2WBUA

Crystal structure of the zinc finger domain of klf4 bound to its target dna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
85
structure length
85
Chain Sequence
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords KRUEPPEL-LIKE FACTOR 4
total genus 26
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbuA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbuA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2wbuA03
2J7JA 2EM9A 2EPUA 3MHSC 1UN6B 1UBDC 2HGHA 2BB8A 2EMLA 2EMIA 5KL7A 1LLMC 2GLIA 4R2AA 2LT7A 2EMBA 2EOHA 1JK1A 2YTGA 1B69A 4R2SA 2EQ1A 1X6HA 2YTIA 2EMKA 1Z1BA 1TF3A 2DGCA 2YSOA 4R2PA 1X6FA 3EPLA 2ENAA 2ENCA 2MDGA 4R2CA 5KL3A 1F2IG 2YTDA 2EM5A 2EM2A 1A1HA 1G2FC 4R2RA 2RPCA 2ELYA 2EOFA 2YTOA 1MEYC 2VRDA 2WCC3 1A1KA 5KL4A 2I13A 2YTEA 2CTDA 2EOMA 2ENHA 2EL6A 2EM4A 4R2DA 2YTNA 1AAYA 2YRMA 2EL4A 2EN7A 3EPJA 2DMIA 5KL2A 2ELZA 2MKDA 1TF6A 2EMAA 2WBTA 4WSGA 4F2JC 1JK2A 2EL5A 2EPCA 1P47A 2EM6A 2YU8A 2R1FA 1A1GA 2EPXA 4M9VC 4R2QA 4F6MA 1WJPA 2EMCA 2YTPA 2EJ4A 1X5WA 2YTQA 2EPRA 2RSIA 2A25A 2YSPA 1A1JA 2EN4A 2EN8A 2EQ3A 2GHFA 2EMHA 2EOSA 2EOQA 1ZU1A 4X9JA 1A1IA 2YU5A 2YRHA 3M99B 2EOZA 2CT1A 3MHHC 1X3CA 2EOYA 2D9HA 2YRKA 5KL6A 2EMZA 2EN6A 2EQ0A 2EPPA 1X6EA 2WBSA 1A1LA 2JPAA 1YUIA 2EOXA 1BB8A 2EM3A 2LVHA 4IS1C 2WBUA 2EM7A 2EMWA 4IJDA 4R2EA 1TN9A 2LV2A 1G2DC 1YSAC 2EOEA 2EN2A 3EPHA 2MKNA 2CSHA 3EPKA 2EM8A 2EM0A 2PRTA 2ADRA 4GZNC 1KJKA 2EORA 2NABA 2JP9A 2DLKA 3UK3C 1DGCA 2EN3A 2LO3A 2EPZA 2DLQA 2YTFA 4FK5C 1ZR9A 2EMFA 1RMDA 2EMYA 2EE8A 5KL5A 4F6NA 1YUJA 2EMGA 2E72A 2EOJA 2EMXA 2EOIA 1NCSA 2EPAA 2YTJA 2M9AA 2EOOA 2EN1A 2DRPA 1A1FA 1BBOA 2LCEA 2EP3A 1ZAAC 3VHTB
chains in the Genus database with same CATH superfamily
