2WC9A

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
b'VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TERMINASE LARGE SUBUNIT
publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wc9A00
2WC9A 4DKWA 2WBNA
chains in the Genus database with same CATH superfamily
1Q86O 2KW4A 1ILYA 4Z0UA 3L8BA 2HHXA 4CZEA 2W40A 2V7ZA 4OPHA 1OH5A 2ZWHA 2Q2RA 2B5JA 4O55A 4RCHA 3AVJA 2YHYA 1GOBA 3ZSOA 2NRTA 2BUPA 2W42A 3LP0A 2PBDA 3HM8A 4ISFA 3V9WA 2A42A 1CLQA 2Q0UA 5DK5A 3DLHA 3OY9A 1X9WA 1BCOA 2GX9A 4BRQA 1I94K 5M1OA 1HMVA 3U9ZA 3KD5E 3AO1A 4FJKA 3SAGA 3TAGA 3U6FA 2QI2A 4JAXA 2FSJA 1X9SA 3VQCA 1HYZA 5HL7L 3W3DA 5LY3A 1HUXA 4C8LA 3IG1A 3KLHA 1D4XA 3K57A 5TKYA 3I8BA 3JYTA 4CZMA 3UKUB 1QQOA 5AFUH 1XNRK 4CHZA 4DFJA 3N4PA 3OYBA 3PO5A 3QBXA 1JLEA 2FXUA 3DI6A 3ZT2A 4XH1A 2OYQA 3H3OB 4RW9A 3HOSA 4JHDB 4AHCA 4GV3A 1LWCA 1NLVA 2P9SB 3LDOA 4DWIA 4PKIA 4C1NI 4FVUA 2HW3A 2WTUA 3T3FA 3V9SA 3TU5A 2GUIA 3TAPA 5D3GA 5KI6A 2E4LA 4KH6A 4NXMK 4DTOA 4WQ5A 3TAQA 3K58A 1L3TA 4X65K 1K8KB 4N47A 4R79A 5SZTA 3FFIA 3PIOL 5HLFA 1GLAG 3SNNA 4KTQA 1VSEA 4GVMA 1JL2A 1W9HA 5AQZA 3VQDA 4YDUA 4GKKK 1BIUA 3OYLA 3C94A 2P5OA 3RMAA 4MLHA 3SV4A 1LW0A 3ZYYX 4B1WB 4O44A 4OGEA 4CBXA 1DEJA 3H08A 1YIJN 2F9TA 2RF2A 1S6QA 3LWMA 3C6TA 3OBYA 3LALA 3MDQA 4H0XB 5KRTA 4HUEA 3MAQA 3SLCA 1XC3A 4FZYA 4EHUA 4W5QA 2KFNA 1Q7YO 4E1MA 4YOTA 3MN9A 3CC2N 2P9UB 4FLXA 5GAHP 3HZ6A 4NO7A 3M8RA 2IIRA 1S9GA 1RDWX 4W5TA 2FBXA 1XC9A 3KWGA 4EZ6A 1Q81O 1REVA 2E2QA 5AZJB 3FZMA 2YNIA 2IAJA 4CGGA 2JWKA 4CJFA 4RWTA 1NM1A 2HHHK 3BZCA 4OLBA 4JLHA 1KRPA 3VQEA 1Q9XA 3CC7N 5FPDA 4Q0BA 3VQ7A 2CH5A 1YJWN 4F3TA 3V4IA 1LV5A 4LSLA 4G1QA 1NBWA 4WE1A 1VSLA 5AQJA 2NRZA 4CHPA 4DR3K 3AAPA 4O8KA 3GDQA 3PSFA 3JS6A 3EN9A 4CEFA 4CGDA 3VQQA 2CGKA 4GVEA 4NCBA 1ZBFA 1U45A 3SUQA 1IG9A 3DXKA 3AA3A 4B3SK 3LDSA 1S1TA 3CI5A 5FROA 3TWHA 3O4NA 2UXDK 4BREA 5HRNA 1KCFA 3SQ2A 3QETA 2F7TA 5KQ8A 4N76A 1T03A 4ZTFA 4BR5A 4CGIA 4CF9A 5AQGA 3MEGA 3D7EO 2NRVA 3P83D 3DXMB 3CCLN 4LF9K 3AY9A 4DKWA 3CJ7A 3LL3A 4QOZB 4KREA 3MCAB 3NGIA 4EFHA 1S1XA 1NGBA 5KPZA 1GLEG 1HX1A 4NB4A 4NXNK 1HLUA 3EKUA 4M3ZA 3HPOA 5T7BA 4J2EA 5JVGL 2P9IA 4KH5A 5F0XA 3WQTA 4CHQA 1HQUA 3HL8A 1S5JA 2HHQA 1IJJA 4OGCA 2NLXA 3KK1A 3NGYA 3GOIA 3OHRA 3OYEA 3KHYA 4M3RA 2ZM6K 4M3WA 1C0FA 1NK5A 5FRNA 4FJNA 1J5EK 1WSEA 2YCHA 3MXMA 1VQ9N 3LP2A 1L3VA 3PX6A 1RDAA 2PZSA 3VQPA 3E1YA 4BC3A 1LWFA 5C2DA 4FM1A 3V1OA 1U48A 3F73A 1HNWK 2GWKA 4CJ3A 2W41A 4LFAK 4YOYA 1U6ZA 1KC8O 1Q8IA 3O80A 1MA9B 3V1QA 3V6DA 2ZQBA 1S22A 4CGFA 1JLQA 3DWLA 4JI2K 3SMPA 3LAMA 4JI6K 3M6GA 2W6LA 4PQUA 4JNEA 4AHRA 2H3GX 2VCPA 3ZETB 3K59A 3IS9A 3DYAA 1Z05A 1NGHA 1LAWA 1VSHA 4F3OA 2ZGZA 4AH9A 4CJQA 1TGOA 4JEPA 4CK3A 3IRXA 1ZC6A 4FLZA 1T05A 3O1BA 2P9PB 4Z4GA 5HRPA 1SL0A 4HWIA 4WYBA 3G0ZA 4KTZA 3ISNC 3HPGA 1TAUA 4KV8A 1OVYA 2QEXN 1RDDA 4FW1A 4AF1A 3OBWA 2A1RA 3EO3A 3VPZA 2FC0A 1MDUB 4BRMA 3M5RA 3CJCA 4W5NA 4KO0A 3QEIA 4PWDA 4CF8A 1QE1A 2QXFA 4H4MA 2EWSA 1RFQA 3UKRA 3SQ0A 2E5LK 4BRPA 4I7FA 3TTCA 1ATRA 4GNIA 1NJIO 3J81O 4YHHK 1QQMA 4O5FA 1OKJA 4DUZK 2FBVA 3KLEA 3NF6A 3HO1A 1BU6O 3O6WA 4GV9A 4M7XA 3CCJN 1HJRA 3LDNA 4WCEL 3HYFA 4DTNA 1SS6A 5BR8K 3QLHA 3WNGA 4IXCA 4BR7A 4CZLA 4W5OA 1QTMA 1VSDA 4B9SA 1HKBA 4BWJA 3CCSN 2JGUA 3P31A 3CPWM 4JI0K 1GLCG 3E66A 3MX2A 3TANA 3BF3A 3SUOA 2HOEA 3OYMA 3VF6A 4XH4A 1RDBA 5C10A 3MXIA 4KKOA 3SJJA 2VWBA 5HOOA 4DTSA 3J80O 4OPKA 4DV3K 5EOYA 4CJ4A 4YOWA 2P9KA 4LF5K 1NK9A 3SZ2A 1IKWA 1RT1A 3O8MA 3M3ZA 1KFDA 3BUZB 2OPPA 4Y1DA 4FJIA 3TSPA 3LDPA 4DU1A 4B9QA 4MDBA 3ZCMA 4B9NA 2Q97A 1WSFA 1L3SA 4BE1A 1VQ7N 2O8CB 4JKDA 4CZHA 2G8IA 3FZKA 4K8ZA 3CCRN 5EX5A 3QERA 1N5YA 1BHLA 4JD2A 2CGJA 3LP1A 5HROA 2VG6A 2X6SA 4IWVA 1TL3A 4FJ7A 4J8FA 4FWKA 3RMDA 3VEXA 4F2SA 4LD0A 3CM5A 4JRPA 1U47A 3VTHA 3RSEA 3PX4A 3LPUA 3QFUA 4OLAA 1XI1A 1NGEA 1B92A 2HF3A 1YAGA 4M7YA 3OYNA 2QWOA 1NGFA 2Z1HA 4M45A 1YJ9N 1JCFA 5GAEP 1BI4B 2O8DA 4CZFA 2D0CA 1VSJA 2KZMA 3CCMN 3LPTA 5FDLA 2RPIA 3RRGA 5GINA 3E9OA 4JK8A 1KXPA 1ZBHA 5M1QA 2WC9A 4E7JA 3K5NA 5FPMA 1Q82O 4DLGA 2VYPA 3NDKA 1DKGD 4B3TK 1HKCA 3FFKB 1NGGA 3S9HA 2A41A 4DSLA 1ZBSA 2HBKA 1FJGK 2RE2A 4M41A 3CM6A 1TYQA 3R1XA 3R3LA 4JI5K 2ZD1A 4FLVA 1N34K 5JS1A 1BOTO 5EU7A 5AQNA 2QA4N 3AVCA 2GELA 5AQKA 2P9LB 2WUSA 4MFBA 1C0MA 1QVFM 3EYZA 3LM2A 2QKBA 4LSNA 1ASUA 1T7PA 2E1YA 5BPLA 1T44A 3R9PA 4AHUA 3U9DA 4WQ4C 3PX0A 3WNHA 4R5PA 2HBLA 2XRIA 2AA4A 5AQPA 3RRHA 1NK0A 2E20A 5M1NA 1C1BA 3U4LA 4JKHA 5LMUK 2PYLA 2NRWA 4CBWA 3VGLA 4DFMA 1SKWA 1TK8A 3Q7CA 4BC4A 4CGJA 3KLGA 3CMEN 2RHKA 2UYTA 3QNOA 2O8BB 3QFPA 3NVKA 4BG8A 5E84A 1CXUA 4BWMA 4IG3A 3AVLA 1XMOK 3CPEA 3VF2A 4YNQA 2YI1A 1TKDA 3AVMA 3OYFA 5CR4A 1S9EA 2ATQA 4FWOA 2B4JA 4B9MA 3K0SA 5KPRA 5DMRA 3QINA 4DV1K 1NJZA 2HHTA 4L3QA 4CZIA 3MMVA 3MWTA 2ZGYA 3C0BA 1LCUA 3K5LA 1SKSA 2D0AA 1EWRA 2V7YA 1DT9A 2XY7A 2RKIA 1X3MA 5AZIA 1KAZA 4HTLA 3FLCO 3ULEA 5CHIA 1ASVA 3BZKA 2GUPA 4GKJK 1TL1A 1WN7A 4FM0A 3EL2A 4ID5A 4JKAA 4IDKA 1WUAA 3S41A 1M90O 4YORA 3IAYA 4EAHD 3A5MC 1BG3A 3HRGA 1UOCA 4CEZA 4KI6A 1X3NA 2A6AA 1HRHA 4ILHA 5KPTA 1HNVA 4PUOA 1TKTA 4H5NA 2YKMA 3QEPA 2NZTA 1ITGA 1U2VB 1BWFO 2FBTA 4DU4A 1NKBA 3HT3A 3OS0A 5AQVA 3DAWA 3T7ZA 3LZJA 2QWRA 4HUFA 3KKSA 1D9DA 4IDHA 4KHQA 4M3XA 4FYDA 3ZSZA 3ITHA 3ENBA 3KD1E 4CJWA 3TSQA 4CFAA 4FOIA 3L2UA 1GLJO 3WNEA 2E2OA 4BRLA 1RBTA 2P9NA 3C7NA 4JKBA 4F4KA 1QZ6A 3WEEA 4E7HA 3U3GA 3VQ6A 2XO7A 4A2AA 3THYA 3VEYA 1RBSA 3OA9A 1XUPO 2ZJPL 5GAGP 3T1YK 4DTPA 2IGIA 4A57A 4DR1K 3UIQA 3PY8A 2R7YA 1U49A 3AVNA 2NRHA 3IDHA 5IWAK 3O4QA 4CD1A 4AQYK 1RBUA 3B8AX 4FPBA 2OTJN 1VSIA 2HBMA 2P51A 5C24A 4BR2A 4FJLA 3CCVN 1OVQA 5KGWA 3THXA 3NVMA 4QS7A 2X6NA 4IZ9A 2HHSA 3D2EB 3SQ1A 2O8FA 4IG0A 1RTIA 4CEBA 4OX9K 1IO2A 4H5WA 1Z6RA 3DXKB 3EZWA 1WBDA 4H0PA 1YVUA 4FWSA 3CFRA 4JKFA 4FW2A 4BRGA 4PL8A 1N32K 3AO4A 4QAGA 3VEWA 5CZ1A 5M1PA 4FJ5A 1IKXA 4KTWA 4BRIA 3OYDA 4X66K 5C25A 2G8VA 4A62A 4CJUA 3K5OA 3LANA 4IOAL 3KLIA 3O9SA 1XWLA 1TV6A 2IC3A 5EY4A 4Z4IA 2WBNA 3EE9A 5AQSA 1TK0A 2ZF5O 5AQYA 3V9UA 3O08A 4O0IA 4KHPK 1MWMA 4IFEA 4M63C 5EXWA 4DHYA 4CD3A 3HK2A 2VQEK 4DTJA 3NGZA 2Q1NA 2F4VK 1C1AA 1KVCA 3FZLA 2FSNA 3NBPA 5BRFA 4YOXA 4B9VA 4JKGA 1IKVA 4HCBA 2G8FA 4FL9A 1TUUA 1K9MO 3GG4A 4FJHA 3L4QA 3ATUA 1HPZA 1KLMA 4H0OA 3LZIA 1G15A 3MK6A 4DUYK 1BISA 4UY8O 1RT7A 3ULDA 1UAXA 2HMIA 4F8RA 4PA1A 4C1NK 3JAMO 4FWNA 3U3YA 3WXLA 5HRSA 1S1VA 4DFPA 1S1UA 1YF5L 4DV2K 4BE0A 4C8OA 1VQNN 4JI7K 4BRNA 