2WAYA

Structure of the human ddx6 c-terminal domain in complex with an edc3- fdf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
165
structure length
153
Chain Sequence
KGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLDIQAVNVVINFDFPKLAETYLHRIGLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Mutually Exclusive Anchoring of P Body Components Edc3 and Tral to the Dead Box Protein Ddx6/Me31B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT RNA HELICASE DDX6
total genus 57
structure length 153
sequence length 165
chains with identical sequence C
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wayA00
1GITA 3QEJA 4BLQA 4JYCA 1W0JD 2CK3A 4PSVA 1F6BA 3GFTA 3IBGA 4RKEA 1QHSA 3EIQA 3EIHA 3TKLA 1W46A 4LHVA 4V0KA 2PJZA 3B9QA 4IW3B 1II9A 5JCZA 5AJZA 4B3XA 5L3RA 3NHBA 4P4SA 1F2UB 4BFTA 4IXNA 5DIFA 5EP2A 1J70A 2FWRA 2IS2A 1KY2A 3TE6A 4Q9IA 1YRAA 1ELOA 1US8A 1AN0A 4ZI2A 4HB4A 1ZCAA 2ZYTX 4FWIB 4I1VA 4DCTA 3K9NA 4RD6A 5BYKA 5FTLA 4GOKA 3CW2A 2JATA 5EE5B 4PR0A 1ZP6A 3KFXA 3KJIA 3REFA 5IRCD 2QAGC 5JJKA 4OQFA 3UIEA 3UXMA 1CS4C 1DE0A 4HAYA 4JVLA 3ADCA 3F8TA 3Q85A 1LVGA 3CO5A 2ZE5A 1D6JA 4B48A 3MGCA 2JJ1A 3TUZC 1KKLA 2RGNC 3CX6A 3IO5A 1GL9B 4P0TA 2QE7D 1OHHA 1T3HA 2WJGA 3WYGA 4RCZA 3WYAA 3OIVA 4U00A 2VF8A 2FH5B 4Z8YA 4A9AA 1X8KA 2HYDA 3SBDA 1G6HA 2JLUA 3MWLA 1ESMA 1GKYA 3E2IA 4RCYA 4B44A 1G4AE 1LS1A 2P5SA 3UPUA 1E9BA 1Q0UA 2QQEA 5F9HA 4MITA 5F3WB 3BFKA 4B76A 1FX0B 4KYUA 3MUFA 5EUMA 4A6XA 4PPGA 4ZIRB 2B8TA 3Q72A 3WMGA 4W5JA 2QNRA 3ADDA 4PZZA 5CB6A 5FOVA 2IK8A 2B21A 1KAOA 2IYXA 5AJVB 1J90A 1XPUA 3B78A 1ZRHA 1DAGA 4KCGA 1DOAA 3L0IB 4AKHA 4KAXA 1LFDB 3EA5A 3FWYA 4CF7A 2B7CA 3AF3A 1E69A 1TF7A 2JLVA 1OXSC 1JPJA 1GOTA 2BCJQ 3HYRA 3L0PA 4B2LA 2OT3B 4TMKA 3X1YA 4JIMA 1XJQA 3MCAA 1NMYA 3O47A 1GAJA 2GXUA 1XXHB 3T5DA 4E09A 4RZUA 2YZ2A 3LQRA 4QBIA 3L8YA 1G6OA 2B92A 5EE3A 1YZKA 1LY1A 2YOHA 3HYTA 5H1YA 2XTNA 4DKXA 2P5TB 4AYXA 2WM9B 2UZIR 5EJEA 4O2LA 2ZYWX 2X19A 1XEXB 3GLHB 2W6IA 4YMUA 1ZM2A 3BIFA 5G3ZA 3THXA 1IY1A 5A5GA 1RRFA 2IWHA 5C4MA 3T1TA 3W5IA 1IN8A 4HAXA 3AVVA 4HDCA 5LBIA 2QTVB 2JLZA 1G3QA 1LF0A 1XMVA 1VYVA 1QF9A 2FGJA 3ZYCA 3VKGA 2GJ8A 5FOWA 2J0VA 2ONKA 1R0XA 4M0LA 4PC7A 4AY2A 2QRZA 3RS3A 3QPUA 1FPMA 2BBWA 1KK0A 1FP6A 2Z43A 2IS6A 2OG2A 1NVWQ 2V1UA 3U7FB 1Q1BA 4I1SA 4LYHA 2A3RA 2IS4A 5CITA 3ZIAA 2XZLA 3C5CA 2ECKA 1EWRA 5FR2A 1KJZA 1E2LA 3FHOA 1P5ZB 1EFHA 2MMCA 3LD9A 3AVOA 1Q21A 3JZAA 3AUYA 2W2TA 4F92B 4B47A 2FE4A 2F43A 5JLJA 1BYUA 4LPKA 2FG5A 4PO1A 1ZC3A 1KSGA 1NG9A 4KFRA 4A4DA 3R9IA 1Z0IA 4PANA 1OJLA 5AUPB 2Q0HA 1DG1G 2FSIA 4JVSB 3OE7A 4WZ6A 2ZEJA 1MO3A 2BKUA 3AF1A 4C0HA 2IYQA 2WWGA 1W4RA 2RKOA 3GJ0A 2OUKA 1F2TA 3AP1A 1SXJC 4PO8A 5FBVB 3CWZA 3VKHA 3K0SA 1N5JA 3TVTA 4GP6A 4KFTA 2JLYA 1T4GA 1W5SA 5CYPA 5FUYA 3QSYA 2ZAMA 3KFVA 1KDRA 1IJEA 2X2EA 2VHCA 4LRWA 1EESA 3CRRA 1QHIA 4RFSA 1IXZA 3KXIA 1TL7C 3EIEA 2WJIA 3IUYA 2BBOA 4JL6A 1Y63A 4A0HA 1CULC 5J40A 2FPKA 1Z06A 2KJQA 2VQSA 3KXLA 3TQCA 4NYMQ 3RS4A 5L3SA 1X1RA 4OHYA 3L2OB 1GKUB 1NRJB 4TT3D 2V54A 4QBHA 1Q3TA 4TWZA 4CVNA 2QGNA 2HUPA 4OJQA 4UNQA 1S1CA 3C5HA 1G20E 4DLRA 1QHHA 2OCYC 2RGAA 4IOKA 1HY3A 1OH8A 4EQ6B 4TMTA 1VMAA 4XWOA 1NNEA 5FFMA 1KYIA 3HU2A 3C7KA 2IYUA 5JWHA 2CHGA 1UPTA 1WA5A 3TSOA 3U5ZB 3UMSA 2GXAA 4DLSA 1VIAA 3PIRA 1AA9A 2P65A 2ZTSA 4QL3A 1X8LA 1H8HD 3MWYW 3VKWA 1SVLA 5BWMA 1KMHB 2BBSA 1TEXA 4PPFA 5TV2A 2C98A 4M1SA 1WF3A 2GDJA 4D0NA 1E2FA 4KJZA 1Q12A 3A8TA 3VFDA 4DZZA 1T9HA 2HLDA 2R6CA 3QF4B 4HDOB 4TMXA 3I72A 3W6OA 1XTIA 5CLQA 4FXPA 4BQSA 2IF0A 3MD0A 3SI7A 3K9LA 3AF4A 3ZH9B 3NH9A 3C16C 1EFCA 4ZV4A 3QIAA 1RW4A 1AKYA 2ZRAA 4LJ4A 3RS5A 1I4TD 1JECA 1XWIA 1YR7A 4Q4AA 1W0KA 2G0NA 2WPDD 3VR3A 1H65A 4BFWA 4C3ZA 2BM0A 2IXEA 1EK0A 4PQRA 3LVRE 3CX7A 4EFMA 3NKVA 4PZYA 1GFIA 3L8ZA 4KLZA 1P75A 3EPKA 2GKSA 3C14C 1QDEA 2XAUA 2FPLA 4ACBA 3U4QB 2OFOA 2ZROA 2GEVA 2YWEA 1JR3A 4Q48A 3BORA 3EZ7A 2RH5A 2IA5A 4FCVA 1J99A 1E94E 3THYA 3DL0A 4M1MA 2Q3HA 4BFXA 2DWQA 4EKDA 1KJWA 4ZPXA 1JJVA 2VHQA 1LV7A 3EARA 4K8OA 4BWYA 1Q1QA 2YJTD 2OSBA 4MA4A 2CL0X 2V1XA 3UATA 5DLQC 1O87A 2ZYUX 1XD9A 1COWD 4XVRA 2WWYA 2F3TA 3HP1A 4E5UA 4WA7A 1XFAA 3SN6A 5J4YA 2ZI6A 1FL9A 1A82A 2QAJA 2ZI4A 3LXXA 1G3RA 1N0UA 1G8YA 3I8SA 3G5UA 2QPAA 2R6FA 3CPJB 2CCJA 3U6BA 4PTLA 1NF3A 1Q44A 3NBZC 3QBVA 3EPJA 2QT1A 2KSQA 1HUQA 2CE7A 1NKSA 2BVNA 1ZUHA 3SBEA 4Q1DA 3B82A 3BWDD 3P20A 821PA 4MDFA 5CJPA 1NLYA 4TZ6A 2REBA 4URYR 5FI1B 1XD2A 2J7PA 5KYKA 2WPDA 1FP7A 1M74A 2O0KA 1FOEB 3A1SA 2BJVA 4G5GA 3RRZA 1DAFA 2P6RA 4GDFA 1DAMA 1Z6AA 4D2IA 1KI6B 2EYQA 2NPIA 2J0UA 1JQLB 1E2QA 4D0LB 2AHOA 2HJVA 5EP1A 1KO4A 1XEWY 1OFTA 4Q7KA 5D3QA 2H17A 4Q5IA 3U4QA 1LTQA 1OE0A 2C04A 4L4UA 1G4UR 2ZRFA 3KKOA 1E9SA 2QMHA 4AKEA 5H8WA 1XPRA 2LWIA 5DN6A 4CEIA 5JJLA 2G88A 3CR8A 2BWJA 1JR3E 1GDDA 2A5YB 2RAPA 3KQHA 1EWQA 5FL3A 3THYB 2XSZA 5K8IA 2XX3A 1XF9A 5GVRA 4KO8A 3RRMA 1UKEA 2WOOA 4U5XA 3PEVA 2JLXA 1KIMA 2LCFA 2ZRJA 1W7AA 4TTPA 1KAGA 3CRQA 1DO0A 1U0HC 2ZANA 3B60A 4YDSA 1KY3A 4EFLA 4XWKA 2C2HA 2CVFA 4F4JA 5JHHB 4G01B 4JLVA 4LI0A 2J7KA 4PPNA 4RZ2A 1Z29A 4NYIR 3T12A 3KQLA 2ZE6A 3GJ6A 4PQYA 