2WC9A

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
molecule keywords TERMINASE LARGE SUBUNIT
molecule tags Viral protein
source organism Bacillus phage spp1
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wc9A00
4DKWA 2WBNA 2WC9A
chains in the Genus database with same CATH superfamily
3KLGA 3QETA 1VQKN 1KAXA 1JLBA 4YDUC 3DLGA 3MN5A 4CFDA 2VCPA 5AQIA 2P9LB 4O0IA 3OYKA 1QZ5A 2HBLA 5ADXA 3V1OA 3HYFA 3M8PA 2P9IA 3LWLA 3HPHA 1YJ9N 2D0AA 3M5RA 4DQIA 2KTQA 4Q5VA 4JI1K 1TV6A 2E4LA 3G25A 3LALA 5JVHL 1XWLA 3CC7N 4A61A 3DOKA 4KH5A 3D2EA 1RDCA 4HTUA 2ITGA 1SV5A 3PX6A 3SPZA 3KZBA 3FZFA 5FDLA 3HBTA 4CK2A 2O8FA 4B9LA 4FM0A 1HPMA 1WLJA 1E4GT 1RTHA 4DQPA 1LWEA 1JLFA 1E3MA 3UIQA 3SUOA 4FJ9A 3MK6A 4KREA 3K9KA 5CY4A 2DY4A 2P9NB 4CJUA 4EZ9A 2OPSA 3HJFA 3I0SA 3JAMO 2VQFK 3LDOA 1QSYA 4CZEA 2GWKA 1NGDA 2UUBK 1NMDA 2Q97A 4JRQA 4MLEA 4FWOA 3MDQA 2FSJA 3NDKA 1BO5O 4H0OA 5KGWA 3J7YP 1D8YA 2PFUA 2P9LA 2F96A 1ZYQA 3VPZA 3BUZB 2EHGA 4FLYA 3QFPA 3CJ7A 3LM9A 4FOIA 2EX3A 3FFKB 3LP3A 2PYJA 1ZC6A 2HF3A 2G8FA 3SYZA 4ISEA 4CEQA 1S3XA 3A5LC 4FXDA 4BR7A 4JNEA 4CGJA 3TTDA 1NM1A 1BIZA 3K9JA 2HHQA 2I7NA 2HB5A 3O08A 3SUPA 3VEVA 4FPAA 4JK9A 3CCMN 2D0PA 2CH5A 2NRTA 5BRFA 3HO1A 3KLIA 1JCGA 3TI0A 2A41A 4LY7A 4M3WA 3DXKB 1JLGA 4IG0A 4OKKA 4XIUA 4A2AA 3K5NA 4CI6A 4CZJA 3OYHA 4CZMA 1YXQA 4E3SA 3ZSVA 3DLKA 2A42A 3ZCMA 3AA5X 2P9NA 5LMUK 5CR4A 5KGXA 4MDBA 5LJVA 1NJIO 1BU6O 3OYBA 3VGKA 3ENBA 4DHYA 5BPNA 5AQWA 2NUBA 1HNVA 1HKBA 3HSCA 1HQUA 4IFEA 1XC3A 4FLTA 3SQ1A 4PWDA 2E6LA 1GOBA 4DV0K 3QEIA 2VGNA 3IS9A 1JLCA 4MDAA 2CGLA 2XY6A 2GBZA 1QTMA 3O4WA 4KHUA 3KK7A 3NF7A 3A8YA 3MN7A 2HW3A 3KWIA 4NCBA 5EOYA 3JYTA 5K14A 3ZSWA 3ENHA 3QFUA 1LW0A 4GV3A 3EKUA 4X62K 4FWMA 2Z1HA 4LFCK 4DV1K 4DR3K 4H0TB 1DT9A 4BRCA 5J2MA 3L4IA 5GINA 3S41A 3K5LA 3RSEB 3EY1A 1JL1A 2E88A 3LP2A 4F3OA 3H1VX 2BDPA 1RT6A 3AVKA 3QEPA 1D9DA 4B9NA 4E7KA 3W0LA 3HM9A 1VSHA 1W0HA 4CESA 3SZ2A 1N34K 1BI4B 3KIOA 3R8EA 2OANA 1VQPN 1RT1A 2JWKA 2YJFA 3M8RA 1ZBHA 3P31A 4M7XA 3VEZA 3MXJA 1S22A 1NKEA 1YJWN 3ZEUB 1NGGA 3G6EN 3K57A 3SMPA 4AHRA 3GG4A 3R3LA 4CW7B 3O3FA 1B9FA 3U3GA 3NGIA 4FK2A 2YX6A 1KLMA 2FF3B 4CF0A 5KI6A 3QIPA 4M7YA 3CJCA 4K42A 1LW2A 2UUAK 4C8NA 1WOQA 3O1BA 3C95A 4OPJA 4DF8A 4IOXA 3IRXA 5F1XA 4DFPA 3NGZA 3QEVA 3L2VA 4DTOA 3NHGA 3A2FA 3PSIA 4H5RA 1WAFA 2QA4N 3VN5A 4Q0BA 4EIAA 4M63C 3RSEA 4DFMA 4DWIA 4CFAA 4C1NI 3HVRA 1NK5A 3T19A 3DRRA 3J81O 4H5NA 3PIOL 4R5PA 1BI4A 4XH1A 4CEZA 1MWKA 3F9KA 4RG8A 3RRGA 2UU9K 1VHXA 2BGGA 4IBNA 5C2FA 4ID5A 3V81A 3ZEUA 1WUAA 2XHBA 2YHWA 3OYAA 2P9PA 2W41A 4CJ5A 1VAZA 4I9LA 1RDDA 4BREA 4KRFA 1VQ6N 2NLXA 5JS2A 4KTZA 3ENOA 4EHTA 3VETA 4DTRA 4RW7A 3C65A 1NGIA 2GEMA 4M42A 1TKTA 3FR0A 3VQ4A 1RT4A 3TTCA 4IFYA 4KKOA 5AQKA 4QS7A 3E9PA 4B1YB 1S1VA 1QHTA 1U4BA 2O4IA 5F2RA 1QQMA 4CBWA 3ISNC 2BH1A 3AO5A 3L3VA 2WOMA 3EE8A 4PQUA 3AO1A 3V9SA 1U47A 2D5RA 4ID1A 1XHXA 3QDKA 4BG9A 4DTPA 4KHPK 4OLAA 2EWSA 2DPNA 4LSNA 2NRVA 1NK0A 5EVZA 4KHYA 5JMVA 3VTHA 1HJOA 3G4SN 3MAQA 4DV5K 1Q81O 1S6PA 3RR8A 4FK4A 3ZSYA 4QAGA 4BRDA 5BN9A 1O13A 2XO7A 4M41A 4C8MA 4CK3A 3AA4A 1VRUA 4FW1A 1YF5L 5B8HA 4HUEA 4E7JA 4FSVA 4B9MA 3N4QA 4CZIA 4JLHA 3SLCA 4YORA 3OJUA 3AVBA 2ETJA 5HP1A 4WCEL 1QHAA 4EZ6A 1C0MA 1Q82O 2FSNA 4DV6K 5BREA 3VQEA 1GLCG 4DB3A 2R7YA 1NJYA 4KTWA 1XI1A 3E1YA 4BE0A 3A5NC 3M8QA 4C1NK 1WSJA 5FPNA 4MO5A 3VF6A 4FVMA 3VEWA 2YHYA 3ZT2A 4FJMA 3A5MC 2FBXA 5J1EA 5EXWA 4LF5K 4M3YA 2RN2A 1D9FA 5AQYA 3VERA 1SL1A 1ATRA 4JS4A 3CFOA 2AJQA 4FPBA 4IOAL 1GLFO 5HOOA 4W5OA 5I42A 3VQ8A 2X6NA 1LWCA 3LP1A 2KKZA 1TGOA 4E19A 1DEJA 1EETA 5DMRA 5J2NA 1DTQA 1K9MO 3PV8A 3ASMA 3Q7BA 3CXCM 2HHTA 3OYNA 3TWHA 1LWFA 3DLLL 3KLFA 1KCFA 4JKGB 5GAHP 5E26A 4IOCL 3MCPA 3NAEA 1U2VB 2QW9A 3FZHA 3H3OB 2O8BB 1S1XA 2P5GA 5AQSA 3SAFA 1WNSA 1L3TA 2W6KA 1EO1A 3FLCO 2BUPA 2W6LA 1CZBA 1S1TA 2ASPA 4B08A 1S1WA 1L5UA 2QK9A 2F4VK 3ID6A 3M3ZA 2E1YA 1EP4A 4ILJA 1DGKN 4JN4A 2E2OA 3DLEA 5BRHA 4N41A 4LF9K 5AJ3K 1VSLA 2QXFA 4KH4A 4WQ5A 4DU1A 3VOVA 4H5WA 5BN8A 4X65K 4DQRA 2HHSA 3TU5A 1NU0A 4O55A 3OTOK 2B4JA 3LL3A 1OH5A 4IDHA 5AQVA 2PAVA 4WFNL 4IO8A 2IVNA 4FL9A 4CJQA 1TVRA 3V9WA 4CD3A 4CGDA 1RDWX 4B3RK 4BGAA 3MCAB 3PX4A 4E7IA 4DF4A 4YNQA 4DTSA 2HOEA 3V4IA 3WXMB 1BHLA 1Q7YO 3U9ZA 4DR2K 5F0XA 3ID8A 5D3GA 1KAYA 2VG5A 5M1KA 1TKXA 1IBMK 4Z4HA 2XRIA 4O8KA 2GTDA 4FW2A 4JKGA 2OPPA 3TSPA 1X9JA 3CC2N 1WBDA 1U2VA 4KHWA 2E5LK 3VENA 2O8BA 2OYQA 4KI4A 2E1ZA 3D7EO 3AV9A 4CGFA 4HVJA 4IEIA 4FJ7A 4KO0A 5CE3A 3C6AA 4AILC 1NGHA 5GIOA 4WYBA 1WBBA 4C8OA 2Z1JA 3C0BA 5GAGP 4BRMA 4CK1A 1SZ2A 1SKRA 3BP8A 1L3SA 5FLXO 5J2QA 4ZTJA 2Q0UA 1T6DA 3FFIA 2GX9A 3CJBA 3SBGA 3VQQA 1SKWA 3P4IA 2ZWHA 5DM6L 5BRDA 4CFBA 1RDUA 5JLHA 4QCLA 1REVA 4FWLA 2QKBA 4PKIA 2ZQBA 4NYFA 4IZ9A 2P9IB 5C0YA 5SWMA 5BR9A 1XC9A 2KFZA 4CF8A 3ZSZA 3J7AP 2D4WA 4DUYK 4XH4A 1ZXOA 2IC3A 3HM8A 3C6UA 3NH2A 3NMUA 3CG7A 1C1AA 3CCVN 1XQSC 1IKVA 4X64K 2V7YA 3DMJA 3AVLA 3ALYA 4XEIA 1NOZA 4W5QA 4TSXA 3TSQA 5KPRA 1T7PA 1NJXA 4GV9A 1HNXK 3ZT1A 1NGEA 2NRWA 3CQXA 1J5OA 3TTFA 1EQYA 4BGBA 3LWMA 5AQLA 1BDGA 3C6TA 1TYQA 1XNRK 2O8EA 1GOCA 3TANA 3RWUA 1RBTA 2D0BA 4BC3A 4KB1A 2NRRA 4BRPA 3RMDA 1Z26A 2KZZA 1KRPA 3NH1A 1ZBIA 3B6OA 4ELTA 5HRPA 1WSEA 4IO9L 3GBTA 4WQ5C 4CBUA 1KXPA 3ULEB 5I9EB 5JS1A 4YOYA 4GKKK 4NCAA 3NVKA 2Y1JA 2VG7A 4BWMA 2FC0A 4BY9C 4BVPA 4KBOA 5LY3A 1QS4A 4JKFA 5CYMA 2P1JA 4DSFA 1W7AA 4H0PA 3V1QA 1QQNA 2Q0RA 2FXUA 5AQNA 1XMOK 1J5EK 5IT9O 3NE6A 1JL2A 1G15A 2O8CB 3E66A 2YKMA 1MA9B 3QBWA 3C94A 3WQTA 4HUFA 4DU3A 1IBLK 1C0FA 1C0UA 4F9OA 3IMXA 1N8RO 3MN6A 2HNYA 4LC9B 3OYLA 1HYVA 1SUQA 5CZ2A 1TUYA 3IFRA 1GLBG 4LF4K 5AQOA 2D1KA 1R0AA 2ZJQL 4DUZK 4JI0K 3F73A 1U49A 4AHUA 4B9TA 3H6EA 3ULEA 1BWFO 2IVPA 5BR8K 1RDBA 4KFBA 4DKWA 2E6MA 3CHWA 3CCJN 3OA9A 4A5BA 2BANA 5IWAK 4EP4A 2V7ZA 3QMLA 1JXEA 1TL1A 2HHWA 3SAHA 1HYSA 3R1XA 1HNIA 1NGJA 2X6SA 4FLUA 2D0OA 1U45A 1W2BM 4FJNA 1VSFA 1N33K 2O8CA 3HI0A 4B9VA 1C0TA 2OPQA 5AQUA 1RTDA 3O80A 5HRSA 4DV4K 2UYTA 1NOYA 2WBNA 3LP0A 2YHAA 4FOEA 3MN9A 4DFKA 3QNNA 4F4KA 4L3QA 3CC4N 4BACA 2NZTA 4H0VB 4WFAL 1D5AA 3G10A 3SV3A 3RRHA 4K8ZA 1UAXA 1TL3A 4ISFA 1X9MA 3WXKA 3CJ9A 2HSTA 3AO3A 4LF8K 4BDYA 4E1JA 1BGXT 4YOWA 4HTLA 3ZT3A 4GNIA 2KLAA 2HF4A 3SQ4A 4BVOA 1RBRA 2Q36A 1ZBLA 4KAZA 3U6FA 4YY3K 4CGGA 2HMIA 1UOCA 3ZSRA 4H5TA 3P5JA 5A2QO 3VMFB 4IEEA 3WNEA 1K73O 1EX4A 5C24A 3L2WA 3MXIA 3ATUA 4PHTX 4KHSA 2HHVA 3KK3A 2NRXA 5C10A 4MLHA 3BEXA 4EFHA 1V4SA 