2IDOA 2Q31A 5AQWA 3TAMA 3C6UA 3K9KA 3GL1A 3K9JA 1H1VA 2PY5A 3CJ9A 5BREA 4DTRA 1YITN 3ALYA 2D5RA 1DLOA 4LFCK 5FPNA 4HHTA 4B3OA 4WFNL 2PFUA 2X78A 4BROA 3KVGA 3NFAA 1WSGA 1CZBA 3O9QA 4JN4A 3UKUA 1VQ4N 4FO0A 4J2DA 4B08A 4FXDA 3WXMB 4B1UB 4OPJA 3DLLL 3H46O 2DFHA 4IKFA 1WBBA 5HP1A 4LF6K 4DG1A 3PIPL 3BGRA 3SAHA 4FJXA 3SBTA 3SPZA 1W97L 2HBJA 2P9SA 4U7BA 4XIUA 3OYCA 1ZXOA 4CZGA 3QICA 1NU0A 3IMXA 3SUPA 1KQSM 1NMNA 3ZSVA 5BRDA 3DLRA 4FLYA 4FJJA 3L4IA 3QO9A 2YKNA 5KGXA 1HJOA 3OTOK 3A5LC 3OYHA 3OW2M 5J2MA 5MLCQ 5ADXA 1ATNA 4IEIA 2Y1JA 1W2BM 5AQFA 1K8KA 1FKPA 4ZHRA 4FLWA 3AVGA 3L2RA 1JJ2M 4CGHA 2HSTA 1Y97A 4CF2A 3G4SN 1BQMA 4O8UA 4KAZA 4B8AB 4CJTA 3QB0A 2ASMA 4FZZA 2UUCK 5CY4A 5GIOA 3DOLA 3ZT3A 2ZJQL 2NNWA 4RW6A 1YHQN 3KK3A 4JV5K 4QS9A 1IBKK 4AM6A 2B6AA 1VSKA 2QWQA 3ZEUA 3DRPA 5JMVA 4CFDA 1YTUA 2I5JA 2P9UA 3ZLJA 3SMSA 3RVCA 4ELTA 3NMUA 1VQPN 3CCEN 3ZT1A 1K6YA 4DV5K 4JI1K 5TKWA 4LF4K 1C0UA 2UUAK 2QW9A 4I6MB 5LMNK 4NLBA 4DQQA 5JLFA 5AZJA 2D0PA 1ZYQA 4A5AA 4ISGA 4BQLA 1J6ZA 2VGNA 4YDUC 4JD2B 4BDZA 1C0TA 4DQRA 4Z4FA 3CJ1A 2OTLN 4DQ8A 4A61A 3F2KA 1YTAA 2Q36A 3HVTA 3CMAN 3HSCA 2UU9K 3FE1A 1NGIA 3DMJA 3OYGA 4KI4A 3E9PA 4WQ4A 4Q5VA 5AR0A 4NLCA 1SKRA 4FZXC 3F9KA 4B9UA 5KTQA 2ITMA 4K0KK 1RDUA 4G9ZA 4MLEA 3AVAA 4JKCA 2O8EB 2QTDA 2Z1IA 2FSKA 1TKZA 3S3OA 1OH8A 3AA4A 4CJVA 1A5VA 2VQFK 2F8SA 2YNGA 3TARA 3DXMA 1MWKA 2ETJA 1VSMA 2J4RA 3SI6A 4LF8K 3DRSA 2PYJA 4BRDA 4LH5A 1WSJA 3F5TA 1NGCA 2QK9A 3V9ZA 1VQKN 1RT3A 1S72N 3THVA 3MEEA 1K73O 1HKGA 3JSMA 4FLUA 1VQ6N 2OCEA 2PAVA 1M1KO 3M8QA 1VHXA 3P39A 5LL6Z 4M3TA 4AHSA 3OYKA 1CZAN 5ELZA 4DR5K 2D4WA 1JKHA 2I7PA 2GV9A 4BR9A 4ELUA 4DR2K 1KAXA 3I33A 4RW4A 4OJRA 1SV5A 4H5TA 4CK1A 3LDLA 3SAFA 3KIOA 4FWQA 4FM2A 1SQKA 4BVPA 1VQMN 1HQEA 3NH2A 3LWLA 3D2FB 3O4WA 4NYNA 4DF8A 1KD1O 1T8EA 3MX5A 3NH1A 4CEDA 1XMQK 1RGIA 3MN7A 5LJWA 4LF7K 1HYVA 2FF3B 4BC2A 4KHYA 5DM7L 3A8YA 3DLGA 1NKEA 2G8HA 1VQON 1HR0K 1B9DA 4FSVA 3L2WA 4K8XA 1NK8A 1SUQA 3B6PA 2VG7A 3V81A 1G99A 4BC5A 5E41A 4Z4EA 1WAJA 2YHBA 3CC4N 2EX3A 1Q18A 2P9PA 3BF1A 5AQRA 2BDPA 4BRCA 2IVOA 4CJSA 4E3SA 2A3ZA 3ZSRA 2HHWA 2BGGA 3K2PA 3QIOA 3KZBA 3VETA 3G71N 3CFPA 1QHAA 4CEQA 4DV7K 4BACA 1RBVA 3NAEA 4I9LA 1S1WA 3AO2A 1KVAA 1ZBIA 1JXEA 3KTQA 2E2NA 1Z25A 1OH7A 4XH5A 5JICA 4GV6A 3WUHA 4CZJA 4BQZA 5J1EA 3HI0A 1R59O 4IJAA 4CK2A 3CQYA 1HNZK 5AQHA 4BRFA 2D1KA 4C23A 4CHOA 1T3VA 1KAYA 5J2NA 3LM9A 3RR8A 3CQ8A 3I0RA 4CVNE 4MDAA 3SV3A 4M3UA 1N33K 4BGAA 3WEEB 3RWUA 2HHUA 2G8UA 4E19A 3OYAA 1LW2A 4DLEA 3VEZA 4H4OA 5B8HA 5CYMA 5SWMA 4YFUA 1BL3A 1VSFA 4BG9A 3OS2A 2IVNA 4WF9L 4CBUA 4EZ9A 3VQ9A 3TTDA 1C6VA 4ICLA 3WXJA 3HPHA 4KHWA 4B1VA 3GBTA 2A40A 3L6QA 3D45A 3I0SA 3VF4A 4OKEA 1JXBA 1TUYA 4B8CA 4BRAA 1GLDG 4K43A 2KFZA 3DM2A 1VRTA 3K5MA 5J2QA 4C8NA 2G8WA 4QS8A 3DRRA 2O8FB 1RTDA 2E6MA 1SAZA 4KBOA 3MWPA 3QESA 1JLCA 5JVHL 3SCXA 3ATVA 2GWJA 2BH1A 2QXLA 1T6DA 1I39A 3O9TA 4JI4K 3M8PA 3ID8A 1JCGA 2Y1IA 4CF1A 4RW8A 5K14A 2W6KA 4JS5A 3SJHA 3VESA 4CFBA 4JYAK 3QEVA 3SPYA 3BY5A 5BN9A 1A5XA 3HSTB 4YOUA 1U04A 2OA8A 1R0AA 1WAFA 2VGMA 1WSHA 2HNZA 3FZFA 4CJKA 1SL1A 4F9OA 3IUCA 3KJVA 4DSEA 1B9FA 2HB5A 4JK7A 3HOTA 3PO4A 4E1JA 1BI4A 1YI2N 3UE5A 3ZT4A 2YNHA 3VENA 4JKGB 4H0YB 5E26A 1W7AA 1IBLK 1TKXA 1JLAA 1GLFO 2CH6A 1NK7A 4A2BA 3SYZA 3OYIA 3PLAA 3C6HA 4IEEA 2P5GA 1NGAA 2ZE2A 1KSPA 1QQCA 5I9EB 1GOAA 4FJGA 3O1WA 1ASWA 4CCHA 3OYJA 1TAQA 3VEOA 2OANA 3CJBA 4CE9A 3DJCA 2P9LA 2VWKA 2KKZA 2XY8A 1BGXT 5I3UA 4DSKA 5AQXA 3AA2A 1IKYA 3PSIA 3O3GA 5ADXH 3ZX2A 4L8RB 2ASOA 1NG9A 3AO3A 3NF7A 1EX4A 1VRUA 4JRQA 2OPSA 4X64K 3NH0A 2Q0RA 2QM1A 3KKRA 3VOVA 4DSJA 1BO5O 3NF9A 4DTUA 2YHAA 4CHNA 2O8BA 2BTFA 3EEQA 1IH7A 4EIAA 4DR4K 5DM6L 4Z4HA 4CJ5A 4YOVA 4FWLA 4Y0WA 5KQDA 4KH4A 3OS1A 4FOEA 1D5AA 3F9MA 4DTXA 4DTMA 3B6OA 3VA0A 4FPAA 3VQ4A 3D0PA 1BQNA 3THWA 2NRRA 4FVMA 2OPRA 4N56A 3VQ5A 2VWJA 2XY5A 3A5OC 4F2RA 1EQYA 1V4TA 1A5WA 3G10A 4Z4CA 4K42A 1TVRA 4IBNA 4I2PA 1KTQA 4JK9A 2YJEA 3ZSQA 2YNFA 3AVFA 3FZHA 3T1AA 4E7KA 1L3UA 1RT4A 3AGKA 5HBMA 1O13A 4PY5A 2XHBA 3LP3A 2P9IB 3MXJA 2UUBK 2YHWA 3MECA 4Y1CA 3KK2A 3RMCA 3WNFA 4DV4K 1V4SA 4DCHA 4EHTA 4B1ZA 3H45C 1XHZA 1HYSA 1YVNA 2KQ2A 4A59A 1U2VA 1U4BA 3FR0A 1QHTA 2D0OA 1XQSC 2NUBA 2JWLA 1P90A 5BR9A 3EE8A 3OJUA 3TI0A 2EHGA 5BN8A 4H0TB 4BRKA 3I55N 3DLKA 1ESVA 1Q9YA 1E4FT 3N4QA 4B1XB 4CEEA 4IOCL 3ZX3A 3OJSA 3ZEUB 4J2BA 1JCEA 2V52B 4HVJA 3M1FA 1JLFA 4PL7A 1DGKN 1L5UA 4CFCA 1Y64A 4ISEA 3H6EA 1IBMK 1QSLA 1UA0A 1WSIA 3T1HK 1XHXA 4B3RK 1VAZA 3U8XA 4LY7A 4CIEA 4PKHA 1EWQA 4H0VB 4AILC 1VQ5N 4C8KA 4KFBA 5JS2A 3J7ZO 1XNQK 4LFBK 2Q3SA 1QZ5A 4H5RA 3CHWA 5BPMA 1FKOA 5GIPA 1D8YA 2OZMA 5AQLA 4CZKA 5AQOA 3VA3A 4KPYA 4KB1A 5C0YA 4WFBL 1BUPA 4E7IA 4B3MK 3IKMA 3L3UA 4O5BA 5CYQA 2WFBA 3C95A 5AQIA 5FRMA 1P8ZA 1X9MA 3CERA 5BRHA 3E9LA 2FF6A 3J8AA 3PV8A 3ENOA 3DOKA 1QS4A 4LC9B 4DR7K 4NCGA 3ZT0A 4JHDA 3I8DA 3UKRB 3D2EA 3AVHA 3KWIA 4KRFA 4V19S 4FJ8A 2OZSA 1NJXA 2KZZA 3L2VA 1J54A 3TSUA 3VGKA 4E0DA 3HM9A 3FGUA 3MN5A 3L0QA 1TK5A 1I3AA 5A2QO 4OKKA 4W5RA 4DV6K 1NJWA 1F21A 3O3HA 4DFKA 1X1PA 1C1CA 3I56N 3KK7A 3QEWA 3G6EN 2XY6A 1KFSA 5BPNA 1SL2A 3OVNA 3S3NA 3MEDA 3QNNA 2E88A 4X62K 3DLBA 3BDPA 3O3FA 4YY3K 2G8KA 1C0GA 1IV0A 4GMJB 4N5SA 2GBZA 4OO1J 3ZSWA 5AFUA 3SBGA 4IFVA 1BIZA 3Q7BA 3ID6A 1JL1A 2Z1JA 2P9KB 4CEOA 2DTUA 4U67L 3V9XA 3S3MA 4BGBA 4BVOA 3WT0A 1BCMA 2LSNA 3MN6A 4JI8K 4BDYA 1GLBG 3TAFA 1D9FA 3T69A 1JLBA 2FBYA 2OPQA 4E7LA 4BDPA 2NRXA 1BA0A 3ZX0A 3AA5X 3J7YP 3AO5A 2RN2A 2YX6A 4WQ5C 3TR8A 4J2AA 5F2RA 2HVHA 4FWRA 3NF8A 3GE1A 1RBRA 3R8EA 3CD6N 5F1XA 2P1JA 5FLXO 1NGDA 1J53A 2FLOA 1GLLO 3IFRA 4HUGA 4O0JA 4ZTJA 4H5VA 3T19A 3G25A 4KHNA 4Z94A 2WOMA 2BANA 4DQSA 3RSEB 2QWNA 1RILA 4CJPA 3HP6A 4DF4A 4DS5A 1RCHA 3HXMA 3VQBA 5IT9O 1LAVA 4FWPA 1UWBA 3TPQA 4NCAA 3O9UA 5EVZA 5GADP 4ID1A 2HNYA 3QMLA 2O8DB 3LAKA 3TTFA 4PKGA 3P1GA 3P4IA 3L2QA 4ILGB 4CERA 3E01A 1KLNA 2YHXA 4CEAA 1DTTA 1IG8A 1ZBUA 3R6MA 4TSXA 1NMDA 4FJ9A 4LH4A 4DB3A 1NWKA 3ZSXA 3RTVA 4CJRA 3VEVA 1EXQA 3EKSA 4RW7A 2F8TA 3H1QA 3A0IX 2ITGA 4FLTA 1TYQB 3AVIA 3CYMA 3VQAA 2IVPA 3H1VX 3AVBA 4OKJA 1S3XA 2GTDA 3P38A 4H8KA 5KRSA 1GOCA 3AVKA 3VERA 4I2QA 1BDGA 4CF0A 4AHTA 1K8AO 1WNSA 1CXQA 3SQ4A 2A5XA 2A1SA 3O5BA 3VN5A 5JLHA 4K41A 3BEXA 5AJ3K 2AP1A 4EP5A 1J5OA 1YUWA 3C65A 1MU2A 2QWLA 1CZ9A 3M8SA 1J9AA 5C42A 1NGJA 2QWPA 4IJNA 1NK4A 4BR4A 4QCLA 1E4GT 1YJNN 3KLFA 5M1KA 4BR0A 5C12A 2ZJRL 4ILJA 4BRHA 3CCUN 1NNEA 3LDQA 5AQMA 