1KI4A 3FYHA 1N5LA 3P4YA 3U44B 1E0SA 1AJEA 1Q1EA 2YHSA 1VHTA 2ANBA 1XB2A 3ASYA 3NBXX 3U3KA 4RD3A 4JMPA 5IHPA 1XMIA 3B1ZA 3LY5A 3ZVRA 2XNDA 2IHBA 3R8CA 2AX4A 2P6UA 2J3EA 4LBVA 4QJ4A 4Q1BA 3CH4B 4MGIR 3A1TA 1E0AA 2EWWA 4IOLA 1J8YF 2GCPA 3RAPR 4DEYA 4N3NA 4RKFA 2C9CA 1D9ZA 2ORIA 3Q5DA 4KVGA 4DCUA 3HU3A 4EFNA 1ZBDA 4NTZA 2VRWA 1OW3B 3LV8A 2J0UB 2VTKA 5G40A 1X8JA 2GK7A 1EX6A 2VA8A 3EC2A 2JJ8A 4DLVA 3BH0A 4C7OB 5C46F 1PVOA 1VCNA 2J5XA 1XU4A 4GMXA 2HF9A 2WBLC 4P4SB 5JRZA 1KHTA 2OBLA 3ZS9A 1G7CA 4TTRA 3T06B 2OCAA 4M21A 3TW4A 1SKYB 3SJAA 1CJMA 1JNYA 4ESHA 1G291 4UXJA 2WZQA 4URZR 2JIZA 1NY6A 2CMKA 2P3SA 2GETA 2ZVQX 5JWOA 2DB3A 1NSTA 4HAWA 4PAOA 3UMRA 3BOSA 3C8UA 3U3MA 4LY6A 3EZ9A 5HR5A 3Q7QA 1M1YE 5H68A 2IEZA 1AZSC 1L8QA 1ZD1A 3KKQA 4HLCA 1VYUA 2ZE7A 1MRNA 4BASA 1VCMA 4LHXA 1FW6A 1YHNA 4CW7A 3SDZA 1D9XA 1YZNA 3ZD6A 2EFEB 1T6NA 3KDSE 5FPTA 1XTKA 2QP4A 4PC6A 1C4OA 1GIAA 1WBBA 2JDIA 1IOZA 1XZQA 2C99A 4FMBB 1F60A 1SVWA 4XIGS 1FUKA 3QPVA 4AYWA 1OV4A 3FHCB 1UADA 4QHTA 3SQWA 4DSUA 4ZO4A 2GWHA 2HV8A 2AK2A 4OL0A 5AUNB 1CRQA 5HTKA 1VDZA 1AK2A 1FX0A 3CNNA 2O0HA 1SVMA 3S1AA 1MH1A 3LDAA 2OZEA 3W6NA 3B5JA 2H5EA 4B75A 2HXSA 1UM8A 1DG3A 1K6MA 3IPYA 2REXB 4FMCB 4HLUA 2UZ3A 5JSZA 1HURA 4LV5B 2VP9A 2F1IA 4TQAA 5GJVC 3V4RA 1PLJA 1EFRD 2EW1A 4JLNA 4EPTA 4PSAA 3LWNA 4PXAA 4JS0A 3T15A 2EQBA 3LW8A 2LKCA 4K81B 5JCPA 1NVVR 2ZS7A 2GEUA 5IK2A 2J1LA 4ARZA 4C0JA 2VHTA 3MG9A 3I62A 2VF7A 3DM9B 1CJKC 2KBEA 2DYKA 4GMDA 1E3MA 4HB0A 1ZNYA 2PH1A 2QT0A 5CYOA 2IBMA 3AVPA 4IXMA 1V5WA 2E1RA 1Z6XA 3TJZA 1U99A 4NCNA 2F55A 3QI2A 1R4AA 5E4FA 5DI9A 5J4VA 3BC1A 3THWB 1H8ED 2ZR7A 1CIPA 3ZZ0A 3I1FA 4D4MA 1G7SA 2FSHA 3MWKA 3VR2A 3P27A 4M9SA 1II8A 1W5TA 4M9XA 2YINC 2B7BA 2R44A 3CM0A 4NCJA 5KSPA 3A36A 3GLIE 2HCBA 5EXXA 3GLGB 3GFPA 4LUCA 3QKRA 3L0OA 1IY2A 2J0QA 2ERYA 1P60A 5JS8A 4FD2A 3TRFA 1ODFA 2N42A 4B3CA 1TU4A 1XTJA 1DO2A 1FNNA 1S3SA 4V03A 4E03A 3M6AA 3S1AB 4TYWA 1M7BA 4JBXA 1GZSA 2IYWA 1P9RA 2OE2A 4B33A 1KNXA 5F2EA 2FEMA 4LZZA 3U2QA 1BIFA 3B1VA 2Q9AA 4BEJA 4XSHA 2DFTA 1FQKA 2BCGY 4A36A 1TQ6A 2G9NA 3EG5A 4RD2A 4B35A 1LS6A 2VP4A 3OAAA 3W9YA 4TLBA 5DSZA 2ZITA 2OFWA 1RJ9B 5AK0A 4ZKEA 3QKSB 3HPQA 2NQ2C 2XB4A 2IT1A 4XD7A 2BM1A 2AD5A 3K0CA 4YQFA 4GP7A 3W3ZB 4BZQA 5DHAA 1TF5A 5E7IA 3B13B 4A8JA 1Z8FA 2GF9A 1Q57A 4AC9A 4DLXA 1R6BX 2BIFA 3AGQA 2UVQA 4GOJA 4JT2A 1JXMA 1NLFA 1KJYA 4JVMA 2RCNA 4HUQB 1E98A 4Q47A 5TMPA 3RHFA 3RS7A 1PUIA 3QBTA 1UBGA 1UJ2A 1P6XA 3EASA 1H8EA 5IT5A 3ONWA 1OLOA 4Q21A 4Y0AA 3LW7A 2O8FB 4HATA 2EVWX 1N6OA 4LJYA 1NJFA 3WRYC 4NH0A 4O3MA 4M53A 1IBRA 4G5OA 1T3SA 3W90A 2GESA 5FTNA 2O8BA 3AKEA 5D3MB 4A0FA 4DT1A 5CM8B 4AWXA 1NY5A 2RHMA 2ZJYA 1FMJA 4UJ3A 1TQ4A 4Z8XA 3K70B 2J87A 4NCIA 3SYNA 2H8KA 4LWZA 3D6TB 4BRWA 1TQ2A 2ZQ5A 1Z0KA 2QROA 2WKQA 3SJBA 5E3HA 4A15A 2QEQA 4AG5A 4JLKA 4B6EA 1Z2AA 3GEIA 3BFVA 4Q9HA 3MAAC 1RIFA 5G3YA 3L43A 3AEZA 4OI1A 2R65A 3I73A 4F4IA 4IOMA 1MV5A 4ESVA 5DNYB 3SFVA 2F1HA 2IUUA 4MRPA 3KUDA 1RC8A 2JIZD 5CIWA 2H92A 1R8SA 2MSCB 3ZZUA 1IJFA 3ADBA 4OI0A 1G5PA 2CL7X 1EG7A 1S2MA 4URVR 4RZXA 4D6PA 2JASA 2W58A 4XVQA 4Q4AB 4IEIA 2ERXA 2XXAB 1NMZA 3AKDA 2R2AA 1U0JA 1SXJB 1DAEA 2AWOA 1DAHA 2ZJAA 4Z1MA 2D2EA 2X8AA 2GVDC 3AKYA 4FCWA 3GP8A 2FU5C 3I8XA 3EPHA 1GL6A 2WWFA 1US8B 4HLDA 4JVNA 3U60B 4Q7JB 3U6KA 4QFMA 1IONA 1G3MA 4WVFA 4ILEA 4NU0A 4KFSA 1FTSA 3QVUA 5CM9C 5JJIA 4P31A 3T1QA 3BK7A 4O25A 5FTMA 2FFHA 2GTPA 3GJ3A 3TBKA 2GCNA 2G1KA 3CZQA 5HE9A 4HUTA 2ZM5A 5EXPA 4MKIA 1XPOA 3D3QA 4GBMA 3GLIA 3JVUA 2VEDA 4LBZA 5JFGA 2WJYA 3WY9A 3FKSD 4IJMA 4A0RA 3W6PA 2AXNA 3AQ4A 3LA6A 3A4MA 2VSXA 3REGA 1GSIA 2QPTA 4OHVA 1MO4A 1GRQA 5CJ2A 1PV4A 3EPLA 1QHYA 2CNWA 1OIVA 4ITRC 1E6CA 5TVKA 1PLLA 2PMDA 1G18A 2CL6X 3GFOA 4DVGA 1IXSB 1OF1A 1QVAA 2Q6TA 3MJRA 4US2R 3GPLA 4M1OA 1UAAA 2OLJA 4XVUA 4IFBA 4JBWA 4PC3A 4PX9A 4QM7A 4IRUB 2Z0MA 4L9WA 4LJ5A 2CJWA 3SNHA 4BRUA 1KI9A 5IDVA 4GPTA 4EUNA 1R5BA 2FFQA 3CB4A 3VX4A 3LRPA 1AZTA 3CNOA 3V4FA 1OH5A 4QGHA 3W3AA 2R6AA 3GJ5A 3Q5EA 4CZ2A 5A0FA 2NG1A 2HEIA 1ZIPA 1ZYUA 2C9OA 4BE7B 1FTNA 1GUAA 4M9ZA 3VHXA 2PJRA 4RZ3A 2XXAA 4GOXA 1Z0DA 1YZGA 1D2EA 2IW3A 3RC8A 4C2UA 1MR3F 1QHNA 4KODA 1JBKA 2EFDB 1GL7A 2CXXA 1EFTA 2AD1A 1TNDA 4NONA 2ZJ8A 4Q9LA 3DEFA 4MRVA 2F1JA 5GJCA 5FI0B 2JLWA 4ZI3A 1ZM4A 2KB0A 4CEIB 2AL7A 5C1BA 3PUZA 2PX3A 3NWJA 3QQ5A 5BN3A 5K8UA 3OFNA 3BFXA 4A2PA 1E79D 1TEVA 3KTAA 4TMZA 3ZVMA 2QG6A 4E22A 3Q9LA 5LD2B 1EXMA 2XOKA 3PV0A 3DHWC 1HT2E 1RZ3A 3TVDA 5KPJA 2QA5A 4MGYR 5FBRB 4TYNA 1Z6YA 2IYZA 3QKUA 3BS4A 2XTMA 5AJWA 4DUGA 1WMSA 1QG2A 3DOFA 2O8DB 1TF2A 3BAFA 3FGNA 2QZ4A 1WQ1R 2GK6A 3ETLA 1RKBA 1E79A 3WP1B 3E1SA 4ASUD 5KU1A 1ZD8A 4EPXA 5B64A 2VYFA 5DYGA 1EGAA 1N6PA 5B58C 2BHRA 4JL5A 2QUZA 2QL6A 4HEJA 4LCBA 4HLUC 1ANKA 2QM7A 1VG9B 2YV5A 2WSSD 2YC2C 4Q00A 2A30A 1E1RD 5HCNA 4NYJR 1WBDA 2ZSFA 2GZHA 2KBFA 1ZC4A 121PA 2O52A 1SULA 2GVZC 3U7HB 5KUTA 3KX2A 3RWOA 1G3IA 1ZU4A 4US1R 2F7SA 3BB1A 3CLVA 2C03A 4DJTA 3D31A 5BN4A 2Z83A 4BPBA 3B1WA 3KB2A 4R98A 3VR1A 1P2UA 4OK3A 1VYTA 1E9RA 1R8QA 3EC1A 1L4UA 1KSFX 3GLFB 1EX7A 4Q18A 3CNLA 3DZDA 1DARA 3HJNA 4Q1EA 5DHFA 3GJ8A 1KNQA 5FR1A 3VR4A 5FPHA 