2WAQG

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
b'KAQEIILSCEINSIERGSLKNLSIIHMSCNDFNISFDIIDSINIFSQKEKVKAFISKNRLSYTNDDFCGHGYIVTELKDSSSNNGNRYITIISLFGLLVKIISNKESFLKIHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2waqG00
1I50H 4GS3A 2GN5A 5IYCG 1KIXA 3KDFB 4TQUS 3GTOH 1HNZL 1YJNA 1I94L 5FLXc 4JI4Q 4R4QA 3HOZG 1X3FA 5HGQA 1GD7A 1JB7A 3HOZH 3G4SA 1CUKA 1PH8A 1L2FA 4DV7L 4X64L 3RNUA 4PG3A 1KL9A 1CKNB 5AJ3Q 2CKZB 2OQ0A 1QZGA 1BKBA 4GN5A 2GVAA 1NTGA 2ID0A 2CWAA 2UXCQ 4LF4L 3A74A 4LFCL 5FLMG 1PV4A 4DV5Q 3W1GA 4LF7L 4JI3Q 1VQGA 5FLMH 4B3TQ 4OONA 3GTKH 1GO3E 4L5SA 5JJLA 1MJEA 3CC2A 1SR3A 3HOVG 4PZ6A 3PO2G 3HOVH 4QJFA 3CPFA 3PO2H 3CD6A 1IL2A 1D8LA 4B3MQ 5GQOA 1R9TH 2E2JH 2K5NA 4LF6L 1E22A 1YBYA 4HJAA 3BU2A 4DK6C 3NBHB 3CMEA 3HOWH 4NXNL 3TREA 1NJIC 2KHIA 1YI2A 2JEAI 3GTMH 1VQ4A 4NPSA 2ZTCA 3PIPA 1XMQQ 4DV2Q 1YIJA 4A3KH 1W3SA 4IJHA 4C3JH 5C3EH 4DR3Q 4DR2Q 2R93G 4OO1G 2WB1G 3OTOL 1Q7YC 1A0IA 3IRBA 4ME3A 2ES2A 5C0XG 4BBRG 1EYGA 1PHJA 2XGTA 3E0EA 3CP0A 2A19A 4O0AA 3CC7A 2IT1A 1CKMA 1YJWA 2PI2A 1FJGQ 1Z9FA 4UP9A 2UU9Q 2UUCL 3EN2A 5IYDH 3F1ZA 1QZHA 3GTQH 4IOCA 1N32Q 4A3LG 3J7A5 3T1YQ 1NY4A 3UDXA 3U50C 5IY0A 3L2PA 1VS0A 4DV4L 4DUYL 1IXRA 4DV1Q 4A3LH 1HNWQ 3GTGH 2VW9A 4QIWE 3FP9A 2Q2UA 1VQ6A 3MXNB 2JEBI 3I4NG 1E1TA 2BH8A 2A8VA 1L0WA 2VQEL 1X3GA 5JEAJ 1U0LA 4MTNA 4YHHL 1PFSA 4IFDJ 4L5RC 1A62A 1EQRA 1X55A 2IX1A 3M4OH 3E9HA 3I2ZA 3PF5A 1SRUA 4DR6L 3PUWA 3OYYA 3RLNA 5GAGC 3J80c 4RG1A 2DUDA 2QGQA 1YHBA 3AQQA 3K8AA 2K50A 4X62Q 4GNXC 1JJ2A 2WAQE 4A3IH 4A3JH 1XNQL 2KCTA 3CAMA 3AFQA 4JI5L 2ZM6Q 1VQNA 4IPGA 3M7NA 3G6EA 2GVBA 2YTVA 4IJLA 2UXDL 1IBMQ 2UUAQ 1X6OA 2VY3A 5C4JH 4JI0L 5LMNL 3CW2C 3JAMi 3CCEA 4C2MH 1QVCA 1XNRL 4JV5L 3T1HQ 1FVIA 3W5OA 2AWOA 1PH1A 2K52A 5LMNW 1VQAA 1XJVA 1K9MC 1HR0W 2D0OA 2VS1A 1KRSA 2KHJA 2I5HA 1KRTA 4X66L 4DV3Q 1VQ9A 4B3SL 5JJKA 1VQ5A 4KHPQ 3KDFA 4A3DH 4IPCA 4LF8L 2WAQG 4IO9A 5M5WH 3U4VA 4AQYL 4DR7Q 3S16H 4A3GG 4A3BG 2VUMG 1S3OA 1Q8KA 4P73A 1G51A 3S1MH 2R7ZG 4KHZA 4A3GH 5ELOA 2EQSA 3TS2A 2R7ZH 4QGUA 4DR1Q 4APVA 4LUOA 3RZDH 1VQIA 3UDFA 1Y1WH 1I3QH 1CKNA 1KD1C 3H0GG 1HNZQ 4UY8C 4QY7A 5J3BA 1I94Q 1HNXL 5E7NA 3H0GH 3PUVA 1N34L 1J6QA 2UXBL 3CCLA 4BBSH 4P72A 2E8GA 1HZ9A 1AE2A 1Y1VG 3PUYA 4FDBA 1VQKA 2LXKA 2MFIA 4L5TA 3KOJA 3UE0A 1RL2A 1EWIA 3CF5A 4JI7Q 2IY5B 5IYBH 2L15A 2K4KA 3JAMc 2JE6I 4BXXG 3WWVA 3KJPA 3GTLH 4BXXH 2Y0SE 4LF4Q 4LFCQ 1X65A 4LF7Q 2YYZA 4C3HH 3S1NH 5FJ8G 4A76A 5K36G 4LF9L 5FJ8H 2RHSB 1KQSA 5M5YH 3HOXG 4Y7NH 2NZOA 4OWXB 2K75A 4POFA 1M90C 3F2CA 1C9OA 2N3SA 3HOXH 1X9NA 2E2HH 3ICEA 2CCZA 5IE8A 3M9BA 2HHHQ 1GVPA 2VQFQ 3UDGA 2E2IH 2BH2A 1XTDA 3HKZE 4GNXA 1YITA 4OX9L 4LF6Q 2Y0SG 3CCUA 3PO3G 1AH9A 3KF8B 3I55A 1Q82C 5LMUQ 2NVQH 2WB1E 4JI6L 4GKJL 4GN4B 1X56A 1Q46A 4NXNQ 3PO3H 3ULJA 1PA6A 4P75A 2JA6G 1NE3A 3I7FA 4LNQA 1TWFH 3M4PA 1SROA 3ULLA 5M3MH 2UUBL 2JA6H 3M3YH 1HZBA 3DLLA 1KAWA 3RR5A 3CCSA 5DLQE 4NB3A 1N36L 2Q2TA 4JI4L 3ERSX 2AKWB 2ASBA 3HOWG 3OTOQ 2ALYB 4IPDA 3PUZA 2ZTEA 4UP8A 3F8TA 3I4MG 4DK3C 3STBC 4A3KG 2JA9A 2CWPA 4DR4Q 3HKZG 4UP7A 5C3EG 4A3FH 3I4MH 3PCOB 5AJ3L 1M1KC 4GNXB 1EQQA 2R92G 1WYDA 5C44G 2UXCL 4LUZA 1IBLQ 3S2HH 4DV0Q 2R92H 1XPOA 1GKHA 2N78A 5IP7G 5C44H 2NN6I 4HJ8A 3FKIH 4A3EH 1MKHA 1CSPA 2R7FA 4JI1Q 5IP7H 4DUZL 4LFBQ 1OXTA 3PF4A 1FL0A 5GAHC 3J80i 1WCMG 3A5UA 1I6HH 1V1QA 1WCMH 2Z0SA 5IYDG 3J81i 3NEMA 4B3RQ 5C0XJ 4GLAC 2JA5G 1KHIA 1G291 2VZAA 3S15H 2JA5H 4A4IA 2B29A 1OXVA 4YY3Q 4JYAQ 1NMGA 2VL6A 4LF5Q 2JJQA 2VQEQ 3S24A 1SE8A 4YHHQ 4LUVA 5EAYA 4HJ9A 4EX5A 2LXJA 4MNOA 5GAEC 3GTJH 4GKKL 1Y14B 2IHEA 4KI0A 2F4VQ 1EIFA 5M3FH 2JQOA 4R4OA 4DR6Q 2F3IA 4JI2Q 1WOCA 4DV2L 4PMWA 4LFAL 1ASYA 4A93H 4XIGS 4JG2A 3CCRA 4DR2L 4AIMA 5IWAL 4A3MH 1T9HA 2I5MX 1XNQQ 1LYLA 1E24A 2V1CC 4JI5Q 4K0KL 2JK8A 1J5EL 4JBWA 3EBEA 3H15A 2UXDQ 1IBKQ 4A93G 3HFZB 1PYSB 4PZ8A 5LMNQ 3BJUA 4A3JG 4A3IG 3KLWA 3CPWA 4DR5L 2BA1A 2MNAA 1HR0Q 5BR8Q 3J81c 3CCVA 2UU9L 1N33L 2K5VA 1P8LA 2AMCB 1N32L 5C4XH 1LM0A 1LUZA 4AYBE 4DNIA 3K81C 1G6PA 4X66Q 3RN2A 3A5ZB 1PVOA 4DV1L 1V43A 1HNWL 1E3PA 1VQMA 3MEFA 4OWTB 4P74A 1CSQA 4JI8L 4AQYQ 2OTJA 3B6YA 3CXCA 1XMOL 1JMCA 2D62A 4DAMA 1VQEA 4R4TA 4A3DG 2I5LX 2N8NA 3K80C 3E9IA 4BA1I 1X54A 3PV0A 1P16A 2ZJQA 4OWWB 1HNXQ 1VQJA 1YZ6A 1IZ6A 4BY1G 1N34Q 2XTIA 4L5QA 4AYBG 4BY1H 2E5LQ 3S14H 1CKOA 1Y1WG 1K73C 3TRZA 4YWMA 3S1QH 3M4QA 4LWCA 2R7DA 4YCWA 3L0OA 1S72A 4BBSG 1Q12A 1BVSA 1UE6A 1OTCA 4NXML 1B70B 2C35B 3NELA 3J7ZC 1K8GA 4DV7Q 4X64Q 4R4CA 2R6GA 5IYBG 4X65L 2UUAL 1B7YB 1SLJA 3U4ZA 3SGIA 2MO1A 1OXUA 2MO0A 3AFPA 4H02A 3KF6B 4X6AH 1DGSA 1L1OC 3TEHB 4GOPB 3T1HL 2EXDA 2YTXA 4KLKA 1Q86C 4WJ3M 4POGA 5JJIA 1OXSC 2Z6KC 1PH3A 5M5XH 1PH5A 1PYBA 1S40A 4DV3L 4EQ5A 2JA8G 4KHPL 4RMFA 2JA7H 3K7UC 2VNUD 1A8VA 1QUQB 1TWCH 2AHOB 1Q1BA 2A1AA 3NENA 3K7AH 4OX9Q 2JA8H 4A3CH 1NMFA 4DV6L 3HOUG 4DR7L 4Y52H 3RLOA 4JI6Q 3H3VI 2DGYA 4O2DA 3HOUH 3DM3A 2NVXH 3RZOH 1QVGA 4DR1L 1WI5A 3S2DH 4GN3B 4P71A 4PZ7A 2PI2E 5H1SE 2N49A 2UUBQ 5IYCH 2HT1A 1N36Q 1K83H 3EIVA 2FXQA 1UE1A 1YVCA 4HIOA 4JBKA 2NZHA 3KJOA 1JT8A 1KXLA 4YWLA 4A75A 3PUXA 1C0AA 3LGJA 5M3MG 4QL5A 4UPAA 2ZJPA 3CCJA 2AWNA 1UWVA 1EFWA 4JI7L 4JBMA 4WJ4A 1E7ZA 1RIPA 2ZTDA 3CCMA 4YCUA 4IFDI 1U5KA 2H5XA 2PQAB 2KBNA 1Q81C 4GLXA 1EUJA 3Q8DA 4DUZQ 1SMXA 4A3FG 3TQYA 1LTLA 3CQZH 2CQOA 1PH7A 2HIVA 3U58A 3I4OA 1YHAA 2EIFA 1PH6A 4A3EG 1AE3A 1VQHA 3FKIG 1VQ8A 2PMZE 2UUCQ 3GO5A 3M85A 4DV5L 4JOIC 4JI3L 1UEBA 4DKAC 2HHHL 4GOPC 4B3TL 1WFQA 4HJ7A 5GROA 2VQFL 1K0RA 4BA2I 1PH4A 3FHWA 4J15A 4XTCS 2KCMA 3PSIA 4DV4Q 1PH9A 1VQCA 1ASZA 2OWOA 4DUYQ 5LMUL 3GTPH 4GKKQ 1JJCB 4JC0A 3KFUA 4OXPA 2RHQB 3G48A 4HJ5A 3CC4A 1N9WA 4B3ML 2WP8J 2OCEA 3G71A 3AEVA 1YEZA 4LFAQ 3I56A 1V9PA 1D7QA 3HKSA 1L1OA 1TWAH 2IX0A 4YCVA 1VQ7A 1H95A 2ATWA 3TS0A 5M3FG 2R93H 5IWAQ 2Z6KA 2HQLA 2LSSA 1X3EA 4IPHA 3J81j 2Q2IA 2PNHA 4DR4L 4K0KQ 3PIOA 2NVYH 1XMQL 3D31A 4BBRH 1K8AC 1J5EQ 4QQBX 2QA4A 4DR3L 3H3VH 1HZCA 1KC8C 3STBD 4A3MG 1IBLL 2OTLA 4DV0L 4DR5Q 3CCQA 5GADC 1VQLA 1N33Q 4LFBL 4JI1L 3F2DA 1E1OA 3S1RH 3GDEA 3RN5A 1W2BA 1K3RA 3JC66 1XPRA 4HIMA 1BBUA 4LW1A 2WFWA 2ZJRA 2D0PA 1L1OB 3AYHB 4JI0Q 1FJGL 1NBWA 4B3RL 4HIKA 1C7YA 4GLVB 4R4IA 5JEAG 1XNRQ 4JV5Q 4JI8Q 1Z47A 4YWKA 1BBWA 5C4XG 4IFDG 4HIDA 3BZKA 2K14A 5IP9G 3A0JA 3ZJYC 4YY3L 1XMOQ 4LF5L 3D0FA 4JYAL 1JJGA 1TWHH 3K0XA 5IP9H 3I4NH 3F2BA 4B3SQ 4IOAA 3T1YL 1MJCA 1UE7A 3ER0A 4LF8Q 1VQBA 1XPUA 2F4VL 3RLFA 2BA0A 1VQDA 4JI2L 2NN6G 2NVTH 1SFOH 3UDIA 1I5FA 1B8AA 2Q2HA 1HZAA 3KF6A 4JOIA 1YJ9A 4R1JA 4GOPA 2UXBQ 4NXMQ 3L7ZC 2B63G 1WJJA 1N8RC 3GD7A 1QVFA 1HJPA 3UE1A 2B63H 5ELNA 4JCVE 1IBKL 2IHFA 4X65Q 3VDYA 4JBJA 2YU9H 1HR0L 1EIYB 1QUQA 4X62L 2QEXA 5BR8L 1GM5A 2YTYA 1YNXA 2OQKA 4BY7G 3KYHC 3OW2A 2ZM6L 1PH2A 4BY7H 1O7IA 1YHQA 3CMAA 4LF9Q 1A63A 1SN8A 1IBML 1Q1EA 2MQHA 1TWGH 2CFMA 2RCNA 4MZ9A 1MIUA 2YV5A 2KENA 1VQFA 1VQOA 4TVAB 5HY6A 1JE5A 2F52A 4DV6Q 3ULPA 1UE5A 3S17H 1OXXK 3W1BA 4A3BH 1IYJB 1EOVA 4DAYB 4AH6A 2VUMH 2JA7G 4OO1I 2B3GA 4A3CG 3BZCA 4DPGA 3HOYG 1VCIA 1FGUA 4C3IH 5C0XI 3HOYH 2K5HA 2PQAA 3PGZA 5IT9c 4ALPA 1VQPA 2HIXA 2RF4A 4GKJQ 1HH2P 2I0QA 2E5LL 1TXYA 1Y1VH
chains in the Genus database with same CATH superfamily
1I50H 2GN5A 4KMUC 1KIXA 5HGQA 1J9OA 3P20A 1GD7A 1JB7A 4CJ2C 2LS01 3G4SA 3I90A 4V190 4X64L 2HDMA 3SR1A 4X3TA 2BOSA 1EL0A 4L63B 3BYTB 4GN5A 3D8GA 4G57A 3K59A 3A74A 4LFCL 5FLMG 4LF7L 3P7JA 4JI3Q 2F0JA 3S14B 3QO2A 1MJEA 1SR3A 1Y1WB 3HOVG 1I4PA 1EY4A 3PO2G 1F2LA 2V4DA 4QJFA 2K5WA 3A7AB 5C5LA 4RGOS 1IL2A 2K6AA 5GQOA 2NTTA 5CV7A 4EVOA 1A2UA 1A3TA 1JE4A 5IGBA 1F77A 5A35A 4HJAA 4NXNL 3GTMH 1VQ4A 1XMQQ 4C3JH 1G91A 1PRTF 5KYIA 2EYFA 4RFBA 3OTOL 1ENAA 4OO1H 3OMCA 5KNCA 1XYIA 2ES2A 5C0XG 1EYGA 3CP0A 3FEWX 4XT3B 4UP9A 1TIID 4RHSA 1STGA 2JYOA 1WTOA 2WV6D 1SNDA 2XWJB 5IIFA 3JAML 1NY4A 4A3LH 1VS0A 1JOKA 2VW9A 2SDFA 1KTKA 2D2CC 4WJWA 2EZVA 3MXNB 1BCPB 1A15A 1E1TA 1IYUA 1GUGA 1X3GA 3MVVA 4YHHL 2I07B 4DAVA 4IFDJ 3G6JB 3I2ZA 3FKIB 1MBYA 5GAGC 3Q22A 1MHWC 4RG1A 3NWTA 4GNXC 1JJ2A 2FHTA 3PMFA 1LACA 2ZM6Q 4DAYA 1IBMQ 4KKTA 1O7LA 2F0MA 1EOTA 5LMNL 5CR3A 1TWAB 2CVRA 5FLXE 5HURA 3T1HQ 2DJGC 3R3OA 1BXTA 2D0OA 1KRSA 1KRTA 2Z4IA 2B2TA 3KDFA 3D3RA 4IQZA 4IPCA 2WAQG 1GHJA 1HHVA 4A3GG 5M9OA 4A3MB 1S3OA 1G51A 2EQSA 1EYAA 4QGUA 1BCPC 4APVA 3RZDH 3UDFA 5LL6X 2EJGC 1Y1WH 3H0GG 1HNZQ 1EU4A 4QY7A 2CH4A 5J3BA 5E7NA 3LNNA 1A6XA 1N34L 2FINB 2EDGA 2FMMA 1Y1VG 1VQKA 2LXKA 5C4XB 5KGUA 3UE0A 3TBIB 1TWHB 3D6CA 3MFGA 3CF5A 3KJPA 3GTLH 3D4WA 2RKSA 3NTKA 5FJ8G 4A76A 4LF9L 1DYQA 2RHSB 1KQSA 1M8AA 4CGYB 2G5DA 2K75A 3Q24A 1SMYD 1C9OA 3HGBA 2E2HH 3ICEA 4QIWB 4H44C 2HHHQ 3IFTA 4O1NA 2BH2A 1XTDA 4K5VA 3HKZE 1FR3A 1YITA 4LF6Q 3CCUA 2F0KA 3J81L 3PO3G 1TR5A 2WB1E 2HCIA 4GN4B 1XX8A 3I72A 1ENFA 4G7HC 1I4HA 2G9HD 2JA6G 1NE3A 1TWFH 5DM73 1SROA 3ULLA 3M3YH 3DLLA 1PZJD 2KOLA 5G3LF 3CCSA 1SNMA 5DLQE 4JI4L 1SYFA 3HOWG 2ASBA 4IPDA 3VYTA 1YNNC 2L11A 4A3KG 4J6HA 3A8KE 2ENBA 4XXEA 3J7AF 1WD0A 3VR6A 4PMCA 2UXCL 4LUZA 3ND8A 2XSCA 4ZUIA 3VYRA 3BDOA 5IP7G 4DV0Q 2R92H 2NN6I 3FKIH 5I9PA 4JI1Q 4DUZL 1OXTA 1SNCA 1FL0A 1Y1VB 2F0WA 3A5UA 1V1QA 3FRPB 2NYZD 1WCMH 1KABA 4B3RQ 1EY9A 3NEMA 1KHIA 3HOZB 4XT1B 3D4RA 1ESFA 3S24A 4K2LA 4HJ9A 4GKKL 5IGFA 1LTBD 5DEHA 3GTKB 4DV2L 1QOHA 3N6RA 4XIGS 3CCRA 2EJFC 4A3MH 1LYLA 1E24A 4JI5Q 3V96A 2F0SA 2RDHA 3H15A 1R9TB 2FFKB 4A3JG 3KLWA 2EYOA 5BR8Q 4GZYC 