5CYQA 4JKCA 3B8AX 3CERA 1U6ZA 2P9SA 3H1QA 4XH5A 4Z94A 4CJ3A 4FJHA 1S5JA 4LH5A 3PY8A 3TABA 4DTMA 3DYAA 4WQ4A 3UKUA 3DWLA 3AVIA 2QWMA 3ZT0A 3O9QA 3IDHA 4OGCA 3SPYA 4I2PA 1IG8A 4MQ3A 3AA3A 1SS6A 2P9PB 2F9TA 2WFBA 4NB4A 4CJWA 1TK0A 4W5NA 1RT7A 3M8SA 2Z1IA 3TAMA 3AO2A 3CFRA 3UB5A 3T69A 4DR6K 3E9OA 3AY9A 4BRKA 3H3NO 4CEAA 4JI2K 3T7ZA 3TAEA 5KRSA 1X3NA 3HSTB 1RTJA 3VQDA 4NXNK 5C42A 4FJ8A 4K43A 1W9HA 3EZ5A 4DTUA 1MU2A 4M3ZA 3CPEA 5JLFA 4WF9L 4CJLA 4CZGA 4AHTA 1WAJA 3R6MA 1S9EA 4CF1A 3SI6A 3S3OA 4M45A 3U3YA 2UXBK 4F8RA 3D45A 5H1SQ 4CEFA 4Z4GA 1Q86O 3HVTA 3I33A 3CM5A 3EZWA 4FM1A 3SV4A 3CMAN 3AVNA 3AVCA 3A5OC 4JKHA 4A59A 3WXIA 4GV6A 5CZ1A 4B3OA 5KPZA 3HRGA 2YKNA 3VGLA 2QM1A 1FXXA 3VQ7A 4O5BA 4L8RB 4BDPA 2G8KA 3U9DA 1QE1A 2YV0X 1G99A 4FJXA 3I0RA 4YHHK 4IG3A 2ZE2A 4GW6A 4GMJB 3T1HK 1VSMA 5KQDA 3KJVA 3TPQA 2A6AA 4LD0A 1A5XA 1X1PA 4DTJA 3T1YK 3I8BA 4OLBA 4CJPA 4QOZB 3O9RA 4DQQA 3EE9A 3KHYA 2KHOA 4H5VA 5EY4A 3ZLJA 1T05A 4KPYA 4PKHA 3SBTA 3CD6N 3SJJA 2ZGZA 3LDLA 3OVNA 3RMAA 3OY9A 3V1RA 3JS6A 1KTQA 1SQKA 3T3FA 3VQPA 5HRNA 1GLJO 1CZAN 4NLCA 1VQON 3VA3A 3RR7A 3F9MA 4NCGA 4CECA 4OKEA 4Z4EA 1MDUB 1IKXA 4WQ4C 4HHTA 3KK2A 3DLHA 4OGEA 2QWNA 4AHCA 4JKAA 1U04A 5FPDA 3E01A 2D0CA 3DLBA 3ZSQA 1JLQA 5LJWA 4BR5A 1RFQA 2FLOA 1P90A 4FM2A 2QKKA 1NGBA 1FKOA 3HOSA 5AZJB 4CIEA 5AQGA 4EAHD 3THYB 3L6QA 2V51B 1TAQA 1J9AA 3KKRA 3V9UA 2KQ2A 3HPOA 5SZTA 3LDSA 4DQ8A 3ZETB 2A3ZA 1I94K 3VA0A 4DG1A 1WSFA 2O4GA 1ASVA 2HBJA 4E1MA 1GLAG 2JWLA 2QWLA 3B6PA 3QNOA 4JI3K 2E8AA 4M3UA 3NF6A 5AQRA 3GE1A 4CFCA 1VSKA 3AGKA 3KD1E 3KWGA 1O1WA 4HWIA 4JAXA 3HT3A 3TAQA 3CYMA 3EKSA 4DFJA 4CJTA 3MX5A 2VG6A 1OVQA 4CZKA 2OZSA 3AGRA 1SAZA 3S9HA 4U7BA 1J54A 3P83D 4BR0A 5C12A 5AZIB 4QS9A 3K5OA 4K41A 3HOTA 3SNNA 3DRPA 3KTQA 1VSIA 3WNFA 1NLVA 2B6AA 1CLQA 4DV7K 4UQGA 2YHXA 1B92A 1GLEG 2Q1NA 2KZMA 1NJWA 5FROA 4H4MA 5AZJA 4HUGA 3FE1A 2P5OA 4CHOA 3THYA 3FZMA 1VSEA 3K58A 4M3TA 1IKWA 1RT2A 3PSFA 1YVUA 3MX2A 1KAZA 1CZ9A 1VQ5N 4RW4A 4EHUA 1F21A 5CHIA 5HBMA 3ZETA 1FW6A 3NGYA 3NH0A 3HK2A 3NF8A 3THVA 3JSMA 4CJRA 3AVJA 4DLEA 4J2DA 3OS2A 4O4GA 1HNWK 3H45C 4N47A 2HMPA 3CJ1A 1GLDG 3I55N 1S1UA 3I8DA 1JLEA 1NG9A 4Y1CA 2IS3A 5M1FA 1LV5A 3D6RA 2F7TA 2UXCK 3MXMA 1YJNN 4JRPA 1YAGA 4JI4K 4FWPA 3QEWA 1NGAA 5AZIA 3CPWM 3CQ8A 1N32K 2RE2A 3NF9A 4KV8A 4BE1A 4B1XB 1VSJA 3CCQN 2HVIA 2Q3SA 3K5MA 5FPEA 2DTUA 4DR4K 1IH7A 3KD5E 1TYQB 2O8EB 4PA1A 3AARA 3LAMA 4CF2A 5AQJA 4H8KA 2E20A 5AQXA 1NKBA 4JI7K 5HROA 2ZJPL 1VQ9N 2AP1A 3QINA 1ATSA 4LF7K 4BG8A 5TKYA 4GVMA 2YI1A 4HCBA 4HCCA 4KI6A 3PIPL 2KFNA 2P9UB 4QS8A 2GELA 3W3DA 1DLOA 2HBMA 1RT3A 3OYMA 3KLHA 3PO5A 4FZXC 5ELZA 3QBXA 3CMEN 1SKSA 3S3NA 3HXMA 1BIUA 3L8BA 3N4PA 1HNZK 4YOXA 4Y0WA 3TARA 3P38A 3MWTA 3LANA 4BRHA 3OBYA 1FJGK 3FGUA 4CEBA 2G8HA 2HVHA 4BRIA 3OYCA 1M1KO 5JVGL 4BR9A 4FVUA 1DTTA 2YJEA 1NK8A 3VF2A 4FJKA 3GOIA 3EYZA 4BRAA 1FKPA 3DAWA 3TR8A 4FLVA 4B9QA 2QWPA 4BROA 5T7BA 2GV9A 4DSLA 4CJSA 4PKGA 3OYJA 1MWMA 3AA2A 3EO3A 2QEXN 4YFUA 4Y1DA 4CJEA 4I6MA 4AQYK 3LM2A 4OX9K 1YITN 3I56N 3K59A 4OO1J 4OKJA 3OYFA 4DR1K 4DSKA 4M3XA 4JD2B 1BQNA 3BY5A 1SL2A 4B1ZA 3AVGA 5M1OA 4ILGB 4GVEA 4JK7A 1ITGA 1WN7A 2P9UA 4F2RA 4A62A 4F3TA 1HMVA 3VQCA 1HPZA 2NNWA 1CXUA 5C25A 1T8EA 1NNEA 2P9KB 4IWVA 1Q9YA 1A5VA 1EWQA 4CEDA 4O44A 4B3MK 2A40A 2OPRA 2E2PA 4IJNA 4LF6K 3VQBA 1A5WA 4JKDA 4N56A 2OCEA 4J2AA 3THWA 1Q18A 1U48A 4K25A 4DTXA 2HNDA 5DM7L 1Z05A 4RCHA 1WSHA 2HBKA 4JI8K 4ISGA 4N76A 3H46O 3P1GA 3ATVA 3U8XA 3IUCA 4C23A 2P51A 3OYIA 3VQ9A 2IGIA 3ZYYX 3M6GA 3QICA 4MFBA 4Z4CA 1N6QA 1S9GA 4AM6A 2A1SA 4CIFA 1BA0A 1JJ2M 1RT5A 2QTDA 1HR0K 4I7FA 1NGFA 4JD2A 5HRRA 3QO9A 3SQ2A 4AHVA 4FWSA 5GADP 3TAFA 1BL3A 2YNHA 5AQFA 4U67L 2KW4A 1IJJA 4FO0A 3SCXA 2HHUA 2CGKA 3SUQA 1ZBUA 3CM6A 1BOTO 2P9KA 3PX0A 1HUXA 3ZSOA 2HHHK 3THXB 1XHZA 1EKEA 4WFBL 1TAUA 4CHYA 5GAEP 4DQSA 4G9ZA 3L2RA 4J2BA 4FJ5A 3J8AA 2G8UA 3SJHA 3O4QA 3PUFA 4CHZA 1H1VA 4K8XA 4JK8A 3D2FB 4B3SK 4DV2K 2IDOA 1C1CA 4AH9A 5KTQA 3WNGA 1YTUA 2ATQA 5C15A 4CBXA 2P9SB 4GY2B 3S3MA 2AA4A 2F9WA 3G71N 1Y97A 3CJAA 1NWKA 1ZBFA 3UKUB 3NVMA 1WSGA 2GUIA 2IIRA 3TAPA 3O1WA 1ASUA 1NMNA 1BISA 4B9UA 4AHSA 4E7HA 3O4NA 1UA1A 3CCSN 2IOCA 3DJCA 3OW2M 3CCUN 1S6QA 5AQMA 4W5RA 4CHPA 1D4XA 4UY8O 1Z6RA 4A2BA 4BC5A 5EU7A 2ASOA 4J8FA 1K8AO 1ILYA 1RDAA 1LAVA 2FSKA 3OYEA 3ULDA 2RKIA 2RPIA 3MEEA 3THXA 1TK5A 3OYGA 1LOTB 4IJAA 1HX1A 3ZSXA 4JV5K 2WUSA 1HLUA 4BRNA 3MWPA 2ASMA 5LL6Z 2BTFA 4ELUA 4CE9A 3LPUA 4RW8A 4NYNA 4OVLA 1T44A 4O0JA 4JI6K 3D2FA 1J53A 4IFVA 4FJLA 4E89A 4JS5A 4KHQA 4B8CA 4DR5K 1YVNA 4CZFA 1IV0A 3VQ5A 5I3UA 3VQ6A 4CEEA 3F2KA 5FPMA 4DLGA 1L3VA 4KTQA 1TK8A 2X78A 4H4OA 1OH7A 3QLHA 4CJKA 1EWRA 1EXQA 2GUPA 2YNFA 1QSSA 3AVHA 3DOLA 2V52B 1BCOA 4ZTFA 3DXKA 2CGJA 5KPTA 4K0KK 3C7NB 3DXMB 4ILHA 1QQOA 4B8AB 1UA0A 2OTJN 2J4RA 4IXCA 5M1NA 2IVOA 2O8DB 3WUHA 5ADXH 3VTIA 3HP9A 5GIPA 5DK5A 2ZM6K 3O3GA 5E41A 1HQEA 1NK9A 4RW6A 2QWQA 1WSIA 1ATNA 3ITHA 4JI5K 4H0XB 4FLXA 2W40A 4ICLA 1DKGD 3NFAA 4BQZA 5BPMA 3L3UA 3SK3A 4LH4A 3LDNA 2Y1IA 2RF2A 1KD1O 1TUUA 4H0YB 1C1BA 2BE2A 3HPGA 1QVGM 4YOUA 1KC8O 4CZHA 3KK1A 4FWNA 1M90O 4M3RA 1X3MA 2PYLA 4CD1A 5TKWA 4CF9A 5FRNA 2XY8A 5AFUA 4PL8A 3WXJA 2I7PA 4RTFD 3CCLN 4FLWA 4MO4A 4Z4IA 1RILA 1IKYA 1LAWA 4LFAK 3C7NA 3DXMA 5HLFA 2HHXA 1OKJA 2VWBA 2YNGA 1HYZA 3EEQA 2VQEK 3J80O 1Q9XA 1C0GA 2UXDK 2QWRA 1FK9A 2O8DA 1N5YA 4DV3K 2I5JA 1XMQK 4B3TK 1K8KB 4CHNA 4FJJA 3RMBA 2FBVA 4DCHA 2ITMA 2QWOA 4O8UA 5LMNK 2F8TA 4DS5A 1ASWA 1KFDA 1HJRA 3KKSA 3JXUA 4CERA 3T1AA 1KFSA 2FBTA 5AQHA 2ZJRL 1RNHA 3DLRA 1OVYA 3GDQA 3EL2A 1RGIA 3OYDA 4GKJK 3AVMA 4JYAK 1TKZA 3ZX3A 4J2EA 3Q7CA 3HTVA 4B1WB 4BR4A 1T03A 1KSPA 3EN9A 2WTUA 2W42A 2VGMA 4OJRA 5EX5A 4N5SA 4NXMK 1VRTA 3UE5A 3VEXA 1IG9A 5AQQA 1KLNA 4FYDA 4DR7K 3WT0A 3G0ZA 3V9XA 4FZYA 4AM7A 3QB0A 4LSLA 3ZT4A 2PY5A 3CQYA 5KQ8A 3L2QA 3MECA 5AQPA 4PUOA 1YIJN 2G8IA 1JXBA 1OH6A 3SAGA 3MMVA 2CH6A 2YNIA 2B5JA 3FZLA 4DU4A 4C8KA 1K8KA 1S72N 4E7LA 2ZF5O 4KHNA 2E2QA 1VK0A 2DFEA 1YUWA 3WQUA 4F2SA 2G8VA 1VQLN 3QEXA 2A5XA 3KVGA 3R9PA 1P8ZA 3IAYA 3L0QA 4DMNA 3CETA 3IKMA 1NBWA 3LPTA 1X9SA 1VQMN 4Z4FA 3O9TA 3SQ0A 3WNHA 1UWBA 2WC9A 2QXLA 1OH8A 4CHQA 1NKCA 1W97L 3V9ZA 3BDPA 1Y64A 1HKCA 5MLCQ 1RTIA 3O5BA 4DSIA 3VF4A 1VSDA 3NCIA 4RWTA 1NJZA 4PL7A 4DS4A 1YHQN 2G8WA 4V19S 4CIGA 1NK6A 3BZCA 4FZZA 2A1RA 4A57A 4R79A 1SL0A 3AAPA 3CI5A 4BQLA 1NK4A 2OTLN 1Z25A 3LAKA 4I9QA 4YOTA 1RBSA 1BUPA 4BRGA 3DM2A 1BG3A 2FF6A 