1UHZA 2LBSB 4YY3E 4BC7A 3AUZA 2BB8A 3KWRA 4DR1E 1IQOA 4HEIA 4R2AA 2LT7A 2YZTA 1JK1A 2YTGA 2EQ1A 1TF3A 2DGCA 2B7VA 2LJHA 1WXRA 2KHXA 4MLVA 1X6FA 2ENCA 4DR7E 5IV8B 2EM5A 1A1HA 2LTSA 2WZOA 2EOFA 1PKPA 4GKKE 2VRDA 2WCC3 2JOBA 3LLHA 2RTXA 4F54A 2YTEA 4O5GA 2EM4A 2R76A 3DF6A 5AE2A 1QNTA 4LF5E 2EL4A 2ELZA 2JXPA 1AH5A 1XNRE 3IWCA 1YYWA 3F6HA 1GTKA 4WSPA 3J7Yp 4LF4E 2YU8A 2BBGA 1A1GA 2HHHE 2JR1A 3LMLA 1X49A 1L4SA 3HTXA 2YTPA 2RQLA 4M30A 1GQEA 3HPZA 4X66E 1WHQA 3DJWA 2L3JA 3BBGA 2EQ3A 3JTZA 2EOSA 1ZU1A 1A1IA 2YU5A 1GZ6A 3MHHC 1X3CA 1QU6A 4OX9E 2EPPA 2EPNA 5TSEA 1EH6A 1XMQE 2JPAA 4JI6E 2EM3A 2WBUA 2EM7A 2UXCE 4IJDA 2ODRD 1WHNA 1XMOE 2L92A 4K0KE 2EZ6A 4BMJA 2MKNA 2B7TA 3ECRA 2PRTA 4GZNC 2RS7A 1KJKA 2EORA 5CFFE 2JY9A 2DLKA 1DGCA 5A6JA 2EN3A 3JU0A 5AC4A 4TUIA 5KL5A 1YUJA 2EMXA 2KOUA 4DUYE 1NCSA 4DV6E 4JI7E 4WX9A 5LMUE 1X48A 4L5NC 1A1FA 3ADJA 2LCEA 2V86A 4O43A 4LFCE 2F8BA 4X8WA 1PDAA 4KZSA 1YFHA 2K4VA 4JI8E 4LFAE 2EM9A 3EQ1A 3MHSC 4DV4E 2EMIA 2GLIA 1T4OA 4B3RE 1O0WA 4R2SA 3C6MA 4JI1E 4DR3E 2YT4A 1F2IG 4NXNE 1G2FC 4LFBE 2RPCA 2UU9E 2YTOA 4B3SE 3JAMC 3T1YE 5DNYA 4DKKA 2I13A 2N3HA 2DMYA 2EL6A 3IWDA 4R2DA 2YTNA 1AAYA 4B3TE 2YRMA 4P7DA 2V83A 2EN7A 3EPJA 1WRJA 3QG5C 4LF7E 2EMAA 4AQYE 1FJGE 2EL5A 2ZM6E 4DV7E 2UUBE 3ADGA 3T1HE 2EM6A 2R1FA 4L8NA 2V85A 1EH8A 2LJUA 2V89A 4R2QA 2EMCA 5IWAE 4I8OA 4GKJE 2EPRA 3C4BA 5FLXC 3J80C 2EOQA 2GHFA 2B9DA 1T38A 2YRKA 5KL6A 4LF8E 4R03A 1PJTA 4J8ZA 2WBSA 4DR2E 1J26A 1HR0E 1PJQA 2KONA 2FTXB 2FGGA 1YSAC 2EN2A 4B3ME 3ADIA 2NABA 3UK3C 2DSYA 3L00A 2YTFA 4FK5C 2JVAA 1YZ9A 4BHBA 2EOIA 2YTJA 1IMUA 2EN1A 2DRPA 1NEIA 1T4LB 1BBOA 4ZYEA 2CPNA 1J5EE 4NXME 2LTRA 4DUZE 2J7JA 3HQ1A 4ZYHA 2L8TA 1UN6B 1UBDC 2EMLA 5KL7A 1DQ3A 2MC6A 4JI2E 4F9BB 2EOHA 1YYKA 2M7QA 1EKZA 4Q28A 1N34E 4LF6E 4JI4E 2EMKA 4O24A 3RMPA 1SR9A 4R2PA 4DV2E 4WFTA 5BR8E 3EPLA 2MDGA 4M2ZA 2ELYA 2EWLA 4LU9A 1MEYC 5A2QC 2V88A 5KL4A 2L33A 2ENHA 4NZVA 2IHR1 5IXMB 1YPNA 4JV5E 2K7IA 1N3GA 2LE2A 2EPLX 2MKDA 1IBME 2WBTA 4WSGA 2B3TB 4WXCA 4WXDA 3J81C 1JK2A 2EPCA 3BGHA 2Q8UA 4M0VA 4ZYGA 5AASA 3ADLA 4YHHE 3OMLA 4F6MA 1RC7A 2V8QB 1SFEA 1EH7A 1WJPA 2EJ4A 1X5WA 2YTQA 3AV0A 2RSIA 3VK6A 4DR6E 1N33E 2YSPA 4F9CB 1UILA 2EN8A 2UUAE 5LLQA 4X9JA 4GEQB 1PJSA 4BCAA 2EOYA 2D9HA 1ZBTA 