4RVCA 4DSOA 3C41J 4JSYA 3ZGXA 1A4RA 1ZUNB 4L15A 3KQUA 2D62A 4DDVA 3U3JA 3OZXA 4I81A 3K0CC 1KGDA 5EZ6B 1E9AA 4A8JC 4R7ZA 1R5OA 2ZU0C 1R7RA 2DFNA 2NO9A 4RFSB 5LB2A 4Q1FA 2AN9A 1CR0A 3RRYA 2ZRDA 2Q9BA 3OIYA 4B43A 4HAZA 2HT1A 5GVSA 1DVRA 4R9UC 1N6NA 4MYUA 5CK4A 2F3RA 4PAMA 3A6PC 2F6RA 4IDQA 2FFBA 4V0LA 3BJIC 3U3OA 2JLSA 2GZAA 2ZRBA 4LOAA 2ZU6A 5FOXA 5JHGB 2C77A 3UMFA 3WNBA 3IGFA 4CRWB 3THOA 1W36B 1Z5ZA 2IL1A 1UBFA 4RD1A 2NZJA 2QY9A 1W44A 1KK2A 1QG4A 1VCIA 4FMCF 4BECA 2WAXA 4JLBA 2F9LA 4PQFA 3IHLA 1M7GA 1XCPA 4A6PA 1OFIA 3I5XA 2XSZD 2ZUCA 5FTKA 1CLUA 2O5VA 1DEKA 3B1YA 1AKEA 2QP3A 4KU4A 4N1AA 1KMQA 4X8LA 1P7CA 1DBSA 3FDIA 1YR9A 4GFDA 4HSEA 5UKDA 1KO1A 4B3DA 2PX0A 4IDOA 1D5CA 1L7VC 1Z0JA 1HT1E 3QPWA 4EJSA 3K53A 5A4JA 4R2IA 3DPUA 1JR6A 2RB4A 1G5RA 1NVXQ 4MGKR 3CPEA 4Q19A 4C2TA 3MRSA 1KSJA 3NEYA 4L9SA 1UF9A 4C30A 3C4JA 4N0EA 2IUSA 3IIKA 3M4YA 2OCBA 1U90A 3FVQA 1IQPA 3C15C 3KJEA 2ATXA 4LBWA 4NKRA 4BLOA 4C0AC 5JI2E 4JKYA 3WMFA 4QKQA 2XB2A 3AVUA 4PFSA 2H1LA 1DPFA 2SHKA 2ZREA 1R0YA 1ZM9A 3N2EA 4MYTA 2FF7A 5L3QA 4JKIA 4Q01A 2W00A 3V9PA 2IUTA 1EFRA 4G0NA 3GLHA 4QHYA 1Z28A 3B1XA 1S9DA 1E2DA 4Q02A 2PLRA 2HF8A 4V0ME 1RYFA 3AGPA 4KBFA 1S9HA 4C0QC 2A5GA 2KE5A 1GRNA 1NN5A 1Z0FA 3AB3A 1FMLA 3SYKA 5IF9A 2A5DA 2Z5FA 4IVRA 5AUQA 2DPXA 1TUIA 2ZSAA 4ZKDA 2X77A 4YMWA 1I2DA 1WXQA 1UFQA 3AF2A 4US0R 2HLDD 4LJ8A 2CCKA 5FL7A 3M1IA 4POAA 4IDNA 1E96A 1S0UA 4CEJB 4X8HA 4V02A 4O0MA 1CR4A 1VCOA 4V0NA 2RGBA 1II8B 3LXRA 4QOSA 5EXSA 5HZKA 3A1WA 2PT5A 1N6LA 1U94A 3IDQA 2JLQA 2Q3FA 2QSYA 3PUVA 1ZCBA 1Q1ZA 3P1JA 4DRZA 2IYVA 3O8DA 1ZINA 3PFIA 1OFHA 1G9XA 2F43B 4FMDB 1ESNA 3SHWA 5LPNA 4B2IA 2ZJOA 4EJSB 621PA 2GEDA 2ZRPA 3OE7D 4A1FA 2RGDA 4C0SA 3CWQA 1AM4D 1SGWA 1G16A 1E32A 2WIAA 4DIEA 4RD0A 4UJ5A 5C18A 5ELXA 4L5BA 2C9YA 1WRBA 3QG5A 1QHGA 1Z0AA 2PCLA 4EPVA 2OFXA 2GA8A 3FMOB 5CDFE 2ZSEA 2QI9C 4KXFB 3AVYA 1XZPA 2PZFA 1RRGA 3L0SA 2QM8A 1JI0A 3U3RA 3IBYA 4M1KA 5DGXA 5FH9A 2ZI7A 5AR1A 1ZM3A 1W4CA 3K09C 3NH6A 2AWNA 2ZETA 3QJYA 1EFUA 2L0XA 3RRNA 3ADKA 2GAOA 4PAQA 3SE0A 1MO6A 5KSYA 2VP2A 4HUQA 3KB1A 2GAAA 4H1UA 5G41A 1E2KA 1IAQA 1NBMD 2EU8A 4DLUA 4HZIA 4PO9A 3A58B 1E4VA 2AKYA 1IN5A 1P3JA 3SJCA 4EQ6A 2REOA 1W47A 2V3CC 3M0EA 3PEYA 2J46A 4Z51A 4NBSA 3VNVA 1AQUA 2GRJA 4I1UA 4XH9B 5TB5A 4OYHA 2QRNA 5SZJA 2GJ9A 2HDNB 4Q4JB 1F5NA 3T1OA 3LH5A 4G5RA 4LYAA 4MUBA 1UKZA 1CU1A 5D3MA 4YXWD 2NZ8A 2BKEA 2PL3A 2WJJA 1E2NA 1U98A 2EFCB 3EAQA 1GWNA 3K0FA 3EZ6A 1OSNA 2N1BA 4NDZA 4XWAA 1M2OB 2E9SA 4KHZA 3CONA 1XBTA 2IYRA 4HAVA 3TMKA 1W48A 4D4KA 3G82C 3X1DA 2FDCA 4WBSA 221PA 5P21A 2F1RA 2RGXA 2HXYA 2QQ0A 1T0HB 4OJKA 1XXHE 3LO5A 4QM6A 3BE4A 3U7GA 2BJWA 4I1OA 3SOPA 3AF0A 3QXCA 2JAQA 4JLPA 3ZLJA 4Q66C 4W9MC 4M8NE 2H7VA 1YE8A 1ZNXA 3MLEA 1QZXA 4Y0VA 4QNRA 3GQBA 2IYTA 2NTYC 1Z47A 2O0JA 3CX8A 1RRCA 4UXHA 4PHFA 3LQQA 4Z54A 4OBEA 4OQLA 4OQNA 4TTQA 1XRJA 4YC7A 2YVUA 5DN6D 2YWHA 1CJVC 1MKYA 3IILA 3QNUA 3VU9B 4BEBA 2CVHA 2F9MA 1KDPA 1N2CE 4NP6A 1MT0A 1UKVY 4D82A 4DBLC 3VR6A 1UBCA 4JLJA 1Z08A 4NYIQ 1ZVQA 2PZGA 4YMTA 5F9FA 2ODWA 1Q20A 5ANRB 3T61A 5J47A 2XJ9A 1E1RA 4DCSA 4CEHB 4JLMA 4Q7MB 4MDEA 1SVSA 1I4DD 1KK1A 2W83A 1W4AA 3L82B 5SZIA 5DH9A 3WBKA 1QHXA 2WVJA 3R9WA 1NP6A 4D26A 2GF0A 3H2YA 4PC1A 3WHKA 5AUOB 3HR8A 3H86A 2ZI3A 2Z6VA 4TMWA 4OI2A 1W36C 4NYMR 4PHGA 5LD2C 2JJ1D 2AFHE 5KO2A 4P4UA 3SQXA 2OXCA 4NPHA 1V43A 4BLSA 3K1JA 1N6RA 1ZMXA 1GNQA 4OI4A 1N5KA 3RANA 2X2FA 4P32A 1CP2A 5TY0A 2N46A 3GEEA 5HE8A 2GJSA 5EZ5A 1M8PA 1ETUA 3PVSA 4R71A 4DDTA 2FZLA 3I32A 4TYQA 1U8AA 4C4PA 4UQOA 4QNMA 1P4SA 1TPZA 3KKMA 3VHLB 4DHEA 2R9VA 5M04A 4RY2A 3QY0A 2QGZA 1CTQA 3OEED 4YMVA 3CUEF 4QGFA 1TU3A 1XD2B 4ZDJA 1XP8A 1E1QD 2CJWB 2P6NA 1UBEA 4J0QA 3HWSA 5FUXA 2WKPA 3IO3A 4Q7LA 4DC9A 3RS0A 2H18A 2IS1A 4UKDA 4YLGA 5AJYA 4AG6A 1G3UA 5KPDA 4GL2A 5JSZB 1P2VA 2CLSA 3UWOA 4MGZR 4TYPA 4LJAA 2QMOA 2VP5A 2AXPA 2CDNA 1E2JA 5KSOA 4D81A 1GNPA 1R2QA 2ZJ2A 2YYZA 1W1WA 3HR7A 2W6JD 2WWIA 1VHLA 3TNFA 5FBLB 4XTCS 1OH7A 4B73A 3TAHA 2XEXA 1NJGA 1OXXK 1YZQA 4FW9A 2J59A 2WWXA 3UK6A 5KTYA 4NZYA 4OHWA 3ND9A 3H1TA 4A0GA 4BZXA 1AIPA 2J41A 1G8PA 3ZVNA 2JDID 3RABA 5IK2D 2VO1A 5EE0A 2ODBA 2D4HA 2A2ZA 1SVKA 4BZPA 5GJBA 3LX8A 2ODEA 3DKVA 1GRRA 3U44A 4KLNA 4TZ0A 4GI7A 4AKGA 1HQYE 2PCJA 4YONB 3ICEA 4AI6A 3ECCA 1U2RA 2JGNA 2WMOB 2ORWA 4BGDA 4TYYA 1NI3A 4LV6A 4MKFA 1I4LD 1IN6A 3PEUA 2O8CB 1W0KD 3AVTA 1YR8A 2G1JA 3CZPA 4DLZA 4F38A 2MSEB 3AM1A 3K70D 1OT3A 3QKRB 2JCSA 2R6DA 2WJVA 1JAIA 1IN7A 2BC9A 3R7WB 2ZRCA 2NOAA 3UANA 1P72A 3UG6A 1ZNWA 2A5FA 4F4CA 4ZDIA 3GMTA 1S3GA 2O8EB 3KUCA 3IIJA 1M7HA 3AVWA 3WYFA 2G3YA 4MYCA 3RS2A 2WSSA 1VTKA 4W5WA 1Z6TA 2I4IA 2AKAB 3RSOA 1U0LA 4Q03A 1KO8A 3T5GA 2FPMA 3I5YA 1UDXA 3W34A 2OBMA 1A7JA 4AIIA 3GLFA 2YOGA 1Y3AA 2BBTA 2ONJA 3X1XA 3VMFA 5K8TA 1XXHA 4LDJA 4M9QA 2G6BA 2WHXA 4LJ7A 2R8RA 4A8JB 2MSDB 2ZSDA 4N0DA 1AGPA 3AVQA 2ANCA 3Q7PA 2H16A 3FTQA 1ONBA 4IOJA 4C9BA 1MOZA 2BEKA 5E95A 1KO5A 1KDOA 1FFHA 2RGEA 4LYFA 1XEXA 1F3OA 1ZAKA 3IPXA 4JZKA 3THXB 1GP2A 5DYIA 4GSYA 4OK5A 4OHXA 1K5GA 2ZE8A 1NVVQ 2NO7A 1ZIOA 3IEVA 2RGGA 1N0WA 1NN1A 5SZHB 1AQYA 1ZU5A 1CXZA 1HYQA 1PZNA 2GBLA 4G5QA 