4E1NA 3D0PA 1NK7A 1HKGA 3HP6A 3VGMA 3PO4A 4B1VA 3V6DA 4DSJA 3O6WA 2YHBA 1JKHA 4BRFA 4IDKA 3FZKA 3A0IX 4FCYA 4B9SA 3SMSA 2PZSA 1L3UA 1R59O 2FBYA 3KLEA 1GOAA 3VEYA 3LDQA 4E0DA 3UKRB 2RHKA 2WONA 4JEPA 1XUPO 3ZX0A 5J2PA 3QERA 3IG1A 3HL8A 4ELVA 2GWJA 4CGIA 1IBKK 1T3VA 1V4TA 4FWRA 2NRHA 5AQZA 4BC4A 4RW9A 4YDUA 4KH6A 1ESVA 3K2PA 5AFUH 4CCHA 3C6HA 1BCMA 4IKFA 4CJ7A 4G1QA 2QI2A 2PBDA 4JHDB 1YTAA 3AVFA 4C8LA 4O5FA 3ZX2A 5FRMA 4BR2A 3OJSA 4NO7A 4B1UB 4BRQA 3BGRA 3WEEB 3HZ6A 5C2DA 1KQSM 1B9DA 1JCFA 3K0SA 3MEGA 3CF5L 1IO2A 4BC2A 3H08A 1N36K 1ZBSA 2Q2RA 1X9WA 4FK0A 5HL7L 3RTVA 1YI2N 3TAGA 2XY5A 1JCEA 4X66K 5JICA 3RMCA 5AQTA 4PY5A 4CVNE 2DFHA 1E4FT 1RBVA 1RCHA 1VQNN 3WXLA 4NLBA 4OPAA 3O9SA 3QIOA 4I2QA 3E9LA 1CXQA 2ZD1A 3UKRA 3GL1A 1BQMA 4BRLA 2XY7A 3P39A 1C6VA 4CZLA 4CEOA 3VEOA 2H3GX 3O8MA 2Z1GA 4FLZA 4OPKA 4H03B 4I6MB 3LDPA 3OS1A 3M1FA 3O9UA 3PLAA 1QQCA 1RBUA 1J6ZA 4BWJA 1KVBA 2UUCK 1QSLA 4CJVA 2OZMA 3AO4A 1WB9A 3OS0A 4BDZA 1T6CA 2ZGYA 4JHDA 1KVCA 4CJ4A 4OPHA 4W5TA 2DFFA 2VWKA 3TSUA 4DTNA 1I3AA 1KVAA 3NBPA 3BF3A 4WE1A 2F8SA 1YT3A 2X74A 5E84A 3J7ZO 3O3HA 2IAJA 1VQ7N 1QVFM 1GLLO 3WEEA 3L2UA 4DSEA 1LCUA 3VQAA 2VYPA 1Q8IA 3RVCA 4YOVA 3THWB 1VQ4N 4ZHRA 3CCEN 3CFPA 2E2NA 5AR0A 2VWJA 1XNQK 3AAQA 4A5AA 4FJIA 5BPLA 3CCRN 2YCHA 2HNZA 3D2EB 2NRZA 2OA8A 3DRSA 3OBWA 3LZIA 5M1QA 5M1PA 4Z0UA 3CIPA 3L4QA 4FWKA 3AVAA 3SUNA 4JKBA 3DI6A 1NGCA 3VESA 2JGUA 2JLEA 1I39A 4BE2A 4CJFA 4FWQA 2O8FB 2Q31A 4KB0A 3MEDA 4JKEA 5KRTA 1QZ6A 2LSNA 1JLAA 4EP5A 1HRHA 4CGHA 4LFBK 3OHRA 1K6YA 1TKDA 1VQ8N 1BA1A 3BF1A 3U4LA 3BZKA 3LZJA 3QESA 4AF1A 4FJGA 3F5TA
chains in the Genus database with same CATH topology
4BC5A 2E2OA 5KQDA 5BRHA 1KAXA 1VQKN 3TPQA 2A6AA 2ASOA 4J8FA 1K8AO 4YDUC 1ILYA 3MN5A 4KH4A 4WQ5A 2FSKA 3I8BA 3VOVA 4H5WA 5BN8A 1LOTB 3O9RA 3EE9A 4IJAA 2VCPA 3KHYA 1HX1A 2KHOA 2P9LB 5AQIA 3TU5A 2WUSA 4H5VA 1QZ5A 2HBLA 5ADXA 3LL3A 1HLUA 5EY4A 4BRNA 4IDHA 3MWPA 2ASMA 2BTFA 5AQVA 2PAVA 4WFNL 4PKHA 3SBTA 2P9IA 2IVNA 4FL9A 4IO8A 3CD6N 1YJ9N 1T44A 2ZGZA 3D2FA 3M5RA 4CD3A 3LDLA 1RDWX 4BGAA 3MCAB 1YVNA 3G25A 4CZFA 5JVHL 3JS6A 2HOEA 3CC7N 3WXMB 1SQKA 4A61A 1Q7YO 3F2KA 3U9ZA 4KH5A 5F0XA 3ID8A 3D2EA 5FPMA 1GLJO 1KAYA 5M1KA 1CZAN 4NLCA 1VQON 4O8KA 3KZBA 3FZFA 2GTDA 4JKGA 2GUPA 3TSPA 2V52B 1X9JA 3F9MA 3HBTA 3CC2N 3DXKA 1U2VA 2CGJA 1MDUB 3VENA 1HPMA 4WQ4C 5KPTA 1E4GT 2E1ZA 3C7NB 3D7EO 3DXMB 4ILHA 4IEIA 1QQOA 5CE3A 2OTJN 2J4RA 3C6AA 3MK6A 4IXCA 5M1NA 3K9KA 2IVOA 2QWNA 3WUHA 5ADXH 4JKAA 3VTIA 1NGHA 2P9NB 5FPDA 5GIOA 5GIPA 4WYBA 5LJWA 4BR5A 3C0BA 1RFQA 2FLOA 4BRMA 5GAGP 3LDOA 1P90A 1SZ2A 2QWQA 2GWKA 1NGBA 1NGDA 3BP8A 4CZEA 3HOSA 1ATNA 1NMDA 2Q97A 2Q0UA 4H0XB 1T6DA 3MDQA 4FWOA 2FSJA 2GX9A 3CJBA 1BO5O 4MLEA 5AQGA 3L6QA 4H0OA 3P4IA 3SBGA 2W40A 2ZWHA 5DM6L 2PFUA 5BRDA 2P9LA 2V51B 1RDUA 1DKGD 4BQZA 5JLHA 5BPMA 3VPZA 3BUZB 3SK3A 4FWLA 4DQ8A 3ZETB 2A3ZA 3QFPA 3CJ7A 3LDNA 4PKIA 1KD1O 1TUUA 4H0YB 3LM9A 4FOIA 2HBJA 3FFKB 4IZ9A 1GLAG 2JWLA 2QWLA 2P9IB 1QVGM 5C0YA 1ZC6A 2HF3A 4YOUA 5BR9A 1KC8O 2E8AA 4CZHA 4ISEA 2D4WA 5AQRA 1S3XA 3A5LC 3GE1A 4FWNA 4XH4A 1M90O 3AGKA 4BR7A 1ZXOA 4JNEA 1X3MA 3HM8A 3TTDA 3KWGA 1NM1A 3K9JA 4HWIA 4JAXA 5TKWA 2I7NA 4CD1A 3EKSA 3MX5A 3NMUA 3O08A 3VEVA 3CCVN 4CZKA 4FPAA 4JK9A 1XQSC 4PL8A 3WXJA 5AFUA 3AGRA 1SAZA 2I7PA 4U7BA 3CCMN 2D0PA 2V7YA 4RTFD 3CCLN 4MO4A 2CH5A 2NRTA 5BRFA 4BR0A 4XEIA 5C12A 1JCGA 2A41A 5AZIB 3TSQA 3DXKB 4QS9A 5KPRA 3C7NA 3DXMA 4K41A 3HOTA 1OKJA 2VWBA 4GV9A 4A2AA 1NGEA 4CI6A 4CZJA 2NRWA 1YXQA 4CZMA 3CQXA 1C0GA 2A42A 2QWRA 3TTFA 1EQYA 4BGBA 2P9NA 5CR4A 5LJVA 4MDBA 1K8KB 1NLVA 1NJIO 1BU6O 5AQLA 1BDGA 1TYQA 2YHXA 1GLEG 3VGKA 4DCHA 2ITMA 3ENBA 2Q1NA 2QWOA 4DHYA 5AQWA 5BPNA 4BC3A 2NRRA 1HKBA 3HSCA 4O8UA 4BRPA 5AZJA 3FE1A 4IFEA 1XC3A 3FZMA 3MX2A 1KAZA 3JXUA 1VQ5N 2VGNA 4EHUA 5CHIA 4IO9L 5AQHA 2ZJRL 4MDAA 2CGLA 3GBTA 1OVYA 3ZETA 4WQ5C 4CBUA 1KXPA 3EL2A 3GDQA 3O4WA 1RGIA 3ULEB 5I9EB 4YOYA 3NVKA 3KK7A 3ZX3A 3Q7CA 3H45C 3HTVA 4B1WB 4BR4A 3A8YA 3MN7A 3EN9A 4BY9C 2HMPA 4BVPA 2VGMA 3CJ1A 3KWIA 4KBOA 5EOYA 5LY3A 1GLDG 5EX5A 3I55N 4JKFA 3ENHA 3QFUA 3UE5A 5M1FA 4H0PA 3EKUA 3D6RA 3VEXA 5AQQA 4GV3A 4FWMA 2F7TA 1QQNA 2Q0RA 3WT0A 4H0TB 1DT9A 4BRCA 2FXUA 4AM7A 5AQNA 1YJNN 3L4IA 3QB0A 5GINA 3CQYA 1YAGA 5KQ8A 3S41A 4FWPA 3E66A 5AQPA 1NGAA 3RSEB 1YIJN 1MA9B 3QBWA 2E88A 5AZIA 3CPWM 3WQTA 1C0FA 3H1VX 4F9OA 3SAGA 2RE2A 3MMVA 3IMXA 1N8RO 3MN6A 3W0LA 2CH6A 4B1XB 3FZLA 3CCQN 4LC9B 5FPEA 1K8KA 3R8EA 1S72N 2OANA 2ZF5O 1TUYA 3IFRA 1VQPN 2JWKA 2E2QA 1GLBG 2YJFA 1TYQB 3P31A 4M7XA 5AQOA 2D1KA 3VEZA 1S22A 2ZJQL 1YUWA 3AARA 3WQUA 1NGGA 3ZEUB 3G6EN 1YJWN 1VQLN 5AQJA 2E20A 5AQXA 3SMPA 3GG4A 3R3LA 2ZJPL 2A5XA 3KVGA 3R9PA 1P8ZA 3L0QA 3CETA 3IKMA 1NBWA 3H6EA 1VQ9N 2AP1A 1VQMN 1ATSA 2YX6A 3O9TA 2FF3B 5TKYA 4BG8A 2YI1A 3ULEA 2WC9A 3PIPL 2QXLA 4M7YA 1BWFO 2IVPA 3CJCA 1W97L 4K42A 1Y64A 4DKWA 1HKCA 5MLCQ 1WOQA 2P9UB 2GELA 3CHWA 3O1BA 3O5BA 4QS8A 5AZJB 3W3DA 3OA9A 4A5BA 3VF4A 3CCJN 2HBMA 2V7ZA 3QMLA 4PL7A 4RWTA 1YHQN 3SAHA 4IOXA 5ELZA 3R1XA 5F1XA 4A57A 4R79A 3AAPA 3QBXA 3CMEN 1NGJA 3CI5A 4BQLA 2D0OA 2OTLN 1W2BM 3N4PA 4H5RA 2QA4N 4YOXA 4Y0WA 3HI0A 4EIAA 4YOTA 1BUPA 4M63C 3RSEA 4BRGA 3P38A 3MWTA 4BRHA 5AQUA 3OBYA 4C1NI 3FGUA 3O80A 1BG3A 2UYTA 2FF6A 2WBNA 4BRIA 1HKGA 1M1KO 5JVGL 4FOEA 3VGMA 4BR9A 3MN9A 4H5NA 3DLLL 4B1VA 3PIOL 4XH1A 4FVUA 3O6WA 2YJEA 4L3QA 3CC4N 2NZTA 1MWKA 3VF2A 3GOIA 4H0VB 4BRFA 4WFAL 3FZKA 3A0IX 3SMSA 4BRAA 1R59O 5C2FA 3DAWA 4ISFA 3WXKA 3CJ9A 3LDQA 2QWPA 3VEYA 3UKRB 2RHKA 3ZEUA 1WUAA 4B9QA 4BROA 4JEPA 2YHWA 1XUPO 4PKGA 3ZX0A 1MWMA 2HSTA 2GWJA 2P9PA 2W41A 3EO3A 2QEXN 1VAZA 1T3VA 1V4TA 4FWRA 4BREA 4E1JA 4I6MA 2NRHA 1VQ6N 2NLXA 3LM2A 4YOWA 4HTLA 5AQZA 4GNIA 2KLAA 3I56N 2HF4A 1YITN 4OO1J 4BC4A 4BVOA 4YDUA 4JD2B 1ESVA 2Q36A 3ENOA 4KH6A 4EHTA 5AFUH 3VETA 3C6HA 4B1ZA 5M1OA 4ILGB 4GVEA 4JK7A 2P9UA 4CJ7A 3C65A 2QI2A 2PBDA 4A62A 1NGIA 4H5TA 2GEMA 3FR0A 4JHDB 2NNWA 3VMFB 3TTCA 4O5FA 4IEEA 3ZX2A 2P9KB 5AQKA 4QS7A 4NO7A 3E9PA 4BR2A 4IWVA 4B1UB 1K73O 4BRQA 3ATUA 4PHTX 4B1YB 5F2RA 1QQMA 3WEEB 2A40A 4CBWA 3HZ6A 4AF1A 5C2DA 1KQSM 1JCFA 2BH1A 2E2PA 2NRXA 4IJNA 3EE8A 5C10A 4JKDA 3CF5L 4MLHA 4BC2A 1ZBSA 2Q2RA 1Q18A 3BEXA 3QDKA 4K25A 4BG9A 4EFHA 1V4SA 5HL7L 1YI2N 4JKCA 1JCEA 2EWSA 2DPNA 3B8AX 2NRVA 3CERA 5AQTA 1U6ZA 5EVZA 5JICA 5JMVA 5DM7L 1HJOA 1Z05A 4RCHA 2P9SA 1E4FT 3H1QA 4XH5A 3VTHA 4EAHD 4Z94A 3G4SN 1VQNN 2HBKA 4ISGA 4NLBA 