPJ A;  4O1N A;  1GUN A;  2N88 A;  4E6I A;  1PH1 A;  1V43 A;  4GN4 B;  1B70 B;  3KUP A;  3WOF A;  5DLQ E;  2EZV A;  1BCP F;  2YV5 A;  1YJN A;  2ZJQ A;  1S5E D;  2K4K A;  5M5W H;  1QIL A;  3GV6 A;  1CKN A;  1I6H H;  4HID A;  4P73 A;  3MXN B;  3PV0 A;  2JXM B;  2NVT B;  5M3M G;  3M4O H;  4KJN A;  3I56 A;  2J0T D;  1SNO A;  2EY6 A;  4S3S A;  1EYA A;  1HTL D;  2K52 A;  3NXW A;  1YHB A;  2JA8 G;  4C1N I;  4IPG A;  3N6R A;  1XPU A;  5KND A;  1PRT D;  2NVY B;  5J3B A;  3CCR A;  2VQF L;  2AWN A;  4X65 L;  2D9U A;  3AQQ A;  3HKZ E;  4KD4 A;  2EE1 A;  5IYB H;  1BBX C;  1EZ6 A;  4GLX A;  5CC4 A;  1DGS A;  3J7Y W;  3GTG B;  2RSN A;  1EIH A;  1EY4 A;  2Z4H A;  3U4V A;  4JI1 Q;  4R4C A;  3A5Z B;  5L37 A;  4MTN A;  2Q8R E;  2RCF A;  3GTM H;  1Y1W G;  3MHB A;  1PH3 A;  3VR6 A;  3S16 B;  1LLR D;  5I2X A;  2JA9 A;  2ZTD A;  5CYU A;  4N8F A;  1EEF D;  3K5N A;  3TRZ A;  1EQT A;  1XTC D;  4HAE A;  2Z6B A;  2HCI A;  4GN3 B;  1LTR D;  4HJA A;  3H94 A;  3ERO A;  2KBN A;  1ZYR C;  4ZKB B;  2ALY B;  2B2T C;  3MXG A;  2CH4 A;  3S2H B;  1U4L A;  3CHB D;  2R61 A;  1E7Z A;  3A8I E;  3C2P A;  3NUC A;  1SYB A;  3IFT A;  2VNU D;  3PIP A;  3S1R H;  2FHT A;  4GOP B;  3EBE A;  4K5V A;  5FOB B;  1NMG A;  1N36 Q;  5M3M H;  3GQB A;  2NZ1 D;  4NW2 A;  4PZ8 A;  4CJ0 B;  1A3V A;  1F2Y A;  1PTO B;  1XNR Q;  4LFC Q;  5JJL A;  1V9P A;  3U4Z A;  1F9S A;  1C48 A;  1EQR A;  4B3M Q;  1UE7 A;  4WRD A;  3PUV A;  2LXK A;  4DGZ A;  4DV2 L;  1SEB D;  2QIL A;  5FK9 C;  2B2Y C;  2RVL A;  2WKD A;  1TWG H;  4A3G B;  1FVI A;  3K0X A;  4C3I H;  5CMD A;  5C3E G;  1SRO A;  4JVZ A;  2I5L X;  4CDD C;  1JMC A;  3CF5 A;  3EJI A;  3SK6 A;  4AQY Q;  2F1M A;  3I8Z A;  2TSS A;  4MN3 A;  2EYF A;  4XIG S;  1FGB D;  1X6O A;  5C4Z A;  1SJE D;  2F0J A;  4X3K A;  3Q22 A;  3CRK C;  1XTD A;  1PFS A;  2L11 A;  3TP6 A;  3UE1 A;  1Y1W H;  4LK1 C;  4R8I A;  4OO1 I;  1B50 A;  1EY7 A;  1HNW L;  3M4P A;  1B44 D;  4R9W A;  5IP7 G;  2UUA L;  2N55 A;  3G48 A;  4ZKC B;  2E5L Q;  1EY6 A;  4C3H G;  1ILQ A;  1OXS C;  4A3F B;  4WOR A;  1CHQ D;  2VS1 A;  4RGT A;  4K8J A;  1KDB A;  1Y14 B;  2I5M X;  1YZ6 A;  1GHJ A;  4IUQ A;  1KAA A;  3G6J B;  2VW9 A;  4DR3 L;  2HT1 A;  3M3Y B;  1MSH A;  4CKB A;  3T1Y Q;  1IBK L;  3GTP H;  3MAQ A;  1SYE A;  1TWH B;  1HFN A;  3L3O C;  2F0U A;  1I94 Q;  2F0O A;  3STB C;  4I7Z C;  1Y69 U;  4DR4 Q;  1HJP A;  1X55 A;  1H95 A;  3OMC A;  5C0X J;  4RGN A;  5C4X G;  1Q82 C;  4KHP L;  2A5H A;  2MHV A;  1S5B D;  2R3Z A;  1FJG L;  4PMB A;  1F9Q A;  2ENB A;  2WAC A;  1TWC B;  1MBY A;  5FLX E;  5M3F H;  4HMJ A;  1SAP A;  3X3M A;  2DY8 A;  1L0Y B;  1VQ7 A;  5C3E H;  1WI5 A;  1TR5 A;  4M1U B;  5HGT A;  1ESF A;  3K5M A;  2RQX A;  4DK3 C;  2K7V A;  1S3O A;  2CWP A;  2NTT A;  1FNW A;  1RIP A;  2K01 A;  2KEE A;  1J9O A;  2X6G A;  1WYD A;  3I55 A;  3S1Q H;  2PQA B;  1U4P A;  4QB4 A;  5FKA C;  1CFM A;  1W6J