2WC9A

Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
177
Chain Sequence
VVPFENLQIEEGIITDAEVARFDNIRQGLDFGYGPDPLAFVRWHYDKRKNRIYAIDELVDHKVSLKRTADFVRKNKYESARIIADSSEPRSIDALKLEHGINRIEGAKKGPDSVEHGERWLDELDAIVIDPLRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TERMINASE LARGE SUBUNIT
publication title Structural Basis for the Nuclease Activity of a Bacteriophage Large Terminase.
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Viral protein
total genus 49
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.280 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2wc9A00
2WC9A 2WBNA 4DKWA
chains in the Genus database with same CATH superfamily
1QS4A 3CCVN 2WFBA 3CMAN 1CXQA 4M41A 5A2QO 3J7AP 3ID8A 3ATUA 1JLGA 3AO5A 3RMBA 4E7HA 5DMRA 2GUIA 2LSNA 1NGJA 3LAKA 1TKXA 4WQ5C 3VEZA 3ATVA 1QVGM 4M3XA 1ITGA 3THYA 3PLAA 3DLHA 3KD1E 2FLOA 5I42A 1XQSC 3CJ1A 3WNEA 4EP4A 1VQNN 5M1KA 5DK5A 3L4QA 1KAZA 2IC3A 4F8RA 3NFAA 2Q1NA 2X74A 3HM9A 1OH6A 3M8PA 3OYNA 3LDNA 1IG8A 3DLLL 4DTXA 1J5EK 2OA8A 4BG9A 2FBTA 1WSJA 3QO9A 4CJWA 1JLBA 1QHAA 2GTDA 4ELTA 4FSVA 1W0HA 2VG5A 3P83D 4IXCA 4FK4A 1RDWX 1BCOA 2NRRA 4DMNA 3AGRA 3CERA 2KFNA 4IO8A 4CK3A 3EYZA 5JLHA 3QESA 3ZSYA 3U9ZA 1WAFA 3A5OC 4CZLA 1N32K 4KO0A 3LP3A 3LM2A 1HPMA 4M3RA 3V9WA 4H5VA 3MEDA 3F9MA 1XI1A 1TUUA 4MFBA 4FJGA 2ZM6K 3CQ8A 4BG8A 4BRCA 3V9UA 1RDDA 4J2AA 1VRTA 3THVA 1BWFO 3R1XA 1CZ9A 4EFHA 4H0XB 4CGJA 4A62A 1HNIA 2P51A 3M3ZA 4CJUA 5FRNA 2P9UB 2GX9A 4I6MA 1S9GA 3D45A 4CEBA 4H5TA 3NE6A 4JKGA 1HKCA 2Z1GA 2D0CA 4DG1A 4X65K 4DFMA 4G1QA 5F1XA 3V9SA 5GINA 4HCCA 1ATRA 3WNHA 1D9FA 1NM1A 1BG3A 1TKDA 4DQIA 5EVZA 5AQZA 4YOWA 1RILA 3O3HA 2NRWA 4M63C 4BC5A 4BRGA 1BU6O 3OYEA 3WXLA 4PHTX 3ZEUA 1TKZA 4FJMA 4FWSA 3RTVA 2G8KA 3J7YP 4LC9B 4A57A 4DV5K 3SAGA 3LZJA 1HKBA 1JXBA 1RCHA 2RHKA 3OHRA 3VGLA 2YHXA 3AA4A 4FJLA 4BRHA 4BR7A 5LMUK 2UUAK 3NCIA 3DMJA 2G8FA 1KVCA 4IEIA 1T3VA 4YOUA 4Z4EA 1HKGA 2QWNA 4FOEA 1TK8A 4YORA 2QKKA 3VENA 4FJ5A 4JKCA 4DSIA 4CFAA 3WEEB 4FLUA 3O1BA 1KD1O 4B1VA 3OYGA 1OH8A 3DJCA 3VQEA 2E20A 3U6FA 1UA0A 4V19S 4CE9A 3M8QA 1NK4A 2VGNA 5AQVA 1NOZA 2O8FB 2WONA 4JI8K 3CQXA 2O8CA 4RW4A 4YOTA 3V9ZA 3FZMA 4YOVA 4K41A 4BR4A 3SNNA 2OANA 3TTCA 3QBXA 4KPYA 1WSGA 1RT7A 5KRTA 1TKTA 3J80O 2UXBK 1LWCA 1HNZK 2ASPA 3LPTA 5IWAK 3MWTA 1RBSA 3PX6A 3I0SA 3ZSVA 3CHWA 3TAGA 2F96A 1T6DA 1KFDA 5DM6L 3TTDA 3ISNC 1G15A 1CZAN 1VSEA 1D5AA 4CZFA 4XH4A 1FK9A 1JL1A 3TARA 3QBWA 2QKBA 4A5BA 5BRFA 4CECA 4DFPA 2CH5A 3V4IA 2F8SA 4C23A 2OTLN 1WUAA 3CFRA 1HNWK 4O5FA 1L5UA 1JXEA 2Q3SA 1QHTA 4PY5A 4M7YA 1NK6A 4DR5K 5EY4A 4FJXA 1RDAA 3O1WA 2XY7A 4A2AA 4IOAL 3KK2A 3OW2M 4DQQA 3TABA 4BRMA 3K57A 1T05A 4NYFA 1W97L 4HUFA 4LSNA 4CHOA 4KI6A 1Q86O 3OYJA 1QZ5A 3DRRA 3KWIA 4F3TA 1LAWA 4H8KA 1VSMA 3EZWA 4ICLA 3F5TA 3LDQA 4DR4K 3LDOA 1IKXA 4JRPA 2HNDA 3T1HK 4FJ7A 1UA1A 4KB1A 2W41A 3UE5A 3T1AA 3O5BA 2WUSA 3QEVA 1IV0A 4M3UA 4FM2A 4X62K 2P9KA 5AQKA 1J5OA 4DCHA 1TV6A 2VWBA 3HPOA 4A2BA 3K5NA 4LFBK 2VQFK 2ZWHA 3QFUA 4BWJA 3AAQA 2OTJN 5BN8A 1KAXA 4FWRA 4IDKA 4LF8K 5M1FA 4X66K 3N4QA 2JWKA 4BGBA 5C2DA 1YUWA 3R3LA 3HPGA 3AA2A 1C6VA 4WYBA 1SUQA 3ZT3A 1X9SA 1FKPA 1VK0A 3PSFA 2OPQA 3B6OA 3CC2N 1HYVA 4CHZA 4FVUA 4J2BA 3O3GA 4JI4K 3AO4A 5AQGA 2WC9A 4WCEL 2F8TA 2P9NA 2KFZA 4BQLA 1ESVA 2YNGA 4CJSA 5C10A 3QFPA 2EX3A 5AFUH 4OX9K 1NGDA 4L3QA 1KQSM 4CGDA 4FWKA 1NNEA 2HHHK 2UXDK 5KQDA 2ZQBA 3NF6A 5AQRA 1W2BM 3PX4A 4BRAA 4LFCK 2QM1A 4MO4A 4FLZA 3PIOL 1HYZA 2JGUA 3KK7A 4OLBA 1DKGD 1NMDA 3G6EN 3HP6A 4B1XB 4FVMA 3S9HA 4H03B 4LD0A 5HRPA 4N41A 1QSLA 1Q8IA 4GMJB 1ZYQA 3VOVA 4UQGA 4ISEA 5BREA 4ID5A 3QERA 4WQ5A 3O9UA 4CK2A 3MECA 1S1TA 5LY3A 3L2RA 1BQMA 1QSYA 4PKGA 4DSFA 3K5OA 2FBXA 1YT3A 3IFRA 3L6QA 3V1QA 3OYKA 3OYHA 2O8EB 1R0AA 4FZZA 2NZTA 1X9WA 3NF7A 1WSEA 2GWJA 4YY3K 1BO5O 5AQNA 2YNHA 2RF2A 4NXMK 2OPSA 3MXMA 3OYLA 5C12A 3LDLA 3K59A 4FJNA 2ASMA 4K25A 3SLCA 3KLEA 3RR8A 5FPMA 1TAUA 4I7FA 3M8RA 4NCAA 3NH1A 2G8UA 4EZ9A 4JKBA 4YDUA 4CBWA 3CCQN 5CYMA 1RTIA 3TR8A 1RT4A 2BTFA 1MWKA 1S5JA 5AR0A 1U45A 2IVPA 3K5MA 5AQPA 4CK1A 4BE2A 1JLCA 1WBBA 3TAPA 2IAJA 3O9SA 3JSMA 4LFAK 4E3SA 4CJKA 4IG3A 4DFJA 3CJ9A 1V4TA 3JXUA 2VQEK 4EHUA 2E6MA 1NLVA 2HMPA 1UAXA 1ASVA 4PKHA 4FLVA 4OVLA 3WUHA 2A41A 1VQLN 4OPKA 1S22A 3NGYA 3DXKB 3ZETB 5IT9O 3DLEA 4QS9A 1OH5A 2WOMA 3DLKA 4AH9A 1YJNN 1ZBLA 2O8DA 3U8XA 1VQ6N 3PO4A 3K2PA 4JI6K 3V81A 3BUZB 3SAHA 2ZE2A 5J2PA 1SL2A 4QCLA 2OZSA 4B3SK 2YKNA 4JD2A 4KHWA 3VQ6A 1LOTB 3Q7BA 1NG9A 3L2QA 3L0QA 4KB0A 5FRMA 2NRTA 3E66A 4MLEA 4WFBL 4BRFA 3RMDA 3MN6A 5AQMA 1EETA 3CPEA 3CMEN 4UY8O 3GBTA 1D4XA 5FPNA 3NHGA 3GDQA 4CZIA 3H1QA 3V9XA 3PUFA 1RT2A 3EZ5A 5HOOA 3VA3A 2OZMA 4DV3K 3LDSA 3RMCA 3CM6A 3ZT4A 4CF0A 5FROA 4JKAA 3U3GA 5CZ1A 3NVMA 2FSJA 4GV3A 4FCYA 3RRGA 3THXA 2PYLA 1HLUA 3ASMA 3IRXA 2G8HA 1YIJN 1NU0A 2BGGA 1MA9B 4CW7B 2HHTA 1GLJO 1YJ9N 3KLIA 4M3YA 2E2OA 2XRIA 3T1YK 2QW9A 1MWMA 2E88A 5C0YA 1RT3A 4H5WA 4KHQA 2E2PA 4FYDA 1ZC6A 3A5NC 5KGWA 2E1YA 5AJ3K 4KTWA 3VQ9A 3BZCA 2HHXA 1RT5A 1C0MA 4FPBA 4CZGA 4DFKA 1QVFM 2P1JA 4GY2B 4DWIA 1NGFA 3VEYA 4ID1A 4C8OA 1LW2A 4KRFA 1BISA 4WFAL 1JLAA 2FSKA 3OS0A 1BA1A 2WTUA 5I3UA 4Q5VA 1XUPO 4B9SA 1RBUA 3VEOA 4BR0A 4H0TB 1FJGK 4B9NA 3T69A 3WXMB 4CZKA 2NRXA 2CH6A 3KVGA 1ZBFA 3A0IX 3WQTA 4H0OA 3H6EA 3UB5A 5FLXO 3HL8A 4BROA 4OPHA 1XMQK 4FZYA 3HO1A 1IKVA 1XHZA 3EL2A 1VQ5N 4O44A 3R9PA 2EWSA 5BR8K 5JICA 5F2RA 2DFHA 2JLEA 1GLEG 1EXQA 4RW6A 4FJ8A 2KZZA 3DM2A 3KWGA 3SUNA 1YVNA 3TU5A 5BPMA 5KRSA 4FWMA 2QXFA 2CGLA 3MEGA 3LM9A 5HRRA 1DLOA 4JN4A 3FE1A 3LDPA 1M90O 1ZXOA 5M1PA 3AA5X 1DTTA 3KLGA 3C6AA 2FSNA 4H0VB 3ZSQA 5KPZA 1YVUA 2P9PB 4CZEA 3HOSA 2I5JA 4KREA 3K9KA 1HQEA 4AHCA 5AQWA 3KLFA 1L3TA 3RWUA 1GLCG 2W42A 4FWNA 2HMIA 4CJPA 3FZKA 5AQQA 3WT0A 4JKFA 1KCFA 3SAFA 4BY9C 3CCUN 3A2FA 3SQ1A 3VQPA 3R6MA 3MDQA 2D5RA 1KC8O 4GV9A 2DFFA 1EKEA 4H4MA 2P9UA 1K73O 3O8MA 4HVJA 1K8AO 1Q82O 2G8IA 4CFCA 1ZBUA 3NGIA 4YDUC 1BQNA 2W40A 4DUYK 2DPNA 1NGHA 1YXQA 1TAQA 1NK9A 2KQ2A 1XNRK 3GOIA 1TK0A 1HUXA 5AQLA 4E0DA 3DLGA 4I9LA 3MN5A 4B8AB 1HRHA 4DS5A 3CJCA 4BR5A 1IBMK 2IGIA 3CJ7A 3B6PA 4QOZB 4M3WA 2YHWA 4QAGA 1WNSA 3MXJA 3KJVA 2VWKA 4O8KA 1D8YA 2CGJA 4O55A 1GLBG 2ITMA 5GIPA 3IG1A 2P9SA 1NJZA 3FZFA 4KKOA 4O0IA 3AAPA 4E7JA 1IG9A 1XMOK 2GELA 4JKHA 1NJWA 1BDGA 1KRPA 4OKEA 5C42A 2I7NA 2IVOA 3TSQA 3MWPA 4CESA 5KI6A 4WF9L 4FK0A 4BREA 4JKDA 1VQPN 4DUZK 3I0RA 1JCEA 3L4IA 3DYAA 1LWEA 4CEOA 5AQIA 1W7AA 4KHUA 2I7PA 4OGCA 1C1CA 4ISFA 2YI1A 3WEEA 3ZLJA 