2EMZA 5IT9C 2EN6A 2EQ0A 5AE1A 5A6BD 1A1LA 2L2NA 2EOXA 2EPOA 2FV4B 4IS1C 4R2EA 1STUA 3THOB 1TN9A 3KZZA 4RH8A 2YWQA 1G2DC 1XNQE 2EOEA 4BBYA 1N36E 5AC5A 3EPKA 4DV5E 2LRSA 2EM8A 1HNZE 2ADRA 2NUEA 2EPKX 5T6JA 3FIGA 1N32E 2EPZA 3OTOE 3THNA 5A6AA 1ZR9A 2EMFA 2G7HA 1RMDA 2EMYA 1T39A 4BS9A 4F6NA 4BC9A 1YYOA 2EOJA 2E1MA 4TUGA 2M1SA 1FKAE 3K6QA 3C6KA 2HC5A 1T4NA 2LUQA 4P78A 3HXLA 2EOOA 3KZYA 2NUGA 2EP3A 5LMNE 1ZAAC 2N3GA 4RHBB 2L2KB 3ZOQB 2EPUA 4DV3E 2H36X 1IBLE 2HGHA 1LLMC 1KYQA 5A69A 2LUPB 2EMBA 1B69A 4MLQA 2YTIA 1X6HA 1Z1BA 2NUFA 2YSOA 2DB2A 2F4VE 2ENAA 4R2CA 3BIDA 5KL3A 2YTDA 2EM2A 5F3WA 3TQMA 4R2RA 2ODRC 3H09A 3J7AG 1A1KA 2CTDA 2L2MA 2EOMA 1IQSA 2VQEE 2RSMA 2VE7C 5ADZA 3F6GA 4KHPE 5A6BA 5AE3A 4LF9E 2DMIA 5KL2A 1TF6A 2RS6A 4DV0E 4F2JC 4JYAE 2LMZA 2UXDE 2JWOA 1P47A 2V87A 1IBKE 2DIXA 2VF1A 1ZBQA 4DV1E 5A6KA 2EPXA 4M9VC 5LL6R 2MDRA 4NHRA 1BBGA 4WPYA 1HNWE 2N8XA 2A25A 1A1JA 4JI3E 2EN4A 3C4TA 2HJJA 2L3CA 2EMHA 3VYXA 2MC5A 2YRHA 1X47A 3M99B 2EOZA 4DR4E 2CT1A 2EPMX 4ZYDA 4JI5E 3VYYA 4OOGC 2I9IA 2JYAA 2NA2A 1I94E 1X6EA 2VQFE 4LTYA 4X65E 4N4RB 1YUIA 1BB8A 2LVHA 4JI0E 2EMWA 3MSWA 4O4KA 4F9AB 1MGTA 2UUCE 2LV2A 4DR5E 3EPHA 2YPNA 2CSHA 4WYQB 2UXBE 2EM0A 2JP9A 4X64E 2LO3A 2DLQA 3HPSA 4X62E 2JOXA 1RQ0A 3IWBA 3BF2A 2EE8A 2EMGA 2E72A 2GPIA 4HTGA 1DI2A 1HNXE 2L6MA 4Q35B 2EPAA 2E5LE 2M9AA 4R8OA 4BHCA 4DMIA 3P1XA 2M4IA 3VHTB 4KWYA
chains in the Genus database with same CATH topology
2J7JA 2EM9A 2EPUA 3MHSC 1UN6B 1UBDC 2HGHA 2BB8A 2EMLA 2EMIA 5KL7A 1LLMC 2GLIA 4R2AA 2LT7A 2EMBA 2EOHA 1JK1A 2YTGA 1B69A 4R2SA 2EQ1A 1X6HA 2YTIA 2EMKA 1Z1BA 1TF3A 2DGCA 2YSOA 4R2PA 1X6FA 3EPLA 2ENAA 2ENCA 2MDGA 4R2CA 5KL3A 1F2IG 2YTDA 2EM5A 2EM2A 1A1HA 1G2FC 4R2RA 2RPCA 2ELYA 2EOFA 2YTOA 1MEYC 2VRDA 2WCC3 1A1KA 5KL4A 2I13A 2YTEA 2CTDA 2EOMA 2ENHA 2EL6A 2EM4A 4R2DA 2YTNA 1AAYA 2YRMA 2EL4A 2EN7A 3EPJA 2DMIA 5KL2A 2ELZA 2MKDA 1TF6A 2EMAA 2WBTA 4WSGA 4F2JC 1JK2A 2EL5A 2EPCA 1P47A 2EM6A 2YU8A 2R1FA 1A1GA 2EPXA 4M9VC 4R2QA 4F6MA 