A;  1E1O A;  1VQ6 A;  1AZQ A;  5M5Y B;  2WB1 B;  4LF7 Q;  1HUN A;  1WD1 A;  3H0G H;  1VQI A;  5IWA Q;  1LT3 D;  3OTO Q;  1XMQ Q;  4BBS G;  2XWB B;  3BZC A;  5LL6 S;  3D3R A;  4CBV A;  2E2J H;  4DV0 L;  4DUY L;  1QNK A;  4C3J G;  2JA5 G;  3TZU A;  2E8G A;  3DWA A;  1MJE A;  4DV1 Q;  2EYL A;  4JBM A;  2ZTE A;  1LT6 D;  4LNQ A;  3OIQ A;  1NTG A;  5DM6 3;  1QVF A;  1PH9 A;  4A3D B;  4GKK L;  5C4X H;  4CGY B;  4EX5 A;  1EY5 A;  3RZD H;  3KJO A;  3MEF A;  4B3S Q;  1JB3 A;  4OX9 L;  1SE8 A;  1B8A A;  3E5S A;  5E7N A;  1HZB A;  4BY7 H;  2IX0 A;  3KDF B;  2IHE A;  1QZH A;  4LFB L;  1VQH A;  1SSO A;  3S17 H;  1Q8K A;  2JEA I;  1GUW A;  1IYJ B;  1NUC A;  2N78 A;  1Z47 A;  2ZXP A;  3DM3 A;  4DV4 Q;  2I5H A;  3J80 E;  5DM7 3;  5GAE C;  1K3R A;  1I4G A;  2R93 G;  1N8R C;  2WAQ B;  3MXN A;  4N9T A;  1R9T H;  2MJ8 A;  2JA6 B;  4ZUJ A;  5IP9 H;  4CJ1 B;  3PUX A;  1B53 A;  2F0W A;  2EY1 A;  3F2U A;  2DGY A;  4GN5 A;  2YTX A;  3TRE A;  3T1H Q;  2FXQ A;  4LUZ A;  1O80 A;  1YJW A;  1VQD A;  4U68 A;  4DN4 M;  1TII D;  2VZA A;  1Q1B A;  1E22 A;  3NBH B;  4NXM Q;  2EYM A;  3CCL A;  1U4R A;  2G9D A;  2MPM A;  4IUN A;  3CCV A;  4HSP A;  5A35 A;  2E2H B;  4BA1 I;  4C3J H;  1KDA A;  1PFM A;  2BA1 A;  1DYQ A;  2N3S A;  2F52 A;  2K1B A;  3C1F A;  3LGJ A;  4OWW B;  1EYG A;  1SN8 A;  1LV9 A;  2CQO A;  2KHS A;  4LMQ D;  2CKZ B;  4A3I B;  4IJL A;  2MP1 A;  2OQK A;  2MNA A;  4KN4 C;  2Z1C A;  3DWP A;  2F0E A;  3CAM A;  4DAV A;  4DNR B;  2KEC A;  4OIJ A;  4C56 C;  3RD4 A;  2AQ2 B;  3CC2 A;  2CQA A;  5D65 A;  1JOR A;  4OWX B;  3I4O A;  5ELC A;  1V8Q A;  1S5C D;  5IGB A;  1Q81 C;  4DFA A;  5M5W B;  1IKL A;  3K5O A;  3OWE B;  2O5J C;  3HOZ G;  1I4Q A;  4JI7 Q;  4BBR H;  4K6D A;  1SMY C;  1HQM C;  2NVX B;  3M4O B;  5BR8 Q;  3TP8 A;  1SXT A;  5C3X A;  4GOP A;  2BCO A;  3QG1 A;  1I4R A;  2F0H A;  5CGK A;  2BDO A;  3A0J A;  2R7D A;  3CRL C;  1IL2 A;  2F0D A;  1WTH A;  4DA2 A;  3IKJ A;  3JC6 6;  3PSI A;  1EY8 A;  1W6K A;  1X3F A;  4A3C H;  2Z8L A;  2E2D C;  3E9I A;  1XPR A;  1LTA D;  3I73 A;  4QL5 A;  3M85 A;  1N36 L;  1HNX Q;  3D6C A;  5IOC A;  1XNR L;  2LY7 A;  3NEM A;  4LFC L;  3GD7 A;  3GTO H;  1PH5 A;  4WJ3 M;  4GKJ L;  4LW1 A;  1TY2 A;  2M00 A;  2N8N A;  1KL9 A;  1EZ8 A;  3BG3 A;  3W3A A;  2WKC A;  4JI8 Q;  4LF6 L;  3GTM B;  1M1K C;  2DNC A;  3VA5 A;  1KNE A;  3S1M H;  3FDT A;  2LKV A;  3C3L A;  3S24 A;  1CSP A;  3CCJ A;  4IQZ A;  3BJU A;  5E3F A;  4A3E G;  3KLR A;  5EPL A;  2A69 D;  4RCO A;  1EU3 A;  1Q90 A;  1HA6 A;  4AQY L;  3J7A F;  1BBU A;  3ZJY C;  4BXX G;  2EYH A;  2MUY A;  2MGS A;  3PQI A;  2VXW A;  3R8B A;  3G4S A;  2NB0 A;  1T9H A;  1CI3 M;  2JJQ A;  1PRT B;  1VS0 A;  1HCZ A;  2HUG A;  3ND9 A;  4EGV A;  2UXC L;  1L2F A;  4B3R L;  1CA6 A;  3S1R B;  4PNY A;  4TVA B;  3HOZ H;  5IGC A;  5M3M B;  4JOI C;  5E4X A;  4HSV A;  2NYZ D;  3ULJ A;  3TN2 A;  3CPW A;  3UDF A;  1WTP A;  4ULL A;  2ICE C;  4A3K H;  1EQQ A;  4LF9 Q;  1HH2 P;  1Q7Y C;  5CV4 A;  2JA8 B;  4A3B G;  3EQL C;  1KD1 C;  3I2Z A;  2NN6 I;  3GDE A;  2IL8 A;  2NWG A;  4KKS A;  4YHH L;  3ULP A;  1GO3 E;  3K59 A;  1I50 H;  4X3U A;  5M5X H;  1U9R A;  1EFW A;  1TWF H;  3I4N G;  4IZ8 A;  1I94 L;  1IW7 D;  4CJ2 C;  3VR5 A;  2Z0S A;  1DOM A;  1AP0 A;  2K5N A;  3S15 H;  1P16 A;  4A3M G;  2VL6 A;  1DCZ A;  4RAU C;  5JEA J;  2L55 A;  5ELF A;  1JQY D;  2H5X A;  1Y1W B;  4ZQ3 A;  1VQ5 A;  2HHH Q;  4XQQ A;  4LF5 Q;  1X3E A;  3WDN A;  2VUM G;  2DJG C;  2PQA A;  2I46 A;  4UY8 C;  2MO0 A;  4ME5 A;  3K7U C;  1G29 1;  4G7H C;  3A7L A;  4OWT B;  1B1Z A;  5KNB A;  1VQG A;  3VYU A;  5EKL A;  3UDI A;  1E2V A;  1H9R A;  1EEI D;  1LM0 A;  3PO3 G;  1TU2 B;  3GTP B;  1YNN D;  4OEM B;  2EPB A;  5IT9 c;  4X66 Q;  1VF7 A;  2Y0S G;  2R7F A;  2F4V Q;  1EYD A;  3R3O A;  3KLS A;  5CV8 A;  4LF7 L;  1B4O A;  4A3I G;  2K03 A;  1IBL Q;  2Z9H A;  3OTO L;  1XMQ L;  2QEJ C;  2M2L A;  1K8M A;  1BDO A;  2Q8T A;  4TKO B;  2EOT A;  3TS0 A;  3QOJ A;  2B2W C;  4H7B A;  5C3E B;  2R7Z H;  1HZC A;  4DR2 Q;  3NTI A;  1B9M A;  3H6M A;  2ZM6 Q;  5T1I A;  4LF8 Q;  1I3Q H;  3TSS A;  3WWV A;  2FFK B;  5CV7 A;  5EQ0 A;  4CDE C;  4DV1 L;  1VMC A;  4UHV A;  2K5Q A;  3NTK A;  4G7Z C;  5D3D A;  4FXK C;  3KDF A;  4DNT B;  2NZH A;  1GD7 A;  3KK7 A;  4WFN 3;  2E75 C;  2K32 A;  4AYB B;  4B3S L;  3S2D H;  2IY5 B;  3BZD B;  1SYD A;  2CHB D;  4DUZ L;  2JSO A;  3SE0 A;  3GTQ H;  4X6A H;  3P7J A;  4IO9 A;  3KJP A;  4C3H B;  1A8V A;  3ICE A;  2F03 A;  2D0O A;  1Y1V H;  1PZI D;  4DV4 L;  5GQO A;  1ENF A;  1JWS D;  3E0J A;  3PUW A;  2ZJP A;  2B2U A;  5JJK A;  4DR1 Q;  2EYJ A;  3PO3 H;  1KHI A;  3RLO A;  1HXY D;  3NBH A;  2QEX A;  3T13 A;  3NPP A;  1PA6 A;  3F2B A;  4OGQ C;  1EY9 A;  2C35 B;  2ZXO A;  1CTM A;  2KCC A;  3HG9 A;  1WTV A;  3BZK A;  4LF4 L;  1SBB B;  1ZEQ X;  1AZP A;  1K0S A;  3M7N A;  1VDZ A;  1MKH A;  3T1H L;  1TXY A;  3VYR A;  2MQH A;  5C4X B;  2SNS A;  4EQP A;  4IFD J;  4NXM L;  1OXU A;  4L6T B;  1ZYR D;  4ABN A;  5I2Y A;  3QJY A;  3BS1 A;  1VQJ A;  3I90 A;  1SLJ A;  2F0Q A;  2C9O A;  3PMF A;  2K5D A;  4BY7 B;  2RHQ B;  1SYF A;  3S17 B;  2PPB C;  3BDO A;  4JYA Q;  1BBW A;  4XTC S;  5M9O A;  1W3S A;  1STA A;  4HIK A;  3AYH B;  3B6Y A;  2BDN A;  1LAC A;  3GP7 A;  2I07 B;  1R9T B;  1J5E Q;  1C7Y A;  1NBW A;  4A76 A;  1QG7 A;  3M9B A;  5F2D A;  1L1O C;  4C3I G;  3RNU A;  1N32 L;  4L63 B;  2MFI A;  4HCE A;  3FHW A;  4DK0 A;  3W1G A;  4BBS B;  3W2D A;  4JK1 C;  4JI7 L;  5HUR A;  4O0A A;  5C0X I;  2F0K A;  4C3J B;  2JA5 B;  3VDY A;  4CKC A;  1D5X C;  2B2T A;  1PMR A;  3BDC A;  1D7Q A;  1PFN A;  3MXU A;  5IGD A;  1KDC A;  5LMN W;  1WFQ A;  1M8A A;  2JE6 I;  2PMZ B;  1SNM A;  2EXZ A;  3CP0 A;  3Q24 A;  5JPM C;  5H1S E;  1YIJ A;  2ASB A;  4OO1 H;  4JI4 L;  3NE5 B;  5JOB A;  4V19 0;  3CCM A;  