4N47A 1C0TA 3OBYA 1Z6RA 4AHUA 3C7NB 3I33A 4E1NA 1EP4A 3ENHA 4CF9A 4MLHA 4DF8A 1N5YA 4JI2K 2O8FA 4OPAA 2A3ZA 5AQFA 5SWMA 1BIUA 2P9SB 2P9LB 5E26A 5GADP 2W6LA 4IO9L 3CC7N 3OYIA 3TPQA 4A61A 3AO3A 3SJHA 2QXLA 1NGIA 4KV8A 4OJRA 3V6DA 1VQ8N 1WB9A 1RDCA 1TYQB 5MLCQ 5K14A 4F2RA 3TTFA 1WLJA 4IG0A 3GL1A 5BPNA 1Q18A 4DKWA 3QEPA 4HTUA 2F9WA 1RT1A 2Y1IA 4FLTA 2V52B 3LANA 3GG4A 1U47A 2HHQA 3ULDA 2VG6A 2HHSA 1C0UA 1YHQN 4CJQA 3HK2A 3AVLA 2Q2RA 3OJUA 4IBNA 1B9FA 4EHTA 3NVKA 2IS3A 1TGOA 4XH1A 3LALA 5J2NA 1SV5A 4BVOA 3F9KA 2RPIA 2E4LA 1DGKN 3ZSWA 3T7ZA 1JLQA 5LL6Z 3ENOA 4ELUA 1SKSA 2V51B 2HNZA 5HP1A 4JEPA 5EOYA 5TKWA 1NWKA 3SUOA 3SMSA 4JK9A 3W0LA 3DRSA 4J8FA 3SV4A 3CG7A 4M42A 4CEFA 5AQSA 1T7PA 4ILJA 1NOYA 3E9OA 2R7YA 2Q0UA 1ASUA 2J4RA 1DTQA 5BRDA 2HW3A 4ZHRA 4DV7K 4B1YB 2UXCK 2OPRA 1NGEA 2FBVA 4R5PA 4CI6A 5M1QA 3U4LA 5KPTA 3NGZA 3THWB 4F3OA 3SQ2A 5C25A 2D0OA 5CYQA 1NKBA 3F73A 1W9HA 3JYTA 1VQKN 1G99A 1GLAG 3FFIA 5C24A 1NK5A 3M1FA 3RMAA 3VF4A 2OCEA 3AVAA 4IZ9A 4F9OA 1DEJA 2PAVA 3VERA 2IIRA 2HOEA 1OVYA 2A40A 3ZX3A 3J7ZO 4R79A 3SQ4A 3QDKA 3AGKA 3CIPA 2CGKA 3BY5A 2F4VK 3DXMB 4NB4A 3BGRA 1QQOA 2BE2A 3EKUA 4CJRA 5I9EB 1U48A 3H1VX 3MN9A 5JLFA 1XHXA 1HJRA 1BI4A 1C1BA 1QSSA 4LF6K 3VF2A 2E1ZA 4DV2K 2DTUA 3W3DA 1T03A 4FWPA 1ILYA 1RBVA 4IWVA 1RFQA 1OVQA 4XH5A 1S1XA 5ADXH 2G8WA 2A6AA 3DRPA 1RTDA 3D2FB 4DS4A 3EY1A 2ZD1A 1R59O 1KAYA 1CLQA 5KGXA 3G71N 4B9VA 3SUQA 4W5TA 1C0FA 1J6ZA 3TANA 4CGIA 4NO7A 2GV9A 3TSPA 3HSTB 2NRHA 2UUBK 3AO2A 5HL7L 3QEIA 2QWQA 2YNIA 1L3SA 4NLCA 1BI4B 2O8EA 3L3VA 4Z4HA 2YV0X 1Z05A 2YJFA 4KH4A 3KHYA 4CEQA 3ID6A 4FM1A 3CCJN 2A1RA 3K0SA 4KHNA 1WOQA 1RDBA 3VGKA 5ELZA 2PBDA 4DTRA 3CCMN 1I39A 1JLFA 3CYMA 5FPEA 3QLHA 3J81O 1S6QA 3G25A 4PL7A 1HX1A 2ZF5O 1D9DA 4CF1A 1U2VB 5HROA 1JCGA 1X9JA 4JAXA 4HCBA 4IEEA 4CF2A 3KD5E 4BE0A 3VQQA 4DHYA 2YX6A 4CHNA 5GAGP 3TAQA 1HNXK 3LZIA 5AQOA 2HNYA 3C94A 3HZ6A 3MAQA 1N36K 4G9ZA 1OKJA 3IAYA 1S1VA 1KTQA 3A5MC 4H0PA 4WQ4C 2D1KA 4CJLA 4RTFD 3OBWA 4KH5A 4DQ8A 2XO7A 4J2DA 2GEMA 1Z26A 1CZBA 3CI5A 4KHPK 3CF5L 4CFBA 5HBMA 1SKWA 2ZJQL 3P1GA 1NK7A 1XC9A 3NH0A 4OO1J 3ULEB 4LH5A 4HUGA 4K0KK 3L2UA 4DF4A 2HF4A 4CEAA 4FZXC 3QMLA 4YHHK 1YJWN 3QINA 1SL1A 2AP1A 1VSDA 3DXKA 4J2EA 3ZETA 4KHYA 3WXIA 5M1NA 5GAHP 3QEWA 4K43A 4DB3A 4H5RA 4Z0UA 1TL1A 5JS2A 4CJ4A 4CIFA 2KTQA 1QZ6A 3KKRA 4H4OA 4U67L 3QIPA 1BCMA 3UKUB 3SMPA 2IOCA 1VRUA 2X78A 3IKMA 4C8NA 4K8XA 1NGBA 4B1ZA 3VQBA 4FLXA 3FGUA 1GOAA 3D2EA 3RR7A 3SPYA 1X1PA 4CERA 3KK3A 1U4BA 2HHVA 1WSIA 4ILGB 4W5NA 3TAMA 3O9TA 4U7BA 4DTUA 4AHSA 4DSLA 3C0BA 3O9RA 1EWQA 2RKIA 3HBTA 5FDLA 2JWLA 4PL8A 1RT6A 3H46O 2QTDA 4CHQA 4DTMA 1J53A 3AVNA 4DSJA 4E7LA 4IJNA 4B9LA 4FJ9A 1Q7YO 1F21A 3HOTA 1C1AA 4PQUA 4CZMA 3ZX0A 4JKEA 2PYJA 1O1WA 5HRNA 3TAFA 1RGIA 3B8AX 1T8EA 4EIAA 4E7KA 3D2EB 3S3OA 4BRIA 5GIOA 3VQDA 2YHBA 3CCLN 3EKSA 3K9JA 1SZ2A 4BACA 3AVCA 3BP8A 3HM8A 2D0PA 4BWMA 4CGGA 5KPRA 1XNQK 1BOTO 1J9AA 4EP5A 3CJAA 5J1EA 3BEXA 4RG8A 4WFNL 1S72N 3U9DA 4ISGA 5BR9A 4LF4K 5LMNK 4QS7A 5M1OA 3OYDA 1KXPA 2IVNA 3O08A 3VEXA 4DR3K 3VQ4A 4DR1K 4AHRA 3P38A 4CFDA 1L3VA 4PWDA 1GOBA 1SL0A 5KQ8A 3EE8A 4YOXA 3ITHA 3SBTA 1K9MO 2QWLA 4FO0A 4DTOA 2DY4A 3HJFA 3SJJA 4C1NI 2VWJA 2HF3A 1ATNA 4XIUA 2O4GA 3FZLA 3A5LC 4GKJK 3CFOA 1OH7A 4L8RB 3S41A 3LPUA 5B8HA 4BDPA 4HWIA 2YCHA 3MN7A 3NAEA 4BVPA 5JS1A 1BL3A 3WXJA 4DTSA 3H3NO 4JHDB 2Q0RA 2QWOA 3OTOK 2P9PA 2QA4N 2P5GA 2F7TA 4KAZA 1N33K 2E8AA 3AVMA 1HNVA 3OYAA 1NK8A 1DT9A 4GKKK 3L2VA 4QS8A 1JLEA 2NNWA 1IH7A 5E84A 2QEXN 5F0XA 3ALYA 1IKWA 1WAJA 3PSIA 1VQ4N 3VF6A 3S3NA 3VQCA 3OA9A 1YTAA 3O4WA 4FLYA 3OS1A 4JNEA 3SBGA 2OYQA 3SYZA 3AARA 3IMXA 1RTJA 1BIZA 4I2QA 3LWMA 3V1RA 1WSHA 4B3MK 1BHLA 3D0PA 2G8VA 2ITGA 4DSEA 3SQ0A 1IBKK 3QICA 4B3RK 3CM5A 3EO3A 2KZMA 4FJJA 4CJVA 4KH6A 3KIOA 3K5LA 1K8KB 4FM0A 3CETA 4RWTA 1GLDG 3AVFA 3HPHA 4E19A 5BRHA 4ZTFA 3LP2A 4JI0K 1VAZA 1A5VA 3TSUA 3OVNA 4BRPA 5AZJB 3NMUA 1Q81O 3D7EO 4AM7A 3AV9A 3PO5A 3WXKA 5EX5A 4MDAA 2X6SA 3VTIA 3PY8A 1VHXA 3IUCA 5ADXA 4RCHA 2ATQA 3L2WA 1QQMA 3HVTA 3UIQA 4IFVA 4CCHA 5GAEP 4BC2A 5AQTA 4JV5K 3TWHA 3CC4N 1WBDA 3C7NA 3HYFA 4CIEA 2V7YA 1T6CA 3T19A 3ZT1A 3QB0A 1C0GA 4FW2A 1X3NA 4BRQA 5LJWA 2P9LA 1LWFA 3O3FA 4W5RA 3THYB 5AQXA 3MX2A 5BN9A 5AFUA 3HXMA 4FOIA 1HPZA 4FLWA 1H1VA 4CD1A 2H3GX 2XY8A 3U3YA 5CZ2A 2Y1JA 4DLGA 3EE9A 3AY9A 4DSKA 1Q9XA 4OKKA 1TYQA 2NLXA 3LAMA 1FKOA 4WQ4A 1ZBSA 3OYCA 4DV0K 4BRLA 2GUPA 2GWKA 3CD6N 4GVEA 1ATSA 1VSFA 4MDBA 3ZSZA 4M3TA 4HUEA 4B1UB 4C8LA 4TSXA 1NK0A 4Z4CA 4CJTA 4Z94A 3NDKA 3EN9A 4BC4A 4YNQA 2PZSA 2DFEA 3SUPA 1EQYA 2E5LK 3DAWA 5FPDA 3MK6A 3BF3A 3ENBA 1YF5L 4I2PA 3DWLA 5SZTA 1HJOA 2ZJRL 1VQ9N 5EXWA 1RBRA 3SPZA 3TI0A 1TK5A 4JI1K 3WNFA 4BQZA 1T44A 2F9TA 2QWMA 3QEXA 4AHVA 4JI7K 4W5OA 3N4PA 3SK3A 3BZKA 4FWQA 4Q0BA 2RN2A 4RW8A 3O4NA 4H5NA 1S1WA 2PFUA 4YFUA 4B08A 1VSJA 1NMNA 4I6MB 3F2KA 4DR7K 3RVCA 3MCPA 3EEQA 4DV4K 4JKGB 3CCSN 3S3MA 4K42A 4CJFA 3MX5A 1X3MA 4JI5K 3QNNA 4DV1K 4DTPA 4O8UA 1Z25A 2FF6A 2ZGYA 1EO1A 3THWA 4JLHA 4FW1A 2XY6A 2AJQA 1NJXA 3P5JA 4AILC 1LCUA 4CJ7A 1WSFA 3SCXA 2Q36A 1SKRA 1X9MA 1ASWA 4C8MA 1Y64A 4CEEA 4AQYK 4CGFA 4KBOA 1V4SA 4B8CA 3ZEUB 4F4KA 4AM6A 1JKHA 1SQKA 4B1WB 3LWLA 4FWOA 1UOCA 1KLMA 2YKMA 4ZTJA 1KSPA 3DXMA 4FK2A 1NJIO 3VQ5A 3FLCO 3ZSOA 5HRSA 2A5XA 1FXXA 3UKRA 4PKIA 3WNGA 5JMVA 4DR2K 1QTMA 3H45C 1B9DA 2YJEA 1IJJA 2Z1JA 3QIOA 3LP0A 4BGAA 4K8ZA 3AO1A 1P8ZA 4JRQA 4CVNE 5JVGL 2FBYA 4C8KA 3KKSA 4Z4FA 1I3AA 3P31A 2FXUA 3D2FA 2HSTA 5T7BA 2O8CB 1A5WA 3RSEA 4CBXA 1CXUA 1HR0K 2YNFA 1XC3A 2B5JA 4YOYA 3PV8A 5C15A 4MO5A 1U49A 3I8BA 4O5BA 3HTVA 2KHOA 3SV3A 4CIGA 3G4SN 3ZT2A 4CF8A 4DQSA 4FJHA 3VMFB 4DQPA 4RW7A 3UKRB 1WN7A 2P9IA 4B9QA 3PX0A 3G0ZA 4PUOA 4HHTA 3KLHA 1U04A 4E89A 4ELVA 3BDPA 2UYTA 4JS5A 5H1SQ 2X6NA 3G10A 4JK8A 4CZHA 1U2VA 1YITN 4DLEA 1E4FT 1RBTA 3ZT0A 3VEWA 2ETJA 3RSEB 4Y0WA 4FJKA 3HP9A 3OYBA 2E6LA 3LL3A 4LF7K 1N8RO 1ZBHA 3A8YA 1ZBIA 4GNIA 4KFBA 2VYPA 5LJVA 1GLLO 1VQON 3ZCMA 3CXCM 1S1UA 2P9IB 5CHIA 4M3ZA 1L3UA 2VCPA 3JAMO 1K6YA 1VSKA 1BGXT 2YHYA 3ULEA 4IOCL 1JL2A 3MCAB 1HQUA 3FZHA 3OY9A 1JJ2M 2QWRA 4OKJA 3C95A 4N56A 1BA0A 4NCGA 4BRNA 1Y97A 2ZGZA 1LAVA 3O80A 1VSIA 1IO2A 4I9QA 1JCFA 4F2SA 2HBMA 3OYMA 4B9TA 4Y1CA 4B3OA 2P9KB 3CQYA 3RRHA 3HT3A 3TAEA 3O4QA 2HHWA 3FR0A 2VG7A 3UKUA 4ILHA 3AVIA 3MMVA 4NXNK 2Q31A 3CCEN 4FXDA 2NRZA 1NGGA 3P39A 4DU4A 5AQUA 1E4GT 3M8SA 4BDZA 4BR9A 2KW4A 3DOLA 3FFKB 3O9QA 4JI3K 1NJYA 4LSLA 4DU3A 4Z4IA 4O4GA 1O13A 2ZJPL 4JYAK 2P5OA 1UWBA 