1WJPA 2EMCA 2YTPA 2EJ4A 1X5WA 2YTQA 2EPRA 2RSIA 2A25A 2YSPA 1A1JA 2EN4A 2EN8A 2EQ3A 2GHFA 2EMHA 2EOSA 2EOQA 1ZU1A 4X9JA 1A1IA 2YU5A 2YRHA 3M99B 2EOZA 2CT1A 3MHHC 1X3CA 2EOYA 2D9HA 2YRKA 5KL6A 2EMZA 2EN6A 2EQ0A 2EPPA 1X6EA 2WBSA 1A1LA 2JPAA 1YUIA 2EOXA 1BB8A 2EM3A 2LVHA 4IS1C 2WBUA 2EM7A 2EMWA 4IJDA 4R2EA 1TN9A 2LV2A 1G2DC 1YSAC 2EOEA 2EN2A 3EPHA 2MKNA 2CSHA 3EPKA 2EM8A 2EM0A 2PRTA 2ADRA 4GZNC 1KJKA 2EORA 2NABA 2JP9A 2DLKA 3UK3C 1DGCA 2EN3A 2LO3A 2EPZA 2DLQA 2YTFA 4FK5C 1ZR9A 2EMFA 1RMDA 2EMYA 2EE8A 5KL5A 4F6NA 1YUJA 2EMGA 2E72A 2EOJA 2EMXA 2EOIA 1NCSA 2EPAA 2YTJA 2M9AA 2EOOA 2EN1A 2DRPA 1A1FA 1BBOA 2LCEA 2EP3A 1ZAAC 3VHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7J A;  2EM9 A;  2EPU A;  3MHS C;  1UN6 B;  1UBD C;  2HGH A;  2BB8 A;  2EML A;  2EMI A;  5KL7 A;  1LLM C;  2GLI A;  4R2A A;  2LT7 A;  2EMB A;  2EOH A;  1JK1 A;  2YTG A;  1B69 A;  4R2S A;  2EQ1 A;  1X6H A;  2YTI A;  2EMK A;  1Z1B A;  1TF3 A;  2DGC A;  2YSO A;  4R2P A;  1X6F A;  3EPL A;  2ENA A;  2ENC A;  2MDG A;  4R2C A;  5KL3 A;  1F2I G;  2YTD A;  2EM5 A;  2EM2 A;  1A1H A;  1G2F C;  4R2R A;  2RPC A;  2ELY A;  2EOF A;  2YTO A;  1MEY C;  2VRD A;  2WCC 3;  1A1K A;  5KL4 A;  2I13 A;  2YTE A;  2CTD A;  2EOM A;  2ENH A;  2EL6 A;  2EM4 A;  4R2D A;  2YTN A;  1AAY A;  2YRM A;  2EL4 A;  2EN7 A;  3EPJ A;  2DMI A;  5KL2 A;  2ELZ A;  2MKD A;  1TF6 A;  2EMA A;  2WBT A;  4WSG A;  4F2J C;  1JK2 A;  2EL5 A;  2EPC A;  1P47 A;  2EM6 A;  2YU8 A;  2R1F A;  1A1G A;  2EPX A;  4M9V C;  4R2Q A;  4F6M A;  1WJP A;  2EMC A;  2YTP A;  2EJ4 A;  1X5W A;  2YTQ A;  2EPR A;  2RSI A;  2A25 A;  2YSP A;  1A1J A;  2EN4 A;  2EN8 A;  2EQ3 A;  2GHF A;  2EMH A;  2EOS A;  2EOQ A;  1ZU1 A;  4X9J A;  1A1I A;  2YU5 A;  2YRH A;  3M99 B;  2EOZ A;  2CT1 A;  3MHH C;  1X3C A;  2EOY A;  2D9H A;  2YRK A;  5KL6 A;  2EMZ A;  2EN6 A;  2EQ0 A;  2EPP A;  1X6E A;  2WBS A;  1A1L A;  2JPA A;  1YUI A;  2EOX A;  1BB8 A;  2EM3 A;  2LVH A;  4IS1 C;  2WBU A;  2EM7 A;  2EMW