4AM7A 4OVLA 4FWMA 4DSIA 1LWEA 3EY1A 3NHGA 1Z26A 2E8AA 4E1NA 2DPNA 1O1WA 3HBTA 1NJYA 3EZ5A 3HP9A 3WXKA 3ZETA 1QVGM 1N6QA 5AZIB 2KTQA 5C15A 3AGRA 1ZBLA 2IOCA 4I6MA 4FCYA 3CETA 3A2FA 3ULEB 4JS4A 4E89A 4FK2A 2YV0X 4HTUA 4MO5A 2DFFA 4IO8A 3QEXA 4BY9C 2UXBK 3P5JA 3H3NO 3CCQN 4CJ7A 4DV0K 3VGMA 3NE6A 1FW6A 1RTHA 1VQLN 4IO9L 1WOQA 3VQ8A 5CZ2A 3W0LA 3CIPA 4O4GA 4DSFA 5LJVA 5J2PA 3O9RA 4FK4A 4K25A 4KHSA 2ASPA 3PUFA 3VMFB 1SZ2A 3WQUA 1HNIA 1VK0A 4IOXA 4CIFA 2UXCK 1T6CA 1RDCA 3HJFA 1RT5A 4NYFA 5AQQA 1EP4A 4DS4A 4CECA 4MO4A 4PHTX 1N8RO 4AHVA 2HNDA 2BE2A 3JXUA 2AJQA 2HHVA 3HVRA 2O8EA 1RT2A 3RR7A 3QIPA 4CIGA 1VQ8N 4CESA 2Z1GA 3MCPA 1FXXA 4XEIA 4KB0A 3CF5L 3SUNA 4C8MA 1UA1A 1QSYA 2E2PA 2VG5A 2P9NB 3C7NB 4GY2B 4JI3K 1S6PA 4FK0A 2E1ZA 4UQGA 2GEMA 1LOTB 5AQTA 3THYB 4HCCA 3CQXA 1OH6A 1YT3A 2E6LA 1X9JA 4A5BA 3TABA 1EETA 4WFAL 4DR6K 4JKEA 2I7NA 4B9LA 4DQIA 3QDKA 1QSSA 2DY4A 4CJEA 1QQNA 4FJMA 4EP4A 5H1SQ 5I42A 2F96A 1NKCA 1NOYA 4RTFD 3AARA 1KVBA 4B1YB 4CI6A 1RT6A 3THXB 3CJAA 4RG8A 2D0BA 4CW7B 5C2FA 2WONA 3AAQA 3A5NC 2HMPA 2HF4A 5AQUA 1E3MA 2HVIA 3CG7A 4DQPA 2KLAA 2QWMA 3D2FA 1HPMA 2X74A 2DFEA 2KHOA 2YJFA 4IFYA 3ASMA 3DLEA 1FK9A 3RMBA 1JLGA 4KHUA 1DTQA 1EKEA 3ZSYA 4CHYA 3BP8A 2O8CA 5FPEA 3THWB 1RTJA 3QBWA 4H03B 3J7AP 1WLJA 1BA1A 3L3VA 2JLEA 3WXIA 5HRRA 3V1RA 3VTIA 1WB9A 4B9TA 1NK6A 3C6AA 1W0HA 4MQ3A 4CJLA 3AV9A 3UB5A 2IS3A 4DU3A 2O4IA 3TAEA 3ENHA 2CGLA 4I9QA 4M42A 1EO1A 4GW6A 3D6RA 5CE3A 1ATSA 1YXQA 2QKKA 4OPAA 3CXCM 4N41A 3SK3A 1HNXK 4BE2A 3HTVA 1NOZA 1RNHA 3NCIA 2F9WA 3CFOA 2O4GA 4ELVA 1N36K 4DMNA 2V51B 5M1FA 4M3YA
chains in the Genus database with same CATH topology
2VGNA 1Q86O 4YDUC 4JD2B 1ILYA 2HF3A 1YAGA 4M7YA 3CJ1A 1VAZA 3U8XA 2QWOA 2W40A 4A61A 3F2KA 4CZEA 4DQ8A 2Q36A 3CMAN 4PKHA 1NGFA 3HSCA 2V7ZA 4OPHA 1YJ9N 1JCFA 5GAEP 4H0VB 2ZWHA 2Q2RA 4RCHA 1VQ5N 4CZFA 3J7ZO 3FE1A 1NGIA 2YHYA 3CCMN 1QZ5A 4H5RA 3CHWA 5BPMA 3E9PA 4WQ4A 2NRTA 2BUPA 5GIPA 5GINA 3E9OA 4JK8A 5AR0A 2PBDA 3HM8A 4NLCA 5AQLA 4ISFA 4CZKA 1KXPA 2A42A 5AQOA 5M1QA 2Q0UA 5C0YA 4WFBL 1BUPA 2WC9A 3IKMA 5FPMA 2ITMA 1Q82O 2VYPA 1RDUA 1DKGD 2WFBA 2GX9A 1HKCA 4BRQA 3FFKB 5M1OA 5AQIA 4G9ZA 4MLEA 3U9ZA 1NGGA 2A41A 1P8ZA 4JKCA 3CERA 1ZBSA 2HBKA 5BRHA 2RE2A 3E9LA 2FF6A 2QTDA 3J8AA 3SAGA 1TYQA 3R1XA 3R3LA 3ENOA 2FSKA 2QI2A 4JAXA 2FSJA 4LC9B 1BOTO 5AQNA 5HL7L 2QA4N 3W3DA 2GELA 4JHDA 5AQKA 1HUXA 3UKRB 2P9LB 2WUSA 5LY3A 1D4XA 3D2EA 3DXMA 3KWIA 3LM2A 1QVFM 1MWKA 5TKYA 2E1YA 2J4RA 1T44A 3R9PA 5BPLA 3I8BA 4BRDA 3U9DA 4CZMA 3UKUB 1QQOA 3F5TA 4WQ4C 1NGCA 5AFUH 2HBLA 5AQPA 2AA4A 3N4PA 2E20A 5M1NA 3U4LA 3TSUA 3QBXA 4JKHA 3VGKA 2NRWA 2FXUA 3VGLA 4CBWA 1VQKN 4XH1A 3Q7CA 1S72N 3FGUA 3H3OB 3MN5A 3HOSA 4BC4A 1K73O 3L0QA 1HKGA 4JHDB 3CMEN 4GV3A 2RHKA 2UYTA 1VQ6N 3QFPA 1NLVA 2PAVA 3NVKA 2P9SB 3LDOA 1M1KO 4BG8A 4PKIA 4C1NI 3P39A 5E84A 4FVUA 1CZAN 5ELZA 2D4WA 2I7PA 3I56N 3CPEA 3KK7A 3VF2A 4BR9A 2YI1A 3TU5A 3G6EN 5BPNA 1KAXA 3I33A 5CR4A 2E88A 4H5TA 4FWOA 3LDLA 4KH6A 3SAFA 4FWQA 5KPRA 1C0GA 1SQKA 4L3QA 4WQ5A 3MMVA 3MWTA 2ZGYA 4BVPA 4CZIA 1VQMN 4OO1J 3C0BA 5AFUA 1LCUA 1K8KB 2V7YA 1DT9A 3SBGA 3D2FB 3O4WA 4R79A 3Q7BA 1KD1O 3ID6A 2P9KB 3MX5A 3PIOL 1GLAG 1X3MA 4U67L 5AZIA 5AQZA 1RGIA 3MN7A 1KAZA 4YDUA 5LJWA 4HTLA 3FLCO 4BGBA 3ULEA 5CHIA 4BVOA 4MLHA 3WT0A 3ZYYX 2GUPA 2FF3B 4B1WB 3EL2A 4JKAA 4CBXA 1WUAA 1DEJA 3MN6A 3S41A 2F9TA 4BC2A 1YIJN 1GLBG 4YORA 5DM7L 1M90O 4EAHD 3A8YA 3T69A 3A5MC 1BG3A 3OBYA 3MDQA 3HRGA 4H0XB 3SLCA 1VQON 1XC3A 1BA0A 2NRXA 3ZX0A 4FSVA 1X3NA 4EHUA 2A6AA 4ILHA 1Q7YO 5KPTA 2YX6A 4H5NA 4WQ5C 5F2RA 4YOTA 1G99A 3MN9A 3CC2N 4BC5A 2P9UB 2NZTA 4FWRA 1U2VB 5GAHP 3HZ6A 4NO7A 3GE1A 1BWFO 3CC4N 1Q18A 3R8EA 5F1XA 3CD6N 2P9PA 3BF1A 5AQRA 5AQVA 2IIRA 4BRCA 1NGDA 3DAWA 2IVOA 1RDWX 3T7ZA 2QWRA 2FLOA 2A3ZA 3KWGA 1GLLO 4IDHA 3IFRA 1Q81O 4H5VA 3H6EA 2E2QA 3G25A 3FZMA 3ENBA 5AZJB 4Z94A 2JWKA 4RWTA 3TSQA 1NM1A 3KZBA 3RSEB 2QWNA 4FOIA 3VETA 3G71N 1GLJO 1QHAA 2E2OA 4BRLA 4FWPA 3CC7N 2P9NA 3C7NA 4JKBA 3TPQA 5FPDA 1QZ6A 3O9UA 5EVZA 5GADP 2CH5A 1YJWN 3WEEA 3QMLA 2E2NA 4XH5A 5JICA 4GV6A 3WUHA 4CZJA 1NBWA 4BQZA 4A2AA 3VEYA 5AQJA 2NRZA 3HI0A 3TTFA 3OA9A 3P4IA 1R59O 1XUPO 4IJAA 4ILGB 4PKGA 3AAPA 5GAGP 2ZJPL 4O8KA 2YHXA 3GDQA 3CQYA 4A57A 1IG8A 3JS6A 3EN9A 5AQHA 4BRFA 2D1KA 4C23A 3R6MA 1NMDA 1T3VA 1KAYA 2NRHA 3IDHA 4DB3A 2CGKA 4CD1A 3LM9A 4GVEA 1NWKA 3B8AX 4MDAA 4BGAA 3WEEB 3VEVA 4FPBA 2OTJN 3DXKA 3EKSA 2HBMA 3CI5A 3H1QA 4BR2A 3VEZA 3A0IX 4BREA 5B8HA 3CCVN 1TYQB 2F7TA 5KQ8A 3NVMA 4QS7A 4BR5A 2IVPA 3H1VX 4BG9A 4IZ9A 5AQGA 1S3XA 3D7EO 2GTDA 2NRVA 3P38A 2IVNA 3D2EB 3DXMB 4WF9L 4CBUA 3CCLN 3VERA 3AY9A 3TTDA 1BDGA 4H5WA 4DKWA 1Z6RA 3DXKB 3WXJA 1K8AO 3EZWA 3CJ7A 4H0PA 4B1VA 3GBTA 3LL3A 2A5XA 2A40A 3L6QA 4FWSA 3MCAB 3O5BA 4JKFA 3VF4A 5JLHA 1TUYA 4K41A 3BEXA 4EFHA 4BRAA 1GLDG 4PL8A 2AP1A 4BRGA 1NGBA 4K43A 5KPZA 1GLEG 1YUWA 1HX1A 3VEWA 4NB4A 1HLUA 3EKUA 5M1PA 3C65A 4QS8A 4BRIA 2QWLA 5JVGL 2P9IA 1NGJA 2QWPA 4KH5A 4IJNA 4A62A 5F0XA 1SAZA 3WQTA 4IOAL 4BR4A 1E4GT 1YJNN 2ZJRL 5M1KA 1IJJA 3O9SA 4KBOA 4BR0A 5C12A 4ILJA 3MWPA 4BRHA 3CCUN 2NLXA 3LDQA 5JVHL 5AQMA 3GOIA 3OHRA 3ATVA 4AM7A 3KHYA 4FWMA 2GWJA 5EY4A 2BH1A 2QXLA 1T6DA 2WBNA 3EE9A 3O9TA 5AQSA 1C0FA 2ZF5O 5AQYA 2E8AA 3O08A 3ID8A 2YCHA 1JCGA 1VQ9N 2DPNA 3HBTA 1MWMA 4IFEA 4M63C 5EXWA 4DHYA 3E1YA 4CD3A 4BC3A 5C2DA 3WXKA 3ZETA 3SJHA 1QVGM 5AZIB 5C15A 3AGRA 3VESA 2Q1NA 4I6MA 2GWKA 2W41A 3FZLA 3CETA 1U6ZA 2FSNA 3ULEB 5BRFA 4YOYA 4YOXA 3O80A 1KC8O 5BN9A 1MA9B 4JKGA 4YOUA 4MO5A 4FL9A 1S22A 4IO8A 1TUUA 2VGMA 4BY9C 3DWLA 1K9MO 3SMPA 3H3NO 3CCQN 4CJ7A 3VGMA 1VQLN 3M6GA 4IO9L 1WOQA 3GG4A 3FZFA 3L4QA 4JNEA 3ATUA 3W0LA 2H3GX 3CIPA 4F9OA 2VCPA 3ZETB 4H0OA 3IUCA 5LJVA 3O9RA 4K25A 4JK7A 3HOTA 2ASPA 4E1JA 1Z05A 3MK6A 3UE5A 1YI2N 4UY8O 1NGHA 3VMFB 3VENA 4JKGB 1SZ2A 4H0YB 5E26A 2ZGZA 3WQUA 4IOXA 4C1NK 1GLFO 2CH6A 4JEPA 4FWNA 4A2BA 1T6CA 3WXLA 1ZC6A 3O1BA 2P9PB 5AQQA 1YF5L 3PLAA 3C6HA 4IEEA 4HWIA 4MO4A 4WYBA 1NGAA 1VQNN 4PHTX 1N8RO 4BRNA 3JXUA 1OVYA 2QEXN 4AF1A 5I9EB 3OBWA 3EO3A 3VPZA 2Q31A 5AQWA 3O1WA 3K9KA 1MDUB 3GL1A 3K9JA 4BRMA 1H1VA 1VQ8N 3MCPA 3CJ9A 3M5RA 3CJCA 4XEIA 3VEOA 5BREA 2OANA 3CF5L 3CJBA 2EWSA 3DJCA 1RFQA 2E2PA 2P9NB 2P9LA 3C7NB 4GY2B 3UKRA 1YITN 4BRPA 2KKZA 2E1ZA 5FPNA 3TTCA 4WFNL 2GEMA 1LOTB 2PFUA 5AQTA 1ATRA 4GNIA 5AQXA 4BROA 3KVGA 3O9QA 5ADXH 3UKUA 1NJIO 4JN4A 3ZX2A 1VQ4N 1QQMA 4FO0A 4O5FA 3WXMB 2ASOA 3CQXA 4B1UB 1OKJA 