2WAQP

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
43
structure length
43
Chain Sequence
CGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
pubmed doi rcsb
molecule tags Transcription
total genus 2
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2009-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.30 Mainly Beta Single Sheet Rubrerythrin, domain 2 RNA polymerase ii, chain L 2waqP00
2YU9L 1R9TL 4BY7L 4A3GL 4BY1L 3S2DL 2R93L 3HOYL 3S1RL 2E2HL 1I50L 4A3DL 5C4JL 2B63L 2VUML 5C3EL 3HOZL 2E2JL 5FJ8L 4A3JL 2R7ZL 3PO3L 4C3IL 1SFOL 4Y7NL 1I3QL 2R92L 3RZDL 5C4XL 4C3JL 4A3IL 3HKZP 1Y1VL 2WB1P 3GTOL 5C44L 5IP7L 3GTJL 2NVYL 5IYDL 3GTQL 3M4OL 1TWAL 2JA8L 3S16L 2JA5L 5FLML 5M3FL 3CQZL 2Y0SP 3GTLL 3H3VM 4A3BL 4QIWP 3PO2L 1K83L 3H0GL 5M3ML 1TWHL 5M5YL 4X6AL 3GTKL 1TWGL 5M5WL 4AYBP 3GTPL 1WCML 4BBRL 2NVQL 1TWFL 3S2HL 3HOWL 3HOUL 4A3LL 3RZOL 1Y1WL 3K7AL 3S1NL 3S15L 3S14L 3S17L 5M5XL 2JA6L 3HOXL 4BBSL 4A3ML 5IYBL 3I4NL 2E2IL 5IYCL 3HOVL 2WAQP 4A3FL 3GTGL 4Y52L 3S1ML 1I6HL 4A93L 2NVTL 4C2M1 3GTML 1TWCL 4A3EL 4BXXL 4A3CL 4C3HL 3M3YL 5IP9L 3FKIL 2NVXL 4A3KL 3I4ML 2PMZP 3S1QL 2JA7L
chains in the Genus database with same CATH superfamily
4TVMA 3S2DL 3QQCE 5K2ME 2XJPA 2E2HL 4A3DL 4AR3A 2A6ED 5MGNA 2R7ZL 5EIOC 1LKOA 1YV1A 4C3IL 1B2OA 1I3QL 3KYYA 5C4XL 3NFPI 4A3IL 1QCVA 2O5JD 2WB1P 3K35A 5C44L 5GAGc 2NVYL 5IYDL 3M4OL 2AQCA 3RYGA 2M6PA 5M3FL 1RYTA 2H12A 2XJSA 4AHWA 4AHZA 4A3BL 4QIWP 2A69D 1K83L 3H0GL 1R0FA 3LWQB 4X6AL 5AI3A 1WCML 4BBRL 3S2HL 4E6YA 1ZRPA 2C6AA 3J7Y1 3PKJA 4AR5A 3S17L 4JADA 5H1Sc 2V0EA 1RWDA 5MLC3 1RDGA 1R0HA 4JAEA 4V196 5IYCL 4UY81 4Y52L 4XGHA 1S2ZA 3S1ML 1I6HL 2C6BA 1PZXA 2M4YA 3MQKB 4C2M1 4BXXL 4AHYA 4A3CL 2Z3RB 1JYBA 5IP9L 2MS3A 4WFN1 4A3KL 2PMZP 3S1QL 3LWOB 2JA7L 2YU9L 1R9TL 4A3GL 2R93L 3PIO1 3S1RL 3WWLA 1R0IA 1DX8A 2QL0A 1YUZA 5C3EL 1F4LA 2CR8A 3P2AA 3PO3L 2ZIXA 4AI2A 1T9PA 5GAEc 2XJVA 2R92L 2HVYC 3MSUA 4ZN3B 1BE7A 3HKZP 3LWRB 3HJWB 2PPTA 1S30A 4AI0A 2XJRA 1TWAL 5FLML 1Z92B 1RYQA 2Y0SP 