A;  4IJD A;  4R2E A;  1TN9 A;  2LV2 A;  1G2D C;  1YSA C;  2EOE A;  2EN2 A;  3EPH A;  2MKN A;  2CSH A;  3EPK A;  2EM8 A;  2EM0 A;  2PRT A;  2ADR A;  4GZN C;  1KJK A;  2EOR A;  2NAB A;  2JP9 A;  2DLK A;  3UK3 C;  1DGC A;  2EN3 A;  2LO3 A;  2EPZ A;  2DLQ A;  2YTF A;  4FK5 C;  1ZR9 A;  2EMF A;  1RMD A;  2EMY A;  2EE8 A;  5KL5 A;  4F6N A;  1YUJ A;  2EMG A;  2E72 A;  2EOJ A;  2EMX A;  2EOI A;  1NCS A;  2EPA A;  2YTJ A;  2M9A A;  2EOO A;  2EN1 A;  2DRP A;  1A1F A;  1BBO A;  2LCE A;  2EP3 A;  1ZAA C;  3VHT B; 
#chains in the Genus database with same CATH topology
 1UHZ A;  2LBS B;  4YY3 E;  4BC7 A;  3AUZ A;  2BB8 A;  3KWR A;  4DR1 E;  1IQO A;  4HEI A;  4R2A A;  2LT7 A;  2YZT A;  1JK1 A;  2YTG A;  2EQ1 A;  1TF3 A;  2DGC A;  2B7V A;  2LJH A;  1WXR A;  2KHX A;  4MLV A;  1X6F A;  2ENC A;  4DR7 E;  5IV8 B;  2EM5 A;  1A1H A;  2LTS A;  2WZO A;  2EOF A;  1PKP A;  4GKK E;  2VRD A;  2WCC 3;  2JOB A;  3LLH A;  2RTX A;  4F54 A;  2YTE A;  4O5G A;  2EM4 A;  2R76 A;  3DF6 A;  5AE2 A;  1QNT A;  4LF5 E;  2EL4 A;  2ELZ A;  2JXP A;  1AH5 A;  1XNR E;  3IWC A;  1YYW A;  3F6H A;  1GTK A;  4WSP A;  3J7Y p;  4LF4 E;  2YU8 A;  2BBG A;  1A1G A;  2HHH E;  2JR1 A;  3LML A;  1X49 A;  1L4S A;  3HTX A;  2YTP A;  2RQL A;  4M30 A;  1GQE A;  3HPZ A;  4X66 E;  1WHQ A;  3DJW A;  2L3J A;  3BBG A;  2EQ3 A;  3JTZ A;  2EOS A;  1ZU1 A;  1A1I A;  2YU5 A;  1GZ6 A;  3MHH C;  1X3C A;  1QU6 A;  4OX9 E;  2EPP A;  2EPN A;  5TSE A;  1EH6 A;  1XMQ E;  2JPA A;  4JI6 E;  2EM3 A;  2WBU A;  2EM7 A;  2UXC E;  4IJD A;  2ODR D;  1WHN A;  1XMO E;  2L92 A;  4K0K E;  2EZ6 A;  4BMJ A;  2MKN A;  2B7T A;  3ECR A;  2PRT A;  4GZN C;  2RS7 A;  1KJK A;  2EOR A;  5CFF E;  2JY9 A;  2DLK A;  1DGC A;  5A6J A;  2EN3 A;  3JU0 A;  5AC4 A;  4TUI A;  5KL5 A;  1YUJ A;  2EMX A;  2KOU A;  4DUY E;  1NCS A;  4DV6 E;  4JI7 E;  4WX9 A;  5LMU E;  1X48 A;  4L5N C;  1A1F A;  3ADJ A;  2LCE A;  2V86 A;  4O43 A;  4LFC E;  2F8B A;  4X8W A;  1PDA A;  4KZS A;  1YFH A;  