2WCIA

Structure of e. coli monothiol glutaredoxin grx4 homodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN-4
publication title Structural Basis for Delivery of the Intact [Fe2S2] Cluster by Monothiol Glutaredoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wciA01
2YANA 2GSTA 1V40A 3LG6A 1SK1A 4PNFA 4EE0A 1E2YA 2E0QA 4N10A 4DSSA 5AISA 3G7YA 3F6FA 3H1NA 4XHMA 2WGRA 3WGEA 2PGTA 4EKZA 3O3TA 3VFIA 1TI3A 3EYTA 3RPPA 5F0GA 3HZ8A 4E8HA 1T8EB 3HYPA 4NAXA 5C04A 1BJXA 1K0OA 3F6DA 1TXXA 2M72A 3IXRA 4PQ1A 3TJGA 1A2LA 3UOMA 3I6AA 5C00A 1U6TA 3KZQA 4TR3A 1XWAA 2C3NA 4IJ3A 4WF4A 2HI7A 5HFGA 3GIXA 3HY2A 1FVKA 2E2GA 2P5RA 4TXOA 1XWBA 3HDCA 1A2JA 2EIRA 2NDOA 2N5AA 4IS0A 5DALA 3QFAC 5ECMB 1MDIA 4MF5A 4POBA 2PVOC 3OR5A 5CRHA 3MAKA 1SJZA 2L57A 1OC8A 4EO3A 5G5EA 1ILOA 1XIYA 4I2TA 3K8NA 1A23A 5IO0A 3TJJA 2M46A 3QPMA 2CVDA 1H75A 1N2AA 3Q19A 3EE2A 2O8VB 3CMIA 2H1AA 1ZOFA 3LGCA 4JEDA 1EWXA 4K0NA 20GSA 1ERUA 2GVPA 1Z9HA 7GSSA 2CA8A 3JCML 5J3RA 3CRTA 4RUVA 4V2NA 5CRWA 1LBKA 5CYYA 5G31A 3RHBA 1CQGA 5ECKB 1XOBA 5CNWA 1OC9B 1FAAA 3F4RA 2A4VA 1PD21 4HS1A 4K7IA 1QGVA 4NV2A 3EWLA 3TGZA 3KP8A 4GCIA 1J9BA 4HZ4A 3UMAA 3D4TA 1YEPA 4F9ZA 4MK3A 3G9BA 3GURA 2HZEA 3APSA 4ML6A 1MEKA 4HQSA 5J9BA 3UJ1A 1ABAA 2JL4A 4JBBA 5AIVA 5LNKe 4H86A 5ECPB 1YF1A 3LYPA 1ACVA 2VM1A 3DVXA 2QGVA 2OE1A 3QAWA 1EOGA 2F8FA 1VF4A 3LXTA 3HJMA 1TK0B 5AGYA 2R4VA 9GSSA 1DBYA 3VK9A 3TDGA 3VWXA 3ZVJD 2QKEA 2WS2A 2GGTA 4P3YB 2CAQA 1JHBA 5JWRB 4YH2A 2NVLA 2E7PA 1UN2A 4L5LA 2H72A 1K3YA 3U6VA 4MPGA 3A5WA 4IVFA 2V2GA 3CTFA 1T3BA 3KIJA 2IMFA 2ON5A 4MZWA 2WB9A 1F2EA 2O89A 1V98A 1J08A 3DXBA 1J0FA 2PUKC 3DMLA 1KEBA 2CT6A 2CQ9A 2CX4A 3J7Yk 3IDVA 3CTGA 1AW9A 4PURA 3GFKA 2AB6A 4ZL7A 1A0RP 1VF1A 5IOWA 2PWJA 2AJQB 1XWCA 1O7UA 1SKWB 3TKSE 1TI1A 2LNSA 3QAVA 3R2QA 5B7CA 3WD6A 2LJAA 2OBIA 3GH9A 2BMXA 2FWEA 3LJRA 4FYUA 3CBUA 4X0XA 4ZBDA 4TXVA 4KSMA 5D96A 5G2ZA 1RW1A 4DEJA 4IELA 2VCWA 3KH7A 5COHA 1GTIA 3VLNA 2C80A 3A2WA 1GSDA 1CQHA 2REMA 5HFIA 1H4OA 3D6IA 5D73A 1A8LA 3QDNA 2H01A 1FB0A 4ACSA 5B6MA 3FK8A 1K0MA 3FZAA 2B6MA 2R3XA 2X8CA 1TK8B 1YEXA 2OA7A 1ZL9A 1MTCA 2FUG2 4WKWA 4GXZA 5D93A 4MCUA 5ELGA 3NZNA 1W89A 1MD3A 5IPHA 2VUPA 2V1MA 3TCOA 5CRGA 1GSQA 3VPQA 1TU7A 4TVEA 2DLXA 4BPYA 3DD3A 2FHEA 3IA1A 3RPNA 3KP9A 3FY7A 4L5OA 4X1UA 2C3QA 2P5QA 1U87A 1KTEA 4K8MA 3P2AA 1PX6A 3D4MA 2DJ3A 2OACA 4OO4A 4GQCA 5G1LA 2GQKA 3GUSA 4KUNA 5HR1A 1IYIA 2F51A 4Z7XA 3H79A 5ECOB 1M7TA 1O81A 2NTOA 3GH6A 3QCPA 2CV4A 4EC0A 2LTKA 4Q5RA 4KAEA 4PQHA 4ECJA 2N5FA 4OFMA 4G9HA 3LXZA 1S3AA 4K2DA 5B8AA 5IMVA 1THOA 1PN9A 1VF3A 5KN3A 4NPBA 1HNBA 4ZB9A 1AXDA 5H5SA 1F37A 5CREA 4ID0A 2VCQA 4MMMA 3KTBA 1T00A 4F0CA 4Q5FA 2C8UA 2QC7A 2IL3A 1X9MB 1K0DA 4JE1A 4MZBA 4HZ2A 4YQMA 1XPVA 2HRNA 2VCVA 3M8NA 5ECLB 4MLYA 4TRXA 1GTBA 4J2FA 4MH2A 2VAFA 1ZGNA 2LKUA 1GULA 4FIWA 3RDWA 12GSA 2MYGA 3BCIA 1O6JA 4ECIA 1GSEA 4GF0A 3M0FA 1F3AA 1JZWA 3ME8A 2MMOA 2V32A 2JZSA 3UVTA 3KMNA 5A4VA 1HD2A 3SBCA 3GKKA 3HJOA 5FT3A 1M2DA 5J5NA 2H75A 5IMFA 4NV5A 1OAZA 2P0GA 2VCZA 1O85A 4J56E 5CAXA 3A3TA 2NBSA 3F4TA 1TRSA 1VGLA 1USBA 3FR6A 2FWFA 2CZ3A 4QQ7A 3ERGA 2MZCA 1DSBA 2B3SA 2TRCP 2HT9A 5D9WA 4KDYA 6GSUA 1R7HA 5HR2A 3U5RE 3TOTA 2A2SA 2KP2A 4I2UA 1QXHA 3IV4A 3W8JA 4KCEA 1XW5A 4EUYA 1G0TA 1TKDB 5ECSA 4DVCA 3FR3A 4MA9A 1PSQA 3VPTA 4I97A 2IPAA 1VRSD 4PGTA 3TRPA 1PRXA 2RLIA 2O7KA 4KE3A 2WDUA 1OE8A 4I6XA 1TOFA 2GT6A 1LJRA 2R6KA 2FWGA 3LWAA 2TRXA 16GSA 3KM6A 3QMXA 1R4WA 3VWUA 5CP1A 2H73A 5D8IA 4LMWA 1Z6NA 1PL1A 3TRXA 2YWOA 3UAPA 4DSRA 3DIEA 3GX0A 3IAS2 3O76A 3VWVA 3GSTA 1YKCA 2VD0A 3IBHA 4GWRA 3VI7A 1XXUA 3GSSA 1DE1A 3DEXA 1X9WB 1XVWA 4HJMA 3MDKA 4GLTA 4EL1A 4Q5QA 6GSYA 3HZ4A 1Z3EA 2YZHA 1XWKA 3WT2A 3DRNA 5KEJA 1G6WA 4XCSA 2VIMA 4OFNA 3LEFA 5EY6A 1QMVA 4MF6A 4MDCA 1GTAA 5EL8A 3TKRA 2IWTA 2FLSA 4OO5A 4MPFA 2C0DA 5IMZA 3E0UA 4MH3A 1E6BA 2K8SA 2GZZA 1GUMA 5IPGA 1FW1A 4JR4A 2D2ZA 2VL3A 1MDKA 1VF2A 5KN2A 3VURA 5AIXA 2R5GA 4MJEA 1YZXA 5ENUA 3HHVA 3QR6A 3IRAA 3QD9A 2TIRA 4OD7A 3AY8A 6GSTA 2YWMA 3F63A 1PA3A 5ABRA 3M9JA 3M1GA 2AV4A 1B4QA 1SL1B 1M9AA 2O87A 5JCUA 1K0BA 3DVWA 2B5XA 2YPMA 4KDXA 2FGXA 2QSIA 5LD0A 1XCCA 2YWNA 3D21A 2B5YA 4L8EA 5B8BA 2CAIA 5DAKB 2AYTA 3BJ5A 4D73B 4RI7A 3ISOA 3KD0A 1GTUA 2YN1A 5G5FA 3KMOA 1K0NA 3QFBC 2H1GA 4MF7A 2JSYA 3ZITA 2GZYA 3HVXA 2OE0A 4TKYA 2DMLA 1NM3A 2P31A 1GUHA 1HNAA 1PKWA 4PQIA 4XS4A 3HA9A 1GLPA 3M9KA 1GNEA 1URMA 2MMZA 3H4KA 2MBSA 3GKMA 3HD5A 2L59A 2C3TA 3DKSA 5IQYA 2VOCA 4G19A 3TKSC 4CDOA 2FWHA 1X9SB 4BWQA 1TRUA 2H1DA 1ZYQB 1A24A 4ECBA 1DE2A 4HEA2 2LJRA 2XPEA 2HLSA 3TKQA 3UBLA 1PGTA 3ZYWA 1EV4A 3TJFA 1SYXA 2KP1A 2K8VA 3RBTA 1OKDA 5DQYA 1Y6EA 3BBYA 2XC2A 3FZ5A 3UVHA 1M2BA 2JADA 1GSFA 2VL9A 2RM5A 3C1SA 4KSOA 2KHPA 5ID2B 1AC1A 3MSZA 4KNDA 2JACA 1TP9A 3EMXA 4QL7A 4ISDA 4KA0A 1SL0B 1XZOA 4HJ2A 1PQNA 4ZL9A 3VI5A 3HJPA 3GTUA 4IBPA 4POLA 1NSWA 2PERA 3KCMA 1AQVA 3ERWA 2J9HA 14GSA 2B1KA 4FO5A 1ON4A 1NW2A 1XWGA 3HVSA 1XW9A 5JWOB 2PN8A 1Q98A 2HNLA 4JU5A 2LNTA 3A2VA 2C0EA 2H6ZA 1AQXA 5CRDA 4AF2A 1TK5B 3GKNA 2V6KA 2VM2A 4ULXA 3TJKA 2H1BA 4PUFC 2ZCTA 4OCFA 2ALBA 3TOUA 4BVYA 2GT5A 3PR8A 5INYA 4NXIA 1IYHA 1M2AA 4TR1A 2B1LA 4OWYA 4EF0A 2BTOT 1NHYA 4F03A 1M0UA 1FG4A 4DSSB 2IMDA 3L9SA 2LQOA 1OC3A 4HI7A 4PX1A 4AJ7A 4TN8A 5EVOA 4XIHA 2G0FA 4FYBA 3TRQA 4K0GA 1S3DA 1B9XC 3CYNA 2WJUA 4WETA 1T4YA 4L0WA 4K6XA 1K3OA 1JZOA 2C4JA 2VCTA 1TW9A 4LL4B 4MP4A 2NPBA 3ZVJA 5H5QA 2KUCA 1PL2A 3FW2A 2HFDA 1EGRA 5CO3A 4ZXGA 1B8XA 4CW9A 3CSIA 4TXOB 2E2MA 1HNCA 4WBJA 1O8WA 2HE3A 2PBJA 1V9WA 4J57E 3P90A 5LCZA 4I8BA 4F2IA 5DALB 2HRFA 3PGTA 2H30A 2DBCA 5DCGA 5ECRB 5E59A 3KEBA 4L0UA 3KXOA 4F82A 5F05A 5IMAA 5HQPA 3IC4A 1XW6A 4MJAA 4F0BA 3TJBA 3GN3A 5HR0A 4NHZA 2IJYA 3WT1A 2CX3A 2CVBA 1BYEA 3Q6OA 2EIOA 3IPZA 2JZRA 4JZQA 4FH8A 2DJ2A 4IN0A 4ZL8A 3FKFA 3ME7A 3F3RA 3ED3A 1A0FA 4OMVA 4V1Ag 2DSAA 5DVBA 2I3YA 5DAKA 3CXGA 1RQMA 4ZBAA 2VLTA 2VLUA 2XPDA 4LA1A 3GA4A 4GSNA 4N0ZA 2X8GA 3IE3A 3ZLPA 1QQ2A 4XRDA 3S9FA 1HQOA 2R2JA 2GTUA 2K9FA 1FO5A 2IFQB 1OC9A 2V41A 2H0HA 3N5OA 4KDUA 1RK4A 2V6OA 4KGIA 2X99A 4EVMA 5JWQB 2VL2C 4X43A 4HOJA 4O92A 2XBQA 3Q18A 2HZEB 3O6TA 2YOIA 6GSWA 4O5RA 4MABA 3FHKA 1GRXA 1O8XA 2XBIA 2CVKA 1X5CA 4PXOA 1YY7A 4GSTA 1R5PA 4PUAA 2WFCA 1BEDA 3DGQA 2WRTA 3IAM2 4TR4A 2IMEA 4BVXA 3CRUA 2B7KA 5JCGA 3TB2A 1K0CA 2ZUPA 4ML1A 2XHFA 1JLWA 3L0HA 3G7IA 5L71A 3P7XA 2H66A 4TOPA 3ZREA 4WR5A 1YJ6A 1WWJA 4IQ1A 4K7OA 2LRCA 1SL2B 1UVZA 3E3EA 3ZL5A 3RHCA 2GQLA 4HUAA 5DJLA 5A4UA 1SD8A 1WMJA 1OKTA 1AIUA 1X0RA 1R26A 2JSZA 1ZZYA 1EEMA 4LMVA 2FY6A 2MMAA 1ERTA 3ZMKA 2H70A 1YDKA 2YJHA 1Y25A 1SENA 2L4CA 5F07A 4WXTA 18GSA 4ZBBA 4N11A 1EEJA 2FA4A 1GNWA 1TTZA 5E4WA 2OKAA 2F9SA 1THXA 2JZTA 4IP6A 2HSHA 5FHIA 5ELAA 1B9YC 2B7JA 4POMA 5G30A 10GSA 2H8LA 1GH2A 1TDIA 2I4AA 2IIYA 17GSA 1S3CA 4GQFA 4TR0A 2WCIA 1EGOA 1PMTA 1SJIA 2Z9SA 3APQA 1G6YA 4KCAA 1AUCA 2HXKA 2OE3A 13GSA 4XS1A 1EP8A 1XFLA 4MJCA 3TKSA 2H76A 4YAVA 3WGXA 2LS5A 4V2MA 1QK8A 4RI6A 3F8UA 4MZCA 4WF5A 3KGKA 4HU9A 2LRTA 3L4NA 1EZKA 2VO4A 11GSA 5HFKA 3FR9A 2PVQA 2H0GA 3IHQA 3IK9A 1LU4A 4XTSA 1X5EA 3KTLA 3HKRA 1DUGA 5J9CA 3LFLA 4KW6A 2GSSA 3EU4A 2L6DA 2KOKA 5AN1A 1YF0A 2CZ2A 4HU7A 1XOAA 8GSSA 1JZRA 2YZUA 4OCEA 1SU9A 1ML6A 5J4UA 4EDZA 5IM9A 2M80A 3SWLA 4IW9A 4K1FA 1WPIA 4NWYA 1UC7A 1BAYA 2L5OA 4IJIA 3TUEA 5GZZB 5EPFA 2DJ1A 1WP0A 5H5RA 5D9TA 2PU9C 5GSSA 1FHEA 2I1UA 2JU5A 3F4SA 4ZB6A 1QFNA 2RUEA 2C0GA 4LLRA 1ERVA 3I43A 5DCHA 3WGDA 2IMIA 5FWGA 1OYJA 5D9VA 2K18A 3ZRDA 4AJ6A 2DJKA 2VCXA 1I5GA 2YWIA 2GQMA 1ZMAA 19GSA 2AHEA 5J41A 1T4ZA 2IFQA 1A8YA 1GL8A 2FCHA 3IR4A 2GZPA 1Z6MA 2H19A 3GRXA 1SK2A 1BQ7A 2FA8A 3EVIA 3EINA 1B48A 1U3IA 5IIZA 1WRYA 5IMDA 4ZILA 3GNJA 2H0IA 4ZIJA 3D5JA 3IOSA 2GSQA 3EU3A 4YQVA 5HR3A 1Z7RA 4ECCA 1UA5A 4KB3A 3E9JB 1T1VA 3EMPA 3WYWA 2LJKA 4WEYA 3HVVA 3ZMLA 5F8BA 3ZTLA 3C7MA 1AAZA 1SD9A 4XRAA 2DIYA 3EC3A 5DJMA 3ZFBA 4I5QA 3UEMA 1N8JA 4IKHA 1OE7A 4FYCA 4JRRA 2H71A 1SKRB 1GUKA 4BA7A 1ZYEA 3NOFA 4YAPA 4POKA 4OFTA 1JZDA 2N5BA 2O85A 2GDRA 3QAGA 4YQUA 3C8EA 4JR6A 1XBSA 3BCKA 2AAWA 4K7NA 2K6VA 3KJYA 1O73A 1KBNA 3CSHA 2OJLA 3P8WA 3APOA 2GS3A 3GV1A 5GSTA 3V1WA 1ZCPA 2DJ0A 4GTUA 5KN1A 2YV9A 1R5AA 4ZB8A 3HXSA 3FRCA 2MMNA 2WZ9A 1GSUA 3ZFLA 2HSYA 1Q4JA 1T7PB 1GP1A 2RIIA 3GYKA 3VWWA 2RM6A 2AUVA 2LUSA 1WE0A 5KN0A 3I9V2 2FNOA 2MBTA 1G7OA 5F06A 3LQ7A 3H93A 1FVJA 3D22A 3DYRA 5JCWA 1YKAA 1EV9A 2YJ7A 4LL1B 1MDJA 4Q5NA 5GAPD 4IGJA 3GMFA 3F3QA 2J23A 2C1YA 3FYGA 1U3AA 2VL2A 3NIVA 2DJJA 4NMUA 3C71A 1WIKA 2DMMA 4EDYA 1M9BA 4AGSA 1GSSA 2L5LA 1W4VA 1PX7A 1K3LA 4XS6A 1ST9A 2R37A 5IO2A 4IQAA 4HQZA 2DIZA 1GWCA 1X5DA 2C0FA 3ERFA 1EOHA 2OBKA 3IK7A 2DC5A 2I81A 2YNXA 3F0IA 2HYXA 5DQSA 3UARA 4WR4A 3HCZA 3Q74A 3ZZXA 4IP1A 2I9HA 1AQWA 2HZFA 1B4PA 5GAND 3ZIJA 1GSYA 5DDLA 1TU8A 3CSJA 3G7JA 4IHUA 1XVQA 1SJ6A 1MD4A 1FOVA 3W6GA 3DWVA 2VLVA 2LRNA 3GL5A 2L4QA 2F8AA 2A2RA 2B5EA 5ECNB 1TRVA 1TJDA 1F3BA 4ILFA 3MNGA 2H6XA 1A2MA 1M99A 1SKSB 6GSVA 2LV3A 4GRFA 2X8HA 1ERWA 3FZ4A 1V2AA 1I9DA 3GX8A 2LEGA 2YP6A 1NHOA 1KNGA 4D73A 2BJXA 1BX9A 2PPTA 4N0VA 3N9JA 1F9MA 1V57A 3LSZA 3LORA 1FB6A 4XS4B 3M3MA 1WOUA 4HDEA 1JFUA 3GL3A 3GKXA 3MWHA 2F3MA 2H74A 2KLXA 4CHSA 2L6CA 2ZNMA 3D0ZA 3QOUA 1GLQA 4E8EA 4DSQA 4QL9A 5DBQA 2VD1A 5ECHB 5ECIB 4MJBA 2WULA 3RAZA 1G7EA 1WJKA 3EURA 1SK0A 5A4WA 2YV7A 1Z7PA 2H6YA 4K9ZA 5IOXA 1EP7A 3TKPA 3FZ9A 6GSSA 2OADA 5D9XA 4BL7A 4O7HA 4V2LA 3KH9A 1SYRA 3FEUA 1K0AA 3PH9A 4KH7A 2IN3A 2GSRA 3BOAA 3GHAA 2PMTA 4G2EA 1C72A 5ID2A 2YCDA 4TW5A 3UIWA 4RQXA 3L9UA 1QUWA 1PKZA 22GSA 2IMKA 3GTUB 4V1Ap 4EXJA 1Z5YE 3L78A 3LYKA 2FD3A 4GSSA 1F6MC 5A5KA 4WBRD 2LQQA 3W8SA 1U88A 1V58A 3BD2A 5G1KA 1JLVA 4N30A 2EC4A 3C1RA 5B6NA 4BWSA 4KX4A 2LSTA 5IMCA 1TRWA 1YQ1A 4RQRA 2GLRA 3PINA 4NHWA 4O32A 6GSXA 4PNGA 3F9UA 3A2XA 4AJ8A 3US3A 4G10A 1BG5A 3UBKA 2X64A 3J7Yb 2EIQA 2ES7A 3UL3A 3I69A 1OVNA 3C73A 1HYUA 4TR1B 3ZIVA 3L9VA 2G2QA 2ON7A 3H8QA 5ECQB 2RUFA