2KN9A 3PO2L 2A68D 5M3ML 2VL6A 4AI3A 5M5YL 2K2DA 4ME3A 5M5WL 1CAAA 1QQTA 1TWFL 3HOWL 3H99A 3RZOL 1RDVA 3S15L 3S1NL 3S14L 3HAXC 2CKCA 5MFZA 3RZ6A 2BE5D 4YWMA 1PFWA 4LHNA 2ERSA 4A3FL 2XJQA 3GTGL 3SS2A 1IRNA 1TWCL 1P7PA 3JR7A 3ZG6A 3LWPB 2L0ZA 4LHLA 1IROA 1VZIA 1FHHA 2HR5A 3HOYL 1I50L 2PVEA 2XJUA 4ZN1B 3VPBE 3P8BA 1H7VA 1FHMA 1SFOL 4G6BA 4GS7D 3RZDL 7RXNA 5GADc 4C3JL 1Y1VL 3GTOL 5JVH1 5IP7L 1NXEA 4TPUA 3GTQL 3KYWA 2JA8L 3S16L 2JA5L 1SMUA 1LKPA 8RXNA 3IU3I 2V3BB 6RXNA 2XJTA 1C09A 1TWHL 1OWBA 1TWGL 4AYBP 3LPEB 2NVQL 5RXNA 1R0GA 2EY4E 2JI3A 3LWVB 3KYUA 5M5XL 1YUXA 1WJVA 5AN9H 1PFUA 2RFKB 1LKMA 2PYAA 4A3ML 3RZTA 3WWNB 1SMWA 2WAQP 1B71A 4POFA 4B8CD 3GTML 4RXNA 4A3EL 2RDVA 1SMMA 2V0FA 3KYVA 1PFVA 4C3HL 1IU5A 3FKIL 2NVXL 3H9CA 4AI1A 4K9FA 4AR4A 5MFPA 4XXBB 1E8JA 3PWFA 2JI2A 1BQ9A 2DSXA 1B13A 1YK5A 4BY7L 4BY1L 2ERJA 5C4JL 2B63L 3LNLA 2M4VA 2VUML 1DVBA 3HOZL 2E2JL 5FJ8L 4A3JL 1ODHA 2AYJA 1IU6A 1BQ8A 2APOB 1S24A 4Y7NL 2KKDA 1NXGA 3PZAA 4AR6A 3GTJL 2NYDA 4U671 4POGA 1YK4A 1B2JA 3FDJA 2Z3QB 3QVDA 2CKAA 3CQZL 1LTLA 4JAFA 1T9OA 2M6OA 3GTLL 3H3VM 2PSMC 2PVXA 5MF6A 2A6HD 5DM71 2GMGA 3A44A 1OWCA 1VZGA 1CADA 1NNQA 3GTKL 1VCXA 3GTPL 2LCQA 1BFYA 4YWLA 3B08B 3PIP1 1BRFA 3HOUL 4A3LL 1Y1WL 3K7AL 2J9UB 3MPSA 3J7Z1 1VZHA 2JA6L 3PL5A 1IW7D 5EINC 3HOXL 4BBSL 1T9QA 1RB9A 4JAGA 2JI1A 5IY0A 3H97A 5IYBL 3I4NL 2E2IL 3HOVL 1PFYA 3KYXA 5JVG1 5DM61 3H9BA 3B0AB 4A93L 1R0JA 2NVTL 5GAHc 3HJYB 3PKIA 2B5ID 1QYBA 4AHXA 5AI2A 3M3YL 2AUSB 3I4ML
chains in the Genus database with same CATH topology
2YU9L 1R9TL 4BY7L 4A3GL 4BY1L 3S2DL 2R93L 3HOYL 3S1RL 2E2HL 1I50L 4A3DL 5C4JL 2B63L 2VUML 5C3EL 3HOZL 2E2JL 5FJ8L 4A3JL 2R7ZL 3PO3L 4C3IL 1SFOL 4Y7NL 1I3QL 2R92L 3RZDL 5C4XL 4C3JL 4A3IL 3HKZP 1Y1VL 2WB1P 3GTOL 5C44L 5IP7L 3GTJL 2NVYL 5IYDL 3GTQL 3M4OL 1TWAL 2JA8L 3S16L 2JA5L 5FLML 5M3FL 3CQZL 2Y0SP 3GTLL 3H3VM 4A3BL 4QIWP 3PO2L 1K83L 3H0GL 5M3ML 1TWHL 5M5YL 4X6AL 3GTKL 1TWGL 5M5WL 4AYBP 3GTPL 1WCML 4BBRL 2NVQL 1TWFL 3S2HL 3HOWL 3HOUL 4A3LL 3RZOL 1Y1WL 3K7AL 