2O4IA 4CEZA 4CZJA 4OGEA 2D4WA 3KK1A 4CHPA 3QNOA 2P9NB 4A5AA 4X64K 5AQHA 1RTHA 5CE3A 3I56N 1NGAA 2HHUA 3P4IA 5C2FA 1QQNA 3I55N 4DV6K 4BDYA 3KZBA 1LW0A 1NGCA 3LP1A 1QE1A 4O0JA 4AF1A 2KKZA 4N76A 2A42A 3QETA 3VESA 5TKYA 2E2NA 2HVHA 3L8BA 3IDHA 1QQCA 4E1JA 3R8EA 3Q7CA 1SS6A 3H08A 1IBLK 1P90A 2WBNA 2W6KA 3HSCA 3HRGA 4Z4GA 2XY5A 2B6AA 1YTUA 3KTQA 4HTLA 3HI0A 1EX4A 4B9UA 2HB5A 3HVRA 3CPWM 2A1SA 4E1MA 4DU1A 5JVHL 3VGMA 1HYSA 2YHAA 3CJBA 4IKFA 4BR2A 4DTJA 4CEDA 3WQUA 3OYFA 1XWLA 4EZ6A 3AVJA 3O6WA 3D6RA 3NF8A 1VQ7N 2ASOA 4CGHA 1KVAA 3AA3A 4GW6A 4BRDA 1IKYA 4IOXA 2BDPA 1YAGA 5BPLA 1KLNA 3OJSA 4LF5K 3T3FA 2NRVA 1VSLA 4JS4A 2UUCK 1FW6A 3DOKA 3L3UA 3VETA 4W5QA 4DTNA 1VQMN 2O8BA 1TVRA 2Z1HA 3C6TA 1EWRA 4DQRA 4BE1A 1YI2N 2GBZA 1LV5A 3E9LA 4IDHA 4IFEA 4BC3A 1RDUA 3VA0A 4CJEA 3ZSRA 5D3GA 3SZ2A 1E3MA 1MDUB 4EAHD 3VN5A 2B4JA 4Y1DA 2QWPA 4JK7A 3NH2A 4XEIA 1REVA 1VSHA 3JS6A 1KFSA 4B9MA 4E7IA 4RW9A 1BUPA 1B92A 2XHBA 3SI6A 1M1KO 3DLBA 3VQ8A 3V1OA 2D0BA 3I8DA 3VQ7A 1NKCA 1NKEA 4MQ3A 5DM7L 3C6UA 3E1YA 4JHDA 3M5RA 1S9EA 3DLRA 1N34K 1NBWA 3GE1A 1S3XA 3MXIA 4PA1A 5AZIA 4N5SA 3K58A 3H3OB 2O8BB 1KVBA 2NUBA 3VPZA 3NBPA 2O8DB 4LH4A 4H0YB 3AVGA 4M7XA 2QI2A 1GOCA 3VEVA 2FF3B 1Q9YA 1HMVA 5AQYA 4IFYA 3AVBA 2HBLA 4JD2B 2V7ZA 4NLBA 3CCRN 4GV6A 3VTHA 2RE2A 4CBUA 3PIPL 3E01A 2OPPA 4FWLA 2Z1IA 5EU7A 4CD3A 4A59A 2VGMA 2Q97A 2EHGA 1J54A 4CJ5A 2BANA 4M45A 3J8AA 3VQAA 4OLAA 3BF1A 5AZIB 4KHSA 1I94K 3NF9A 4LY7A 5J2QA 4KTZA 2AA4A 3OS2A 3THXB 2E2QA 2KLAA 4FL9A 3ZYYX 1RNHA 5CR4A 3CFPA 1K8KA 4WE1A 4KTQA 4DR6K 2D0AA 5KTQA 3MEEA 2PY5A 1S6PA 5CY4A 2HBKA 4AHTA 4CHYA 4NYNA 1N6QA 2BUPA 4IJAA 4BRKA 3ZX2A 2BH1A 3C65A 1GLFO 1TL3A 4C1NK 1TUYA 4B3TK 2HBJA 5HLFA 4GVMA 4CJ3A 5AZJA 5AQJA 5E41A 3IS9A 4FJIA 3AVHA 3M6GA 3DI6A 4OPJA 2FC0A 2HVIA 3C6HA 4LF9K 2IDOA 2QK9A 4NCBA 3E9PA 1MU2A 3ZSXA 1A5XA 4FPAA 3AVKA 5J2MA 1U6ZA 1SAZA 4KI4A 2UU9K
chains in the Genus database with same CATH topology
2PFUA 3U8XA 1VQ6N 3CCVN 2WFBA 3CMAN 4I6MB 3F2KA 3BUZB 3RVCA 1C0FA 1J6ZA 3SAHA 3MCPA 3ID8A 4NO7A 3ATUA 4JKGB 3CCSN 3TSPA 2NRHA 5HL7L 4K42A 3MX5A 1X3MA 4JD2A 2QWQA 1NGJA 1LOTB 3Q7BA 4O8UA 3L0QA 2FF6A 4NLCA 4WQ5C 2NRTA 3VEZA 3ATVA 2ZGYA 1QVGM 1EO1A 3PLAA 1Z05A 3E66A 4MLEA 4WFBL 4BRFA 2YJFA 2FLOA 3KHYA 3MN6A 3ID6A 4KH4A 1XQSC 3CJ1A 3CCJN 1VQNN 5AQMA 1WOQA 5M1KA 3VGKA 5ELZA 2PBDA 3CPEA 3L4QA 3CCMN 3CMEN 1KAZA 4UY8O 1LCUA 3GBTA 4CJ7A 1D4XA 5FPNA 2Q36A 2Q1NA 5FPEA 3GDQA 1Y64A 3G25A 4CZIA 4PL7A 3H1QA 3LDNA 1HX1A 1IG8A 2ZF5O 3DLLL 1U2VB 5HOOA 1JCGA 1V4SA 1X9JA 4KBOA 3ZEUB 4JAXA 4IEEA 4JKAA 4DHYA 2YX6A 4AM6A 1SQKA 4B1WB 4BG9A 5GAGP 3NVMA 2FSJA 4FWOA 4GV3A 2GTDA 1QHAA 4FSVA 5AQOA 3DXMA 3HZ6A 4G9ZA 1OKJA 1HLUA 4IXCA 1NJIO 1RDWX 2NRRA 3A5MC 3AGRA 3CERA 4H0PA 4WQ4C 2D1KA 4IO8A 3FLCO 4RTFD 3OBWA 4KH5A 2A5XA 4DQ8A 3UKRA 5JLHA 4PKIA 5JMVA 1YIJN 3U9ZA 1MA9B 3H45C 3A5OC 4CZLA 2GEMA 3CI5A 1GLJO 1YJ9N 3LM2A 2E2OA 1HPMA 2YJEA 2QW9A 1MWMA 4H5VA 1IJJA 2E88A 3CF5L 5C0YA 3F9MA 4H5WA 2E2PA 2ZJQL 1TUUA 1ZC6A 3A5NC 4BGAA 2E1YA 4BG8A 1P8ZA 4BRCA 4OO1J 3ULEB 5JVGL 2HF4A 1BWFO 4FPBA 3QMLA 4CZGA 1YJWN 1QVFM 4GY2B 2AP1A 3P31A 2FXUA 3D2FA 3R1XA 4H0XB 4A62A 4EFHA 3M3ZA 3DXKA 1NGFA 3ZETA 2HSTA 3VEYA 3WXIA 5M1NA 5GAHP 2P9UB 4WFAL 3RSEA 4K43A 4CBXA 2FSKA 2GX9A 1BA1A 4DB3A 4H5RA 1XC3A 4YOYA 1XUPO 3VEOA 1QZ6A 4I6MA 4H0TB 4BR0A 5C15A 4MO5A 4H5TA 3I8BA 3T69A 3WXMB 4CZKA 4U67L 4JKGA 2NRXA 3HTVA 3UKUB 3SMPA 2KHOA 1HKCA 2CH6A 3KVGA 3A0IX 3WQTA 3G4SN 4H0OA 3IKMA 3H6EA 3UB5A 3VMFB 4BROA 3UKRB 5F1XA 5GINA 1ATRA 4OPHA 2P9IA 1NGBA 4B1ZA 4B9QA 3FGUA 3EL2A 1NM1A 1BG3A 3D2EA 1VQ5N 5EVZA 3R9PA 5AQZA 2EWSA 4YOWA 2NRWA 4M63C 5JICA 5F2RA 4BC5A 4BRGA 1GLEG 1BU6O 2UYTA 4ILGB 5H1SQ 3O9TA 3WXLA 4U7BA 4JK8A 4CZHA 4PHTX 1U2VA 1YITN 3C0BA 3O9RA 3KWGA 1YVNA 3HBTA 3TU5A 3ZEUA 4FWSA 5BPMA 2JWLA 1E4FT 4PL8A 4FWMA 3VEWA 3H46O 3RSEB 4LC9B 2QTDA 4Y0WA 4A57A 2CGLA 3SAGA 1HKBA 3LM9A 4IJNA 4JN4A 2RHKA 3FE1A 3LL3A 3LDPA 3OHRA 3VGLA 3HOTA 1Q7YO 1N8RO 2YHXA 1M90O 1ZXOA 3A8YA 5M1PA 4BRHA 4BR7A 4GNIA 4CZMA 3C6AA 2FSNA 4H0VB 3ZX0A 4IEIA 5KPZA 1T3VA 2VYPA 4JKEA 4YOUA 5LJVA 1GLLO 1VQON 1HKGA 2QWNA 4FOEA 3CXCM 2P9PB 4CZEA 3HOSA 1RGIA 3B8AX 2P9IB 4YORA 3K9KA 4EIAA 5CHIA 2VCPA 5AQWA 3VENA 1GLCG 2YHYA 3D2EB 4JKCA 3WEEB 4FWNA 3ULEA 4IOCL 3O1BA 3FZKA 5AQQA 3WT0A 4B1VA 1KD1O 4BRIA 4JKFA 3MCAB 5GIOA 3DJCA 3SAFA 3FZHA 3CCLN 3EKSA 3K9JA 2E20A 2QWRA 3CCUN 1JJ2M 1SZ2A 4BY9C 3R6MA 3MDQA 1BA0A 2VGNA 4BRNA 5AQVA 3BP8A 3HM8A 1KC8O 2ZGZA 2D0PA 3O80A 4GV9A 5KPRA 3CQXA 4YOTA 2P9UA 1JCFA 2HBMA 1BOTO 3FZMA 4YOVA 1K73O 3O8MA 2P9KB 3CQYA 3CJAA 4K41A 4BR4A 2OANA 1K8AO 1Q82O 3TTCA 3QBXA 3BEXA 4WFNL 3FR0A 1S72N 3U9DA 3UKUA 4ISGA 4YDUC 5BR9A 2W40A 4ILHA 2DPNA 1NGHA 1YXQA 3MMVA 2Q31A 2ASPA 3GOIA 4QS7A 5M1OA 3CCEN 1HUXA 5AQLA 2NRZA 1NGGA 3MWTA 3P39A 5AQUA 1E4GT 1KXPA 2IVNA 3O08A 3VEXA 3MN5A 4BR9A 3CHWA 3FFKB 3CJCA 1T6DA 3P38A 3O9QA 4BR5A 5DM6L 5KQ8A 3CJ7A 3EE8A 4YOXA 1O13A 3TTDA 2YHWA 3SBTA 1K9MO 2ZJPL 1CZAN 4CZFA 4XH4A 4O8KA 2CGJA 2QWLA 4FO0A 3QBWA 1GLBG 2ITMA 5GIPA 4A5BA 4CZJA 5BRFA 2D4WA 2P9SA 2CH5A 4C1NI 4C23A 3FZFA 2HF3A 2OTLN 2P9NB 3AAPA 4A5AA 1ATNA 1WUAA 2GELA 4O5FA 3FZLA 3A5LC 4JKHA 1BDGA 5AQHA 5CE3A 4M7YA 3I56N 2I7NA 1NGAA 2IVOA 3P4IA 5EY4A 1QQNA 3O1WA 3TSQA 4A2AA 5C2FA 3S41A 3I55N 3OW2M 3MWPA 4IOAL 3KZBA 4BRMA 1NGCA 5B8HA 1W97L 4HWIA 2YCHA 3MN7A 4AF1A 4BVPA 3WXJA 4WF9L 2KKZA 3H3NO 2A42A 1Q86O 4BREA 4JKDA 3VESA 5TKYA 1QZ5A 2E2NA 2Q0RA 4JHDB 1VQPN 1JCEA 2QWOA 3KWIA 3L4IA 2P9PA 2QA4N 3IDHA 2F7TA 2E8AA 3EZWA 4E1JA 5AQIA 3R8EA 1DT9A 2I7PA 3Q7CA 3F5TA 4ISFA 1SS6A 2YI1A 3WEEA 3LDQA 4QS8A 1P90A 2WBNA 3LDOA 2NNWA 5E84A 3OBYA 1Z6RA 3HSCA 2QEXN 3HRGA 5F0XA 3C7NB 3I33A 2W41A 3UE5A 3ENHA 4HTLA 3HI0A 4MLHA 3O5BA 2WUSA 1VQ4N 4OPAA 3VF6A 3CPWM 2A3ZA 5AQFA 2P9SB 5JVHL 3OA9A 3VGMA 2P9LB 2P9KA 5E26A 3CJBA 3O4WA 5AQKA 4BR2A 3WQUA 5GADP 4JNEA 4DCHA 3SBGA 2VWBA 4A2BA 4IO9L 3O6WA 1VQ7N 2ZWHA 3D6RA 2ASOA 3CC7N 3QFUA 3AAQA 3AARA 3IMXA 3TPQA 4A61A 5BN8A 1KAXA 2OTJN 3SJHA 4BRDA 2QXLA 1NGIA 4FWRA 4IOXA 1YAGA 5BPLA 5M1FA 1VQ8N 3N4QA 2JWKA 2NRVA 1TYQB 4BGBA 5C2DA 5MLCQ 1YUWA 3R3LA 1VQMN 3VETA 4WYBA 3TTFA 3GL1A 3QICA 1YI2N 5BPNA 1Q18A 3E9LA 3EO3A 4IFEA 4IDHA 4BC3A 1RDUA 4DKWA 3CC2N 2F9WA 4FVUA 2V52B 4KH6A 1MDUB 3GG4A 4EAHD 1K8KB 3CETA 4RWTA 2QWPA 4JK7A 1YHQN 1GLDG 4XEIA 5AQGA 2WC9A 4WCEL 3JS6A 2Q2RA 2P9NA 5BRHA 4BQLA 1ESVA 1VAZA 1BUPA 3QFPA 5AFUH 3TSUA 1NGDA 5C10A 4EHTA 4L3QA 1M1KO 1KQSM 4FWKA 3NVKA 