4FF1A 2K5VA 1EFID 5JEAH 1N32L 5C4XH 1LTRD 3EROA 1QNUA 5CV9A 1G6PA 1FNVA 3SK4A 2AQ3B 4RCNA 3H91A 5HGTA 5EQ0A 1V43A 1HNWL 1VQMA 1G2TA 4OWTB 3E3XA 1CSQA 4KTAA 4P74A 3MXUA 5I6WA 4DAMA 4R4TA 1HQRD 1X54A 3ITPA 5JVH3 1XTCD 2QF7A 2ZJQA 1YZ6A 4IUUA 1IL8A 4C1NI 5CBEE 1MGSA 4CKBA 3PIP3 1K73C 1SBBB 3TRZA 1NUCA 1BO0A 3S1QH 2MHVA 1OTCA 4NXML 3J7ZC 1XWEA 1K8GA 4FF3A 4X64Q 4XQQA 1Q8IA 4X65L 4NMZA 3I4NB 3SGIA 1K3BC 2MO0A 3AFPA 1GUOA 4H02A 4KY6A 1DGSA 5FKAC 2YTXA 3M4OB 1EYDA 2SOBA 1PYBA 1S40A 4DV3L 4EQ5A 1S5ED 2VNUD 4RMFA 3K7UC 2EY2A 1X3QA 5FO7B 3E0JA 1AFPA 1NMFA 4DNTB 2DGYA 2XRQD 1SSOA 4PV1C 2NVXH 4ULLA 4DR1L 1WI5A 4PZ7A 1JICA 1N36Q 4CDEC 1C8CA 1UUPA 1BCPD 4YWLA 4A75A 3PUXA 3LGJA 2F0IA 4QL5A 5CC4A 4UPAA 5M3MG 2F3VA 4JI7L 2A69C 3KBGA 4YCUA 2EYMA 2QDLA 3E5SA 4A3FG 3NQIA 1PH7A 2B8GA 4K14A 2R7ZB 4FF4A 3GO5A 4JI3L 2L55A 3I4LA 1WFQA 1HUMA 4HJ7A 2VQFL 1PH4A 3FHWA 2KCMA 2MJ8A 4RKLA 1PH9A 3T53B 5CMDA 3MZ5A 2M9VA 2OCEA 1MSGA 4CJ0B 1V9PA 1PLFA 4JPBW 4YCVA 5M5YB 1VQ7A 1H95A 2DNCA 1B9NA 2ATWA 3HOXB 5IWAQ 2BCOA 1JR0D 4N9TA 4K0KQ 2XIWA 1XMQL 3DUZA 3W2DA 3H3VH 1YNND 1KLUD 1HZCA 1CFMA 1TVXA 1V8QA 4DR5Q 5GADC 1N33Q 2PPBC 1SDFA 3S1RH 1XPRA 4HIMA 1BBUA 2E2JB 5M3MB 2QDBA 1E2ZA 3DMUA 1AZQA 5FLXL 4GLVB 5CV4A 1HFGA 1KDBA 1BBWA 4YWKA 4DF7A 4HIDA 2F0GA 2O5JC 3BZKA 4LF5L 4IFDH 1D5XC 3I4NH 3K6OA 5C3EB 1D2BA 1ONLA 2F0OA 3S2HB 4RH6A 1D1KA 1U4LA 5C44B 2XNAC 2F4VL 4IN3A 4RGNA 5J39A 3R93A 1LTID 2NN6G 3UDIA 4OEMB 1I5FA 1SYGA 1HZAA 1QB5D 1U9RA 3QIAA 1YJ9A 4GOPA 4M8AA 2JA5B 1QVFA 3UE1A 1UNSA 2ZT9C 1EWCA 2EYLA 4IUQA 4L6TB 1HR0L 1KDCA 1LTAD 3C2PA 1U4RA 1JWUD 1YNXA 4N9PA 2ZM6L 3BG3A 1YHQA 5C6AA 4LF9Q 2QILA 1A63A 4IZ8A 2OF1A 1IBML 2IL8A 1Q1EA 1W6JA 3L3OC 4ZRZA 1VQOA 2B2UA 4DV6Q 4IUTA 3ULPA 1KNAA 1ILQA 1AN8A 1EOVA 1W6KA 4DAYB 4AH6A 5KYLA 1ML0D 1S5FD 4ABNA 4C3IG 5D3DA 4DPGA 3HOYG 1VCIA 4A93B 5C0XI 3A55A 2E5LL 2I0QA 2O5IC 3IL8A 1LTGD 5IYCG 4NKLA 3KDFB 3GTOH 1HNZL 3OIPA 4HN7A 4JI4Q 4R4QA 1X3FA 1PH8A 2IX3A 5D14A 1KL9A 4F8MA 2CKZB 5KNDA 2UXCQ 4FO2A 5M5WB 1WTHA 1IKMA 1PV4A 4DV5Q 1VQGA 2JSOA 4BY1B 3K5LA 1SYCA 1ZYRC 3K57A 4ZLTF 3A8JE 1WTPA 1D5ZC 3CPFA 4WRDA 5ELCA 4B3MQ 2E2JH 1BQQT 5BN4A 4LF6L 2F0LA 4G4KA 4DK6C 4LJZC 1WTQA 1SYBA 2KHIA 3KLSA 4NPSA 2ZTCA 2KEDA 2EY5A 4C3JG 3R2IA 2WIIB 4DV2Q 1YIJA 4L8JA 5C3EH 2JA8B 1TWCB 4OO1G 1PTOB 2WB1G 5I4DA 3IRBA 5J22A 3HOUB 2DN8A 3QOJA 1PHJA 1O7ZA 1EWHA 2A19A 3S2DB 2IW3A 2E2IB 4F88A 1S5CD 5ELFA 2PI2A 4CDFC 1FJGQ 2UUCL 3EN2A 3F1ZA 1JWSD 5T1IA 2ICIA 1N32Q 4CHTB 4A3LG 4XYQA 1Q3LA 3UDXA 3U50C 5IY0A 2F1MA 1ET9A 1HNWQ 1CQVA 3FP9A 2Q2UA 2K04A 1EY6A 3CQZB 3AU7A 3GV6A 5JEAJ 3T13A 3VR3A 1NR2A 1PFSA 4L5RC 5F2DA 1EQRA 2IX1A 3E9HA 3Q6SA 1F2YA 1WTXA 2TMPA 1RF2D 3PUWA 1I4QA 1IHZA 2L0CA 4BWGB 3J80c 3OMGA 2QGQA 3K8AA 1TS4A 2KCTA 3CAMA 4JI5L 4IPGA 3M7NA 1PYWD 1HCZA 4IJLA 5C4JH 2F0EA 4JI0L 3CCEA 3AB9A 3Q23A 5EKIA 3TZUA 2PMZB 2PZWA 1XJVA 4EQNA 5M3FB 1HR0W 4DV3Q 1Y69U 1F2MA 4CDCC 5CYUA 5M5WH 3U4VA 3SDZA 1BDOA 1RODA 4A3BG 1Q8KA 3S1MH 5ELOA 2PYKA 3BS1A 4DR1Q 3RMHA 3IAYA 4LUOA 1KD1C 1VQIA 4UY8C 1CKNA 1ESRA 1I94Q 4LMQD 3D4DA 4QF4A 5JPMC 2UXBL 3CCLA 4P72A 3PUYA 3PIO3 4FDBA 1TQOA 1AP0A 2L12A 4JI7Q 2A6EC 3WWVA 1CQFA 1S4ZA 1X65A 4C3HH 2B39A 3TN2A 5EGTA 1EIGA 1CZGA 4Y7NH 4OWXB 2D9UA 3QG1A 1QWYA 3F2CA 3NBHA 5IE8A 5C4ZA 1GVPA 2VQFQ 2B63B 2E2IH 3CKIB 2Y0SG 1SYEA 2Z6BA 2K7VA 1UAPA 4GKJL 1Q46A 2EVBA 3ULJA 4BY7B 1O80A 2WKDA 4P75A 2LMCB 3M4PA 1N36L 1KAWA 3RR5A 3LX0A 1R4PB 2ALYB 3U9OA 3PUZA 5D3IB 3HZXA 3F8TA 3S17B 1RD9D 4A3BB 4U68A 3I4MH 4KD3A 3TP7A 3PCOB 5AJ3L 4GNXB 2JA7B 4HAEA 2R92G 3I3CA 5E3FA 3DM1A 1XPOA 2N78A 4A3EH 1YI2A 1MKHA 2R7FA 3DWPA 2F0FA 5DAUA 1V1PA 2N88A 1I6HH 1WCMG 4J8QA 2K5QA 1STEA 5IYDG 4KV6A 4HR7B 1G291 2VZAA 3S15H 1DD2A 3MHBA 1OXVA 4LF5Q 2J0TD 3VR4A 4E6IA 4EX5A 2LXJA 4MNOA 5GAEC 1B44D 1Y14B 1H9JA 2F4VQ 5M3FH 5L37A 4R4OA 4DR6Q 1WOCA 4PMWA 1ASYA 3DHQA 1LO5D 2KCNA 2ZXRA 3HOVB 5IWAL 1T9HA 1XNQQ 3PO2B 1VDZA 1NCVA 4K0KL 3HFZB 4PZ8A 3BJUA 1HA5A 4A3IG 2GA4B 1HR0Q 4DR5L 2UU9L 2Q8IB 3CCVA 1U4PA 1N33L 1XXGA 4N8X1 4DNIA 4X66Q 3RN2A 1ICWA 3A5ZB 4DV1L 1HTPA 1I4XA 3MEFA 4N8FA 3B6YA 3CXCA 1JMCA 2D62A 1VQEA 4A3DG 2I5LX 3K80C 3E9IA 4BA1I 3PV0A 1P16A 4OWWB 1HNXQ 3C46A 4I7ZC 1A3UA 1PDQA 4KN4C 4AYBG 2KQ3A 2E5LQ 3GTQB 3S14H 4M1UB 3WDNA 4YWMA 3MA2B 2R7DA 3L0OA 1S72A 4BBSG 1Q12A 5CV6A 4H7BA 5ELBA 2R6GA 5IYBG 2UUAL 3MXGA 1PTOD 1BBXC 2MO1A 3DEPA 4X6AH 1X32A 4GOPB 2PW7A 2EXDA 4WJ3M 1EQTA 1PH3A 1SFOB 3DWQA 2JA7H 1C4QA 4OX9Q 4A3CH 4Y52H 4DV6L 4A3IB 4JI6Q 3F2UA 1I6VC 2PZTA 1EZ8A 1QVGA 4GN3B 2UUBQ 4YIJA 2N49A 3N52A 3C1EA 2FXQA 4C2MB 1UE1A 1YVCA 2K03A 1JB3A 2KJXA 4DK1A 1C0AA 3TP8A 2RDFA 2A68C 1BNZA 1UWVA 3NWSA 2DJFC 2ZTDA 3H09A 1U5KA 2H5XA 1Q81C 5JAVA 2WAQB 4A3GB 1ICFB 2DNEA 3TQYA 1GUWA 4HEDA 1WVLA 1CHQD 1F9QA 1Z6HA 3I4OA 1YHAA 2EIFA 1I3QB 1DOLA 1AE3A 1VQHA 5DNFA 2PMZE 3H0GB 2UUCQ 1JQYD 4DV5L 2KECA 3MEHA 4GOPC 5GROA 1NSNS 1FYCA 4J15A 2HCCA 3OSOA 3M7GA 5LMUL 4JC0A 5KEEA 3W3AA 4OXPA 3KFUA 2RHQB 2MUYA 2EYJA 4B3ML 3G71A 3AEVA 4LFAQ 1STAA 1L1OA 1TWAH 1CI3M 2IX0A 3CHBD 4HSPA 3OW7A 2Z6KA 2M00A 2LSSA 2B2UC 1VF5C 3J81j 2PNHA 4X3UA 4DR4L 4QMGA 3D31A 2B2YC 3T56B 1KC8C 5T1GA 1VQLA 2NVQB 3PO3B 3F2DA 1E1OA 1GUNA 3RN5A 4FVMA 4LW1A 1L0XB 1LT3D 3AYHB 2JA6B 1DM0B 4JI0Q 2IJ0A 1FJGL 4XDXA 5KNBA 4R4IA 2A5HA 3BZDB 3HOWB 1STNA 1Y8OB 5EBDA 4G7OC 4IFDG 2KVMA 2K14A 2PZUA 4DNRB 5AFWA 4YY3L 1XMOQ 3D0FA 1TWHH 3K0XA 5IP9H 1D5MC 4A3KB 2F0TA 4C56C 1EY8A 2QW7A 3QB3A 3RLFA 2BA0A 4JI2L 4IALA 1DJRD 1SFOH 2QEJC 1B8AA 5EBCA 2F0NA 3NQTA 1G8ZD 3KF6A 4R1JA 2I46A 3NXWA 5IT9E 2UXBQ 1WJJA 1HJPA 5IGGA 2ICEC 5ELNA 5IODA 4I65A 1H9SA 3FVQA 3NBIA 1B4OA 4JBJA 2Z9HA 1EIYB 1QUQA 2QEXA 1GM5A 2YTYA 5CGKA 2O2LD 1HA6A 4FNFA 3GTGB 3T16A 1TU2B 3CMAA 1SN8A 4QB4A 3TDQA 4KY7A 2MQHA 1I4GA 1I4RA 1VQFA 1EY0A 2A6HC 1OXXK 1IYJB 1H9KA 4OO1I 1MD2D 4P2CB 1FGUA 1HXYD 2K5HA 1WTVA 5IT9c 4A3JB 4GKJQ 2RF4A 1PMRA 1TXYA 3VYSA 1Y1VH 1IKLA 3MAQA 1STBA 3ZYYX 1YJNA 1I94L 1KNEA 1SNQA 3HOZH 1TKWB 1CUKA 3H6MA 4CKEA 1L2FA 2E74C 5KIXA 1CKNB 5AJ3Q 1EEID 2OQ0A 4I7AA 1QZGA 2AUKA 2GVAA 2ID0A 2MPMA 2CWAA 5BN3A 1BF4A 2C5CA 1H9MA 3S16B 4IUVA 4OONA 3GTKH 3SVMA 1GO3E 1Q90A 4XQJA 3C1FA 3GV3A 3IFDA 4PZ6A 1DXMA 3H3VC 3NP8A 2MP1A 3KK7A 1RTNA 4DN4M 1R9TH 4K5XA 4KKUA 5JVG3 2F0PA 1B3QA 3NBHB 3CMEA 5EPJA 3HOWH 1DZ1A 3TREA 2E2DC 5M5XB 4A3KH 1W3SA 4IJHA 1CA6A 2R93G 2A68D 1Q7YC 1A0IA 4ME3A 4BBRG 2XGTA 4HSVA 3CC7A 1BCPF 2IT1A 1CKMA 1YJWA 4UDUC 3ERQA 2UU9Q 2AQ2B 1QZHA 4OL7A 4IOCA 1E2WA 1S5DD 1K8MA 3A8IE 2E75C 5COYA 3J7A5 3T1YQ 3CRLC 3L2PA 4DUYL 4DV1Q 1VMCA 3GTGH 2SEBD 4QIWE 1VQ6A 2B8FA 1UEAB 1V1PB 1QE6A 1LV9A 2BH8A 4OELB 4A3FB 1RJTA 1IW7C 1KDAA 4MTNA 3CRKC 2XWBB 3M4OH 4H13C 1SRUA 3QWNA 3FPPA 4DR6L 3RLNA 1MI2A 1PZKD 2CW0C 1JWMD 4QCLA 2DUDA 1YHBA 3NHHA 3URYA 2WAQE 4A3JH 3GTPB 1XNQL 1VQNA 4MTKA 2GVBA 2UUAQ 1X6OA 2VY3A 4CDDC 1SAPA 4O42A 3JAMi 3JAME 3V2TA 3BDLA 4JVZA 4FXDA 4JV5L 3GTJB 1RKNA 1QJOA 2HUGA 2K52A 1VQAA 2O4XA 5FOBB 4K2KA 2VS1A 2KHJA 4R8IA 4X66L 2PNRC 5JJKA 1CM9A 5ELEA 2QKIC 1VQ5A 1PRTC 4IO9A 3S16H 2VUMG 4P73A 5JPNC 4NW2A 2B2YA 3TS2A 2R7ZH 2BDNA 2RVLA 4MN3A 1HNXL 2L4NA 4OHJA 1J6QA 2E8GA 4B9XA 2PCFB 1EY7A 2K32A 3KLRA 1WD1A 1CZWA 1RL2A 2AUJD 3JAMc 3I70A 4BXXH 4LF4Q 2WACA 1G6ZA 1ZXTA 5K36H 3V05A 5M5YH 5D65A 4DXFA 3HOXH 2N3SA 2CCZA 3DEOA 3DWAA 4DK0A 2A6HD 4ME5A 5A2QE 5I2YA 1T5XD 4OX9L 4UAIA 2YU9B 5ISRA 1AH9A 3I55A 5LMUQ 4JI6L 4ZYSA 1X56A 3HRZC 4FP5D 3I7FA 1NR4A 5M3MH 2UUBL 2XVSA 1TWGB 2Q2TA 4NB3A 1EY5A 3ERSX 2AKWB 4UP8A 1O78A 3I4MG 4DK3C 3STBC 4DR4Q 2JA9A 3HKZG 4K8JA 4UP7A 4A3FH 2HD3A 2EJMA 1PFBA 2VB2X 3HS0C 3S2HH 4C3IB 1GKHA 5C44H 3HOYB 4HJ8A 1RHPA 2A69D 1CSPA 1ENCA 1I50B 5GAHC 3J80i 3GP7A 4C1NK 3J80E 1K83B 2L9HA 3J81i 5C0XJ 3J81E 4RHRA 2JA5H 4A4IA 4YY3Q 2VL6A 1D1IA 2JJQA 4KKSA 2VQEQ 4FF2A 2JP1A 1SE8A 4LUVA 5EAYA 1CK1A 1V1OA 2F0HA 4ZKBB 3GTJH 2IHEA 4KI0A 1EIFA 3OPOA 2B2WC 2EYHA 3OIQA 4JI2Q 4CJ1B 4LFAL 1AW7A 4X3SA 4JG2A 4WORA 4DR2L 4AIMA 1CHPD 2KUMA 1VF7A 3NK9A 3BVMA 5ELDA 2I5MX 2JK8A 3EBEA 2UXDQ 1PZID 1PYSB 1J8IA 4A93H 3CPWA 3I73A 4JW0A 3J81c 2DY8A 3TP6A 3GTMB 1P8LA 3VYUA 1LM0A 2IPKD 1LUZA 3K81C 3M4YA 2L1BA 3S9WA 5EKKA 4C3JB 1WTRA 1E3PA 4AQYQ 2OTJA 2WB1B 1JCKB 5BN5A 1XMOL 3OWFA 2NVYB 2N8NA 2NN6H 4F87A 2LKVA 5LL6S 1QILA 3MC0B 1IZ6A 3BVGA 3SHLA 1IW7D 4DU9A 4L5QA 2R61A 4BY1H 2F0UA 4B08A 1Y1WG 1EU3A 1GUSA 2DY7A 4LWCA 3VA5A 5J1ZA 1T5EA 1M4VA 3NELA 4R4CA 1B7YB 1SLJA 1OXUA 3KF6B 1L1OC 3TEHB 3KF8A 4Q5VA 1QCBD 1Q86C 3FPUB 4POGA 2Z6KC 1PH5A 1PFMA 5TSSA 4KHPL 1A8VA 1QUQB 1TWCH 2AHOB 1Q1BA 1PTOH 2A1AA 2JA8H 1ILPA 4DR7L 5JJZA 3RLOA 3H3VI 2XRSD 3HOUH 1PRTD 3DM3A 3S2DH 4P71A 5H1SE 1TS2A 5IYCH 2C9OA 3O13A 1K83H 3EIVA 4HIOA 1KXLA 2NZHA 1JT8A 2Z8LA 1DOMA 2AWNA 1EFWA 4JK1C 2AQ1B 4WJ4A 1E7ZA 1RIPA 4IFDI 1AEXA 4Q0FA 2ZXPA 1PXUA 1EUJA 5E1FA 1LTLA 1TS3A 3CQZH 4BS9A 2HIVA 3U58A 4U673 4CBVA 3RZDB 4KD4A 2BDOA 1PH6A 2TSSA 1GOZA 3FKIG 3I8ZA 4ZUJA 1UEBA 4K5WA 4BA2I 1K0RA 4XTCS 2ZXOA 3PSIA 3J7AV 1VQCA 2OWOA 1U4MA 4DUYQ 3GTLB 3K58A 3SK6A 1ZYRD 2J7ZA 1YEZA 3U9SA 4ZKCB 3AMUA 1D7QA 3HKSA 3TS0A 2E2HB 4J1MA 1X3EA 4ZCKA 2NVYH 4WFN3 1STHA 1K8AC 1J5EQ 4QQBX 1MSHA 3STBD 2PQEA 3LWEA 4A3MG 1IBLL 2OTLA 1H9RA 1SE3A 4LFBL 2Y0SB 1K3RA 1TS5A 3EVQA 1TWFB 3JC66 3FMCA 2WFWA 2ZJRA 3M3YB 1SNPA 1NBWA 4HIKA 5JEAG 4JV5Q 2P5ZX 5K5PA 4JI8Q 4EGVA 3TMEA 5C4XG 5IP9G 3A0JA 3ZJYC 