3S1NL 3S15L 3S14L 3S17L 5M5XL 2JA6L 3HOXL 4BBSL 4A3ML 5IYBL 3I4NL 2E2IL 5IYCL 3HOVL 2WAQP 4A3FL 3GTGL 4Y52L 3S1ML 1I6HL 4A93L 2NVTL 4C2M1 3GTML 1TWCL 4A3EL 4BXXL 4A3CL 4C3HL 3M3YL 5IP9L 3FKIL 2NVXL 4A3KL 3I4ML 2PMZP 3S1QL 2JA7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 L;  1R9T L;  4BY7 L;  4A3G L;  4BY1 L;  3S2D L;  2R93 L;  3HOY L;  3S1R L;  2E2H L;  1I50 L;  4A3D L;  5C4J L;  2B63 L;  2VUM L;  5C3E L;  3HOZ L;  2E2J L;  5FJ8 L;  4A3J L;  2R7Z L;  3PO3 L;  4C3I L;  1SFO L;  4Y7N L;  1I3Q L;  2R92 L;  3RZD L;  5C4X L;  4C3J L;  4A3I L;  3HKZ P;  1Y1V L;  2WB1 P;  3GTO L;  5C44 L;  5IP7 L;  3GTJ L;  2NVY L;  5IYD L;  3GTQ L;  3M4O L;  1TWA L;  2JA8 L;  3S16 L;  2JA5 L;  5FLM L;  5M3F L;  3CQZ L;  2Y0S P;  3GTL L;  3H3V M;  4A3B L;  4QIW P;  3PO2 L;  1K83 L;  3H0G L;  5M3M L;  1TWH L;  5M5Y L;  4X6A L;  3GTK L;  1TWG L;  5M5W L;  4AYB P;  3GTP L;  1WCM L;  4BBR L;  2NVQ L;  1TWF L;  3S2H L;  3HOW L;  3HOU L;  4A3L L;  3RZO L;  1Y1W L;  3K7A L;  3S1N L;  3S15 L;  3S14 L;  3S17 L;  5M5X L;  2JA6 L;  3HOX L;  4BBS L;  4A3M L;  5IYB L;  3I4N L;  2E2I L;  5IYC L;  3HOV L;  2WAQ P;  4A3F L;  3GTG L;  4Y52 L;  3S1M L;  1I6H L;  4A93 L;  2NVT L;  4C2M 1;  3GTM L;  1TWC L;  4A3E L;  4BXX L;  4A3C L;  4C3H L;  3M3Y L;  5IP9 L;  3FKI L;  2NVX L;  4A3K L;  3I4M L;  2PMZ P;  3S1Q L;  2JA7 L; 
#chains in the Genus database with same CATH topology
 4TVM A;  3S2D L;  3QQC E;  5K2M E;  2XJP A;  2E2H L;  4A3D L;  4AR3 A;  2A6E D;  5MGN A;  2R7Z L;  5EIO C;  1LKO A;  1YV1 A;  4C3I L;  1B2O A;  1I3Q L;  3KYY A;  5C4X L;  3NFP I;  4A3I L;  1QCV A;  2O5J D;  2WB1 P;  3K35 A;  5C44 L;  5GAG c;  2NVY L;  5IYD L;  3M4O L;  2AQC A;  3RYG A;  2M6P A;  5M3F L;  1RYT A;  2H12 A;  2XJS A;  4AHW A;  4AHZ A;  4A3B L;  4QIW P;  2A69 D;  1K83 L;  3H0G L;  1R0F A;  3LWQ B;  4X6A L;  5AI3 A;  1WCM L;  4BBR L;  3S2H L;  4E6Y A;  1ZRP A;  2C6A A;  3J7Y 1;  3PKJ A;  4AR5 A;  3S17 L;  4JAD A;  5H1S c;  2V0E A;  1RWD A;  5MLC 3;  1RDG