chains in the Genus database with same CATH superfamily
2YANA 2GSTA 1V40A 3LG6A 1SK1A 4PNFA 4EE0A 1E2YA 2DKIA 2E0QA 4N10A 4DSSA 5AISA 3G7YA 3F6FA 2R0GA 3H1NA 4XHMA 2WGRA 3WGEA 2PGTA 4EKZA 3O3TA 3VFIA 1TI3A 3EYTA 3RPPA 5F0GA 3HZ8A 4E8HA 1T8EB 3HYPA 4NAXA 5C04A 1BJXA 1K0OA 3F6DA 1TXXA 2M72A 3IXRA 4PQ1A 3TJGA 4BIKA 1A2LA 3UOMA 3I6AA 5C00A 1U6TA 3KZQA 4TR3A 1XWAA 2C3NA 4IJ3A 4WF4A 2HI7A 5HFGA 3GIXA 3HY2A 1FVKA 2E2GA 2P5RA 4TXOA 1XWBA 3HDCA 1A2JA 2DKHA 2EIRA 2NDOA 4G0LA 2N5AA 4ICYA 4IS0A 5DALA 3QFAC 5ECMB 1MDIA 4MF5A 4POBA 2PVOC 3OR5A 5CRHA 3MAKA 1SJZA 2L57A 1OC8A 4EO3A 5G5EA 1ILOA 1XIYA 4I2TA 3K8NA 1A23A 5IO0A 3TJJA 2M46A 3QPMA 2CVDA 1H75A 1N2AA 1PN0A 3Q19A 3EE2A 2O8VB 3CMIA 2H1AA 1ZOFA 3LGCA 4JEDA 1EWXA 4K0NA 20GSA 1ERUA 2GVPA 1Z9HA 7GSSA 2CA8A 3JCML 5J3RA 3CRTA 4RUVA 4V2NA 5CRWA 1LBKA 5CYYA 5G31A 2QA2A 3RHBA 1CQGA 5ECKB 1XOBA 5CNWA 3EPTA 1OC9B 1FAAA 3F4RA 2A4VA 1PD21 4HS1A 4K7IA 1QGVA 4NV2A 3EWLA 3TGZA 3KP8A 4GCIA 1J9BA 4HZ4A 3UMAA 4G0IA 3D4TA 3IHGA 1YEPA 2UZ8A 4X4JA 4F9ZA 4MK3A 3G9BA 3GURA 2HZEA 3APSA 4ML6A 1MEKA 4HQSA 5J9BA 3UJ1A 1ABAA 2JL4A 4JBBA 5AIVA 5LNKe 4H86A 5ECPB 1YF1A 3LYPA 1ACVA 2VM1A 3DVXA 2QGVA 2OE1A 3QAWA 1EOGA 2F8FA 1VF4A 3LXTA 3HJMA 1TK0B 5AGYA 2R4VA 9GSSA 4MNNA 1DBYA 4BVXB 3VK9A 3TDGA 3VWXA 3ZVJD 2QKEA 2WS2A 2GGTA 4P3YB 2CAQA 1JHBA 5JWRB 4YH2A 2NVLA 2E7PA 4CY8A 1UN2A 4L5LA 2H72A 1K3YA 3U6VA 4MPGA 3A5WA 4IVFA 2V2GA 3CTFA 1T3BA 3KIJA 2IMFA 2ON5A 4MZWA 2WB9A 1F2EA 2O89A 1V98A 1J08A 3DXBA 1J0FA 2PUKC 3DMLA 1KEBA 2CT6A 2CQ9A 2CX4A 3J7Yk 3IDVA 3CTGA 1AW9A 4PURA 3GFKA 2AB6A 4ZL7A 1A0RP 1VF1A 5IOWA 2PWJA 2AJQB 1XWCA 1O7UA 1SKWB 3TKSE 1TI1A 2LNSA 3QAVA 3R2QA 5B7CA 3WD6A 2LJAA 2OBIA 3GH9A 2BMXA 2FWEA 3LJRA 4FYUA 3CBUA 4X0XA 4ZBDA 4TXVA 4KSMA 5D96A 5G2ZA 1RW1A 4DEJA 4IELA 2VCWA 3KH7A 5COHA 1GTIA 3VLNA 2C80A 3A2WA 1GSDA 1CQHA 2REMA 5HFIA 1H4OA 3D6IA 5D73A 1A8LA 3QDNA 2H01A 1FB0A 4EIQA 4ACSA 5B6MA 3FK8A 1K0MA 3FZAA 2B6MA 2R3XA 2X8CA 1TK8B 1YEXA 2OA7A 1ZL9A 1MTCA 2FUG2 4WKWA 4GXZA 5D93A 4MCUA 4K5SA 5ELGA 3NZNA 1W89A 1MD3A 5IPHA 2VUPA 2V1MA 3TCOA 5CRGA 1GSQA 3VPQA 1TU7A 4TVEA 2DLXA 4BPYA 3DD3A 2FHEA 3IA1A 3RPNA 3KP9A 3FY7A 4L5OA 4X1UA 2C3QA 2P5QA 1U87A 1KTEA 4K8MA 3P2AA 1PX6A 3D4MA 2DJ3A 2OACA 4OO4A 4GQCA 5G1LA 2GQKA 3GUSA 4KUNA 5HR1A 1IYIA 2F51A 4Z7XA 3H79A 5ECOB 1M7TA 1O81A 2NTOA 3GH6A 3QCPA 2CV4A 4PTSA 4EC0A 2LTKA 4Q5RA 4KAEA 4PQHA 4ECJA 2N5FA 4OFMA 4G9HA 3LXZA 1S3AA 4K2DA 5B8AA 5IMVA 1THOA 1PN9A 1VF3A 5KN3A 4NPBA 1HNBA 4ZB9A 1AXDA 5H5SA 2QA1A 1F37A 2HRKA 5CREA 4ID0A 2VCQA 4MMMA 3KTBA 1T00A 1S3RA 4Q5FA 4F0CA 2C8UA 2QC7A 2IL3A 1X9MB 1K0DA 4JE1A 4MZBA 4HZ2A 4YQMA 1XPVA 2HRNA 2VCVA 3M8NA 5ECLB 4MLYA 4TRXA 1GTBA 4J2FA 4MH2A 2VAFA 1ZGNA 3FMWA 2LKUA 1GULA 4FIWA 3RDWA 12GSA 2MYGA 3BCIA 1O6JA 4ECIA 1GSEA 4GF0A 3M0FA 1F3AA 1JZWA 3ME8A 2MMOA 2V32A 2JZSA 3UVTA 3KMNA 5A4VA 1HD2A 3SBCA 3GKKA 3HJOA 5FT3A 1M2DA 5J5NA 2H75A 5IMFA 4NV5A 1OAZA 2P0GA 2VCZA 1O85A 4J56E 5CAXA 3A3TA 2NBSA 3F4TA 1TRSA 1VGLA 1USBA 3FR6A 2R0PA 2FWFA 2CZ3A 4QQ7A 3ERGA 2MZCA 1DSBA 2B3SA 2HSMA 2TRCP 2HT9A 5D9WA 4KDYA 6GSUA 1R7HA 5HR2A 3U5RE 3TOTA 2A2SA 2KP2A 4I2UA 1QXHA 3IV4A 3W8JA 4KCEA 1XW5A 4EUYA 1G0TA 1TKDB 5ECSA 4DVCA 3FR3A 4MA9A 1PSQA 3VPTA 4I97A 2IPAA 1VRSD 4PGTA 3TRPA 1PRXA 2RLIA 2O7KA 4KE3A 2WDUA 1OE8A 4I6XA 1TOFA 2GT6A 1LJRA 2R6KA 2FWGA 4O5QA 3LWAA 2TRXA 16GSA 3KM6A 3QMXA 1R4WA 3VWUA 5CP1A 2H73A 5D8IA 4LMWA 1Z6NA 1PL1A 3TRXA 3CQFA 2YWOA 3UAPA 4DSRA 4Z2TA 3DIEA 3GX0A 3IAS2 3O76A 3VWVA 3GSTA 1YKCA 2VD0A 3IBHA 4GWRA 3VI7A 1XXUA 2A2PA 4Z2RA 3GSSA 1DE1A 3DEXA 1X9WB 1XVWA 4HJMA 3MDKA 4GLTA 4EL1A 4Q5QA 6GSYA 3R3EA 3HZ4A 1Z3EA 2YZHA 1XWKA 3WT2A 3DRNA 5KEJA 1G6WA 4XCSA 2VIMA 4OFNA 3LEFA 5EY6A 1QMVA 4MF6A 4MDCA 1GTAA 5EL8A 3TKRA 2IWTA 2FLSA 4OO5A 4MPFA 2C0DA 5IMZA 3E0UA 4MH3A 1E6BA 2K8SA 2GZZA 1GUMA 5IPGA 1FW1A 4JR4A 2D2ZA 2VL3A 1MDKA 1VF2A 5KN2A 3VURA 2R0CA 5AIXA 2R5GA 4MJEA 1YZXA 5ENUA 3HHVA 3QR6A 3IRAA 3QD9A 2TIRA 4OD7A 3AY8A 6GSTA 2YWMA 3F63A 1PA3A 5ABRA 3M9JA 3M1GA 2AV4A 1B4QA 1SL1B 1M9AA 2O87A 5JCUA 1K0BA 3DVWA 4A5PA 2B5XA 2YPMA 4KDXA 2FGXA 2QSIA 5LD0A 1XCCA 2YWNA 3D21A 2B5YA 4L8EA 5B8BA 2CAIA 5DAKB 2AYTA 3BJ5A 4D73B 4RI7A 3ISOA 3KD0A 4O5UA 1GTUA 2YN1A 5G5FA 3KMOA 1K0NA 3QFBC 2H1GA 4MF7A 2JSYA 3ZITA 2GZYA 3HVXA 2OE0A 4TKYA 2DMLA 1NM3A 2P31A 1GUHA 1HNAA 1PKWA 4PQIA 4XS4A 3HA9A 1GLPA 3M9KA 1GNEA 1URMA 2MMZA 3H4KA 2MBSA 3GKMA 3HD5A 2L59A 2C3TA 3DKSA 5IQYA 2VOCA 4G19A 3TKSC 4CDOA 2FWHA 1X9SB 4BWQA 1TRUA 2H1DA 1ZYQB 1A24A 4ECBA 1DE2A 4HEA2 2LJRA 2XPEA 2HLSA 3TKQA 3UBLA 1PGTA 3ZYWA 1EV4A 3TJFA 4BL7B 1SYXA 2KP1A 2K8VA 3RBTA 1OKDA 5DQYA 1Y6EA 3BBYA 2XC2A 3FZ5A 3UVHA 1M2BA 2JADA 1GSFA 2VL9A 2RM5A 3C1SA 4KSOA 2KHPA 5ID2B 1AC1A 3MSZA 4KNDA 2JACA 1TP9A 3EMXA 5BRTA 4QL7A 4ISDA 3HVNA 4KA0A 1SL0B 1XZOA 4HJ2A 1PQNA 4ZL9A 3VI5A 3HJPA 3GTUA 4IBPA 4POLA 1NSWA 2PERA 3KCMA 1AQVA 3ERWA 2J9HA 14GSA 2B1KA 4FO5A 1ON4A 1NW2A 1XWGA 3HVSA 1XW9A 5JWOB 2PN8A 1Q98A 2HNLA 4JU5A 2LNTA 3A2VA 2C0EA 2H6ZA 1PFOA 1AQXA 5CRDA 4AF2A 1TK5B 3GKNA 2V6KA 2VM2A 4ULXA 3TJKA 2H1BA 4PUFC 2ZCTA 4OCFA 2ALBA 3TOUA 4BVYA 2GT5A 3PR8A 5INYA 4NXIA 1IYHA 1M2AA 4TR1A 2B1LA 4OWYA 4EF0A 2BTOT 1NHYA 4F03A 1M0UA 1FG4A 4DSSB 2IMDA 3L9SA 2LQOA 1OC3A 4HI7A 4PX1A 4AJ7A 4TN8A 5EVOA 4XIHA 2G0FA 4FYBA 3TRQA 4K0GA 1S3DA 1B9XC 3CYNA 2WJUA 4WETA 1M3IA 1T4YA 4L0WA 4K6XA 1K3OA 1JZOA 2C4JA 2VCTA 1TW9A 4LL4B 4MP4A 2NPBA 3ZVJA 5H5QA 2KUCA 1PL2A 3FW2A 2HFDA 1EGRA 5CO3A 4ZXGA 1B8XA 4CW9A 3CSIA 4TXOB 2E2MA 1HNCA 4WBJA 1O8WA 2HE3A 2PBJA 1V9WA 4J57E 3P90A 5LCZA 4I8BA 4F2IA 5DALB 2HRFA 3PGTA 2H30A 2DBCA 5DCGA 5ECRB 5E59A 3KEBA 4L0UA 3KXOA 4F82A 5F05A 5IMAA 5HQPA 3IC4A 1XW6A 4MJAA 4F0BA 3TJBA 3GN3A 5HR0A 4NHZA 2IJYA 3WT1A 2CX3A 2CVBA 1BYEA 3Q6OA 2EIOA 3IPZA 2JZRA 4JZQA 4FH8A 1M3JA 2DJ2A 4IN0A 4ZL8A 2X4AA 3FKFA 3ME7A 3F3RA 3ED3A 3A5IA 1A0FA 4OMVA 4V1Ag 2DSAA 5DVBA 2I3YA 5DAKA 3CXGA 1RQMA 4ZBAA 2VLTA 2VLUA 2XPDA 4LA1A 3GA4A 4GSNA 4N0ZA 2X8GA 3IE3A 3ZLPA 1QQ2A 4XRDA 3S9FA 1HQOA 2R2JA 2GTUA 2K9FA 1FO5A 2IFQB 1OC9A 2V41A 3LW9A 2H0HA 3N5OA 4KDUA 1RK4A 2V6OA 4KGIA 2X99A 4EVMA 5JWQB 2VL2C 4X43A 3IC8A 4HOJA 4O92A 2XBQA 3Q18A 2HZEB 3O6TA 2YOIA 6GSWA 4O5RA 4MABA 3FHKA 1GRXA 1O8XA 2XBIA 2CVKA 1X5CA 4PXOA 1YY7A 4GSTA 1R5PA 4PUAA 2WFCA 1BEDA 3DGQA 2WRTA 3IAM2 4TR4A 2IMEA 4BVXA 3CRUA 2B7KA 5JCGA 3TB2A 1K0CA 2ZUPA 4ML1A 2XHFA 1JLWA 3L0HA 3G7IA 5L71A 3P7XA 2H66A 4TOPA 3ZREA 4WR5A 1YJ6A 1WWJA 4IQ1A 4K7OA 2LRCA 1SL2B 1UVZA 4CY6A 3E3EA 3ZL5A 3RHCA 2GQLA 4HUAA 5DJLA 5A4UA 1SD8A 1WMJA 1OKTA 1AIUA 1X0RA 1R26A 2JSZA 1ZZYA 1EEMA 4LMVA 2FY6A 2MMAA 1ERTA 3ZMKA 2H70A 1YDKA 2YJHA 1Y25A 1SENA 2L4CA 5F07A 4WXTA 18GSA 4ZBBA 2A4HA 4N11A 1EEJA 2FA4A 1GNWA 1TTZA 5E4WA 2OKAA 2F9SA 1THXA 2JZTA 4IP6A 2HSHA 5FHIA 5ELAA 1B9YC 2B7JA 4POMA 5G30A 10GSA 2H8LA 1GH2A 1TDIA 2I4AA 4K5RA 2IIYA 17GSA 1S3CA 4GQFA 4TR0A 2WCIA 1EGOA 1PMTA 1SJIA 2Z9SA 3APQA 1G6YA 3MIXA 4KCAA 1AUCA 2HXKA 2OE3A 13GSA 4XS1A 1EP8A 1XFLA 4MJCA 3TKSA 2H76A 4YAVA 3WGXA 2LS5A 4V2MA 1QK8A 4RI6A 3F8UA 4MZCA 4WF5A 3KGKA 4HU9A 5BMUA 2LRTA 3L4NA 1EZKA 2VO4A 11GSA 5HFKA 3FR9A 2PVQA 2H0GA 3IHQA 3IK9A 1LU4A 4XTSA 1X5EA 3KTLA 3HKRA 1DUGA 5J9CA 3LFLA 4KW6A 2GSSA 3EU4A 2L6DA 2KOKA 5AN1A 1YF0A 2CZ2A 4HU7A 1XOAA 8GSSA 1JZRA 2YZUA 4OCEA 1SU9A 1ML6A 5J4UA 4EDZA 5IM9A 2M80A 3SWLA 4IW9A 4K1FA 1WPIA 4NWYA 1UC7A 1BAYA 2L5OA 4IJIA 3TUEA 5GZZB 4HSCX 5EPFA 2DJ1A 1WP0A 5H5RA 5D9TA 2PU9C 5GSSA 1FHEA 2I1UA 2JU5A 2HRAA 3F4SA 4ZB6A 1QFNA 2RUEA 2C0GA 4LLRA 1ERVA 3I43A 5DCHA 3WGDA 2IMIA 5FWGA 1OYJA 5D9VA 2K18A 3ZRDA 4AJ6A 2DJKA 2VCXA 1I5GA 2YWIA 2GQMA 1ZMAA 19GSA 2AHEA 5J41A 1T4ZA 4K2XA 2IFQA 1A8YA 1GL8A 2FCHA 1XG8A 3IR4A 2GZPA 1Z6MA 2H19A 3GRXA 1SK2A 1BQ7A 2FA8A 3EVIA 3EINA 1B48A 1U3IA 5IIZA 1WRYA 5IMDA 4ZILA 3GNJA 2H0IA 4ZIJA 3D5JA 3IOSA 2GSQA 3EU3A 4YQVA 5HR3A 1Z7RA 4ECCA 1UA5A 4KB3A 3E9JB 1T1VA 3EMPA 3WYWA 2LJKA 4WEYA 3HVVA 3ZMLA 5KOXA 5F8BA 3ZTLA 3C7MA 1AAZA 1SD9A 4XRAA 2DIYA 3EC3A 5DJMA 3ZFBA 4I5QA 3UEMA 1N8JA 4IKHA 1OE7A 4FYCA 4JRRA 2H71A 1SKRB 1GUKA 4BA7A 1ZYEA 3NOFA 4YAPA 4POKA 4OFTA 1JZDA 2N5BA 2O85A 2GDRA 3QAGA 