2W6JA 3K8YA 3AVXA 3NC1C 3PJRA 1WCV1 3BB3A 3T35A 2VPPA 4CYMA 1OKKD 1XJ0A 2QPOA 1DS6A 4DUGD 3B2EA 5EP4A 3EA0A 3SEAA 3SS8A 1L4YA 2DFKB 4EPRA 2V7QA 3A1VA 5L8VA 1YU9A 1KI1A 3RLFA 3KL4A 1W4BA 2ORVA 4EPWA 4Q4HA 3NIBA 721PA 4I99A 1T5IA 5CIQA 5FUVA 3LBIA 3FFBA 3VR5A 5EP3A 4D4JA 5AWFC 1SKQA 3OESA 1WP9A 4U7DA 3N70A 3W8NA 3RNLA 4UNPA 4HZUB 3GJXC 4QRHA 1SXJD 1M34E 2H57A 2UKDA 2R62A 3MMPA 4KV9A 4XTRA 3AUXA 2J45A 3RDPA 3DMDA 3TIFA 1S96A 1JALA 3QXHA 2FGKA 2V55B 4IVQA 1HE8B 3NTUA 3TSWA 5H70A 2RHDA 3WNCA 5JWRA 2ZUBA 4O2RA 4F91B 4WW0A 3SR0A 3B6EA 5G53C 4D80A 2I3BA 4HDQB 3NDBB 2HYIC 2ZYVX 5L3QB 3EXAA 1XD8A 3MSXA 2A78A 4FMDF 5FBQB 1E2PA 1G8GA 3WMEA 4DSTA 2ZS9A 1AS2A 5C4GB 4UXIA 3AP3A 2ZRIA 4BLTA 1D2MA 1T91A 2BMFA 3IQWA 2OCPA 3TUJC 1LF5A 4MQBA 3I61A 4XD7D 3RWMB 3THWA 3RC3A 4FWTA 3GLFE 3BGWA 1G7TA 2HCJB 2D2FA 5LB4A 2IHYA 3U7EB 1KTVA 3GLGE 2XITA 3QKTA 4A82A 1VG1A 3NBYC 4DXAA 3FHTA 2W6ID 4KI0A 4BFVA 2E87A 2Y8EA 1W36D 1A5TA 4GT1A 4CEJA 2WIBA 4FINA 2PBRA 2NO0A 3X2SA 4IDPA 4JLDA 2ZPTX 4OKSA 4TSFD 2C5LA 4B3BA 4ZCLA 4OK6A 1B0UA 421PA 1VECA 4LPSA 4D4LA 5BXQC 2ZS8A 1E2EA 1Z6GA 3NHAA 1KMHA 4LJ9A 3JVVA 3TW8B 4IHQA 4C0KA 2CEAA 2FX3A 4XOIA 1FNMA 1QBKC 4MKGA 1JJ7A 5FOTA 4B74A 4Z1MD 1OXVA 1S1MA 5J4KA 3OF5A 5F98A 3EZFA 3GD7A 4LJ6A 1KI3A 1RJ9A 2PT7A 2PZEA 2QORA 3A1UA 1VG8A 5HKKD 4TMVA 2XNDD 5KDLA 2GXQA 2HT6A 3BB4A 4LBYA 2BV3A 2YOFA 2DBYA 3PXGA 2OO7A 1SHKA 4M1TA 4M2LA 4WAUA 3TR5A 4DLYA 1G41A 3K0EA 1UEIA 2ATVA 4KSBA 3DKPA 4LGMA 4KSCA 1GKIA 4PSKA 4EPYA 3FMFA 3LVQE 1IY0A 3FFAA 1NN3A 3E5HA 3V00A 1J8MF 3FKSA 5SZKB 1N0VC 2QAGA 2GHIA 1E2MA 4RJLA 2WMNB 2NO6A 2O8FA 3QXXA 1HQCA 1OB2A 4LSGA 1XJCA 2GILA 4LK2A 5B30A 3E70C 3H4MA 4IKEA 1P2SA 1SQ5A 5TDHA 1BMFD 2ZIAA 5GADl 4D25A 4HLQB 4TLAA 4WXRA 3KTAB 2YC4C 4R2HA 1CRPA 1YQTA 4HB3A 4DT1B 3QOFA 4QBFA 4X8MA 1NBME 3AV0B 1CEEA 4LC1A 1C9KA 1TMKA 5CK5A 2XOKD 2GCOB 1XDBA 2NO1A 2QP9X 4P4TA 2MMGA 2O8DA 4Q4JA 3SHFA 1E2HA 2AR7A 2Z4SA 1CBUA 1HH4A 2FN4A 5KDDA 3A4NA 4U02A 1XTSA 4DIDA 2QN6A 1COWA 1YRBA 3DDCA 1BKDR 4G3XA 3QF7A 1N6HA 2ZSBA 2Q21A 4B34A 3P4XA 3SC3A 2CK3D 1HTWA 3O8BA 4II7A 4NCHA 5DO9A 1OIWA 2ZUDA 2RMKA 2WSMA 4LHYA 2FOLA 1SHZA 1SVOA 3BRWD 5J5CA 3LNCA 2OAP1 4M1YA 2ZAOA 2GJAA 2WWHA 4XSGA 3G0HA 2V6JA 5FL7D 3SFZA 4EJSC 2IYSA 2CCGA 2CE2X 4RFVA 3W5JA 1OH6A 3W8RA 2D7CA 4NE2A 1SKYE 2ZI5A 4BFSA 1F2TB 2ZRNA 5JI3E 3KQKA 2VP6A 1IXRC 1JQJC 3R9XA 2EFGA 2I1QA 3HPRA 3BH6A 1L2TA 1N6KA 4M4SA 4JSTA 1R0WA 4QC2A 1KZGB 2XZPA 2PEZA 1DADA 3T34A 2C8VA 3TR0A 2QAGB 3EWSA 2QENA 4TL8A 3U61B 4FI3C 4EIWA 4DEXA 4CEHA 1GNRA 3H84A 3PR1A 3K0AA 1G64A 2QE7A 5KNBA 4MUAA 1N25A 3H0KA 3CH5A 1AS3A 4E07A 1OFUX 2PLFA 1JR3D 2Q3MA 3PENA 3DVLA 1ZUIA 1FUUA 4B3FX 2JJ2A 5B57C 4ASUA 1NBMA 4WZBE 1P9WA 1P2TA 4NMMA 2GCOA 4MYHA 1HV8A 2VHUA 2TMKA 2PEYA 2RGCA 5FPKA 2DFLA 3GLHE 3X1WA 1IM2A 3QENA 4RSGA 3KZ1E 1S4QA 8OHMA 3IKJA 5JEEA 3GJ7A 2QSZA 1GG2A 4W7SA 4NCKA 2KWIA 1P9NA 2DWOA 2WJHA 2BDTA 1N6IA 2AFIE 3QE0A 4WIAA 1NIPA 5EE1A 2ZRKA 1N3BA 5JMTA 3OEEA 2ZJZA 4TL9A 4TLDA 3RVBA 2DCUA 5BN5A 3NG1A 1TX4B 1C1YA 2NIPA 2GNOA 1VG0B 3FMIA 3MFYA 3SYLA 4BFZA 3ZVLA 2CHVA 1U81A 4TL7A 1J2JA 5LDDC 1II0A 1U9IA 1R0ZA 4LYJA 3TAUA 4B6FA 4BFUA 4FIDA 3DO6A 2G77B 2XTZA 4P3YA 3F0TA 2YWGA 1FQJA 2CHQA 2VIIA 4HAUA 1JPNA 4M22A 3TGPA 1B23P 1YZUA 1YR6A 3ZS8A 1CR1A 2YNMA 2J9RA 3B85A 4QHSA 3IEUA 4TLCA 2VLIA 3CKLA 4C7OA 4BUJA 2A5JA 4DB4A 2C96A 4ZCMA 2J7PD 3AKCA 1WE2A 1ZM7A 4PC2A 4TLEA 1DTSA 1OIXA 4ERNA 4DSNA 1Z83A 4DLWA 3WHLA 2J0SA 1H8HA 3A37A 2P0EA 4B3GA 4LV8B 3VX3A 3FB4A 1OYWA 4MRRA 2JJ2D 2W0SA 4OQXA 2QU8A 1OYYA 1T0JB 3B7GA 1I2MA 4IVPA 4QGAA 2DHRA 1W2GA 1T8UA 5FOSA 3I3SR 1BMFA 2GBLC 2ZI9A 4JBYA 1G7RA 1XNJA 1BH2A 1GTVA 4LC0A 4QBGB 2ZR9A 3NDPA 2W2XA 1YZTA 3MJHA 4EAQA 3ZIAD 1PLKA 2FNAA 2FV8A 2D7DA 2C78A 4XJXA 3P32A 2WOJA 2BEJA 2HJGA 4OQMA 1ZW6A 2OLKA 3N5CA 3D8BA 5E7MA 1JXOA 3SU8A 4AYTA 3PUYA 4S35A 1BOFA 4PHHA 3LLMA 3KXKA 2O8CA 4RD4A 521PA 3UG7A 5KNDA 3LLUA 2V7QD 2ZRHA 4A2WA 3ZDQA 3DMNA 3FOZA 3LBNA 2G83A 5EUQB 1XMJA 4JJZA 2OV2A 2IXGA 4HB2A 2WKRA 3NEJA 5CDFA 3HU1A 2CBZA 4BLPA 4G5SA 1NMXA 1JAHA 3EZ2A 4S2EA 4TN1A 4Q4LA 1WDTA 4FCTA 4V0OA 5B2ZA 3TQFA 2EFHB 4YMSA 1E9EA 2I1VB 3I4LA 4IFEA 1K8RA 3Q3JB 4KBGA 4HYYA 2ZJBA 1CR2A 1VPLA 3TH5A 3I92A 1U8ZA 1TTTA 4X8OA 1UKYA 1A1VA 2BMJA 4URWR 1G19A 1KKMA 2XNSA 2DR3A 2YWFA 5EQTA 3QXSA 3Q8XB 4KITB 5FPYA 3FKQA 4CGZA 3KQNA 5HKKA 5BQ5A 5J4LA 2LKDA 1OXTA 4OHZA 3UWKA 1N5IA 3KJGA 4W5HA 4ARZB 3OIUA 3D7MA 5BW8A 1G5TA 1YVDA 1KI7A 1TAGA 1DAKA 1MABB 1XCGB 2GXSA 3BXZA 2QTFA 3TUIC 1PUJA 3LFUA 2EYUA 1ZD9A 5FPSA 4DDUA 1UEJA 1S8FA 2Z4RA 2FMXA 4CIDA 2BMEA 4DWJA 3CF6R 1D8TA 1KK3A 5FOUA 2WTUA 1YZLA 2JEOA 3FPAA 4GRAA 1E4YA 4YDHB 4DDWA 1HA3A 2FFAA 1JB1A 5FTJA 3TSZA 1LW7A 2RGNA 3VNUA 3K9GA 1LB1B 3F5FA 3OIWA 4L16A 4TT3A 1T8TA 4CDGA 1J7KA 3GLGA 2WAYA 4PZLA 3KKNA 3CF0A 3ZZTA 1M6NA 1GVNB 1P62B 5JS7A 2IYLD 3PITA 2CNWD 2WICA 2P67A 4C0BA 1G8HA 2D06A 5HPYB 3CRMA 2OILA 1R10A 4Q4HB 2VP0A 3BBPA 5AJXA 1E99A 2ZVPX 3SJZA 2GZDA 1O3YA 1F48A 1RE0A 3NC0C 3K9HA 1E0KA 4ON9A 1AGRA 5JEDA 1WB9A 1FZQA 1NL3A 5DISB 2IYYA 3GCGA 3BH7A 2P2LA 1RYHA 2XZOA 4HZUA 1G8FA 3KKPA 