2K4V A;  4JI8 E;  4LFA E;  2EM9 A;  3EQ1 A;  3MHS C;  4DV4 E;  2EMI A;  2GLI A;  1T4O A;  4B3R E;  1O0W A;  4R2S A;  3C6M A;  4JI1 E;  4DR3 E;  2YT4 A;  1F2I G;  4NXN E;  1G2F C;  4LFB E;  2RPC A;  2UU9 E;  2YTO A;  4B3S E;  3JAM C;  3T1Y E;  5DNY A;  4DKK A;  2I13 A;  2N3H A;  2DMY A;  2EL6 A;  3IWD A;  4R2D A;  2YTN A;  1AAY A;  4B3T E;  2YRM A;  4P7D A;  2V83 A;  2EN7 A;  3EPJ A;  1WRJ A;  3QG5 C;  4LF7 E;  2EMA A;  4AQY E;  1FJG E;  2EL5 A;  2ZM6 E;  4DV7 E;  2UUB E;  3ADG A;  3T1H E;  2EM6 A;  2R1F A;  4L8N A;  2V85 A;  1EH8 A;  2LJU A;  2V89 A;  4R2Q A;  2EMC A;  5IWA E;  4I8O A;  4GKJ E;  2EPR A;  3C4B A;  5FLX C;  3J80 C;  2EOQ A;  2GHF A;  2B9D A;  1T38 A;  2YRK A;  5KL6 A;  4LF8 E;  4R03 A;  1PJT A;  4J8Z A;  2WBS A;  4DR2 E;  1J26 A;  1HR0 E;  1PJQ A;  2KON A;  2FTX B;  2FGG A;  1YSA C;  2EN2 A;  4B3M E;  3ADI A;  2NAB A;  3UK3 C;  2DSY A;  3L00 A;  2YTF A;  4FK5 C;  2JVA A;  1YZ9 A;  4BHB A;  2EOI A;  2YTJ A;  1IMU A;  2EN1 A;  2DRP A;  1NEI A;  1T4L B;  1BBO A;  4ZYE A;  2CPN A;  1J5E E;  4NXM E;  2LTR A;  4DUZ E;  2J7J A;  3HQ1 A;  4ZYH A;  2L8T A;  1UN6 B;  1UBD C;  2EML A;  5KL7 A;  1DQ3 A;  2MC6 A;  4JI2 E;  4F9B B;  2EOH A;  1YYK A;  2M7Q A;  1EKZ A;  4Q28 A;  1N34 E;  4LF6 E;  4JI4 E;  2EMK A;  4O24 A;  3RMP A;  1SR9 A;  4R2P A;  4DV2 E;  4WFT A;  5BR8 E;  3EPL A;  2MDG A;  4M2Z A;  2ELY A;  2EWL A;  4LU9 A;  1MEY C;  5A2Q C;  2V88 A;  5KL4 A;  2L33 A;  2ENH A;  4NZV A;  2IHR 1;  5IXM B;  1YPN A;  4JV5 E;  2K7I A;  1N3G A;  2LE2 A;  2EPL X;  2MKD A;  1IBM E;  2WBT A;  4WSG A;  2B3T B;  4WXC A;  4WXD A;  3J81 C;  1JK2 A;  2EPC A;  3BGH A;  2Q8U A;  4M0V A;  4ZYG A;  5AAS A;  3ADL A;  4YHH E;  3OML A;  4F6M A;  1RC7 A;  2V8Q B;  1SFE A;  1EH7 A;  1WJP A;  2EJ4 A;  1X5W A;  2YTQ A;  3AV0 A;  2RSI A;  3VK6 A;  4DR6 E;  1N33 E;  2YSP A;  4F9C B;  1UIL A;  2EN8 A;  2UUA E;  5LLQ A;  4X9J A;  4GEQ B;  1PJS A;  4BCA A;  2EOY A;  2D9H A;  1ZBT A;  2EMZ A;  5IT9 C;  