4JYAL 1O7YA 1NAPA 2J4XA 3F2BA 4IOAA 3T1YL 1MJCA 1UE7A 4QUCA 3BVZA 5JOBA 2RDGA 3MFYA 2R92B 2EXZA 2OXPA 2Q2HA 2K28A 1CT1D 2F4IA 1WCMB 4JOIA 3ONAB 3L7ZC 2G9DA 3EQLC 1N8RC 2B63H 5C4HA 1A2TA 4JCVE 1IBKL 2IHFA 2OEOA 2K01A 3VDYA 3K5MA 3NPPA 1G2SA 1F2ZA 3KUPA 1Z7TA 2RSOA 5IOCA 1PH2A 4BY7H 3K5NA 4RGTA 2Q8RE 2CFMA 2RCNA 3HEJA 1MIUA 2YV5A 2KENA 4TVAB 1F9RA 5HY6A 1JE5A 2B2WA 1UE5A 3S17H 5G3LD 3W1BA 3P1HA 4A3BH 1CTMA 5A2QL 2B3GA 4IUPA 4TSSA 3BZCA 2Z4HA 1B3AA 4X3KA 2R3ZA 1LT4D 2EY1A 3PGZA 2PQAA 1VQPA 2HIXA 1HH2P 1E0BA 2M2LA 1RDPD 4GS3A 1SJED 4NDXA 3KBXA 1HFNA 4TQUS 2Z1CA 1EEFD 5FLXc 3HOZG 3SEBA 4ILWA 4UHVA 3QR8A 4DV7L 2F3WA 3RNUA 4PG3A 4HCSA 2D5DA 1BKBA 4KJOA 4A3DB 1NTGA 4RCOA 4LF4L 2A6ED 3W1GA 2A73B 2X6GA 4HCEA 5FLMH 4B3TQ 4L5SA 4AYBB 5JJLA 3J80L 1WTWA 3CC2A 4XQNA 3S1QB 3HOVH 3NTHA 5CV5A 3PO2H 1PTOF 4KY5A 1LT5D 3CD6A 4BBSB 1K8OA 1Y8PB 1D8LA 2K5NA 1BOSA 1E22A 1YBYA 3BU2A 4V0BA 1NJIC 2JEAI 3S1NB 4PMBA 3PIPA 2EPBA 2B2VA 2XN9C 4DR3Q 3SE0A 4DR2Q 2PO4A 4HTHA 2Q8TA 3VA7A 2SNMA 2NVXB 3E0EA 5C0XH 4B9WA 4O0AA 1K28A 2NTSA 1ZKOA 4DAPA 1Z9FA 5IYDH 3GTQH 1BR9A 4DV4L 2F0DA 3MWYW 5IGEA 1IXRA 3A7LA 2CHBD 4OIJA 2JEBI 3I4NG 4G7ZC 1DOKA 2A8VA 1L0WA 2VQEL 1U0LA 1II3A 4FXKC 1A62A 4ZAIA 1X55A 5IGCA 3HG9A 3PF5A 2WINB 1B53A 2KHSA 4HMIA 3OYYA 2F0VA 2KEEA 3L9AX 2RQXA 3EA6A 3AQQA 2K50A 1B9MA 1TY0A 4X62Q 4DFAA 4A3IH 3AFQA 4RAUC 2N55A 4Z9CB 3G6EA 2YTVA 1C48A 2UXDL 3CW2C 3X3MA 4C2MH 1QVCA 5EPKA 1XNRL 4MHEA 1IYVA 1FVIA 2KCCA 3W5OA 2AWOA 1PH1A 5LMNW 2NBFA 1SNOA 4R8NA 1K9MC 2I5HA 1VQ9A 4B3SL 4KHPQ 4RWSC 1SJHD 4A3DH 4LF8L 4AQYL 4DR7Q 4IUNA 1LABA 4A3GH 2R7ZG 4KHZA 3BYYB 1DCZA 3S1RB 1LT6D 1RTOA 1DONA 3KLSX 2NUCA 2HT1A 1I3QH 4S3SA 5C3WA 3H0GH 3PUVA 4BBSH 5C5MA 1AE2A 1HZ9A 1ZEQX 2MFIA 4ID6A 4L5TA 3KOJA 1GHKA 1EWIA 2IY5B 5IYBH 2L15A 2K4KA 4DGZA 2JE6I 4BXXG 3T51B 2E76C 2Y0SE 2MGSA 2VB3X 4LFCQ 4LF7Q 2YYZA 3S1NH 5K36G 3K5OA 5FJ8H 1HRJA 3DXJC 2RBMA 3HOXG 2NZOA 4POFA 1M90C 2EYPA 1X9NA 3M9BA 1VMPA 2H1EA 1LTSD 3UDGA 4KHVA 1TY2A 1JOOA 3GQBA 4GNXA 1A3VA 1SXTA 1GUTA 3KF8B 1Q82C 2NVQH 3PO3H 4NXNQ 5KRUA 1PA6A 4LNQA 2JA6H 5IGDA 1HZBA 3CU7A 2X69A 3OOCA 1JOQA 3OTOQ 2ZTEA 3I91A 4OIKA 3RUZA 2CWPA 1FD7D 2FJ2A 5C3EG 1M1KC 1EQQA 5E4WC 5I6YA 1WYDA 2RSNA 4IURA 5C44G 1IBLQ 3K7AB 4LFBQ 5IP7H 3MXNA 3PF4A 3RZOB 4KJNA 4RKBA 3WOFA 1E2VA 1B2TA 2RCFA 3NSWA 1PFNA 3GTOB 3R2TA 2VXWA 1KAAA 3RD4A 3VR2A 2Z0SA 2JA5G 3NTIA 3HP3A 4GLAC 4R9WA 5EKLA 4DXGA 4CKCA 4XYOA 3WOEA 2B29A 2CQAA 4FYDA 4F7XA 4JYAQ 1NMGA 1PRTB 1TT2A 4YHHQ 3LWUA 1FNWA 1FNUA 2F0QA 2NB0A 2IWHA 3E6ZX 2F3IA 2RA4A 1YNJC 1BUVT 5CBAE 1AZPA 1EZ6A 2V1CC 3VR5A 1R4QB 4JBWA 1J5EL 1IBKQ 5CORA 4A93G 5LMNQ 2BA1A 2MNAA 1S5BD 2BE5C 4EQPA 3J7YW 2AMCB 1K0SA 4TKOB 3OWEB 4AYBE 4ZK9B 2HDLA 1PVOA 4RA8A 3OHXC 5EPLA 4JI8L 2R93B 4LAAA 4K8IA 3A56A 3IKJA 4BBRB 3SK5A 4EQOA 1EYCA 3PQIA 1QNKA 1VQJA 4BY1G 1N34Q 1STYA 2XTIA 3UI2A 4MIUA 1QG7A 3K0YA 1FGBD 1CKOA 2JXMB 4PNYA 3QOLA 3M4QA 3BDCA 4YCWA 1BVSA 1UE6A 1B70B 2C35B 4DV7Q 2F03A 1EIHA 3U4ZA 1GJXA 1OO9B 4C3HG 3T1HL 1D6EC 4KLKA 1B50A 1JC7A 5E4XA 5JJIA 1OXSC 5M5XH 3H94A 2HQEA 2NVTB 2JA8G 3TP5A 4K6DA 3NENA 3K7AH 3HOUG 5CV8A 4O2DA 3RZOH 2PI2E 5C4JB 3A54A 4QUFA 4LK1C 3NE5B 4JBKA 3KJOA 2SNSA 1SE2A 2ZJPA 3CCJA 2QCPX 4JBMA 4K6LA 3CCMA 1F9PA 2KBNA 2PQAB 4GLXA 3Q8DA 2A74C 1SMXA 4DUZQ 3S1MB 2VUMB 2CQOA 2K33A 2OT2A 1NNXA 1F9SA 4A3EG 4H0LC 1VQ8A 4KK7A 3M85A 4OGQC 3TSSA 4JOIC 2NWGA 4DKAC 2HHHL 5FO9B 4B3TL 2X6LA 3D6WA 4NP5A 3MXPA 4DV4Q 1ASZA 3GTPH 4GKKQ 1JJCB 2CH4W 1LLRD 4C3HB 3G48A 4HJ5A 3CC4A 1N9WA 2WP8J 3I56A 1HPCA 2B2TC 4Y7NB 2LY7A 3EFXD 4ZQ3A 2EOTA 5M3FG 5FK9C 1LTTD 2R93H 2HQLA 4IPHA 2NZ1D 2KA7A 2Q2IA 3PIOA 4BBRH 1B1ZA 2QA4A 4DR3L 2L5TA 3Q0AA 4TRDA 5C3XA 4DV0L 3CCQA 1X3PA 5IT9L 2JN4A 4JI1L 5I2XA 1SE4A 3GDEA 1W2BA 2D0PA 1L1OB 1SYDA 1L0YB 4B3RL 1C7YA 3G7LA 5LHY1 1XNRQ 2PW5A 1Z47A 3ND9A 3QJYA 2K05A 3FDTA 1JJGA 1SEBD 3I4MB 4FXGC 4B3SQ 4ODGA 3HKZB 3ER0A 2FMCA 1CA5A 4LF8Q 1VQBA 1XPUA 2K1BA 4A3EB 1HTLD 4HMJA 1VQDA 2K5DA 2NVTH 3EJIA 1I6HB 1JORA 3S15B 1YNJD 1PTOC 4NXMQ 2B63G 3GD7A 4X65Q 3SK8A 1HUNA 2YU9H 1HQMC 1ET6A 1KLGD 4X62L 2WKCA 5BR8L 4PQXA 2OQKA 2CW0D 4BY7G 2EE1A 3KYHC 3OW2A 2H4OA 5NUCA 1Y8NB 1O7IA 5I9OA 3NUCA 2BE5D 3R8BA 3P75A 1SMYC 4KN7C 1TWGH 3MTSA 4MZ9A 2B2VC 4RGMA 2F52A 2EY6A 4DA2A 5FO8B 1GXDC 2VUMH 1RCVD 2JA7G 2LFNA 1H9SB 3X3NA 4A3CG 3TZDA 3T4AC 4C3IH 3SXHA 3HOYH 4ALPA 5DM63 3C3LA 5EJWA 1EQVA 2JQOA
chains in the Genus database with same CATH topology
1I50H 4GS3A 2GN5A 5IYCG 1KIXA 3KDFB 4TQUS 3GTOH 1HNZL 1YJNA 1I94L 5FLXc 4JI4Q 4R4QA 3HOZG 1X3FA 5HGQA 1GD7A 1JB7A 3HOZH 3G4SA 1CUKA 1PH8A 1L2FA 4DV7L 4X64L 3RNUA 4PG3A 1KL9A 1CKNB 5AJ3Q 2CKZB 2OQ0A 1QZGA 1BKBA 4GN5A 2GVAA 1NTGA 2ID0A 2CWAA 2UXCQ 4LF4L 3A74A 4LFCL 5FLMG 1PV4A 4DV5Q 3W1GA 4LF7L 4JI3Q 1VQGA 5FLMH 4B3TQ 4OONA 3GTKH 1GO3E 4L5SA 5JJLA 1MJEA 3CC2A 1SR3A 3HOVG 4PZ6A 3PO2G 3HOVH 4QJFA 3CPFA 3PO2H 3CD6A 1IL2A 1D8LA 4B3MQ 5GQOA 1R9TH 2E2JH 2K5NA 4LF6L 1E22A 1YBYA 4HJAA 3BU2A 4DK6C 3NBHB 3CMEA 3HOWH 4NXNL 3TREA 1NJIC 2KHIA 1YI2A 2JEAI 3GTMH 1VQ4A 4NPSA 2ZTCA 3PIPA 1XMQQ 4DV2Q 1YIJA 4A3KH 1W3SA 4IJHA 4C3JH 5C3EH 4DR3Q 4DR2Q 2R93G 4OO1G 2WB1G 3OTOL 1Q7YC 1A0IA 3IRBA 4ME3A 2ES2A 5C0XG 4BBRG 1EYGA 1PHJA 2XGTA 3E0EA 3CP0A 2A19A 4O0AA 3CC7A 2IT1A 1CKMA 1YJWA 2PI2A 1FJGQ 1Z9FA 4UP9A 2UU9Q 2UUCL 3EN2A 5IYDH 3F1ZA 1QZHA 3GTQH 4IOCA 1N32Q 4A3LG 3J7A5 3T1YQ 1NY4A 3UDXA 3U50C 5IY0A 3L2PA 1VS0A 4DV4L 4DUYL 1IXRA 4DV1Q 4A3LH 1HNWQ 3GTGH 2VW9A 4QIWE 3FP9A 2Q2UA 1VQ6A 3MXNB 2JEBI 3I4NG 1E1TA 2BH8A 2A8VA 1L0WA 2VQEL 1X3GA 5JEAJ 1U0LA 4MTNA 4YHHL 1PFSA 4IFDJ 4L5RC 1A62A 1EQRA 1X55A 2IX1A 3M4OH 3E9HA 3I2ZA 3PF5A 1SRUA 4DR6L 3PUWA 3OYYA 3RLNA 5GAGC 3J80c 4RG1A 2DUDA 2QGQA 1YHBA 3AQQA 3K8AA 2K50A 4X62Q 4GNXC 1JJ2A 2WAQE 4A3IH 4A3JH 1XNQL 2KCTA 3CAMA 3AFQA 4JI5L 2ZM6Q 1VQNA 4IPGA 3M7NA 3G6EA 2GVBA 2YTVA 4IJLA 2UXDL 1IBMQ 2UUAQ 1X6OA 2VY3A 5C4JH 4JI0L 5LMNL 3CW2C 3JAMi 3CCEA 4C2MH 1QVCA 1XNRL 4JV5L 3T1HQ 1FVIA 3W5OA 2AWOA 1PH1A 2K52A 5LMNW 1VQAA 1XJVA 1K9MC 1HR0W 2D0OA 2VS1A 1KRSA 2KHJA 2I5HA 1KRTA 4X66L 4DV3Q 1VQ9A 4B3SL 5JJKA 1VQ5A 4KHPQ 3KDFA 4A3DH 4IPCA 4LF8L 2WAQG 4IO9A 5M5WH 3U4VA 4AQYL 4DR7Q 3S16H 4A3GG 4A3BG 2VUMG 1S3OA 1Q8KA 4P73A 1G51A 3S1MH 2R7ZG 4KHZA 4A3GH 5ELOA 2EQSA 3TS2A 2R7ZH 4QGUA 4DR1Q 4APVA 4LUOA 3RZDH 1VQIA 3UDFA 1Y1WH 1I3QH 1CKNA 1KD1C 3H0GG 1HNZQ 4UY8C 4QY7A 5J3BA 1I94Q 1HNXL 5E7NA 3H0GH 3PUVA 1N34L 1J6QA 2UXBL 3CCLA 4BBSH 4P72A 2E8GA 1HZ9A 1AE2A 1Y1VG 3PUYA 4FDBA 1VQKA 2LXKA 2MFIA 4L5TA 3KOJA 3UE0A 1RL2A 1EWIA 3CF5A 4JI7Q 2IY5B 5IYBH 2L15A 2K4KA 3JAMc 2JE6I 4BXXG 3WWVA 3KJPA 3GTLH 4BXXH 2Y0SE 4LF4Q 4LFCQ 1X65A 4LF7Q 2YYZA 4C3HH 3S1NH 5FJ8G 4A76A 5K36G 4LF9L 5FJ8H 2RHSB 1KQSA 5M5YH 3HOXG 4Y7NH 2NZOA 4OWXB 2K75A 4POFA 1M90C 3F2CA 1C9OA 2N3SA 3HOXH 1X9NA 2E2HH 3ICEA 2CCZA 5IE8A 3M9BA 2HHHQ 1GVPA 2VQFQ 3UDGA 2E2IH 2BH2A 1XTDA 3HKZE 4GNXA 1YITA 4OX9L 4LF6Q 2Y0SG 3CCUA 3PO3G 1AH9A 3KF8B 3I55A 1Q82C 5LMUQ 2NVQH 2WB1E 4JI6L 4GKJL 4GN4B 1X56A 1Q46A 4NXNQ 3PO3H 3ULJA 1PA6A 4P75A 2JA6G 1NE3A 3I7FA 4LNQA 1TWFH 3M4PA 1SROA 3ULLA 5M3MH 2UUBL 2JA6H 3M3YH 1HZBA 3DLLA 1KAWA 3RR5A 3CCSA 5DLQE 4NB3A 1N36L 2Q2TA 4JI4L 3ERSX 2AKWB 2ASBA 3HOWG 3OTOQ 2ALYB 4IPDA 3PUZA 2ZTEA 4UP8A 3F8TA 3I4MG 4DK3C 3STBC 4A3KG 2JA9A 2CWPA 4DR4Q 3HKZG 4UP7A 5C3EG 4A3FH 3I4MH 3PCOB 5AJ3L 1M1KC 4GNXB 1EQQA 2R92G 1WYDA 5C44G 2UXCL 4LUZA 1IBLQ 3S2HH 4DV0Q 2R92H 1XPOA 1GKHA 2N78A 5IP7G 5C44H 2NN6I 4HJ8A 3FKIH 4A3EH 1MKHA 1CSPA 2R7FA 4JI1Q 5IP7H 4DUZL 4LFBQ 1OXTA 3PF4A 1FL0A 5GAHC 3J80i 1WCMG 3A5UA 1I6HH 1V1QA 1WCMH 2Z0SA 5IYDG 3J81i 3NEMA 4B3RQ 5C0XJ 4GLAC 2JA5G 1KHIA 1G291 2VZAA 3S15H 2JA5H 4A4IA 2B29A 1OXVA 4YY3Q 4JYAQ 1NMGA 2VL6A 4LF5Q 2JJQA 2VQEQ 3S24A 1SE8A 4YHHQ 4LUVA 5EAYA 4HJ9A 4EX5A 2LXJA 4MNOA 5GAEC 3GTJH 4GKKL 1Y14B 2IHEA 4KI0A 2F4VQ 1EIFA 5M3FH 2JQOA 4R4OA 4DR6Q 2F3IA 4JI2Q 1WOCA 4DV2L 4PMWA 4LFAL 1ASYA 4A93H 4XIGS 4JG2A 3CCRA 4DR2L 4AIMA 5IWAL 4A3MH 1T9HA 2I5MX 1XNQQ 1LYLA 1E24A 2V1CC 4JI5Q 4K0KL 2JK8A 1J5EL 4JBWA 3EBEA 3H15A 2UXDQ 1IBKQ 4A93G 3HFZB 1PYSB 4PZ8A 5LMNQ 3BJUA 4A3JG 4A3IG 3KLWA 3CPWA 4DR5L 2BA1A 2MNAA 1HR0Q 5BR8Q 3J81c 3CCVA 2UU9L 1N33L 2K5VA 1P8LA 2AMCB 1N32L 5C4XH 1LM0A 1LUZA 4AYBE 4DNIA 3K81C 1G6PA 4X66Q 3RN2A 3A5ZB 1PVOA 4DV1L 1V43A 1HNWL 1E3PA 1VQMA 3MEFA 4OWTB 4P74A 1CSQA 4JI8L 4AQYQ 2OTJA 3B6YA 3CXCA 1XMOL 1JMCA 2D62A 4DAMA 1VQEA 4R4TA 4A3DG 2I5LX 2N8NA 3K80C 3E9IA 4BA1I 1X54A 3PV0A 1P16A 2ZJQA 4OWWB 1HNXQ 1VQJA 1YZ6A 1IZ6A 4BY1G 1N34Q 2XTIA 4L5QA 4AYBG 4BY1H 2E5LQ 3S14H 1CKOA 1Y1WG 1K73C 3TRZA 4YWMA 3S1QH 3M4QA 4LWCA 2R7DA 4YCWA 3L0OA 1S72A 4BBSG 1Q12A 1BVSA 1UE6A 1OTCA 4NXML 1B70B 2C35B 3NELA 3J7ZC 1K8GA 4DV7Q 4X64Q 4R4CA 2R6GA 5IYBG 4X65L 2UUAL 1B7YB 1SLJA 3U4ZA 3SGIA 2MO1A 1OXUA 2MO0A 3AFPA 4H02A 3KF6B 4X6AH 1DGSA 1L1OC 3TEHB 4GOPB 3T1HL 2EXDA 2YTXA 4KLKA 1Q86C 4WJ3M 4POGA 5JJIA 1OXSC 2Z6KC 1PH3A 5M5XH 1PH5A 1PYBA 1S40A 4DV3L 4EQ5A 2JA8G 4KHPL 4RMFA 2JA7H 3K7UC 2VNUD 1A8VA 1QUQB 1TWCH 2AHOB 1Q1BA 2A1AA 3NENA 3K7AH 4OX9Q 2JA8H 4A3CH 1NMFA 4DV6L 3HOUG 4DR7L 4Y52H 3RLOA 4JI6Q 3H3VI 2DGYA 4O2DA 3HOUH 3DM3A 2NVXH 3RZOH 1QVGA 4DR1L 1WI5A 3S2DH 4GN3B 4P71A 4PZ7A 2PI2E 5H1SE 2N49A 2UUBQ 5IYCH 2HT1A 1N36Q 1K83H 3EIVA 2FXQA 1UE1A 1YVCA 4HIOA 4JBKA 2NZHA 3KJOA 1JT8A 1KXLA 4YWLA 4A75A 3PUXA 1C0AA 3LGJA 5M3MG 4QL5A 