5TARA 3GEHA 3PQCA 4H1VA 4HI0E 1LNZA 2WV9A 4M1WA 1DAIA 3OEHD 4A92A 3QKSA 3VU9A 3EW9A 2X1VA 1OXUA 3BERA 3OFND 2ZXUA 3CPHA 1XMSA 3F3YA 2JLRA 1KZ7B 5JRJA 2IEYA 5L3SB 2OAQ1 5HCIA 3PUWA 3LX5A 3FE2A 5EE9A 1G21E 4GZLA 1MABA 1KSHA 1JEDA 3A4LA 1W0JA 3HDTA 3QVVA 3QXJA 1QHHB 3O8RA 2OXRA 3UKDA 3X1ZA 1UDWA 1P73A 4UNSA 1A2BA 2FSGA 5C2JB 4DB2A 2ODNA 3CIOA 4F7WA 1KI8A 1VKJA 4IDHA 1E9CA 1GILA 1TUEA 1SZPA 2ZRLA 3TK1A 2FEOA 1AS0A 2ZRMA 3N2IA 2BOVA 3P26A 5GJWC 3SZRA 2JA1A 2PMKA 4Q9JA 5KDOA 3CRW1 4LHZA 4B2PA 4C0LA 1GM5A 3O8CA 2XJ4A 4FN5A 2W0MA 4Q9KA 4NL4H 4JLAA 4JL8A 3RYTC 3AH8A 3DZ8A 3QF4A 1NKTA 1XEFA 4QXAA 2B6HA 3T1VA 2NMVA 5KOYA 1A2KC 1K5DA 2VBCA 5KHOC 1NSFA 3IHWA 4EDHA 1W2HA 3OEHA 1MO5A 4ABYA 2OM2A 2D74A 5E7JA 4AURA 4B32A 3PCRB 4QJ5A 4A2QA 1U9IC 1E9FA 4MRNA 3RSLA 1QVRA 2Q9CA 4G1UC 3JZMA 3VQTA 1E9DA 3B9PA 4ACAA 5JECA 4BFYA 2VL7A 2D3WA 3K09A 1Q3HA 2IF2A 3DOEA 2QTHA 4JJKA 3QUSA 2A7QA 1SXJA 1E2GA 3DM5A 4F93B 4P33A 1YJ5A 4QGGA 1PJRA 3KJHA 2OBNA 1RPZA 3OAAD 4AK9A 3WXMA 4LHWA 2VSOA 2G0TA 1XTRA 3CR7A 2VH5R 5JBQA 1CJUC 2ZJ5A 4YXWA 1XX6A 4PPQA 2DWPA 3ZJYA 4WZAE 1BO6A 2OEPA 4TQUS 1NN0A 4KVAA 4JYBA 1OHHD 3GLIB 3QEOA 4JT4A 2FZ4A 3IIMA 3CF2A 3K0FB 3EX7C 1T5LA 2DY1A 1YKSA 1OPXA 3WBJA 1NG1A 2V6IA 6Q21A 3QG1A 1CJTC 4TL6A 3B8HA 5DI3A 4H9GA 4NYJQ 2FSFA 2NGRA 2OESA 4JLOA 4URUR 3GJ4A 1XTQA 5J4HA 1ZNZA 1DELA 4QG7A 3K70C 3ZD7A 2IX3A 1SXJE 3J81k 5L3VA 4TSFA 1Z2CA 3R7WA 3TLXA 1RFLA 1G1MA 1MRSA 2XGJA 4WXPA 5FBWB 5KSZA 2QBYB 4UNRA 1KO7A 1KI6A 4TQ9A 2GJKA 1IHUA 2K5UA 3MWJA 4PHTA 1Z63A 3WNDA 4NHOA 2O8EA 2C95A 1X1SA 1G17A 3CBQA 3AP2A 4L8GA 3LBHA 5CB8A 4MRSA 5BYJA 4Q1CA 4ZCIA 1X86B 1KDTA 4CT5A 5JZVA 1Z07A 2A9KA 3NBFA 4K46A 2IC5A 1IN4A 4KYIB 1F2UA 2V8OA 4MH0R 3VAAA 3ZQJA 3PEWA 1HEIA 2W2VA 2IXFA 3R20A 1E1QA 3PG5A 1E0JA 3EWAA 2B8WA 4I4LA 3LAWA 4QJ3A 3NVAA 4DCVA 3PUXA 4V0MA 1ZJ6A 1D2NA 4WOPA 3VTKA 2FJUA 1BS1A 4KFUA 2FA9A 4ZDWA 3WRXC 2NPFA 2IWRA 1OB5A 4ZDKA 3BD9A 2CLDX 4UNNA 4MKHA 1E2IA 4CT4B 1CF4A 1VIYA 3R8FA 3K0AB 4Q1AA 2VSFA 1NLZA 4AD8A 2YKGA 4B71A 4BLRA 1BYIA 1Z22A 1XEWX 1Z3IX 2QMEA 3OHMA 5DE3A 2O8BB 4AKIA 2ZR0A 2QMUA 4D0GA 1R5NA 1HE1C 1NVUQ 5FUWA 2EWVA 3IQXA 1SVIA 1P61B 2ASEA 1T3LA 3FMPB 3WP0A 2V4ZA 5DI3B 1X6VA 1XCMA 5HZHA 1CKEA 3ZQ6A 2OHFA 1RRPA 4DCNA 4DLTA 5K8LA 2ZRGA 1TQDA 4IEEA 1RVDA 2WWWA 3ICQB 1U8YA 4URXR 1NIJA 4LX0A 5KNCA 3NXSA 1X3SA 5EXTA 2CLCX 2AK3A 2VHJA 3ND8A 2BMDA 1W49A 4GZMA 4ZIRA 5CLLA 3ASZA 2V9PA 2KI5A 2QBYA 1KOFA 1KI2A 1OKKA 2R6GA 3CRVA 4GNKA 1JEEA 1TADA 1Q22A 5TXGA 1QRAA
chains in the Genus database with same CATH superfamily
4Z4GA 1PD0A 2P9CA 5IM5A 1MEOA 1W0JD 3GX1A 5EMHA 4HOYA 2Q5CA 5EPEA 3LOQA 3TKLA 5EJ4A 1LDEA 3GZNB 4FFOA 1W46A 1N8NA 1HWYA 2PJZA 3H4TA 4LQ4A 3B9QA 4V0KA 5COBA 1QGUB 3U09A 4OQDA 2H4WA 2ZBDA 3R0XA 2X4GA 4YMHA 1HTTA 4Z7JA 1H2YA 1TYZA 3V32A 1VPTA 4IQGA 4JY7A 2CBGA 3N2LA 1NQOA 4ZAVA 4ZZ3A 2R751 4ZEMA 4WLNA 2F3QA 1EZZA 2PBZA 5A0VA 1W0CA 3TE6A 5KYUB 2FHSA 3A05A 1YRAA 1IM5A 2FPIA 2QD4A 4BQPA 2HD4A 4FWIB 3OE1A 5B1EA 4RHCA 3IKTA 1OC4A 3K9NA 5BYKA 3U1BA 1I33A 3CEPB 4O4LB 5EE5B 3NTOA 4F2GA 4NU6A 4PR0A 4DG9A 1F8GA 3KFXA 3NW9A 1PR6A 4CLDA 1EP9A 5HIJA 1QX4A 3MELA 1XR3A 2G25A 1AY0A 3C43A 3OEWA 3QFHA 4KQXA 4HAYA 4BVEA 1SC3A 1ZQ1A 3KJFA 3F8TA 3D0RA 1BQEA 3Q85A 4KQWA 4O2BF 1OUMA 3MGCA 1AXRA 2Z5VA 3FUUA 1OMOA 1XCLA 2H0AA 3WSWA 4D02A 4ZC8A 2V0NA 2YICA 1CT9A 1XLTA 4P0TA 3BMCA 3AHJA 3ROXA 4U00A 3WDMA 1K97A 3LTEA 3AR4A 3EUFA 3KEGA 3BA6A 4A9AA 1TJ4A 4KMOA 3SBDA 4CKZA 4QOFA 3FLBA 3MWLA 2VDUE 2CVPA 4ETIA 1GKYA 5FPPA 3E2IA 4RCYA 4B44A 2P5SA 1LS1A 1YO6A 2A4MA 3JRNA 3CSDA 5A3SA 5TS3A 2F62A 3EAGA 4MITA 3GEBA 3MUFA 1BS2A 3GP3A 1V37A 3K20A 3D3KA 1VE6A 4O08A 3WMGA 1D6MA 1SD1A 1AKRA 2O48X 4PAGA 2VWPA 3R0VA 4QBKA 3AY0A 2IK8A 1LDNA 2B21A 3I6BA 3KPUA 3QM1A 5KNDD 4ZARA 4P98A 1J90A 2ABWA 2PFSA 1JHUA 2A94A 3E9ZA 3N07A 4FOTA 4JGIA 1DAGA 2PH7A 4KCGA 2JRLA 4K9PA 3TW8A 4FJ2A 5B3JC 1DKMA 1UIMA 4FB4A 4FC7A 4BKOA 2EL9A 3FWYA 2B7CA 5MHTA 1TF7A 4BBZA 4Q3DA 4X61A 2JLVA 1G55A 1GOTA 1EJ2A 3HYRA 3L0PA 5B5SA 4CODB 2OT3B 3W8EA 2PRJA 3LKBA 3X1YA 5IUJC 1JJAA 2XOXA 2LXNA 2BH9A 2Q1UA 1SHLA 2J33A 3LT2A 4JQOA 1KE1A 1L9XA 4ENRA 1Q2XA 3LBYA 2CF6A 4M99A 4NABA 3ZGYA 4E09A 2RBKA 2VXBA 3FPFA 3L8YA 4HQ0A 4B1FA 3JQ6A 5EE3A 1YZKA 3UQZA 3JR3A 1LY1A 3RAEC 3WIBA 3R40A 2BGRA 4JGGA 3P2YA 2CF5A 3H6HA 1KVQA 5JASA 5EJEA 2B20A 5SYMA 3TLCA 1ADJA 3KXPA 4OJYA 3FYUB 1DQZA 3D5TA 3ICCA 3VJMA 2XTJA 5A5GA 3T1TA 4HGQA 4KQ9A 1IN8A 3VOBA 1OGYA 1VJRA 1BE6A 2ACVA 2D2IA 3H99A 3IX7A 4HDCA 2QTVB 4JITA 5A7HA 3BMCB 4G56A 5KAPA 3BT7A 5K8JB 1IHOA 3EHDA 2FGJA 3DP9A 3P5SA 3SD7A 3ZYCA 1T36B 4UUAA 3ND5A 2ICAA 2C2ZA 4AY2A 2QUJA 2ZIFA 2FZCA 3KYBA 4MCHA 1YIAA 3PEFA 4EY4A 3W79A 1FPMA 2FSSA 1KK0A 1LBQA 1NRWA 4WKCA 5EIOA 4FS8A 3E6AA 5M7EA 2COKA 1AGYA 1C41A 1Y4ZA 2EBWA 3G79A 2X23A 3ZBQA 2AOWA 2G9RA 2F00A 3ZIAA 3C5CA 4Z4FA 1EWRA 1CQIB 5F1OA 3MLBA 1T2VA 4OGFA 2D2VA 4XB1A 1P5ZB 2MMCA 4MQEB 4J75A 3ZCTA 3AVOA 5KVQA 4N41A 1E3QA 3WLHA 3ANXA 2HA2A 2P4UA 4B4OA 3LY7A 4MI9A 4TKUB 1A9XB 3WTBA 1TRKA 3R4VA 3G5MA 3PNMA 1LBSA 2HMUA 2F43A 5JLJA 5B55A 4BNFA 5DW0A 4D8TA 4DIUA 4E1AA 1QU2A 