4YQUA 3C8EA 4JR6A 1XBSA 3BCKA 2AAWA 4K7NA 2K6VA 3KJYA 1O73A 1KBNA 3CSHA 2OJLA 3P8WA 3APOA 2GS3A 3GV1A 5GSTA 3V1WA 1ZCPA 2DJ0A 4GTUA 5KN1A 2YV9A 1R5AA 4ZB8A 3HXSA 3FRCA 2MMNA 2WZ9A 1GSUA 3ZFLA 2HSYA 1Q4JA 1T7PB 1GP1A 2RIIA 3GYKA 3VWWA 2RM6A 2AUVA 2LUSA 1WE0A 5KN0A 3I9V2 2FNOA 2MBTA 1G7OA 5F06A 3LQ7A 3H93A 1FVJA 3D22A 3DYRA 5JCWA 1YKAA 1EV9A 2YJ7A 4LL1B 1MDJA 4Q5NA 5GAPD 4IGJA 3GMFA 3F3QA 2J23A 3PPUA 2C1YA 3FYGA 1U3AA 2VL2A 3NIVA 2DJJA 4NMUA 3C71A 1WIKA 2DMMA 4EDYA 1M9BA 4AGSA 1GSSA 4Z2UA 2L5LA 1W4VA 1PX7A 1K3LA 4XS6A 1ST9A 2R37A 5IO2A 4IQAA 4HQZA 2DIZA 1GWCA 1X5DA 2C0FA 3ERFA 1EOHA 2OBKA 4USSA 3IK7A 2DC5A 2I81A 2YNXA 3F0IA 2HYXA 5DQSA 3UARA 4WR4A 3HCZA 3Q74A 3ZZXA 4IP1A 2I9HA 1AQWA 2HZFA 1B4PA 5GAND 3ZIJA 1GSYA 5DDLA 1TU8A 3CSJA 3G7JA 4IHUA 1XVQA 1SJ6A 1MD4A 1FOVA 3W6GA 3DWVA 2VLVA 2LRNA 3GL5A 2L4QA 2F8AA 2A2RA 2B5EA 5ECNB 1TRVA 1TJDA 1F3BA 4ILFA 3MNGA 2H6XA 1A2MA 1M99A 1SKSB 6GSVA 5KOWA 2LV3A 4GRFA 2X8HA 1ERWA 3FZ4A 1V2AA 1I9DA 3GX8A 2LEGA 2YP6A 1NHOA 1KNGA 4D73A 2BJXA 4G0KA 1BX9A 2PPTA 4N0VA 3N9JA 1F9MA 1V57A 3LSZA 3LORA 1FB6A 4XS4B 3M3MA 1WOUA 4HDEA 1JFUA 3GL3A 3GKXA 3MWHA 2F3MA 2H74A 2KLXA 4CHSA 2L6CA 2ZNMA 3D0ZA 3QOUA 1GLQA 4E8EA 4DSQA 2X49A 4QL9A 5DBQA 2VD1A 5ECHB 5ECIB 4MJBA 2WULA 3RAZA 1G7EA 1ZYNA 4EIPA 1WJKA 3EURA 1SK0A 5A4WA 2YV7A 1Z7PA 2H6YA 4K9ZA 5IOXA 1FOHA 3MYDA 1EP7A 3TKPA 3FZ9A 1ZYPA 2OADA 6GSSA 5D9XA 4BL7A 4O7HA 4V2LA 3KH9A 1SYRA 3FEUA 4YKGA 1K0AA 3PH9A 4KH7A 2IN3A 2GSRA 3BOAA 4KF9A 3GHAA 2PMTA 4G2EA 1C72A 5ID2A 2YCDA 4TW5A 3UIWA 4RQXA 3L9UA 1QUWA 1PKZA 22GSA 2IMKA 3GTUB 4V1Ap 4EXJA 1Z5YE 3L78A 3LYKA 2FD3A 4GSSA 1F6MC 5A5KA 4WBRD 2LQQA 3W8SA 1U88A 4FQUA 1V58A 3BD2A 5G1KA 1JLVA 4N30A 2EC4A 3C1RA 5B6NA 4YKFA 4BWSA 4KX4A 2LSTA 5IMCA 1TRWA 1YQ1A 4RQRA 2GLRA 3PINA 4NHWA 4O32A 6GSXA 4PNGA 3F9UA 3A2XA 4AJ8A 3US3A 4G10A 1BG5A 3UBKA 2X64A 4BVYB 2EIQA 2ES7A 3UL3A 3J7Yb 3I69A 1OVNA 3C73A 1HYUA 4TR1B 3ZIVA 3L9VA 2G2QA 2ON7A 3H8QA 5ECQB 2RUFA
chains in the Genus database with same CATH topology
2YANA 2GSTA 1V40A 3LG6A 1SK1A 4PNFA 4EE0A 1E2YA 2DKIA 2E0QA 4N10A 4DSSA 5AISA 3G7YA 3F6FA 2R0GA 3H1NA 4XHMA 2WGRA 3WGEA 2PGTA 4EKZA 3O3TA 3VFIA 1TI3A 3EYTA 3RPPA 5F0GA 3HZ8A 4E8HA 1T8EB 3HYPA 4NAXA 5C04A 1BJXA 1K0OA 3F6DA 1TXXA 2M72A 3IXRA 4PQ1A 3TJGA 1A2LA 3UOMA 3I6AA 5C00A 1U6TA 3KZQA 4TR3A 1XWAA 2C3NA 4IJ3A 4WF4A 2HI7A 5HFGA 3GIXA 3HY2A 1FVKA 2E2GA 2P5RA 4TXOA 1XWBA 3HDCA 1A2JA 2DKHA 2EIRA 2NDOA 4G0LA 2N5AA 4ICYA 4IS0A 5DALA 3QFAC 5ECMB 1MDIA 4MF5A 4POBA 2PVOC 3OR5A 5CRHA 3MAKA 1SJZA 2L57A 1OC8A 4EO3A 5G5EA 1ILOA 1XIYA 4I2TA 3K8NA 1A23A 5IO0A 3TJJA 2M46A 3QPMA 2CVDA 1H75A 1N2AA 1PN0A 3Q19A 3EE2A 2O8VB 3CMIA 2H1AA 1ZOFA 3LGCA 4JEDA 1EWXA 4K0NA 20GSA 1ERUA 2GVPA 1Z9HA 7GSSA 2CA8A 3JCML 5J3RA 3CRTA 4RUVA 4V2NA 5CRWA 1LBKA 5CYYA 5G31A 2QA2A 3RHBA 1CQGA 5ECKB 1XOBA 5CNWA 3EPTA 1OC9B 1FAAA 3F4RA 2A4VA 1PD21 4HS1A 4K7IA 1QGVA 4NV2A 3EWLA 3TGZA 3KP8A 4GCIA 1J9BA 4HZ4A 3UMAA 4G0IA 3D4TA 3IHGA 1YEPA 2UZ8A 4X4JA 4F9ZA 4MK3A 3G9BA 3GURA 2HZEA 3APSA 4ML6A 1MEKA 4HQSA 5J9BA 3UJ1A 1ABAA 2JL4A 4JBBA 5AIVA 5LNKe 4H86A 5ECPB 1YF1A 3LYPA 1ACVA 2VM1A 3DVXA 2QGVA 2OE1A 3QAWA 1EOGA 2F8FA 1VF4A 3LXTA 3HJMA 1TK0B 5AGYA 2R4VA 9GSSA 4MNNA 1DBYA 4BVXB 3VK9A 3TDGA 3VWXA 3ZVJD 2QKEA 2WS2A 2GGTA 4P3YB 2CAQA 1JHBA 5JWRB 4YH2A 2NVLA 2E7PA 4CY8A 1UN2A 4L5LA 2H72A 1K3YA 3U6VA 4MPGA 3A5WA 4IVFA 2V2GA 3CTFA 1T3BA 3KIJA 2IMFA 2ON5A 4MZWA 2WB9A 1F2EA 2O89A 1V98A 1J08A 3DXBA 1J0FA 2PUKC 3DMLA 1KEBA 2CT6A 2CQ9A 2CX4A 3J7Yk 3IDVA 3CTGA 1AW9A 4PURA 3GFKA 2AB6A 4ZL7A 1A0RP 1VF1A 5IOWA 2PWJA 2AJQB 1XWCA 1O7UA 1SKWB 3TKSE 1TI1A 2LNSA 3QAVA 3R2QA 5B7CA 3WD6A 2LJAA 2OBIA 3GH9A 2BMXA 2FWEA 3LJRA 4FYUA 3CBUA 4X0XA 4ZBDA 4TXVA 4KSMA 5D96A 5G2ZA 1RW1A 4DEJA 4IELA 2VCWA 3KH7A 5COHA 1GTIA 3VLNA 2C80A 3A2WA 1GSDA 1CQHA 2REMA 5HFIA 1H4OA 3D6IA 5D73A 1A8LA 3QDNA 2H01A 1FB0A 4EIQA 4ACSA 5B6MA 3FK8A 1K0MA 3FZAA 2B6MA 2R3XA 2X8CA 1TK8B 1YEXA 2OA7A 1ZL9A 1MTCA 2FUG2 4WKWA 4GXZA 5D93A 4MCUA 4K5SA 5ELGA 3NZNA 1W89A 1MD3A 5IPHA 2VUPA 2V1MA 3TCOA 5CRGA 1GSQA 3VPQA 1TU7A 4TVEA 2DLXA 4BPYA 3DD3A 2FHEA 3IA1A 3RPNA 3KP9A 3FY7A 4L5OA 4X1UA 2C3QA 2P5QA 1U87A 1KTEA 4K8MA 3P2AA 1PX6A 3D4MA 2DJ3A 2OACA 4OO4A 4GQCA 5G1LA 2GQKA 3GUSA 4KUNA 5HR1A 1IYIA 2F51A 4Z7XA 3H79A 5ECOB 1M7TA 1O81A 2NTOA 3GH6A 3QCPA 2CV4A 4PTSA 4EC0A 2LTKA 4Q5RA 4KAEA 4PQHA 4ECJA 2N5FA 4OFMA 4G9HA 3LXZA 1S3AA 4K2DA 5B8AA 5IMVA 1THOA 1PN9A 1VF3A 5KN3A 4NPBA 1HNBA 4ZB9A 1AXDA 5H5SA 2QA1A 1F37A 2HRKA 5CREA 4ID0A 2VCQA 4MMMA 3KTBA 1T00A 4F0CA 4Q5FA 2C8UA 2QC7A 2IL3A 1X9MB 1K0DA 4JE1A 4MZBA 4HZ2A 4YQMA 1XPVA 2HRNA 2VCVA 3M8NA 5ECLB 4MLYA 4TRXA 1GTBA 4J2FA 4MH2A 2VAFA 1ZGNA 3FMWA 2LKUA 1GULA 4FIWA 3RDWA 12GSA 2MYGA 3BCIA 1O6JA 4ECIA 1GSEA 4GF0A 3M0FA 1F3AA 1JZWA 3ME8A 2MMOA 2V32A 2JZSA 3UVTA 3KMNA 5A4VA 1HD2A 3SBCA 3GKKA 3HJOA 5FT3A 1M2DA 5J5NA 2H75A 5IMFA 4NV5A 1OAZA 2P0GA 2VCZA 1O85A 4J56E 5CAXA 3A3TA 2NBSA 3F4TA 1TRSA 1VGLA 1USBA 3FR6A 2R0PA 2FWFA 2CZ3A 4QQ7A 3ERGA 2MZCA 1DSBA 2B3SA 2HSMA 2TRCP 2HT9A 5D9WA 4KDYA 6GSUA 1R7HA 5HR2A 3U5RE 3TOTA 2A2SA 2KP2A 4I2UA 1QXHA 3IV4A 3W8JA 4KCEA 1XW5A 4EUYA 1G0TA 1TKDB 5ECSA 4DVCA 3FR3A 4MA9A 1PSQA 3VPTA 4I97A 2IPAA 1VRSD 4PGTA 3TRPA 1PRXA 2RLIA 2O7KA 4KE3A 2WDUA 1OE8A 4I6XA 1TOFA 2GT6A 1LJRA 2R6KA 2FWGA 4O5QA 3LWAA 2TRXA 16GSA 3KM6A 3QMXA 1R4WA 3VWUA 5CP1A 2H73A 5D8IA 4LMWA 1Z6NA 1PL1A 3TRXA 2YWOA 3UAPA 4DSRA 4Z2TA 3DIEA 3GX0A 3IAS2 3O76A 3VWVA 3GSTA 1YKCA 2VD0A 3IBHA 4GWRA 3VI7A 1XXUA 2A2PA 4Z2RA 3GSSA 1DE1A 3DEXA 1X9WB 1XVWA 4HJMA 3MDKA 4GLTA 4EL1A 4Q5QA 6GSYA 3R3EA 3HZ4A 1Z3EA 2YZHA 1XWKA 3WT2A 3DRNA 5KEJA 1G6WA 4XCSA 2VIMA 4OFNA 3LEFA 5EY6A 1QMVA 4MF6A 4MDCA 1GTAA 5EL8A 3TKRA 2IWTA 2FLSA 4OO5A 4MPFA 2C0DA 5IMZA 3E0UA 4MH3A 1E6BA 2K8SA 2GZZA 1GUMA 5IPGA 1FW1A 4JR4A 2D2ZA 2VL3A 1MDKA 1VF2A 5KN2A 3VURA 2R0CA 5AIXA 2R5GA 4MJEA 1YZXA 5ENUA 3HHVA 3QR6A 3IRAA 3QD9A 2TIRA 4OD7A 3AY8A 6GSTA 2YWMA 3F63A 1PA3A 5ABRA 3M9JA 3M1GA 2AV4A 1B4QA 1SL1B 1M9AA 2O87A 5JCUA 1K0BA 3DVWA 4A5PA 2B5XA 2YPMA 4KDXA 2FGXA 2QSIA 5LD0A 1XCCA 2YWNA 3D21A 2B5YA 4L8EA 5B8BA 2CAIA 5DAKB 2AYTA 3BJ5A 4D73B 4RI7A 3ISOA 3KD0A 4O5UA 1GTUA 2YN1A 5G5FA 3KMOA 1K0NA 3QFBC 2H1GA 4MF7A 2JSYA 3ZITA 2GZYA 3HVXA 2OE0A 4TKYA 2DMLA 1NM3A 2P31A 1GUHA 1HNAA 1PKWA 4PQIA 4XS4A 3HA9A 1GLPA 3M9KA 1GNEA 1URMA 2MMZA 3H4KA 2MBSA 3GKMA 3HD5A 2L59A 2C3TA 3DKSA 5IQYA 2VOCA 4G19A 3TKSC 4CDOA 2FWHA 1X9SB 4BWQA 1TRUA 2H1DA 1ZYQB 1A24A 4ECBA 1DE2A 4HEA2 2LJRA 2XPEA 2HLSA 3TKQA 3UBLA 1PGTA 3ZYWA 1EV4A 3TJFA 4BL7B 1SYXA 2KP1A 2K8VA 3RBTA 1OKDA 5DQYA 1Y6EA 3BBYA 2XC2A 3FZ5A 3UVHA 1M2BA 2JADA 1GSFA 2VL9A 2RM5A 3C1SA 4KSOA 2KHPA 5ID2B 1AC1A 3MSZA 4KNDA 2JACA 1TP9A 3EMXA 5BRTA 4QL7A 4ISDA 4KA0A 1SL0B 1XZOA 4HJ2A 1PQNA 4ZL9A 3VI5A 3HJPA 3GTUA 4IBPA 4POLA 1NSWA 2PERA 3KCMA 1AQVA 3ERWA 2J9HA 14GSA 2B1KA 4FO5A 1ON4A 1NW2A 1XWGA 3HVSA 1XW9A 5JWOB 2PN8A 1Q98A 2HNLA 4JU5A 2LNTA 3A2VA 2C0EA 2H6ZA 1AQXA 5CRDA 4AF2A 1TK5B 3GKNA 2V6KA 2VM2A 4ULXA 3TJKA 2H1BA 4PUFC 2ZCTA 4OCFA 2ALBA 3TOUA 4BVYA 2GT5A 3PR8A 5INYA 4NXIA 1IYHA 1M2AA 4TR1A 2B1LA 4OWYA 4EF0A 2BTOT 1NHYA 4F03A 1M0UA 1FG4A 4DSSB 2IMDA 3L9SA 2LQOA 1OC3A 4HI7A 4PX1A 4AJ7A 4TN8A 5EVOA 4XIHA 2G0FA 4FYBA 3TRQA 4K0GA 1S3DA 1B9XC 3CYNA 2WJUA 4WETA 1T4YA 4L0WA 4K6XA 1K3OA 1JZOA 2C4JA 2VCTA 1TW9A 4LL4B 4MP4A 2NPBA 3ZVJA 5H5QA 2KUCA 1PL2A 3FW2A 2HFDA 1EGRA 5CO3A 4ZXGA 1B8XA 4CW9A 3CSIA 4TXOB 2E2MA 1HNCA 4WBJA 1O8WA 2HE3A 2PBJA 1V9WA 4J57E 3P90A 5LCZA 4I8BA 4F2IA 5DALB 2HRFA 3PGTA 2H30A 2DBCA 5DCGA 5ECRB 5E59A 3KEBA 4L0UA 3KXOA 4F82A 5F05A 5IMAA 5HQPA 3IC4A 1XW6A 4MJAA 4F0BA 3TJBA 3GN3A 5HR0A 4NHZA 2IJYA 3WT1A 2CX3A 2CVBA 1BYEA 3Q6OA 2EIOA 3IPZA 2JZRA 4JZQA 4FH8A 2DJ2A 4IN0A 4ZL8A 2X4AA 3FKFA 3ME7A 3F3RA 3ED3A 3A5IA 1A0FA 4OMVA 4V1Ag 2DSAA 5DVBA 2I3YA 5DAKA 3CXGA 1RQMA 4ZBAA 2VLTA 2VLUA 2XPDA 4LA1A 3GA4A 4GSNA 4N0ZA 2X8GA 3IE3A 3ZLPA 1QQ2A 4XRDA 3S9FA 1HQOA 2R2JA 2GTUA 2K9FA 1FO5A 2IFQB 1OC9A 2V41A 3LW9A 2H0HA 3N5OA 4KDUA 1RK4A 2V6OA 4KGIA 2X99A 4EVMA 5JWQB 2VL2C 4X43A 3IC8A 4HOJA 4O92A 2XBQA 3Q18A 2HZEB 3O6TA 2YOIA 6GSWA 4O5RA 4MABA 3FHKA 1GRXA 1O8XA 2XBIA 2CVKA 1X5CA 4PXOA 1YY7A 4GSTA 1R5PA 4PUAA 2WFCA 1BEDA 3DGQA 2WRTA 3IAM2 4TR4A 2IMEA 4BVXA 3CRUA 2B7KA 5JCGA 3TB2A 1K0CA 2ZUPA 4ML1A 2XHFA 1JLWA 3L0HA 3G7IA 5L71A 3P7XA 2H66A 4TOPA 3ZREA 4WR5A 1YJ6A 1WWJA 4IQ1A 4K7OA 2LRCA 1SL2B 1UVZA 4CY6A 3E3EA 3ZL5A 3RHCA 2GQLA 4HUAA 5DJLA 5A4UA 1SD8A 1WMJA 1OKTA 1AIUA 1X0RA 1R26A 2JSZA 1ZZYA 1EEMA 4LMVA 2FY6A 2MMAA 1ERTA 3ZMKA 2H70A 1YDKA 2YJHA 1Y25A 1SENA 2L4CA 5F07A 4WXTA 18GSA 4ZBBA 2A4HA 4N11A 1EEJA 2FA4A 1GNWA 1TTZA 5E4WA 2OKAA 2F9SA 1THXA 2JZTA 4IP6A 2HSHA 5FHIA 5ELAA 1B9YC 2B7JA 4POMA 5G30A 10GSA 2H8LA 1GH2A 1TDIA 2I4AA 4K5RA 2IIYA 17GSA 1S3CA 4GQFA 4TR0A 2WCIA 1EGOA 1PMTA 1SJIA 2Z9SA 3APQA 1G6YA 3MIXA 4KCAA 1AUCA 2HXKA 2OE3A 13GSA 4XS1A 1EP8A 1XFLA 4MJCA 3TKSA 2H76A 4YAVA 3WGXA 2LS5A 4V2MA 1QK8A 4RI6A 3F8UA 4MZCA 4WF5A 3KGKA 