4UPAA 2ZJPA 3CCJA 2AWNA 1UWVA 1EFWA 4JI7L 4JBMA 4WJ4A 1E7ZA 1RIPA 2ZTDA 3CCMA 4YCUA 4IFDI 1U5KA 2H5XA 2PQAB 2KBNA 1Q81C 4GLXA 1EUJA 3Q8DA 4DUZQ 1SMXA 4A3FG 3TQYA 1LTLA 3CQZH 2CQOA 1PH7A 2HIVA 3U58A 3I4OA 1YHAA 2EIFA 1PH6A 4A3EG 1AE3A 1VQHA 3FKIG 1VQ8A 2PMZE 2UUCQ 3GO5A 3M85A 4DV5L 4JOIC 4JI3L 1UEBA 4DKAC 2HHHL 4GOPC 4B3TL 1WFQA 4HJ7A 5GROA 2VQFL 1K0RA 4BA2I 1PH4A 3FHWA 4J15A 4XTCS 2KCMA 3PSIA 4DV4Q 1PH9A 1VQCA 1ASZA 2OWOA 4DUYQ 5LMUL 3GTPH 4GKKQ 1JJCB 4JC0A 3KFUA 4OXPA 2RHQB 3G48A 4HJ5A 3CC4A 1N9WA 4B3ML 2WP8J 2OCEA 3G71A 3AEVA 1YEZA 4LFAQ 3I56A 1V9PA 1D7QA 3HKSA 1L1OA 1TWAH 2IX0A 4YCVA 1VQ7A 1H95A 2ATWA 3TS0A 5M3FG 2R93H 5IWAQ 2Z6KA 2HQLA 2LSSA 1X3EA 4IPHA 3J81j 2Q2IA 2PNHA 4DR4L 4K0KQ 3PIOA 2NVYH 1XMQL 3D31A 4BBRH 1K8AC 1J5EQ 4QQBX 2QA4A 4DR3L 3H3VH 1HZCA 1KC8C 3STBD 4A3MG 1IBLL 2OTLA 4DV0L 4DR5Q 3CCQA 5GADC 1VQLA 1N33Q 4LFBL 4JI1L 3F2DA 1E1OA 3S1RH 3GDEA 3RN5A 1W2BA 1K3RA 3JC66 1XPRA 4HIMA 1BBUA 4LW1A 2WFWA 2ZJRA 2D0PA 1L1OB 3AYHB 4JI0Q 1FJGL 1NBWA 4B3RL 4HIKA 1C7YA 4GLVB 4R4IA 5JEAG 1XNRQ 4JV5Q 4JI8Q 1Z47A 4YWKA 1BBWA 5C4XG 4IFDG 4HIDA 3BZKA 2K14A 5IP9G 3A0JA 3ZJYC 4YY3L 1XMOQ 4LF5L 3D0FA 4JYAL 1JJGA 1TWHH 3K0XA 5IP9H 3I4NH 3F2BA 4B3SQ 4IOAA 3T1YL 1MJCA 1UE7A 3ER0A 4LF8Q 1VQBA 1XPUA 2F4VL 3RLFA 2BA0A 1VQDA 4JI2L 2NN6G 2NVTH 1SFOH 3UDIA 1I5FA 1B8AA 2Q2HA 1HZAA 3KF6A 4JOIA 1YJ9A 4R1JA 4GOPA 2UXBQ 4NXMQ 3L7ZC 2B63G 1WJJA 1N8RC 3GD7A 1QVFA 1HJPA 3UE1A 2B63H 5ELNA 4JCVE 1IBKL 2IHFA 4X65Q 3VDYA 4JBJA 2YU9H 1HR0L 1EIYB 1QUQA 4X62L 2QEXA 5BR8L 1GM5A 2YTYA 1YNXA 2OQKA 4BY7G 3KYHC 3OW2A 2ZM6L 1PH2A 4BY7H 1O7IA 1YHQA 3CMAA 4LF9Q 1A63A 1SN8A 1IBML 1Q1EA 2MQHA 1TWGH 2CFMA 2RCNA 4MZ9A 1MIUA 2YV5A 2KENA 1VQFA 1VQOA 4TVAB 5HY6A 1JE5A 2F52A 4DV6Q 3ULPA 1UE5A 3S17H 1OXXK 3W1BA 4A3BH 1IYJB 1EOVA 4DAYB 4AH6A 2VUMH 2JA7G 4OO1I 2B3GA 4A3CG 3BZCA 4DPGA 3HOYG 1VCIA 1FGUA 4C3IH 5C0XI 3HOYH 2K5HA 2PQAA 3PGZA 5IT9c 4ALPA 1VQPA 2HIXA 2RF4A 4GKJQ 1HH2P 2I0QA 2E5LL 1TXYA 1Y1VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 H;  4GS3 A;  2GN5 A;  5IYC G;  1KIX A;  3KDF B;  4TQU S;  3GTO H;  1HNZ L;  1YJN A;  1I94 L;  5FLX c;  4JI4 Q;  4R4Q A;  3HOZ G;  1X3F A;  5HGQ A;  1GD7 A;  1JB7 A;  3HOZ H;  3G4S A;  1CUK A;  1PH8 A;  1L2F A;  4DV7 L;  4X64 L;  3RNU A;  4PG3 A;  1KL9 A;  1CKN B;  5AJ3 Q;  2CKZ B;  2OQ0 A;  1QZG A;  1BKB A;  4GN5 A;  2GVA A;  1NTG A;  2ID0 A;  2CWA A;  2UXC Q;  4LF4 L;  3A74 A;  4LFC L;  5FLM G;  1PV4 A;  4DV5 Q;  3W1G A;  4LF7 L;  4JI3 Q;  1VQG A;  5FLM H;  4B3T Q;  4OON A;  3GTK H;  1GO3 E;  4L5S A;  5JJL A;  1MJE A;  3CC2 A;  1SR3 A;  3HOV G;  4PZ6 A;  3PO2 G;  3HOV H;  4QJF A;  3CPF A;  3PO2 H;  3CD6 A;  1IL2 A;  1D8L A;  4B3M Q;  5GQO A;  1R9T H;  2E2J H;  2K5N A;  4LF6 L;  1E22 A;  1YBY A;  4HJA A;  3BU2 A;  4DK6 C;  3NBH B;  3CME A;  3HOW H;  4NXN L;  3TRE A;  1NJI C;  2KHI A;  1YI2 A;  2JEA I;  3GTM H;  1VQ4 A;  4NPS A;  2ZTC A;  3PIP A;  1XMQ Q;  4DV2 Q;  1YIJ A;  4A3K H;  1W3S A;  4IJH A;  4C3J H;  5C3E H;  4DR3 Q;  4DR2 Q;  2R93 G;  4OO1 G;  2WB1 G;  3OTO L;  1Q7Y C;  1A0I A;  3IRB A;  4ME3 A;  2ES2 A;  5C0X G;  4BBR G;  1EYG A;  1PHJ A;  2XGT A;  3E0E A;  3CP0 A;  2A19 A;  4O0A A;  3CC7 A;  2IT1 A;  1CKM A;  1YJW A;  2PI2 A;  1FJG Q;  1Z9F A;  4UP9 A;  2UU9 Q;  2UUC L;  3EN2 A;  5IYD H;  3F1Z A;  1QZH A;  3GTQ H;  4IOC A;  1N32 Q;  4A3L G;  3J7A 5;  3T1Y Q;  1NY4 A;  3UDX A;  3U50 C;  5IY0 A;  3L2P A;  1VS0 A;  4DV4 L;  4DUY L;  1IXR A;  4DV1 Q;  4A3L H;  1HNW Q;  3GTG H;  2VW9 A;  4QIW E;  3FP9 A;  2Q2U A;  1VQ6 A;  3MXN B;  2JEB I;  3I4N G;  1E1T A;  2BH8 A;  2A8V A;  1L0W A;  2VQE L;  1X3G A;  5JEA J;  1U0L A;  4MTN A;  4YHH L;  1PFS A;  4IFD J;  4L5R C;  1A62 A;  1EQR A;  1X55 A;  2IX1 A;  3M4O H;  3E9H A;  3I2Z A;  3PF5 A;  1SRU A;  4DR6 L;  3PUW A;  3OYY A;  3RLN A;  5GAG C;  3J80 c;  4RG1 A;  2DUD A;  2QGQ A;  1YHB A;  3AQQ A;  3K8A A;  2K50 A;  4X62 Q;  4GNX C;  1JJ2 A;  2WAQ E;  4A3I H;  4A3J H;  1XNQ L;  2KCT A;  3CAM A;  3AFQ A;  4JI5 L;  2ZM6 Q;  1VQN A;  4IPG A;  3M7N A;  3G6E A;  2GVB A;  2YTV A;  4IJL A;  2UXD L;  1IBM Q;  2UUA Q;  1X6O A;  2VY3 A;  5C4J H;  4JI0 L;  5LMN L;  3CW2 C;  3JAM i;  3CCE A;  4C2M H;  1QVC A;  1XNR L;  4JV5 L;  3T1H Q;  1FVI A;  3W5O A;  2AWO A;  1PH1 A;  2K52 A;  5LMN W;  1VQA A;  1XJV A;  1K9M C;  1HR0 W;  2D0O A;  2VS1 A;  1KRS A;  2KHJ A;  2I5H A;  1KRT A;  4X66 L;  4DV3 Q;  1VQ9 A;  4B3S L;  5JJK A;  1VQ5 A;  4KHP Q;  3KDF A;  4A3D H;  4IPC A;  4LF8 L;  2WAQ G;  4IO9 A;  5M5W H;  3U4V A;  4AQY L;  4DR7 Q;  3S16 H;  4A3G G;  4A3B G;  2VUM G;  1S3O A;  1Q8K A;  4P73 A;  1G51 A;  3S1M H;  2R7Z G;  4KHZ A;  4A3G H;  5ELO A;  2EQS A;  3TS2 A;  2R7Z H;  4QGU A;  4DR1 Q;  4APV A;  4LUO A;  3RZD H;  1VQI A;  3UDF A;  1Y1W H;  1I3Q H;  1CKN A;  1KD1 C;  3H0G G;  1HNZ Q;  4UY8 C;  4QY7 A;  5J3B A;  1I94 Q;  1HNX L;  5E7N A;  3H0G H;  3PUV A;  1N34 L;  1J6Q A;  2UXB L;  3CCL A;  4BBS H;  4P72 A;  2E8G A;  1HZ9 A;  1AE2 A;  1Y1V G;  3PUY A;  4FDB A;  1VQK A;  2LXK A;  2MFI A;  4L5T A;  3KOJ A;  3UE0 A;  1RL2 A;  1EWI A;  3CF5 A;  4JI7 Q;  2IY5 B;  5IYB H;  2L15 A;  2K4K A;  3JAM c;  2JE6 I;  4BXX G;  3WWV A;  3KJP A;  3GTL H;  4BXX H;  2Y0S E;  4LF4 Q;  4LFC Q;  1X65 A;  4LF7 Q;  2YYZ A;  4C3H H;  3S1N H;  5FJ8 G;  4A76 A;  5K36 G;  4LF9 L;  5FJ8 H;  2RHS B;  1KQS A;  5M5Y H;  3HOX G;  4Y7N H;  2NZO A;  4OWX B;  2K75 A;  4POF A;  1M90 C;  3F2C A;  1C9O A;  2N3S A;  3HOX H;  1X9N A;  2E2H H;  3ICE A;  2CCZ A;  5IE8 A;  3M9B A;  2HHH Q;  1GVP A;  2VQF Q;  3UDG A;  2E2I H;  2BH2 A;  1XTD A;  3HKZ E;  4GNX A;  1YIT A;  4OX9 L;  4LF6 Q;  2Y0S G;  3CCU A;  3PO3 G;  1AH9 A;  3KF8 B;  3I55 A;  1Q82 C;  5LMU Q;  2NVQ H;  2WB1 E;  4JI6 L;  4GKJ L;  4GN4 B;  1X56 A;  1Q46 A;  4NXN Q;  3PO3 H;  3ULJ A;  1PA6 A;  4P75 A;  2JA6 G;  1NE3 A;  3I7F A;  4LNQ A;  1TWF H;  3M4P A;  1SRO A;  3ULL A;  5M3M H;  2UUB L;  2JA6 H;  3M3Y H;  1HZB A;  3DLL A;  1KAW A;  3RR5 A;  3CCS A;  5DLQ E;  4NB3 A;  1N36 L;  2Q2T A;  4JI4 L;  3ERS X;  2AKW B;  2ASB A;  3HOW G;  3OTO Q;  2ALY B;  4IPD A;  3PUZ A;  2ZTE A;  4UP8 A;  3F8T A;  3I4M G;  4DK3 C;  3STB C;  4A3K G;  2JA9 A;  2CWP A;  4DR4 Q;  3HKZ G;  4UP7 A;  5C3E G;  4A3F H;  3I4M H;  3PCO B;  5AJ3 L;  1M1K C;  4GNX B;  1EQQ A;  2R92 G;  1WYD A;  5C44 G;  2UXC L;  4LUZ A;  1IBL Q;  3S2H H;  4DV0 Q;  2R92 H;  1XPO A;  1GKH A;  2N78 A;  5IP7 G;  5C44 H;  2NN6 I;  4HJ8 A;  3FKI H;  4A3E H;  1MKH A;  1CSP A;  2R7F A;  4JI1 Q;  5IP7 H;  4DUZ L;  4LFB Q;  1OXT A;  3PF4 A;  1FL0 A;  5GAH C;  3J80 i;  1WCM G;  3A5U A;  1I6H H;  1V1Q A;  1WCM H;  2Z0S A;  5IYD G;  3J81 i;  3NEM A;  4B3R Q;  5C0X J;  4GLA C;  2JA5 G;  1KHI A;  1G29 1;  2VZA A;  3S15 H;  2JA5 H;  4A4I A;  2B29 A;  1OXV A;  4YY3 Q;  4JYA Q;  1NMG A;  2VL6 A;  4LF5 Q;  2JJQ A;  2VQE Q;  3S24 A;  1SE8 A;  4YHH Q;  4LUV A;  5EAY A;  4HJ9 A;  4EX5 A;  2LXJ A;  4MNO A;  5GAE C;  3GTJ H;  4GKK L;  1Y14 B;  2IHE A;  4KI0 A;  2F4V Q;  1EIF A;  5M3F H;  2JQO A;  4R4O A;  4DR6 Q;  2F3I A;  4JI2 Q;  1WOC A;  4DV2 L;  4PMW A;  4LFA L;  1ASY A;  4A93 H;  4XIG S;  4JG2 A;  3CCR A;  4DR2 L;  4AIM A;  5IWA L;  4A3M H;  1T9H A;  2I5M X;  1XNQ Q;  1LYL A;  1E24 A;  2V1C C;  4JI5 Q;  4K0K L;  2JK8 A;  1J5E L;  4JBW A;  3EBE A;  3H15 A;  2UXD Q;  1IBK Q;  4A93 G;  3HFZ B;  1PYS B;  4PZ8 A;  5LMN Q;  3BJU A;  4A3J G;  4A3I G;  3KLW A;  3CPW A;  4DR5 L;  2BA1 A;  2MNA A;  1HR0 Q;  5BR8 Q;  3J81 c;  3CCV A;  2UU9 L;  1N33 L;  2K5V A;  1P8L A;  2AMC B;  1N32 L;  5C4X H;  1LM0 A;  1LUZ A;  4AYB E;  4DNI A;  3K81 C;  1G6P A;  4X66 Q;  3RN2 A;  3A5Z B;  1PVO A;  4DV1 L;  1V43 A;  1HNW L;  1E3P A;  1VQM A;  3MEF A;  4OWT B;  4P74 A;  1CSQ A;  4JI8 L;  4AQY Q;  2OTJ A;  3B6Y A;  3CXC A;  1XMO L;  1JMC A;  2D62 A;  4DAM A;  1VQE A;  4R4T A;  4A3D G;  2I5L X;  2N8N A;  3K80 C;  3E9I A;  4BA1 I;  1X54 A;  3PV0 A;  1P16 A;  2ZJQ A;  4OWW B;  1HNX Q;  1VQJ A;  1YZ6 A;  1IZ6 A;  4BY1 G;  1N34 Q;  2XTI A;  4L5Q A;  4AYB G;  4BY1 H;  2E5L Q;  3S14 H;  1CKO A;  1Y1W G;  1K73 C;  3TRZ A;  4YWM A;  3S1Q H;  3M4Q A;  4LWC A;  2R7D A;  4YCW A;  3L0O A;  1S72 A;  4BBS G;  1Q12 A;  1BVS A;  1UE6 A;  1OTC A;  4NXM L;  1B70 B;  2C35 B;  3NEL A;  3J7Z C;  1K8G A;  4DV7 Q;  4X64 Q;  4R4C A;  2R6G A;  5IYB G;  4X65 L;  2UUA L;  1B7Y B;  1SLJ A;  3U4Z A;  3SGI A;  2MO1 A;  1OXU A;  2MO0 A;  3AFP A;  4H02 A;  3KF6 B;  4X6A H;  1DGS A;  1L1O C;  3TEH B;  4GOP B;  3T1H L;  2EXD A;  2YTX A;  4KLK A;  1Q86 C;  4WJ3 M;  4POG A;  5JJI A;  1OXS C;  2Z6K C;  1PH3 A;  5M5X H;  1PH5 A;  1PYB A;  1S40 A;  4DV3 L;  4EQ5 A;  2JA8 G;  4KHP L;  4RMF A;  2JA7 H;  3K7U C;  2VNU D;  1A8V A;  1QUQ B;  1TWC H;  2AHO B;  1Q1B A;  2A1A A;  3NEN A;  3K7A H;  4OX9 Q;  2JA8 H;  4A3C H;  1NMF A;  4DV6 L;  3HOU G;  4DR7 L;  4Y52 H;  3RLO A;  4JI6 Q;  3H3V I;  2DGY A;  4O2D A;  3HOU H;  3DM3 A;  2NVX H;  3RZO H;  1QVG A;  4DR1 L;  1WI5 A;  3S2D H;  4GN3 B;  4P71 A;  4PZ7 A;  2PI2 E;  5H1S E;  2N49 A;  2UUB Q;  5IYC H;  2HT1 A;  1N36 Q;  1K83 H;  3EIV A;  2FXQ A;  1UE1 A;  1YVC A;  4HIO A;  4JBK A;  2NZH A;  3KJO A;  1JT8 A;  1KXL A;  4YWL A;  4A75 A;  3PUX A;  1C0A A;  3LGJ A;  5M3M G;  4QL5 