1X9JA 3DLLL 4A5BA 1BU6O 4WFAL 3H46O 3O6WA 4M7XA 4GV9A 4JKEA 2I7NA 3CCJN 3QDKA 2Q0RA 3LDNA 4WCEL 2QM1A 3VOVA 1BO5O 3PIPL 1SS6A 3SAHA 1QQNA 3SBTA 4IXCA 1W97L 2HBJA 2BTFA 2P9SA 4BR7A 4U7BA 4CZLA 5H1SQ 4EIAA 5DM6L 1ZXOA 4YOVA 4RTFD 4FWLA 4CZGA 3AARA 3QICA 1HKBA 4Y0WA 4KH4A 4B1YB 5KQDA 3CCSN 4CI6A 3P31A 3CPWM 3IMXA 1KQSM 3CJAA 4FOEA 5C2FA 1GLCG 3AAQA 3A5NC 3E66A 3F9MA 3MX2A 5BRDA 2HMPA 3BF3A 2HOEA 3L4IA 3VF6A 4FPAA 2HF4A 2NRRA 4XH4A 5AQUA 5C10A 1HJOA 3OW2M 3A5LC 5MLCQ 3A5OC 1ATNA 1EQYA 2VWBA 4IEIA 5ADXA 1V4TA 5AQFA 2KLAA 5HOOA 1K8KA 2QWMA 1W2BM 3D2FA 1HPMA 4K42A 5EOYA 2KHOA 2YJFA 4YOWA 2P9KA 2OTLN 1JJ2M 4JK9A 2HSTA 2YJEA 3G4SN 3BP8A 3FZHA 4O8UA 5FPEA 3AGKA 1O13A 3O8MA 3M3ZA 3QB0A 2ASMA 3QBWA 4H03B 2P9IB 2YHWA 3BUZB 5GIOA 1BA1A 2ZJQL 2NNWA 3TSPA 3LDPA 1YHQN 4B9QA 3WXIA 4MDBA 4QS9A 1V4SA 4DCHA 4AM6A 3VTIA 4EHTA 2QWQA 3ZEUA 3H45C 4B1ZA 5JMVA 3C6AA 2Q97A 1VQ7N 1YVNA 2P9UA 3UB5A 4A59A 1U2VA 4JKDA 3SMSA 4CZHA 3FR0A 3FZKA 3CCRN 3ENHA 5EX5A 3RVCA 3NMUA 2D0OA 1XQSC 2CGLA 1VQPN 2JWLA 1P90A 1EO1A 5BR9A 3EE8A 3CCEN 4JD2A 5BN8A 3D6RA 5CE3A 5TKWA 2CGJA 1ATSA 4H0TB 4BRKA 1YXQA 4IWVA 3I55N 4OPAA 3CXCM 1ESVA 2QW9A 4I6MB 4J8FA 4FWKA 1E4FT 3N4QA 3SK3A 4NLBA 3VEXA 4B1XB 3ZX3A 4IOCL 3HTVA 5JLFA 3ZEUB 5AZJA 1JCEA 2V52B 3M1FA 2D0PA 2F9WA 4PL7A 1DGKN 3VTHA 3RSEA 1Y64A 4ISEA 4ISGA 4A5AA 3QFUA 2V51B 5M1FA 4BQLA 1NGEA 1J6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC9 A;  4DKW A;  2WBN A; 
#chains in the Genus database with same CATH topology
 1Q86 O;  2KW4 A;  1ILY A;  4Z0U A;  3L8B A;  2HHX A;  4CZE A;  2W40 A;  2V7Z A;  4OPH A;  1OH5 A;  2ZWH A;  2Q2R A;  2B5J A;  4O55 A;  4RCH A;  3AVJ A;  2YHY A;  1GOB A;  3ZSO A;  2NRT A;  2BUP A;  2W42 A;  3LP0 A;  2PBD A;  3HM8 A;  4ISF A;  3V9W A;  2A42 A;  1CLQ A;  2Q0U A;  5DK5 A;  3DLH A;  3OY9 A;  1X9W A;  1BCO A;  2GX9 A;  4BRQ A;  1I94 K;  5M1O A;  1HMV A;  3U9Z A;  3KD5 E;  3AO1 A;  4FJK A;  3SAG A;  3TAG A;  3U6F A;  2QI2 A;  4JAX A;  2FSJ A;  1X9S A;  3VQC A;  1HYZ A;  5HL7 L;  3W3D A;  5LY3 A;  1HUX A;  4C8L A;  3IG1 A;  3KLH A;  1D4X A;  3K57 A;  5TKY A;  3I8B A;  3JYT A;  4CZM A;  3UKU B;  1QQO A;  5AFU H;  1XNR K;  4CHZ A;  4DFJ A;  3N4P A;  3OYB A;  3PO5 A;  3QBX A;  1JLE A;  2FXU A;  3DI6 A;  3ZT2 A;  4XH1 A;  2OYQ A;  3H3O B;  4RW9 A;  3HOS A;  4JHD B;  4AHC A;  4GV3 A;  1LWC A;  1NLV A;  2P9S B;  3LDO A;  4DWI A;  4PKI A;  4C1N I;  4FVU A;  2HW3 A;  2WTU A;  3T3F A;  3V9S A;  3TU5 A;  2GUI A;  3TAP A;  5D3G A;  5KI6 A;  2E4L A;  4KH6 A;  4NXM K;  4DTO A;  4WQ5 A;  3TAQ A;  3K58 A;  1L3T A;  4X65 K;  1K8K B;  4N47 A;  4R79 A;  5SZT A;  3FFI A;  3PIO L;  5HLF A;  1GLA G;  3SNN A;  4KTQ A;  1VSE A;  4GVM A;  1JL2 A;  1W9H A;  5AQZ A;  3VQD A;  4YDU A;  4GKK K;  1BIU A;  3OYL A;  3C94 A;  2P5O A;  3RMA A;  4MLH A;  3SV4 A;  1LW0 A;  3ZYY X;  4B1W B;  4O44 A;  4OGE A;  4CBX A;  1DEJ A;  3H08 A;  1YIJ N;  2F9T A;  2RF2 A;  1S6Q A;  3LWM A;  3C6T A;  3OBY A;  3LAL A;  3MDQ A;  4H0X B;  5KRT A;  4HUE A;  3MAQ A;  3SLC A;  1XC3 A;  4FZY A;  4EHU A;  4W5Q A;  2KFN A;  1Q7Y O;  4E1M A;  4YOT A;  3MN9 A;  3CC2 N;  2P9U B;  4FLX A;  5GAH P;  3HZ6 A;  4NO7 A;  3M8R A;  2IIR A;  1S9G A;  1RDW X;  4W5T A;  2FBX A;  1XC9 A;  3KWG A;  4EZ6 A;  1Q81 O;  1REV A;  2E2Q A;  5AZJ B;  3FZM A;  2YNI A;  2IAJ A;  4CGG A;  2JWK A;  4CJF A;  4RWT A;  1NM1 A;  2HHH K;  3BZC A;  4OLB A;  4JLH A;  1KRP A;  3VQE A;  1Q9X A;  3CC7 N;  5FPD A;  4Q0B A;  3VQ7 A;  2CH5 A;  1YJW N;  4F3T A;  3V4I A;  1LV5 A;  4LSL A;  4G1Q A;  1NBW A;  4WE1 A;  1VSL A;  5AQJ A;  2NRZ A;  4CHP A;  4DR3 K;  3AAP A;  4O8K A;  3GDQ A;  3PSF A;  3JS6 A;  3EN9 A;  4CEF A;  4CGD A;  3VQQ A;  2CGK A;  4GVE A;  4NCB A;  1ZBF A;  1U45 A;  3SUQ A;  1IG9 A;  3DXK A;  3AA3 A;  4B3S K;  3LDS A;  1S1T A;  3CI5 A;  5FRO A;  3TWH A;  3O4N A;  2UXD K;  4BRE A;  5HRN A;  1KCF A;  3SQ2 A;  3QET A;  2F7T A;  5KQ8 A;  4N76 A;  1T03 A;  4ZTF A;  4BR5 A;  4CGI A;  4CF9 A;  5AQG A;  3MEG A;  3D7E O;  2NRV A;  3P83 D;  3DXM B;  3CCL N;  4LF9 K;  3AY9 A;  4DKW A;  3CJ7 A;  3LL3 A;  4QOZ B;  4KRE A;  3MCA B;  3NGI A;  4EFH A;  1S1X A;  1NGB A;  5KPZ A;  1GLE G;  1HX1 A;  4NB4 A;  4NXN K;  1HLU A;  3EKU A;  4M3Z A;  3HPO A;  5T7B A;  4J2E A;  5JVG L;  2P9I A;  4KH5 A;  5F0X A;  3WQT A;  4CHQ A;  1HQU A;  3HL8 A;  1S5J A;  2HHQ A;  1IJJ A;  4OGC A;  2NLX A;  3KK1 A;  3NGY A;  3GOI A;  3OHR A;  3OYE A;  3KHY A;  4M3R A;  2ZM6 K;  4M3W A;  1C0F A;  1NK5 A;  5FRN A;  4FJN A;  1J5E K;  1WSE A;  2YCH A;  3MXM A;  1VQ9 N;  3LP2 A;  1L3V A;  3PX6 A;  1RDA A;  2PZS A;  3VQP A;  3E1Y A;  4BC3 A;  1LWF A;  5C2D A;  4FM1 A;  3V1O A;  1U48 A;  3F73 A;  1HNW K;  2GWK A;  4CJ3 A;  2W41 A;  4LFA K;  4YOY A;  1U6Z A;  1KC8 O;  1Q8I A;  3O80 A;  1MA9 B;  3V1Q A;  3V6D A;  2ZQB A;  1S22 A;  4CGF A;  1JLQ A;  3DWL A;  4JI2 K;  3SMP A;  3LAM A;  4JI6 K;  3M6G A;  2W6L A;  4PQU A;  4JNE A;  4AHR A;  2H3G X;  2VCP A;  3ZET B;  3K59 A;  3IS9 A;  3DYA A;  1Z05 A;  1NGH A;  1LAW A;  1VSH A;  4F3O A;  2ZGZ A;  4AH9 A;  4CJQ A;  1TGO A;  4JEP A;  4CK3 A;  3IRX A;  1ZC6 A;  4FLZ A;  1T05 A;  3O1B A;  2P9P B;  4Z4G A;  5HRP A;  1SL0 A;  4HWI A;  4WYB A;  3G0Z A;  4KTZ A;  3ISN C;  3HPG A;  1TAU A;  4KV8 A;  1OVY A;  2QEX N;  1RDD A;  4FW1 A;  4AF1 A;  3OBW A;  2A1R A;  3EO3 A;  3VPZ A;  2FC0 A;  1MDU B;  4BRM A;  3M5R A;  3CJC A;  4W5N A;  4KO0 A;  3QEI A;  4PWD A;  4CF8 A;  1QE1 A;  2QXF A;  4H4M A;  2EWS A;  1RFQ A;  3UKR A;  3SQ0 A;  2E5L K;  4BRP A;  4I7F A;  3TTC A;  1ATR A;  4GNI A;  1NJI O;  3J81 O;  4YHH K;  1QQM A;  4O5F A;  1OKJ A;  4DUZ K;  2FBV A;  3KLE A;  3NF6 A;  3HO1 A;  1BU6 O;  3O6W A;  4GV9 A;  4M7X A;  3CCJ N;  1HJR A;  3LDN A;  4WCE L;  3HYF A;  4DTN A;  1SS6 A;  5BR8 K;  3QLH A;  3WNG A;  4IXC A;  4BR7 A;  4CZL A;  4W5O A;  1QTM A;  1VSD A;  4B9S A;  1HKB A;  4BWJ A;  3CCS N;  2JGU A;  3P31 A;  3CPW M;  4JI0 K;  1GLC G;  3E66 A;  3MX2 A;  3TAN A;  3BF3 A;  3SUO A;  2HOE A;  3OYM A;  3VF6 A;  4XH4 A;  1RDB A;  5C10 A;  3MXI A;  4KKO A;  3SJJ A;  2VWB A;  5HOO A;  4DTS A;  3J80 O;  4OPK A;  4DV3 K;  5EOY A;  4CJ4 A;  4YOW A;  2P9K A;  4LF5 K;  1NK9 A;  3SZ2 A;  1IKW A;  1RT1 A;  3O8M A;  3M3Z A;  1KFD A;  3BUZ B;  2OPP A;  4Y1D A;  4FJI A;  3TSP A;  3LDP A;  4DU1 A;  4B9Q A;  4MDB A;  3ZCM A;  