2QLLA 1ZC3A 4PGHA 4BB9A 3EISA 3HADA 1B8PA 3UGTA 3IOMA 4A4DA 1A7UA 3WWYA 5KOHA 2PUFA 4PANA 1OJLA 4N5DA 3HU5A 1UBSB 5FUQA 4WZ6A 1QZZA 2ZEJA 5PNTA 3W2IA 4D0RA 3AF1A 4N0MA 3H2ZA 2RKOA 3MXOA 4KAFA 4UM5A 5TQ2A 3ZI4A 3GJ0A 3ZZNA 3TECE 4CXMA 5DGCA 4QYWA 4B7AA 1X92A 2ORYA 5FBVB 3CWZA 3VKHA 3JY6A 1LX6A 1ODCA 4FYKA 3FCEA 4KFTA 5A03A 5C4IA 4MW5A 2JLYA 4J1QA 3EA4A 1W5SA 4Z0TA 4BVGA 3QSYA 3UOGA 3V7NA 4K88A 1KDRA 5JJCA 3CRRA 4YT8A 3VM6A 3DL4A 1B14A 3FRJA 3GAAA 3EIEA 1B8UA 2BBOA 4IJ5A 1U7OA 1X7WB 2WILA 2C4WA 3IVAA 3S1LA 1Y63A 1T5SA 1CULC 4DV4B 2IH5A 3AG6A 1SPBS 2FPKA 3F46A 3LSYA 1MJGA 1G2QA 4C07A 1U1DA 1U7UA 2P9YA 3IR6A 1X1RA 3Q7RA 1W85B 4GXTA 5JQGB 1GKUB 4OHYA 3DFMA 3V7UA 1Q74A 4QBHA 1AO3A 1Q3TA 2HIGA 5CVDA 1HL3A 2H63A 4LTMA 4UNQA 3C5HA 2HRQA 1T36A 5HQ3A 4CN9A 1VE3A 1FRZA 3LY9A 5GWXA 4BQEA 4JODA 5AH0A 1HC7A 4RY9A 1OH8A 4XWOA 4QAJA 1KYIA 2SKCA 3WGZA 4EKNB 3HU2A 3JRWA 3HCAA 5F1KA 4UZEA 5FHQA 3MOGA 4H60A 5JWHA 4J03A 1WA5A 1Z5PA 3UV3A 2GXAA 3GFFA 3BGIA 1T2EA 1VIAA 4LTNA 1TYBE 2XKJE 4DLSA 2H52A 5BN1A 3PIRA 3L7DA 1AA9A 3OZVA 3K2BA 1UP4A 1M6WA 4Y2TA 1E58A 5CAEA 2XQVA 2OPHA 2WD9A 4RU1A 1EHCA 2ZSKA 5BWMA 1NOKA 1QX3A 4Y6QA 3GRRA 4NXNB 2BBSA 5TV2A 2C98A 5A4FS 4Q9NA 1PS9A 2WIFA 1QMGA 1ZUD1 5JPIA 1K75A 3F47A 1TLTA 1URPA 3VFDA 1T9HA 2HLDA 3HN2A 2R6CA 3HMQA 5C34B 1O4VA 2BDEA 4RL4A 4TMXA 3SZUA 3A6LA 3TFOA 4BQSA 4FXPA 3D2BA 3MD0A 2FMFA 3AF4A 1K89A 3KEMA 4E1BA 2WEKA 4N5NA 1GQ2A 3NH9A 3C16C 4JBGA 4ZV4A 5EIAA 1RW4A 1EVQA 3L1VA 2BL4A 4G4GA 3KYCB 2PXHA 2Z1DA 3IESA 1TXGA 2XGOA 3RH0A 4U7HA 2QSUA 2F8TA 1YR7A 2GPYA 4Q4AA 4XCXA 5LR6A 3CO0S 1NJ6A 4EATA 5JO9A 4NEHB 4EHHA 3LMKA 3OLCX 1GPUA 2BM0A 2IXEA 3MB8A 4PQRA 3LVRE 5FFNA 1YL7A 4LECA 2HHCA 3NKVA 2ZULA 1Z62A 3L8ZA 2HMVA 4KLZA 4ECEA 1P3Y1 1P75A 3B6IA 1C7IA 3N86A 5KQRA 3JYPA 3LKVA 3WLKX 5DBFA 1QDEA 2XAUA 4OA5A 2O2ZA 4ACBA 3DT9A 3N2KA 4WGFA 1BGVA 1EYZA 3HCDA 3QUAA 3GBSA 5L7TA 3AWDA 2FW7A 1K5PA 1Z36A 2X4IA 3P0HA 4U7TB 5CT9A 2IV2X 4DKJA 2YWEA 1P45A 1E6KA 2O3RA 3EEOA 2NV2B 2EHDA 3E7XA 3WAJA 1E94E 5JAMA 3THYA 2QY6A 3HJFA 3DL0A 2I33A 4M1MA 2O3TA 1FRVA 3RSSA 4B0OA 3OX4A 1P39A 2H11A 2P9BA 2F9FA 4MVJH 5CDYA 4J1TA 3QEBZ 2VHQA 1YJ8A 4JXXA 2OECA 2QYTA 4K8OA 5ED0A 2A6PA 2OSBA 4MA4A 3JU3A 1C50A 1QK3A 2H8GA 4H1TA 1I6WA 4I5EA 5AVJA 3CNEA 4J0GA 3GUUA 2QTLA 4XPIB 1XD9A 3F5MA 3MJFA 5A9TA 1QGED 2LV8A 1MJNA 4WA7A 1XFAA 2UUPA 1JFVA 3P9ZA 3TNJA 3PT9A 2FWMX 1J1UA 5CVTA 4WKNA 2DU8A 3C5EA 4E51A 5I4CA 3IJEB 4DUYB 2AX3A 4G84A 3QOXA 3EXFB 1WQ3A 3FNQA 3I8SA 1QFZA 1QKJA 2HBZA 2QPAA 2R6FA 4MQUA 3W7AA 3WL8A 4IH4A 3NBZC 3VC7A 3OE4A 2QT1A 2R2GA 2I7CA 4S1WA 2ZLBA 4FHFA 3CS3A 4INAA 4Q1DA 2DZDA 2P9ZA 2JBAA 3MWFA 2EX1A 3JATA 4QVIA 1NGSA 3BGVA 5DBEX 1BROA 1ZSVA 3C3WA 4URYR 1XKLA 1JPUA 2J7PA 4AX4A 5DZSA 5IEJA 1FP7A 2PKCA 5IANA 1FOEB 3A1SA 2P6RA 1DAFA 1DTWB 3A32A 2CLKB 3OY7A 2BMAA 2CUKA 4LWQA 1PW7A 3LPMA 3BSSA 2EYQA 3ODGA 4IIBA 2QL5A 1QCYA 3SSOA 3JS5A 1U04A 4N48A 4ZKDA 1DT5A 3V8RA 1IVNA 1P1JA 3ND6A 4CLRA 1L7AA 5J1TB 4V1CI 4I55A 4KPGA 1DV2A 1EK2A 3RIMA 1T25A 1LTQA 3KKOA 2ZRFA 1E9SA 4I4CA 5DNVA 3CA8A 1XP5A 2QMQA 3C3EA 3HTXA 3CR8A 4JA2A 2BN4A 4M6WA 3B3QA 2A5YB 1JLLB 2Z58A 4O2AA 1EWQA 4HRXA 3THYB 1Q1GA 1T2AA 1AZWA 2DPYA 4FT4A 2UUCB 5K0LA 5HZMA 5I7EA 2XX3A 3R6TA 1R4NA 1CD5A 1GYQA 1UKEA 2FDXA 4LY0A 1GD1O 3K73O 3O8LA 3I12A 4YDSA 4EFLA 4XWKA 4OO3A 2R4UA 1XMPA 4N18A 1J8QA 1WCXA 2H0QA 2Q3DA 4G01B 4B4VA 4KGXA 1WUJS 4PPNA 1QOZA 1Z29A 3GPIA 3T12A 5JH7A 3SIPA 2A59A 3IPRA 2L69A 3FH0A 1WM1A 2QYSA 4PQYA 1KI4A 2GI4A 4L5CA 5EJAA 2EJCA 4DFDA 2K4MA 3IRUA 3UAOA 4MUMA 3CLRC 4K2HA 5EIBD 4KFCA 4IR7A 3FMVA 4CNQA 2VDMB 4CV1A 4TLLB 4YRRA 3U3KA 3RUAA 1WSDA 2HMAA 1J07A 3RSFA 1IQRA 1SC6A 3WGYA 3SQDA 2YHIA 2P2DA 3UGKA 3R8CA 3C5WP 4PVDA 6YASA 2CN1A 5K0BA 2P6UA 2DTEA 1UC8A 4LBVA 3NYQA 5B3JA 4MPDA 3RFCA 4D4GA 5MDHA 3PUHA 3L4SO 2EWWA 3ND7A 4HWOA 2YMLA 1YBMA 4FQ5A 4FR0A 4I9HA 1IEVA 5JE8A 4N3NA 4DEYA 4RKFA 4Y1GA 4DV7B 2WHYA 3UMYA 4OQZA 1D9ZA 1KETA 2WSLA 3W04A 3HU3A 2J9ZB 1W6UA 3GG9A 4EFNA 2O1XA 3OJCA 4MDYA 4I1PA 4AUMA 2JNWA 3EG9A 3O5AA 1X8JA 2AFIA 2VA8A 1YJAA 2PBLA 4IJWA 2H29A 2PZBA 1L9KA 2RI6A 3EC2A 2D1FA 1OD6A 3HA3A 2IXBA 3LRTA 2VJBA 4K3VA 4NQZA 1FJ2A 2QVZX 3B1FA 2F17A 3H2GA 4CG3A 3R24A 5C46F 1SBZA 4YX9A 4V1CA 5HYVA 1UWLA 4GMXA 1W8DA 3AI7A 5JRZA 3RO7A 4HAIA 4RFLA 3ZS9A 1G7CA 4LMPA 1WD7A 3LCJA 2VSQA 3HP4A 1Z0UA 3Q11A 3TW4A 4M6WB 4EW3A 4KNWA 1G291 3TEJA 2YJ4A 4BNMA 2P3SA 3ZU4A 1I0LA 5KJ1A 3A7DA 2JHPA 4CFZA 3JVEA 2WLSA 1F8XA 3DT6A 4PAOA 3AYXB 4NSNA 3UMRA 3CNQS 1QJ4A 3BOSA 5J9FA 3C8UA 3TIVA 2EJWA 3U3MA 4DA4A 3Q7QA 2O0MA 4GWLA 1M1YE 2WVAA 2D59A 2PYDA 2OQIA 2ISQA 3IALA 3TMYA 3KKQA 1JV2B 1M6VB 3GVXA 1XRPA 2H08A 1VCMA 1Z5VA 3EH1A 4LHXA 4YBZA 5DOVA 5G0UA 1P0CA 1A72A 2A9QA 3DZBA 4CW7A 5LZ4A 1PEKE 1VFPA 2CEKA 1TLLA 2P11A 1LWNA 1ZMTA 4FBGA 1EXDA 3GG2A 2I4NA 4LWOA 3PS9A 3PHCA 1GIAA 2RKBA 2DQKA 2YJZA 4PC6A 4O3FA 4YRDA 4HNVA 2H2GA 2PWPA 1KEZA 2XZTA 2B1RA 2JDIA 3DFUA 2FLVA 3MGBA 1IOZA 1X7HA 4LXYA 1MXFA 4JUIA 4M37A 1FUKA 4AYWA 4IFTA 1NR7A 1Q0RA 3RGWS 1UADA 4AROA 3O1LA 1NM5C 3FCCA 3G0CA 4Y2YA 2NXNA 3ABIA 4Q15A 3BXHA 1J97A 1SKUA 1VDZA 