4HU9A 5BMUA 2LRTA 3L4NA 1EZKA 2VO4A 11GSA 5HFKA 3FR9A 2PVQA 2H0GA 3IHQA 3IK9A 1LU4A 4XTSA 1X5EA 3KTLA 3HKRA 1DUGA 5J9CA 3LFLA 4KW6A 2GSSA 3EU4A 2L6DA 2KOKA 5AN1A 1YF0A 2CZ2A 4HU7A 1XOAA 8GSSA 1JZRA 2YZUA 4OCEA 1SU9A 1ML6A 5J4UA 4EDZA 5IM9A 2M80A 3SWLA 4IW9A 4K1FA 1WPIA 4NWYA 1UC7A 1BAYA 2L5OA 4IJIA 3TUEA 5GZZB 5EPFA 2DJ1A 1WP0A 5H5RA 5D9TA 2PU9C 5GSSA 1FHEA 2I1UA 2JU5A 2HRAA 3F4SA 4ZB6A 1QFNA 2RUEA 2C0GA 4LLRA 1ERVA 3I43A 5DCHA 3WGDA 2IMIA 5FWGA 1OYJA 5D9VA 2K18A 3ZRDA 4AJ6A 2DJKA 2VCXA 1I5GA 2YWIA 2GQMA 1ZMAA 19GSA 2AHEA 5J41A 1T4ZA 4K2XA 2IFQA 1A8YA 1GL8A 2FCHA 3IR4A 2GZPA 1Z6MA 2H19A 3GRXA 1SK2A 1BQ7A 2FA8A 3EVIA 3EINA 1B48A 1U3IA 5IIZA 1WRYA 5IMDA 4ZILA 3GNJA 2H0IA 4ZIJA 3D5JA 3IOSA 2GSQA 3EU3A 4YQVA 5HR3A 1Z7RA 4ECCA 1UA5A 4KB3A 3E9JB 1T1VA 3EMPA 3WYWA 2LJKA 4WEYA 3HVVA 3ZMLA 5KOXA 5F8BA 3ZTLA 3C7MA 1AAZA 1SD9A 4XRAA 2DIYA 3EC3A 5DJMA 3ZFBA 4I5QA 3UEMA 1N8JA 4IKHA 1OE7A 4FYCA 4JRRA 2H71A 1SKRB 1GUKA 4BA7A 1ZYEA 3NOFA 4YAPA 4POKA 4OFTA 1JZDA 2N5BA 2O85A 2GDRA 3QAGA 4YQUA 3C8EA 4JR6A 1XBSA 3BCKA 2AAWA 4K7NA 2K6VA 3KJYA 1O73A 1KBNA 3CSHA 2OJLA 3P8WA 3APOA 2GS3A 3GV1A 5GSTA 3V1WA 1ZCPA 2DJ0A 4GTUA 5KN1A 2YV9A 1R5AA 4ZB8A 3HXSA 3FRCA 2MMNA 2WZ9A 1GSUA 3ZFLA 2HSYA 1Q4JA 1T7PB 1GP1A 2RIIA 3GYKA 3VWWA 2RM6A 2AUVA 2LUSA 1WE0A 5KN0A 3I9V2 2FNOA 2MBTA 1G7OA 5F06A 3LQ7A 3H93A 1FVJA 3D22A 3DYRA 5JCWA 1YKAA 1EV9A 2YJ7A 4LL1B 1MDJA 4Q5NA 5GAPD 4IGJA 3GMFA 3F3QA 2J23A 3PPUA 2C1YA 3FYGA 1U3AA 2VL2A 3NIVA 2DJJA 4NMUA 3C71A 1WIKA 2DMMA 4EDYA 1M9BA 4AGSA 1GSSA 4Z2UA 2L5LA 1W4VA 1PX7A 1K3LA 4XS6A 1ST9A 2R37A 5IO2A 4IQAA 4HQZA 2DIZA 1GWCA 1X5DA 2C0FA 3ERFA 1EOHA 2OBKA 4USSA 3IK7A 2DC5A 2I81A 2YNXA 3F0IA 2HYXA 5DQSA 3UARA 4WR4A 3HCZA 3Q74A 3ZZXA 4IP1A 2I9HA 1AQWA 2HZFA 1B4PA 5GAND 3ZIJA 1GSYA 5DDLA 1TU8A 3CSJA 3G7JA 4IHUA 1XVQA 1SJ6A 1MD4A 1FOVA 3W6GA 3DWVA 2VLVA 2LRNA 3GL5A 2L4QA 2F8AA 2A2RA 2B5EA 5ECNB 1TRVA 1TJDA 1F3BA 4ILFA 3MNGA 2H6XA 1A2MA 1M99A 1SKSB 6GSVA 5KOWA 2LV3A 4GRFA 2X8HA 1ERWA 3FZ4A 1V2AA 1I9DA 3GX8A 2LEGA 2YP6A 1NHOA 1KNGA 4D73A 2BJXA 4G0KA 1BX9A 2PPTA 4N0VA 3N9JA 1F9MA 1V57A 3LSZA 3LORA 1FB6A 4XS4B 3M3MA 1WOUA 4HDEA 1JFUA 3GL3A 3GKXA 3MWHA 2F3MA 2H74A 2KLXA 4CHSA 2L6CA 2ZNMA 3D0ZA 3QOUA 1GLQA 4E8EA 4DSQA 2X49A 4QL9A 5DBQA 2VD1A 5ECHB 5ECIB 4MJBA 2WULA 3RAZA 1G7EA 1ZYNA 4EIPA 1WJKA 3EURA 1SK0A 5A4WA 2YV7A 1Z7PA 2H6YA 4K9ZA 5IOXA 1FOHA 3MYDA 1EP7A 3TKPA 3FZ9A 1ZYPA 2OADA 6GSSA 5D9XA 4BL7A 4O7HA 4V2LA 3KH9A 1SYRA 3FEUA 4YKGA 1K0AA 3PH9A 4KH7A 2IN3A 2GSRA 3BOAA 4KF9A 3GHAA 2PMTA 4G2EA 1C72A 5ID2A 2YCDA 4TW5A 3UIWA 4RQXA 3L9UA 1QUWA 1PKZA 22GSA 2IMKA 3GTUB 4V1Ap 4EXJA 1Z5YE 3L78A 3LYKA 2FD3A 4GSSA 1F6MC 5A5KA 4WBRD 2LQQA 3W8SA 1U88A 4FQUA 1V58A 3BD2A 5G1KA 1JLVA 4N30A 2EC4A 3C1RA 5B6NA 4YKFA 4BWSA 4KX4A 2LSTA 5IMCA 1TRWA 1YQ1A 4RQRA 2GLRA 3PINA 4NHWA 4O32A 6GSXA 4PNGA 3F9UA 3A2XA 4AJ8A 3US3A 4G10A 1BG5A 3UBKA 2X64A 4BVYB 2EIQA 2ES7A 3UL3A 3J7Yb 3I69A 1OVNA 3C73A 1HYUA 4TR1B 3ZIVA 3L9VA 2G2QA 2ON7A 3H8QA 5ECQB 2RUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YAN A;  2GST A;  1V40 A;  3LG6 A;  1SK1 A;  4PNF A;  4EE0 A;  1E2Y A;  2E0Q A;  4N10 A;  4DSS A;  5AIS A;  3G7Y A;  3F6F A;  3H1N A;  4XHM A;  2WGR A;  3WGE A;  2PGT A;  4EKZ A;  3O3T A;  3VFI A;  1TI3 A;  3EYT A;  3RPP A;  5F0G A;  3HZ8 A;  4E8H A;  1T8E B;  3HYP A;  4NAX A;  5C04 A;  1BJX A;  1K0O A;  3F6D A;  1TXX A;  2M72 A;  3IXR A;  4PQ1 A;  3TJG A;  1A2L A;  3UOM A;  3I6A A;  5C00 A;  1U6T A;  3KZQ A;  4TR3 A;  1XWA A;  2C3N A;  4IJ3 A;  4WF4 A;  2HI7 A;  5HFG A;  3GIX A;  3HY2 A;  1FVK A;  2E2G A;  2P5R A;  4TXO A;  1XWB A;  3HDC A;  1A2J A;  2EIR A;  2NDO A;  2N5A A;  4IS0 A;  5DAL A;  3QFA C;  5ECM B;  1MDI A;  4MF5 A;  4POB A;  2PVO C;  3OR5 A;  5CRH A;  3MAK A;  1SJZ A;  2L57 A;  1OC8 A;  4EO3 A;  5G5E A;  1ILO A;  1XIY A;  4I2T A;  3K8N A;  1A23 A;  5IO0 A;  3TJJ A;  2M46 A;  3QPM A;  2CVD A;  1H75 A;  1N2A A;  3Q19 A;  3EE2 A;  2O8V B;  3CMI A;  2H1A A;  1ZOF A;  3LGC A;  4JED A;  1EWX A;  4K0N A;  20GS A;  1ERU A;  2GVP A;  1Z9H A;  7GSS A;  2CA8 A;  3JCM L;  5J3R A;  3CRT A;  4RUV A;  4V2N A;  5CRW A;  1LBK A;  5CYY A;  5G31 A;  3RHB A;  1CQG A;  5ECK B;  1XOB A;  5CNW A;  1OC9 B;  1FAA A;  3F4R A;  2A4V A;  1PD2 1;  4HS1 A;  4K7I A;  1QGV A;  4NV2 A;  3EWL A;  3TGZ A;  3KP8 A;  4GCI A;  1J9B A;  4HZ4 A;  3UMA A;  3D4T A;  1YEP A;  4F9Z A;  4MK3 A;  3G9B A;  3GUR A;  2HZE A;  3APS A;  4ML6 A;  1MEK A;  4HQS A;  5J9B A;  3UJ1 A;  1ABA A;  2JL4 A;  4JBB A;  5AIV A;  5LNK e;  4H86 A;  5ECP B;  1YF1 A;  3LYP A;  1ACV A;  2VM1 A;  3DVX A;  2QGV A;  2OE1 A;  3QAW A;  1EOG A;  2F8F A;  1VF4 A;  3LXT A;  3HJM A;  1TK0 B;  5AGY A;  2R4V A;  9GSS A;  1DBY A;  3VK9 A;  3TDG A;  3VWX A;  3ZVJ D;  2QKE A;  2WS2 A;  2GGT A;  4P3Y B;  2CAQ A;  1JHB A;  5JWR B;  4YH2 A;  2NVL A;  2E7P A;  1UN2 A;  4L5L A;  2H72 A;  1K3Y A;  3U6V A;  4MPG A;  3A5W A;  4IVF A;  2V2G A;  3CTF A;  1T3B A;  3KIJ A;  2IMF A;  2ON5 A;  4MZW A;  2WB9 A;  1F2E A;  2O89 A;  1V98 A;  1J08 A;  3DXB A;  1J0F A;  2PUK C;  3DML A;  1KEB A;  2CT6 A;  2CQ9 A;  2CX4 A;  3J7Y k;  3IDV A;  3CTG A;  1AW9 A;  4PUR A;  3GFK A;  2AB6 A;  4ZL7 A;  1A0R P;  1VF1 A;  5IOW A;  2PWJ A;  2AJQ B;  1XWC A;  1O7U A;  1SKW B;  3TKS E;  1TI1 A;  2LNS A;  3QAV A;  3R2Q A;  5B7C A;  3WD6 A;  2LJA A;  2OBI A;  3GH9 A;  2BMX A;  2FWE A;  3LJR A;  4FYU A;  3CBU A;  4X0X A;  4ZBD A;  4TXV A;  4KSM A;  5D96 A;  5G2Z A;  1RW1 A;  4DEJ A;  4IEL A;  2VCW A;  3KH7 A;  5COH A;  1GTI A;  3VLN A;  2C80 A;  3A2W A;  1GSD A;  1CQH A;  2REM A;  5HFI A;  1H4O A;  3D6I A;  5D73 A;  1A8L A;  3QDN A;  2H01 A;  1FB0 A;  4ACS A;  5B6M A;  3FK8 A;  1K0M A;  3FZA A;  2B6M A;  2R3X A;  2X8C A;  1TK8 B;  1YEX A;  2OA7 A;  1ZL9 A;  1MTC A;  2FUG 2;  4WKW A;  4GXZ A;  5D93 A;  4MCU A;  5ELG A;  3NZN A;  1W89 A;  1MD3 A;  5IPH A;  2VUP A;  2V1M A;  3TCO A;  5CRG A;  1GSQ A;  3VPQ A;  1TU7 A;  4TVE A;  2DLX A;  4BPY A;  3DD3 A;  2FHE A;  3IA1 A;  3RPN A;  3KP9 A;  3FY7 A;  4L5O A;  4X1U A;  2C3Q A;  2P5Q A;  1U87 A;  1KTE A;  4K8M A;  3P2A A;  1PX6 A;  3D4M A;  2DJ3 A;  2OAC A;  4OO4 A;  4GQC A;  5G1L A;  2GQK A;  3GUS A;  4KUN A;  5HR1 A;  1IYI A;  2F51 A;  4Z7X A;  3H79 A;  5ECO B;  1M7T A;  1O81 A;  2NTO A;  3GH6 A;  3QCP A;  2CV4 A;  4EC0 A;  2LTK A;  4Q5R A;  4KAE A;  4PQH A;  4ECJ A;  2N5F A;  4OFM A;  4G9H A;  3LXZ A;  1S3A A;  4K2D A;  5B8A A;  5IMV A;  1THO A;  1PN9 A;  1VF3 A;  5KN3 A;  4NPB A;  1HNB A;  4ZB9 A;  1AXD A;  5H5S A;  1F37 A;  5CRE A;  4ID0 A;  2VCQ A;  4MMM A;  3KTB A;  1T00 A;  4F0C A;  4Q5F A;  2C8U A;  2QC7 A;  2IL3 A;  1X9M B;  1K0D A;  4JE1 A;  4MZB A;  4HZ2 A;  4YQM A;  1XPV A;  2HRN A;  2VCV A;  3M8N A;  5ECL B;  4MLY A;  4TRX A;  1GTB A;  4J2F A;  4MH2 A;  2VAF A;  1ZGN A;  2LKU A;  1GUL A;  4FIW A;  3RDW A;  12GS A;  2MYG A;  3BCI A;  1O6J A;  4ECI A;  1GSE A;  4GF0 A;  3M0F A;  1F3A A;  1JZW A;  3ME8 A;  2MMO A;  2V32 A;  2JZS A;  3UVT A;  3KMN A;  5A4V A;  1HD2 A;  3SBC A;  3GKK A;  3HJO A;  5FT3 A;  1M2D A;  5J5N A;  2H75 A;  5IMF A;  4NV5 A;  1OAZ A;  2P0G A;  2VCZ A;  1O85 A;  4J56 E;  5CAX A;  3A3T A;  2NBS A;  3F4T A;  1TRS A;  1VGL A;  1USB A;  3FR6 A;  2FWF A;  2CZ3 A;  4QQ7 A;  3ERG A;  2MZC A;  1DSB A;  2B3S A;  2TRC P;  2HT9 A;  5D9W A;  4KDY A;  6GSU A;  1R7H A;  5HR2 A;  3U5R E;  3TOT A;  2A2S A;  2KP2 A;  4I2U A;  1QXH A;  3IV4 A;  3W8J A;  4KCE A;  1XW5 A;  4EUY A;  1G0T A;  1TKD B;  5ECS A;  4DVC A;  3FR3 A;  4MA9 A;  1PSQ A;  3VPT A;  4I97 A;  2IPA A;  1VRS D;  4PGT A;  3TRP A;  1PRX A;  2RLI A;  2O7K A;  4KE3 A;  2WDU A;  1OE8 A;  4I6X A;  1TOF A;  2GT6 A;  1LJR A;  2R6K A;  2FWG A;  3LWA A;  2TRX A;  16GS A;  3KM6 A;  3QMX A;  1R4W A;  3VWU A;  5CP1 A;  2H73 A;  5D8I A;  4LMW A;  1Z6N A;  1PL1 A;  3TRX A;  2YWO A;  3UAP A;  4DSR A;  3DIE A;  3GX0 A;  3IAS 2;  3O76 A;  3VWV A;  3GST A;  1YKC A;  2VD0 A;  3IBH A;  4GWR A;  3VI7 A;  1XXU A;  3GSS A;  1DE1 A;  3DEX A;  1X9W B;  1XVW A;  4HJM A;  3MDK A;  4GLT A;  4EL1 A;  4Q5Q A;  6GSY A;  3HZ4 A;  1Z3E A;  2YZH A;  1XWK A;  3WT2 A;  3DRN A;  5KEJ A;  1G6W A;  4XCS A;  2VIM A;  4OFN A;  3LEF A;  5EY6 A;  1QMV A;  4MF6 A;  4MDC A;  1GTA A;  5EL8 A;  3TKR A;  2IWT A;  2FLS A;  4OO5 A;  4MPF A;  2C0D A;  5IMZ A;  3E0U A;  4MH3 A;  1E6B A;  2K8S A;  2GZZ A;  1GUM A;  5IPG A;  1FW1 A;  4JR4 A;  2D2Z A;  2VL3 A;  1MDK A;  1VF2 A;  5KN2 A;  3VUR A;  5AIX A;  2R5G A;  4MJE A;  1YZX A;  5ENU A;  3HHV A;  3QR6 A;  3IRA A;  3QD9 A;  2TIR A;  4OD7 A;  3AY8 A;  6GST A;  2YWM A;  3F63 A;  1PA3 A;  5ABR A;  3M9J A;  3M1G A;  2AV4 A;  1B4Q A;  1SL1 B;  1M9A A;  2O87 A;  5JCU A;  1K0B A;  3DVW A;  2B5X A;  2YPM A;  4KDX A;  2FGX A;  2QSI A;  5LD0 A;  1XCC A;  2YWN A;  3D21 A;  2B5Y A;  4L8E A;  5B8B A;  2CAI A;  5DAK B;  2AYT A;  3BJ5 A;  4D73 B;  4RI7 A;  3ISO A;  3KD0 