4OPAA 3H46O 3WXLA 1Q81O 3O9SA 4BRDA 4WQ4A 3UKUA 5BN9A 3E9LA 1O13A 3ATVA 3DWLA 3U8XA 2QWMA 3IUCA 4C23A 3O9QA 3UKRA 3GL1A 3IDHA 4BRLA 1IG8A 1YF5L 3M6GA 3QICA 3ZYYX 5B8HA 3P39A 1SS6A 4CZLA 4AM6A 2P9PB 2F9TA 2H3GX 3O8MA 3N4QA 4FSVA 1BA0A 2WFBA 3VEOA 3SLCA 4NB4A 4CZIA 4YORA 1JJ2M 4WCEL 1QHAA 4H03B 4I6MB 3LDPA 3M1FA 3O9UA 1Q82O 2FSNA 2QTDA 3PLAA 5BREA 1J6ZA 1GLCG 1NGFA 4JD2A 4DB3A 3UB5A 3T69A 3E1YA 3E9OA 3AY9A 3A5NC 4FWSA 3H3NO 4BRKA 5GADP 4C1NK 3T7ZA 1T6CA 5AQFA 5FPNA 4U67L 2ZGYA 4JHDA 1IJJA 4FO0A 1X3NA 4MO5A 4OPHA 3VF6A 2CGKA 3VEWA 2YHYA 3A5MC 1BOTO 2P9KA 3TSUA 1HUXA 3BF3A 4K43A 5EXWA 3J7ZO 5E84A 4WFBL 3CPEA 5GAEP 5JLFA 1VQ7N 1QVFM 1GLLO 4G9ZA 3WEEA 5AQYA 3VERA 4WF9L 1ATRA 1LCUA 4CZGA 3J8AA 4FPBA 3SJHA 4IOAL 1GLFO 5HOOA 3R6MA 1H1VA 2VYPA 4JK8A 3D2FB 3RVCA 4YOVA 1VQ4N 3CCEN 2E2NA 2KKZA 5AR0A 5H1SQ 1DEJA 3AAQA 4A5AA 5BPLA 3CCRN 2YCHA 5C15A 4CBXA 2P9SB 3D2EB 3Q7BA 2NRZA 4GY2B 3CXCM 1Q86O 1K9MO 3OBWA 3I33A 2AA4A 2F9WA 3G71N 5M1QA 5M1PA 3CJAA 1NWKA 3EZWA 3CIPA 3NVMA 3UKUB 2IIRA 3L4QA 4FWKA 3CMAN 4JKHA 3A5OC 4JKGB 4JKBA 3O1WA 3WXIA 4A59A 5E26A 5GAHP 4IOCL 4GV6A 1NGCA 3MCPA 3VESA 5KPZA 4FWQA 1U2VB 2QW9A 3FZHA 3H3OB 2Q31A 3HRGA 3VGLA 2QM1A 4JKEA 5AQSA 3SAFA 3CCSN 1QZ6A 1EO1A 3DJCA 3FLCO 2BUPA 3U9DA 3OW2M 3OHRA 3CCUN 1G99A 2ASPA 5AQMA 1VQ8N 1BA1A 3BF1A 3U4LA 1D4XA 3ID6A 4UY8O 3M3ZA 2E1YA 4ILJA 1DGKN 1Z6RA 3F5TA 4JN4A 4A2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKW A;  2WBN A;  2WC9 A; 
#chains in the Genus database with same CATH topology
 3KLG A;  3QET A;  1VQK N;  1KAX A;  1JLB A;  4YDU C;  3DLG A;  3MN5 A;  4CFD A;  2VCP A;  5AQI A;  2P9L B;  4O0I A;  3OYK A;  1QZ5 A;  2HBL A;  5ADX A;  3V1O A;  3HYF A;  3M8P A;  2P9I A;  3LWL A;  3HPH A;  1YJ9 N;  2D0A A;  3M5R A;  4DQI A;  2KTQ A;  4Q5V A;  4JI1 K;  1TV6 A;  2E4L A;  3G25 A;  3LAL A;  5JVH L;  1XWL A;  3CC7 N;  4A61 A;  3DOK A;  4KH5 A;  3D2E A;  1RDC A;  4HTU A;  2ITG A;  1SV5 A;  3PX6 A;  3SPZ A;  3KZB A;  3FZF A;  5FDL A;  3HBT A;  4CK2 A;  2O8F A;  4B9L A;  4FM0 A;  1HPM A;  1WLJ A;  1E4G T;  1RTH A;  4DQP A;  1LWE A;  1JLF A;  1E3M A;  3UIQ A;  3SUO A;  4FJ9 A;  3MK6 A;  4KRE A;  3K9K A;  5CY4 A;  2DY4 A;  2P9N B;  4CJU A;  4EZ9 A;  2OPS A;  3HJF A;  3I0S A;  3JAM O;  2VQF K;  3LDO A;  1QSY A;  4CZE A;  2GWK A;  1NGD A;  2UUB K;  1NMD A;  2Q97 A;  4JRQ A;  4MLE A;  4FWO A;  3MDQ A;  2FSJ A;  3NDK A;  1BO5 O;  4H0O A;  5KGW A;  3J7Y P;  1D8Y A;  2PFU A;  2P9L A;  2F96 A;  1ZYQ A;  3VPZ A;  3BUZ B;  2EHG A;  4FLY A;  3QFP A;  3CJ7 A;  3LM9 A;  4FOI A;  2EX3 A;  3FFK B;  3LP3 A;  2PYJ A;  1ZC6 A;  2HF3 A;  2G8F A;  3SYZ A;  4ISE A;  4CEQ A;  1S3X A;  3A5L C;  4FXD A;  4BR7 A;  4JNE A;  4CGJ A;  3TTD A;  1NM1 A;  1BIZ A;  3K9J A;  2HHQ A;  2I7N A;  2HB5 A;  3O08 A;  3SUP A;  3VEV A;  4FPA A;  4JK9 A;  3CCM N;  2D0P A;  2CH5 A;  2NRT A;  5BRF A;  3HO1 A;  3KLI A;  1JCG A;  3TI0 A;  2A41 A;  4LY7 A;  4M3W A;  3DXK B;  1JLG A;  4IG0 A;  4OKK A;  4XIU A;  4A2A A;  3K5N A;  4CI6 A;  4CZJ A;  3OYH A;  4CZM A;  1YXQ A;  4E3S A;  3ZSV A;  3DLK A;  2A42 A;  3ZCM A;  3AA5 X;  2P9N A;  5LMU K;  5CR4 A;  5KGX A;  4MDB A;  5LJV A;  1NJI O;  1BU6 O;  3OYB A;  3VGK A;  3ENB A;  4DHY A;  5BPN A;  5AQW A;  2NUB A;  1HNV A;  1HKB A;  3HSC A;  1HQU A;  4IFE A;  1XC3 A;  4FLT A;  3SQ1 A;  4PWD A;  2E6L A;  1GOB A;  4DV0 K;  3QEI A;  2VGN A;  3IS9 A;  1JLC A;  4MDA A;  2CGL A;  2XY6 A;  2GBZ A;  1QTM A;  3O4W A;  4KHU A;  3KK7 A;  3NF7 A;  3A8Y A;  3MN7 A;  2HW3 A;  3KWI A;  4NCB A;  5EOY A;  3JYT A;  5K14 A;  3ZSW A;  3ENH A;  3QFU A;  1LW0 A;  4GV3 A;  3EKU A;  4X62 K;  4FWM A;  2Z1H A;  4LFC K;  4DV1 K;  4DR3 K;  4H0T B;  1DT9 A;  4BRC A;  5J2M A;  3L4I A;  5GIN A;  3S41 A;  3K5L A;  3RSE B;  3EY1 A;  1JL1 A;  2E88 A;  3LP2 A;  4F3O A;  3H1V X;  2BDP A;  1RT6 A;  3AVK A;  3QEP A;  1D9D A;  4B9N A;  4E7K A;  3W0L A;  3HM9 A;  1VSH A;  1W0H A;  4CES A;  3SZ2 A;  1N34 K;  1BI4 B;  3KIO A;  3R8E A;  2OAN A;  1VQP N;  1RT1 A;  2JWK A;  2YJF A;  3M8R A;  1ZBH A;  3P31 A;  4M7X A;  3VEZ A;  3MXJ A;  1S22 A;  1NKE A;  1YJW N;  3ZEU B;  1NGG A;  3G6E N;  3K57 A;  3SMP A;  4AHR A;  3GG4 A;  3R3L A;  4CW7 B;  3O3F A;  1B9F A;  3U3G A;  3NGI A;  4FK2 A;  2YX6 A;  1KLM A;  2FF3 B;  4CF0 A;  5KI6 A;  3QIP A;  4M7Y A;  3CJC A;  4K42 A;  1LW2 A;  2UUA K;  4C8N A;  1WOQ A;  3O1B A;  3C95 A;  4OPJ A;  4DF8 A;  4IOX A;  3IRX A;  5F1X A;  4DFP A;  3NGZ A;  3QEV A;  3L2V A;  4DTO A;  3NHG A;  3A2F A;  3PSI A;  4H5R A;  1WAF A;  2QA4 N;  3VN5 A;  4Q0B A;  4EIA A;  4M63 C;  3RSE A;  4DFM A;  4DWI A;  4CFA A;  4C1N I;  3HVR A;  1NK5 A;  3T19 A;  3DRR A;  3J81 O;  4H5N A;  3PIO L;  4R5P A;  1BI4 A;  4XH1 A;  4CEZ A;  1MWK A;  3F9K A;  4RG8 A;  3RRG A;  2UU9 K;  1VHX A;  2BGG A;  4IBN A;  5C2F A;  4ID5 A;  3V81 A;  3ZEU A;  1WUA A;  2XHB A;  2YHW A;  3OYA A;  2P9P A;  2W41 A;  4CJ5 A;  1VAZ A;  4I9L A;  1RDD A;  4BRE A;  4KRF A;  1VQ6 N;  2NLX A;  5JS2 A;  4KTZ A;  3ENO A;  4EHT A;  3VET A;  4DTR A;  4RW7 A;  3C65 A;  1NGI A;  2GEM A;  4M42 A;  1TKT A;  3FR0 A;  3VQ4 A;  1RT4 A;  3TTC A;  4IFY A;  4KKO A;  5AQK A;  4QS7 A;  3E9P A;  4B1Y B;  1S1V A;  1QHT A;  1U4B A;  2O4I A;  5F2R A;  1QQM A;  4CBW A;  3ISN C;  2BH1 A;  3AO5 A;  3L3V A;  2WOM A;  3EE8 A;  4PQU A;  3AO1 A;  3V9S A;  1U47 A;  2D5R A;  4ID1 A;  1XHX A;  3QDK A;  4BG9 A;  4DTP A;  4KHP K;  4OLA A;  2EWS A;  2DPN A;  4LSN A;  2NRV A;  1NK0 A;  5EVZ A;  4KHY A;  5JMV A;  3VTH A;  1HJO A;  3G4S N;  3MAQ A;  4DV5 K;  1Q81 O;  1S6P A;  3RR8 A;  4FK4 A;  3ZSY A;  4QAG A;  4BRD A;  5BN9 A;  1O13 A;  2XO7 A;  4M41 A;  4C8M A;  4CK3 A;  3AA4 A;  1VRU A;  4FW1 A;  1YF5 L;  5B8H A;  4HUE A;  4E7J A;  4FSV A;  4B9M A;  3N4Q A;  4CZI A;  4JLH A;  3SLC A;  4YOR A;  3OJU A;  3AVB A;  2ETJ A;  5HP1 A;  4WCE L;  1QHA A;  4EZ6 A;  1C0M A;  1Q82 O;  2FSN A;  4DV6 K;  5BRE A;  3VQE A;  1GLC G;  4DB3 A;  2R7Y A;  1NJY A;  4KTW A;  1XI1 A;  3E1Y A;  4BE0 A;  3A5N C;  3M8Q A;  4C1N K;  1WSJ A;  5FPN A;  4MO5 A;  3VF6 A;  4FVM A;  3VEW A;  2YHY A;  3ZT2 A;  4FJM A;  3A5M C;  2FBX A;  5J1E A;  5EXW A;  4LF5 K;  4M3Y A;  2RN2 A;  1D9F A;  5AQY A;  3VER A;  1SL1 A;  1ATR A;  4JS4 A;  3CFO A;  2AJQ A;  4FPB A;  4IOA L;  1GLF O;  5HOO A;  4W5O A;  5I42 A;  3VQ8 A;  2X6N A;  1LWC A;  3LP1 A;  2KKZ A;  1TGO A;  4E19 A;  1DEJ A;  1EET A;  5DMR A;  5J2N A;  1DTQ A;  1K9M O;  3PV8 A;  3ASM A;  3Q7B A;  3CXC M;  2HHT A;  3OYN A;  3TWH A;  1LWF A;  3DLL L;  3KLF A;  1KCF A;  4JKG B;  5GAH P;  5E26 A;  4IOC L;  3MCP A;  3NAE A;  1U2V B;  2QW9 A;  3FZH A;  3H3O B;  2O8B B;  1S1X A;  2P5G A;  5AQS A;  3SAF A;  1WNS A;  1L3T A;  2W6K A;  1EO1 A;  3FLC O;  2BUP A;  2W6L A;  1CZB A;  1S1T A;  2ASP A;  4B08 A;  1S1W A;  1L5U A;  2QK9 A;  2F4V K;  3ID6 A;  3M3Z A;  2E1Y A;  1EP4 A;  4ILJ A;  1DGK N;  4JN4 A;  2E2O A;  3DLE A;  5BRH A;  4N41 A;  4LF9 K;  5AJ3 K;  1VSL A;  2QXF A;  4KH4 A;  4WQ5 A;  4DU1 A;  3VOV A;  4H5W A;  5BN8 A;  4X65 K;  4DQR A;  2HHS A;  3TU5 A;  1NU0 A;  4O55 A;  3OTO K;  2B4J A;  3LL3 A;  1OH5 A;  4IDH A;  5AQV A;  2PAV A;  4WFN L;  4IO8 A;  2IVN A;  4FL9 A;  4CJQ A;  1TVR A;  3V9W A;  4CD3 A;  4CGD A;  1RDW X;  4B3R K;  4BGA A;  3MCA B;  3PX4 A;  4E7I A;  4DF4 A;  4YNQ A;  4DTS A;  2HOE A;  3V4I A;  3WXM B;  1BHL A;  1Q7Y O;  3U9Z A;  4DR2 K;  5F0X A;  3ID8 A;  5D3G A;  1KAY A;  2VG5 A;  5M1K A;  1TKX A;  1IBM K;  4Z4H A;  2XRI A;  4O8K A;  2GTD A;  4FW2 A;  4JKG A;  2OPP A;  3TSP A;  1X9J A;  3CC2 N;  1WBD A;  1U2V A;  4KHW A;  2E5L K;  3VEN A;  2O8B A;  2OYQ A;  4KI4 A;  2E1Z A;  3D7E O;  3AV9 A;  4CGF A;  4HVJ A;  4IEI A;  4FJ7 A;  4KO0 A;  5CE3 A;  3C6A A;  4AIL C;  1NGH A;  5GIO A;  4WYB A;  1WBB A;  4C8O A;  2Z1J A;  3C0B A;  5GAG P;  4BRM A;  4CK1 A;  1SZ2 A;  1SKR A;  3BP8 A;  1L3S A;  5FLX O;  5J2Q A;  4ZTJ A;  2Q0U A;  1T6D A;  3FFI A;  2GX9 A;  3CJB A;  3SBG A;  3VQQ A;  1SKW A;  3P4I A;  2ZWH A;  5DM6 L;  5BRD A;  4CFB A;  1RDU A;  5JLH A;  4QCL A;  1REV A;  4FWL A;  2QKB A;  4PKI A;  2ZQB A;  4NYF A;  4IZ9 A;  2P9I B;  5C0Y A;  5SWM A;  5BR9 A;  1XC9 A;  2KFZ A;  4CF8 A;  3ZSZ A;  3J7A P;  2D4W A;  4DUY K;  4XH4 A;  1ZXO A;  2IC3 A;  3HM8 A;  3C6U A;  3NH2 A;  3NMU A;  3CG7 A;  1C1A A;  3CCV N;  1XQS C;  1IKV A;  4X64 K;  2V7Y A;  3DMJ A;  3AVL A;  3ALY A;  4XEI A;  1NOZ A;  4W5Q A;  4TSX A;  3TSQ A;  5KPR A;  1T7P A;  1NJX A;  4GV9 A;  1HNX K;  3ZT1 A;  1NGE A;  2NRW A;  3CQX A;  1J5O A;  3TTF A;  1EQY A;  4BGB A;  3LWM A;  5AQL A;  1BDG A;  3C6T A;  1TYQ A;  1XNR K;  2O8E A;  1GOC A;  3TAN A;  3RWU A;  1RBT A;  2D0B A;  4BC3 A;  4KB1 A;  2NRR A;  4BRP A;  3RMD A;  1Z26 A;  2KZZ A;  1KRP A;  3NH1 A;  1ZBI A;  3B6O A;  4ELT A;  5HRP A;  1WSE A;  4IO9 L;  3GBT A;  4WQ5 C;  4CBU A;  1KXP A;  3ULE B;  5I9E B;  5JS1 A;  4YOY A;  4GKK K;  4NCA A;  3NVK A;  2Y1J A;  2VG7 A;  4BWM A;  2FC0 A;  4BY9 C;  4BVP A;  4KBO A;  5LY3 A;  1QS4 A;  4JKF A;  5CYM A;  2P1J A;  4DSF A;  1W7A A;  4H0P A;  3V1Q A;  1QQN A;  2Q0R A;  2FXU A;  5AQN A;  1XMO K;  1J5E K;  5IT9 O;  3NE6 A;  1JL2 A;  1G15 A;  2O8C B;  3E66 A;  2YKM A;  1MA9 B;  3QBW A;  3C94 A;  3WQT A;  4HUF A;  4DU3 A;  1IBL K;  1C0F A;  1C0U A;  4F9O A;  3IMX A;  1N8R O;  3MN6 A;  2HNY A;  4LC9 B;  3OYL A;  1HYV A;  1SUQ A;  5CZ2 A;  1TUY A;  3IFR A;  1GLB G;  4LF4 K;  5AQO A;  2D1K A;  1R0A A;  2ZJQ L;  4DUZ K;  4JI0 K;  3F73 A;  1U49 A;  4AHU A;  4B9T A;  3H6E A;  3ULE A;  1BWF O;  2IVP A;  5BR8 K;  1RDB A;  4KFB A;  4DKW A;  2E6M A;  3CHW A;  3CCJ N;  3OA9 A;  4A5B A;  2BAN A;  5IWA K;  4EP4 A;  2V7Z A;  3QML A;  1JXE A;  1TL1 A;  2HHW A;  3SAH A;  1HYS A;  3R1X A;  1HNI A;  1NGJ A;  2X6S A;  4FLU A;  2D0O A;  1U45 A;  1W2B M;  4FJN A;  1VSF A;  1N33 K;  2O8C A;  3HI0 A;  4B9V A;  1C0T A;  2OPQ A;  5AQU A;  1RTD A;  3O80 A;  5HRS A;  4DV4 K;  2UYT A;  1NOY A;  2WBN A;  3LP0 A;  2YHA A;  4FOE A;  3MN9 A;  4DFK A;  3QNN A;  4F4K A;  4L3Q A;  3CC4 N;  4BAC A;  2NZT A;  4H0V B;  4WFA L;  1D5A A;  3G10 A;  3SV3 A;  3RRH A;  4K8Z A;  1UAX A;  1TL3 A;  4ISF A;  1X9M A;  3WXK A;  3CJ9 A;  2HST A;  3AO3 A;  4LF8 K;  4BDY A;  4E1J A;  1BGX T;  4YOW A;  4HTL A;  3ZT3 A;  4GNI A;  2KLA A;  2HF4 A;  3SQ4 A;  4BVO A;  1RBR A;  2Q36 A;  1ZBL A;  4KAZ A;  3U6F A;  4YY3 K;  4CGG A;  2HMI A;  1UOC A;  3ZSR A;  4H5T A;  3P5J A;  5A2Q O;  3VMF B;  4IEE A;  3WNE A;  1K73 O;  1EX4 A;  5C24 A;  3L2W A;  3MXI A;  3ATU A;  4PHT X;  4KHS A;  2HHV A;  3KK3 A;  2NRX A;  5C10 A;  4MLH A;  3BEX A;  4EFH A;  1V4S A;  5CYQ A;  4JKC A;  3B8A X;  3CER A;  1U6Z A;  2P9S A;  3H1Q A;  4XH5 A;  4Z94 A;  4CJ3 A;  4FJH A;  1S5J A;  4LH5 A;  3PY8 A;  3TAB A;  4DTM A;  3DYA A;  4WQ4 A;  3UKU A;  3DWL A;  3AVI A;  2QWM A;  3ZT0 A;  3O9Q A;  3IDH A;  4OGC A;  3SPY A;  4I2P A;  1IG8 A;  4MQ3 A;  3AA3 A;  1SS6 A;  2P9P B;  2F9T A;  2WFB A;  4NB4 A;  4CJW A;  1TK0 A;  4W5N A;  1RT7 A;  3M8S A;  2Z1I A;  3TAM A;  3AO2 A;  3CFR A;  3UB5 A;  3T69 A;  4DR6 K;  3E9O A;  3AY9 A;  4BRK A;  3H3N O;  4CEA A;  4JI2 K;  3T7Z A;  3TAE A;  5KRS A;  1X3N A;  3HST B;  1RTJ A;  3VQD A;  4NXN K;  5C42 A;  4FJ8 A;  4K43 A;  1W9H A;  3EZ5 A;  4DTU A;  1MU2 A;  4M3Z A;  3CPE A;  5JLF A;  4WF9 L;  4CJL A;  4CZG A;  4AHT A;  1WAJ A;  3R6M A;  1S9E A;  4CF1 A;  3SI6 A;  3S3O A;  4M45 A;  3U3Y A;  2UXB K;  4F8R A;  3D45 A;  5H1S Q;  4CEF A;  4Z4G A;  1Q86 O;  3HVT A;  3I33 A;  3CM5 A;  3EZW A;  4FM1 A;  3SV4 A;  3CMA N;  3AVN A;  3AVC A;  3A5O C;  4JKH A;  4A59 A;  3WXI A;  4GV6 A;  5CZ1 A;  4B3O A;  5KPZ A;  3HRG A;  2YKN A;  3VGL A;  2QM1 A;  1FXX A;  3VQ7 A;  4O5B A;  4L8R B;  4BDP A;  2G8K A;  3U9D A;  1QE1 A;  2YV0 X;  1G99 A;  4FJX A;  3I0R A;  4YHH K;  4IG3 A;  2ZE2 A;  4GW6 A;  4GMJ B;  3T1H K;  1VSM A;  5KQD A;  3KJV A;  3TPQ A;  2A6A A;  4LD0 A;  1A5X A;  1X1P A;  4DTJ A;  3T1Y K;  3I8B A;  4OLB A;  4CJP A;  4QOZ B;  3O9R A;  4DQQ A;  3EE9 A;  3KHY A;  2KHO A;  4H5V A;  5EY4 A;  3ZLJ A;  1T05 A;  4KPY A;  4PKH A;  3SBT A;  3CD6 N;  3SJJ A;  2ZGZ A;  3LDL A;  3OVN A;  3RMA A;  3OY9 A;  3V1R A;  3JS6 A;  1KTQ A;  1SQK A;  3T3F A;  3VQP A;  5HRN A;  1GLJ O;  1CZA N;  4NLC A;  1VQO N;  3VA3 A;  3RR7 A;  3F9M A;  4NCG A;  4CEC A;  4OKE A;  4Z4E A;  1MDU B;  1IKX A;  4WQ4 C;  4HHT A;  3KK2 A;  3DLH A;  4OGE A;  2QWN A;  4AHC A;  4JKA A;  1U04 A;  5FPD A;  3E01 A;  2D0C A;  3DLB A;  3ZSQ A;  1JLQ A;  5LJW A;  4BR5 A;  1RFQ A;  2FLO A;  1P90 A;  4FM2 A;  2QKK A;  1NGB A;  1FKO A;  3HOS A;  5AZJ B;  4CIE A;  5AQG A;  4EAH D;  3THY B;  3L6Q A;  2V51 B;  1TAQ A;  1J9A A;  3KKR A;  3V9U A;  2KQ2 A;  3HPO A;  5SZT A;  3LDS A;  4DQ8 A;  3ZET