4WEQA 4DRYA 3IXQA 4Q1VA 1QU3A 4DIOA 3C6KA 1P2GA 1FBTA 2CZGA 3F78A 1SVMA 5LCXA 3L8DA 1MH1A 1G4HA 2OZEA 4IG4A 1OLSB 1XLWA 3B5JA 1J6UA 3EG9B 4ZO8A 2H5EA 1QH8B 5DBGA 1ZOSA 1UM8A 5GTDA 5SYAA 1J9ZA 3HJUA 4HLUA 1U3GA 4YFVA 4E31A 3MAJA 3RBXA 1DIOB 2VP9A 2R7KA 1UM9A 2P41A 1PLJA 3A4IA 3L93A 1W1IA 1EFRD 1R5JA 2R1TB 2EW1A 2WMYA 2XR1A 4JLNA 4D99A 4ADSG 2Z3WA 5IH7A 5KQMA 3ZNNA 2EQBA 5FRDA 3LW8A 3RRBA 2VXCA 1RYYA 1NP7A 4CMCA 3H6GA 2GK4A 2ZWPA 1FJGB 1P29A 3L84A 4L02A 3GNQA 4RACA 2PUBA 1PJQA 2VHTA 1CRZA 3MG9A 2OZVA 2VUSA 3ZD8A 5K4GA 3CW9A 1RHQA 1H1DA 1CJKC 1M8KA 3DNPA 3PC7A 1E3MA 4RK4A 4LDQA 1ZNYA 4ZOAA 1MDFA 4EB3A 1EK6A 2IDMA 2QT0A 5CYOA 3AVPA 2YRFA 3NWBA 1D07A 1LKZA 2JK0A 1M66A 1U99A 3LC0A 4JNKA 2F55A 1R4AA 3DPIA 2Y0PA 4HN9A 3ESRA 1TKRA 1J4AA 2VJAA 3QZUA 4H7PA 3ZWBA 5MFPA 4I3FA 2H2DA 3KEFA 4UOZA 3CU5A 3C3JA 3CRNA 4OPMA 1GTRA 3ENQA 1W5TA 4M9XA 2E4ZA 2M98A 1V6SA 3GXOA 4ND8A 2B7BA 4P58A 4CQMA 1OA0A 2R44A 4G23A 2PZJA 2FF5A 3CM0A 1ECJA 5KSPA 4MKXA 2HCBA 4HFNA 5EXXA 1R37A 2CGEA 3N8KA 4KXUA 4UW9A 2Q1TA 3QKRA 3WGJA 4Q7QA 2QVXX 2ZWIA 3MGAA 5JS8A 4CM9A 4CQLA 2N42A 3RBZA 2QJOA 1TU4A 5AKGA 2WJZB 4M9CA 1XTJA 1DO2A 2VF5X 2Q2WA 1T9AA 4KXMA 4DZRA 4TYWA 1ZK2A 4TV9A 4ZPJA 5JVDB 1UIRA 1SQSA 2BUBA 3E61A 1P9RA 3P96A 4N3AA 3PQ5A 5AT1A 4W9NC 5E2BA 4B33A 5E4JA 4EG6A 2ZYSA 3TXYA 4KIWA 1WSBA 4G8CA 5F2EA 3U2QA 3W1WA 4BATA 5I9LA 3T7AA 1PX2A 3CJQA 5JSFA 2G28A 1JZSA 3G2OA 2VYVA 3W8FA 2ACEA 4KDEA 3AG5A 3TTVA 1ZJZA 5PGMA 1FQKA 2BCGY 2P3OA 2Q6LA 1SIUA 4M1ZA 4MV7A 4ZQEA 4RD2A 4A36A 1GQOA 3OAAA 3QLJA 1BXRB 2NVUA 1NMQA 1DOZA 2R1TA 3DEIA 4TLBA 4X3OA 4BVLA 2HSWA 3K2IA 4L72A 1JHPA 1VSBA 2NQ2C 5C7YA 2IT1A 3GRZA 4XD7A 5AKZA 2VRBA 3K0CA 5LUBA 1B93A 2MYTA 4BVHA 4DNXA 5DHAA 3SGLA 4A8JA 3FLEA 1YF3A 2CZQA 4PG7A 3OQPA 4GBED 4DLXA 6REQA 2WZDA 4MVJF 4EB6A 5LDHA 2JFPA 3RSHA 4AY5A 1JBEA 3H9QA 1E98A 3DWEX 5K09A 3RNOA 2Q45A 3WWEA 1PUIA 3L7BA 3AJEA 3ZCXA 4S1OA 1P7PA 1T8RA 2FMHA 1UJ2A 1N0IA 2BUAA 2XTAA 1P1IA 4GEGA 1CRLA 2JFVA 3IUJA 3M8KA 3R6GA 3UEOA 3JV7A 4HATA 5AVRA 2EVWX 1UT8A 2CFTA 4AY4A 2VVTA 4ZEWA 3U9LA 4BP8A 3TB6A 1RQ7A 4MUGA 2GEJA 1RYDA 2JK1A 3AEKB 5IZ4A 3OA0A 4NBLA 1ECGA 4P36A 1NATA 4YAOA 3I1IA 1M8JA 2WG0A 2PS3A 3G5AA 3Q4GA 4HDRB 1HT3A 1O97D 1QIGA 3AKEA 3LS2A 3PIIA 3QMMA 4MLPA 1XZNA 3UA3A 1C1XA 4DT1A 3U4AA 4AWXA 3EGIA 5JZBA 3BWMA 3AL0C 3ET4A 2C8JA 2I6GA 2JIRA 2VEOA 4LOLA 1DI0A 1FMJA 3L0DA 2NT3A 3T9AA 5IDXA 2B8EA 1QC5B 2JHFA 3SYNA 1Z0SA 3D6TB 4LWZA 4OOFA 4WLFA 5EHIA 4BRWA 1J2RA 5BV8A 4BQQA 2ZQ5A 4UQLA 4WXHA 4YRFA 3USES 1FYEA 2NXWA 3TR6A 1QGYA 2CV1A 3P52A 4DUPA 4JLKA 4EAAA 4FYYA 5IKEA 4Q9HA 3C3XA 1U0RA 1O96B 1SOWA 3WLQA 1YC2A 5GGYA 3ZKWA 4G4SP 4DMKA 2R65A 3A6GA 3AOEC 5JMWA 1OZAA 1MV5A 1YOVA 2O8NA 3H2HA 4M8LA 1GFZA 4KR9A 3IOBA 3PFHA 5DNYB 4O4JF 4G86A 5TEWA 3GEDA 3K05A 5ICMA 1VL5A 1YB5A 2ZQYA 2XADA 4XA8A 4B7UA 5I7FA 1Y8ZA 1JA0A 1HDXA 4FN4A 2MSCB 4DV1B 1NVMB 1IJFA 1I14A 2Y2VA 1JP7A 3H83A 2FHPA 2F1OA 4HX9A 3X0DA 5JS1A 1NBEA 4OA8A 4RK0A 4D6PA 1SG6A 3ZWAA 3L9XA 4DMCA 5FLXA 4XVQA 5CCDA 4AN1A 4YAJA 2IEIA 3JARA 1TKAA 2HTFA 4IEIA 4D9MA 1NMZA 3WL6A 3M6LA 3G88A 1JHXA 1EH5A 3RFFA 2H7XA 5C3MA 2FR0A 3P0EA 1SXJB 1DAEA 3CXUA 2ZJAA 3GV0A 4BB5A 3EQ9A 2FU5C 1CUHA 2JAOA 3NHKA 1GL6A 5G4LA 2WWFA 4XJSA 1D4AA 3FGPA 5JNUA 4MVJI 1JU3A 1V7QA 3J81A 2R4TA 5EWMA 2FOXA 4D0SA 3U60B 4Q7JB 3U6KA 4DWOA 2WB2A 4FZ5A 3EQ8A 4NU0A 4DR4B 4KFSA 1QZ3A 5B6JA 4KDRA 1NPYA 1XALA 3IP5A 4F9TA 1H9CA 3A9VA 2DUJA 3BK7A 2Q8QA 5FTMA 4L8VA 4MAFA 5ITWA 1LDGA 3AEKA 5C0OE 1M33A 3A9UA 3CZQA 4IKOA 1AK9A 4NFYA 3DAPA 5EXPA 2P7IA 4I2NA 4GBMA 2ZM5A 4F71A 5IXJA 2O7SA 3JVUA 4LBZA 3DF9A 1R0BA 4IBOA 2H4XA 3FKSD 1JKIA 3Q8WA 1RACA 3TJMA 3W6PA 5ALMA 1JG3A 3A4MA 2R85A 4NAVA 3S5UA 2QPTA 5CJ2A 1RP7A 4BBAA 1UMDB 3C1TA 4CIXA 4U7FA 2CNWA 5TVKA 5KYTA 4UM8B 1L5YA 1G18A 2CL6X 3KM0A 4IV8A 3QYAA 4DVGA 1OF1A 2Q6TA 1VI5A 5HKOA 3GPLA 1SIWA 4P92A 4ZOLB 2PZLA 1AKWA 1KS9A 1EX9A 1TCUA 2XDWA 2EBUA 4QM7A 4G09A 4MPPA 1M73E 3E8XA 5ER9A 2C3MA 4GVXA 4MR7B 4UFNA 1DBIA 2I7DA 4BRUA 2ZYRA 5I9SA 3D7LA 1ZA1A 4S05A 1DBWA 3LRPA 1RRMA 4QGHA 4LZNA 1TDJA 3Q5EA 1BKSB 2XAAA 2NG1A 3A0UA 1ZL0A 4NVRA 3NWOA 5KWEA 2FK8A 3KEQA 4G1EB 4G4SO 3VHXA 3UK1A 5BORA 1LPAB 2BGIA 4FYVA 1KZHA 1SCIA 4OEHA 3ZJ5A 2XXAA 1EM8B 5KQLA 3ILSA 1NF8A 2HRRA 3DE1X 4GW3A 3M5CA 3O2SB 4OQEA 2EFDB 5KVAA 3U17A 1K6JA 2QX8A 1CUEA 1TNDA 4YP5A 2QTAA 3DV9A 4CKEA 3H1BA 4AMBA 2J9FB 2JKZA 4NONA 4PTYA 4X1KA 4MRVA 3U7IA 5FT9A 5HFJA 2R7LA 2B30A 3RQSA 1ZM4A 3N8IA 3NHRA 5CXQA 4CEIB 3FDZA 3PYXA 4FZJA 3LQ2A 3PDIA 2NACA 5BN3A 1FVOA 1UDCA 5K8UA 3G5TA 4AQYB 1TEVA 3FYUA 4TMZA 4EP1A 3P2KA 3VBCA 7REQA 4KJXA 2HJSA 5LD2B 3ZVMA 2DBVO 2XOKA 1JA9A 1EBUA 3PV0A 2L2QA 3DC2A 1NXXA 2QA5A 2QOEA 1JDNA 3L8FA 2VHVA 1DBVO 4MGYR 2F4NA 3QUCA 1OZ0A 1R0KA 4M8KA 3ZY2A 2I4RA 1IZ0A 1I9CA 3D6VA 3O3NB 3NP7A 3L6UA 2VPTA 5CVJA 1E66A 1VP3A 2ENUA 5ALWA 1ISIA 4L9RA 4LE1A 2WLTA 1ODLA 4BX0A 3OJEA 1BKYA 3SZOA 4PS0A 5DASA 3K71B 3WP1B 3E1SA 4ASUD 2P9JA 1RWNA 4ABTA 4YGXB 4REQB 3SVTA 1U2TA 5JALA 5DYGA 4HG2A 1EGAA 1N6PA 2GN2A 1MTOA 4G8BA 4NXMB 3DXZA 4MR7A 1NFQA 2QUZA 3BILA 1FVFA 2C9MA 3C3DA 2EBHX 3WXBA 4GLBA 