2HDL A;  3CQZ H;  4PZ7 A;  4X64 Q;  2JEB I;  4JG2 A;  3NTH A;  1BNZ A;  4JI8 L;  4EQN A;  2B2Y A;  3OW2 A;  1I5F A;  3STB D;  3MFY A;  2H1E A;  1I4H A;  5JJZ A;  4Q0F A;  1XNQ Q;  3R2T A;  4BBR B;  5D14 A;  1VQ9 A;  3FPP A;  2R93 B;  3X3N A;  1D6E C;  4R4I A;  4DK6 C;  5I6Y A;  1D5M C;  3NHH A;  3M4Y A;  1WTQ A;  5M3F G;  2LSS A;  3NWT A;  1K83 H;  1SJH D;  2B63 G;  4DU9 A;  1X56 A;  1NMF A;  5FO8 B;  2F0S A;  1WTO A;  3ND8 A;  4LFA L;  4H02 A;  3AFP A;  2JN4 A;  4DNI A;  4RHR A;  1WCM G;  4DAM A;  2A68 C;  2HIV A;  1F2M A;  5ELE A;  1ENC A;  5GRO A;  1WTW A;  4POG A;  3RR5 A;  4LF9 L;  3GTO B;  3GTJ B;  4AYB G;  3RMH A;  5J39 A;  3S14 B;  1JWU D;  2JYO A;  1K28 A;  3S1M B;  4XQJ A;  2MO1 A;  1HNZ Q;  3AFQ A;  4JV5 Q;  2AUJ D;  1IHZ A;  3MEH A;  3SGI A;  4A3J G;  1ONL A;  2B2V A;  4C2M H;  1PYB A;  3I3C A;  2PI2 A;  1KLU D;  1CUK A;  3H0G G;  1QVC A;  2A6H C;  5I9O A;  1N33 L;  1EL0 A;  5BN3 A;  1E24 A;  4JCV E;  3E0E A;  3PO2 H;  4P2C B;  2HHH L;  4LF5 L;  1JJG A;  3FKI H;  2AKW B;  1HTP A;  2PZT A;  1ICW A;  1D1K A;  3CKI B;  1U0L A;  3G7L A;  3HKZ G;  5NUC A;  3HOZ B;  2R6G A;  1BR9 A;  3SVM A;  1STB A;  1HZ9 A;  5GAH C;  5KRU A;  1G51 A;  1NY4 A;  1SND A;  4BWG B;  4X62 L;  2M9V A;  2PYK A;  3SR1 A;  2XSC A;  2IX1 A;  1NAP A;  3VYS A;  1XXG A;  2BOS A;  1G91 A;  3HOX G;  2XNA C;  3BDL A;  5IT9 E;  3V2T A;  3EIV A;  3SXH A;  2B63 H;  2SEB D;  3HOW H;  1I50 B;  1X3Q A;  4BY7 G;  4R8N A;  5JAV A;  5K36 G;  1TWF B;  1IKM A;  1UUP A;  2F4V L;  1WCM H;  1AFP A;  1EWI A;  2F0L A;  1BCP C;  4TQU S;  3RLF A;  4K2K A;  2N49 A;  5IYC H;  1OTC A;  4IOC A;  4F87 A;  1SR3 A;  1X32 A;  2FIN B;  1SE4 A;  1SNQ A;  4DV3 L;  4HJ5 A;  2YU9 H;  1SE3 A;  2BE5 C;  5IP9 G;  1I4P A;  1TVX A;  4QUF A;  5AJ3 Q;  3H3V I;  3K81 C;  4XT1 B;  2SDF A;  4K5W A;  1N34 Q;  4A3J H;  4DR2 L;  4DPG A;  4A3E B;  2ZM6 L;  4LF8 L;  5HGQ A;  1ET6 A;  1RL2 A;  4KY5 A;  1DD2 A;  1DZ1 A;  2GVB A;  1HR0 Q;  3LWU A;  1KNA A;  3UE0 A;  2ZJR A;  3V05 A;  1Z9F A;  3K58 A;  3OPO A;  4DF7 A;  4DR6 Q;  1B7Y B;  3R93 A;  1STN A;  2DN8 A;  5JVH 3;  4A4I A;  3MWY W;  2OTL A;  1VMP A;  5E1F A;  4DV5 Q;  1LAB A;  2EYO A;  4OON A;  2PNR C;  1TQO A;  1CK1 A;  4QIW B;  3D4R A;  4KK7 A;  1B9N A;  3H09 A;  1K0R A;  4BA2 I;  2F0T A;  4A3B B;  2GA4 B;  4Z9C B;  4DR1 L;  3FVQ A;  3HOX H;  4JBK A;  3MFG A;  2R7Z B;  4RG1 A;  3IL8 A;  5K36 H;  2RBM A;  3I4N B;  4JW0 A;  5EKK A;  2G9H D;  3PUZ A;  1I3Q B;  2EJM A;  1PHJ A;  3I70 A;  1F2Z A;  5FJ8 G;  3C46 A;  4HIM A;  2OQ0 A;  3W1B A;  5JJI A;  1VQC A;  1SMY D;  3SK8 A;  3ZYY X;  4RGO S;  4A3M B;  1HRJ A;  3MC0 B;  3J7Z C;  4BBR G;  3CU7 A;  5J22 A;  1JOQ A;  2KUM A;  3EVQ A;  2Q2U A;  1OXX K;  5LHY 1;  1JT8 A;  1AE2 A;  3GV3 A;  4RWS C;  3S2D B;  2VUM B;  1KLG D;  1HUM A;  2L12 A;  5FO9 B;  4B3T Q;  4HED A;  2F0P A;  3RN5 A;  2WB1 E;  4UP9 