4BRPA 5KQDA 4XH1A 5AZJB 3NMUA 4BVOA 1Q81O 3D7EO 5AQRA 1W2BM 1DGKN 4BRAA 3T7ZA 4AM7A 5DM7L 2QM1A 3ENOA 4MO4A 3E1YA 4JHDA 4MDAA 2V51B 3M5RA 5EX5A 3VTIA 3WXKA 3PIOL 3KK7A 3IUCA 1NBWA 4JEPA 5EOYA 5ADXA 1DKGD 1NMDA 1S3XA 3GE1A 4RCHA 4B1XB 1QQMA 5TKWA 3G6EN 4H03B 5AZIA 1NWKA 3H3OB 3SMSA 5GAEP 3VPZA 3VOVA 4BC2A 4JK9A 3W0LA 5AQTA 4J8FA 4ISEA 4H0YB 5BREA 3CC4N 4WQ5A 3O9UA 4M7XA 5AQSA 2QI2A 3C7NA 5LY3A 4ILJA 3VEVA 2FF3B 2V7YA 3E9OA 2Q0UA 1T6CA 5AQYA 4PKGA 3QB0A 1C0GA 2J4RA 2HBLA 4JD2B 1X3NA 5BRDA 3IFRA 4BRQA 5LJWA 3L6QA 2P9LA 2V7ZA 4NLBA 4B1YB 3CCRN 4GV6A 1NGEA 3VTHA 4CI6A 2RE2A 5M1QA 3U4LA 5KPTA 4CBUA 2NZTA 5AQXA 3MX2A 5BN9A 2D0OA 3PIPL 2GWJA 5AFUA 1BO5O 5AQNA 1G99A 1VQKN 4FOIA 1GLAG 1H1VA 4FWLA 4CD1A 3LDLA 5C12A 2H3GX 2ASMA 4K25A 3SLCA 3M1FA 3EE9A 5FPMA 3AY9A 3VF4A 4IZ9A 4CD3A 4A59A 2VGMA 4F9OA 1DEJA 1TYQA 2NLXA 2PAVA 2Q97A 4JKBA 4YDUA 2IIRA 3VERA 4CBWA 2HOEA 3J8AA 3CCQN 1OVYA 3BF1A 5AZIB 2A40A 4WQ4A 1ZBSA 2BTFA 2AA4A 3ZX3A 4BRLA 1MWKA 2GUPA 4R79A 3J7ZO 2GWKA 3QDKA 3AGKA 5AR0A 3CIPA 4GVEA 3CD6N 2CGKA 1ATSA 2E2QA 2KLAA 4FL9A 4MDBA 3ZYYX 2IVPA 3DXMB 5CR4A 4B1UB 4NB4A 5AQPA 1K8KA 1QQOA 4Z94A 3EKUA 5I9EB 3EN9A 3H1VX 4BC4A 3O9SA 3MN9A 5JLFA 1EQYA 2HBKA 3DAWA 5FPDA 3MK6A 2BUPA 4IJAA 3BF3A 4BRKA 3ENBA 2BH1A 3ZX2A 3C65A 1GLFO 3CJ9A 1V4TA 1YF5L 3JXUA 4C1NK 4EHUA 1TUYA 1NLVA 3DWLA 2HBJA 2HMPA 1HJOA 2ZJRL 1VQ9N 5AZJA 5EXWA 3VF2A 5AQJA 2E1ZA 4PKHA 3W3DA 4BQZA 3M6GA 1T44A 4FWPA 3WUHA 1ILYA 2F9TA 3C6HA 4IWVA 1RFQA 2QWMA 4XH5A 5ADXH 2A6AA 2A41A 3N4PA 3SK3A 4FWQA 1VQLN 1S22A 3D2FB 3DXKB 3E9PA 3ZETB 4QS9A 1R59O 4FPAA 1KAYA 1U6ZA 1SAZA 3G71N 1YJNN 4H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC9 A;  2WBN A;  4DKW A; 
#chains in the Genus database with same CATH topology
 1QS4 A;  3CCV N;  2WFB A;  3CMA N;  1CXQ A;  4M41 A;  5A2Q O;  3J7A P;  3ID8 A;  3ATU A;  1JLG A;  3AO5 A;  3RMB A;  4E7H A;  5DMR A;  2GUI A;  2LSN A;  1NGJ A;  3LAK A;  1TKX A;  4WQ5 C;  3VEZ A;  3ATV A;  1QVG M;  4M3X A;  1ITG A;  3THY A;  3PLA A;  3DLH A;  3KD1 E;  2FLO A;  5I42 A;  1XQS C;  3CJ1 A;  3WNE A;  4EP4 A;  1VQN N;  5M1K A;  5DK5 A;  3L4Q A;  1KAZ A;  2IC3 A;  4F8R A;  3NFA A;  2Q1N A;  2X74 A;  3HM9 A;  1OH6 A;  3M8P A;  3OYN A;  3LDN A;  1IG8 A;  3DLL L;  4DTX A;  1J5E K;  2OA8 A;  4BG9 A;  2FBT A;  1WSJ A;  3QO9 A;  4CJW A;  1JLB A;  1QHA A;  2GTD A;  4ELT A;  4FSV A;  1W0H A;  2VG5 A;  3P83 D;  4IXC A;  4FK4 A;  1RDW X;  1BCO A;  2NRR A;  4DMN A;  3AGR A;  3CER A;  2KFN A;  4IO8 A;  4CK3 A;  3EYZ A;  5JLH A;  3QES A;  3ZSY A;  3U9Z A;  1WAF A;  3A5O C;  4CZL A;  1N32 K;  4KO0 A;  3LP3 A;  3LM2 A;  1HPM A;  4M3R A;  3V9W A;  4H5V A;  3MED A;  3F9M A;  1XI1 A;  1TUU A;  4MFB A;  4FJG A;  2ZM6 K;  3CQ8 A;  4BG8 A;  4BRC A;  3V9U A;  1RDD A;  4J2A A;  1VRT A;  3THV A;  1BWF O;  3R1X A;  1CZ9 A;  4EFH A;  4H0X B;  4CGJ A;  4A62 A;  1HNI A;  2P51 A;  3M3Z A;  4CJU A;  5FRN A;  2P9U B;  2GX9 A;  4I6M A;  1S9G A;  3D45 A;  4CEB A;  4H5T A;  3NE6 A;  4JKG A;  1HKC A;  2Z1G A;  2D0C A;  4DG1 A;  4X65 K;  4DFM A;  4G1Q A;  5F1X A;  3V9S A;  5GIN A;  4HCC A;  1ATR A;  3WNH A;  1D9F A;  1NM1 A;  1BG3 A;  1TKD A;  4DQI A;  5EVZ A;  5AQZ A;  4YOW A;  1RIL A;  3O3H A;  2NRW A;  4M63 C;  4BC5 A;  4BRG A;  1BU6 O;  3OYE A;  3WXL A;  4PHT X;  3ZEU A;  1TKZ A;  4FJM A;  4FWS A;  3RTV A;  2G8K A;  3J7Y P;  4LC9 B;  4A57 A;  4DV5 K;  3SAG A;  3LZJ A;  1HKB A;  1JXB A;  1RCH A;  2RHK A;  3OHR A;  3VGL A;  2YHX A;  3AA4 A;  4FJL A;  4BRH A;  4BR7 A;  5LMU K;  2UUA K;  3NCI A;  3DMJ A;  2G8F A;  1KVC A;  4IEI A;  1T3V A;  4YOU A;  4Z4E A;  1HKG A;  2QWN A;  4FOE A;  1TK8 A;  4YOR A;  2QKK A;  3VEN A;  4FJ5 A;  4JKC A;  4DSI A;  4CFA A;  3WEE B;  4FLU A;  3O1B A;  1KD1 O;  4B1V A;  3OYG A;  1OH8 A;  3DJC A;  3VQE A;  2E20 A;  3U6F A;  1UA0 A;  4V19 S;  4CE9 A;  3M8Q A;  1NK4 A;  2VGN A;  5AQV A;  1NOZ A;  2O8F B;  2WON A;  4JI8 K;  3CQX A;  2O8C A;  4RW4 A;  4YOT A;  3V9Z A;  3FZM A;  4YOV A;  4K41 A;  4BR4 A;  3SNN A;  2OAN A;  3TTC A;  3QBX A;  4KPY A;  1WSG A;  1RT7 A;  5KRT A;  1TKT A;  3J80 O;  2UXB K;  1LWC A;  1HNZ K;  2ASP A;  3LPT A;  5IWA K;  3MWT A;  1RBS A;  3PX6 A;  3I0S A;  3ZSV A;  3CHW A;  3TAG A;  2F96 A;  1T6D A;  1KFD A;  5DM6 L;  3TTD A;  3ISN C;  1G15 A;  1CZA N;  1VSE A;  1D5A A;  4CZF A;  4XH4 A;  1FK9 A;  1JL1 A;  3TAR A;  3QBW A;  2QKB A;  4A5B A;  5BRF A;  4CEC A;  4DFP A;  2CH5 A;  3V4I A;  2F8S A;  4C23 A;  2OTL N;  1WUA A;  3CFR A;  1HNW K;  4O5F A;  1L5U A;  1JXE A;  2Q3S A;  1QHT A;  4PY5 A;  4M7Y A;  1NK6 A;  4DR5 K;  5EY4 A;  4FJX A;  1RDA A;  3O1W A;  2XY7 A;  4A2A A;  4IOA L;  3KK2 A;  3OW2 M;  4DQQ A;  3TAB A;  4BRM A;  3K57 A;  1T05 A;  4NYF A;  1W97 L;  4HUF A;  4LSN A;  4CHO A;  4KI6 A;  1Q86 O;  3OYJ A;  1QZ5 A;  3DRR A;  3KWI A;  4F3T A;  1LAW A;  4H8K A;  1VSM A;  3EZW A;  4ICL A;  3F5T A;  3LDQ A;  4DR4 K;  3LDO A;  1IKX A;  4JRP A;  2HND A;  3T1H K;  4FJ7 A;  1UA1 A;  4KB1 A;  2W41 A;  3UE5 A;  3T1A A;  3O5B A;  2WUS A;  3QEV A;  1IV0 A;  4M3U A;  4FM2 A;  4X62 K;  2P9K A;  5AQK A;  1J5O A;  4DCH A;  1TV6 A;  2VWB A;  3HPO A;  4A2B A;  3K5N A;  4LFB K;  2VQF K;  2ZWH A;  3QFU A;  4BWJ A;  3AAQ A;  2OTJ N;  5BN8 A;  1KAX A;  4FWR A;  4IDK A;  4LF8 K;  5M1F A;  4X66 K;  3N4Q A;  2JWK A;  4BGB A;  5C2D A;  1YUW A;  3R3L A;  3HPG A;  3AA2 A;  1C6V A;  4WYB A;  1SUQ A;  3ZT3 A;  1X9S A;  1FKP A;  1VK0 A;  3PSF A;  2OPQ A;  3B6O A;  3CC2 N;  1HYV A;  4CHZ A;  4FVU A;  4J2B A;  3O3G A;  4JI4 K;  3AO4 A;  5AQG A;  2WC9 A;  4WCE L;  2F8T A;  2P9N A;  2KFZ A;  4BQL A;  1ESV A;  2YNG A;  4CJS A;  5C10 A;  3QFP A;  2EX3 A;  5AFU H;  4OX9 K;  1NGD A;  4L3Q A;  1KQS M;  4CGD A;  4FWK A;  1NNE A;  2HHH K;  2UXD K;  5KQD A;  2ZQB A;  3NF6 A;  5AQR A;  1W2B M;  3PX4 A;  4BRA A;  4LFC K;  2QM1 A;  4MO4 A;  4FLZ A;  3PIO L;  1HYZ A;  2JGU A;  3KK7 A;  4OLB A;  1DKG D;  1NMD A;  3G6E N;  3HP6 A;  4B1X B;  4FVM A;  3S9H A;  4H03 B;  4LD0 A;  5HRP A;  4N41 A;  1QSL A;  1Q8I A;  4GMJ B;  1ZYQ A;  3VOV A;  4UQG A;  4ISE A;  5BRE A;  4ID5 A;  3QER A;  4WQ5 A;  3O9U A;  4CK2 A;  3MEC A;  1S1T A;  5LY3 A;  3L2R A;  1BQM A;  1QSY A;  4PKG A;  4DSF A;  3K5O A;  2FBX A;  1YT3 A;  3IFR A;  3L6Q A;  3V1Q A;  3OYK A;  3OYH A;  2O8E B;  1R0A A;  4FZZ A;  2NZT A;  1X9W A;  3NF7 A;  1WSE A;  2GWJ A;  4YY3 K;  1BO5 O;  5AQN A;  2YNH