3T9BA 1VDMA 2YV5A 3QMVA 2WSSD 5K3DA 2A30A 1E1RD 4N8SA 1YIDA 4NYJR 3PKJA 4Q9AA 3ZU2A 1A9XA 2KBFA 1Y3BE 1JVNA 2Z8YA 1RAEA 1WXHA 3GVIA 5IKOA 2O52A 2ZJ4A 3RM3A 3WX0A 5HG0A 4A2CA 4MIOA 5KUTA 3U37A 1TM4E 1MHPA 4QFBA 1ZU4A 2NZVG 3A10A 1KC1A 1KH2A 3CLVA 3IURA 2Y76A 5M3BA 2QMZA 1LNSA 3VR1A 5CEJA 1P2UA 2QLMA 1R8QA 9LDBA 1L4UA 3FNFA 4UAJA 4U8HA 1CRWG 3STXA 1IEXA 5DHFA 1JIUA 1KNQA 1GXSB 4UHJA 5TQ2B 4RVCA 3C41J 4ZT6A 4L15A 1FUEA 3HM9A 1R16A 3ZN2A 4PXYA 3KWMA 4X1KB 4ER5A 4JDPA 3QHPA 3WGNA 2DVMA 3OZXA 2XEDA 4CV3A 1IVSA 1G98A 3K0CC 4A3SA 5KC9A 1E9AA 1P44A 3WLSA 3GLRA 1V25A 2ZU0C 3KJXA 4RBNA 3IBFA 4E6EA 4YUXA 4DV2B 4BC1A 1MOSA 3MHPA 2XIQA 2YWBA 2Q9BA 4HGZA 2FP3A 1YKGA 4Z7NB 1ZOLA 5B3LA 3ZDDA 1T1GA 3U7RA 3IERA 1DVRA 4QDOA 4XIFA 5GVSA 3RVKA 1AQ6A 5DSXA 3HLTA 1FDWA 3ONFA 3T7DA 2F3RA 5JNVA 4IDQA 3KHKA 4GEKA 2QJFA 3BJIC 3TZBA 2M6SA 5COQA 4G85A 3U3OA 4DM7A 4L27A 3ZW8A 4OJTA 4AJIA 4PYQA 2BMWA 4BYMA 4UE6A 1N2GA 3WNBA 3KC2A 4QSHA 2G40A 2YV3A 3T7TA 1XDUA 3AU8A 3AI3A 1WPXA 3Q9SA 1FYDA 1NVGA 2IL1A 2CWWA 4RD1A 5H82A 1W44A 3UOWA 2FK7A 1E8DA 1EVIA 3O1JC 1VCIA 4JB0A 3ZWMA 4BECA 1UBUS 2RHWA 4PQFA 1DEOA 3GDWA 3RV4A 4KQJA 1AXGA 3AEXA 5BUSA 2V5AA 4E5DA 3R5FA 2XSZD 2ZUCA 3FZYA 3B1YA 1W75A 1AKEA 4KU4A 4M54A 2FYTA 2NZWA 2Q9UA 4LGCA 4G8DA 5EL0A 1ZI6A 1YDMA 2C4TA 2QMYA 2ZB2A 4HSEA 5UKDA 5IPFA 3IT1A 1L7VC 3AXSA 4WERA 1Z0JA 1DAOA 4QT4A 2GN8A 1GY8A 3G0IA 4EJSA 2V8BA 1KEPA 2PQMA 2RB4A 3COVA 1Y3FE 3UXYA 3JZFA 3SCZA 2I66A 5A5FA 4L9SA 4X54A 3C4JA 3M9XA 2PIDA 3GPBA 1QJCA 2JPDA 4FK8A 5BWOA 4YR9A 3PDUA 1MB0A 1U90A 1BA2A 3C15C 1WZCA 3HXKA 2Q1WA 2Q2OA 2ATXA 1TM5E 2PGOA 3FSRA 3FB1A 1WKBA 2Q8NA 3QPCA 3VR5D 4BLOA 1NAIA 5JI2E 4JKYA 3AVUA 3DTTA 4LXGA 3BIWA 4PCLA 3IDOA 4HDKA 4OBXA 4QELA 1NVDA 3KLOA 3N2EA 4FXOA 1YOBA 1YR3A 4DSAA 3KRTA 1WKCA 4Q01A 3V8NA 4DTIA 1IXKA 1RMQA 3V9PA 1KJ8A 4RTPA 1EFRA 3L07A 4G0NA 2IDJA 1J8VA 5JD3A 3VR3D 1N36B 3B1XA 3DBRA 2H07A 4I1IA 3UXHA 4P93A 4H35A 3AGPA 3SQNA 1MG5A 2FWNA 1E8MA 3G0DA 2KE5A 4G0PA 4MCJA 4C0QC 3RC7A 4DIMA 4YRNA 2HPZA 1Z0FA 1ZEMA 3UMCA 1FMLA 3SYKA 5F21A 4MWEA 2C4VA 5AUQA 3OTQA 2M6KA 5TEVA 3GDHA 3GAFA 1TYDE 1C7RA 1KMCA 2X77A 2A0WA 1I2DA 2LIPA 3C5VA 4YMWA 2E5FA 1N3LA 5J58A 1MPTA 2AV6A 3AF2A 1C0PA 2HLDD 2EF0A 3M1IA 5AHKA 1S0UA 3BE8A 4LRXA 4K1XA 2WVHA 2LZ0A 1N0HA 1PK7A 1Z5OA 2RGBA 1II8B 3GH3A 4YO8A 4QPNA 3FPEA 5ALYA 5EXSA 3A1WA 2VDWA 5HZKA 4F4FA 1U2DA 2EP7A 3RASA 1SCAA 4O4JA 1C3EA 4JOQA 1Q0TA 1KOJA 3MJDA 5JW6A 1GQQA 1LWOA 2M32A 3H5RA 4DQ0A 2F43B 2PH5A 4AG3A 4F3CA 3A06A 3G5LA 1L4GA 2UYYA 2VATA 2X0JA 4KSYA 3UJNA 4G41A 1SU6A 1KYZA 3NTXA 4PYMA 1LSOA 4YA6A 4C0SA 5JNWA 4BMDA 3NP9A 3H7IA 3DW1X 5ALDA 4CQJA 3O92A 16PKA 3TQQA 2VZLA 1R0LA 1TCVA 4CIAA 4G5HA 1C30A 1I51A 3KZKA 4BLVA 4YRJA 1UAYA 1H2RS 4CMBA 2I2DA 3H05A 4ZVRA 5GIOE 3H2KA 1SOAA 1SPXA 4TTJA 1W19A 1JI0A 2IIPA 2KYRA 2V9CA 4WADA 4EY6A 2AVNA 1EGMB 2VDVE 5ADWA 4EKIA 1FYWA 1ZM3A 1FVHA 4REMA 5BQXA 1NE7A 2NTNA 4ER0A 5EHNA 1YQUA 5A4IS 4ZU1X 1ZH6A 2RC5A 2APJA 1RP1A 4I55B 2GAOA 2GN0A 2OV6A 1EZ1A 1QTRA 2Q5OA 1RPTA 1LQTA 2GOYA 4W8HA 2VP2A 2Z2JA 1L5FA 3ANLA 1FFSA 4HUQA 3KB1A 2FWBA 4ZANA 2HK9A 3I23A 4W5TA 2CVQA 2VAWA 3SSMA 4RV4A 5LZ2A 4XXHA 4BQNA 2IE8A 2W6OA 1IAQA 1NBMD 2IPXA 3DD5A 4YMGA 1XQ9A 1I1HA 1YUBA 4XCVA 2OFFA 2V58A 1HMPA 5E2IA 4AL4A 2XMRA 4UHDA 1W47A 5CNKA 3A1NA 5F5LA 1V8FA 2O07A 2OORC 3M0EA 3I6QA 4Z51A 1IOLA 3BMNA 4BNWA 1KJIA 3U3DA 1X13A 3A11A 3KUXA 3CE9A 1PT6A 2Z6AA 2Q6IA 2YV1A 2V7PA 4NV1A 1NX9A 4BCDA 1AQIA 3T1OA 4G5RA 2C00A 4LYAA 2UZ1B 2X3UA 5CAEB 4P22A 1NURA 5D3MA 3ZE6A 4PX5A 4C08A 4YRBA 2WJJA 4YXWD 3VA7A 2EFCB 4JBNA 4PO3X 3EZ6A 1OSNA 1RABA 2N1BA 5SV2A 3E3MA 2GARA 4XWAA 2E9SA 2GN6A 4KHZA 5FLKA 4UMEA 1SAYA 2IYRA 5JZSA 5L51A 1QTQA 4ZYUA 3G2MA 1MB2A 3G82C 2FDCA 2IPLA 5FLYA 4AJ9A 5KNBH 4GZ5A 5P21A 1MGOA 4DQVA 3LGSA 3D6AA 3LO5A 5DT2A 2UYGA 1A1SA 1QORA 2UUBB 1FU4A 3CMCO 1CY2A 3OPQA 3BL8A 4J4TA 2FN7A 3UT5A 1I3MA 5TPZD 1FFGA 3PXAA 1DV1A 4TMYA 4YP6A 4HNGA 3OQMA 3BJZA 3OLWA 3R1IA 4PFJA 4QNRA 4XR4A 1WB4A 2NTYC 4D3FA 4EBBA 1VCHA 1SUPA 2NU9A 2O0JA 3CX8A 2O2EA 5EVJA 4EGJA 1RRCA 4HEA1 1XN4A 3B6MA 3GFQA 3LQQA 4Z54A 1KFEB 4OQLA 4FC6A 1B6TA 2P0AA 5FYQA 5DN6D 3FPLA 1MKYA 4RQBA 3QVJA 2NU7A 1N2CE 4OHRA 3UJ6A 1MT0A 2X5OA 3EQ7A 3H0EA 1PQUA 1L7NA 1JLRA 3HKEB 4O4IF 5CLGA 1Z08A 2V59A 5HMMA 3SVZA 2ODWA 3AUAA 4BJ6A 2PQ2A 5ANRB 1RC0A 5IVKA 2XVXA 1E1RA 3PKZA 3WL3A 2P1ZA 2WRZA 5JZMA 3WK6A 1I4DD 1KK1A 1PP4A 2W83A 2M1XA 4JXKA 3OCYA 2X9GA 1IBSA 3QI7A 3FR8A 2WVJA 2BY4A 2IPAB 3DD1A 1PWZA 4CKXA 3SC6A 1DRKA 4C2BA 1T9CA 5K6AA 3IR5A 1DQRA 2AJBA 2JKVA 1RHMA 3KZMA 1K88A 1ZHFA 4TMWA 1QK5A 3DVAA 3TFQA 3TLGA 1ACMA 1G0OA 2XH8A 4J1TC 3FGOA 1I5EA 4D9GA 1LDMA 2GZ2A 2JJ1D 3HGMA 4QFDA 5EGNA 1X7YB 2YWRA 1B0AA 2E48A 2OXCA 4PLTA 4PW0A 1JRLA 4OI4A 1N5KA 4P32A 3GA0A 1CP2A 3QBJA 3QVKA 5TY0A 4FLFA 3VJKA 4LVCA 4L78A 4J4BA 5EZ5A 2AOTB 3MTEA 3PVSA 4DDTA 1JFFB 4R6XA 4RK5A 2NYVA 4C4PA 2VT2A 4LQDA 1E1LA 2AHRA 1DOHA 2IY8A 1EA5A 4QNMA 5IM4F 3DNFA 2E1PA 1KRWA 4BO7A 3E3NA 5LQJA 1DIGA 2G8LA 3BTSA 2WAOA 3CUEF 1A71A 4QGFA 3V55A 3WYEA 4IKPA 1JQKA 3DMTC 4U39A 1XP8A 3HUFA 4CMAA 2PV0A 2CJWB 3DLPX 3IKV