A;  1GTU A;  2YN1 A;  5G5F A;  3KMO A;  1K0N A;  3QFB C;  2H1G A;  4MF7 A;  2JSY A;  3ZIT A;  2GZY A;  3HVX A;  2OE0 A;  4TKY A;  2DML A;  1NM3 A;  2P31 A;  1GUH A;  1HNA A;  1PKW A;  4PQI A;  4XS4 A;  3HA9 A;  1GLP A;  3M9K A;  1GNE A;  1URM A;  2MMZ A;  3H4K A;  2MBS A;  3GKM A;  3HD5 A;  2L59 A;  2C3T A;  3DKS A;  5IQY A;  2VOC A;  4G19 A;  3TKS C;  4CDO A;  2FWH A;  1X9S B;  4BWQ A;  1TRU A;  2H1D A;  1ZYQ B;  1A24 A;  4ECB A;  1DE2 A;  4HEA 2;  2LJR A;  2XPE A;  2HLS A;  3TKQ A;  3UBL A;  1PGT A;  3ZYW A;  1EV4 A;  3TJF A;  1SYX A;  2KP1 A;  2K8V A;  3RBT A;  1OKD A;  5DQY A;  1Y6E A;  3BBY A;  2XC2 A;  3FZ5 A;  3UVH A;  1M2B A;  2JAD A;  1GSF A;  2VL9 A;  2RM5 A;  3C1S A;  4KSO A;  2KHP A;  5ID2 B;  1AC1 A;  3MSZ A;  4KND A;  2JAC A;  1TP9 A;  3EMX A;  4QL7 A;  4ISD A;  4KA0 A;  1SL0 B;  1XZO A;  4HJ2 A;  1PQN A;  4ZL9 A;  3VI5 A;  3HJP A;  3GTU A;  4IBP A;  4POL A;  1NSW A;  2PER A;  3KCM A;  1AQV A;  3ERW A;  2J9H A;  14GS A;  2B1K A;  4FO5 A;  1ON4 A;  1NW2 A;  1XWG A;  3HVS A;  1XW9 A;  5JWO B;  2PN8 A;  1Q98 A;  2HNL A;  4JU5 A;  2LNT A;  3A2V A;  2C0E A;  2H6Z A;  1AQX A;  5CRD A;  4AF2 A;  1TK5 B;  3GKN A;  2V6K A;  2VM2 A;  4ULX A;  3TJK A;  2H1B A;  4PUF C;  2ZCT A;  4OCF A;  2ALB A;  3TOU A;  4BVY A;  2GT5 A;  3PR8 A;  5INY A;  4NXI A;  1IYH A;  1M2A A;  4TR1 A;  2B1L A;  4OWY A;  4EF0 A;  2BTO T;  1NHY A;  4F03 A;  1M0U A;  1FG4 A;  4DSS B;  2IMD A;  3L9S A;  2LQO A;  1OC3 A;  4HI7 A;  4PX1 A;  4AJ7 A;  4TN8 A;  5EVO A;  4XIH A;  2G0F A;  4FYB A;  3TRQ A;  4K0G A;  1S3D A;  1B9X C;  3CYN A;  2WJU A;  4WET A;  1T4Y A;  4L0W A;  4K6X A;  1K3O A;  1JZO A;  2C4J A;  2VCT A;  1TW9 A;  4LL4 B;  4MP4 A;  2NPB A;  3ZVJ A;  5H5Q A;  2KUC A;  1PL2 A;  3FW2 A;  2HFD A;  1EGR A;  5CO3 A;  4ZXG A;  1B8X A;  4CW9 A;  3CSI A;  4TXO B;  2E2M A;  1HNC A;  4WBJ A;  1O8W A;  2HE3 A;  2PBJ A;  1V9W A;  4J57 E;  3P90 A;  5LCZ A;  4I8B A;  4F2I A;  5DAL B;  2HRF A;  3PGT A;  2H30 A;  2DBC A;  5DCG A;  5ECR B;  5E59 A;  3KEB A;  4L0U A;  3KXO A;  4F82 A;  5F05 A;  5IMA A;  5HQP A;  3IC4 A;  1XW6 A;  4MJA A;  4F0B A;  3TJB A;  3GN3 A;  5HR0 A;  4NHZ A;  2IJY A;  3WT1 A;  2CX3 A;  2CVB A;  1BYE A;  3Q6O A;  2EIO A;  3IPZ A;  2JZR A;  4JZQ A;  4FH8 A;  2DJ2 A;  4IN0 A;  4ZL8 A;  3FKF A;  3ME7 A;  3F3R A;  3ED3 A;  1A0F A;  4OMV A;  4V1A g;  2DSA A;  5DVB A;  2I3Y A;  5DAK A;  3CXG A;  1RQM A;  4ZBA A;  2VLT A;  2VLU A;  2XPD A;  4LA1 A;  3GA4 A;  4GSN A;  4N0Z A;  2X8G A;  3IE3 A;  3ZLP A;  1QQ2 A;  4XRD A;  3S9F A;  1HQO A;  2R2J A;  2GTU A;  2K9F A;  1FO5 A;  2IFQ B;  1OC9 A;  2V41 A;  2H0H A;  3N5O A;  4KDU A;  1RK4 A;  2V6O A;  4KGI A;  2X99 A;  4EVM A;  5JWQ B;  2VL2 C;  4X43 A;  4HOJ A;  4O92 A;  2XBQ A;  3Q18 A;  2HZE B;  3O6T A;  2YOI A;  6GSW A;  4O5R A;  4MAB A;  3FHK A;  1GRX A;  1O8X A;  2XBI A;  2CVK A;  1X5C A;  4PXO A;  1YY7 A;  4GST A;  1R5P A;  4PUA A;  2WFC A;  1BED A;  3DGQ A;  2WRT A;  3IAM 2;  4TR4 A;  2IME A;  4BVX A;  3CRU A;  2B7K A;  5JCG A;  3TB2 A;  1K0C A;  2ZUP A;  4ML1 A;  2XHF A;  1JLW A;  3L0H A;  3G7I A;  5L71 A;  3P7X A;  2H66 A;  4TOP A;  3ZRE A;  4WR5 A;  1YJ6 A;  1WWJ A;  4IQ1 A;  4K7O A;  2LRC A;  1SL2 B;  1UVZ A;  3E3E A;  3ZL5 A;  3RHC A;  2GQL A;  4HUA A;  5DJL A;  5A4U A;  1SD8 A;  1WMJ A;  1OKT A;  1AIU A;  1X0R A;  1R26 A;  2JSZ A;  1ZZY A;  1EEM A;  4LMV A;  2FY6 A;  2MMA A;  1ERT A;  3ZMK A;  2H70 A;  1YDK A;  2YJH A;  1Y25 A;  1SEN A;  2L4C A;  5F07 A;  4WXT A;  18GS A;  4ZBB A;  4N11 A;  1EEJ A;  2FA4 A;  1GNW A;  1TTZ A;  5E4W A;  2OKA A;  2F9S A;  1THX A;  2JZT A;  4IP6 A;  2HSH A;  5FHI A;  5ELA A;  1B9Y C;  2B7J A;  4POM A;  5G30 A;  10GS A;  2H8L A;  1GH2 A;  1TDI A;  2I4A A;  2IIY A;  17GS A;  1S3C A;  4GQF A;  4TR0 A;  2WCI A;  1EGO A;  1PMT A;  1SJI A;  2Z9S A;  3APQ A;  1G6Y A;  4KCA A;  1AUC A;  2HXK A;  2OE3 A;  13GS A;  4XS1 A;  1EP8 A;  1XFL A;  4MJC A;  3TKS A;  2H76 A;  4YAV A;  3WGX A;  2LS5 A;  4V2M A;  1QK8 A;  4RI6 A;  3F8U A;  4MZC A;  4WF5 A;  3KGK A;  4HU9 A;  2LRT A;  3L4N A;  1EZK A;  2VO4 A;  11GS A;  5HFK A;  3FR9 A;  2PVQ A;  2H0G A;  3IHQ A;  3IK9 A;  1LU4 A;  4XTS A;  1X5E A;  3KTL A;  3HKR A;  1DUG A;  5J9C A;  3LFL A;  4KW6 A;  2GSS A;  3EU4 A;  2L6D A;  2KOK A;  5AN1 A;  1YF0 A;  2CZ2 A;  4HU7 A;  1XOA A;  8GSS A;  1JZR A;  2YZU A;  4OCE A;  1SU9 A;  1ML6 A;  5J4U A;  4EDZ A;  5IM9 A;  2M80 A;  3SWL A;  4IW9 A;  4K1F A;  1WPI A;  4NWY A;  1UC7 A;  1BAY A;  2L5O A;  4IJI A;  3TUE A;  5GZZ B;  5EPF A;  2DJ1 A;  1WP0 A;  5H5R A;  5D9T A;  2PU9 C;  5GSS A;  1FHE A;  2I1U A;  2JU5 A;  3F4S A;  4ZB6 A;  1QFN A;  2RUE A;  2C0G A;  4LLR A;  1ERV A;  3I43 A;  5DCH A;  3WGD A;  2IMI A;  5FWG A;  1OYJ A;  5D9V A;  2K18 A;  3ZRD A;  4AJ6 A;  2DJK A;  2VCX A;  1I5G A;  2YWI A;  2GQM A;  1ZMA A;  19GS A;  2AHE A;  5J41 A;  1T4Z A;  2IFQ A;  1A8Y A;  1GL8 A;  2FCH A;  3IR4 A;  2GZP A;  1Z6M A;  2H19 A;  3GRX A;  1SK2 A;  1BQ7 A;  2FA8 A;  3EVI A;  3EIN A;  1B48 A;  1U3I A;  5IIZ A;  1WRY A;  5IMD A;  4ZIL A;  3GNJ A;  2H0I A;  4ZIJ A;  3D5J A;  3IOS A;  2GSQ A;  3EU3 A;  4YQV A;  5HR3 A;  1Z7R A;  4ECC A;  1UA5 A;  4KB3 A;  3E9J B;  1T1V A;  3EMP A;  3WYW A;  2LJK A;  4WEY A;  3HVV A;  3ZML A;  5F8B A;  3ZTL A;  3C7M A;  1AAZ A;  1SD9 A;  4XRA A;  2DIY A;  3EC3 A;  5DJM A;  3ZFB A;  4I5Q A;  3UEM A;  1N8J A;  4IKH A;  1OE7 A;  4FYC A;  4JRR A;  2H71 A;  1SKR B;  1GUK A;  4BA7 A;  1ZYE A;  3NOF A;  4YAP A;  4POK A;  4OFT A;  1JZD A;  2N5B A;  2O85 A;  2GDR A;  3QAG A;  4YQU A;  3C8E A;  4JR6 A;  1XBS A;  3BCK A;  2AAW A;  4K7N A;  2K6V A;  3KJY A;  1O73 A;  1KBN A;  3CSH A;  2OJL A;  3P8W A;  3APO A;  2GS3 A;  3GV1 A;  5GST A;  3V1W A;  1ZCP A;  2DJ0 A;  4GTU A;  5KN1 A;  2YV9 A;  1R5A A;  4ZB8 A;  3HXS A;  3FRC A;  2MMN A;  2WZ9 A;  1GSU A;  3ZFL A;  2HSY A;  1Q4J A;  1T7P B;  1GP1 A;  2RII A;  3GYK A;  3VWW A;  2RM6 A;  2AUV A;  2LUS A;  1WE0 A;  5KN0 A;  3I9V 2;  2FNO A;  2MBT A;  1G7O A;  5F06 A;  3LQ7 A;  3H93 A;  1FVJ A;  3D22 A;  3DYR A;  5JCW A;  1YKA A;  1EV9 A;  2YJ7 A;  4LL1 B;  1MDJ A;  4Q5N A;  5GAP D;  4IGJ A;  3GMF A;  3F3Q A;  2J23 A;  2C1Y A;  3FYG A;  1U3A A;  2VL2 A;  3NIV A;  2DJJ A;  4NMU A;  3C71 A;  1WIK A;  2DMM A;  4EDY A;  1M9B A;  4AGS A;  1GSS A;  2L5L A;  1W4V A;  1PX7 A;  1K3L A;  4XS6 A;  1ST9 A;  2R37 A;  5IO2 A;  4IQA A;  4HQZ A;  2DIZ A;  1GWC A;  1X5D A;  2C0F A;  3ERF A;  1EOH A;  2OBK A;  3IK7 A;  2DC5 A;  2I81 A;  2YNX A;  3F0I A;  2HYX A;  5DQS A;  3UAR A;  4WR4 A;  3HCZ A;  3Q74 A;  3ZZX A;  4IP1 A;  2I9H A;  1AQW A;  2HZF A;  1B4P A;  5GAN D;  3ZIJ A;  1GSY A;  5DDL A;  1TU8 A;  3CSJ A;  3G7J A;  4IHU A;  1XVQ A;  1SJ6 A;  1MD4 A;  1FOV A;  3W6G A;  3DWV A;  2VLV A;  2LRN A;  3GL5 A;  2L4Q A;  2F8A A;  2A2R A;  2B5E A;  5ECN B;  1TRV A;  1TJD A;  1F3B A;  4ILF A;  3MNG A;  2H6X A;  1A2M A;  1M99 A;  1SKS B;  6GSV A;  2LV3 A;  4GRF A;  2X8H A;  1ERW A;  3FZ4 A;  1V2A A;  1I9D A;  3GX8 A;  2LEG A;  2YP6 A;  1NHO A;  1KNG A;  4D73 A;  2BJX A;  1BX9 A;  2PPT A;  4N0V A;  3N9J A;  1F9M A;  1V57 A;  3LSZ A;  3LOR A;  1FB6 A;  4XS4 B;  3M3M A;  1WOU A;  4HDE A;  1JFU A;  3GL3 A;  3GKX A;  3MWH A;  2F3M A;  2H74 A;  2KLX A;  4CHS A;  2L6C A;  2ZNM A;  3D0Z A;  3QOU A;  1GLQ A;  4E8E A;  4DSQ A;  4QL9 A;  5DBQ A;  2VD1 A;  5ECH B;  5ECI B;  4MJB A;  2WUL A;  3RAZ A;  1G7E A;  1WJK A;  3EUR A;  1SK0 A;  5A4W A;  2YV7 A;  1Z7P A;  2H6Y A;  4K9Z A;  5IOX A;  1EP7 A;  3TKP A;  3FZ9 A;  6GSS A;  2OAD A;  5D9X A;  4BL7 A;  4O7H A;  4V2L A;  3KH9 A;  1SYR A;  3FEU A;  1K0A A;  3PH9 A;  4KH7 A;  2IN3 A;  2GSR A;  3BOA A;  3GHA A;  2PMT A;  4G2E A;  1C72 A;  5ID2 A;  2YCD A;  4TW5 A;  3UIW A;  4RQX A;  3L9U A;  1QUW A;  1PKZ A;  22GS A;  2IMK A;  3GTU B;  4V1A p;  4EXJ A;  1Z5Y E;  3L78 A;  3LYK A;  2FD3 A;  4GSS A;  1F6M C;  5A5K A;  4WBR D;  2LQQ A;  3W8S A;  1U88 A;  1V58 A;  3BD2 A;  5G1K A;  1JLV A;  4N30 A;  2EC4 A;  3C1R A;  5B6N A;  4BWS A;  4KX4 A;  2LST A;  5IMC A;  1TRW A;  1YQ1 A;  4RQR A;  2GLR A;  3PIN A;  4NHW A;  4O32 A;  6GSX A;  4PNG A;  3F9U A;  3A2X A;  4AJ8 A;  3US3 A;  4G10 A;  1BG5 A;  3UBK A;  2X64 A;  3J7Y b;  2EIQ A;  2ES7 A;  3UL3 A;  3I69 A;  1OVN A;  3C73 A;  1HYU A;  4TR1 B;  3ZIV A;  3L9V A;  2G2Q A;  2ON7 A;  3H8Q A;  5ECQ B;  2RUF A; 
#chains in the Genus database with same CATH topology