A;  2RF2 A;  4NXM K;  2OPS A;  3MXM A;  3OYL A;  5C12 A;  3LDL A;  3K59 A;  4FJN A;  2ASM A;  4K25 A;  3SLC A;  3KLE A;  3RR8 A;  5FPM A;  1TAU A;  4I7F A;  3M8R A;  4NCA A;  3NH1 A;  2G8U A;  4EZ9 A;  4JKB A;  4YDU A;  4CBW A;  3CCQ N;  5CYM A;  1RTI A;  3TR8 A;  1RT4 A;  2BTF A;  1MWK A;  1S5J A;  5AR0 A;  1U45 A;  2IVP A;  3K5M A;  5AQP A;  4CK1 A;  4BE2 A;  1JLC A;  1WBB A;  3TAP A;  2IAJ A;  3O9S A;  3JSM A;  4LFA K;  4E3S A;  4CJK A;  4IG3 A;  4DFJ A;  3CJ9 A;  1V4T A;  3JXU A;  2VQE K;  4EHU A;  2E6M A;  1NLV A;  2HMP A;  1UAX A;  1ASV A;  4PKH A;  4FLV A;  4OVL A;  3WUH A;  2A41 A;  1VQL N;  4OPK A;  1S22 A;  3NGY A;  3DXK B;  3ZET B;  5IT9 O;  3DLE A;  4QS9 A;  1OH5 A;  2WOM A;  3DLK A;  4AH9 A;  1YJN N;  1ZBL A;  2O8D A;  3U8X A;  1VQ6 N;  3PO4 A;  3K2P A;  4JI6 K;  3V81 A;  3BUZ B;  3SAH A;  2ZE2 A;  5J2P A;  1SL2 A;  4QCL A;  2OZS A;  4B3S K;  2YKN A;  4JD2 A;  4KHW A;  3VQ6 A;  1LOT B;  3Q7B A;  1NG9 A;  3L2Q A;  3L0Q A;  4KB0 A;  5FRM A;  2NRT A;  3E66 A;  4MLE A;  4WFB L;  4BRF A;  3RMD A;  3MN6 A;  5AQM A;  1EET A;  3CPE A;  3CME N;  4UY8 O;  3GBT A;  1D4X A;  5FPN A;  3NHG A;  3GDQ A;  4CZI A;  3H1Q A;  3V9X A;  3PUF A;  1RT2 A;  3EZ5 A;  5HOO A;  3VA3 A;  2OZM A;  4DV3 K;  3LDS A;  3RMC A;  3CM6 A;  3ZT4 A;  4CF0 A;  5FRO A;  4JKA A;  3U3G A;  5CZ1 A;  3NVM A;  2FSJ A;  4GV3 A;  4FCY A;  3RRG A;  3THX A;  2PYL A;  1HLU A;  3ASM A;  3IRX A;  2G8H A;  1YIJ N;  1NU0 A;  2BGG A;  1MA9 B;  4CW7 B;  2HHT A;  1GLJ O;  1YJ9 N;  3KLI A;  4M3Y A;  2E2O A;  2XRI A;  3T1Y K;  2QW9 A;  1MWM A;  2E88 A;  5C0Y A;  1RT3 A;  4H5W A;  4KHQ A;  2E2P A;  4FYD A;  1ZC6 A;  3A5N C;  5KGW A;  2E1Y A;  5AJ3 K;  4KTW A;  3VQ9 A;  3BZC A;  2HHX A;  1RT5 A;  1C0M A;  4FPB A;  4CZG A;  4DFK A;  1QVF M;  2P1J A;  4GY2 B;  4DWI A;  1NGF A;  3VEY A;  4ID1 A;  4C8O A;  1LW2 A;  4KRF A;  1BIS A;  4WFA L;  1JLA A;  2FSK A;  3OS0 A;  1BA1 A;  2WTU A;  5I3U A;  4Q5V A;  1XUP O;  4B9S A;  1RBU A;  3VEO A;  4BR0 A;  4H0T B;  1FJG K;  4B9N A;  3T69 A;  3WXM B;  4CZK A;  2NRX A;  2CH6 A;  3KVG A;  1ZBF A;  3A0I X;  3WQT A;  4H0O A;  3H6E A;  3UB5 A;  5FLX O;  3HL8 A;  4BRO A;  4OPH A;  1XMQ K;  4FZY A;  3HO1 A;  1IKV A;  1XHZ A;  3EL2 A;  1VQ5 N;  4O44 A;  3R9P A;  2EWS A;  5BR8 K;  5JIC A;  5F2R A;  2DFH A;  2JLE A;  1GLE G;  1EXQ A;  4RW6 A;  4FJ8 A;  2KZZ A;  3DM2 A;  3KWG A;  3SUN A;  1YVN A;  3TU5 A;  5BPM A;  5KRS A;  4FWM A;  2QXF A;  2CGL A;  3MEG A;  3LM9 A;  5HRR A;  1DLO A;  4JN4 A;  3FE1 A;  3LDP A;  1M90 O;  1ZXO A;  5M1P A;  3AA5 X;  1DTT A;  3KLG A;  3C6A A;  2FSN A;  4H0V B;  3ZSQ A;  5KPZ A;  1YVU A;  2P9P B;  4CZE A;  3HOS A;  2I5J A;  4KRE A;  3K9K A;  1HQE A;  4AHC A;  5AQW A;  3KLF A;  1L3T A;  3RWU A;  1GLC G;  2W42 A;  4FWN A;  2HMI A;  4CJP A;  3FZK A;  5AQQ A;  3WT0 A;  4JKF A;  1KCF A;  3SAF A;  4BY9 C;  3CCU N;  3A2F A;  3SQ1 A;  3VQP A;  3R6M A;  3MDQ A;  2D5R A;  1KC8 O;  4GV9 A;  2DFF A;  1EKE A;  4H4M A;  2P9U A;  1K73 O;  3O8M A;  4HVJ A;  1K8A O;  1Q82 O;  2G8I A;  4CFC A;  1ZBU A;  3NGI A;  4YDU C;  1BQN A;  2W40 A;  4DUY K;  2DPN A;  1NGH A;  1YXQ A;  1TAQ A;  1NK9 A;  2KQ2 A;  1XNR K;  3GOI A;  1TK0 A;  1HUX A;  5AQL A;  4E0D A;  3DLG A;  4I9L A;  3MN5 A;  4B8A B;  1HRH A;  4DS5 A;  3CJC A;  4BR5 A;  1IBM K;  2IGI A;  3CJ7 A;  3B6P A;  4QOZ B;  4M3W A;  2YHW A;  4QAG A;  1WNS A;  3MXJ A;  3KJV A;  2VWK A;  4O8K A;  1D8Y A;  2CGJ A;  4O55 A;  1GLB G;  2ITM A;  5GIP A;  3IG1 A;  2P9S A;  1NJZ A;  3FZF A;  4KKO A;  4O0I A;  3AAP A;  4E7J A;  1IG9 A;  1XMO K;  2GEL A;  4JKH A;  1NJW A;  1BDG A;  1KRP A;  4OKE A;  5C42 A;  2I7N A;  2IVO A;  3TSQ A;  3MWP A;  4CES A;  5KI6 A;  4WF9 L;  4FK0 A;  4BRE A;  4JKD A;  1VQP N;  4DUZ K;  3I0R A;  1JCE A;  3L4I A;  3DYA A;  1LWE A;  4CEO A;  5AQI A;  1W7A A;  4KHU A;  2I7P A;  4OGC A;  1C1C A;  4ISF A;  2YI1 A;  3WEE A;  3ZLJ A;  4N47 A;  1C0T A;  3OBY A;  1Z6R A;  4AHU A;  3C7N B;  3I33 A;  4E1N A;  1EP4 A;  3ENH A;  4CF9 A;  4MLH A;  4DF8 A;  1N5Y A;  4JI2 K;  2O8F A;  4OPA A;  2A3Z A;  5AQF A;  5SWM A;  1BIU A;  2P9S B;  2P9L B;  5E26 A;  5GAD P;  2W6L A;  4IO9 L;  3CC7 N;  3OYI A;  3TPQ A;  4A61 A;  3AO3 A;  3SJH A;  2QXL A;  1NGI A;  4KV8 A;  4OJR A;  3V6D A;  1VQ8 N;  1WB9 A;  1RDC A;  1TYQ B;  5MLC Q;  5K14 A;  4F2R A;  3TTF A;  1WLJ A;  4IG0 A;  3GL1 A;  5BPN A;  1Q18 A;  4DKW A;  3QEP A;  4HTU A;  2F9W A;  1RT1 A;  2Y1I A;  4FLT A;  2V52 B;  3LAN A;  3GG4 A;  1U47 A;  2HHQ A;  3ULD A;  2VG6 A;  2HHS A;  1C0U A;  1YHQ N;  4CJQ A;  3HK2 A;  3AVL A;  2Q2R A;  3OJU A;  4IBN A;  1B9F A;  4EHT A;  3NVK A;  2IS3 A;  1TGO A;  4XH1 A;  3LAL A;  5J2N A;  1SV5 A;  4BVO A;  3F9K A;  2RPI A;  2E4L A;  1DGK N;  3ZSW A;  3T7Z A;  1JLQ A;  5LL6 Z;  3ENO A;  4ELU A;  1SKS A;  2V51 B;  2HNZ A;  5HP1 A;  4JEP A;  5EOY A;  5TKW A;  1NWK A;  3SUO A;  3SMS A;  4JK9 A;  3W0L A;  3DRS A;  4J8F A;  3SV4 A;  3CG7 A;  4M42 A;  4CEF A;  5AQS A;  1T7P A;  4ILJ A;  1NOY A;  3E9O A;  2R7Y A;  2Q0U A;  1ASU A;  2J4R A;  1DTQ A;  5BRD A;  2HW3 A;  4ZHR A;  4DV7 K;  4B1Y B;  2UXC K;  2OPR A;  1NGE A;  2FBV A;  4R5P A;  4CI6 A;  5M1Q A;  3U4L A;  5KPT A;  3NGZ A;  3THW B;  4F3O A;  3SQ2 A;  5C25 A;  2D0O A;  5CYQ A;  1NKB A;  3F73 A;  1W9H A;  3JYT A;  1VQK N;  1G99 A;  1GLA G;  3FFI A;  5C24 A;  1NK5 A;  3M1F A;  3RMA A;  3VF4 A;  2OCE A;  3AVA A;  4IZ9 A;  4F9O A;  1DEJ A;  2PAV A;  3VER A;  2IIR A;  2HOE A;  1OVY A;  2A40 A;  3ZX3 A;  3J7Z O;  4R79 A;  3SQ4 A;  3QDK A;  3AGK A;  3CIP A;  2CGK A;  3BY5 A;  2F4V K;  3DXM B;  4NB4 A;  3BGR A;  1QQO A;  2BE2 A;  3EKU A;  4CJR A;  5I9E B;  1U48 A;  3H1V X;  3MN9 A;  5JLF A;  1XHX A;  1HJR A;  1BI4 A;  1C1B A;  1QSS A;  4LF6 K;  3VF2 A;  2E1Z A;  4DV2 K;  2DTU A;  3W3D A;  1T03 A;  4FWP A;  1ILY A;  1RBV A;  4IWV A;  1RFQ A;  1OVQ A;  4XH5 A;  1S1X A;  5ADX H;  2G8W A;  2A6A A;  3DRP A;  1RTD A;  3D2F B;  4DS4 A;  3EY1 A;  2ZD1 A;  1R59 O;  1KAY A;  1CLQ A;  5KGX A;  3G71 N;  4B9V A;  3SUQ A;  4W5T A;  1C0F A;  1J6Z A;  3TAN A;  4CGI A;  4NO7 A;  2GV9 A;  3TSP A;  3HST B;  2NRH A;  2UUB K;  3AO2 A;  5HL7 L;  3QEI A;  2QWQ A;  2YNI A;  1L3S A;  4NLC A;  1BI4 B;  2O8E A;  3L3V A;  4Z4H A;  2YV0 X;  1Z05 A;  2YJF A;  4KH4 A;  3KHY A;  4CEQ A;  3ID6 A;  4FM1 A;  3CCJ N;  2A1R A;  3K0S A;  4KHN A;  1WOQ A;  1RDB A;  3VGK