2EN6 A;  2EQ0 A;  5AE1 A;  5A6B D;  1A1L A;  2L2N A;  2EOX A;  2EPO A;  2FV4 B;  4IS1 C;  4R2E A;  1STU A;  3THO B;  1TN9 A;  3KZZ A;  4RH8 A;  2YWQ A;  1G2D C;  1XNQ E;  2EOE A;  4BBY A;  1N36 E;  5AC5 A;  3EPK A;  4DV5 E;  2LRS A;  2EM8 A;  1HNZ E;  2ADR A;  2NUE A;  2EPK X;  5T6J A;  3FIG A;  1N32 E;  2EPZ A;  3OTO E;  3THN A;  5A6A A;  1ZR9 A;  2EMF A;  2G7H A;  1RMD A;  2EMY A;  1T39 A;  4BS9 A;  4F6N A;  4BC9 A;  1YYO A;  2EOJ A;  2E1M A;  4TUG A;  2M1S A;  1FKA E;  3K6Q A;  3C6K A;  2HC5 A;  1T4N A;  2LUQ A;  4P78 A;  3HXL A;  2EOO A;  3KZY A;  2NUG A;  2EP3 A;  5LMN E;  1ZAA C;  2N3G A;  4RHB B;  2L2K B;  3ZOQ B;  2EPU A;  4DV3 E;  2H36 X;  1IBL E;  2HGH A;  1LLM C;  1KYQ A;  5A69 A;  2LUP B;  2EMB A;  1B69 A;  4MLQ A;  2YTI A;  1X6H A;  1Z1B A;  2NUF A;  2YSO A;  2DB2 A;  2F4V E;  2ENA A;  4R2C A;  3BID A;  5KL3 A;  2YTD A;  2EM2 A;  5F3W A;  3TQM A;  4R2R A;  2ODR C;  3H09 A;  3J7A G;  1A1K A;  2CTD A;  2L2M A;  2EOM A;  1IQS A;  2VQE E;  2RSM A;  2VE7 C;  5ADZ A;  3F6G A;  4KHP E;  5A6B A;  5AE3 A;  4LF9 E;  2DMI A;  5KL2 A;  1TF6 A;  2RS6 A;  4DV0 E;  4F2J C;  4JYA E;  2LMZ A;  2UXD E;  2JWO A;  1P47 A;  2V87 A;  1IBK E;  2DIX A;  2VF1 A;  1ZBQ A;  4DV1 E;  5A6K A;  2EPX A;  4M9V C;  5LL6 R;  2MDR A;  4NHR A;  1BBG A;  4WPY A;  1HNW E;  2N8X A;  2A25 A;  1A1J A;  4JI3 E;  2EN4 A;  3C4T A;  2HJJ A;  2L3C A;  2EMH A;  3VYX A;  2MC5 A;  2YRH A;  1X47 A;  3M99 B;  2EOZ A;  4DR4 E;  2CT1 A;  2EPM X;  4ZYD A;  4JI5 E;  3VYY A;  4OOG C;  2I9I A;  2JYA A;  2NA2 A;  1I94 E;  1X6E A;  2VQF E;  4LTY A;  4X65 E;  4N4R B;  1YUI A;  1BB8 A;  2LVH A;  4JI0 E;  2EMW A;  3MSW A;  4O4K A;  4F9A B;  1MGT A;  2UUC E;  2LV2 A;  4DR5 E;  3EPH A;  2YPN A;  2CSH A;  4WYQ B;  2UXB E;  2EM0 A;  2JP9 A;  4X64 E;  2LO3 A;  2DLQ A;  3HPS A;  4X62 E;  2JOX A;  1RQ0 A;  3IWB A;  3BF2 A;  2EE8 A;  2EMG A;  2E72 A;  2GPI A;  4HTG A;  1DI2 A;  1HNX E;  2L6M A;  4Q35 B;  2EPA A;  2E5L E;  2M9A A;  4R8O A;  4BHC A;  4DMI A;  3P1X A;  2M4I A;  3VHT B;  4KWY A; 