B;  2A3Z A;  1I94 K;  3VA0 A;  4DG1 A;  1WSF A;  2O4G A;  1ASV A;  2HBJ A;  4E1M A;  1GLA G;  2JWL A;  2QWL A;  3B6P A;  3QNO A;  4JI3 K;  2E8A A;  4M3U A;  3NF6 A;  5AQR A;  3GE1 A;  4CFC A;  1VSK A;  3AGK A;  3KD1 E;  3KWG A;  1O1W A;  4HWI A;  4JAX A;  3HT3 A;  3TAQ A;  3CYM A;  3EKS A;  4DFJ A;  4CJT A;  3MX5 A;  2VG6 A;  1OVQ A;  4CZK A;  2OZS A;  3AGR A;  1SAZ A;  3S9H A;  4U7B A;  1J54 A;  3P83 D;  4BR0 A;  5C12 A;  5AZI B;  4QS9 A;  3K5O A;  4K41 A;  3HOT A;  3SNN A;  3DRP A;  3KTQ A;  1VSI A;  3WNF A;  1NLV A;  2B6A A;  1CLQ A;  4DV7 K;  4UQG A;  2YHX A;  1B92 A;  1GLE G;  2Q1N A;  2KZM A;  1NJW A;  5FRO A;  4H4M A;  5AZJ A;  4HUG A;  3FE1 A;  2P5O A;  4CHO A;  3THY A;  3FZM A;  1VSE A;  3K58 A;  4M3T A;  1IKW A;  1RT2 A;  3PSF A;  1YVU A;  3MX2 A;  1KAZ A;  1CZ9 A;  1VQ5 N;  4RW4 A;  4EHU A;  1F21 A;  5CHI A;  5HBM A;  3ZET A;  1FW6 A;  3NGY A;  3NH0 A;  3HK2 A;  3NF8 A;  3THV A;  3JSM A;  4CJR A;  3AVJ A;  4DLE A;  4J2D A;  3OS2 A;  4O4G A;  1HNW K;  3H45 C;  4N47 A;  2HMP A;  3CJ1 A;  1GLD G;  3I55 N;  1S1U A;  3I8D A;  1JLE A;  1NG9 A;  4Y1C A;  2IS3 A;  5M1F A;  1LV5 A;  3D6R A;  2F7T A;  2UXC K;  3MXM A;  1YJN N;  4JRP A;  1YAG A;  4JI4 K;  4FWP A;  3QEW A;  1NGA A;  5AZI A;  3CPW M;  3CQ8 A;  1N32 K;  2RE2 A;  3NF9 A;  4KV8 A;  4BE1 A;  4B1X B;  1VSJ A;  3CCQ N;  2HVI A;  2Q3S A;  3K5M A;  5FPE A;  2DTU A;  4DR4 K;  1IH7 A;  3KD5 E;  1TYQ B;  2O8E B;  4PA1 A;  3AAR A;  3LAM A;  4CF2 A;  5AQJ A;  4H8K A;  2E20 A;  5AQX A;  1NKB A;  4JI7 K;  5HRO A;  2ZJP L;  1VQ9 N;  2AP1 A;  3QIN A;  1ATS A;  4LF7 K;  4BG8 A;  5TKY A;  4GVM A;  2YI1 A;  4HCB A;  4HCC A;  4KI6 A;  3PIP L;  2KFN A;  2P9U B;  4QS8 A;  2GEL A;  3W3D A;  1DLO A;  2HBM A;  1RT3 A;  3OYM A;  3KLH A;  3PO5 A;  4FZX C;  5ELZ A;  3QBX A;  3CME N;  1SKS A;  3S3N A;  3HXM A;  1BIU A;  3L8B A;  3N4P A;  1HNZ K;  4YOX A;  4Y0W A;  3TAR A;  3P38 A;  3MWT A;  3LAN A;  4BRH A;  3OBY A;  1FJG K;  3FGU A;  4CEB A;  2G8H A;  2HVH A;  4BRI A;  3OYC A;  1M1K O;  5JVG L;  4BR9 A;  4FVU A;  1DTT A;  2YJE A;  1NK8 A;  3VF2 A;  4FJK A;  3GOI A;  3EYZ A;  4BRA A;  1FKP A;  3DAW A;  3TR8 A;  4FLV A;  4B9Q A;  2QWP A;  4BRO A;  5T7B A;  2GV9 A;  4DSL A;  4CJS A;  4PKG A;  3OYJ A;  1MWM A;  3AA2 A;  3EO3 A;  2QEX N;  4YFU A;  4Y1D A;  4CJE A;  4I6M A;  4AQY K;  3LM2 A;  4OX9 K;  1YIT N;  3I56 N;  3K59 A;  4OO1 J;  4OKJ A;  3OYF A;  4DR1 K;  4DSK A;  4M3X A;  4JD2 B;  1BQN A;  3BY5 A;  1SL2 A;  4B1Z A;  3AVG A;  5M1O A;  4ILG B;  4GVE A;  4JK7 A;  1ITG A;  1WN7 A;  2P9U A;  4F2R A;  4A62 A;  4F3T A;  1HMV A;  3VQC A;  1HPZ A;  2NNW A;  1CXU A;  5C25 A;  1T8E A;  1NNE A;  2P9K B;  4IWV A;  1Q9Y A;  1A5V A;  1EWQ A;  4CED A;  4O44 A;  4B3M K;  2A40 A;  2OPR A;  2E2P A;  4IJN A;  4LF6 K;  3VQB A;  1A5W A;  4JKD A;  4N56 A;  2OCE A;  4J2A A;  3THW A;  1Q18 A;  1U48 A;  4K25 A;  4DTX A;  2HND A;  5DM7 L;  1Z05 A;  4RCH A;  1WSH A;  2HBK A;  4JI8 K;  4ISG A;  4N76 A;  3H46 O;  3P1G A;  3ATV A;  3U8X A;  3IUC A;  4C23 A;  2P51 A;  3OYI A;  3VQ9 A;  2IGI A;  3ZYY X;  3M6G A;  3QIC A;  4MFB A;  4Z4C A;  1N6Q A;  1S9G A;  4AM6 A;  2A1S A;  4CIF A;  1BA0 A;  1JJ2 M;  1RT5 A;  2QTD A;  1HR0 K;  4I7F A;  1NGF A;  4JD2 A;  5HRR A;  3QO9 A;  3SQ2 A;  4AHV A;  4FWS A;  5GAD P;  3TAF A;  1BL3 A;  2YNH A;  5AQF A;  4U67 L;  2KW4 A;  1IJJ A;  4FO0 A;  3SCX A;  2HHU A;  2CGK A;  3SUQ A;  1ZBU A;  3CM6 A;  1BOT O;  2P9K A;  3PX0 A;  1HUX A;  3ZSO A;  2HHH K;  3THX B;  1XHZ A;  1EKE A;  4WFB L;  1TAU A;  4CHY A;  5GAE P;  4DQS A;  4G9Z A;  3L2R A;  4J2B A;  4FJ5 A;  3J8A A;  2G8U A;  3SJH A;  3O4Q A;  3PUF A;  4CHZ A;  1H1V A;  4K8X A;  4JK8 A;  3D2F B;  4B3S K;  4DV2 K;  2IDO A;  1C1C A;  4AH9 A;  5KTQ A;  3WNG A;  1YTU A;  2ATQ A;  5C15 A;  4CBX A;  2P9S B;  4GY2 B;  3S3M A;  2AA4 A;  2F9W A;  3G71 N;  1Y97 A;  3CJA A;  1NWK A;  1ZBF A;  3UKU B;  3NVM A;  1WSG A;  2GUI A;  2IIR A;  3TAP A;  3O1W A;  1ASU A;  1NMN A;  1BIS A;  4B9U A;  4AHS A;  4E7H A;  3O4N A;  1UA1 A;  3CCS N;  2IOC A;  3DJC A;  3OW2 M;  3CCU N;  1S6Q A;  5AQM A;  4W5R A;  4CHP A;  1D4X A;  4UY8 O;  1Z6R A;  4A2B A;  4BC5 A;  5EU7 A;  2ASO A;  4J8F A;  1K8A O;  1ILY A;  1RDA A;  1LAV A;  2FSK A;  3OYE A;  3ULD A;  2RKI A;  2RPI A;  3MEE A;  3THX A;  1TK5 A;  3OYG A;  1LOT B;  4IJA A;  1HX1 A;  3ZSX A;  4JV5 K;  2WUS A;  1HLU A;  4BRN A;  3MWP A;  2ASM A;  5LL6 Z;  2BTF A;  4ELU A;  4CE9 A;  3LPU A;  4RW8 A;  4NYN A;  4OVL A;  1T44 A;  4O0J A;  4JI6 K;  3D2F A;  1J53 A;  4IFV A;  4FJL A;  4E89 A;  4JS5 A;  4KHQ A;  4B8C A;  4DR5 K;  1YVN A;  4CZF A;  1IV0 A;  3VQ5 A;  5I3U A;  3VQ6 A;  4CEE A;  3F2K A;  5FPM A;  4DLG A;  1L3V A;  4KTQ A;  1TK8 A;  2X78 A;  4H4O A;  1OH7 A;  3QLH A;  4CJK A;  1EWR A;  1EXQ A;  2GUP A;  2YNF A;  1QSS A;  3AVH A;  3DOL A;  2V52 B;  1BCO A;  4ZTF A;  3DXK A;  2CGJ A;  5KPT A;  4K0K K;  3C7N B;  3DXM B;  4ILH A;  1QQO A;  4B8A B;  1UA0 A;  2OTJ N;  2J4R A;  4IXC A;  5M1N A;  2IVO A;  2O8D B;  3WUH A;  5ADX H;  3VTI A;  3HP9 A;  5GIP A;  5DK5 A;  2ZM6 K;  3O3G A;  5E41 A;  1HQE A;  1NK9 A;  4RW6 A;  2QWQ A;  1WSI A;  1ATN A;  3ITH A;  4JI5 K;  4H0X B;  4FLX A;  2W40 A;  4ICL A;  1DKG D;  3NFA A;  4BQZ A;  5BPM A;  3L3U A;  3SK3 A;  4LH4 A;  3LDN A;  2Y1I A;  2RF2 A;  1KD1 O;  1TUU A;  4H0Y B;  1C1B A;  2BE2 A;  3HPG A;  1QVG M;  4YOU A;  1KC8 O;  4CZH A;  3KK1 A;  4FWN A;  1M90 O;  4M3R A;  1X3M A;  2PYL A;  4CD1 A;  5TKW A;  4CF9 A;  5FRN A;  2XY8 A;  5AFU A;  4PL8 A;  3WXJ A;  2I7P A;  4RTF D;  3CCL N;  4FLW A;  4MO4 A;  4Z4I A;  1RIL A;  1IKY A;  1LAW A;  4LFA K;  3C7N A;  3DXM A;  5HLF A;  2HHX A;  1OKJ A;  2VWB A;  2YNG A;  1HYZ A;  3EEQ A;  2VQE K;  3J80 O;  1Q9X A;  1C0G A;  2UXD K;  2QWR A;  1FK9 A;  2O8D A;  1N5Y A;  4DV3 K;  2I5J A;  1XMQ K;  4B3T K;  1K8K B;  4CHN A;  4FJJ A;  3RMB A;  2FBV A;  4DCH A;  2ITM A;  2QWO A;  4O8U A;  5LMN K;  2F8T A;  4DS5 A;  1ASW A;  1KFD A;  1HJR A;  3KKS A;  3JXU A;  4CER A;  3T1A A;  1KFS A;  2FBT A;  5AQH A;  2ZJR L;  1RNH A;  3DLR A;  1OVY A;  3GDQ A;  3EL2 A;  1RGI A;  3OYD A;  4GKJ K;  3AVM A;  4JYA K;  1TKZ A;  3ZX3 A;  4J2E A;  3Q7C A;  3HTV A;  4B1W B;  4BR4 A;  1T03 A;  1KSP A;  3EN9 A;  2WTU A;  2W42 A;  2VGM A;  4OJR A;  5EX5 A;  4N5S A;  4NXM K;  1VRT A;  3UE5 