 2YAN A;  2GST A;  1V40 A;  3LG6 A;  1SK1 A;  4PNF A;  4EE0 A;  1E2Y A;  2DKI A;  2E0Q A;  4N10 A;  4DSS A;  5AIS A;  3G7Y A;  3F6F A;  2R0G A;  3H1N A;  4XHM A;  2WGR A;  3WGE A;  2PGT A;  4EKZ A;  3O3T A;  3VFI A;  1TI3 A;  3EYT A;  3RPP A;  5F0G A;  3HZ8 A;  4E8H A;  1T8E B;  3HYP A;  4NAX A;  5C04 A;  1BJX A;  1K0O A;  3F6D A;  1TXX A;  2M72 A;  3IXR A;  4PQ1 A;  3TJG A;  4BIK A;  1A2L A;  3UOM A;  3I6A A;  5C00 A;  1U6T A;  3KZQ A;  4TR3 A;  1XWA A;  2C3N A;  4IJ3 A;  4WF4 A;  2HI7 A;  5HFG A;  3GIX A;  3HY2 A;  1FVK A;  2E2G A;  2P5R A;  4TXO A;  1XWB A;  3HDC A;  1A2J A;  2DKH A;  2EIR A;  2NDO A;  4G0L A;  2N5A A;  4ICY A;  4IS0 A;  5DAL A;  3QFA C;  5ECM B;  1MDI A;  4MF5 A;  4POB A;  2PVO C;  3OR5 A;  5CRH A;  3MAK A;  1SJZ A;  2L57 A;  1OC8 A;  4EO3 A;  5G5E A;  1ILO A;  1XIY A;  4I2T A;  3K8N A;  1A23 A;  5IO0 A;  3TJJ A;  2M46 A;  3QPM A;  2CVD A;  1H75 A;  1N2A A;  1PN0 A;  3Q19 A;  3EE2 A;  2O8V B;  3CMI A;  2H1A A;  1ZOF A;  3LGC A;  4JED A;  1EWX A;  4K0N A;  20GS A;  1ERU A;  2GVP A;  1Z9H A;  7GSS A;  2CA8 A;  3JCM L;  5J3R A;  3CRT A;  4RUV A;  4V2N A;  5CRW A;  1LBK A;  5CYY A;  5G31 A;  2QA2 A;  3RHB A;  1CQG A;  5ECK B;  1XOB A;  5CNW A;  3EPT A;  1OC9 B;  1FAA A;  3F4R A;  2A4V A;  1PD2 1;  4HS1 A;  4K7I A;  1QGV A;  4NV2 A;  3EWL A;  3TGZ A;  3KP8 A;  4GCI A;  1J9B A;  4HZ4 A;  3UMA A;  4G0I A;  3D4T A;  3IHG A;  1YEP A;  2UZ8 A;  4X4J A;  4F9Z A;  4MK3 A;  3G9B A;  3GUR A;  2HZE A;  3APS A;  4ML6 A;  1MEK A;  4HQS A;  5J9B A;  3UJ1 A;  1ABA A;  2JL4 A;  4JBB A;  5AIV A;  5LNK e;  4H86 A;  5ECP B;  1YF1 A;  3LYP A;  1ACV A;  2VM1 A;  3DVX A;  2QGV A;  2OE1 A;  3QAW A;  1EOG A;  2F8F A;  1VF4 A;  3LXT A;  3HJM A;  1TK0 B;  5AGY A;  2R4V A;  9GSS A;  4MNN A;  1DBY A;  4BVX B;  3VK9 A;  3TDG A;  3VWX A;  3ZVJ D;  2QKE A;  2WS2 A;  2GGT A;  4P3Y B;  2CAQ A;  1JHB A;  5JWR B;  4YH2 A;  2NVL A;  2E7P A;  4CY8 A;  1UN2 A;  4L5L A;  2H72 A;  1K3Y A;  3U6V A;  4MPG A;  3A5W A;  4IVF A;  2V2G A;  3CTF A;  1T3B A;  3KIJ A;  2IMF A;  2ON5 A;  4MZW A;  2WB9 A;  1F2E A;  2O89 A;  1V98 A;  1J08 A;  3DXB A;  1J0F A;  2PUK C;  3DML A;  1KEB A;  2CT6 A;  2CQ9 A;  2CX4 A;  3J7Y k;  3IDV A;  3CTG A;  1AW9 A;  4PUR A;  3GFK A;  2AB6 A;  4ZL7 A;  1A0R P;  1VF1 A;  5IOW A;  2PWJ A;  2AJQ B;  1XWC A;  1O7U A;  1SKW B;  3TKS E;  1TI1 A;  2LNS A;  3QAV A;  3R2Q A;  5B7C A;  3WD6 A;  2LJA A;  2OBI A;  3GH9 A;  2BMX A;  2FWE A;  3LJR A;  4FYU A;  3CBU A;  4X0X A;  4ZBD A;  4TXV A;  4KSM A;  5D96 A;  5G2Z A;  1RW1 A;  4DEJ A;  4IEL A;  2VCW A;  3KH7 A;  5COH A;  1GTI A;  3VLN A;  2C80 A;  3A2W A;  1GSD A;  1CQH A;  2REM A;  5HFI A;  1H4O A;  3D6I A;  5D73 A;  1A8L A;  3QDN A;  2H01 A;  1FB0 A;  4EIQ A;  4ACS A;  5B6M A;  3FK8 A;  1K0M A;  3FZA A;  2B6M A;  2R3X A;  2X8C A;  1TK8 B;  1YEX A;  2OA7 A;  1ZL9 A;  1MTC A;  2FUG 2;  4WKW A;  4GXZ A;  5D93 A;  4MCU A;  4K5S A;  5ELG A;  3NZN A;  1W89 A;  1MD3 A;  5IPH A;  2VUP A;  2V1M A;  3TCO A;  5CRG A;  1GSQ A;  3VPQ A;  1TU7 A;  4TVE A;  2DLX A;  4BPY A;  3DD3 A;  2FHE A;  3IA1 A;  3RPN A;  3KP9 A;  3FY7 A;  4L5O A;  4X1U A;  2C3Q A;  2P5Q A;  1U87 A;  1KTE A;  4K8M A;  3P2A A;  1PX6 A;  3D4M A;  2DJ3 A;  2OAC A;  4OO4 A;  4GQC A;  5G1L A;  2GQK A;  3GUS A;  4KUN A;  5HR1 A;  1IYI A;  2F51 A;  4Z7X A;  3H79 A;  5ECO B;  1M7T A;  1O81 A;  2NTO A;  3GH6 A;  3QCP A;  2CV4 A;  4PTS A;  4EC0 A;  2LTK A;  4Q5R A;  4KAE A;  4PQH A;  4ECJ A;  2N5F A;  4OFM A;  4G9H A;  3LXZ A;  1S3A A;  4K2D A;  5B8A A;  5IMV A;  1THO A;  1PN9 A;  1VF3 A;  5KN3 A;  4NPB A;  1HNB A;  4ZB9 A;  1AXD A;  5H5S A;  2QA1 A;  1F37 A;  2HRK A;  5CRE A;  4ID0 A;  2VCQ A;  4MMM A;  3KTB A;  1T00 A;  1S3R A;  4Q5F A;  4F0C A;  2C8U A;  2QC7 A;  2IL3 A;  1X9M B;  1K0D A;  4JE1 A;  4MZB A;  4HZ2 A;  4YQM A;  1XPV A;  2HRN A;  2VCV A;  3M8N A;  5ECL B;  4MLY A;  4TRX A;  1GTB A;  4J2F A;  4MH2 A;  2VAF A;  1ZGN A;  3FMW A;  2LKU A;  1GUL A;  4FIW A;  3RDW A;  12GS A;  2MYG A;  3BCI A;  1O6J A;  4ECI A;  1GSE A;  4GF0 A;  3M0F A;  1F3A A;  1JZW A;  3ME8 A;  2MMO A;  2V32 A;  2JZS A;  3UVT A;  3KMN A;  5A4V A;  1HD2 A;  3SBC A;  3GKK A;  3HJO A;  5FT3 A;  1M2D A;  5J5N A;  2H75 A;  5IMF A;  4NV5 A;  1OAZ A;  2P0G A;  2VCZ A;  1O85 A;  4J56 E;  5CAX A;  3A3T A;  2NBS A;  3F4T A;  1TRS A;  1VGL A;  1USB A;  3FR6 A;  2R0P A;  2FWF A;  2CZ3 A;  4QQ7 A;  3ERG A;  2MZC A;  1DSB A;  2B3S A;  2HSM A;  2TRC P;  2HT9 A;  5D9W A;  4KDY A;  6GSU A;  1R7H A;  5HR2 A;  3U5R E;  3TOT A;  2A2S A;  2KP2 A;  4I2U A;  1QXH A;  3IV4 A;  3W8J A;  4KCE A;  1XW5 A;  4EUY A;  1G0T A;  1TKD B;  5ECS A;  4DVC A;  3FR3 A;  4MA9 A;  1PSQ A;  3VPT A;  4I97 A;  2IPA A;  1VRS D;  4PGT A;  3TRP A;  1PRX A;  2RLI A;  2O7K A;  4KE3 A;  2WDU A;  1OE8 A;  4I6X A;  1TOF A;  2GT6 A;  1LJR A;  2R6K A;  2FWG A;  4O5Q A;  3LWA A;  2TRX A;  16GS A;  3KM6 A;  3QMX A;  1R4W A;  3VWU A;  5CP1 A;  2H73 A;  5D8I A;  4LMW A;  1Z6N A;  1PL1 A;  3TRX A;  3CQF A;  2YWO A;  3UAP A;  4DSR A;  4Z2T A;  3DIE A;  3GX0 A;  3IAS 2;  3O76 A;  3VWV A;  3GST A;  1YKC A;  2VD0 A;  3IBH A;  4GWR A;  3VI7 A;  1XXU A;  2A2P A;  4Z2R A;  3GSS A;  1DE1 A;  3DEX A;  1X9W B;  1XVW A;  4HJM A;  3MDK A;  4GLT A;  4EL1 A;  4Q5Q A;  6GSY A;  3R3E A;  3HZ4 A;  1Z3E A;  2YZH A;  1XWK A;  3WT2 A;  3DRN A;  5KEJ A;  1G6W A;  4XCS A;  2VIM A;  4OFN A;  3LEF A;  5EY6 A;  1QMV A;  4MF6 A;  4MDC A;  1GTA A;  5EL8 A;  3TKR A;  2IWT A;  2FLS A;  4OO5 A;  4MPF A;  2C0D A;  5IMZ A;  3E0U A;  4MH3 A;  1E6B A;  2K8S A;  2GZZ A;  1GUM A;  5IPG A;  1FW1 A;  4JR4 A;  2D2Z A;  2VL3 A;  1MDK A;  1VF2 A;  5KN2 A;  3VUR A;  2R0C A;  5AIX A;  2R5G A;  4MJE A;  1YZX A;  5ENU A;  3HHV A;  3QR6 A;  3IRA A;  3QD9 A;  2TIR A;  4OD7 A;  3AY8 A;  6GST A;  2YWM A;  3F63 A;  1PA3 A;  5ABR A;  3M9J A;  3M1G A;  2AV4 A;  1B4Q A;  1SL1 B;  1M9A A;  2O87 A;  5JCU A;  1K0B A;  3DVW A;  4A5P A;  2B5X A;  2YPM A;  4KDX A;  2FGX A;  2QSI A;  5LD0 A;  1XCC A;  2YWN A;  3D21 A;  2B5Y A;  4L8E A;  5B8B A;  2CAI A;  5DAK B;  2AYT A;  3BJ5 A;  4D73 B;  4RI7 A;  3ISO A;  3KD0 A;  4O5U A;  1GTU A;  2YN1 A;  5G5F A;  3KMO A;  1K0N A;  3QFB C;  2H1G A;  4MF7 A;  2JSY A;  3ZIT A;  2GZY A;  3HVX A;  2OE0 A;  4TKY A;  2DML A;  1NM3 A;  2P31 A;  1GUH A;  1HNA A;  1PKW A;  4PQI A;  4XS4 A;  3HA9 A;  1GLP A;  3M9K A;  1GNE A;  1URM A;  2MMZ A;  3H4K A;  2MBS A;  3GKM A;  3HD5 A;  2L59 A;  2C3T A;  3DKS A;  5IQY A;  2VOC A;  4G19 A;  3TKS C;  4CDO A;  2FWH A;  1X9S B;  4BWQ A;  1TRU A;  2H1D A;  1ZYQ B;  1A24 A;  4ECB A;  1DE2 A;  4HEA 2;  2LJR A;  2XPE A;  2HLS A;  3TKQ A;  3UBL A;  1PGT A;  3ZYW A;  1EV4 A;  3TJF A;  4BL7 B;  1SYX A;  2KP1 A;  2K8V A;  3RBT A;  1OKD A;  5DQY A;  1Y6E A;  3BBY A;  2XC2 A;  3FZ5 A;  3UVH A;  1M2B A;  2JAD A;  1GSF A;  2VL9 A;  2RM5 A;  3C1S A;  4KSO A;  2KHP A;  5ID2 B;  1AC1 A;  3MSZ A;  4KND A;  2JAC A;  1TP9 A;  3EMX A;  5BRT A;  4QL7 A;  4ISD A;  3HVN A;  4KA0 A;  1SL0 B;  1XZO A;  4HJ2 A;  1PQN A;  4ZL9 A;  3VI5 A;  3HJP A;  3GTU A;  4IBP A;  4POL A;  1NSW A;  2PER A;  3KCM A;  1AQV A;  3ERW A;  2J9H A;  14GS A;  2B1K A;  4FO5 A;  1ON4 A;  1NW2 A;  1XWG A;  3HVS A;  1XW9 A;  5JWO B;  2PN8 A;  1Q98 A;  2HNL A;  4JU5 A;  2LNT A;  3A2V A;  2C0E A;  2H6Z A;  1PFO A;  1AQX A;  5CRD A;  4AF2 A;  1TK5 B;  3GKN A;  2V6K A;  2VM2 A;  4ULX A;  3TJK A;  2H1B A;  4PUF C;  2ZCT A;  4OCF A;  2ALB A;  3TOU A;  4BVY A;  2GT5 A;  3PR8 A;  5INY A;  4NXI A;  1IYH A;  1M2A A;  4TR1 A;  2B1L A;  4OWY A;  4EF0 A;  2BTO T;  1NHY A;  4F03 A;  1M0U A;  1FG4 A;  4DSS B;  2IMD A;  3L9S A;  2LQO A;  1OC3 A;  4HI7 A;  4PX1 A;  4AJ7 A;  4TN8 A;  5EVO A;  4XIH A;  2G0F A;  4FYB A;  3TRQ A;  4K0G A;  1S3D A;  1B9X C;  3CYN A;  2WJU A;  4WET A;  1M3I A;  1T4Y A;  4L0W A;  4K6X A;  1K3O A;  1JZO A;  2C4J A;  2VCT A;  1TW9 A;  4LL4 B;  4MP4 A;  2NPB A;  3ZVJ A;  5H5Q A;  2KUC A;  1PL2 A;  3FW2 A;  2HFD A;  1EGR A;  5CO3 A;  4ZXG A;  1B8X A;  4CW9 A;  3CSI A;  4TXO B;  2E2M A;  1HNC A;  4WBJ A;  1O8W A;  2HE3 A;  2PBJ A;  1V9W A;  4J57 E;  3P90 A;  5LCZ A;  4I8B A;  4F2I A;  5DAL B;  2HRF A;  3PGT A;  2H30 A;  2DBC A;  5DCG A;  5ECR B;  5E59 A;  3KEB A;  4L0U A;  3KXO A;  4F82 A;  5F05 A;  5IMA A;  5HQP A;  3IC4 A;  1XW6 A;  4MJA A;  4F0B A;  3TJB A;  3GN3 A;  5HR0 A;  4NHZ A;  2IJY A;  3WT1 A;  2CX3 A;  2CVB A;  1BYE A;  3Q6O A;  2EIO A;  3IPZ A;  2JZR A;  4JZQ A;  4FH8 A;  1M3J A;  2DJ2 A;  4IN0 A;  4ZL8 A;  2X4A A;  3FKF A;  3ME7 A;  3F3R A;  3ED3 A;  3A5I A;  1A0F A;  4OMV A;  4V1A g;  2DSA A;  5DVB A;  2I3Y A;  5DAK A;  3CXG A;  1RQM A;  4ZBA A;  2VLT A;  2VLU A;  2XPD A;  4LA1 A;  3GA4 A;  4GSN A;  4N0Z A;  2X8G A;  3IE3 A;  3ZLP A;  1QQ2 A;  4XRD A;  3S9F A;  1HQO A;  2R2J A;  2GTU A;  2K9F A;  1FO5 A;  2IFQ B;  1OC9 A;  2V41 A;  3LW9 A;  2H0H A;  3N5O A;  4KDU A;  1RK4 A;  2V6O A;  4KGI A;  2X99 A;  4EVM A;  5JWQ B;  2VL2 C;  4X43 A;  3IC8 A;  4HOJ A;  4O92 A;  2XBQ A;  3Q18 A;  2HZE B;  3O6T A;  2YOI A;  6GSW A;  4O5R A;  4MAB A;  3FHK A;  1GRX A;  1O8X A;  2XBI A;  2CVK A;  1X5C A;  4PXO A;  1YY7 A;  4GST A;  1R5P A;  4PUA A;  2WFC A;  1BED A;  3DGQ A;  2WRT A;  3IAM 2;  4TR4 A;  2IME A;  4BVX A;  3CRU A;  2B7K A;  5JCG A;  3TB2 A;  1K0C A;  2ZUP A;  4ML1 A;  2XHF