A;  4UPA A;  2ZJP A;  3CCJ A;  2AWN A;  1UWV A;  1EFW A;  4JI7 L;  4JBM A;  4WJ4 A;  1E7Z A;  1RIP A;  2ZTD A;  3CCM A;  4YCU A;  4IFD I;  1U5K A;  2H5X A;  2PQA B;  2KBN A;  1Q81 C;  4GLX A;  1EUJ A;  3Q8D A;  4DUZ Q;  1SMX A;  4A3F G;  3TQY A;  1LTL A;  3CQZ H;  2CQO A;  1PH7 A;  2HIV A;  3U58 A;  3I4O A;  1YHA A;  2EIF A;  1PH6 A;  4A3E G;  1AE3 A;  1VQH A;  3FKI G;  1VQ8 A;  2PMZ E;  2UUC Q;  3GO5 A;  3M85 A;  4DV5 L;  4JOI C;  4JI3 L;  1UEB A;  4DKA C;  2HHH L;  4GOP C;  4B3T L;  1WFQ A;  4HJ7 A;  5GRO A;  2VQF L;  1K0R A;  4BA2 I;  1PH4 A;  3FHW A;  4J15 A;  4XTC S;  2KCM A;  3PSI A;  4DV4 Q;  1PH9 A;  1VQC A;  1ASZ A;  2OWO A;  4DUY Q;  5LMU L;  3GTP H;  4GKK Q;  1JJC B;  4JC0 A;  3KFU A;  4OXP A;  2RHQ B;  3G48 A;  4HJ5 A;  3CC4 A;  1N9W A;  4B3M L;  2WP8 J;  2OCE A;  3G71 A;  3AEV A;  1YEZ A;  4LFA Q;  3I56 A;  1V9P A;  1D7Q A;  3HKS A;  1L1O A;  1TWA H;  2IX0 A;  4YCV A;  1VQ7 A;  1H95 A;  2ATW A;  3TS0 A;  5M3F G;  2R93 H;  5IWA Q;  2Z6K A;  2HQL A;  2LSS A;  1X3E A;  4IPH A;  3J81 j;  2Q2I A;  2PNH A;  4DR4 L;  4K0K Q;  3PIO A;  2NVY H;  1XMQ L;  3D31 A;  4BBR H;  1K8A C;  1J5E Q;  4QQB X;  2QA4 A;  4DR3 L;  3H3V H;  1HZC A;  1KC8 C;  3STB D;  4A3M G;  1IBL L;  2OTL A;  4DV0 L;  4DR5 Q;  3CCQ A;  5GAD C;  1VQL A;  1N33 Q;  4LFB L;  4JI1 L;  3F2D A;  1E1O A;  3S1R H;  3GDE A;  3RN5 A;  1W2B A;  1K3R A;  3JC6 6;  1XPR A;  4HIM A;  1BBU A;  4LW1 A;  2WFW A;  2ZJR A;  2D0P A;  1L1O B;  3AYH B;  4JI0 Q;  1FJG L;  1NBW A;  4B3R L;  4HIK A;  1C7Y A;  4GLV B;  4R4I A;  5JEA G;  1XNR Q;  4JV5 Q;  4JI8 Q;  1Z47 A;  4YWK A;  1BBW A;  5C4X G;  4IFD G;  4HID A;  3BZK A;  2K14 A;  5IP9 G;  3A0J A;  3ZJY C;  4YY3 L;  1XMO Q;  4LF5 L;  3D0F A;  4JYA L;  1JJG A;  1TWH H;  3K0X A;  5IP9 H;  3I4N H;  3F2B A;  4B3S Q;  4IOA A;  3T1Y L;  1MJC A;  1UE7 A;  3ER0 A;  4LF8 Q;  1VQB A;  1XPU A;  2F4V L;  3RLF A;  2BA0 A;  1VQD A;  4JI2 L;  2NN6 G;  2NVT H;  1SFO H;  3UDI A;  1I5F A;  1B8A A;  2Q2H A;  1HZA A;  3KF6 A;  4JOI A;  1YJ9 A;  4R1J A;  4GOP A;  2UXB Q;  4NXM Q;  3L7Z C;  2B63 G;  1WJJ A;  1N8R C;  3GD7 A;  1QVF A;  1HJP A;  3UE1 A;  2B63 H;  5ELN A;  4JCV E;  1IBK L;  2IHF A;  4X65 Q;  3VDY A;  4JBJ A;  2YU9 H;  1HR0 L;  1EIY B;  1QUQ A;  4X62 L;  2QEX A;  5BR8 L;  1GM5 A;  2YTY A;  1YNX A;  2OQK A;  4BY7 G;  3KYH C;  3OW2 A;  2ZM6 L;  1PH2 A;  4BY7 H;  1O7I A;  1YHQ A;  3CMA A;  4LF9 Q;  1A63 A;  1SN8 A;  1IBM L;  1Q1E A;  2MQH A;  1TWG H;  2CFM A;  2RCN A;  4MZ9 A;  1MIU A;  2YV5 A;  2KEN A;  1VQF A;  1VQO A;  4TVA B;  5HY6 A;  1JE5 A;  2F52 A;  4DV6 Q;  3ULP A;  1UE5 A;  3S17 H;  1OXX K;  3W1B A;  4A3B H;  1IYJ B;  1EOV A;  4DAY B;  4AH6 A;  2VUM H;  2JA7 G;  4OO1 I;  2B3G A;  4A3C G;  3BZC A;  4DPG A;  3HOY G;  1VCI A;  1FGU A;  4C3I H;  5C0X I;  3HOY H;  2K5H A;  2PQA A;  3PGZ A;  5IT9 c;  4ALP A;  1VQP A;  2HIX A;  2RF4 A;  4GKJ Q;  1HH2 P;  2I0Q A;  2E5L L;  1TXY A;  1Y1V H; 
#chains in the Genus database with same CATH topology
 1I50 H;  2GN5 A;  4KMU C;  1KIX A;  5HGQ A;  1J9O A;  3P20 A;  1GD7 A;  1JB7 A;  4CJ2 C;  2LS0 1;  3G4S A;  3I90 A;  4V19 0;  4X64 L;  2HDM A;  3SR1 A;  4X3T A;  2BOS A;  1EL0 A;  4L63 B;  3BYT B;  4GN5 A;  3D8G A;  4G57 A;  3K59 A;  3A74 A;  4LFC L;  5FLM G;  4LF7 L;  3P7J A;  4JI3 Q;  2F0J A;  3S14 B;  3QO2 A;  1MJE A;  1SR3 A;  1Y1W B;  3HOV G;  1I4P A;  1EY4 A;  3PO2 G;  1F2L A;  2V4D A;  4QJF A;  2K5W A;  3A7A B;  5C5L A;  4RGO S;  1IL2 A;  2K6A A;  5GQO A;  2NTT A;  5CV7 A;  4EVO A;  1A2U A;  1A3T A;  1JE4 A;  5IGB A;  1F77 A;  5A35 A;  4HJA A;  4NXN L;  3GTM H;  1VQ4 A;  1XMQ Q;  4C3J H;  1G91 A;  1PRT F;  5KYI A;  2EYF A;  4RFB A;  3OTO L;  1ENA A;  4OO1 H;  3OMC A;  5KNC A;  1XYI A;  2ES2 A;  5C0X G;  1EYG A;  3CP0 A;  3FEW X;  4XT3 B;  4UP9 A;  1TII D;  4RHS A;  1STG A;  2JYO A;  1WTO A;  2WV6 D;  1SND A;  2XWJ B;  5IIF A;  3JAM L;  1NY4 A;  4A3L H;  1VS0 A;  1JOK A;  2VW9 A;  2SDF A;  1KTK A;  2D2C C;  4WJW A;  2EZV A;  3MXN B;  1BCP B;  1A15 A;  1E1T A;  1IYU A;  1GUG A;  1X3G A;  3MVV A;  4YHH L;  2I07 B;  4DAV A;  4IFD J;  3G6J B;  3I2Z A;  3FKI B;  1MBY A;  5GAG C;  3Q22 A;  1MHW C;  4RG1 A;  3NWT A;  4GNX C;  1JJ2 A;  2FHT A;  3PMF A;  1LAC A;  2ZM6 Q;  4DAY A;  1IBM Q;  4KKT A;  1O7L A;  2F0M A;  1EOT A;  5LMN L;  5CR3 A;  1TWA B;  2CVR A;  5FLX E;  5HUR A;  3T1H Q;  2DJG C;  3R3O A;  1BXT A;  2D0O A;  1KRS A;  1KRT A;  2Z4I A;  2B2T A;  3KDF A;  3D3R A;  4IQZ A;  4IPC A;  2WAQ G;  1GHJ A;  1HHV A;  4A3G G;  5M9O A;  4A3M B;  1S3O A;  1G51 A;  2EQS A;  1EYA A;  4QGU A;  1BCP C;  4APV A;  3RZD H;  3UDF A;  5LL6 X;  2EJG C;  1Y1W H;  3H0G G;  1HNZ Q;  1EU4 A;  4QY7 A;  2CH4 A;  5J3B A;  5E7N A;  3LNN A;  1A6X A;  1N34 L;  2FIN B;  2EDG A;  2FMM A;  1Y1V G;  1VQK A;  2LXK A;  5C4X B;  5KGU A;  3UE0 A;  3TBI B;  1TWH B;  3D6C A;  3MFG A;  3CF5 A;  3KJP A;  3GTL H;  3D4W A;  2RKS A;  3NTK A;  5FJ8 G;  4A76 A;  4LF9 L;  1DYQ A;  2RHS B;  1KQS A;  1M8A A;  4CGY B;  2G5D A;  2K75 A;  3Q24 A;  1SMY D;  1C9O A;  3HGB A;  2E2H H;  3ICE A;  4QIW B;  4H44 C;  2HHH Q;  3IFT A;  4O1N A;  2BH2 A;  1XTD A;  4K5V A;  3HKZ E;  1FR3 A;  1YIT A;  4LF6 Q;  3CCU A;  2F0K A;  3J81 L;  3PO3 G;  1TR5 A;  2WB1 E;  2HCI A;  4GN4 B;  1XX8 A;  3I72 A;  1ENF A;  4G7H C;  1I4H A;  2G9H D;  2JA6 G;  1NE3 A;  1TWF H;  5DM7 3;  1SRO A;  3ULL A;  3M3Y H;  3DLL A;  1PZJ D;  2KOL A;  5G3L F;  3CCS A;  1SNM A;  5DLQ E;  4JI4 L;  1SYF A;  3HOW G;  2ASB A;  4IPD A;  3VYT A;  1YNN C;  2L11 A;  4A3K G;  4J6H A;  3A8K E;  2ENB A;  4XXE A;  3J7A F;  1WD0 A;  3VR6 A;  4PMC A;  2UXC L;  4LUZ A;  3ND8 A;  2XSC A;  4ZUI A;  3VYR A;  3BDO A;  5IP7 G;  4DV0 Q;  2R92 H;  2NN6 I;  3FKI H;  5I9P A;  4JI1 Q;  4DUZ L;  1OXT A;  1SNC A;  1FL0 A;  1Y1V B;  2F0W A;  3A5U A;  1V1Q A;  3FRP B;  2NYZ D;  1WCM H;  1KAB A;  4B3R Q;  1EY9 A;  3NEM A;  1KHI A;  3HOZ B;  4XT1 B;  3D4R A;  1ESF A;  3S24 A;  4K2L A;  4HJ9 A;  4GKK L;  5IGF A;  1LTB D;  5DEH A;  3GTK B;  4DV2 L;  1QOH A;  3N6R A;  4XIG S;  3CCR A;  2EJF C;  4A3M H;  1LYL A;  1E24 A;  4JI5 Q;  3V96 A;  2F0S A;  2RDH A;  3H15 A;  1R9T B;  2FFK B;  4A3J G;  3KLW A;  2EYO A;  5BR8 Q;  4GZY C;  4FF1 A;  2K5V A;  1EFI D;  5JEA H;  1N32 L;  5C4X H;  1LTR D;  3ERO A;  1QNU A;  5CV9 A;  1G6P A;  1FNV A;  3SK4 A;  2AQ3 B;  4RCN A;  3H91 A;  5HGT A;  5EQ0 A;  1V43 A;  1HNW L;  1VQM A;  1G2T A;  4OWT B;  3E3X A;  1CSQ A;  4KTA A;  4P74 A;  3MXU A;  5I6W A;  4DAM A;  4R4T A;  1HQR D;  1X54 A;  3ITP A;  5JVH 3;  1XTC D;  2QF7 A;  2ZJQ A;  1YZ6 A;  4IUU A;  1IL8 A;  4C1N I;  5CBE E;  1MGS A;  4CKB A;  3PIP 3;  1K73 C;  1SBB B;  3TRZ A;  1NUC A;  1BO0 A;  3S1Q H;  2MHV A;  1OTC A;  4NXM L;  3J7Z C;  1XWE A;  1K8G A;  4FF3 A;  4X64 Q;  4XQQ A;  1Q8I A;  4X65 L;  4NMZ A;  3I4N B;  3SGI A;  1K3B C;  2MO0 A;  3AFP A;  1GUO A;  4H02 A;  4KY6 A;  1DGS A;  5FKA C;  2YTX A;  3M4O B;  1EYD A;  2SOB A;  1PYB A;  1S40 A;  4DV3 L;  4EQ5 A;  1S5E D;  2VNU D;  4RMF A;  3K7U C;  2EY2 A;  1X3Q A;  5FO7 B;  3E0J A;  1AFP A;  1NMF A;  4DNT B;  2DGY A;  2XRQ D;  1SSO A;  4PV1 C;  2NVX H;  4ULL A;  4DR1 L;  1WI5 A;  4PZ7 A;  1JIC A;  1N36 Q;  4CDE C;  1C8C A;  1UUP A;  1BCP D;  4YWL A;  4A75 A;  3PUX A;  3LGJ A;  2F0I A;  4QL5 A;  5CC4 A;  4UPA A;  5M3M G;  2F3V A;  4JI7 L;  2A69 C;  3KBG A;  4YCU A;  2EYM A;  2QDL A;  3E5S A;  4A3F G;  3NQI A;  1PH7 A;  2B8G A;  4K14 A;  2R7Z B;  4FF4 A;  3GO5 A;  4JI3 L;  2L55 A;  3I4L A;  1WFQ A;  1HUM A;  4HJ7 A;  2VQF L;  1PH4 A;  3FHW A;  2KCM A;  2MJ8 A;  4RKL A;  1PH9 A;  3T53 B;  5CMD A;  3MZ5 A;  2M9V A;  2OCE A;  1MSG A;  4CJ0 B;  1V9P A;  1PLF A;  4JPB W;  4YCV A;  5M5Y B;  1VQ7 A;  1H95 A;  2DNC A;  1B9N A;  2ATW A;  3HOX B;  5IWA Q;  2BCO A;  1JR0 D;  4N9T A;  4K0K Q;  2XIW A;  1XMQ L;  3DUZ A;  3W2D A;  3H3V H;  1YNN D;  1KLU D;  1HZC A;  1CFM A;  1TVX A;  1V8Q A;  4DR5 Q;  5GAD C;  1N33 Q;  2PPB C;  1SDF A;  3S1R H;  1XPR A;  4HIM A;  1BBU A;  2E2J B;  5M3M B;  2QDB A;  1E2Z A;  3DMU A;  1AZQ A;  5FLX L;  4GLV B;  5CV4 A;  1HFG A;  1KDB A;  1BBW A;  4YWK A;  4DF7 A;  4HID A;  2F0G A;  2O5J C;  3BZK A;  4LF5 L;  4IFD H;  1D5X C;  3I4N H;  3K6O A;  5C3E B;  1D2B A;  1ONL A;  2F0O A;  3S2H B;  4RH6 A;  1D1K A;  1U4L A;  5C44 B;  2XNA C;  2F4V L;  4IN3 A;  4RGN A;  5J39 A;  3R93 A;  1LTI D;  2NN6 G;  3UDI A;  4OEM B;  1I5F A;  1SYG A;  1HZA A;  1QB5 D;  1U9R A;  3QIA A;  1YJ9 A;  4GOP A;  4M8A A;  2JA5 B;  1QVF A;  3UE1 A;  1UNS A;  2ZT9 C;  1EWC A;  2EYL A;  4IUQ A;  4L6T B;  1HR0 L;  1KDC A;  1LTA D;  3C2P A;  1U4R A;  1JWU D;  1YNX A;  4N9P A;  2ZM6 L;  3BG3 A;  1YHQ A;  5C6A A;  4LF9 Q;  2QIL A;  1A63 A;  4IZ8 A;  2OF1 A;  1IBM L;  2IL8 A;  1Q1E A;  1W6J A;  3L3O C;  4ZRZ A;  1VQO A;  2B2U A;  4DV6 Q;  4IUT A;  3ULP A;  1KNA A;  1ILQ A;  1AN8 A;  1EOV A;  1W6K A;  4DAY B;  4AH6 A;  5KYL A;  1ML0 D;  1S5F D;  4ABN A;  4C3I G;  5D3D A;  4DPG A;  3HOY G;  1VCI A;  4A93 B;  5C0X I;  3A55 A;  2E5L L;  2I0Q A;  2O5I C;  3IL8 A;  1LTG D;  5IYC G;  4NKL A;  3KDF B;  3GTO H;  1HNZ L;  3OIP A;  4HN7 A;  4JI4 Q;  4R4Q A;  1X3F A;  1PH8 A;  2IX3 A;  5D14 A;  1KL9 A;  4F8M A;  2CKZ B;  