A;  2IWH A;  4LAA A;  4MHE A;  1VQF A;  1FL0 A;  4A3C G;  4XXE A;  1SFO H;  3J7A 5;  3KOJ A;  4JYA L;  1Y1V B;  2O5I C;  1Y8N B;  1OXV A;  2NN6 G;  2OXP A;  3PO3 B;  1PH7 A;  1QB5 D;  3I4M G;  1J5E L;  2EVB A;  1ASZ A;  1EWH A;  1EFI D;  1SE2 A;  2Y0S B;  3HEJ A;  4QF4 A;  5C44 G;  1X3P A;  1EOV A;  3GTK H;  4O42 A;  3MXP A;  4M8A A;  1H9K A;  1ML0 D;  3FP9 A;  3KYH C;  4GLA C;  3NQI A;  1KIX A;  2NZO A;  2LS0 1;  1BF4 A;  5FLM H;  1ASY A;  2EQS A;  3CCQ A;  4JI1 L;  2F0F A;  2WFW A;  1EY0 A;  2CFM A;  2BA0 A;  3OOC A;  4BY1 G;  5FJ8 H;  4G4K A;  4H44 C;  4I65 A;  3AU7 A;  4YCV A;  1ZXT A;  3AEV A;  1I6H B;  1O7L A;  1KC8 C;  1RD9 D;  1CHP D;  4U67 3;  2C5C A;  1JOK A;  3D8G A;  1ENA A;  1FNU A;  1E2Z A;  1I4X A;  2WAQ E;  3FPU B;  4YY3 Q;  4A93 G;  4A3K G;  1E1T A;  4NMZ A;  4O2D A;  3F1Z A;  3S2H H;  4UPA A;  1B3A A;  1L0X B;  2EY5 A;  1SDF A;  3K7A H;  4X64 L;  3NP8 A;  2O4X A;  4NPS A;  4HJ7 A;  3ITP A;  3MTS A;  4K6L A;  1A6X A;  1A2U A;  4POF A;  4QCL A;  4HIO A;  4Q5V A;  1G2T A;  2KEN A;  2NN6 H;  1PH4 A;  4JC0 A;  1PTO H;  1XYI A;  1XNQ L;  2L0C A;  4DXF A;  1VQ8 A;  3W5O A;  4IPH A;  4UP8 A;  1IBM Q;  2KCT A;  4GZY C;  3I4M H;  4B3M L;  3S9W A;  1STY A;  2QF7 A;  4UDU C;  3GTL H;  3UDG A;  4FF1 A;  1A2T A;  3HOV G;  5C44 H;  1KRT A;  3DXJ C;  3VR3 A;  2CW0 D;  4GS3 A; 
#chains in the Genus database with same CATH homology
 4GNX B;  1UEB A;  4GOP C;  2Z6K A;  4DUZ L;  4JOI A;  3GTQ H;  1XNR Q;  3IRB A;  4X6A H;  4LFC Q;  5JJL A;  1V9P A;  3U4Z A;  5GAG C;  1YIT A;  2KCM A;  1EQR A;  4IO9 A;  4B3M Q;  1UE7 A;  1FGU A;  3PUV A;  3KJP A;  1A8V A;  2LXK A;  4DV2 L;  3ICE A;  2D0O A;  1TWG H;  1Y1V H;  4DV4 L;  5GQO A;  3TEH B;  4R1J A;  1FVI A;  3K0X A;  4C3I H;  5C3E G;  3PUW A;  2ZJP A;  1SRO A;  4BY1 H;  3OYY A;  2I5L X;  4LUV A;  5JJK A;  1U5K A;  3PIO A;  1HNZ L;  1JMC A;  4DR1 Q;  3CF5 A;  3PO3 H;  3J81 c;  5ELO A;  1KHI A;  3RLO A;  2QEX A;  1PA6 A;  3F2B A;  4DUZ Q;  4AQY Q;  4MNO A;  1BKB A;  2E5L L;  5LMN Q;  4KHZ A;  2C35 B;  3KF6 B;  1JJ2 A;  3L2P A;  4EQ5 A;  4XIG S;  1X6O A;  4A93 H;  3BZK A;  1MJC A;  4DV2 Q;  1NJI C;  4LF4 L;  4NXN Q;  3JAM i;  3M7N A;  1XTD A;  1PFS A;  2AMC B;  2D62 A;  3UE1 A;  1Y1W H;  1MKH A;  3T1H L;  1TXY A;  4OO1 I;  2MQH A;  2NVT H;  2UUC Q;  3T1Y L;  5LMU Q;  1HNW L;  4YCW A;  4IFD J;  2R7Z G;  4NXM L;  2ATW A;  1OXU A;  3M4P A;  4JI2 Q;  1K9M C;  5IP7 G;  2UUA L;  2A1A A;  2JK8 A;  4R4O A;  3G48 A;  4K0K Q;  2E5L Q;  1VQJ A;  4DR5 Q;  1HR0 W;  4RMF A;  1OXS C;  1SLJ A;  2ZTC A;  4R4T A;  3EN2 A;  2VS1 A;  1CKO A;  2NVY H;  3CW2 C;  4DR4 L;  4LF4 Q;  4A3G G;  2RHQ B;  2I5M X;  1Y14 B;  1VQO A;  2BH8 A;  1YZ6 A;  1A62 A;  2VW9 A;  3F8T A;  1GKH A;  3NEL A;  4DR3 L;  1S40 A;  4IFD I;  4JYA Q;  2HT1 A;  1BBW A;  4XTC S;  3T1Y Q;  1IBK L;  3K80 C;  4QIW E;  3GTP H;  2OWO A;  4QQB X;  