A;  5ELZ A;  2PBD A;  4DTR A;  3CCM N;  1I39 A;  1JLF A;  3CYM A;  5FPE A;  3QLH A;  3J81 O;  1S6Q A;  3G25 A;  4PL7 A;  1HX1 A;  2ZF5 O;  1D9D A;  4CF1 A;  1U2V B;  5HRO A;  1JCG A;  1X9J A;  4JAX A;  4HCB A;  4IEE A;  4CF2 A;  3KD5 E;  4BE0 A;  3VQQ A;  4DHY A;  2YX6 A;  4CHN A;  5GAG P;  3TAQ A;  1HNX K;  3LZI A;  5AQO A;  2HNY A;  3C94 A;  3HZ6 A;  3MAQ A;  1N36 K;  4G9Z A;  1OKJ A;  3IAY A;  1S1V A;  1KTQ A;  3A5M C;  4H0P A;  4WQ4 C;  2D1K A;  4CJL A;  4RTF D;  3OBW A;  4KH5 A;  4DQ8 A;  2XO7 A;  4J2D A;  2GEM A;  1Z26 A;  1CZB A;  3CI5 A;  4KHP K;  3CF5 L;  4CFB A;  5HBM A;  1SKW A;  2ZJQ L;  3P1G A;  1NK7 A;  1XC9 A;  3NH0 A;  4OO1 J;  3ULE B;  4LH5 A;  4HUG A;  4K0K K;  3L2U A;  4DF4 A;  2HF4 A;  4CEA A;  4FZX C;  3QML A;  4YHH K;  1YJW N;  3QIN A;  1SL1 A;  2AP1 A;  1VSD A;  3DXK A;  4J2E A;  3ZET A;  4KHY A;  3WXI A;  5M1N A;  5GAH P;  3QEW A;  4K43 A;  4DB3 A;  4H5R A;  4Z0U A;  1TL1 A;  5JS2 A;  4CJ4 A;  4CIF A;  2KTQ A;  1QZ6 A;  3KKR A;  4H4O A;  4U67 L;  3QIP A;  1BCM A;  3UKU B;  3SMP A;  2IOC A;  1VRU A;  2X78 A;  3IKM A;  4C8N A;  4K8X A;  1NGB A;  4B1Z A;  3VQB A;  4FLX A;  3FGU A;  1GOA A;  3D2E A;  3RR7 A;  3SPY A;  1X1P A;  4CER A;  3KK3 A;  1U4B A;  2HHV A;  1WSI A;  4ILG B;  4W5N A;  3TAM A;  3O9T A;  4U7B A;  4DTU A;  4AHS A;  4DSL A;  3C0B A;  3O9R A;  1EWQ A;  2RKI A;  3HBT A;  5FDL A;  2JWL A;  4PL8 A;  1RT6 A;  3H46 O;  2QTD A;  4CHQ A;  4DTM A;  1J53 A;  3AVN A;  4DSJ A;  4E7L A;  4IJN A;  4B9L A;  4FJ9 A;  1Q7Y O;  1F21 A;  3HOT A;  1C1A A;  4PQU A;  4CZM A;  3ZX0 A;  4JKE A;  2PYJ A;  1O1W A;  5HRN A;  3TAF A;  1RGI A;  3B8A X;  1T8E A;  4EIA A;  4E7K A;  3D2E B;  3S3O A;  4BRI A;  5GIO A;  3VQD A;  2YHB A;  3CCL N;  3EKS A;  3K9J A;  1SZ2 A;  4BAC A;  3AVC A;  3BP8 A;  3HM8 A;  2D0P A;  4BWM A;  4CGG A;  5KPR A;  1XNQ K;  1BOT O;  1J9A A;  4EP5 A;  3CJA A;  5J1E A;  3BEX A;  4RG8 A;  4WFN L;  1S72 N;  3U9D A;  4ISG A;  5BR9 A;  4LF4 K;  5LMN K;  4QS7 A;  5M1O A;  3OYD A;  1KXP A;  2IVN A;  3O08 A;  3VEX A;  4DR3 K;  3VQ4 A;  4DR1 K;  4AHR A;  3P38 A;  4CFD A;  1L3V A;  4PWD A;  1GOB A;  1SL0 A;  5KQ8 A;  3EE8 A;  4YOX A;  3ITH A;  3SBT A;  1K9M O;  2QWL A;  4FO0 A;  4DTO A;  2DY4 A;  3HJF A;  3SJJ A;  4C1N I;  2VWJ A;  2HF3 A;  1ATN A;  4XIU A;  2O4G A;  3FZL A;  3A5L C;  4GKJ K;  3CFO A;  1OH7 A;  4L8R B;  3S41 A;  3LPU A;  5B8H A;  4BDP A;  4HWI A;  2YCH A;  3MN7 A;  3NAE A;  4BVP A;  5JS1 A;  1BL3 A;  3WXJ A;  4DTS A;  3H3N O;  4JHD B;  2Q0R A;  2QWO A;  3OTO K;  2P9P A;  2QA4 N;  2P5G A;  2F7T A;  4KAZ A;  1N33 K;  2E8A A;  3AVM A;  1HNV A;  3OYA A;  1NK8 A;  1DT9 A;  4GKK K;  3L2V A;  4QS8 A;  1JLE A;  2NNW A;  1IH7 A;  5E84 A;  2QEX N;  5F0X A;  3ALY A;  1IKW A;  1WAJ A;  3PSI A;  1VQ4 N;  3VF6 A;  3S3N A;  3VQC A;  3OA9 A;  1YTA A;  3O4W A;  4FLY A;  3OS1 A;  4JNE A;  3SBG A;  2OYQ A;  3SYZ A;  3AAR A;  3IMX A;  1RTJ A;  1BIZ A;  4I2Q A;  3LWM A;  3V1R A;  1WSH A;  4B3M K;  1BHL A;  3D0P A;  2G8V A;  2ITG A;  4DSE A;  3SQ0 A;  1IBK K;  3QIC A;  4B3R K;  3CM5 A;  3EO3 A;  2KZM A;  4FJJ A;  4CJV A;  4KH6 A;  3KIO A;  3K5L A;  1K8K B;  4FM0 A;  3CET A;  4RWT A;  1GLD G;  3AVF A;  3HPH A;  4E19 A;  5BRH A;  4ZTF A;  3LP2 A;  4JI0 K;  1VAZ A;  1A5V A;  3TSU A;  3OVN A;  4BRP A;  5AZJ B;  3NMU A;  1Q81 O;  3D7E O;  4AM7 A;  3AV9 A;  3PO5 A;  3WXK A;  5EX5 A;  4MDA A;  2X6S A;  3VTI A;  3PY8 A;  1VHX A;  3IUC A;  5ADX A;  4RCH A;  2ATQ A;  3L2W A;  1QQM A;  3HVT A;  3UIQ A;  4IFV A;  4CCH A;  5GAE P;  4BC2 A;  5AQT A;  4JV5 K;  3TWH A;  3CC4 N;  1WBD A;  3C7N A;  3HYF A;  4CIE A;  2V7Y A;  1T6C A;  3T19 A;  3ZT1 A;  3QB0 A;  1C0G A;  4FW2 A;  1X3N A;  4BRQ A;  5LJW A;  2P9L A;  1LWF A;  3O3F A;  4W5R A;  3THY B;  5AQX A;  3MX2 A;  5BN9 A;  5AFU A;  3HXM A;  4FOI A;  1HPZ A;  4FLW A;  1H1V A;  4CD1 A;  2H3G X;  2XY8 A;  3U3Y A;  5CZ2 A;  2Y1J A;  4DLG A;  3EE9 A;  3AY9 A;  4DSK A;  1Q9X A;  4OKK A;  1TYQ A;  2NLX A;  3LAM A;  1FKO A;  4WQ4 A;  1ZBS A;  3OYC A;  4DV0 K;  4BRL A;  2GUP A;  2GWK A;  3CD6 N;  4GVE A;  1ATS A;  1VSF A;  4MDB A;  3ZSZ A;  4M3T A;  4HUE A;  4B1U B;  4C8L A;  4TSX A;  1NK0 A;  4Z4C A;  4CJT A;  4Z94 A;  3NDK A;  3EN9 A;  4BC4 A;  4YNQ A;  2PZS A;  2DFE A;  3SUP A;  1EQY A;  2E5L K;  3DAW A;  5FPD A;  3MK6 A;  3BF3 A;  3ENB A;  1YF5 L;  4I2P A;  3DWL A;  5SZT A;  1HJO A;  2ZJR L;  1VQ9 N;  5EXW A;  1RBR A;  3SPZ A;  3TI0 A;  1TK5 A;  4JI1 K;  3WNF A;  4BQZ A;  1T44 A;  2F9T A;  2QWM A;  3QEX A;  4AHV A;  4JI7 K;  4W5O A;  3N4P A;  3SK3 A;  3BZK A;  4FWQ A;  4Q0B A;  2RN2 A;  4RW8 A;  3O4N A;  4H5N A;  1S1W A;  2PFU A;  4YFU A;  4B08 A;  1VSJ A;  1NMN A;  4I6M B;  3F2K A;  4DR7 K;  3RVC A;  3MCP A;  3EEQ A;  4DV4 K;  4JKG B;  3CCS N;  3S3M A;  4K42 A;  4CJF A;  3MX5 A;  1X3M A;  4JI5 K;  3QNN A;  4DV1 K;  4DTP A;  4O8U A;  1Z25 A;  2FF6 A;  2ZGY A;  1EO1 A;  3THW A;  4JLH A;  4FW1 A;  2XY6 A;  2AJQ A;  1NJX A;  3P5J A;  4AIL C;  1LCU A;  4CJ7 A;  1WSF A;  3SCX A;  2Q36 A;  1SKR A;  1X9M A;  1ASW A;  4C8M A;  1Y64 A;  4CEE A;  4AQY K;  4CGF A;  4KBO A;  1V4S A;  4B8C A;  3ZEU B;  4F4K A;  4AM6 A;  1JKH A;  1SQK A;  4B1W B;  3LWL A;  4FWO A;  1UOC A;  1KLM A;  2YKM A;  4ZTJ A;  1KSP A;  3DXM A;  4FK2 A;  1NJI O;  3VQ5 A;  3FLC O;  3ZSO A;  5HRS A;  2A5X A;  1FXX A;  3UKR A;  4PKI A;  3WNG A;  5JMV A;  4DR2 K;  1QTM A;  3H45 C;  1B9D A;  2YJE A;  1IJJ A;  2Z1J A;  3QIO A;  3LP0 A;  4BGA A;  4K8Z A;  3AO1 A;  1P8Z A;  4JRQ A;  4CVN E;  5JVG L;  2FBY A;  4C8K A;  3KKS A;  4Z4F A;  1I3A A;  3P31 A;  2FXU A;  3D2F A;  2HST A;  5T7B A;  2O8C B;  1A5W A;  3RSE A;  4CBX A;  1CXU A;  1HR0 K;  2YNF A;  1XC3 A;  2B5J A;  4YOY A;  3PV8 A;  5C15 A;  4MO5 A;  1U49 A;  3I8B A;  4O5B A;  3HTV A;  2KHO A;  3SV3 A;  4CIG A;  3G4S N;  3ZT2 A;  4CF8 A;  4DQS A;  4FJH A;  3VMF B;  4DQP A;  4RW7 A;  3UKR B;  1WN7 A;  2P9I A;  4B9Q A;  3PX0 A;  3G0Z A;  4PUO A;  4HHT A;  3KLH A;  1U04 A;  4E89 A;  4ELV A;  3BDP A;  2UYT A;  4JS5 A;  5H1S Q;  2X6N A;  3G10 A;  4JK8 A;  4CZH A;  1U2V A;  1YIT N;  4DLE A;  1E4F T;  1RBT A;  3ZT0 A;  3VEW A;  2ETJ A;  3RSE B;  4Y0W A;  4FJK A;  3HP9 A;  3OYB A;  2E6L A;  3LL3 A;  4LF7 K;  1N8R O;  1ZBH A;  3A8Y A;  1ZBI A;  4GNI A;  4KFB A;  2VYP A;  5LJV A;  1GLL O;  1VQO N;  3ZCM A;  3CXC M;  1S1U A;  2P9I B;  5CHI A;  4M3Z