A;  1R0H A;  4JAE A;  4V19 6;  5IYC L;  4UY8 1;  4Y52 L;  4XGH A;  1S2Z A;  3S1M L;  1I6H L;  2C6B A;  1PZX A;  2M4Y A;  3MQK B;  4C2M 1;  4BXX L;  4AHY A;  4A3C L;  2Z3R B;  1JYB A;  5IP9 L;  2MS3 A;  4WFN 1;  4A3K L;  2PMZ P;  3S1Q L;  3LWO B;  2JA7 L;  2YU9 L;  1R9T L;  4A3G L;  2R93 L;  3PIO 1;  3S1R L;  3WWL A;  1R0I A;  1DX8 A;  2QL0 A;  1YUZ A;  5C3E L;  1F4L A;  2CR8 A;  3P2A A;  3PO3 L;  2ZIX A;  4AI2 A;  1T9P A;  5GAE c;  2XJV A;  2R92 L;  2HVY C;  3MSU A;  4ZN3 B;  1BE7 A;  3HKZ P;  3LWR B;  3HJW B;  2PPT A;  1S30 A;  4AI0 A;  2XJR A;  1TWA L;  5FLM L;  1Z92 B;  1RYQ A;  2Y0S P;  2KN9 A;  3PO2 L;  2A68 D;  5M3M L;  2VL6 A;  4AI3 A;  5M5Y L;  2K2D A;  4ME3 A;  5M5W L;  1CAA A;  1QQT A;  1TWF L;  3HOW L;  3H99 A;  3RZO L;  1RDV A;  3S15 L;  3S1N L;  3S14 L;  3HAX C;  2CKC A;  5MFZ A;  3RZ6 A;  2BE5 D;  4YWM A;  1PFW A;  4LHN A;  2ERS A;  4A3F L;  2XJQ A;  3GTG L;  3SS2 A;  1IRN A;  1TWC L;  1P7P A;  3JR7 A;  3ZG6 A;  3LWP B;  2L0Z A;  4LHL A;  1IRO A;  1VZI A;  1FHH A;  2HR5 A;  3HOY L;  1I50 L;  2PVE A;  2XJU A;  4ZN1 B;  3VPB E;  3P8B A;  1H7V A;  1FHM A;  1SFO L;  4G6B A;  4GS7 D;  3RZD L;  7RXN A;  5GAD c;  4C3J L;  1Y1V L;  3GTO L;  5JVH 1;  5IP7 L;  1NXE A;  4TPU A;  3GTQ L;  3KYW A;  2JA8 L;  3S16 L;  2JA5 L;  1SMU A;  1LKP A;  8RXN A;  3IU3 I;  2V3B B;  6RXN A;  2XJT A;  1C09 A;  1TWH L;  1OWB A;  1TWG L;  4AYB P;  3LPE B;  2NVQ L;  5RXN A;  1R0G A;  2EY4 E;  2JI3 A;  3LWV B;  3KYU A;  5M5X L;  1YUX A;  1WJV A;  5AN9 H;  1PFU A;  2RFK B;  1LKM A;  2PYA A;  4A3M L;  3RZT A;  3WWN B;  1SMW A;  2WAQ P;  1B71 A;  4POF A;  4B8C D;  3GTM L;  4RXN A;  4A3E L;  2RDV A;  1SMM A;  2V0F A;  3KYV A;  1PFV A;  4C3H L;  1IU5 A;  3FKI L;  2NVX L;  3H9C A;  4AI1 A;  4K9F A;  4AR4 A;  5MFP A;  4XXB B;  1E8J A;  3PWF A;  2JI2 A;  1BQ9 A;  2DSX A;  1B13 A;  1YK5 A;  4BY7 L;  4BY1 L;  2ERJ A;  5C4J L;  2B63 L;  3LNL A;  2M4V A;  2VUM L;  1DVB A;  3HOZ L;  2E2J L;  5FJ8 L;  4A3J L;  1ODH A;  2AYJ A;  1IU6 