4IFD G;  4BBS H;  2XGT A;  1W3S A;  4DAY B;  3GTG H;  3HOV H;  4DV7 L;  3TS2 A;  2UXB Q;  4HIK A;  2UUA Q;  3AYH B;  2IHF A;  3CC4 A;  3B6Y A;  2R92 G;  1I94 Q;  1K8G A;  2JA5 H;  1VCI A;  2NVQ H;  3STB C;  1JJC B;  4DR4 Q;  3CC7 A;  1HJP A;  1X55 A;  1J5E Q;  1L1O B;  5C0X J;  1NBW A;  4QGU A;  1C7Y A;  4A76 A;  1H95 A;  5C4X G;  1Q82 C;  4KHP L;  1Y1V G;  3S16 H;  1YHA A;  3M9B A;  3U50 C;  4DR3 Q;  1FJG L;  1L1O C;  2LXJ A;  3RNU A;  4DR7 Q;  2HIX A;  5M3F H;  1N32 L;  1MIU A;  2MFI A;  3FHW A;  2VQE Q;  3W1G A;  5C3E H;  1WI5 A;  4A3F G;  1VQ7 A;  4JBJ A;  4JI7 L;  4O0A A;  5C0X I;  2UXD L;  2Q2H A;  5AJ3 L;  4DK3 C;  1S3O A;  1N34 L;  2CWP A;  1PH6 A;  3VDY A;  1CKN B;  1RIP A;  2V1C C;  2HQL A;  4LUO A;  5IWA L;  1VQ4 A;  1K8A C;  2VQF Q;  1WYD A;  4X65 Q;  3I55 A;  1HR0 L;  2PQA B;  1KQS A;  3S1Q H;  2F3I A;  1N32 Q;  1D7Q A;  4MZ9 A;  1KAW A;  1TWA H;  5LMN W;  1D8L A;  1E1O A;  1WFQ A;  2EIF A;  1HZA A;  2JE6 I;  2ASB A;  2WP8 J;  3CP0 A;  1YIJ A;  1VQ6 A;  5H1S E;  4A3L H;  2R93 H;  4JI4 L;  4NB3 A;  4Y7N H;  1ASZ A;  1VQP A;  4LF7 Q;  2UU9 L;  4KI0 A;  3K8A A;  3CCM A;  1UWV A;  3H0G H;  1VQI A;  5IWA Q;  3CQZ H;  4PZ7 A;  1QUQ B;  4JI0 L;  4JI3 Q;  4WJ4 A;  4X64 Q;  2JEB I;  1N9W A;  4JG2 A;  1IXR A;  4PZ6 A;  3OTO Q;  1XMQ Q;  4A3G H;  2A19 A;  4JI8 L;  2YTV A;  4JI6 L;  4BBS G;  3BZC A;  1YHQ A;  2E2J H;  2Y0S E;  4DV0 L;  3OW2 A;  1PH8 A;  4DUY L;  4ALP A;  1I5F A;  3STB D;  1UE5 A;  2JA5 G;  2IT1 A;  4JI4 Q;  1XNQ Q;  2K5H A;  3KLW A;  2PI2 E;  4IPC A;  1YJ9 A;  1VQ9 A;  1M90 C;  2R92 H;  2E8G A;  3I7F A;  1MJE A;  4R4I A;  4DV1 Q;  4JBM A;  2ZTE A;  4DK6 C;  4GNX C;  4LNQ A;  3GTJ H;  1NTG A;  1QVF A;  4DV6 Q;  1PH9 A;  3S14 H;  3RN2 A;  1AH9 A;  4GKK L;  1PVO A;  5C4X H;  4YWK A;  5M3F G;  3ER0 A;  4EX5 A;  1KRS A;  2LSS A;  3RZD H;  1K83 H;  3KJO A;  3MEF A;  2B63 G;  1X56 A;  2WB1 G;  4B3S Q;  4OX9 L;  1NMF A;  4JV5 L;  2JA6 H;  4LWC A;  5ELN A;  4LFA L;  1SE8 A;  3S15 H;  4A3F H;  1B8A A;  4H02 A;  3AFP A;  5E7N A;  1HZB A;  1J6Q A;  1BVS A;  4DNI A;  4QY7 A;  1WCM G;  2IX0 A;  3KDF B;  3F2C A;  4BY7 H;  2IHE A;  4DAM A;  1QZH A;  4LFB L;  1VQH A;  2HIV A;  1LTL A;  1K73 C;  4B3T L;  5HY6 A;  3S17 H;  1Q8K A;  2JEA I;  5GRO A;  4POG A;  4GKK Q;  3RR5 A;  1IYJ B;  2N78 A;  4LF9 L;  1Z47 A;  2CWA A;  4AYB G;  3M3Y H;  3DM3 A;  3J81 i;  4DV4 Q;  3G6E A;  2YYZ A;  2YTY A;  2I5H A;  1TWH H;  1HNZ Q;  2MO1 A;  5GAE C;  1K3R A;  4OX9 Q;  4A3L G;  1VQB A;  3AFQ A;  4YWM A;  1N8R C;  2RHS B;  4JV5 Q;  4OO1 G;  4LFA Q;  2R93 G;  3SGI A;  4A3J G;  1R9T H;  4C2M H;  1PYB A;  5IP9 H;  1A63 A;  2Z6K C;  2PI2 A;  1O7I A;  3H0G G;  1CUK A;  4A3D G;  1QVC A;  4LFB Q;  3PUX A;  1C9O A;  1N33 L;  3PCO B;  3U58 A;  2DGY A;  4GN5 A;  3CD6 A;  2YTX A;  1E24 A;  1Q1E A;  3TRE A;  1TWC H;  4JCV E;  3T1H Q;  2FXQ A;  4LUZ A;  3E0E