A;  1JLW A;  3L0H A;  3G7I A;  5L71 A;  3P7X A;  2H66 A;  4TOP A;  3ZRE A;  4WR5 A;  1YJ6 A;  1WWJ A;  4IQ1 A;  4K7O A;  2LRC A;  1SL2 B;  1UVZ A;  4CY6 A;  3E3E A;  3ZL5 A;  3RHC A;  2GQL A;  4HUA A;  5DJL A;  5A4U A;  1SD8 A;  1WMJ A;  1OKT A;  1AIU A;  1X0R A;  1R26 A;  2JSZ A;  1ZZY A;  1EEM A;  4LMV A;  2FY6 A;  2MMA A;  1ERT A;  3ZMK A;  2H70 A;  1YDK A;  2YJH A;  1Y25 A;  1SEN A;  2L4C A;  5F07 A;  4WXT A;  18GS A;  4ZBB A;  2A4H A;  4N11 A;  1EEJ A;  2FA4 A;  1GNW A;  1TTZ A;  5E4W A;  2OKA A;  2F9S A;  1THX A;  2JZT A;  4IP6 A;  2HSH A;  5FHI A;  5ELA A;  1B9Y C;  2B7J A;  4POM A;  5G30 A;  10GS A;  2H8L A;  1GH2 A;  1TDI A;  2I4A A;  4K5R A;  2IIY A;  17GS A;  1S3C A;  4GQF A;  4TR0 A;  2WCI A;  1EGO A;  1PMT A;  1SJI A;  2Z9S A;  3APQ A;  1G6Y A;  3MIX A;  4KCA A;  1AUC A;  2HXK A;  2OE3 A;  13GS A;  4XS1 A;  1EP8 A;  1XFL A;  4MJC A;  3TKS A;  2H76 A;  4YAV A;  3WGX A;  2LS5 A;  4V2M A;  1QK8 A;  4RI6 A;  3F8U A;  4MZC A;  4WF5 A;  3KGK A;  4HU9 A;  5BMU A;  2LRT A;  3L4N A;  1EZK A;  2VO4 A;  11GS A;  5HFK A;  3FR9 A;  2PVQ A;  2H0G A;  3IHQ A;  3IK9 A;  1LU4 A;  4XTS A;  1X5E A;  3KTL A;  3HKR A;  1DUG A;  5J9C A;  3LFL A;  4KW6 A;  2GSS A;  3EU4 A;  2L6D A;  2KOK A;  5AN1 A;  1YF0 A;  2CZ2 A;  4HU7 A;  1XOA A;  8GSS A;  1JZR A;  2YZU A;  4OCE A;  1SU9 A;  1ML6 A;  5J4U A;  4EDZ A;  5IM9 A;  2M80 A;  3SWL A;  4IW9 A;  4K1F A;  1WPI A;  4NWY A;  1UC7 A;  1BAY A;  2L5O A;  4IJI A;  3TUE A;  5GZZ B;  4HSC X;  5EPF A;  2DJ1 A;  1WP0 A;  5H5R A;  5D9T A;  2PU9 C;  5GSS A;  1FHE A;  2I1U A;  2JU5 A;  2HRA A;  3F4S A;  4ZB6 A;  1QFN A;  2RUE A;  2C0G A;  4LLR A;  1ERV A;  3I43 A;  5DCH A;  3WGD A;  2IMI A;  5FWG A;  1OYJ A;  5D9V A;  2K18 A;  3ZRD A;  4AJ6 A;  2DJK A;  2VCX A;  1I5G A;  2YWI A;  2GQM A;  1ZMA A;  19GS A;  2AHE A;  5J41 A;  1T4Z A;  4K2X A;  2IFQ A;  1A8Y A;  1GL8 A;  2FCH A;  1XG8 A;  3IR4 A;  2GZP A;  1Z6M A;  2H19 A;  3GRX A;  1SK2 A;  1BQ7 A;  2FA8 A;  3EVI A;  3EIN A;  1B48 A;  1U3I A;  5IIZ A;  1WRY A;  5IMD A;  4ZIL A;  3GNJ A;  2H0I A;  4ZIJ A;  3D5J A;  3IOS A;  2GSQ A;  3EU3 A;  4YQV A;  5HR3 A;  1Z7R A;  4ECC A;  1UA5 A;  4KB3 A;  3E9J B;  1T1V A;  3EMP A;  3WYW A;  2LJK A;  4WEY A;  3HVV A;  3ZML A;  5KOX A;  5F8B A;  3ZTL A;  3C7M A;  1AAZ A;  1SD9 A;  4XRA A;  2DIY A;  3EC3 A;  5DJM A;  3ZFB A;  4I5Q A;  3UEM A;  1N8J A;  4IKH A;  1OE7 A;  4FYC A;  4JRR A;  2H71 A;  1SKR B;  1GUK A;  4BA7 A;  1ZYE A;  3NOF A;  4YAP A;  4POK A;  4OFT A;  1JZD A;  2N5B A;  2O85 A;  2GDR A;  3QAG A;  4YQU A;  3C8E A;  4JR6 A;  1XBS A;  3BCK A;  2AAW A;  4K7N A;  2K6V A;  3KJY A;  1O73 A;  1KBN A;  3CSH A;  2OJL A;  3P8W A;  3APO A;  2GS3 A;  3GV1 A;  5GST A;  3V1W A;  1ZCP A;  2DJ0 A;  4GTU A;  5KN1 A;  2YV9 A;  1R5A A;  4ZB8 A;  3HXS A;  3FRC A;  2MMN A;  2WZ9 A;  1GSU A;  3ZFL A;  2HSY A;  1Q4J A;  1T7P B;  1GP1 A;  2RII A;  3GYK A;  3VWW A;  2RM6 A;  2AUV A;  2LUS A;  1WE0 A;  5KN0 A;  3I9V 2;  2FNO A;  2MBT A;  1G7O A;  5F06 A;  3LQ7 A;  3H93 A;  1FVJ A;  3D22 A;  3DYR A;  5JCW A;  1YKA A;  1EV9 A;  2YJ7 A;  4LL1 B;  1MDJ A;  4Q5N A;  5GAP D;  4IGJ A;  3GMF A;  3F3Q A;  2J23 A;  3PPU A;  2C1Y A;  3FYG A;  1U3A A;  2VL2 A;  3NIV A;  2DJJ A;  4NMU A;  3C71 A;  1WIK A;  2DMM A;  4EDY A;  1M9B A;  4AGS A;  1GSS A;  4Z2U A;  2L5L A;  1W4V A;  1PX7 A;  1K3L A;  4XS6 A;  1ST9 A;  2R37 A;  5IO2 A;  4IQA A;  4HQZ A;  2DIZ A;  1GWC A;  1X5D A;  2C0F A;  3ERF A;  1EOH A;  2OBK A;  4USS A;  3IK7 A;  2DC5 A;  2I81 A;  2YNX A;  3F0I A;  2HYX A;  5DQS A;  3UAR A;  4WR4 A;  3HCZ A;  3Q74 A;  3ZZX A;  4IP1 A;  2I9H A;  1AQW A;  2HZF A;  1B4P A;  5GAN D;  3ZIJ A;  1GSY A;  5DDL A;  1TU8 A;  3CSJ A;  3G7J A;  4IHU A;  1XVQ A;  1SJ6 A;  1MD4 A;  1FOV A;  3W6G A;  3DWV A;  2VLV A;  2LRN A;  3GL5 A;  2L4Q A;  2F8A A;  2A2R A;  2B5E A;  5ECN B;  1TRV A;  1TJD A;  1F3B A;  4ILF A;  3MNG A;  2H6X A;  1A2M A;  1M99 A;  1SKS B;  6GSV A;  5KOW A;  2LV3 A;  4GRF A;  2X8H A;  1ERW A;  3FZ4 A;  1V2A A;  1I9D A;  3GX8 A;  2LEG A;  2YP6 A;  1NHO A;  1KNG A;  4D73 A;  2BJX A;  4G0K A;  1BX9 A;  2PPT A;  4N0V A;  3N9J A;  1F9M A;  1V57 A;  3LSZ A;  3LOR A;  1FB6 A;  4XS4 B;  3M3M A;  1WOU A;  4HDE A;  1JFU A;  3GL3 A;  3GKX A;  3MWH A;  2F3M A;  2H74 A;  2KLX A;  4CHS A;  2L6C A;  2ZNM A;  3D0Z A;  3QOU A;  1GLQ A;  4E8E A;  4DSQ A;  2X49 A;  4QL9 A;  5DBQ A;  2VD1 A;  5ECH B;  5ECI B;  4MJB A;  2WUL A;  3RAZ A;  1G7E A;  1ZYN A;  4EIP A;  1WJK A;  3EUR A;  1SK0 A;  5A4W A;  2YV7 A;  1Z7P A;  2H6Y A;  4K9Z A;  5IOX A;  1FOH A;  3MYD A;  1EP7 A;  3TKP A;  3FZ9 A;  1ZYP A;  2OAD A;  6GSS A;  5D9X A;  4BL7 A;  4O7H A;  4V2L A;  3KH9 A;  1SYR A;  3FEU A;  4YKG A;  1K0A A;  3PH9 A;  4KH7 A;  2IN3 A;  2GSR A;  3BOA A;  4KF9 A;  3GHA A;  2PMT A;  4G2E A;  1C72 A;  5ID2 A;  2YCD A;  4TW5 A;  3UIW A;  4RQX A;  3L9U A;  1QUW A;  1PKZ A;  22GS A;  2IMK A;  3GTU B;  4V1A p;  4EXJ A;  1Z5Y E;  3L78 A;  3LYK A;  2FD3 A;  4GSS A;  1F6M C;  5A5K A;  4WBR D;  2LQQ A;  3W8S A;  1U88 A;  4FQU A;  1V58 A;  3BD2 A;  5G1K A;  1JLV A;  4N30 A;  2EC4 A;  3C1R A;  5B6N A;  4YKF A;  4BWS A;  4KX4 A;  2LST A;  5IMC A;  1TRW A;  1YQ1 A;  4RQR A;  2GLR A;  3PIN A;  4NHW A;  4O32 A;  6GSX A;  4PNG A;  3F9U A;  3A2X A;  4AJ8 A;  3US3 A;  4G10 A;  1BG5 A;  3UBK A;  2X64 A;  4BVY B;  2EIQ A;  2ES7 A;  3UL3 A;  3J7Y b;  3I69 A;  1OVN A;  3C73 A;  1HYU A;  4TR1 B;  3ZIV A;  3L9V A;  2G2Q A;  2ON7 A;  3H8Q A;  5ECQ B;  2RUF A; 
#chains in the Genus database with same CATH homology
 2YAN A;  2GST A;  1V40 A;  3LG6 A;  1SK1 A;  4PNF A;  4EE0 A;  1E2Y A;  2DKI A;  2E0Q A;  4N10 A;  4DSS A;  5AIS A;  3G7Y A;  3F6F A;  2R0G A;  3H1N A;  4XHM A;  2WGR A;  3WGE A;  2PGT A;  4EKZ A;  3O3T A;  3VFI A;  1TI3 A;  3EYT A;  3RPP A;  5F0G A;  3HZ8 A;  4E8H A;  1T8E B;  3HYP A;  4NAX A;  5C04 A;  1BJX A;  1K0O A;  3F6D A;  1TXX A;  2M72 A;  3IXR A;  4PQ1 A;  3TJG A;  1A2L A;  3UOM A;  3I6A A;  5C00 A;  1U6T A;  3KZQ A;  4TR3 A;  1XWA A;  2C3N A;  4IJ3 A;  4WF4 A;  2HI7 A;  5HFG A;  3GIX A;  3HY2 A;  1FVK A;  2E2G A;  2P5R A;  4TXO A;  1XWB A;  3HDC A;  1A2J A;  2DKH A;  2EIR A;  2NDO A;  4G0L A;  2N5A A;  4ICY A;  4IS0 A;  5DAL A;  3QFA C;  5ECM B;  1MDI A;  4MF5 A;  4POB A;  2PVO C;  3OR5 A;  5CRH A;  3MAK A;  1SJZ A;  2L57 A;  1OC8 A;  4EO3 A;  5G5E A;  1ILO A;  1XIY A;  4I2T A;  3K8N A;  1A23 A;  5IO0 A;  3TJJ A;  2M46 A;  3QPM A;  2CVD A;  1H75 A;  1N2A A;  1PN0 A;  3Q19 A;  3EE2 A;  2O8V B;  3CMI A;  2H1A A;  1ZOF A;  3LGC A;  4JED A;  1EWX A;  4K0N A;  20GS A;  1ERU A;  2GVP A;  1Z9H A;  7GSS A;  2CA8 A;  3JCM L;  5J3R A;  3CRT A;  4RUV A;  4V2N A;  5CRW A;  1LBK A;  5CYY A;  5G31 A;  2QA2 A;  3RHB A;  1CQG A;  5ECK B;  1XOB A;  5CNW A;  3EPT A;  1OC9 B;  1FAA A;  3F4R A;  2A4V A;  1PD2 1;  4HS1 A;  4K7I A;  1QGV A;  4NV2 A;  3EWL A;  3TGZ A;  3KP8 A;  4GCI A;  1J9B A;  4HZ4 A;  3UMA A;  4G0I A;  3D4T A;  3IHG A;  1YEP A;  2UZ8 A;  4X4J A;  4F9Z A;  4MK3 A;  3G9B A;  3GUR A;  2HZE A;  3APS A;  4ML6 A;  1MEK A;  4HQS A;  5J9B A;  3UJ1 A;  1ABA A;  2JL4 A;  4JBB A;  5AIV A;  5LNK e;  4H86 A;  5ECP B;  1YF1 A;  3LYP A;  1ACV A;  2VM1 A;  3DVX A;  2QGV A;  2OE1 A;  3QAW A;  1EOG A;  2F8F A;  1VF4 A;  3LXT A;  3HJM A;  1TK0 B;  5AGY A;  2R4V A;  9GSS A;  4MNN A;  1DBY A;  4BVX B;  3VK9 A;  3TDG A;  3VWX A;  3ZVJ D;  2QKE A;  2WS2 A;  2GGT A;  4P3Y B;  2CAQ A;  1JHB A;  5JWR B;  4YH2 A;  2NVL A;  2E7P A;  4CY8 A;  1UN2 A;  4L5L A;  2H72 A;  1K3Y A;  3U6V A;  4MPG A;  3A5W A;  4IVF A;  2V2G A;  3CTF A;  1T3B A;  3KIJ A;  2IMF A;  2ON5 A;  4MZW A;  2WB9 A;  1F2E A;  2O89 A;  1V98 A;  1J08 A;  3DXB A;  1J0F A;  2PUK C;  3DML A;  1KEB A;  2CT6 A;  2CQ9 A;  2CX4 A;  3J7Y k;  3IDV A;  3CTG A;  1AW9 A;  4PUR A;  3GFK A;  2AB6 A;  4ZL7 A;  1A0R P;  1VF1 A;  5IOW A;  2PWJ A;  2AJQ B;  1XWC A;  1O7U A;  1SKW B;  3TKS E;  1TI1 A;  2LNS A;  3QAV A;  3R2Q A;  5B7C A;  3WD6 A;  2LJA A;  2OBI A;  3GH9 A;  2BMX A;  2FWE A;  3LJR A;  4FYU A;  3CBU A;  4X0X A;  4ZBD A;  4TXV A;  4KSM A;  5D96 A;  5G2Z A;  1RW1 A;  4DEJ A;  4IEL A;  2VCW A;  3KH7 A;  5COH A;  1GTI A;  3VLN A;  2C80 A;  3A2W A;  1GSD A;  1CQH A;  2REM A;  5HFI A;  1H4O A;  3D6I A;  5D73 A;  1A8L A;  3QDN A;  2H01 A;  1FB0 A;  4EIQ A;  4ACS A;  5B6M A;  3FK8 A;  1K0M A;  3FZA A;  2B6M A;  2R3X A;  2X8C A;  1TK8 B;  1YEX A;  2OA7 A;  1ZL9 A;  1MTC A;  2FUG 2;  4WKW A;  4GXZ A;  5D93 A;  4MCU A;  4K5S A;  5ELG A;  3NZN A;  1W89 A;  1MD3 A;  5IPH A;  2VUP A;  2V1M A;  3TCO A;  5CRG A;  1GSQ A;  3VPQ A;  1TU7 A;  4TVE A;  2DLX A;  4BPY A;  3DD3 A;  2FHE A;  3IA1 A;  3RPN A;  3KP9 A;  3FY7 A;  4L5O A;  4X1U A;  2C3Q A;  2P5Q A;  1U87 A;  1KTE A;  4K8M A;  3P2A A;  1PX6 A;  3D4M A;  2DJ3 A;  2OAC A;  4OO4 A;  4GQC A;  5G1L A;  2GQK A;  3GUS A;  