5KND A;  2UXC Q;  4FO2 A;  5M5W B;  1WTH A;  1IKM A;  1PV4 A;  4DV5 Q;  1VQG A;  2JSO A;  4BY1 B;  3K5L A;  1SYC A;  1ZYR C;  3K57 A;  4ZLT F;  3A8J E;  1WTP A;  1D5Z C;  3CPF A;  4WRD A;  5ELC A;  4B3M Q;  2E2J H;  1BQQ T;  5BN4 A;  4LF6 L;  2F0L A;  4G4K A;  4DK6 C;  4LJZ C;  1WTQ A;  1SYB A;  2KHI A;  3KLS A;  4NPS A;  2ZTC A;  2KED A;  2EY5 A;  4C3J G;  3R2I A;  2WII B;  4DV2 Q;  1YIJ A;  4L8J A;  5C3E H;  2JA8 B;  1TWC B;  4OO1 G;  1PTO B;  2WB1 G;  5I4D A;  3IRB A;  5J22 A;  3HOU B;  2DN8 A;  3QOJ A;  1PHJ A;  1O7Z A;  1EWH A;  2A19 A;  3S2D B;  2IW3 A;  2E2I B;  4F88 A;  1S5C D;  5ELF A;  2PI2 A;  4CDF C;  1FJG Q;  2UUC L;  3EN2 A;  3F1Z A;  1JWS D;  5T1I A;  2ICI A;  1N32 Q;  4CHT B;  4A3L G;  4XYQ A;  1Q3L A;  3UDX A;  3U50 C;  5IY0 A;  2F1M A;  1ET9 A;  1HNW Q;  1CQV A;  3FP9 A;  2Q2U A;  2K04 A;  1EY6 A;  3CQZ B;  3AU7 A;  3GV6 A;  5JEA J;  3T13 A;  3VR3 A;  1NR2 A;  1PFS A;  4L5R C;  5F2D A;  1EQR A;  2IX1 A;  3E9H A;  3Q6S A;  1F2Y A;  1WTX A;  2TMP A;  1RF2 D;  3PUW A;  1I4Q A;  1IHZ A;  2L0C A;  4BWG B;  3J80 c;  3OMG A;  2QGQ A;  3K8A A;  1TS4 A;  2KCT A;  3CAM A;  4JI5 L;  4IPG A;  3M7N A;  1PYW D;  1HCZ A;  4IJL A;  5C4J H;  2F0E A;  4JI0 L;  3CCE A;  3AB9 A;  3Q23 A;  5EKI A;  3TZU A;  2PMZ B;  2PZW A;  1XJV A;  4EQN A;  5M3F B;  1HR0 W;  4DV3 Q;  1Y69 U;  1F2M A;  4CDC C;  5CYU A;  5M5W H;  3U4V A;  3SDZ A;  1BDO A;  1ROD A;  4A3B G;  1Q8K A;  3S1M H;  5ELO A;  2PYK A;  3BS1 A;  4DR1 Q;  3RMH A;  3IAY A;  4LUO A;  1KD1 C;  1VQI A;  4UY8 C;  1CKN A;  1ESR A;  1I94 Q;  4LMQ D;  3D4D A;  4QF4 A;  5JPM C;  2UXB L;  3CCL A;  4P72 A;  3PUY A;  3PIO 3;  4FDB A;  1TQO A;  1AP0 A;  2L12 A;  4JI7 Q;  2A6E C;  3WWV A;  1CQF A;  1S4Z A;  1X65 A;  4C3H H;  2B39 A;  3TN2 A;  5EGT A;  1EIG A;  1CZG A;  4Y7N H;  4OWX B;  2D9U A;  3QG1 A;  1QWY A;  3F2C A;  3NBH A;  5IE8 A;  5C4Z A;  1GVP A;  2VQF Q;  2B63 B;  2E2I H;  3CKI B;  2Y0S G;  1SYE A;  2Z6B A;  2K7V A;  1UAP A;  4GKJ L;  1Q46 A;  2EVB A;  3ULJ A;  4BY7 B;  1O80 A;  2WKD A;  4P75 A;  2LMC B;  3M4P A;  1N36 L;  1KAW A;  3RR5 A;  3LX0 A;  1R4P B;  2ALY B;  3U9O A;  3PUZ A;  5D3I B;  3HZX A;  3F8T A;  3S17 B;  1RD9 D;  4A3B B;  4U68 A;  3I4M H;  4KD3 A;  3TP7 A;  3PCO B;  5AJ3 L;  4GNX B;  2JA7 B;  4HAE A;  2R92 G;  3I3C A;  5E3F A;  3DM1 A;  1XPO A;  2N78 A;  4A3E H;  1YI2 A;  1MKH A;  2R7F A;  3DWP A;  2F0F A;  5DAU A;  1V1P A;  2N88 A;  1I6H H;  1WCM G;  4J8Q A;  2K5Q A;  1STE A;  5IYD G;  4KV6 A;  4HR7 B;  1G29 1;  2VZA A;  3S15 H;  1DD2 A;  3MHB A;  1OXV A;  4LF5 Q;  2J0T D;  3VR4 A;  4E6I A;  4EX5 A;  2LXJ A;  4MNO A;  5GAE C;  1B44 D;  1Y14 B;  1H9J A;  2F4V Q;  5M3F H;  5L37 A;  4R4O A;  4DR6 Q;  1WOC A;  4PMW A;  1ASY A;  3DHQ A;  1LO5 D;  2KCN A;  2ZXR A;  3HOV B;  5IWA L;  1T9H A;  1XNQ Q;  3PO2 B;  1VDZ A;  1NCV A;  4K0K L;  3HFZ B;  4PZ8 A;  3BJU A;  1HA5 A;  4A3I G;  2GA4 B;  1HR0 Q;  4DR5 L;  2UU9 L;  2Q8I B;  3CCV A;  1U4P A;  1N33 L;  1XXG A;  4N8X 1;  4DNI A;  4X66 Q;  3RN2 A;  1ICW A;  3A5Z B;  4DV1 L;  1HTP A;  1I4X A;  3MEF A;  4N8F A;  3B6Y A;  3CXC A;  1JMC A;  2D62 A;  1VQE A;  4A3D G;  2I5L X;  3K80 C;  3E9I A;  4BA1 I;  3PV0 A;  1P16 A;  4OWW B;  1HNX Q;  3C46 A;  4I7Z C;  1A3U A;  1PDQ A;  4KN4 C;  4AYB G;  2KQ3 A;  2E5L Q;  3GTQ B;  3S14 H;  4M1U B;  3WDN A;  4YWM A;  3MA2 B;  2R7D A;  3L0O A;  1S72 A;  4BBS G;  1Q12 A;  5CV6 A;  4H7B A;  5ELB A;  2R6G A;  5IYB G;  2UUA L;  3MXG A;  1PTO D;  1BBX C;  2MO1 A;  3DEP A;  4X6A H;  1X32 A;  4GOP B;  2PW7 A;  2EXD A;  4WJ3 M;  1EQT A;  1PH3 A;  1SFO B;  3DWQ A;  2JA7 H;  1C4Q A;  4OX9 Q;  4A3C H;  4Y52 H;  4DV6 L;  4A3I B;  4JI6 Q;  3F2U A;  1I6V C;  2PZT A;  1EZ8 A;  1QVG A;  4GN3 B;  2UUB Q;  4YIJ A;  2N49 A;  3N52 A;  3C1E A;  2FXQ A;  4C2M B;  1UE1 A;  1YVC A;  2K03 A;  1JB3 A;  2KJX A;  4DK1 A;  1C0A A;  3TP8 A;  2RDF A;  2A68 C;  1BNZ A;  1UWV A;  3NWS A;  2DJF C;  2ZTD A;  3H09 A;  1U5K A;  2H5X A;  1Q81 C;  5JAV A;  2WAQ B;  4A3G B;  1ICF B;  2DNE A;  3TQY A;  1GUW A;  4HED A;  1WVL A;  1CHQ D;  1F9Q A;  1Z6H A;  3I4O A;  1YHA A;  2EIF A;  1I3Q B;  1DOL A;  1AE3 A;  1VQH A;  5DNF A;  2PMZ E;  3H0G B;  2UUC Q;  1JQY D;  4DV5 L;  2KEC A;  3MEH A;  4GOP C;  5GRO A;  1NSN S;  1FYC A;  4J15 A;  2HCC A;  3OSO A;  3M7G A;  5LMU L;  4JC0 A;  5KEE A;  3W3A A;  4OXP A;  3KFU A;  2RHQ B;  2MUY A;  2EYJ A;  4B3M L;  3G71 A;  3AEV A;  4LFA Q;  1STA A;  1L1O A;  1TWA H;  1CI3 M;  2IX0 A;  3CHB D;  4HSP A;  3OW7 A;  2Z6K A;  2M00 A;  2LSS A;  2B2U C;  1VF5 C;  3J81 j;  2PNH A;  4X3U A;  4DR4 L;  4QMG A;  3D31 A;  2B2Y C;  3T56 B;  1KC8 C;  5T1G A;  1VQL A;  2NVQ B;  3PO3 B;  3F2D A;  1E1O A;  1GUN A;  3RN5 A;  4FVM A;  4LW1 A;  1L0X B;  1LT3 D;  3AYH B;  2JA6 B;  1DM0 B;  4JI0 Q;  2IJ0 A;  1FJG L;  4XDX A;  5KNB A;  4R4I A;  2A5H A;  3BZD B;  3HOW B;  1STN A;  1Y8O B;  5EBD A;  4G7O C;  4IFD G;  2KVM A;  2K14 A;  2PZU A;  4DNR B;  5AFW A;  4YY3 L;  1XMO Q;  3D0F A;  1TWH H;  3K0X A;  5IP9 H;  1D5M C;  4A3K B;  2F0T A;  4C56 C;  1EY8 A;  2QW7 A;  3QB3 A;  3RLF A;  2BA0 A;  4JI2 L;  4IAL A;  1DJR D;  1SFO H;  2QEJ C;  1B8A A;  5EBC A;  2F0N A;  3NQT A;  1G8Z D;  3KF6 A;  4R1J A;  2I46 A;  3NXW A;  5IT9 E;  2UXB Q;  1WJJ A;  1HJP A;  5IGG A;  2ICE C;  5ELN A;  5IOD A;  4I65 A;  1H9S A;  3FVQ A;  3NBI A;  1B4O A;  4JBJ A;  2Z9H A;  1EIY B;  1QUQ A;  2QEX A;  1GM5 A;  2YTY A;  5CGK A;  2O2L D;  1HA6 A;  4FNF A;  3GTG B;  3T16 A;  1TU2 B;  3CMA A;  1SN8 A;  4QB4 A;  3TDQ A;  4KY7 A;  2MQH A;  1I4G A;  1I4R A;  1VQF A;  1EY0 A;  2A6H C;  1OXX K;  1IYJ B;  1H9K A;  4OO1 I;  1MD2 D;  4P2C B;  1FGU A;  1HXY D;  2K5H A;  1WTV A;  5IT9 c;  4A3J B;  4GKJ Q;  2RF4 A;  1PMR A;  1TXY A;  3VYS A;  1Y1V H;  1IKL A;  3MAQ A;  1STB A;  3ZYY X;  1YJN A;  1I94 L;  1KNE A;  1SNQ A;  3HOZ H;  1TKW B;  1CUK A;  3H6M A;  4CKE A;  1L2F A;  2E74 C;  5KIX A;  1CKN B;  5AJ3 Q;  1EEI D;  2OQ0 A;  4I7A A;  1QZG A;  2AUK A;  2GVA A;  2ID0 A;  2MPM A;  2CWA A;  5BN3 A;  1BF4 A;  2C5C A;  1H9M A;  3S16 B;  4IUV A;  4OON A;  3GTK H;  3SVM A;  1GO3 E;  1Q90 A;  4XQJ A;  3C1F A;  3GV3 A;  3IFD A;  4PZ6 A;  1DXM A;  3H3V C;  3NP8 A;  2MP1 A;  3KK7 A;  1RTN A;  4DN4 M;  1R9T H;  4K5X A;  4KKU A;  5JVG 3;  2F0P A;  1B3Q A;  3NBH B;  3CME A;  5EPJ A;  3HOW H;  1DZ1 A;  3TRE A;  2E2D C;  5M5X B;  4A3K H;  1W3S A;  4IJH A;  1CA6 A;  2R93 G;  2A68 D;  1Q7Y C;  1A0I A;  4ME3 A;  4BBR G;  2XGT A;  4HSV A;  3CC7 A;  1BCP F;  2IT1 A;  1CKM A;  1YJW A;  4UDU C;  3ERQ A;  2UU9 Q;  2AQ2 B;  1QZH A;  4OL7 A;  4IOC A;  1E2W A;  1S5D D;  1K8M A;  3A8I E;  2E75 C;  5COY A;  3J7A 5;  3T1Y Q;  3CRL C;  3L2P A;  4DUY L;  4DV1 Q;  1VMC A;  3GTG H;  2SEB D;  4QIW E;  1VQ6 A;  2B8F A;  1UEA B;  1V1P B;  1QE6 A;  1LV9 A;  2BH8 A;  4OEL B;  4A3F B;  1RJT A;  1IW7 C;  1KDA A;  4MTN A;  3CRK C;  2XWB B;  3M4O H;  4H13 C;  1SRU A;  3QWN A;  3FPP A;  4DR6 L;  3RLN A;  1MI2 A;  1PZK D;  2CW0 C;  1JWM D;  4QCL A;  2DUD A;  1YHB A;  3NHH A;  3URY A;  2WAQ E;  4A3J H;  3GTP B;  1XNQ L;  1VQN A;  4MTK A;  2GVB A;  2UUA Q;  1X6O A;  2VY3 A;  4CDD C;  1SAP A;  4O42 A;  3JAM i;  3JAM E;  3V2T A;  3BDL A;  4JVZ A;  4FXD A;  4JV5 L;  3GTJ B;  1RKN A;  1QJO A;  2HUG A;  2K52 A;  1VQA A;  2O4X A;  5FOB B;  4K2K A;  2VS1 A;  2KHJ A;  4R8I A;  4X66 L;  2PNR C;  5JJK A;  1CM9 A;  5ELE A;  2QKI C;  1VQ5 A;  1PRT C;  4IO9 A;  3S16 H;  2VUM G;  4P73 A;  5JPN C;  4NW2 A;  2B2Y A;  3TS2 A;  2R7Z H;  2BDN A;  2RVL A;  4MN3 A;  1HNX L;  2L4N A;  4OHJ A;  1J6Q A;  2E8G A;  4B9X A;  2PCF B;  1EY7 A;  2K32 A;  3KLR A;  1WD1 A;  1CZW A;  1RL2 A;  2AUJ D;  3JAM c;  3I70 A;  4BXX H;  4LF4 Q;  2WAC A;  1G6Z A;  1ZXT A;  5K36 H;  3V05 A;  5M5Y H;  5D65 A;  4DXF A;  3HOX H;  2N3S A;  2CCZ A;  3DEO A;  3DWA A;  4DK0 A;  2A6H D;  4ME5 A;  5A2Q E;  5I2Y A;  1T5X D;  4OX9 L;  4UAI A;  2YU9 B;  5ISR A;  1AH9 A;  3I55 A;  5LMU Q;  4JI6 L;  4ZYS A;  1X56 A;  3HRZ C;  4FP5 D;  3I7F A;  1NR4 A;  5M3M H;  2UUB L;  2XVS A;  1TWG B;  2Q2T A;  4NB3 A;  1EY5 A;  3ERS X;  2AKW B;  4UP8 A;  1O78 A;  3I4M G;  4DK3 C;  3STB C;  4DR4 Q;  2JA9 A;  3HKZ G;  4K8J A;  4UP7 A;  4A3F H;  2HD3 A;  2EJM A;  1PFB A;  2VB2 X;  3HS0 C;  3S2H H;  4C3I B;  1GKH A;  5C44 H;  3HOY B;  4HJ8 A;  1RHP A;  2A69 D;  1CSP A;  1ENC A;  1I50 B;  5GAH C;  3J80 i;  3GP7 A;  4C1N K;  3J80 E;  1K83 B;  2L9H A;  3J81 i;  5C0X J;  3J81 E;  4RHR A;  2JA5 H;  4A4I A;  4YY3 Q;  2VL6 A;  1D1I A;  2JJQ A;  4KKS A;  2VQE Q;  4FF2 A;  2JP1 A;  1SE8 A;  4LUV A;  5EAY A;  1CK1 A;  1V1O A;  2F0H A;  4ZKB B;  3GTJ H;  2IHE A;  4KI0 A;  1EIF A;  3OPO A;  2B2W C;  2EYH A;  3OIQ A;  4JI2 Q;  4CJ1 B;  4LFA L;  1AW7 A;  4X3S A;  4JG2 A;  4WOR A;  4DR2 L;  4AIM A;  1CHP D;  2KUM A;  1VF7 A;  3NK9 A;  3BVM A;  5ELD A;  2I5M X;  2JK8 A;  3EBE A;  2UXD Q;  1PZI D;  1PYS B;  1J8I A;  4A93 H;  3CPW A;  3I73 A;  4JW0 A;  3J81 c;  2DY8 A;  3TP6 A;  3GTM B;  1P8L A;  3VYU A;  1LM0 A;  2IPK D;  1LUZ A;  3K81 C;  3M4Y A;  2L1B A;  3S9W A;  5EKK A;  4C3J B;  1WTR A;  1E3P A;  4AQY Q;  2OTJ A;  2WB1 B;  1JCK B;  5BN5 A;  1XMO L;  3OWF A;  2NVY B;  2N8N A;  2NN6 H;  4F87 A;  2LKV A;  