4B9N A;  2Q97 A;  1WSF A;  1L3S A;  4BE1 A;  1VQ7 N;  2O8C B;  4JKD A;  4CZH A;  2G8I A;  3FZK A;  4K8Z A;  3CCR N;  5EX5 A;  3QER A;  1N5Y A;  1BHL A;  4JD2 A;  2CGJ A;  3LP1 A;  5HRO A;  2VG6 A;  2X6S A;  4IWV A;  1TL3 A;  4FJ7 A;  4J8F A;  4FWK A;  3RMD A;  3VEX A;  4F2S A;  4LD0 A;  3CM5 A;  4JRP A;  1U47 A;  3VTH A;  3RSE A;  3PX4 A;  3LPU A;  3QFU A;  4OLA A;  1XI1 A;  1NGE A;  1B92 A;  2HF3 A;  1YAG A;  4M7Y A;  3OYN A;  2QWO A;  1NGF A;  2Z1H A;  4M45 A;  1YJ9 N;  1JCF A;  5GAE P;  1BI4 B;  2O8D A;  4CZF A;  2D0C A;  1VSJ A;  2KZM A;  3CCM N;  3LPT A;  5FDL A;  2RPI A;  3RRG A;  5GIN A;  3E9O A;  4JK8 A;  1KXP A;  1ZBH A;  5M1Q A;  2WC9 A;  4E7J A;  3K5N A;  5FPM A;  1Q82 O;  4DLG A;  2VYP A;  3NDK A;  1DKG D;  4B3T K;  1HKC A;  3FFK B;  1NGG A;  3S9H A;  2A41 A;  4DSL A;  1ZBS A;  2HBK A;  1FJG K;  2RE2 A;  4M41 A;  3CM6 A;  1TYQ A;  3R1X A;  3R3L A;  4JI5 K;  2ZD1 A;  4FLV A;  1N34 K;  5JS1 A;  1BOT O;  5EU7 A;  5AQN A;  2QA4 N;  3AVC A;  2GEL A;  5AQK A;  2P9L B;  2WUS A;  4MFB A;  1C0M A;  1QVF M;  3EYZ A;  3LM2 A;  2QKB A;  4LSN A;  1ASU A;  1T7P A;  2E1Y A;  5BPL A;  1T44 A;  3R9P A;  4AHU A;  3U9D A;  4WQ4 C;  3PX0 A;  3WNH A;  4R5P A;  2HBL A;  2XRI A;  2AA4 A;  5AQP A;  3RRH A;  1NK0 A;  2E20 A;  5M1N A;  1C1B A;  3U4L A;  4JKH A;  5LMU K;  2PYL A;  2NRW A;  4CBW A;  3VGL A;  4DFM A;  1SKW A;  1TK8 A;  3Q7C A;  4BC4 A;  4CGJ A;  3KLG A;  3CME N;  2RHK A;  2UYT A;  3QNO A;  2O8B B;  3QFP A;  3NVK A;  4BG8 A;  5E84 A;  1CXU A;  4BWM A;  4IG3 A;  3AVL A;  1XMO K;  3CPE A;  3VF2 A;  4YNQ A;  2YI1 A;  1TKD A;  3AVM A;  3OYF A;  5CR4 A;  1S9E A;  2ATQ A;  4FWO A;  2B4J A;  4B9M A;  3K0S A;  5KPR A;  5DMR A;  3QIN A;  4DV1 K;  1NJZ A;  2HHT A;  4L3Q A;  4CZI A;  3MMV A;  3MWT A;  2ZGY A;  3C0B A;  1LCU A;  3K5L A;  1SKS A;  2D0A A;  1EWR A;  2V7Y A;  1DT9 A;  2XY7 A;  2RKI A;  1X3M A;  5AZI A;  1KAZ A;  4HTL A;  3FLC O;  3ULE A;  5CHI A;  1ASV A;  3BZK A;  2GUP A;  4GKJ K;  1TL1 A;  1WN7 A;  4FM0 A;  3EL2 A;  4ID5 A;  4JKA A;  4IDK A;  1WUA A;  3S41 A;  1M90 O;  4YOR A;  3IAY A;  4EAH D;  3A5M C;  1BG3 A;  3HRG A;  1UOC A;  4CEZ A;  4KI6 A;  1X3N A;  2A6A A;  1HRH A;  4ILH A;  5KPT A;  1HNV A;  4PUO A;  1TKT A;  4H5N A;  2YKM A;  3QEP A;  2NZT A;  1ITG A;  1U2V B;  1BWF O;  2FBT A;  4DU4 A;  1NKB A;  3HT3 A;  3OS0 A;  5AQV A;  3DAW A;  3T7Z A;  3LZJ A;  2QWR A;  4HUF A;  3KKS A;  1D9D A;  4IDH A;  4KHQ A;  4M3X A;  4FYD A;  3ZSZ A;  3ITH A;  3ENB A;  3KD1 E;  4CJW A;  3TSQ A;  4CFA A;  4FOI A;  3L2U A;  1GLJ O;  3WNE A;  2E2O A;  4BRL A;  1RBT A;  2P9N A;  3C7N A;  4JKB A;  4F4K A;  1QZ6 A;  3WEE A;  4E7H A;  3U3G A;  3VQ6 A;  2XO7 A;  4A2A A;  3THY A;  3VEY A;  1RBS A;  3OA9 A;  1XUP O;  2ZJP L;  5GAG P;  3T1Y K;  4DTP A;  2IGI A;  4A57 A;  4DR1 K;  3UIQ A;  3PY8 A;  2R7Y A;  1U49 A;  3AVN A;  2NRH A;  3IDH A;  5IWA K;  3O4Q A;  4CD1 A;  4AQY K;  1RBU A;  3B8A X;  4FPB A;  2OTJ N;  1VSI A;  2HBM A;  2P51 A;  5C24 A;  4BR2 A;  4FJL A;  3CCV N;  1OVQ A;  5KGW A;  3THX A;  3NVM A;  4QS7 A;  2X6N A;  4IZ9 A;  2HHS A;  3D2E B;  3SQ1 A;  2O8F A;  4IG0 A;  1RTI A;  4CEB A;  4OX9 K;  1IO2 A;  4H5W A;  1Z6R A;  3DXK B;  3EZW A;  1WBD A;  4H0P A;  1YVU A;  4FWS A;  3CFR A;  4JKF A;  4FW2 A;  4BRG A;  4PL8 A;  1N32 K;  3AO4 A;  4QAG A;  3VEW A;  5CZ1 A;  5M1P A;  4FJ5 A;  1IKX A;  4KTW A;  4BRI A;  3OYD A;  4X66 K;  5C25 A;  2G8V A;  4A62 A;  4CJU A;  3K5O A;  3LAN A;  4IOA L;  3KLI A;  3O9S A;  1XWL A;  1TV6 A;  2IC3 A;  5EY4 A;  4Z4I A;  2WBN A;  3EE9 A;  5AQS A;  1TK0 A;  2ZF5 O;  5AQY A;  3V9U A;  3O08 A;  4O0I A;  4KHP K;  1MWM A;  4IFE A;  4M63 C;  5EXW A;  4DHY A;  4CD3 A;  3HK2 A;  2VQE K;  4DTJ A;  3NGZ A;  2Q1N A;  2F4V K;  1C1A A;  1KVC A;  3FZL A;  2FSN A;  3NBP A;  5BRF A;  4YOX A;  4B9V A;  4JKG A;  1IKV A;  4HCB A;  2G8F A;  4FL9 A;  1TUU A;  1K9M O;  3GG4 A;  4FJH A;  3L4Q A;  3ATU A;  1HPZ A;  1KLM A;  4H0O A;  3LZI A;  1G15 A;  3MK6 A;  4DUY K;  1BIS A;  4UY8 O;  1RT7 A;  3ULD A;  1UAX A;  2HMI A;  4F8R A;  4PA1 A;  4C1N K;  3JAM O;  4FWN A;  3U3Y A;  3WXL A;  5HRS A;  1S1V A;  4DFP A;  1S1U A;  1YF5 L;  4DV2 K;  4BE0 A;  4C8O A;  1VQN N;  4JI7 K;  4BRN A;  2IDO A;  2Q31 A;  5AQW A;  3TAM A;  3C6U A;  3K9K A;  3GL1 A;  3K9J A;  1H1V A;  2PY5 A;  3CJ9 A;  5BRE A;  4DTR A;  1YIT N;  3ALY A;  2D5R A;  1DLO A;  4LFC K;  5FPN A;  4HHT A;  4B3O A;  4WFN L;  2PFU A;  2X78 A;  4BRO A;  3KVG A;  3NFA A;  1WSG A;  1CZB A;  3O9Q A;  4JN4 A;  3UKU A;  1VQ4 N;  4FO0 A;  4J2D A;  4B08 A;  4FXD A;  3WXM B;  4B1U B;  4OPJ A;  3DLL L;  3H46 O;  2DFH A;  4IKF A;  1WBB A;  5HP1 A;  4LF6 K;  4DG1 A;  3PIP L;  3BGR A;  3SAH A;  4FJX A;  3SBT A;  3SPZ A;  1W97 L;  2HBJ A;  2P9S A;  4U7B A;  4XIU A;  3OYC A;  1ZXO A;  4CZG A;  3QIC A;  1NU0 A;  3IMX A;  3SUP A;  1KQS M;  1NMN A;  3ZSV A;  5BRD A;  3DLR A;  4FLY A;  4FJJ A;  3L4I A;  3QO9 A;  2YKN A;  5KGX A;  1HJO A;  3OTO K;  3A5L C;  3OYH A;  3OW2 M;  5J2M A;  5MLC Q;  5ADX A;  1ATN A;  4IEI A;  2Y1J A;  1W2B M;  5AQF A;  1K8K A;  1FKP A;  4ZHR A;  4FLW A;  3AVG A;  3L2R A;  1JJ2 M;  4CGH A;  2HST A;  1Y97 A;  4CF2 A;  3G4S N;  1BQM A;  4O8U A;  4KAZ A;  4B8A B;  4CJT A;  3QB0 A;  2ASM A;  4FZZ A;  2UUC K;  5CY4 A;  5GIO A;  3DOL A;  3ZT3 A;  2ZJQ L;  2NNW A;  4RW6 A;  1YHQ N;  3KK3 A;  4JV5 K;  4QS9 A;  1IBK K;  4AM6 A;  2B6A A;  1VSK A;  2QWQ A;  3ZEU A;  3DRP A;  5JMV A;  4CFD A;  1YTU A;  2I5J A;  2P9U A;  3ZLJ A;  3SMS A;  3RVC A;  4ELT A;  3NMU A;  1VQP N;  3CCE N;  3ZT1 A;  1K6Y A;  4DV5 K;  4JI1 K;  5TKW A;  4LF4 K;  1C0U A;  2UUA K;  2QW9 A;  4I6M B;  5LMN K;  4NLB A;  4DQQ A;  5JLF A;  5AZJ A;  2D0P A;  1ZYQ A;  4A5A A;  4ISG A;  4BQL A;  1J6Z A;  2VGN A;  4YDU C;  4JD2 B;  4BDZ A;  1C0T A;  4DQR A;  4Z4F A;  3CJ1 A;  2OTL N;  4DQ8 A;  4A61 A;  3F2K A;  1YTA A;  2Q36 A;  3HVT A;  3CMA N;  3HSC A;  2UU9 K;  3FE1 A;  1NGI A;  3DMJ A;  3OYG A;  4KI4 A;  3E9P A;  4WQ4 A;  4Q5V A;  5AR0 A;  4NLC A;  1SKR A;  4FZX C;  3F9K A;  4B9U A;  5KTQ A;  2ITM A;  4K0K K;  1RDU A;  4G9Z A;  4MLE A;  3AVA A;  4JKC A;  2O8E B;  2QTD A;  2Z1I A;  2FSK A;  1TKZ A;  3S3O A;  1OH8 A;  3AA4 A;  4CJV A;  1A5V A;  2VQF K;  2F8S A;  2YNG A;  3TAR A;  3DXM A;  1MWK A;  2ETJ A;  1VSM A;  2J4R A;  3SI6 A;  4LF8 