A;  1BQ8 A;  2APO B;  1S24 A;  4Y7N L;  2KKD A;  1NXG A;  3PZA A;  4AR6 A;  3GTJ L;  2NYD A;  4U67 1;  4POG A;  1YK4 A;  1B2J A;  3FDJ A;  2Z3Q B;  3QVD A;  2CKA A;  3CQZ L;  1LTL A;  4JAF A;  1T9O A;  2M6O A;  3GTL L;  3H3V M;  2PSM C;  2PVX A;  5MF6 A;  2A6H D;  5DM7 1;  2GMG A;  3A44 A;  1OWC A;  1VZG A;  1CAD A;  1NNQ A;  3GTK L;  1VCX A;  3GTP L;  2LCQ A;  1BFY A;  4YWL A;  3B08 B;  3PIP 1;  1BRF A;  3HOU L;  4A3L L;  1Y1W L;  3K7A L;  2J9U B;  3MPS A;  3J7Z 1;  1VZH A;  2JA6 L;  3PL5 A;  1IW7 D;  5EIN C;  3HOX L;  4BBS L;  1T9Q A;  1RB9 A;  4JAG A;  2JI1 A;  5IY0 A;  3H97 A;  5IYB L;  3I4N L;  2E2I L;  3HOV L;  1PFY A;  3KYX A;  5JVG 1;  5DM6 1;  3H9B A;  3B0A B;  4A93 L;  1R0J A;  2NVT L;  5GAH c;  3HJY B;  3PKI A;  2B5I D;  1QYB A;  4AHX A;  5AI2 A;  3M3Y L;  2AUS B;  3I4M L; 
#chains in the Genus database with same CATH homology
 2YU9 L;  1R9T L;  4BY7 L;  4A3G L;  4BY1 L;  3S2D L;  2R93 L;  3HOY L;  3S1R L;  2E2H L;  1I50 L;  4A3D L;  5C4J L;  2B63 L;  2VUM L;  5C3E L;  3HOZ L;  2E2J L;  5FJ8 L;  4A3J L;  2R7Z L;  3PO3 L;  4C3I L;  1SFO L;  4Y7N L;  1I3Q L;  2R92 L;  3RZD L;  5C4X L;  4C3J L;  4A3I L;  3HKZ P;  1Y1V L;  2WB1 P;  3GTO L;  5C44 L;  5IP7 L;  3GTJ L;  2NVY L;  5IYD L;  3GTQ L;  3M4O L;  1TWA L;  2JA8 L;  3S16 L;  2JA5 L;  5FLM L;  5M3F L;  3CQZ L;  2Y0S P;  3GTL L;  3H3V M;  4A3B L;  4QIW P;  3PO2 L;  1K83 L;  3H0G L;  5M3M L;  1TWH L;  5M5Y L;  4X6A L;  3GTK L;  1TWG L;  5M5W L;  4AYB P;  3GTP L;  1WCM L;  4BBR L;  2NVQ L;  1TWF L;  3S2H L;  3HOW L;  3HOU L;  4A3L L;  3RZO L;  1Y1W L;  3K7A L;  3S1N L;  3S15 L;  3S14 L;  3S17 L;  5M5X L;  2JA6 L;  3HOX L;  4BBS L;  4A3M L;  5IYB L;  3I4N L;  2E2I L;  5IYC L;  3HOV L;  2WAQ P;  4A3F L;  3GTG L;  4Y52 L;  3S1M L;  1I6H L;  4A93 L;  2NVT L;  4C2M 1;  3GTM L;  1TWC L;  4A3E L;  4BXX L;  4A3C L;  4C3H L;  3M3Y L;  5IP9 L;  3FKI L;  2NVX L;  4A3K L;  3I4M L;  2PMZ P;  3S1Q L;  2JA7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...