A;  3VEX A;  1IG9 A;  5AQQ A;  1KLN A;  4FYD A;  4DR7 K;  3WT0 A;  3G0Z A;  3V9X A;  4FZY A;  4AM7 A;  3QB0 A;  4LSL A;  3ZT4 A;  2PY5 A;  3CQY A;  5KQ8 A;  3L2Q A;  3MEC A;  5AQP A;  4PUO A;  1YIJ N;  2G8I A;  1JXB A;  1OH6 A;  3SAG A;  3MMV A;  2CH6 A;  2YNI A;  2B5J A;  3FZL A;  4DU4 A;  4C8K A;  1K8K A;  1S72 N;  4E7L A;  2ZF5 O;  4KHN A;  2E2Q A;  1VK0 A;  2DFE A;  1YUW A;  3WQU A;  4F2S A;  2G8V A;  1VQL N;  3QEX A;  2A5X A;  3KVG A;  3R9P A;  1P8Z A;  3IAY A;  3L0Q A;  4DMN A;  3CET A;  3IKM A;  1NBW A;  3LPT A;  1X9S A;  1VQM N;  4Z4F A;  3O9T A;  3SQ0 A;  3WNH A;  1UWB A;  2WC9 A;  2QXL A;  1OH8 A;  4CHQ A;  1NKC A;  1W97 L;  3V9Z A;  3BDP A;  1Y64 A;  1HKC A;  5MLC Q;  1RTI A;  3O5B A;  4DSI A;  3VF4 A;  1VSD A;  3NCI A;  4RWT A;  1NJZ A;  4PL7 A;  4DS4 A;  1YHQ N;  2G8W A;  4V19 S;  4CIG A;  1NK6 A;  3BZC A;  4FZZ A;  2A1R A;  4A57 A;  4R79 A;  1SL0 A;  3AAP A;  3CI5 A;  4BQL A;  1NK4 A;  2OTL N;  1Z25 A;  3LAK A;  4I9Q A;  4YOT A;  1RBS A;  1BUP A;  4BRG A;  3DM2 A;  1BG3 A;  2FF6 A;  4E1N A;  3D0P A;  1NK7 A;  1HKG A;  3HP6 A;  3VGM A;  3PO4 A;  4B1V A;  3V6D A;  4DSJ A;  3O6W A;  2YHB A;  1JKH A;  4BRF A;  4IDK A;  3FZK A;  3A0I X;  4FCY A;  4B9S A;  3SMS A;  2PZS A;  1L3U A;  1R59 O;  2FBY A;  3KLE A;  1GOA A;  3VEY A;  3LDQ A;  4E0D A;  3UKR B;  2RHK A;  2WON A;  4JEP A;  1XUP O;  3ZX0 A;  5J2P A;  3QER A;  3IG1 A;  3HL8 A;  4ELV A;  2GWJ A;  4CGI A;  1IBK K;  1T3V A;  1V4T A;  4FWR A;  2NRH A;  5AQZ A;  4BC4 A;  4RW9 A;  4YDU A;  4KH6 A;  1ESV A;  3K2P A;  5AFU H;  4CCH A;  3C6H A;  1BCM A;  4IKF A;  4CJ7 A;  4G1Q A;  2QI2 A;  2PBD A;  4JHD B;  1YTA A;  3AVF A;  4C8L A;  4O5F A;  3ZX2 A;  5FRM A;  4BR2 A;  3OJS A;  4NO7 A;  4B1U B;  4BRQ A;  3BGR A;  3WEE B;  3HZ6 A;  5C2D A;  1KQS M;  1B9D A;  1JCF A;  3K0S A;  3MEG A;  3CF5 L;  1IO2 A;  4BC2 A;  3H08 A;  1N36 K;  1ZBS A;  2Q2R A;  1X9W A;  4FK0 A;  5HL7 L;  3RTV A;  1YI2 N;  3TAG A;  2XY5 A;  1JCE A;  4X66 K;  5JIC A;  3RMC A;  5AQT A;  4PY5 A;  4CVN E;  2DFH A;  1E4F T;  1RBV A;  1RCH A;  1VQN N;  3WXL A;  4NLB A;  4OPA A;  3O9S A;  3QIO A;  4I2Q A;  3E9L A;  1CXQ A;  2ZD1 A;  3UKR A;  3GL1 A;  1BQM A;  4BRL A;  2XY7 A;  3P39 A;  1C6V A;  4CZL A;  4CEO A;  3VEO A;  2H3G X;  3O8M A;  2Z1G A;  4FLZ A;  4OPK A;  4H03 B;  4I6M B;  3LDP A;  3OS1 A;  3M1F A;  3O9U A;  3PLA A;  1QQC A;  1RBU A;  1J6Z A;  4BWJ A;  1KVB A;  2UUC K;  1QSL A;  4CJV A;  2OZM A;  3AO4 A;  1WB9 A;  3OS0 A;  4BDZ A;  1T6C A;  2ZGY A;  4JHD A;  1KVC A;  4CJ4 A;  4OPH A;  4W5T A;  2DFF A;  2VWK A;  3TSU A;  4DTN A;  1I3A A;  1KVA A;  3NBP A;  3BF3 A;  4WE1 A;  2F8S A;  1YT3 A;  2X74 A;  5E84 A;  3J7Z O;  3O3H A;  2IAJ A;  1VQ7 N;  1QVF M;  1GLL O;  3WEE A;  3L2U A;  4DSE A;  1LCU A;  3VQA A;  2VYP A;  1Q8I A;  3RVC A;  4YOV A;  3THW B;  1VQ4 N;  4ZHR A;  3CCE N;  3CFP A;  2E2N A;  5AR0 A;  2VWJ A;  1XNQ K;  3AAQ A;  4A5A A;  4FJI A;  5BPL A;  3CCR N;  2YCH A;  2HNZ A;  3D2E B;  2NRZ A;  2OA8 A;  3DRS A;  3OBW A;  3LZI A;  5M1Q A;  5M1P A;  4Z0U A;  3CIP A;  3L4Q A;  4FWK A;  3AVA A;  3SUN A;  4JKB A;  3DI6 A;  1NGC A;  3VES A;  2JGU A;  2JLE A;  1I39 A;  4BE2 A;  4CJF A;  4FWQ A;  2O8F B;  2Q31 A;  4KB0 A;  3MED A;  4JKE A;  5KRT A;  1QZ6 A;  2LSN A;  1JLA A;  4EP5 A;  1HRH A;  4CGH A;  4LFB K;  3OHR A;  1K6Y A;  1TKD A;  1VQ8 N;  1BA1 A;  3BF1 A;  3U4L A;  3BZK A;  3LZJ A;  3QES A;  4AF1 A;  4FJG A;  3F5T A; 
#chains in the Genus database with same CATH homology
 4BC5 A;  2E2O A;  5KQD A;  5BRH A;  1KAX A;  1VQK N;  3TPQ A;  2A6A A;  2ASO A;  4J8F A;  1K8A O;  4YDU C;  1ILY A;  3MN5 A;  4KH4 A;  4WQ5 A;  2FSK A;  3I8B A;  3VOV A;  4H5W A;  5BN8 A;  1LOT B;  3O9R A;  3EE9 A;  4IJA A;  2VCP A;  3KHY A;  1HX1 A;  2KHO A;  2P9L B;  5AQI A;  3TU5 A;  2WUS A;  4H5V A;  1QZ5 A;  2HBL A;  5ADX A;  3LL3 A;  1HLU A;  5EY4 A;  4BRN A;  4IDH A;  3MWP A;  2ASM A;  2BTF A;  5AQV A;  2PAV A;  4WFN L;  4PKH A;  3SBT A;  2P9I A;  2IVN A;  4FL9 A;  4IO8 A;  3CD6 N;  1YJ9 N;  1T44 A;  2ZGZ A;  3D2F A;  3M5R A;  4CD3 A;  3LDL A;  1RDW X;  4BGA A;  3MCA B;  1YVN A;  3G25 A;  4CZF A;  5JVH L;  3JS6 A;  2HOE A;  3CC7 N;  3WXM B;  1SQK A;  4A61 A;  1Q7Y O;  3F2K A;  3U9Z A;  4KH5 A;  5F0X A;  3ID8 A;  3D2E A;  5FPM A;  1GLJ O;  1KAY A;  5M1K A;  1CZA N;  4NLC A;  1VQO N;  4O8K A;  3KZB A;  3FZF A;  2GTD A;  4JKG A;  2GUP A;  3TSP A;  2V52 B;  1X9J A;  3F9M A;  3HBT A;  3CC2 N;  3DXK A;  1U2V A;  2CGJ A;  1MDU B;  3VEN A;  1HPM A;  4WQ4 C;  5KPT A;  1E4G T;  2E1Z A;  3C7N B;  3D7E O;  3DXM B;  4ILH A;  4IEI A;  1QQO A;  5CE3 A;  2OTJ N;  2J4R A;  3C6A A;  3MK6 A;  4IXC A;  5M1N A;  3K9K A;  2IVO A;  2QWN A;  3WUH A;  5ADX H;  4JKA A;  3VTI A;  1NGH A;  2P9N B;  5FPD A;  5GIO A;  5GIP A;  4WYB A;  5LJW A;  4BR5 A;  3C0B A;  1RFQ A;  2FLO A;  4BRM A;  5GAG P;  3LDO A;  1P90 A;  1SZ2 A;  2QWQ A;  2GWK A;  1NGB A;  1NGD A;  3BP8 A;  4CZE A;  3HOS A;  1ATN A;  1NMD A;  2Q97 A;  2Q0U A;  4H0X B;  1T6D A;  3MDQ A;  4FWO A;  2FSJ A;  2GX9 A;  3CJB A;  1BO5 O;  4MLE A;  5AQG A;  3L6Q A;  4H0O A;  3P4I A;  3SBG A;  2W40 A;  2ZWH A;  5DM6 L;  2PFU A;  5BRD A;  2P9L A;  2V51 B;  1RDU A;  1DKG D;  4BQZ A;  5JLH A;  5BPM A;  3VPZ A;  3BUZ B;  3SK3 A;  4FWL A;  4DQ8 A;  3ZET B;  2A3Z A;  3QFP A;  3CJ7 A;  3LDN A;  4PKI A;  1KD1 O;  1TUU A;  4H0Y B;  3LM9 A;  4FOI A;  2HBJ A;  3FFK B;  4IZ9 A;  1GLA G;  2JWL A;  2QWL A;  2P9I B;  1QVG M;  5C0Y A;  1ZC6 A;  2HF3 A;  4YOU A;  5BR9 A;  1KC8 O;  2E8A A;  4CZH A;  4ISE A;  2D4W A;  5AQR A;  1S3X A;  3A5L C;  3GE1 A;  4FWN A;  4XH4 A;  1M90 O;  3AGK A;  4BR7 A;  1ZXO A;  4JNE A;  1X3M A;  3HM8 A;  3TTD A;  3KWG A;  1NM1 A;  3K9J A;  4HWI A;  4JAX A;  5TKW A;  2I7N A;  4CD1 A;  3EKS A;  3MX5 A;  3NMU A;  3O08 A;  3VEV A;  3CCV N;  4CZK A;  4FPA A;  4JK9 A;  1XQS C;  4PL8 A;  3WXJ A;  5AFU A;  3AGR A;  1SAZ A;  2I7P A;  4U7B A;  3CCM N;  2D0P A;  2V7Y A;  4RTF D;  3CCL N;  4MO4 A;  2CH5 A;  2NRT A;  5BRF A;  4BR0 A;  4XEI A;  5C12 A;  1JCG A;  2A41 A;  5AZI B;  3TSQ A;  3DXK B;  4QS9 A;  5KPR A;  3C7N A;  3DXM A;  4K41 A;  3HOT A;  1OKJ A;  2VWB A;  4GV9 A;  4A2A A;  1NGE A;  4CI6 A;  4CZJ A;  2NRW A;  1YXQ A;  4CZM A;  3CQX A;  1C0G A;  2A42 A;  2QWR A;  3TTF A;  1EQY A;  4BGB A;  2P9N A;  5CR4 A;  5LJV