K;  3DRS A;  2PYJ A;  4BRD A;  4LH5 A;  1WSJ A;  3F5T A;  1NGC A;  2QK9 A;  3V9Z A;  1VQK N;  1RT3 A;  1S72 N;  3THV A;  3MEE A;  1K73 O;  1HKG A;  3JSM A;  4FLU A;  1VQ6 N;  2OCE A;  2PAV A;  1M1K O;  3M8Q A;  1VHX A;  3P39 A;  5LL6 Z;  4M3T A;  4AHS A;  3OYK A;  1CZA N;  5ELZ A;  4DR5 K;  2D4W A;  1JKH A;  2I7P A;  2GV9 A;  4BR9 A;  4ELU A;  4DR2 K;  1KAX A;  3I33 A;  4RW4 A;  4OJR A;  1SV5 A;  4H5T A;  4CK1 A;  3LDL A;  3SAF A;  3KIO A;  4FWQ A;  4FM2 A;  1SQK A;  4BVP A;  1VQM N;  1HQE A;  3NH2 A;  3LWL A;  3D2F B;  3O4W A;  4NYN A;  4DF8 A;  1KD1 O;  1T8E A;  3MX5 A;  3NH1 A;  4CED A;  1XMQ K;  1RGI A;  3MN7 A;  5LJW A;  4LF7 K;  1HYV A;  2FF3 B;  4BC2 A;  4KHY A;  5DM7 L;  3A8Y A;  3DLG A;  1NKE A;  2G8H A;  1VQO N;  1HR0 K;  1B9D A;  4FSV A;  3L2W A;  4K8X A;  1NK8 A;  1SUQ A;  3B6P A;  2VG7 A;  3V81 A;  1G99 A;  4BC5 A;  5E41 A;  4Z4E A;  1WAJ A;  2YHB A;  3CC4 N;  2EX3 A;  1Q18 A;  2P9P A;  3BF1 A;  5AQR A;  2BDP A;  4BRC A;  2IVO A;  4CJS A;  4E3S A;  2A3Z A;  3ZSR A;  2HHW A;  2BGG A;  3K2P A;  3QIO A;  3KZB A;  3VET A;  3G71 N;  3CFP A;  1QHA A;  4CEQ A;  4DV7 K;  4BAC A;  1RBV A;  3NAE A;  4I9L A;  1S1W A;  3AO2 A;  1KVA A;  1ZBI A;  1JXE A;  3KTQ A;  2E2N A;  1Z25 A;  1OH7 A;  4XH5 A;  5JIC A;  4GV6 A;  3WUH A;  4CZJ A;  4BQZ A;  5J1E A;  3HI0 A;  1R59 O;  4IJA A;  4CK2 A;  3CQY A;  1HNZ K;  5AQH A;  4BRF A;  2D1K A;  4C23 A;  4CHO A;  1T3V A;  1KAY A;  5J2N A;  3LM9 A;  3RR8 A;  3CQ8 A;  3I0R A;  4CVN E;  4MDA A;  3SV3 A;  4M3U A;  1N33 K;  4BGA A;  3WEE B;  3RWU A;  2HHU A;  2G8U A;  4E19 A;  3OYA A;  1LW2 A;  4DLE A;  3VEZ A;  4H4O A;  5B8H A;  5CYM A;  5SWM A;  4YFU A;  1BL3 A;  1VSF A;  4BG9 A;  3OS2 A;  2IVN A;  4WF9 L;  4CBU A;  4EZ9 A;  3VQ9 A;  3TTD A;  1C6V A;  4ICL A;  3WXJ A;  3HPH A;  4KHW A;  4B1V A;  3GBT A;  2A40 A;  3L6Q A;  3D45 A;  3I0S A;  3VF4 A;  4OKE A;  1JXB A;  1TUY A;  4B8C A;  4BRA A;  1GLD G;  4K43 A;  2KFZ A;  3DM2 A;  1VRT A;  3K5M A;  5J2Q A;  4C8N A;  2G8W A;  4QS8 A;  3DRR A;  2O8F B;  1RTD A;  2E6M A;  1SAZ A;  4KBO A;  3MWP A;  3QES A;  1JLC A;  5JVH L;  3SCX A;  3ATV A;  2GWJ A;  2BH1 A;  2QXL A;  1T6D A;  1I39 A;  3O9T A;  4JI4 K;  3M8P A;  3ID8 A;  1JCG A;  2Y1I A;  4CF1 A;  4RW8 A;  5K14 A;  2W6K A;  4JS5 A;  3SJH A;  3VES A;  4CFB A;  4JYA K;  3QEV A;  3SPY A;  3BY5 A;  5BN9 A;  1A5X A;  3HST B;  4YOU A;  1U04 A;  2OA8 A;  1R0A A;  1WAF A;  2VGM A;  1WSH A;  2HNZ A;  3FZF A;  4CJK A;  1SL1 A;  4F9O A;  3IUC A;  3KJV A;  4DSE A;  1B9F A;  2HB5 A;  4JK7 A;  3HOT A;  3PO4 A;  4E1J A;  1BI4 A;  1YI2 N;  3UE5 A;  3ZT4 A;  2YNH A;  3VEN A;  4JKG B;  4H0Y B;  5E26 A;  1W7A A;  1IBL K;  1TKX A;  1JLA A;  1GLF O;  2CH6 A;  1NK7 A;  4A2B A;  3SYZ A;  3OYI A;  3PLA A;  3C6H A;  4IEE A;  2P5G A;  1NGA A;  2ZE2 A;  1KSP A;  1QQC A;  5I9E B;  1GOA A;  4FJG A;  3O1W A;  1ASW A;  4CCH A;  3OYJ A;  1TAQ A;  3VEO A;  2OAN A;  3CJB A;  4CE9 A;  3DJC A;  2P9L A;  2VWK A;  2KKZ A;  2XY8 A;  1BGX T;  5I3U A;  4DSK A;  5AQX A;  3AA2 A;  1IKY A;  3PSI A;  3O3G A;  5ADX H;  3ZX2 A;  4L8R B;  2ASO A;  1NG9 A;  3AO3 A;  3NF7 A;  1EX4 A;  1VRU A;  4JRQ A;  2OPS A;  4X64 K;  3NH0 A;  2Q0R A;  2QM1 A;  3KKR A;  3VOV A;  4DSJ A;  1BO5 O;  3NF9 A;  4DTU A;  2YHA A;  4CHN A;  2O8B A;  2BTF A;  3EEQ A;  1IH7 A;  4EIA A;  4DR4 K;  5DM6 L;  4Z4H A;  4CJ5 A;  4YOV A;  4FWL A;  4Y0W A;  5KQD A;  4KH4 A;  3OS1 A;  4FOE A;  1D5A A;  3F9M A;  4DTX A;  4DTM A;  3B6O A;  3VA0 A;  4FPA A;  3VQ4 A;  3D0P A;  1BQN A;  3THW A;  2NRR A;  4FVM A;  2OPR A;  4N56 A;  3VQ5 A;  2VWJ A;  2XY5 A;  3A5O C;  4F2R A;  1EQY A;  1V4T A;  1A5W A;  3G10 A;  4Z4C A;  4K42 A;  1TVR A;  4IBN A;  4I2P A;  1KTQ A;  4JK9 A;  2YJE A;  3ZSQ A;  2YNF A;  3AVF A;  3FZH A;  3T1A A;  4E7K A;  1L3U A;  1RT4 A;  3AGK A;  5HBM A;  1O13 A;  4PY5 A;  2XHB A;  3LP3 A;  2P9I B;  3MXJ A;  2UUB K;  2YHW A;  3MEC A;  4Y1C A;  3KK2 A;  3RMC A;  3WNF A;  4DV4 K;  1V4S A;  4DCH A;  4EHT A;  4B1Z A;  3H45 C;  1XHZ A;  1HYS A;  1YVN A;  2KQ2 A;  4A59 A;  1U2V A;  1U4B A;  3FR0 A;  1QHT A;  2D0O A;  1XQS C;  2NUB A;  2JWL A;  1P90 A;  5BR9 A;  3EE8 A;  3OJU A;  3TI0 A;  2EHG A;  5BN8 A;  4H0T B;  4BRK A;  3I55 N;  3DLK A;  1ESV A;  1Q9Y A;  1E4F T;  3N4Q A;  4B1X B;  4CEE A;  4IOC L;  3ZX3 A;  3OJS A;  3ZEU B;  4J2B A;  1JCE A;  2V52 B;  4HVJ A;  3M1F A;  1JLF A;  4PL7 A;  1DGK N;  1L5U A;  4CFC A;  1Y64 A;  4ISE A;  3H6E A;  1IBM K;  1QSL A;  1UA0 A;  1WSI A;  3T1H K;  1XHX A;  4B3R K;  1VAZ A;  3U8X A;  4LY7 A;  4CIE A;  4PKH A;  1EWQ A;  4H0V B;  4AIL C;  1VQ5 N;  4C8K A;  4KFB A;  5JS2 A;  3J7Z O;  1XNQ K;  4LFB K;  2Q3S A;  1QZ5 A;  4H5R A;  3CHW A;  5BPM A;  1FKO A;  5GIP A;  1D8Y A;  2OZM A;  5AQL A;  4CZK A;  5AQO A;  3VA3 A;  4KPY A;  4KB1 A;  5C0Y A;  4WFB L;  1BUP A;  4E7I A;  4B3M K;  3IKM A;  3L3U A;  4O5B A;  5CYQ A;  2WFB A;  3C95 A;  5AQI A;  5FRM A;  1P8Z A;  1X9M A;  3CER A;  5BRH A;  3E9L A;  2FF6 A;  3J8A A;  3PV8 A;  3ENO A;  3DOK A;  1QS4 A;  4LC9 B;  4DR7 K;  4NCG A;  3ZT0 A;  4JHD A;  3I8D A;  3UKR B;  3D2E A;  3AVH A;  3KWI A;  4KRF A;  4V19 S;  4FJ8 A;  2OZS A;  1NJX A;  2KZZ A;  3L2V A;  1J54 A;  3TSU A;  3VGK A;  4E0D A;  3HM9 A;  3FGU A;  3MN5 A;  3L0Q A;  1TK5 A;  1I3A A;  5A2Q O;  4OKK A;  4W5R A;  4DV6 K;  1NJW A;  1F21 A;  3O3H A;  4DFK A;  1X1P A;  1C1C A;  3I56 N;  3KK7 A;  3QEW A;  3G6E N;  2XY6 A;  1KFS A;  5BPN A;  1SL2 A;  3OVN A;  3S3N A;  3MED A;  3QNN A;  2E88 A;  4X62 K;  3DLB A;  3BDP A;  3O3F A;  4YY3 K;  2G8K A;  1C0G A;  1IV0 A;  4GMJ B;  4N5S A;  2GBZ A;  4OO1 J;  3ZSW A;  5AFU A;  3SBG A;  4IFV A;  1BIZ A;  3Q7B A;  3ID6 A;  1JL1 A;  2Z1J A;  2P9K B;  4CEO A;  2DTU A;  4U67 L;  3V9X A;  3S3M A;  4BGB A;  4BVO A;  3WT0 A;  1BCM A;  2LSN A;  3MN6 A;  4JI8 K;  4BDY A;  1GLB G;  3TAF A;  1D9F A;  3T69 A;  1JLB A;  2FBY A;  2OPQ A;  4E7L A;  4BDP A;  2NRX A;  1BA0 A;  3ZX0 A;  3AA5 X;  3J7Y P;  3AO5 A;  2RN2 A;  2YX6 A;  4WQ5 C;  3TR8 A;  4J2A A;  5F2R A;  2HVH A;  4FWR A;  3NF8 A;  3GE1 A;  1RBR A;  3R8E A;  3CD6 N;  5F1X A;  2P1J A;  5FLX O;  1NGD A;  1J53 A;  2FLO A;  1GLL O;  3IFR A;  4HUG A;  4O0J A;  4ZTJ A;  4H5V A;  3T19 A;  3G25 A;  4KHN A;  4Z94 A;  2WOM A;  2BAN A;  4DQS A;  3RSE B;  2QWN A;  1RIL A;  4CJP A;  3HP6 A;  4DF4 