A;  1L3U A;  2VCP A;  3JAM O;  1K6Y A;  1VSK A;  1BGX T;  2YHY A;  3ULE A;  4IOC L;  1JL2 A;  3MCA B;  1HQU A;  3FZH A;  3OY9 A;  1JJ2 M;  2QWR A;  4OKJ A;  3C95 A;  4N56 A;  1BA0 A;  4NCG A;  4BRN A;  1Y97 A;  2ZGZ A;  1LAV A;  3O80 A;  1VSI A;  1IO2 A;  4I9Q A;  1JCF A;  4F2S A;  2HBM A;  3OYM A;  4B9T A;  4Y1C A;  4B3O A;  2P9K B;  3CQY A;  3RRH A;  3HT3 A;  3TAE A;  3O4Q A;  2HHW A;  3FR0 A;  2VG7 A;  3UKU A;  4ILH A;  3AVI A;  3MMV A;  4NXN K;  2Q31 A;  3CCE N;  4FXD A;  2NRZ A;  1NGG A;  3P39 A;  4DU4 A;  5AQU A;  1E4G T;  3M8S A;  4BDZ A;  4BR9 A;  2KW4 A;  3DOL A;  3FFK B;  3O9Q A;  4JI3 K;  1NJY A;  4LSL A;  4DU3 A;  4Z4I A;  4O4G A;  1O13 A;  2ZJP L;  4JYA K;  2P5O A;  1UWB A;  2O4I A;  4CEZ A;  4CZJ A;  4OGE A;  2D4W A;  3KK1 A;  4CHP A;  3QNO A;  2P9N B;  4A5A A;  4X64 K;  5AQH A;  1RTH A;  5CE3 A;  3I56 N;  1NGA A;  2HHU A;  3P4I A;  5C2F A;  1QQN A;  3I55 N;  4DV6 K;  4BDY A;  3KZB A;  1LW0 A;  1NGC A;  3LP1 A;  1QE1 A;  4O0J A;  4AF1 A;  2KKZ A;  4N76 A;  2A42 A;  3QET A;  3VES A;  5TKY A;  2E2N A;  2HVH A;  3L8B A;  3IDH A;  1QQC A;  4E1J A;  3R8E A;  3Q7C A;  1SS6 A;  3H08 A;  1IBL K;  1P90 A;  2WBN A;  2W6K A;  3HSC A;  3HRG A;  4Z4G A;  2XY5 A;  2B6A A;  1YTU A;  3KTQ A;  4HTL A;  3HI0 A;  1EX4 A;  4B9U A;  2HB5 A;  3HVR A;  3CPW M;  2A1S A;  4E1M A;  4DU1 A;  5JVH L;  3VGM A;  1HYS A;  2YHA A;  3CJB A;  4IKF A;  4BR2 A;  4DTJ A;  4CED A;  3WQU A;  3OYF A;  1XWL A;  4EZ6 A;  3AVJ A;  3O6W A;  3D6R A;  3NF8 A;  1VQ7 N;  2ASO A;  4CGH A;  1KVA A;  3AA3 A;  4GW6 A;  4BRD A;  1IKY A;  4IOX A;  2BDP A;  1YAG A;  5BPL A;  1KLN A;  3OJS A;  4LF5 K;  3T3F A;  2NRV A;  1VSL A;  4JS4 A;  2UUC K;  1FW6 A;  3DOK A;  3L3U A;  3VET A;  4W5Q A;  4DTN A;  1VQM N;  2O8B A;  1TVR A;  2Z1H A;  3C6T A;  1EWR A;  4DQR A;  4BE1 A;  1YI2 N;  2GBZ A;  1LV5 A;  3E9L A;  4IDH A;  4IFE A;  4BC3 A;  1RDU A;  3VA0 A;  4CJE A;  3ZSR A;  5D3G A;  3SZ2 A;  1E3M A;  1MDU B;  4EAH D;  3VN5 A;  2B4J A;  4Y1D A;  2QWP A;  4JK7 A;  3NH2 A;  4XEI A;  1REV A;  1VSH A;  3JS6 A;  1KFS A;  4B9M A;  4E7I A;  4RW9 A;  1BUP A;  1B92 A;  2XHB A;  3SI6 A;  1M1K O;  3DLB A;  3VQ8 A;  3V1O A;  2D0B A;  3I8D A;  3VQ7 A;  1NKC A;  1NKE A;  4MQ3 A;  5DM7 L;  3C6U A;  3E1Y A;  4JHD A;  3M5R A;  1S9E A;  3DLR A;  1N34 K;  1NBW A;  3GE1 A;  1S3X A;  3MXI A;  4PA1 A;  5AZI A;  4N5S A;  3K58 A;  3H3O B;  2O8B B;  1KVB A;  2NUB A;  3VPZ A;  3NBP A;  2O8D B;  4LH4 A;  4H0Y B;  3AVG A;  4M7X A;  2QI2 A;  1GOC A;  3VEV A;  2FF3 B;  1Q9Y A;  1HMV A;  5AQY A;  4IFY A;  3AVB A;  2HBL A;  4JD2 B;  2V7Z A;  4NLB A;  3CCR N;  4GV6 A;  3VTH A;  2RE2 A;  4CBU A;  3PIP L;  3E01 A;  2OPP A;  4FWL A;  2Z1I A;  5EU7 A;  4CD3 A;  4A59 A;  2VGM A;  2Q97 A;  2EHG A;  1J54 A;  4CJ5 A;  2BAN A;  4M45 A;  3J8A A;  3VQA A;  4OLA A;  3BF1 A;  5AZI B;  4KHS A;  1I94 K;  3NF9 A;  4LY7 A;  5J2Q A;  4KTZ A;  2AA4 A;  3OS2 A;  3THX B;  2E2Q A;  2KLA A;  4FL9 A;  3ZYY X;  1RNH A;  5CR4 A;  3CFP A;  1K8K A;  4WE1 A;  4KTQ A;  4DR6 K;  2D0A A;  5KTQ A;  3MEE A;  2PY5 A;  1S6P A;  5CY4 A;  2HBK A;  4AHT A;  4CHY A;  4NYN A;  1N6Q A;  2BUP A;  4IJA A;  4BRK A;  3ZX2 A;  2BH1 A;  3C65 A;  1GLF O;  1TL3 A;  4C1N K;  1TUY A;  4B3T K;  2HBJ A;  5HLF A;  4GVM A;  4CJ3 A;  5AZJ A;  5AQJ A;  5E41 A;  3IS9 A;  4FJI A;  3AVH A;  3M6G A;  3DI6 A;  4OPJ A;  2FC0 A;  2HVI A;  3C6H A;  4LF9 K;  2IDO A;  2QK9 A;  4NCB A;  3E9P A;  1MU2 A;  3ZSX A;  1A5X A;  4FPA A;  3AVK A;  5J2M A;  1U6Z A;  1SAZ A;  4KI4 A;  2UU9 K; 
#chains in the Genus database with same CATH homology
 2PFU A;  3U8X A;  1VQ6 N;  3CCV N;  2WFB A;  3CMA N;  4I6M B;  3F2K A;  3BUZ B;  3RVC A;  1C0F A;  1J6Z A;  3SAH A;  3MCP A;  3ID8 A;  4NO7 A;  3ATU A;  4JKG B;  3CCS N;  3TSP A;  2NRH A;  5HL7 L;  4K42 A;  3MX5 A;  1X3M A;  4JD2 A;  2QWQ A;  1NGJ A;  1LOT B;  3Q7B A;  4O8U A;  3L0Q A;  2FF6 A;  4NLC A;  4WQ5 C;  2NRT A;  3VEZ A;  3ATV A;  2ZGY A;  1QVG M;  1EO1 A;  3PLA A;  1Z05 A;  3E66 A;  4MLE A;  4WFB L;  4BRF A;  2YJF A;  2FLO A;  3KHY A;  3MN6 A;  3ID6 A;  4KH4 A;  1XQS C;  3CJ1 A;  3CCJ N;  1VQN N;  5AQM A;  1WOQ A;  5M1K A;  3VGK A;  5ELZ A;  2PBD A;  3CPE A;  3L4Q A;  3CCM N;  3CME N;  1KAZ A;  4UY8 O;  1LCU A;  3GBT A;  4CJ7 A;  1D4X A;  5FPN A;  2Q36 A;  2Q1N A;  5FPE A;  3GDQ A;  1Y64 A;  3G25 A;  4CZI A;  4PL7 A;  3H1Q A;  3LDN A;  1HX1 A;  1IG8 A;  2ZF5 O;  3DLL L;  1U2V B;  5HOO A;  1JCG A;  1V4S A;  1X9J A;  4KBO A;  3ZEU B;  4JAX A;  4IEE A;  4JKA A;  4DHY A;  2YX6 A;  4AM6 A;  1SQK A;  4B1W B;  4BG9 A;  5GAG P;  3NVM A;  2FSJ A;  4FWO A;  4GV3 A;  2GTD A;  1QHA A;  4FSV A;  5AQO A;  3DXM A;  3HZ6 A;  4G9Z A;  1OKJ A;  1HLU A;  4IXC A;  1NJI O;  1RDW X;  2NRR A;  3A5M C;  3AGR A;  3CER A;  4H0P A;  4WQ4 C;  2D1K A;  4IO8 A;  3FLC O;  4RTF D;  3OBW A;  4KH5 A;  2A5X A;  4DQ8 A;  3UKR A;  5JLH A;  4PKI A;  5JMV A;  1YIJ N;  3U9Z A;  1MA9 B;  3H45 C;  3A5O C;  4CZL A;  2GEM A;  3CI5 A;  1GLJ O;  1YJ9 N;  3LM2 A;  2E2O A;  1HPM A;  2YJE A;  2QW9 A;  1MWM A;  4H5V A;  1IJJ A;  2E88 A;  3CF5 L;  5C0Y A;  3F9M A;  4H5W A;  2E2P A;  2ZJQ L;  1TUU A;  1ZC6 A;  3A5N C;  4BGA A;  2E1Y A;  4BG8 A;  1P8Z A;  4BRC A;  4OO1 J;  3ULE B;  5JVG L;  2HF4 A;  1BWF O;  4FPB A;  3QML A;  4CZG A;  1YJW N;  1QVF M;  4GY2 B;  2AP1 A;  3P31 A;  2FXU A;  3D2F A;  3R1X A;  4H0X B;  4A62 A;  4EFH A;  3M3Z A;  3DXK A;  1NGF A;  3ZET A;  2HST A;  3VEY A;  3WXI A;  5M1N A;  5GAH P;  2P9U B;  4WFA L;  3RSE A;  4K43 A;  4CBX A;  2FSK A;  2GX9 A;  1BA1 A;  4DB3 A;  4H5R A;  1XC3 A;  4YOY A;  1XUP O;  3VEO A;  1QZ6 A;  4I6M A;  4H0T B;  4BR0 A;  5C15 A;  4MO5 A;  4H5T A;  3I8B A;  3T69 A;  3WXM B;  4CZK A;  4U67 L;  4JKG A;  2NRX A;  3HTV A;  3UKU B;  3SMP A;  2KHO A;  1HKC A;  2CH6 A;  3KVG A;  3A0I X;  3WQT A;  3G4S N;  4H0O A;  3IKM A;  3H6E A;  3UB5 A;  3VMF B;  4BRO A;  3UKR B;  5F1X A;  5GIN A;  1ATR A;  4OPH A;  2P9I A;  1NGB A;  4B1Z A;  4B9Q A;  3FGU A;  3EL2 A;  1NM1 A;  1BG3 A;  3D2E A;  1VQ5 N;  5EVZ A;  3R9P A;  5AQZ A;  2EWS A;  4YOW A;  2NRW A;  4M63 C;  5JIC A;  5F2R A;  4BC5 A;  4BRG A;  1GLE G;  1BU6 O;  2UYT A;  4ILG B;  5H1S Q;  3O9T A;  3WXL A;  4U7B A;  4JK8 A;  4CZH A;  4PHT X;  1U2V A;  1YIT N;  3C0B A;  3O9R A;  3KWG A;  1YVN A;  3HBT A;  3TU5 A;  3ZEU A;  4FWS A;  5BPM A;  2JWL A;  1E4F T;  4PL8 