5LL6 S;  1QIL A;  3MC0 B;  1IZ6 A;  3BVG A;  3SHL A;  1IW7 D;  4DU9 A;  4L5Q A;  2R61 A;  4BY1 H;  2F0U A;  4B08 A;  1Y1W G;  1EU3 A;  1GUS A;  2DY7 A;  4LWC A;  3VA5 A;  5J1Z A;  1T5E A;  1M4V A;  3NEL A;  4R4C A;  1B7Y B;  1SLJ A;  1OXU A;  3KF6 B;  1L1O C;  3TEH B;  3KF8 A;  4Q5V A;  1QCB D;  1Q86 C;  3FPU B;  4POG A;  2Z6K C;  1PH5 A;  1PFM A;  5TSS A;  4KHP L;  1A8V A;  1QUQ B;  1TWC H;  2AHO B;  1Q1B A;  1PTO H;  2A1A A;  2JA8 H;  1ILP A;  4DR7 L;  5JJZ A;  3RLO A;  3H3V I;  2XRS D;  3HOU H;  1PRT D;  3DM3 A;  3S2D H;  4P71 A;  5H1S E;  1TS2 A;  5IYC H;  2C9O A;  3O13 A;  1K83 H;  3EIV A;  4HIO A;  1KXL A;  2NZH A;  1JT8 A;  2Z8L A;  1DOM A;  2AWN A;  1EFW A;  4JK1 C;  2AQ1 B;  4WJ4 A;  1E7Z A;  1RIP A;  4IFD I;  1AEX A;  4Q0F A;  2ZXP A;  1PXU A;  1EUJ A;  5E1F A;  1LTL A;  1TS3 A;  3CQZ H;  4BS9 A;  2HIV A;  3U58 A;  4U67 3;  4CBV A;  3RZD B;  4KD4 A;  2BDO A;  1PH6 A;  2TSS A;  1GOZ A;  3FKI G;  3I8Z A;  4ZUJ A;  1UEB A;  4K5W A;  4BA2 I;  1K0R A;  4XTC S;  2ZXO A;  3PSI A;  3J7A V;  1VQC A;  2OWO A;  1U4M A;  4DUY Q;  3GTL B;  3K58 A;  3SK6 A;  1ZYR D;  2J7Z A;  1YEZ A;  3U9S A;  4ZKC B;  3AMU A;  1D7Q A;  3HKS A;  3TS0 A;  2E2H B;  4J1M A;  1X3E A;  4ZCK A;  2NVY H;  4WFN 3;  1STH A;  1K8A C;  1J5E Q;  4QQB X;  1MSH A;  3STB D;  2PQE A;  3LWE A;  4A3M G;  1IBL L;  2OTL A;  1H9R A;  1SE3 A;  4LFB L;  2Y0S B;  1K3R A;  1TS5 A;  3EVQ A;  1TWF B;  3JC6 6;  3FMC A;  2WFW A;  2ZJR A;  3M3Y B;  1SNP A;  1NBW A;  4HIK A;  5JEA G;  4JV5 Q;  2P5Z X;  5K5P A;  4JI8 Q;  4EGV A;  3TME A;  5C4X G;  5IP9 G;  3A0J A;  3ZJY C;  4JYA L;  1O7Y A;  1NAP A;  2J4X A;  3F2B A;  4IOA A;  3T1Y L;  1MJC A;  1UE7 A;  4QUC A;  3BVZ A;  5JOB A;  2RDG A;  3MFY A;  2R92 B;  2EXZ A;  2OXP A;  2Q2H A;  2K28 A;  1CT1 D;  2F4I A;  1WCM B;  4JOI A;  3ONA B;  3L7Z C;  2G9D A;  3EQL C;  1N8R C;  2B63 H;  5C4H A;  1A2T A;  4JCV E;  1IBK L;  2IHF A;  2OEO A;  2K01 A;  3VDY A;  3K5M A;  3NPP A;  1G2S A;  1F2Z A;  3KUP A;  1Z7T A;  2RSO A;  5IOC A;  1PH2 A;  4BY7 H;  3K5N A;  4RGT A;  2Q8R E;  2CFM A;  2RCN A;  3HEJ A;  1MIU A;  2YV5 A;  2KEN A;  4TVA B;  1F9R A;  5HY6 A;  1JE5 A;  2B2W A;  1UE5 A;  3S17 H;  5G3L D;  3W1B A;  3P1H A;  4A3B H;  1CTM A;  5A2Q L;  2B3G A;  4IUP A;  4TSS A;  3BZC A;  2Z4H A;  1B3A A;  4X3K A;  2R3Z A;  1LT4 D;  2EY1 A;  3PGZ A;  2PQA A;  1VQP A;  2HIX A;  1HH2 P;  1E0B A;  2M2L A;  1RDP D;  4GS3 A;  1SJE D;  4NDX A;  3KBX A;  1HFN A;  4TQU S;  2Z1C A;  1EEF D;  5FLX c;  3HOZ G;  3SEB A;  4ILW A;  4UHV A;  3QR8 A;  4DV7 L;  2F3W A;  3RNU A;  4PG3 A;  4HCS A;  2D5D A;  1BKB A;  4KJO A;  4A3D B;  1NTG A;  4RCO A;  4LF4 L;  2A6E D;  3W1G A;  2A73 B;  2X6G A;  4HCE A;  5FLM H;  4B3T Q;  4L5S A;  4AYB B;  5JJL A;  3J80 L;  1WTW A;  3CC2 A;  4XQN A;  3S1Q B;  3HOV H;  3NTH A;  5CV5 A;  3PO2 H;  1PTO F;  4KY5 A;  1LT5 D;  3CD6 A;  4BBS B;  1K8O A;  1Y8P B;  1D8L A;  2K5N A;  1BOS A;  1E22 A;  1YBY A;  3BU2 A;  4V0B A;  1NJI C;  2JEA I;  3S1N B;  4PMB A;  3PIP A;  2EPB A;  2B2V A;  2XN9 C;  4DR3 Q;  3SE0 A;  4DR2 Q;  2PO4 A;  4HTH A;  2Q8T A;  3VA7 A;  2SNM A;  2NVX B;  3E0E A;  5C0X H;  4B9W A;  4O0A A;  1K28 A;  2NTS A;  1ZKO A;  4DAP A;  1Z9F A;  5IYD H;  3GTQ H;  1BR9 A;  4DV4 L;  2F0D A;  3MWY W;  5IGE A;  1IXR A;  3A7L A;  2CHB D;  4OIJ A;  2JEB I;  3I4N G;  4G7Z C;  1DOK A;  2A8V A;  1L0W A;  2VQE L;  1U0L A;  1II3 A;  4FXK C;  1A62 A;  4ZAI A;  1X55 A;  5IGC A;  3HG9 A;  3PF5 A;  2WIN B;  1B53 A;  2KHS A;  4HMI A;  3OYY A;  2F0V A;  2KEE A;  3L9A X;  2RQX A;  3EA6 A;  3AQQ A;  2K50 A;  1B9M A;  1TY0 A;  4X62 Q;  4DFA A;  4A3I H;  3AFQ A;  4RAU C;  2N55 A;  4Z9C B;  3G6E A;  2YTV A;  1C48 A;  2UXD L;  3CW2 C;  3X3M A;  4C2M H;  1QVC A;  5EPK A;  1XNR L;  4MHE A;  1IYV A;  1FVI A;  2KCC A;  3W5O A;  2AWO A;  1PH1 A;  5LMN W;  2NBF A;  1SNO A;  4R8N A;  1K9M C;  2I5H A;  1VQ9 A;  4B3S L;  4KHP Q;  4RWS C;  1SJH D;  4A3D H;  4LF8 L;  4AQY L;  4DR7 Q;  4IUN A;  1LAB A;  4A3G H;  2R7Z G;  4KHZ A;  3BYY B;  1DCZ A;  3S1R B;  1LT6 D;  1RTO A;  1DON A;  3KLS X;  2NUC A;  2HT1 A;  1I3Q H;  4S3S A;  5C3W A;  3H0G H;  3PUV A;  4BBS H;  5C5M A;  1AE2 A;  1HZ9 A;  1ZEQ X;  2MFI A;  4ID6 A;  4L5T A;  3KOJ A;  1GHK A;  1EWI A;  2IY5 B;  5IYB H;  2L15 A;  2K4K A;  4DGZ A;  2JE6 I;  4BXX G;  3T51 B;  2E76 C;  2Y0S E;  2MGS A;  2VB3 X;  4LFC Q;  4LF7 Q;  2YYZ A;  3S1N H;  5K36 G;  3K5O A;  5FJ8 H;  1HRJ A;  3DXJ C;  2RBM A;  3HOX G;  2NZO A;  4POF A;  1M90 C;  2EYP A;  1X9N A;  3M9B A;  1VMP A;  2H1E A;  1LTS D;  3UDG A;  4KHV A;  1TY2 A;  1JOO A;  3GQB A;  4GNX A;  1A3V A;  1SXT A;  1GUT A;  3KF8 B;  1Q82 C;  2NVQ H;  3PO3 H;  4NXN Q;  5KRU A;  1PA6 A;  4LNQ A;  2JA6 H;  5IGD A;  1HZB A;  3CU7 A;  2X69 A;  3OOC A;  1JOQ A;  3OTO Q;  2ZTE A;  3I91 A;  4OIK A;  3RUZ A;  2CWP A;  1FD7 D;  2FJ2 A;  5C3E G;  1M1K C;  1EQQ A;  5E4W C;  5I6Y A;  1WYD A;  2RSN A;  4IUR A;  5C44 G;  1IBL Q;  3K7A B;  4LFB Q;  5IP7 H;  3MXN A;  3PF4 A;  3RZO B;  4KJN A;  4RKB A;  3WOF A;  1E2V A;  1B2T A;  2RCF A;  3NSW A;  1PFN A;  3GTO B;  3R2T A;  2VXW A;  1KAA A;  3RD4 A;  3VR2 A;  2Z0S A;  2JA5 G;  3NTI A;  3HP3 A;  4GLA C;  4R9W A;  5EKL A;  4DXG A;  4CKC A;  4XYO A;  3WOE A;  2B29 A;  2CQA A;  4FYD A;  4F7X A;  4JYA Q;  1NMG A;  1PRT B;  1TT2 A;  4YHH Q;  3LWU A;  1FNW A;  1FNU A;  2F0Q A;  2NB0 A;  2IWH A;  3E6Z X;  2F3I A;  2RA4 A;  1YNJ C;  1BUV T;  5CBA E;  1AZP A;  1EZ6 A;  2V1C C;  3VR5 A;  1R4Q B;  4JBW A;  1J5E L;  1IBK Q;  5COR A;  4A93 G;  5LMN Q;  2BA1 A;  2MNA A;  1S5B D;  2BE5 C;  4EQP A;  3J7Y W;  2AMC B;  1K0S A;  4TKO B;  3OWE B;  4AYB E;  4ZK9 B;  2HDL A;  1PVO A;  4RA8 A;  3OHX C;  5EPL A;  4JI8 L;  2R93 B;  4LAA A;  4K8I A;  3A56 A;  3IKJ A;  4BBR B;  3SK5 A;  4EQO A;  1EYC A;  3PQI A;  1QNK A;  1VQJ A;  4BY1 G;  1N34 Q;  1STY A;  2XTI A;  3UI2 A;  4MIU A;  1QG7 A;  3K0Y A;  1FGB D;  1CKO A;  2JXM B;  4PNY A;  3QOL A;  3M4Q A;  3BDC A;  4YCW A;  1BVS A;  1UE6 A;  1B70 B;  2C35 B;  4DV7 Q;  2F03 A;  1EIH A;  3U4Z A;  1GJX A;  1OO9 B;  4C3H G;  3T1H L;  1D6E C;  4KLK A;  1B50 A;  1JC7 A;  5E4X A;  5JJI A;  1OXS C;  5M5X H;  3H94 A;  2HQE A;  2NVT B;  2JA8 G;  3TP5 A;  4K6D A;  3NEN A;  3K7A H;  3HOU G;  5CV8 A;  4O2D A;  3RZO H;  2PI2 E;  5C4J B;  3A54 A;  4QUF A;  4LK1 C;  3NE5 B;  4JBK A;  3KJO A;  2SNS A;  1SE2 A;  2ZJP A;  3CCJ A;  2QCP X;  4JBM A;  4K6L A;  3CCM A;  1F9P A;  2KBN A;  2PQA B;  4GLX A;  3Q8D A;  2A74 C;  1SMX A;  4DUZ Q;  3S1M B;  2VUM B;  2CQO A;  2K33 A;  2OT2 A;  1NNX A;  1F9S A;  4A3E G;  4H0L C;  1VQ8 A;  4KK7 A;  3M85 A;  4OGQ C;  3TSS A;  4JOI C;  2NWG A;  4DKA C;  2HHH L;  5FO9 B;  4B3T L;  2X6L A;  3D6W A;  4NP5 A;  3MXP A;  4DV4 Q;  1ASZ A;  3GTP H;  4GKK Q;  1JJC B;  2CH4 W;  1LLR D;  4C3H B;  3G48 A;  4HJ5 A;  3CC4 A;  1N9W A;  2WP8 J;  3I56 A;  1HPC A;  2B2T C;  4Y7N B;  2LY7 A;  3EFX D;  4ZQ3 A;  2EOT A;  5M3F G;  5FK9 C;  1LTT D;  2R93 H;  2HQL A;  4IPH A;  2NZ1 D;  2KA7 A;  2Q2I A;  3PIO A;  4BBR H;  1B1Z A;  2QA4 A;  4DR3 L;  2L5T A;  3Q0A A;  4TRD A;  5C3X A;  4DV0 L;  3CCQ A;  1X3P A;  5IT9 L;  2JN4 A;  4JI1 L;  5I2X A;  1SE4 A;  3GDE A;  1W2B A;  2D0P A;  1L1O B;  1SYD A;  1L0Y B;  4B3R L;  1C7Y A;  3G7L A;  5LHY 1;  1XNR Q;  2PW5 A;  1Z47 A;  3ND9 A;  3QJY A;  2K05 A;  3FDT A;  1JJG A;  1SEB D;  3I4M B;  4FXG C;  4B3S Q;  4ODG A;  3HKZ B;  3ER0 A;  2FMC A;  1CA5 A;  4LF8 Q;  1VQB A;  1XPU A;  2K1B A;  4A3E B;  1HTL D;  4HMJ A;  1VQD A;  2K5D A;  2NVT H;  3EJI A;  1I6H B;  1JOR A;  3S15 B;  1YNJ D;  1PTO C;  4NXM Q;  2B63 G;  3GD7 A;  4X65 Q;  3SK8 A;  1HUN A;  2YU9 H;  1HQM C;  1ET6 A;  1KLG D;  4X62 L;  2WKC A;  5BR8 L;  4PQX A;  2OQK A;  2CW0 D;  4BY7 G;  2EE1 A;  3KYH C;  3OW2 A;  2H4O A;  5NUC A;  1Y8N B;  1O7I A;  5I9O A;  3NUC A;  2BE5 D;  3R8B A;  3P75 A;  1SMY C;  4KN7 C;  1TWG H;  3MTS A;  4MZ9 A;  2B2V C;  4RGM A;  2F52 A;  2EY6 A;  4DA2 A;  5FO8 B;  1GXD C;  2VUM H;  1RCV D;  2JA7 G;  2LFN A;  1H9S B;  3X3N A;  4A3C G;  3TZD A;  3T4A C;  4C3I H;  3SXH A;  3HOY H;  4ALP A;  5DM6 3;  3C3L A;  5EJW A;  1EQV A;  2JQO A; 
#chains in the Genus database with same CATH homology