A;  4DS5 A;  1RCH A;  3HXM A;  3VQB A;  5IT9 O;  1LAV A;  4FWP A;  1UWB A;  3TPQ A;  4NCA A;  3O9U A;  5EVZ A;  5GAD P;  4ID1 A;  2HNY A;  3QML A;  2O8D B;  3LAK A;  3TTF A;  4PKG A;  3P1G A;  3P4I A;  3L2Q A;  4ILG B;  4CER A;  3E01 A;  1KLN A;  2YHX A;  4CEA A;  1DTT A;  1IG8 A;  1ZBU A;  3R6M A;  4TSX A;  1NMD A;  4FJ9 A;  4LH4 A;  4DB3 A;  1NWK A;  3ZSX A;  3RTV A;  4CJR A;  3VEV A;  1EXQ A;  3EKS A;  4RW7 A;  2F8T A;  3H1Q A;  3A0I X;  2ITG A;  4FLT A;  1TYQ B;  3AVI A;  3CYM A;  3VQA A;  2IVP A;  3H1V X;  3AVB A;  4OKJ A;  1S3X A;  2GTD A;  3P38 A;  4H8K A;  5KRS A;  1GOC A;  3AVK A;  3VER A;  4I2Q A;  1BDG A;  4CF0 A;  4AHT A;  1K8A O;  1WNS A;  1CXQ A;  3SQ4 A;  2A5X A;  2A1S A;  3O5B A;  3VN5 A;  5JLH A;  4K41 A;  3BEX A;  5AJ3 K;  2AP1 A;  4EP5 A;  1J5O A;  1YUW A;  3C65 A;  1MU2 A;  2QWL A;  1CZ9 A;  3M8S A;  1J9A A;  5C42 A;  1NGJ A;  2QWP A;  4IJN A;  1NK4 A;  4BR4 A;  4QCL A;  1E4G T;  1YJN N;  3KLF A;  5M1K A;  4BR0 A;  5C12 A;  2ZJR L;  4ILJ A;  4BRH A;  3CCU N;  1NNE A;  3LDQ A;  5AQM A;  4AM7 A;  4OVL A;  4FWM A;  4DSI A;  1LWE A;  3EY1 A;  3NHG A;  1Z26 A;  2E8A A;  4E1N A;  2DPN A;  1O1W A;  3HBT A;  1NJY A;  3EZ5 A;  3HP9 A;  3WXK A;  3ZET A;  1QVG M;  1N6Q A;  5AZI B;  2KTQ A;  5C15 A;  3AGR A;  1ZBL A;  2IOC A;  4I6M A;  4FCY A;  3CET A;  3A2F A;  3ULE B;  4JS4 A;  4E89 A;  4FK2 A;  2YV0 X;  4HTU A;  4MO5 A;  2DFF A;  4IO8 A;  3QEX A;  4BY9 C;  2UXB K;  3P5J A;  3H3N O;  3CCQ N;  4CJ7 A;  4DV0 K;  3VGM A;  3NE6 A;  1FW6 A;  1RTH A;  1VQL N;  4IO9 L;  1WOQ A;  3VQ8 A;  5CZ2 A;  3W0L A;  3CIP A;  4O4G A;  4DSF A;  5LJV A;  5J2P A;  3O9R A;  4FK4 A;  4K25 A;  4KHS A;  2ASP A;  3PUF A;  3VMF B;  1SZ2 A;  3WQU A;  1HNI A;  1VK0 A;  4IOX A;  4CIF A;  2UXC K;  1T6C A;  1RDC A;  3HJF A;  1RT5 A;  4NYF A;  5AQQ A;  1EP4 A;  4DS4 A;  4CEC A;  4MO4 A;  4PHT X;  1N8R O;  4AHV A;  2HND A;  2BE2 A;  3JXU A;  2AJQ A;  2HHV A;  3HVR A;  2O8E A;  1RT2 A;  3RR7 A;  3QIP A;  4CIG A;  1VQ8 N;  4CES A;  2Z1G A;  3MCP A;  1FXX A;  4XEI A;  4KB0 A;  3CF5 L;  3SUN A;  4C8M A;  1UA1 A;  1QSY A;  2E2P A;  2VG5 A;  2P9N B;  3C7N B;  4GY2 B;  4JI3 K;  1S6P A;  4FK0 A;  2E1Z A;  4UQG A;  2GEM A;  1LOT B;  5AQT A;  3THY B;  4HCC A;  3CQX A;  1OH6 A;  1YT3 A;  2E6L A;  1X9J A;  4A5B A;  3TAB A;  1EET A;  4WFA L;  4DR6 K;  4JKE A;  2I7N A;  4B9L A;  4DQI A;  3QDK A;  1QSS A;  2DY4 A;  4CJE A;  1QQN A;  4FJM A;  4EP4 A;  5H1S Q;  5I42 A;  2F96 A;  1NKC A;  1NOY A;  4RTF D;  3AAR A;  1KVB A;  4B1Y B;  4CI6 A;  1RT6 A;  3THX B;  3CJA A;  4RG8 A;  2D0B A;  4CW7 B;  5C2F A;  2WON A;  3AAQ A;  3A5N C;  2HMP A;  2HF4 A;  5AQU A;  1E3M A;  2HVI A;  3CG7 A;  4DQP A;  2KLA A;  2QWM A;  3D2F A;  1HPM A;  2X74 A;  2DFE A;  2KHO A;  2YJF A;  4IFY A;  3ASM A;  3DLE A;  1FK9 A;  3RMB A;  1JLG A;  4KHU A;  1DTQ A;  1EKE A;  3ZSY A;  4CHY A;  3BP8 A;  2O8C A;  5FPE A;  3THW B;  1RTJ A;  3QBW A;  4H03 B;  3J7A P;  1WLJ A;  1BA1 A;  3L3V A;  2JLE A;  3WXI A;  5HRR A;  3V1R A;  3VTI A;  1WB9 A;  4B9T A;  1NK6 A;  3C6A A;  1W0H A;  4MQ3 A;  4CJL A;  3AV9 A;  3UB5 A;  2IS3 A;  4DU3 A;  2O4I A;  3TAE A;  3ENH A;  2CGL A;  4I9Q A;  4M42 A;  1EO1 A;  4GW6 A;  3D6R A;  5CE3 A;  1ATS A;  1YXQ A;  2QKK A;  4OPA A;  3CXC M;  4N41 A;  3SK3 A;  1HNX K;  4BE2 A;  3HTV A;  1NOZ A;  1RNH A;  3NCI A;  2F9W A;  3CFO A;  2O4G A;  4ELV A;  1N36 K;  4DMN A;  2V51 B;  5M1F A;  4M3Y A; 
#chains in the Genus database with same CATH homology
 2VGN A;  1Q86 O;  4YDU C;  4JD2 B;  1ILY A;  2HF3 A;  1YAG A;  4M7Y A;  3CJ1 A;  1VAZ A;  3U8X A;  2QWO A;  2W40 A;  4A61 A;  3F2K A;  4CZE A;  4DQ8 A;  2Q36 A;  3CMA N;  4PKH A;  1NGF A;  3HSC A;  2V7Z A;  4OPH A;  1YJ9 N;  1JCF A;  5GAE P;  4H0V B;  2ZWH A;  2Q2R A;  4RCH A;  1VQ5 N;  4CZF A;  3J7Z O;  3FE1 A;  1NGI A;  2YHY A;  3CCM N;  1QZ5 A;  4H5R A;  3CHW A;  5BPM A;  3E9P A;  4WQ4 A;  2NRT A;  2BUP A;  5GIP A;  5GIN A;  3E9O A;  4JK8 A;  5AR0 A;  2PBD A;  3HM8 A;  4NLC A;  5AQL A;  4ISF A;  4CZK A;  1KXP A;  2A42 A;  5AQO A;  5M1Q A;  2Q0U A;  5C0Y A;  4WFB L;  1BUP A;  2WC9 A;  3IKM A;  5FPM A;  2ITM A;  1Q82 O;  2VYP A;  1RDU A;  1DKG D;  2WFB A;  2GX9 A;  1HKC A;  4BRQ A;  3FFK B;  5M1O A;  5AQI A;  4G9Z A;  4MLE A;  3U9Z A;  1NGG A;  2A41 A;  1P8Z A;  4JKC A;  3CER A;  1ZBS A;  2HBK A;  5BRH A;  2RE2 A;  3E9L A;  2FF6 A;  2QTD A;  3J8A A;  3SAG A;  1TYQ A;  3R1X A;  3R3L A;  3ENO A;  2FSK A;  2QI2 A;  4JAX A;  2FSJ A;  4LC9 B;  1BOT O;  5AQN A;  5HL7 L;  2QA4 N;  3W3D A;  2GEL A;  4JHD A;  5AQK A;  1HUX A;  3UKR B;  2P9L B;  2WUS A;  5LY3 A;  1D4X A;  3D2E A;  3DXM A;  3KWI A;  3LM2 A;  1QVF M;  1MWK A;  5TKY A;  2E1Y A;  2J4R A;  1T44 A;  3R9P A;  5BPL A;  3I8B A;  4BRD A;  3U9D A;  4CZM A;  3UKU B;  1QQO A;  3F5T A;  4WQ4 C;  1NGC A;  5AFU H;  2HBL A;  5AQP A;  2AA4 A;  3N4P A;  2E20 A;  5M1N A;  3U4L A;  3TSU A;  3QBX A;  4JKH A;  3VGK A;  2NRW A;  2FXU A;  3VGL A;  4CBW A;  1VQK N;  4XH1 A;  3Q7C A;  1S72 N;  3FGU A;  3H3O B;  3MN5 A;  3HOS A;  4BC4 A;  1K73 O;  3L0Q A;  1HKG A;  4JHD B;  3CME N;  4GV3 A;  2RHK A;  2UYT A;  1VQ6 N;  3QFP A;  1NLV A;  2PAV A;  3NVK A;  2P9S B;  3LDO A;  1M1K O;  4BG8 A;  4PKI A;  4C1N I;  3P39 A;  5E84 A;  4FVU A;  1CZA N;  5ELZ A;  2D4W A;  2I7P A;  3I56 N;  3CPE A;  3KK7 A;  3VF2 A;  4BR9 A;  2YI1 A;  3TU5 A;  3G6E N;  5BPN A;  1KAX A;  3I33 A;  5CR4 A;  2E88 A;  4H5T A;  4FWO A;  3LDL A;  4KH6 A;  3SAF A;  4FWQ A;  5KPR A;  1C0G A;  1SQK A;  4L3Q A;  4WQ5 A;  3MMV A;  3MWT A;  2ZGY A;  4BVP A;  4CZI A;  1VQM N;  4OO1 J;  3C0B A;  5AFU A;  1LCU A;  1K8K B;  2V7Y A;  1DT9 A;  3SBG A;  3D2F B;  3O4W A;  4R79 A;  3Q7B A;  1KD1 O;  3ID6 A;  2P9K B;  3MX5 A;  3PIO L;  1GLA G;  1X3M A;  4U67 L;  5AZI A;  5AQZ A;  1RGI A;  3MN7 A;  1KAZ A;  4YDU A;  5LJW A;  4HTL A;  3FLC O;  4BGB A;  3ULE A;  5CHI A;  4BVO A;  4MLH A;  3WT0 A;  3ZYY X;  2GUP A;  2FF3 B;  4B1W B;  3EL2 A;  4JKA A;  4CBX A;  1WUA A;  1DEJ A;  3MN6 A;  3S41 A;  2F9T A;  4BC2 A;  1YIJ N;  1GLB G;  4YOR A;  5DM7 L;  1M90 O;  4EAH D;  3A8Y A;  3T69 A;  3A5M C;  1BG3 A;  3OBY A;  3MDQ A;  3HRG A;  4H0X B;  3SLC A;  1VQO N;  1XC3 A;  1BA0 A;  2NRX A;  3ZX0 A;  4FSV A;  1X3N A;  4EHU A;  2A6A A;  4ILH A;  1Q7Y O;  5KPT A;  2YX6 A;  4H5N A;  4WQ5 C;  