A;  3PO2 H;  1YJW A;  1VQD A;  1HNW Q;  2VZA A;  1Q1B A;  1E22 A;  3NBH B;  2HHH L;  2UUB L;  3TQY A;  4LF5 L;  3CCL A;  4NXM Q;  3CCV A;  4HJ9 A;  3L7Z C;  3CXC A;  1Q86 C;  1GM5 A;  1JJG A;  3FKI H;  2AKW B;  5EAY A;  2RF4 A;  2VY3 A;  3CME A;  4BA1 I;  4C3J H;  4P72 A;  4J15 A;  1U0L A;  3PGZ A;  3HKZ G;  2BA1 A;  3CCE A;  2R6G A;  2OCE A;  3S1N H;  2N3S A;  2RCN A;  1NE3 A;  2F52 A;  1N33 Q;  3LGJ A;  3GO5 A;  4OWW B;  1EYG A;  1SN8 A;  4R4Q A;  4GLV B;  1HZ9 A;  3HKS A;  2CQO A;  4Y52 H;  5GAH C;  1NY4 A;  1G51 A;  3CCU A;  1IBK Q;  2WAQ G;  1SMX A;  4X62 L;  3M4Q A;  2CKZ B;  2GN5 A;  1LYL A;  4IJL A;  3A5U A;  2IX1 A;  2JA6 G;  4DV7 Q;  3HOX G;  1G6P A;  2OQK A;  2MNA A;  2NVX H;  5M5Y H;  3EIV A;  2B63 H;  3HOW H;  4BY7 G;  4L5S A;  3CAM A;  4A3E H;  5K36 G;  4KLK A;  5BR8 L;  4HJ8 A;  4YY3 L;  3RZO H;  5C0X G;  3CC2 A;  1V1Q A;  2Q2T A;  2F4V L;  4KHP Q;  1WCM H;  2KHI A;  2K14 A;  1PV4 A;  4OWX B;  1EWI A;  1XMO L;  1E3P A;  4TQU S;  3I4O A;  1FJG Q;  4BXX H;  3RLN A;  3RLF A;  1Q12 A;  1A0I A;  2N49 A;  2B29 A;  5IYC H;  4X62 Q;  1UE1 A;  1Q81 C;  1VQN A;  2EXD A;  2JQO A;  3UDX A;  1OTC A;  4IOC A;  1SR3 A;  3NEN A;  2BH2 A;  5FLX c;  4DV3 L;  4HJ5 A;  1AE3 A;  2YU9 H;  4DR6 L;  3HOZ G;  4JI7 Q;  4BBR H;  1VQK A;  1CKM A;  2XTI A;  5IP9 G;  2UXD Q;  5AJ3 Q;  3H15 A;  3H3V I;  4YCU A;  3K81 C;  5BR8 Q;  1PYS B;  3HOY G;  1N34 Q;  1HNX L;  4A3J H;  4DR2 L;  4GOP A;  4DPG A;  2AHO B;  2ZM6 L;  4LF8 L;  2K5V A;  5HGQ A;  3ERS X;  3A0J A;  3PUY A;  4DV5 L;  3BU2 A;  4A3D H;  1RL2 A;  1VQE A;  4GNX A;  1IBM L;  2R7D A;  1IL2 A;  3PO2 G;  2GVB A;  1HR0 Q;  2QGQ A;  3UE0 A;  1XJV A;  5IY0 A;  3JC6 6;  3PSI A;  2ZJR A;  1Z9F A;  4FDB A;  2ID0 A;  4JI5 L;  1W2B A;  1X3F A;  4A3B H;  4DV3 Q;  4A3C H;  2A8V A;  4DR6 Q;  3FKI G;  1B7Y B;  4L5T A;  4DKA C;  3E9I A;  1XPR A;  2JA7 G;  4QL5 A;  4P75 A;  4A4I A;  3M85 A;  4QJF A;  1P8L A;  1N36 L;  1HNX Q;  2OTL A;  3I4N H;  2UU9 Q;  4DV5 Q;  1XNR L;  3NEM A;  4LFC L;  3GD7 A;  3GTO H;  1PH5 A;  4JI0 Q;  4WJ3 M;  4GKJ L;  4LW1 A;  1YNX A;  4OON A;  4P74 A;  2N8N A;  1KL9 A;  4JI8 Q;  1PH2 A;  4JI6 Q;  3KF6 A;  1M1K C;  4A3M H;  4LF6 L;  1WJJ A;  1K0R A;  3S1M H;  4DV0 Q;  4BA2 I;  4IJH A;  4DUY Q;  1QZG A;  3S24 A;  2DUD A;  1CSP A;  3CCJ A;  3BJU A;  3KF8 B;  3J81 j;  3HOW G;  4A3E G;  4AIM A;  1Q46 A;  3CCS A;  2L15 A;  4DR1 L;  1JB7 A;  2VUM H;  3HOX H;  4JBK A;  1VQA A;  1GVP A;  3Q8D A;  3CMA A;  5IYD G;  4RG1 A;  4AQY L;  4L5R C;  1BBU A;  3ZJY C;  5LMN L;  4BXX G;  4GKJ Q;  1EIF A;  2E2I H;  3PUZ A;  1PHJ A;  2JA8 H;  1X3G A;  5IYC G;  1WOC A;  5FJ8 G;  4LF6 Q;  3G4S A;  2QA4 A;  4HIM A;  1YI2 A;  2OQ0 A;  4NXN L;  3W1B A;  1T9H A;  1VQC A;  1VS0 A;  2JJQ A;  5IYB G;  5JJI A;  1OXT A;  2UXC L;  1L2F A;  3ULL A;  1SRU A;  3J7Z C;  2UUC L;  4BBR G;  4B3R L;  3PF5 A;  2K75 A;  