 1I50 H;  4GS3 A;  2GN5 A;  5IYC G;  1KIX A;  3KDF B;  4TQU S;  3GTO H;  1HNZ L;  1YJN A;  1I94 L;  5FLX c;  4JI4 Q;  4R4Q A;  3HOZ G;  1X3F A;  5HGQ A;  1GD7 A;  1JB7 A;  3HOZ H;  3G4S A;  1CUK A;  1PH8 A;  1L2F A;  4DV7 L;  4X64 L;  3RNU A;  4PG3 A;  1KL9 A;  1CKN B;  5AJ3 Q;  2CKZ B;  2OQ0 A;  1QZG A;  1BKB A;  4GN5 A;  2GVA A;  1NTG A;  2ID0 A;  2CWA A;  2UXC Q;  4LF4 L;  3A74 A;  4LFC L;  5FLM G;  1PV4 A;  4DV5 Q;  3W1G A;  4LF7 L;  4JI3 Q;  1VQG A;  5FLM H;  4B3T Q;  4OON A;  3GTK H;  1GO3 E;  4L5S A;  5JJL A;  1MJE A;  3CC2 A;  1SR3 A;  3HOV G;  4PZ6 A;  3PO2 G;  3HOV H;  4QJF A;  3CPF A;  3PO2 H;  3CD6 A;  1IL2 A;  1D8L A;  4B3M Q;  5GQO A;  1R9T H;  2E2J H;  2K5N A;  4LF6 L;  1E22 A;  1YBY A;  4HJA A;  3BU2 A;  4DK6 C;  3NBH B;  3CME A;  3HOW H;  4NXN L;  3TRE A;  1NJI C;  2KHI A;  1YI2 A;  2JEA I;  3GTM H;  1VQ4 A;  4NPS A;  2ZTC A;  3PIP A;  1XMQ Q;  4DV2 Q;  1YIJ A;  4A3K H;  1W3S A;  4IJH A;  4C3J H;  5C3E H;  4DR3 Q;  4DR2 Q;  2R93 G;  4OO1 G;  2WB1 G;  3OTO L;  1Q7Y C;  1A0I A;  3IRB A;  4ME3 A;  2ES2 A;  5C0X G;  4BBR G;  1EYG A;  1PHJ A;  2XGT A;  3E0E A;  3CP0 A;  2A19 A;  4O0A A;  3CC7 A;  2IT1 A;  1CKM A;  1YJW A;  2PI2 A;  1FJG Q;  1Z9F A;  4UP9 A;  2UU9 Q;  2UUC L;  3EN2 A;  5IYD H;  3F1Z A;  1QZH A;  3GTQ H;  4IOC A;  1N32 Q;  4A3L G;  3J7A 5;  3T1Y Q;  1NY4 A;  3UDX A;  3U50 C;  5IY0 A;  3L2P A;  1VS0 A;  4DV4 L;  4DUY L;  1IXR A;  4DV1 Q;  4A3L H;  1HNW Q;  3GTG H;  2VW9 A;  4QIW E;  3FP9 A;  2Q2U A;  1VQ6 A;  3MXN B;  2JEB I;  3I4N G;  1E1T A;  2BH8 A;  2A8V A;  1L0W A;  2VQE L;  1X3G A;  5JEA J;  1U0L A;  4MTN A;  4YHH L;  1PFS A;  4IFD J;  4L5R C;  1A62 A;  1EQR A;  1X55 A;  2IX1 A;  3M4O H;  3E9H A;  3I2Z A;  3PF5 A;  1SRU A;  4DR6 L;  3PUW A;  3OYY A;  3RLN A;  5GAG C;  3J80 c;  4RG1 A;  2DUD A;  2QGQ A;  1YHB A;  3AQQ A;  3K8A A;  2K50 A;  4X62 Q;  4GNX C;  1JJ2 A;  2WAQ E;  4A3I H;  4A3J H;  1XNQ L;  2KCT A;  3CAM A;  3AFQ A;  4JI5 L;  2ZM6 Q;  1VQN A;  4IPG A;  3M7N A;  3G6E A;  2GVB A;  2YTV A;  4IJL A;  2UXD L;  1IBM Q;  2UUA Q;  1X6O A;  2VY3 A;  5C4J H;  4JI0 L;  5LMN L;  3CW2 C;  3JAM i;  3CCE A;  4C2M H;  1QVC A;  1XNR L;  4JV5 L;  3T1H Q;  1FVI A;  3W5O A;  2AWO A;  1PH1 A;  2K52 A;  5LMN W;  1VQA A;  1XJV A;  1K9M C;  1HR0 W;  2D0O A;  2VS1 A;  1KRS A;  2KHJ A;  2I5H A;  1KRT A;  4X66 L;  4DV3 Q;  1VQ9 A;  4B3S L;  5JJK A;  1VQ5 A;  4KHP Q;  3KDF A;  4A3D H;  4IPC A;  4LF8 L;  2WAQ G;  4IO9 A;  5M5W H;  3U4V A;  4AQY L;  4DR7 Q;  3S16 H;  4A3G G;  4A3B G;  2VUM G;  1S3O A;  1Q8K A;  4P73 A;  1G51 A;  3S1M H;  2R7Z G;  4KHZ A;  4A3G H;  5ELO A;  2EQS A;  3TS2 A;  2R7Z H;  4QGU A;  4DR1 Q;  4APV A;  4LUO A;  3RZD H;  1VQI A;  3UDF A;  1Y1W H;  1I3Q H;  1CKN A;  1KD1 C;  3H0G G;  1HNZ Q;  4UY8 C;  4QY7 A;  5J3B A;  1I94 Q;  1HNX L;  5E7N A;  3H0G H;  3PUV A;  1N34 L;  1J6Q A;  2UXB L;  3CCL A;  4BBS H;  4P72 A;  2E8G A;  1HZ9 A;  1AE2 A;  1Y1V G;  3PUY A;  4FDB A;  1VQK A;  2LXK A;  2MFI A;  4L5T A;  3KOJ A;  3UE0 A;  1RL2 A;  1EWI A;  3CF5 A;  4JI7 Q;  2IY5 B;  5IYB H;  2L15 A;  2K4K A;  3JAM c;  2JE6 I;  4BXX G;  3WWV A;  3KJP A;  3GTL H;  4BXX H;  2Y0S E;  4LF4 Q;  4LFC Q;  1X65 A;  4LF7 Q;  2YYZ A;  4C3H H;  3S1N H;  5FJ8 G;  4A76 A;  5K36 G;  4LF9 L;  5FJ8 H;  2RHS B;  1KQS A;  5M5Y H;  3HOX G;  4Y7N H;  2NZO A;  4OWX B;  2K75 A;  4POF A;  1M90 C;  3F2C A;  1C9O A;  2N3S A;  3HOX H;  1X9N A;  2E2H H;  3ICE A;  2CCZ A;  5IE8 A;  3M9B A;  2HHH Q;  1GVP A;  2VQF Q;  3UDG A;  2E2I H;  2BH2 A;  1XTD A;  3HKZ E;  4GNX A;  1YIT A;  4OX9 L;  4LF6 Q;  2Y0S G;  3CCU A;  3PO3 G;  1AH9 A;  3KF8 B;  3I55 A;  1Q82 C;  5LMU Q;  2NVQ H;  2WB1 E;  4JI6 L;  4GKJ L;  4GN4 B;  1X56 A;  1Q46 A;  4NXN Q;  3PO3 H;  3ULJ A;  1PA6 A;  4P75 A;  2JA6 G;  1NE3 A;  3I7F A;  4LNQ A;  1TWF H;  3M4P A;  1SRO A;  3ULL A;  5M3M H;  2UUB L;  2JA6 H;  3M3Y H;  1HZB A;  3DLL A;  1KAW A;  3RR5 A;  3CCS A;  5DLQ E;  4NB3 A;  1N36 L;  2Q2T A;  4JI4 L;  3ERS X;  2AKW B;  2ASB A;  3HOW G;  3OTO Q;  2ALY B;  4IPD A;  3PUZ A;  2ZTE A;  4UP8 A;  3F8T A;  3I4M G;  4DK3 C;  3STB C;  4A3K G;  2JA9 A;  2CWP A;  4DR4 Q;  3HKZ G;  4UP7 A;  5C3E G;  4A3F H;  3I4M H;  3PCO B;  5AJ3 L;  1M1K C;  4GNX B;  1EQQ A;  2R92 G;  1WYD A;  5C44 G;  2UXC L;  4LUZ A;  1IBL Q;  3S2H H;  4DV0 Q;  2R92 H;  1XPO A;  1GKH A;  2N78 A;  5IP7 G;  5C44 H;  2NN6 I;  4HJ8 A;  3FKI H;  4A3E H;  1MKH A;  1CSP A;  2R7F A;  4JI1 Q;  5IP7 H;  4DUZ L;  4LFB Q;  1OXT A;  3PF4 A;  1FL0 A;  5GAH C;  3J80 i;  1WCM G;  3A5U A;  1I6H H;  1V1Q A;  1WCM H;  2Z0S A;  5IYD G;  3J81 i;  3NEM A;  4B3R Q;  5C0X J;  4GLA C;  2JA5 G;  1KHI A;  1G29 1;  2VZA A;  3S15 H;  2JA5 H;  4A4I A;  2B29 A;  1OXV A;  4YY3 Q;  4JYA Q;  1NMG A;  2VL6 A;  4LF5 Q;  2JJQ A;  2VQE Q;  3S24 A;  1SE8 A;  4YHH Q;  4LUV A;  5EAY A;  4HJ9 A;  4EX5 A;  2LXJ A;  4MNO A;  5GAE C;  3GTJ H;  4GKK L;  1Y14 B;  2IHE A;  4KI0 A;  2F4V Q;  1EIF A;  5M3F H;  2JQO A;  4R4O A;  4DR6 Q;  2F3I A;  4JI2 Q;  1WOC A;  4DV2 L;  4PMW A;  4LFA L;  1ASY A;  4A93 H;  4XIG S;  4JG2 A;  3CCR A;  4DR2 L;  4AIM A;  5IWA L;  4A3M H;  1T9H A;  2I5M X;  1XNQ Q;  1LYL A;  1E24 A;  2V1C C;  4JI5 Q;  4K0K L;  2JK8 A;  1J5E L;  4JBW A;  3EBE A;  3H15 A;  2UXD Q;  1IBK Q;  4A93 G;  3HFZ B;  1PYS B;  4PZ8 A;  5LMN Q;  3BJU A;  4A3J G;  4A3I G;  3KLW A;  3CPW A;  4DR5 L;  2BA1 A;  2MNA A;  1HR0 Q;  5BR8 Q;  3J81 c;  3CCV A;  2UU9 L;  1N33 L;  2K5V A;  1P8L A;  2AMC B;  1N32 L;  5C4X H;  1LM0 A;  1LUZ A;  4AYB E;  4DNI A;  3K81 C;  1G6P A;  4X66 Q;  3RN2 A;  3A5Z B;  1PVO A;  4DV1 L;  1V43 A;  1HNW L;  1E3P A;  1VQM A;  3MEF A;  4OWT B;  4P74 A;  1CSQ A;  4JI8 L;  4AQY Q;  2OTJ A;  3B6Y A;  3CXC A;  1XMO L;  1JMC A;  2D62 A;  4DAM A;  1VQE A;  4R4T A;  4A3D G;  2I5L X;  2N8N A;  3K80 C;  3E9I A;  4BA1 I;  1X54 A;  3PV0 A;  1P16 A;  2ZJQ A;  4OWW B;  1HNX Q;  1VQJ A;  1YZ6 A;  1IZ6 A;  4BY1 G;  1N34 Q;  2XTI A;  4L5Q A;  4AYB G;  4BY1 H;  2E5L Q;  3S14 H;  1CKO A;  1Y1W G;  1K73 C;  3TRZ A;  4YWM A;  3S1Q H;  3M4Q A;  4LWC A;  2R7D A;  4YCW A;  3L0O A;  1S72 A;  4BBS G;  1Q12 A;  1BVS A;  1UE6 A;  1OTC A;  4NXM L;  1B70 B;  2C35 B;  3NEL A;  3J7Z C;  1K8G A;  4DV7 Q;  4X64 Q;  4R4C A;  2R6G A;  5IYB G;  4X65 L;  2UUA L;  1B7Y B;  1SLJ A;  3U4Z A;  3SGI A;  2MO1 A;  1OXU A;  2MO0 A;  3AFP A;  4H02 A;  3KF6 B;  4X6A H;  1DGS A;  1L1O C;  3TEH B;  4GOP B;  3T1H L;  2EXD A;  2YTX A;  4KLK A;  1Q86 C;  4WJ3 M;  4POG A;  5JJI A;  1OXS C;  2Z6K C;  1PH3 A;  5M5X H;  1PH5 A;  1PYB A;  1S40 A;  4DV3 L;  4EQ5 A;  2JA8 G;  4KHP L;  4RMF A;  2JA7 H;  3K7U C;  2VNU D;  1A8V A;  1QUQ B;  1TWC H;  2AHO B;  1Q1B A;  2A1A A;  3NEN A;  3K7A H;  4OX9 Q;  2JA8 H;  4A3C H;  1NMF A;  4DV6 L;  3HOU G;  4DR7 L;  4Y52 H;  3RLO A;  4JI6 Q;  3H3V I;  2DGY A;  4O2D A;  3HOU H;  3DM3 A;  2NVX H;  3RZO H;  1QVG A;  4DR1 L;  1WI5 A;  3S2D H;  4GN3 B;  4P71 A;  4PZ7 A;  2PI2 E;  5H1S E;  2N49 A;  2UUB Q;  5IYC H;  2HT1 A;  1N36 Q;  1K83 H;  3EIV A;  2FXQ A;  1UE1 A;  1YVC A;  4HIO A;  4JBK A;  2NZH A;  3KJO A;  1JT8 A;  1KXL A;  4YWL A;  4A75 A;  3PUX A;  1C0A A;  3LGJ A;  5M3M G;  4QL5 A;  4UPA A;  2ZJP A;  3CCJ A;  2AWN A;  1UWV A;  1EFW A;  4JI7 L;  4JBM A;  4WJ4 A;  1E7Z A;  1RIP A;  2ZTD A;  3CCM A;  4YCU A;  4IFD I;  1U5K A;  2H5X A;  2PQA B;  2KBN A;  1Q81 C;  4GLX A;  1EUJ A;  3Q8D A;  4DUZ Q;  1SMX A;  4A3F G;  3TQY A;  1LTL A;  3CQZ H;  2CQO A;  1PH7 A;  2HIV A;  3U58 A;  3I4O A;  1YHA A;  2EIF A;  1PH6 A;  4A3E G;  1AE3 A;  1VQH A;  3FKI G;  1VQ8 A;  2PMZ E;  2UUC Q;  3GO5 A;  3M85 A;  4DV5 L;  4JOI C;  4JI3 L;  1UEB A;  4DKA C;  2HHH L;  4GOP C;  4B3T L;  1WFQ A;  4HJ7 A;  5GRO A;  2VQF L;  1K0R A;  4BA2 I;  1PH4 A;  3FHW A;  4J15 A;  4XTC S;  2KCM A;  3PSI A;  4DV4 Q;  1PH9 A;  1VQC A;  1ASZ A;  2OWO A;  4DUY Q;  5LMU L;  3GTP H;  4GKK Q;  1JJC B;  4JC0 A;  3KFU A;  4OXP A;  2RHQ B;  3G48 A;  4HJ5 A;  3CC4 A;  1N9W A;  4B3M L;  2WP8 J;  2OCE A;  3G71 A;  3AEV A;  1YEZ A;  4LFA Q;  3I56 A;  1V9P A;  1D7Q A;  3HKS A;  1L1O A;  1TWA H;  2IX0 A;  4YCV A;  1VQ7 A;  1H95 A;  2ATW A;  3TS0 A;  5M3F G;  2R93 H;  5IWA Q;  2Z6K A;  2HQL A;  2LSS A;  1X3E A;  4IPH A;  3J81 j;  2Q2I A;  2PNH A;  4DR4 L;  4K0K Q;  3PIO A;  2NVY H;  1XMQ L;  3D31 A;  4BBR H;  1K8A C;  1J5E Q;  4QQB X;  2QA4 A;  4DR3 L;  3H3V H;  1HZC A;  1KC8 C;  3STB D;  4A3M G;  1IBL L;  2OTL A;  4DV0 L;  4DR5 Q;  3CCQ A;  5GAD C;  1VQL A;  1N33 Q;  4LFB L;  4JI1 L;  3F2D A;  1E1O A;  3S1R H;  3GDE A;  3RN5 A;  1W2B A;  1K3R A;  3JC6 6;  1XPR A;  4HIM A;  1BBU A;  4LW1 A;  2WFW A;  2ZJR A;  2D0P A;  1L1O B;  3AYH B;  4JI0 Q;  1FJG L;  1NBW A;  4B3R L;  4HIK A;  1C7Y A;  4GLV B;  4R4I A;  5JEA G;  1XNR Q;  4JV5 Q;  4JI8 Q;  1Z47 A;  4YWK A;  1BBW A;  5C4X G;  4IFD G;  4HID A;  3BZK A;  2K14 A;  5IP9 G;  3A0J A;  3ZJY C;  4YY3 L;  1XMO Q;  4LF5 L;  3D0F A;  4JYA L;  1JJG A;  1TWH H;  3K0X A;  5IP9 H;  3I4N H;  3F2B A;  4B3S Q;  4IOA A;  3T1Y L;  1MJC A;  1UE7 A;  3ER0 A;  4LF8 Q;  1VQB A;  1XPU A;  2F4V L;  3RLF A;  2BA0 A;  1VQD A;  4JI2 L;  2NN6 G;  2NVT H;  1SFO H;  3UDI A;  1I5F A;  1B8A A;  2Q2H A;  1HZA A;  3KF6 A;  4JOI A;  1YJ9 A;  4R1J A;  4GOP A;  2UXB Q;  4NXM Q;  3L7Z C;  2B63 G;  1WJJ A;  1N8R C;  3GD7 A;  1QVF A;  1HJP A;  3UE1 A;  2B63 H;  5ELN A;  4JCV E;  1IBK L;  2IHF A;  4X65 Q;  3VDY A;  4JBJ A;  2YU9 H;  1HR0 L;  1EIY B;  1QUQ A;  4X62 L;  2QEX A;  5BR8 L;  1GM5 A;  2YTY A;  1YNX A;  2OQK A;  4BY7 G;  3KYH C;  3OW2 A;  2ZM6 L;  1PH2 A;  4BY7 H;  1O7I A;  1YHQ A;  3CMA A;  4LF9 Q;  1A63 A;  1SN8 A;  1IBM L;  1Q1E A;  2MQH A;  1TWG H;  2CFM A;  2RCN A;  4MZ9 A;  1MIU A;  2YV5 A;  2KEN A;  1VQF A;  1VQO A;  4TVA B;  5HY6 A;  1JE5 A;  2F52 A;  4DV6 Q;  3ULP A;  1UE5 A;  3S17 H;  1OXX K;  3W1B A;  4A3B H;  1IYJ B;  1EOV A;  4DAY B;  4AH6 A;  2VUM H;  2JA7 G;  4OO1 I;  2B3G A;  4A3C G;  3BZC A;  4DPG A;  3HOY G;  1VCI A;  1FGU A;  4C3I H;  5C0X I;  3HOY H;  2K5H A;  2PQA A;  3PGZ A;  5IT9 c;  4ALP A;  1VQP A;  2HIX A;  2RF4 A;  4GKJ Q;  1HH2 P;  2I0Q A;  2E5L L;  1TXY A;  1Y1V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...