5F2R A;  4YOT A;  1G99 A;  3MN9 A;  3CC2 N;  4BC5 A;  2P9U B;  2NZT A;  4FWR A;  1U2V B;  5GAH P;  3HZ6 A;  4NO7 A;  3GE1 A;  1BWF O;  3CC4 N;  1Q18 A;  3R8E A;  5F1X A;  3CD6 N;  2P9P A;  3BF1 A;  5AQR A;  5AQV A;  2IIR A;  4BRC A;  1NGD A;  3DAW A;  2IVO A;  1RDW X;  3T7Z A;  2QWR A;  2FLO A;  2A3Z A;  3KWG A;  1GLL O;  4IDH A;  3IFR A;  1Q81 O;  4H5V A;  3H6E A;  2E2Q A;  3G25 A;  3FZM A;  3ENB A;  5AZJ B;  4Z94 A;  2JWK A;  4RWT A;  3TSQ A;  1NM1 A;  3KZB A;  3RSE B;  2QWN A;  4FOI A;  3VET A;  3G71 N;  1GLJ O;  1QHA A;  2E2O A;  4BRL A;  4FWP A;  3CC7 N;  2P9N A;  3C7N A;  4JKB A;  3TPQ A;  5FPD A;  1QZ6 A;  3O9U A;  5EVZ A;  5GAD P;  2CH5 A;  1YJW N;  3WEE A;  3QML A;  2E2N A;  4XH5 A;  5JIC A;  4GV6 A;  3WUH A;  4CZJ A;  1NBW A;  4BQZ A;  4A2A A;  3VEY A;  5AQJ A;  2NRZ A;  3HI0 A;  3TTF A;  3OA9 A;  3P4I A;  1R59 O;  1XUP O;  4IJA A;  4ILG B;  4PKG A;  3AAP A;  5GAG P;  2ZJP L;  4O8K A;  2YHX A;  3GDQ A;  3CQY A;  4A57 A;  1IG8 A;  3JS6 A;  3EN9 A;  5AQH A;  4BRF A;  2D1K A;  4C23 A;  3R6M A;  1NMD A;  1T3V A;  1KAY A;  2NRH A;  3IDH A;  4DB3 A;  2CGK A;  4CD1 A;  3LM9 A;  4GVE A;  1NWK A;  3B8A X;  4MDA A;  4BGA A;  3WEE B;  3VEV A;  4FPB A;  2OTJ N;  3DXK A;  3EKS A;  2HBM A;  3CI5 A;  3H1Q A;  4BR2 A;  3VEZ A;  3A0I X;  4BRE A;  5B8H A;  3CCV N;  1TYQ B;  2F7T A;  5KQ8 A;  3NVM A;  4QS7 A;  4BR5 A;  2IVP A;  3H1V X;  4BG9 A;  4IZ9 A;  5AQG A;  1S3X A;  3D7E O;  2GTD A;  2NRV A;  3P38 A;  2IVN A;  3D2E B;  3DXM B;  4WF9 L;  4CBU A;  3CCL N;  3VER A;  3AY9 A;  3TTD A;  1BDG A;  4H5W A;  4DKW A;  1Z6R A;  3DXK B;  3WXJ A;  1K8A O;  3EZW A;  3CJ7 A;  4H0P A;  4B1V A;  3GBT A;  3LL3 A;  2A5X A;  2A40 A;  3L6Q A;  4FWS A;  3MCA B;  3O5B A;  4JKF A;  3VF4 A;  5JLH A;  1TUY A;  4K41 A;  3BEX A;  4EFH A;  4BRA A;  1GLD G;  4PL8 A;  2AP1 A;  4BRG A;  1NGB A;  4K43 A;  5KPZ A;  1GLE G;  1YUW A;  1HX1 A;  3VEW A;  4NB4 A;  1HLU A;  3EKU A;  5M1P A;  3C65 A;  4QS8 A;  4BRI A;  2QWL A;  5JVG L;  2P9I A;  1NGJ A;  2QWP A;  4KH5 A;  4IJN A;  4A62 A;  5F0X A;  1SAZ A;  3WQT A;  4IOA L;  4BR4 A;  1E4G T;  1YJN N;  2ZJR L;  5M1K A;  1IJJ A;  3O9S A;  4KBO A;  4BR0 A;  5C12 A;  4ILJ A;  3MWP A;  4BRH A;  3CCU N;  2NLX A;  3LDQ A;  5JVH L;  5AQM A;  3GOI A;  3OHR A;  3ATV A;  4AM7 A;  3KHY A;  4FWM A;  2GWJ A;  5EY4 A;  2BH1 A;  2QXL A;  1T6D A;  2WBN A;  3EE9 A;  3O9T A;  5AQS A;  1C0F A;  2ZF5 O;  5AQY A;  2E8A A;  3O08 A;  3ID8 A;  2YCH A;  1JCG A;  1VQ9 N;  2DPN A;  3HBT A;  1MWM A;  4IFE A;  4M63 C;  5EXW A;  4DHY A;  3E1Y A;  4CD3 A;  4BC3 A;  5C2D A;  3WXK A;  3ZET A;  3SJH A;  1QVG M;  5AZI B;  5C15 A;  3AGR A;  3VES A;  2Q1N A;  4I6M A;  2GWK A;  2W41 A;  3FZL A;  3CET A;  1U6Z A;  2FSN A;  3ULE B;  5BRF A;  4YOY A;  4YOX A;  3O80 A;  1KC8 O;  5BN9 A;  1MA9 B;  4JKG A;  4YOU A;  4MO5 A;  4FL9 A;  1S22 A;  4IO8 A;  1TUU A;  2VGM A;  4BY9 C;  3DWL A;  1K9M O;  3SMP A;  3H3N O;  3CCQ N;  4CJ7 A;  3VGM A;  1VQL N;  3M6G A;  4IO9 L;  1WOQ A;  3GG4 A;  3FZF A;  3L4Q A;  4JNE A;  3ATU A;  3W0L A;  2H3G X;  3CIP A;  4F9O A;  2VCP A;  3ZET B;  4H0O A;  3IUC A;  5LJV A;  3O9R A;  4K25 A;  4JK7 A;  3HOT A;  2ASP A;  4E1J A;  1Z05 A;  3MK6 A;  3UE5 A;  1YI2 N;  4UY8 O;  1NGH A;  3VMF B;  3VEN A;  4JKG B;  1SZ2 A;  4H0Y B;  5E26 A;  2ZGZ A;  3WQU A;  4IOX A;  4C1N K;  1GLF O;  2CH6 A;  4JEP A;  4FWN A;  4A2B A;  1T6C A;  3WXL A;  1ZC6 A;  3O1B A;  2P9P B;  5AQQ A;  1YF5 L;  3PLA A;  3C6H A;  4IEE A;  4HWI A;  4MO4 A;  4WYB A;  1NGA A;  1VQN N;  4PHT X;  1N8R O;  4BRN A;  3JXU A;  1OVY A;  2QEX N;  4AF1 A;  5I9E B;  3OBW A;  3EO3 A;  3VPZ A;  2Q31 A;  5AQW A;  3O1W A;  3K9K A;  1MDU B;  3GL1 A;  3K9J A;  4BRM A;  1H1V A;  1VQ8 N;  3MCP A;  3CJ9 A;  3M5R A;  3CJC A;  4XEI A;  3VEO A;  5BRE A;  2OAN A;  3CF5 L;  3CJB A;  2EWS A;  3DJC A;  1RFQ A;  2E2P A;  2P9N B;  2P9L A;  3C7N B;  4GY2 B;  3UKR A;  1YIT N;  4BRP A;  2KKZ A;  2E1Z A;  5FPN A;  3TTC A;  4WFN L;  2GEM A;  1LOT B;  2PFU A;  5AQT A;  1ATR A;  4GNI A;  5AQX A;  4BRO A;  3KVG A;  3O9Q A;  5ADX H;  3UKU A;  1NJI O;  4JN4 A;  3ZX2 A;  1VQ4 N;  1QQM A;  4FO0 A;  4O5F A;  3WXM B;  2ASO A;  3CQX A;  4B1U B;  1OKJ A;  1X9J A;  3DLL L;  4A5B A;  1BU6 O;  4WFA L;  3H46 O;  3O6W A;  4M7X A;  4GV9 A;  4JKE A;  2I7N A;  3CCJ N;  3QDK A;  2Q0R A;  3LDN A;  4WCE L;  2QM1 A;  3VOV A;  1BO5 O;  3PIP L;  1SS6 A;  3SAH A;  1QQN A;  3SBT A;  4IXC A;  1W97 L;  2HBJ A;  2BTF A;  2P9S A;  4BR7 A;  4U7B A;  4CZL A;  5H1S Q;  4EIA A;  5DM6 L;  1ZXO A;  4YOV A;  4RTF D;  4FWL A;  4CZG A;  3AAR A;  3QIC A;  1HKB A;  4Y0W A;  4KH4 A;  4B1Y B;  5KQD A;  3CCS N;  4CI6 A;  3P31 A;  3CPW M;  3IMX A;  1KQS M;  3CJA A;  4FOE A;  5C2F A;  1GLC G;  3AAQ A;  3A5N C;  3E66 A;  3F9M A;  3MX2 A;  5BRD A;  2HMP A;  3BF3 A;  2HOE A;  3L4I A;  3VF6 A;  4FPA A;  2HF4 A;  2NRR A;  4XH4 A;  5AQU A;  5C10 A;  1HJO A;  3OW2 M;  3A5L C;  5MLC Q;  3A5O C;  1ATN A;  1EQY A;  2VWB A;  4IEI A;  5ADX A;  1V4T A;  5AQF A;  2KLA A;  5HOO A;  1K8K A;  2QWM A;  1W2B M;  3D2F A;  1HPM A;  4K42 A;  5EOY A;  2KHO A;  2YJF A;  4YOW A;  2P9K A;  2OTL N;  1JJ2 M;  4JK9 A;  2HST A;  2YJE A;  3G4S N;  3BP8 A;  3FZH A;  4O8U A;  5FPE A;  3AGK A;  1O13 A;  3O8M A;  3M3Z A;  3QB0 A;  2ASM A;  3QBW A;  4H03 B;  2P9I B;  2YHW A;  3BUZ B;  5GIO A;  1BA1 A;  2ZJQ L;  2NNW A;  3TSP A;  3LDP A;  1YHQ N;  4B9Q A;  3WXI A;  4MDB A;  4QS9 A;  1V4S A;  4DCH A;  4AM6 A;  3VTI A;  4EHT A;  2QWQ A;  3ZEU A;  3H45 C;  4B1Z A;  5JMV A;  3C6A A;  2Q97 A;  1VQ7 N;  1YVN A;  2P9U A;  3UB5 A;  4A59 A;  1U2V A;  4JKD A;  3SMS A;  4CZH A;  3FR0 A;  3FZK A;  3CCR N;  3ENH A;  5EX5 A;  3RVC A;  3NMU A;  2D0O A;  1XQS C;  2CGL A;  1VQP N;  2JWL A;  1P90 A;  1EO1 A;  5BR9 A;  3EE8 A;  3CCE N;  4JD2 A;  5BN8 A;  3D6R A;  5CE3 A;  5TKW A;  2CGJ A;  1ATS A;  4H0T B;  4BRK A;  1YXQ A;  4IWV A;  3I55 N;  4OPA A;  3CXC M;  1ESV A;  2QW9 A;  4I6M B;  4J8F A;  4FWK A;  1E4F T;  3N4Q A;  3SK3 A;  4NLB A;  3VEX A;  4B1X B;  3ZX3 A;  4IOC L;  3HTV A;  5JLF A;  3ZEU B;  5AZJ A;  1JCE A;  2V52 B;  3M1F A;  2D0P A;  2F9W A;  4PL7 A;  1DGK N;  3VTH A;  3RSE A;  1Y64 A;  4ISE A;  4ISG A;  4A5A A;  3QFU A;  2V51 B;  5M1F A;  4BQL A;  1NGE A;  1J6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...