5LMU L;  1KXL A;  3JAM c;  2Q2U A;  1OXX K;  2E2H H;  4JI2 L;  1JT8 A;  1AE2 A;  2B3G A;  4TVA B;  3HOZ H;  4P71 A;  1X65 A;  2PMZ E;  4K0K L;  4DR5 L;  1YEZ A;  4JOI C;  4PMW A;  1EIY B;  3E9H A;  4B3T Q;  2PNH A;  3CPF A;  3HOY H;  2K50 A;  3ULJ A;  3CPW A;  3RN5 A;  3UDF A;  2WB1 E;  4UP9 A;  4A3K H;  1EQQ A;  2I0Q A;  1CSQ A;  4LF9 Q;  3H3V H;  2D0P A;  1HH2 P;  3A74 A;  5IE8 A;  1VQF A;  1Q7Y C;  4A3B G;  2KHJ A;  1FL0 A;  4A3I H;  4A3C G;  1L1O A;  1KD1 C;  1SFO H;  3J7A 5;  2UXC Q;  3KOJ A;  4JYA L;  3I2Z A;  2NN6 I;  3GDE A;  4B3R Q;  4YHH L;  4IPD A;  3ULP A;  1GO3 E;  4PG3 A;  1XPO A;  1OXV A;  1JE5 A;  1I50 H;  2NN6 G;  3J80 c;  5M5X H;  1EFW A;  3HOU G;  3KFU A;  4IOA A;  1TWF H;  3I4N G;  2UXB L;  4AYB E;  4JBW A;  1I94 L;  2JA7 H;  1PH7 A;  1UE6 A;  4L5Q A;  2Z0S A;  3I4M G;  1X54 A;  1PH1 A;  1J5E L;  1V43 A;  3G71 A;  1B70 B;  1LUZ A;  1P16 A;  2K5N A;  4GN4 B;  5DLQ E;  2YV5 A;  4A3M G;  1YJN A;  2ZJQ A;  4A75 A;  2VL6 A;  4YWL A;  3J80 i;  3PF4 A;  5JEA J;  2K4K A;  5C44 G;  5M5W H;  2GVA A;  1I6H H;  1CKN A;  1EOV A;  4HID A;  2H5X A;  4P73 A;  3GTK H;  3MXN B;  3PV0 A;  4YHH Q;  1VQ5 A;  2HHH Q;  2UUB Q;  4LF5 Q;  4DR7 L;  1X3E A;  5M3M G;  2VUM G;  3F2D A;  2PQA A;  2VQE L;  3M4O H;  3FP9 A;  3KYH C;  4GLA C;  3I56 A;  1KIX A;  2NZO A;  1YBY A;  3D31 A;  5FLM H;  1X9N A;  4UY8 C;  2K52 A;  2MO0 A;  2EQS A;  1ASY A;  3K7U C;  4X66 L;  1YHB A;  3CCQ A;  2JA8 G;  4JI1 L;  5GAD C;  1G29 1;  4IPG A;  1VQM A;  1QVG A;  2OTJ A;  2WFW A;  1EUJ A;  5IYD H;  1XPU A;  4OWT B;  2CFM A;  5J3B A;  2BA0 A;  5JEA G;  3CCR A;  1VQG A;  2VQF L;  4BY1 G;  5FJ8 H;  1IBL L;  2AWN A;  3UDI A;  4X65 L;  3AQQ A;  3HKZ E;  4YCV A;  1QUQ A;  4AH6 A;  4UP7 A;  3AEV A;  1LM0 A;  5IYB H;  3PO3 G;  4ME3 A;  1KC8 C;  4GLX A;  1DGS A;  2ES2 A;  1VQL A;  3L0O A;  3HFZ B;  5IT9 c;  3U4V A;  2WAQ E;  4YY3 Q;  4X66 Q;  4JI1 Q;  4R4C A;  2Y0S G;  2R7F A;  4A93 G;  3A5Z B;  4A3K G;  2F4V Q;  4LF7 L;  1E1T A;  4MTN A;  4O2D A;  3F1Z A;  3S2H H;  1XMO Q;  4UPA A;  3GTM H;  1Y1W G;  4A3I G;  1PH3 A;  3K7A H;  4JI3 L;  4X64 L;  1IBL Q;  4NPS A;  3OTO L;  4HJ7 A;  1XMQ L;  4POF A;  4HIO A;  2JA9 A;  2ZTD A;  1C0A A;  2KEN A;  3TS0 A;  3TRZ A;  2AWO A;  2R7Z H;  3HOU H;  2IY5 B;  1HZC A;  1YVC A;  4JC0 A;  4DR2 Q;  1L0W A;  3DLL A;  1PH4 A;  1XNQ L;  4GN3 B;  5IP7 H;  2ZM6 Q;  4LF8 Q;  4HJA A;  1I3Q H;  3WWV A;  1VQ8 A;  1IZ6 A;  4OXP A;  2Q2I A;  3W5O A;  4C3H H;  4IPH A;  2KBN A;  4UP8 A;  2KCT A;  4DV1 L;  1IBM Q;  5C4J H;  2ALY B;  3I4M H;  4B3M L;  4DV6 L;  2CCZ A;  3KDF A;  3GTL H;  3UDG A;  2NZH A;  1GD7 A;  3D0F A;  4APV A;  4JI5 Q;  1E7Z A;  3HOV G;  1S72 A;  5C44 H;  1KRT A;  2VNU D;  3PIP A;  3S1R H;  4GOP B;  3EBE A;  1NMG A;  4B3S L;  5FLM G;  1N36 Q;  3S2D H;  5M3M H;  4PZ8 A;  4GS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...