A;  4MDB A;  1K8K B;  1NLV A;  1NJI O;  1BU6 O;  5AQL A;  1BDG A;  1TYQ A;  2YHX A;  1GLE G;  3VGK A;  4DCH A;  2ITM A;  3ENB A;  2Q1N A;  2QWO A;  4DHY A;  5AQW A;  5BPN A;  4BC3 A;  2NRR A;  1HKB A;  3HSC A;  4O8U A;  4BRP A;  5AZJ A;  3FE1 A;  4IFE A;  1XC3 A;  3FZM A;  3MX2 A;  1KAZ A;  3JXU A;  1VQ5 N;  2VGN A;  4EHU A;  5CHI A;  4IO9 L;  5AQH A;  2ZJR L;  4MDA A;  2CGL A;  3GBT A;  1OVY A;  3ZET A;  4WQ5 C;  4CBU A;  1KXP A;  3EL2 A;  3GDQ A;  3O4W A;  1RGI A;  3ULE B;  5I9E B;  4YOY A;  3NVK A;  3KK7 A;  3ZX3 A;  3Q7C A;  3H45 C;  3HTV A;  4B1W B;  4BR4 A;  3A8Y A;  3MN7 A;  3EN9 A;  4BY9 C;  2HMP A;  4BVP A;  2VGM A;  3CJ1 A;  3KWI A;  4KBO A;  5EOY A;  5LY3 A;  1GLD G;  5EX5 A;  3I55 N;  4JKF A;  3ENH A;  3QFU A;  3UE5 A;  5M1F A;  4H0P A;  3EKU A;  3D6R A;  3VEX A;  5AQQ A;  4GV3 A;  4FWM A;  2F7T A;  1QQN A;  2Q0R A;  3WT0 A;  4H0T B;  1DT9 A;  4BRC A;  2FXU A;  4AM7 A;  5AQN A;  1YJN N;  3L4I A;  3QB0 A;  5GIN A;  3CQY A;  1YAG A;  5KQ8 A;  3S41 A;  4FWP A;  3E66 A;  5AQP A;  1NGA A;  3RSE B;  1YIJ N;  1MA9 B;  3QBW A;  2E88 A;  5AZI A;  3CPW M;  3WQT A;  1C0F A;  3H1V X;  4F9O A;  3SAG A;  2RE2 A;  3MMV A;  3IMX A;  1N8R O;  3MN6 A;  3W0L A;  2CH6 A;  4B1X B;  3FZL A;  3CCQ N;  4LC9 B;  5FPE A;  1K8K A;  3R8E A;  1S72 N;  2OAN A;  2ZF5 O;  1TUY A;  3IFR A;  1VQP N;  2JWK A;  2E2Q A;  1GLB G;  2YJF A;  1TYQ B;  3P31 A;  4M7X A;  5AQO A;  2D1K A;  3VEZ A;  1S22 A;  2ZJQ L;  1YUW A;  3AAR A;  3WQU A;  1NGG A;  3ZEU B;  3G6E N;  1YJW N;  1VQL N;  5AQJ A;  2E20 A;  5AQX A;  3SMP A;  3GG4 A;  3R3L A;  2ZJP L;  2A5X A;  3KVG A;  3R9P A;  1P8Z A;  3L0Q A;  3CET A;  3IKM A;  1NBW A;  3H6E A;  1VQ9 N;  2AP1 A;  1VQM N;  1ATS A;  2YX6 A;  3O9T A;  2FF3 B;  5TKY A;  4BG8 A;  2YI1 A;  3ULE A;  2WC9 A;  3PIP L;  2QXL A;  4M7Y A;  1BWF O;  2IVP A;  3CJC A;  1W97 L;  4K42 A;  1Y64 A;  4DKW A;  1HKC A;  5MLC Q;  1WOQ A;  2P9U B;  2GEL A;  3CHW A;  3O1B A;  3O5B A;  4QS8 A;  5AZJ B;  3W3D A;  3OA9 A;  4A5B A;  3VF4 A;  3CCJ N;  2HBM A;  2V7Z A;  3QML A;  4PL7 A;  4RWT A;  1YHQ N;  3SAH A;  4IOX A;  5ELZ A;  3R1X A;  5F1X A;  4A57 A;  4R79 A;  3AAP A;  3QBX A;  3CME N;  1NGJ A;  3CI5 A;  4BQL A;  2D0O A;  2OTL N;  1W2B M;  3N4P A;  4H5R A;  2QA4 N;  4YOX A;  4Y0W A;  3HI0 A;  4EIA A;  4YOT A;  1BUP A;  4M63 C;  3RSE A;  4BRG A;  3P38 A;  3MWT A;  4BRH A;  5AQU A;  3OBY A;  4C1N I;  3FGU A;  3O80 A;  1BG3 A;  2UYT A;  2FF6 A;  2WBN A;  4BRI A;  1HKG A;  1M1K O;  5JVG L;  4FOE A;  3VGM A;  4BR9 A;  3MN9 A;  4H5N A;  3DLL L;  4B1V A;  3PIO L;  4XH1 A;  4FVU A;  3O6W A;  2YJE A;  4L3Q A;  3CC4 N;  2NZT A;  1MWK A;  3VF2 A;  3GOI A;  4H0V B;  4BRF A;  4WFA L;  3FZK A;  3A0I X;  3SMS A;  4BRA A;  1R59 O;  5C2F A;  3DAW A;  4ISF A;  3WXK A;  3CJ9 A;  3LDQ A;  2QWP A;  3VEY A;  3UKR B;  2RHK A;  3ZEU A;  1WUA A;  4B9Q A;  4BRO A;  4JEP A;  2YHW A;  1XUP O;  4PKG A;  3ZX0 A;  1MWM A;  2HST A;  2GWJ A;  2P9P A;  2W41 A;  3EO3 A;  2QEX N;  1VAZ A;  1T3V A;  1V4T A;  4FWR A;  4BRE A;  4E1J A;  4I6M A;  2NRH A;  1VQ6 N;  2NLX A;  3LM2 A;  4YOW A;  4HTL A;  5AQZ A;  4GNI A;  2KLA A;  3I56 N;  2HF4 A;  1YIT N;  4OO1 J;  4BC4 A;  4BVO A;  4YDU A;  4JD2 B;  1ESV A;  2Q36 A;  3ENO A;  4KH6 A;  4EHT A;  5AFU H;  3VET A;  3C6H A;  4B1Z A;  5M1O A;  4ILG B;  4GVE A;  4JK7 A;  2P9U A;  4CJ7 A;  3C65 A;  2QI2 A;  2PBD A;  4A62 A;  1NGI A;  4H5T A;  2GEM A;  3FR0 A;  4JHD B;  2NNW A;  3VMF B;  3TTC A;  4O5F A;  4IEE A;  3ZX2 A;  2P9K B;  5AQK A;  4QS7 A;  4NO7 A;  3E9P A;  4BR2 A;  4IWV A;  4B1U B;  1K73 O;  4BRQ A;  3ATU A;  4PHT X;  4B1Y B;  5F2R A;  1QQM A;  3WEE B;  2A40 A;  4CBW A;  3HZ6 A;  4AF1 A;  5C2D A;  1KQS M;  1JCF A;  2BH1 A;  2E2P A;  2NRX A;  4IJN A;  3EE8 A;  5C10 A;  4JKD A;  3CF5 L;  4MLH A;  4BC2 A;  1ZBS A;  2Q2R A;  1Q18 A;  3BEX A;  3QDK A;  4K25 A;  4BG9 A;  4EFH A;  1V4S A;  5HL7 L;  1YI2 N;  4JKC A;  1JCE A;  2EWS A;  2DPN A;  3B8A X;  2NRV A;  3CER A;  5AQT A;  1U6Z A;  5EVZ A;  5JIC A;  5JMV A;  5DM7 L;  1HJO A;  1Z05 A;  4RCH A;  2P9S A;  1E4F T;  3H1Q A;  4XH5 A;  3VTH A;  4EAH D;  4Z94 A;  3G4S N;  1VQN N;  2HBK A;  4ISG A;  4NLB A;  4OPA A;  3H46 O;  3WXL A;  1Q81 O;  3O9S A;  4BRD A;  4WQ4 A;  3UKU A;  5BN9 A;  3E9L A;  1O13 A;  3ATV A;  3DWL A;  3U8X A;  2QWM A;  3IUC A;  4C23 A;  3O9Q A;  3UKR A;  3GL1 A;  3IDH A;  4BRL A;  1IG8 A;  1YF5 L;  3M6G A;  3QIC A;  3ZYY X;  5B8H A;  3P39 A;  1SS6 A;  4CZL A;  4AM6 A;  2P9P B;  2F9T A;  2H3G X;  3O8M A;  3N4Q A;  4FSV A;  1BA0 A;  2WFB A;  3VEO A;  3SLC A;  4NB4 A;  4CZI A;  4YOR A;  1JJ2 M;  4WCE L;  1QHA A;  4H03 B;  4I6M B;  3LDP A;  3M1F A;  3O9U A;  1Q82 O;  2FSN A;  2QTD A;  3PLA A;  5BRE A;  1J6Z A;  1GLC G;  1NGF A;  4JD2 A;  4DB3 A;  3UB5 A;  3T69 A;  3E1Y A;  3E9O A;  3AY9 A;  3A5N C;  4FWS A;  3H3N O;  4BRK A;  5GAD P;  4C1N K;  3T7Z A;  1T6C A;  5AQF A;  5FPN A;  4U67 L;  2ZGY A;  4JHD A;  1IJJ A;  4FO0 A;  1X3N A;  4MO5 A;  4OPH A;  3VF6 A;  2CGK A;  3VEW A;  2YHY A;  3A5M C;  1BOT O;  2P9K A;  3TSU A;  1HUX A;  3BF3 A;  4K43 A;  5EXW A;  3J7Z O;  5E84 A;  4WFB L;  3CPE A;  5GAE P;  5JLF A;  1VQ7 N;  1QVF M;  1GLL O;  4G9Z A;  3WEE A;  5AQY A;  3VER A;  4WF9 L;  1ATR A;  1LCU A;  4CZG A;  3J8A A;  4FPB A;  3SJH A;  4IOA L;  1GLF O;  5HOO A;  3R6M A;  1H1V A;  2VYP A;  4JK8 A;  3D2F B;  3RVC A;  4YOV A;  1VQ4 N;  3CCE N;  2E2N A;  2KKZ A;  5AR0 A;  5H1S Q;  1DEJ A;  3AAQ A;  4A5A A;  5BPL A;  3CCR N;  2YCH A;  5C15 A;  4CBX A;  2P9S B;  3D2E B;  3Q7B A;  2NRZ A;  4GY2 B;  3CXC M;  1Q86 O;  1K9M O;  3OBW A;  3I33 A;  2AA4 A;  2F9W A;  3G71 N;  5M1Q A;  5M1P A;  3CJA A;  1NWK A;  3EZW A;  3CIP A;  3NVM A;  3UKU B;  2IIR A;  3L4Q A;  4FWK A;  3CMA N;  4JKH A;  3A5O C;  4JKG B;  4JKB A;  3O1W A;  3WXI A;  4A59 A;  5E26 A;  5GAH P;  4IOC L;  4GV6 A;  1NGC A;  3MCP A;  3VES A;  5KPZ A;  4FWQ A;  1U2V B;  2QW9 A;  3FZH A;  3H3O B;  2Q31 A;  3HRG A;  3VGL A;  2QM1 A;  4JKE A;  5AQS A;  3SAF A;  3CCS N;  1QZ6 A;  1EO1 A;  3DJC A;  3FLC O;  2BUP A;  3U9D A;  3OW2 M;  3OHR A;  3CCU N;  1G99 A;  2ASP A;  5AQM A;  1VQ8 N;  1BA1 A;  3BF1 A;  3U4L A;  1D4X A;  3ID6 A;  4UY8 O;  3M3Z A;  2E1Y A;  4ILJ A;  1DGK N;  1Z6R A;  3F5T A;  4JN4 A;  4A2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...