A;  4FWM A;  3VEW A;  3H46 O;  3RSE B;  4LC9 B;  2QTD A;  4Y0W A;  4A57 A;  2CGL A;  3SAG A;  1HKB A;  3LM9 A;  4IJN A;  4JN4 A;  2RHK A;  3FE1 A;  3LL3 A;  3LDP A;  3OHR A;  3VGL A;  3HOT A;  1Q7Y O;  1N8R O;  2YHX A;  1M90 O;  1ZXO A;  3A8Y A;  5M1P A;  4BRH A;  4BR7 A;  4GNI A;  4CZM A;  3C6A A;  2FSN A;  4H0V B;  3ZX0 A;  4IEI A;  5KPZ A;  1T3V A;  2VYP A;  4JKE A;  4YOU A;  5LJV A;  1GLL O;  1VQO N;  1HKG A;  2QWN A;  4FOE A;  3CXC M;  2P9P B;  4CZE A;  3HOS A;  1RGI A;  3B8A X;  2P9I B;  4YOR A;  3K9K A;  4EIA A;  5CHI A;  2VCP A;  5AQW A;  3VEN A;  1GLC G;  2YHY A;  3D2E B;  4JKC A;  3WEE B;  4FWN A;  3ULE A;  4IOC L;  3O1B A;  3FZK A;  5AQQ A;  3WT0 A;  4B1V A;  1KD1 O;  4BRI A;  4JKF A;  3MCA B;  5GIO A;  3DJC A;  3SAF A;  3FZH A;  3CCL N;  3EKS A;  3K9J A;  2E20 A;  2QWR A;  3CCU N;  1JJ2 M;  1SZ2 A;  4BY9 C;  3R6M A;  3MDQ A;  1BA0 A;  2VGN A;  4BRN A;  5AQV A;  3BP8 A;  3HM8 A;  1KC8 O;  2ZGZ A;  2D0P A;  3O80 A;  4GV9 A;  5KPR A;  3CQX A;  4YOT A;  2P9U A;  1JCF A;  2HBM A;  1BOT O;  3FZM A;  4YOV A;  1K73 O;  3O8M A;  2P9K B;  3CQY A;  3CJA A;  4K41 A;  4BR4 A;  2OAN A;  1K8A O;  1Q82 O;  3TTC A;  3QBX A;  3BEX A;  4WFN L;  3FR0 A;  1S72 N;  3U9D A;  3UKU A;  4ISG A;  4YDU C;  5BR9 A;  2W40 A;  4ILH A;  2DPN A;  1NGH A;  1YXQ A;  3MMV A;  2Q31 A;  2ASP A;  3GOI A;  4QS7 A;  5M1O A;  3CCE N;  1HUX A;  5AQL A;  2NRZ A;  1NGG A;  3MWT A;  3P39 A;  5AQU A;  1E4G T;  1KXP A;  2IVN A;  3O08 A;  3VEX A;  3MN5 A;  4BR9 A;  3CHW A;  3FFK B;  3CJC A;  1T6D A;  3P38 A;  3O9Q A;  4BR5 A;  5DM6 L;  5KQ8 A;  3CJ7 A;  3EE8 A;  4YOX A;  1O13 A;  3TTD A;  2YHW A;  3SBT A;  1K9M O;  2ZJP L;  1CZA N;  4CZF A;  4XH4 A;  4O8K A;  2CGJ A;  2QWL A;  4FO0 A;  3QBW A;  1GLB G;  2ITM A;  5GIP A;  4A5B A;  4CZJ A;  5BRF A;  2D4W A;  2P9S A;  2CH5 A;  4C1N I;  4C23 A;  3FZF A;  2HF3 A;  2OTL N;  2P9N B;  3AAP A;  4A5A A;  1ATN A;  1WUA A;  2GEL A;  4O5F A;  3FZL A;  3A5L C;  4JKH A;  1BDG A;  5AQH A;  5CE3 A;  4M7Y A;  3I56 N;  2I7N A;  1NGA A;  2IVO A;  3P4I A;  5EY4 A;  1QQN A;  3O1W A;  3TSQ A;  4A2A A;  5C2F A;  3S41 A;  3I55 N;  3OW2 M;  3MWP A;  4IOA L;  3KZB A;  4BRM A;  1NGC A;  5B8H A;  1W97 L;  4HWI A;  2YCH A;  3MN7 A;  4AF1 A;  4BVP A;  3WXJ A;  4WF9 L;  2KKZ A;  3H3N O;  2A42 A;  1Q86 O;  4BRE A;  4JKD A;  3VES A;  5TKY A;  1QZ5 A;  2E2N A;  2Q0R A;  4JHD B;  1VQP N;  1JCE A;  2QWO A;  3KWI A;  3L4I A;  2P9P A;  2QA4 N;  3IDH A;  2F7T A;  2E8A A;  3EZW A;  4E1J A;  5AQI A;  3R8E A;  1DT9 A;  2I7P A;  3Q7C A;  3F5T A;  4ISF A;  1SS6 A;  2YI1 A;  3WEE A;  3LDQ A;  4QS8 A;  1P90 A;  2WBN A;  3LDO A;  2NNW A;  5E84 A;  3OBY A;  1Z6R A;  3HSC A;  2QEX N;  3HRG A;  5F0X A;  3C7N B;  3I33 A;  2W41 A;  3UE5 A;  3ENH A;  4HTL A;  3HI0 A;  4MLH A;  3O5B A;  2WUS A;  1VQ4 N;  4OPA A;  3VF6 A;  3CPW M;  2A3Z A;  5AQF A;  2P9S B;  5JVH L;  3OA9 A;  3VGM A;  2P9L B;  2P9K A;  5E26 A;  3CJB A;  3O4W A;  5AQK A;  4BR2 A;  3WQU A;  5GAD P;  4JNE A;  4DCH A;  3SBG A;  2VWB A;  4A2B A;  4IO9 L;  3O6W A;  1VQ7 N;  2ZWH A;  3D6R A;  2ASO A;  3CC7 N;  3QFU A;  3AAQ A;  3AAR A;  3IMX A;  3TPQ A;  4A61 A;  5BN8 A;  1KAX A;  2OTJ N;  3SJH A;  4BRD A;  2QXL A;  1NGI A;  4FWR A;  4IOX A;  1YAG A;  5BPL A;  5M1F A;  1VQ8 N;  3N4Q A;  2JWK A;  2NRV A;  1TYQ B;  4BGB A;  5C2D A;  5MLC Q;  1YUW A;  3R3L A;  1VQM N;  3VET A;  4WYB A;  3TTF A;  3GL1 A;  3QIC A;  1YI2 N;  5BPN A;  1Q18 A;  3E9L A;  3EO3 A;  4IFE A;  4IDH A;  4BC3 A;  1RDU A;  4DKW A;  3CC2 N;  2F9W A;  4FVU A;  2V52 B;  4KH6 A;  1MDU B;  3GG4 A;  4EAH D;  1K8K B;  3CET A;  4RWT A;  2QWP A;  4JK7 A;  1YHQ N;  1GLD G;  4XEI A;  5AQG A;  2WC9 A;  4WCE L;  3JS6 A;  2Q2R A;  2P9N A;  5BRH A;  4BQL A;  1ESV A;  1VAZ A;  1BUP A;  3QFP A;  5AFU H;  3TSU A;  1NGD A;  5C10 A;  4EHT A;  4L3Q A;  1M1K O;  1KQS M;  4FWK A;  3NVK A;  4BRP A;  5KQD A;  4XH1 A;  5AZJ B;  3NMU A;  4BVO A;  1Q81 O;  3D7E O;  5AQR A;  1W2B M;  1DGK N;  4BRA A;  3T7Z A;  4AM7 A;  5DM7 L;  2QM1 A;  3ENO A;  4MO4 A;  3E1Y A;  4JHD A;  4MDA A;  2V51 B;  3M5R A;  5EX5 A;  3VTI A;  3WXK A;  3PIO L;  3KK7 A;  3IUC A;  1NBW A;  4JEP A;  5EOY A;  5ADX A;  1DKG D;  1NMD A;  1S3X A;  3GE1 A;  4RCH A;  4B1X B;  1QQM A;  5TKW A;  3G6E N;  4H03 B;  5AZI A;  1NWK A;  3H3O B;  3SMS A;  5GAE P;  3VPZ A;  3VOV A;  4BC2 A;  4JK9 A;  3W0L A;  5AQT A;  4J8F A;  4ISE A;  4H0Y B;  5BRE A;  3CC4 N;  4WQ5 A;  3O9U A;  4M7X A;  5AQS A;  2QI2 A;  3C7N A;  5LY3 A;  4ILJ A;  3VEV A;  2FF3 B;  2V7Y A;  3E9O A;  2Q0U A;  1T6C A;  5AQY A;  4PKG A;  3QB0 A;  1C0G A;  2J4R A;  2HBL A;  4JD2 B;  1X3N A;  5BRD A;  3IFR A;  4BRQ A;  5LJW A;  3L6Q A;  2P9L A;  2V7Z A;  4NLB A;  4B1Y B;  3CCR N;  4GV6 A;  1NGE A;  3VTH A;  4CI6 A;  2RE2 A;  5M1Q A;  3U4L A;  5KPT A;  4CBU A;  2NZT A;  5AQX A;  3MX2 A;  5BN9 A;  2D0O A;  3PIP L;  2GWJ A;  5AFU A;  1BO5 O;  5AQN A;  1G99 A;  1VQK N;  4FOI A;  1GLA G;  1H1V A;  4FWL A;  4CD1 A;  3LDL A;  5C12 A;  2H3G X;  2ASM A;  4K25 A;  3SLC A;  3M1F A;  3EE9 A;  5FPM A;  3AY9 A;  3VF4 A;  4IZ9 A;  4CD3 A;  4A59 A;  2VGM A;  4F9O A;  1DEJ A;  1TYQ A;  2NLX A;  2PAV A;  2Q97 A;  4JKB A;  4YDU A;  2IIR A;  3VER A;  4CBW A;  2HOE A;  3J8A A;  3CCQ N;  1OVY A;  3BF1 A;  5AZI B;  2A40 A;  4WQ4 A;  1ZBS A;  2BTF A;  2AA4 A;  3ZX3 A;  4BRL A;  1MWK A;  2GUP A;  4R79 A;  3J7Z O;  2GWK A;  3QDK A;  3AGK A;  5AR0 A;  3CIP A;  4GVE A;  3CD6 N;  2CGK A;  1ATS A;  2E2Q A;  2KLA A;  4FL9 A;  4MDB A;  3ZYY X;  2IVP A;  3DXM B;  5CR4 A;  4B1U B;  4NB4 A;  5AQP A;  1K8K A;  1QQO A;  4Z94 A;  3EKU A;  5I9E B;  3EN9 A;  3H1V X;  4BC4 A;  3O9S A;  3MN9 A;  5JLF A;  1EQY A;  2HBK A;  3DAW A;  5FPD A;  3MK6 A;  2BUP A;  4IJA A;  3BF3 A;  4BRK A;  3ENB A;  2BH1 A;  3ZX2 A;  3C65 A;  1GLF O;  3CJ9 A;  1V4T A;  1YF5 L;  3JXU A;  4C1N K;  4EHU A;  1TUY A;  1NLV A;  3DWL A;  2HBJ A;  2HMP A;  1HJO A;  2ZJR L;  1VQ9 N;  5AZJ A;  5EXW A;  3VF2 A;  5AQJ A;  2E1Z A;  4PKH A;  3W3D A;  4BQZ A;  3M6G A;  1T44 A;  4FWP A;  3WUH A;  1ILY A;  2F9T A;  3C6H A;  4IWV A;  1RFQ A;  2QWM A;  4XH5 A;  5ADX H;  2A6A A;  2A41 A;  3N4P A;  3SK3 A;  4FWQ A;  1VQL N;  1S22 A;  3D2F B;  3DXK B;  3E9P A;  3ZET B;  4QS9 A;  1R59 O;  4FPA A;  1KAY A;  1U6Z A;  1SAZ A;  3G71 N;  1YJN N;  4H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...