#chains in the Genus database with same CATH homology
 2J7J A;  2EM9 A;  2EPU A;  3MHS C;  1UN6 B;  1UBD C;  2HGH A;  2BB8 A;  2EML A;  2EMI A;  5KL7 A;  1LLM C;  2GLI A;  4R2A A;  2LT7 A;  2EMB A;  2EOH A;  1JK1 A;  2YTG A;  1B69 A;  4R2S A;  2EQ1 A;  1X6H A;  2YTI A;  2EMK A;  1Z1B A;  1TF3 A;  2DGC A;  2YSO A;  4R2P A;  1X6F A;  3EPL A;  2ENA A;  2ENC A;  2MDG A;  4R2C A;  5KL3 A;  1F2I G;  2YTD A;  2EM5 A;  2EM2 A;  1A1H A;  1G2F C;  4R2R A;  2RPC A;  2ELY A;  2EOF A;  2YTO A;  1MEY C;  2VRD A;  2WCC 3;  1A1K A;  5KL4 A;  2I13 A;  2YTE A;  2CTD A;  2EOM A;  2ENH A;  2EL6 A;  2EM4 A;  4R2D A;  2YTN A;  1AAY A;  2YRM A;  2EL4 A;  2EN7 A;  3EPJ A;  2DMI A;  5KL2 A;  2ELZ A;  2MKD A;  1TF6 A;  2EMA A;  2WBT A;  4WSG A;  4F2J C;  1JK2 A;  2EL5 A;  2EPC A;  1P47 A;  2EM6 A;  2YU8 A;  2R1F A;  1A1G A;  2EPX A;  4M9V C;  4R2Q A;  4F6M A;  1WJP A;  2EMC A;  2YTP A;  2EJ4 A;  1X5W A;  2YTQ A;  2EPR A;  2RSI A;  2A25 A;  2YSP A;  1A1J A;  2EN4 A;  2EN8 A;  2EQ3 A;  2GHF A;  2EMH A;  2EOS A;  2EOQ A;  1ZU1 A;  4X9J A;  1A1I A;  2YU5 A;  2YRH A;  3M99 B;  2EOZ A;  2CT1 A;  3MHH C;  1X3C A;  2EOY A;  2D9H A;  2YRK A;  5KL6 A;  2EMZ A;  2EN6 A;  2EQ0 A;  2EPP A;  1X6E A;  2WBS A;  1A1L A;  2JPA A;  1YUI A;  2EOX A;  1BB8 A;  2EM3 A;  2LVH A;  4IS1 C;  2WBU A;  2EM7 A;  2EMW A;  4IJD A;  4R2E A;  1TN9 A;  2LV2 A;  1G2D C;  1YSA C;  2EOE A;  2EN2 A;  3EPH A;  2MKN A;  2CSH A;  3EPK A;  2EM8 A;  2EM0 A;  2PRT A;  2ADR A;  4GZN C;  1KJK A;  2EOR A;  2NAB A;  2JP9 A;  2DLK A;  3UK3 C;  1DGC A;  2EN3 A;  2LO3 A;  2EPZ A;  2DLQ A;  2YTF A;  4FK5 C;  1ZR9 A;  2EMF A;  1RMD A;  2EMY A;  2EE8 A;  5KL5 A;  4F6N A;  1YUJ A;  2EMG A;  2E72 A;  2EOJ A;  2EMX A;  2EOI A;  1NCS A;  2EPA A;  2YTJ A;  2M9A A;  2EOO A;  2EN1 A;  2DRP A;  1A1F A;  1BBO A;  2LCE A;  2EP3 A;  1ZAA C;  3VHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...