4KUN A;  5HR1 A;  1IYI A;  2F51 A;  4Z7X A;  3H79 A;  5ECO B;  1M7T A;  1O81 A;  2NTO A;  3GH6 A;  3QCP A;  2CV4 A;  4PTS A;  4EC0 A;  2LTK A;  4Q5R A;  4KAE A;  4PQH A;  4ECJ A;  2N5F A;  4OFM A;  4G9H A;  3LXZ A;  1S3A A;  4K2D A;  5B8A A;  5IMV A;  1THO A;  1PN9 A;  1VF3 A;  5KN3 A;  4NPB A;  1HNB A;  4ZB9 A;  1AXD A;  5H5S A;  2QA1 A;  1F37 A;  2HRK A;  5CRE A;  4ID0 A;  2VCQ A;  4MMM A;  3KTB A;  1T00 A;  4F0C A;  4Q5F A;  2C8U A;  2QC7 A;  2IL3 A;  1X9M B;  1K0D A;  4JE1 A;  4MZB A;  4HZ2 A;  4YQM A;  1XPV A;  2HRN A;  2VCV A;  3M8N A;  5ECL B;  4MLY A;  4TRX A;  1GTB A;  4J2F A;  4MH2 A;  2VAF A;  1ZGN A;  3FMW A;  2LKU A;  1GUL A;  4FIW A;  3RDW A;  12GS A;  2MYG A;  3BCI A;  1O6J A;  4ECI A;  1GSE A;  4GF0 A;  3M0F A;  1F3A A;  1JZW A;  3ME8 A;  2MMO A;  2V32 A;  2JZS A;  3UVT A;  3KMN A;  5A4V A;  1HD2 A;  3SBC A;  3GKK A;  3HJO A;  5FT3 A;  1M2D A;  5J5N A;  2H75 A;  5IMF A;  4NV5 A;  1OAZ A;  2P0G A;  2VCZ A;  1O85 A;  4J56 E;  5CAX A;  3A3T A;  2NBS A;  3F4T A;  1TRS A;  1VGL A;  1USB A;  3FR6 A;  2R0P A;  2FWF A;  2CZ3 A;  4QQ7 A;  3ERG A;  2MZC A;  1DSB A;  2B3S A;  2HSM A;  2TRC P;  2HT9 A;  5D9W A;  4KDY A;  6GSU A;  1R7H A;  5HR2 A;  3U5R E;  3TOT A;  2A2S A;  2KP2 A;  4I2U A;  1QXH A;  3IV4 A;  3W8J A;  4KCE A;  1XW5 A;  4EUY A;  1G0T A;  1TKD B;  5ECS A;  4DVC A;  3FR3 A;  4MA9 A;  1PSQ A;  3VPT A;  4I97 A;  2IPA A;  1VRS D;  4PGT A;  3TRP A;  1PRX A;  2RLI A;  2O7K A;  4KE3 A;  2WDU A;  1OE8 A;  4I6X A;  1TOF A;  2GT6 A;  1LJR A;  2R6K A;  2FWG A;  4O5Q A;  3LWA A;  2TRX A;  16GS A;  3KM6 A;  3QMX A;  1R4W A;  3VWU A;  5CP1 A;  2H73 A;  5D8I A;  4LMW A;  1Z6N A;  1PL1 A;  3TRX A;  2YWO A;  3UAP A;  4DSR A;  4Z2T A;  3DIE A;  3GX0 A;  3IAS 2;  3O76 A;  3VWV A;  3GST A;  1YKC A;  2VD0 A;  3IBH A;  4GWR A;  3VI7 A;  1XXU A;  2A2P A;  4Z2R A;  3GSS A;  1DE1 A;  3DEX A;  1X9W B;  1XVW A;  4HJM A;  3MDK A;  4GLT A;  4EL1 A;  4Q5Q A;  6GSY A;  3R3E A;  3HZ4 A;  1Z3E A;  2YZH A;  1XWK A;  3WT2 A;  3DRN A;  5KEJ A;  1G6W A;  4XCS A;  2VIM A;  4OFN A;  3LEF A;  5EY6 A;  1QMV A;  4MF6 A;  4MDC A;  1GTA A;  5EL8 A;  3TKR A;  2IWT A;  2FLS A;  4OO5 A;  4MPF A;  2C0D A;  5IMZ A;  3E0U A;  4MH3 A;  1E6B A;  2K8S A;  2GZZ A;  1GUM A;  5IPG A;  1FW1 A;  4JR4 A;  2D2Z A;  2VL3 A;  1MDK A;  1VF2 A;  5KN2 A;  3VUR A;  2R0C A;  5AIX A;  2R5G A;  4MJE A;  1YZX A;  5ENU A;  3HHV A;  3QR6 A;  3IRA A;  3QD9 A;  2TIR A;  4OD7 A;  3AY8 A;  6GST A;  2YWM A;  3F63 A;  1PA3 A;  5ABR A;  3M9J A;  3M1G A;  2AV4 A;  1B4Q A;  1SL1 B;  1M9A A;  2O87 A;  5JCU A;  1K0B A;  3DVW A;  4A5P A;  2B5X A;  2YPM A;  4KDX A;  2FGX A;  2QSI A;  5LD0 A;  1XCC A;  2YWN A;  3D21 A;  2B5Y A;  4L8E A;  5B8B A;  2CAI A;  5DAK B;  2AYT A;  3BJ5 A;  4D73 B;  4RI7 A;  3ISO A;  3KD0 A;  4O5U A;  1GTU A;  2YN1 A;  5G5F A;  3KMO A;  1K0N A;  3QFB C;  2H1G A;  4MF7 A;  2JSY A;  3ZIT A;  2GZY A;  3HVX A;  2OE0 A;  4TKY A;  2DML A;  1NM3 A;  2P31 A;  1GUH A;  1HNA A;  1PKW A;  4PQI A;  4XS4 A;  3HA9 A;  1GLP A;  3M9K A;  1GNE A;  1URM A;  2MMZ A;  3H4K A;  2MBS A;  3GKM A;  3HD5 A;  2L59 A;  2C3T A;  3DKS A;  5IQY A;  2VOC A;  4G19 A;  3TKS C;  4CDO A;  2FWH A;  1X9S B;  4BWQ A;  1TRU A;  2H1D A;  1ZYQ B;  1A24 A;  4ECB A;  1DE2 A;  4HEA 2;  2LJR A;  2XPE A;  2HLS A;  3TKQ A;  3UBL A;  1PGT A;  3ZYW A;  1EV4 A;  3TJF A;  4BL7 B;  1SYX A;  2KP1 A;  2K8V A;  3RBT A;  1OKD A;  5DQY A;  1Y6E A;  3BBY A;  2XC2 A;  3FZ5 A;  3UVH A;  1M2B A;  2JAD A;  1GSF A;  2VL9 A;  2RM5 A;  3C1S A;  4KSO A;  2KHP A;  5ID2 B;  1AC1 A;  3MSZ A;  4KND A;  2JAC A;  1TP9 A;  3EMX A;  5BRT A;  4QL7 A;  4ISD A;  4KA0 A;  1SL0 B;  1XZO A;  4HJ2 A;  1PQN A;  4ZL9 A;  3VI5 A;  3HJP A;  3GTU A;  4IBP A;  4POL A;  1NSW A;  2PER A;  3KCM A;  1AQV A;  3ERW A;  2J9H A;  14GS A;  2B1K A;  4FO5 A;  1ON4 A;  1NW2 A;  1XWG A;  3HVS A;  1XW9 A;  5JWO B;  2PN8 A;  1Q98 A;  2HNL A;  4JU5 A;  2LNT A;  3A2V A;  2C0E A;  2H6Z A;  1AQX A;  5CRD A;  4AF2 A;  1TK5 B;  3GKN A;  2V6K A;  2VM2 A;  4ULX A;  3TJK A;  2H1B A;  4PUF C;  2ZCT A;  4OCF A;  2ALB A;  3TOU A;  4BVY A;  2GT5 A;  3PR8 A;  5INY A;  4NXI A;  1IYH A;  1M2A A;  4TR1 A;  2B1L A;  4OWY A;  4EF0 A;  2BTO T;  1NHY A;  4F03 A;  1M0U A;  1FG4 A;  4DSS B;  2IMD A;  3L9S A;  2LQO A;  1OC3 A;  4HI7 A;  4PX1 A;  4AJ7 A;  4TN8 A;  5EVO A;  4XIH A;  2G0F A;  4FYB A;  3TRQ A;  4K0G A;  1S3D A;  1B9X C;  3CYN A;  2WJU A;  4WET A;  1T4Y A;  4L0W A;  4K6X A;  1K3O A;  1JZO A;  2C4J A;  2VCT A;  1TW9 A;  4LL4 B;  4MP4 A;  2NPB A;  3ZVJ A;  5H5Q A;  2KUC A;  1PL2 A;  3FW2 A;  2HFD A;  1EGR A;  5CO3 A;  4ZXG A;  1B8X A;  4CW9 A;  3CSI A;  4TXO B;  2E2M A;  1HNC A;  4WBJ A;  1O8W A;  2HE3 A;  2PBJ A;  1V9W A;  4J57 E;  3P90 A;  5LCZ A;  4I8B A;  4F2I A;  5DAL B;  2HRF A;  3PGT A;  2H30 A;  2DBC A;  5DCG A;  5ECR B;  5E59 A;  3KEB A;  4L0U A;  3KXO A;  4F82 A;  5F05 A;  5IMA A;  5HQP A;  3IC4 A;  1XW6 A;  4MJA A;  4F0B A;  3TJB A;  3GN3 A;  5HR0 A;  4NHZ A;  2IJY A;  3WT1 A;  2CX3 A;  2CVB A;  1BYE A;  3Q6O A;  2EIO A;  3IPZ A;  2JZR A;  4JZQ A;  4FH8 A;  2DJ2 A;  4IN0 A;  4ZL8 A;  2X4A A;  3FKF A;  3ME7 A;  3F3R A;  3ED3 A;  3A5I A;  1A0F A;  4OMV A;  4V1A g;  2DSA A;  5DVB A;  2I3Y A;  5DAK A;  3CXG A;  1RQM A;  4ZBA A;  2VLT A;  2VLU A;  2XPD A;  4LA1 A;  3GA4 A;  4GSN A;  4N0Z A;  2X8G A;  3IE3 A;  3ZLP A;  1QQ2 A;  4XRD A;  3S9F A;  1HQO A;  2R2J A;  2GTU A;  2K9F A;  1FO5 A;  2IFQ B;  1OC9 A;  2V41 A;  3LW9 A;  2H0H A;  3N5O A;  4KDU A;  1RK4 A;  2V6O A;  4KGI A;  2X99 A;  4EVM A;  5JWQ B;  2VL2 C;  4X43 A;  3IC8 A;  4HOJ A;  4O92 A;  2XBQ A;  3Q18 A;  2HZE B;  3O6T A;  2YOI A;  6GSW A;  4O5R A;  4MAB A;  3FHK A;  1GRX A;  1O8X A;  2XBI A;  2CVK A;  1X5C A;  4PXO A;  1YY7 A;  4GST A;  1R5P A;  4PUA A;  2WFC A;  1BED A;  3DGQ A;  2WRT A;  3IAM 2;  4TR4 A;  2IME A;  4BVX A;  3CRU A;  2B7K A;  5JCG A;  3TB2 A;  1K0C A;  2ZUP A;  4ML1 A;  2XHF A;  1JLW A;  3L0H A;  3G7I A;  5L71 A;  3P7X A;  2H66 A;  4TOP A;  3ZRE A;  4WR5 A;  1YJ6 A;  1WWJ A;  4IQ1 A;  4K7O A;  2LRC A;  1SL2 B;  1UVZ A;  4CY6 A;  3E3E A;  3ZL5 A;  3RHC A;  2GQL A;  4HUA A;  5DJL A;  5A4U A;  1SD8 A;  1WMJ A;  1OKT A;  1AIU A;  1X0R A;  1R26 A;  2JSZ A;  1ZZY A;  1EEM A;  4LMV A;  2FY6 A;  2MMA A;  1ERT A;  3ZMK A;  2H70 A;  1YDK A;  2YJH A;  1Y25 A;  1SEN A;  2L4C A;  5F07 A;  4WXT A;  18GS A;  4ZBB A;  2A4H A;  4N11 A;  1EEJ A;  2FA4 A;  1GNW A;  1TTZ A;  5E4W A;  2OKA A;  2F9S A;  1THX A;  2JZT A;  4IP6 A;  2HSH A;  5FHI A;  5ELA A;  1B9Y C;  2B7J A;  4POM A;  5G30 A;  10GS A;  2H8L A;  1GH2 A;  1TDI A;  2I4A A;  4K5R A;  2IIY A;  17GS A;  1S3C A;  4GQF A;  4TR0 A;  2WCI A;  1EGO A;  1PMT A;  1SJI A;  2Z9S A;  3APQ A;  1G6Y A;  3MIX A;  4KCA A;  1AUC A;  2HXK A;  2OE3 A;  13GS A;  4XS1 A;  1EP8 A;  1XFL A;  4MJC A;  3TKS A;  2H76 A;  4YAV A;  3WGX A;  2LS5 A;  4V2M A;  1QK8 A;  4RI6 A;  3F8U A;  4MZC A;  4WF5 A;  3KGK A;  4HU9 A;  5BMU A;  2LRT A;  3L4N A;  1EZK A;  2VO4 A;  11GS A;  5HFK A;  3FR9 A;  2PVQ A;  2H0G A;  3IHQ A;  3IK9 A;  1LU4 A;  4XTS A;  1X5E A;  3KTL A;  3HKR A;  1DUG A;  5J9C A;  3LFL A;  4KW6 A;  2GSS A;  3EU4 A;  2L6D A;  2KOK A;  5AN1 A;  1YF0 A;  2CZ2 A;  4HU7 A;  1XOA A;  8GSS A;  1JZR A;  2YZU A;  4OCE A;  1SU9 A;  1ML6 A;  5J4U A;  4EDZ A;  5IM9 A;  2M80 A;  3SWL A;  4IW9 A;  4K1F A;  1WPI A;  4NWY A;  1UC7 A;  1BAY A;  2L5O A;  4IJI A;  3TUE A;  5GZZ B;  5EPF A;  2DJ1 A;  1WP0 A;  5H5R A;  5D9T A;  2PU9 C;  5GSS A;  1FHE A;  2I1U A;  2JU5 A;  2HRA A;  3F4S A;  4ZB6 A;  1QFN A;  2RUE A;  2C0G A;  4LLR A;  1ERV A;  3I43 A;  5DCH A;  3WGD A;  2IMI A;  5FWG A;  1OYJ A;  5D9V A;  2K18 A;  3ZRD A;  4AJ6 A;  2DJK A;  2VCX A;  1I5G A;  2YWI A;  2GQM A;  1ZMA A;  19GS A;  2AHE A;  5J41 A;  1T4Z A;  4K2X A;  2IFQ A;  1A8Y A;  1GL8 A;  2FCH A;  3IR4 A;  2GZP A;  1Z6M A;  2H19 A;  3GRX A;  1SK2 A;  1BQ7 A;  2FA8 A;  3EVI A;  3EIN A;  1B48 A;  1U3I A;  5IIZ A;  1WRY A;  5IMD A;  4ZIL A;  3GNJ A;  2H0I A;  4ZIJ A;  3D5J A;  3IOS A;  2GSQ A;  3EU3 A;  4YQV A;  5HR3 A;  1Z7R A;  4ECC A;  1UA5 A;  4KB3 A;  3E9J B;  1T1V A;  3EMP A;  3WYW A;  2LJK A;  4WEY A;  3HVV A;  3ZML A;  5KOX A;  5F8B A;  3ZTL A;  3C7M A;  1AAZ A;  1SD9 A;  4XRA A;  2DIY A;  3EC3 A;  5DJM A;  3ZFB A;  4I5Q A;  3UEM A;  1N8J A;  4IKH A;  1OE7 A;  4FYC A;  4JRR A;  2H71 A;  1SKR B;  1GUK A;  4BA7 A;  1ZYE A;  3NOF A;  4YAP A;  4POK A;  4OFT A;  1JZD A;  2N5B A;  2O85 A;  2GDR A;  3QAG A;  4YQU A;  3C8E A;  4JR6 A;  1XBS A;  3BCK A;  2AAW A;  4K7N A;  2K6V A;  3KJY A;  1O73 A;  1KBN A;  3CSH A;  2OJL A;  3P8W A;  3APO A;  2GS3 A;  3GV1 A;  5GST A;  3V1W A;  1ZCP A;  2DJ0 A;  4GTU A;  5KN1 A;  2YV9 A;  1R5A A;  4ZB8 A;  3HXS A;  3FRC A;  2MMN A;  2WZ9 A;  1GSU A;  3ZFL A;  2HSY A;  1Q4J A;  1T7P B;  1GP1 A;  2RII A;  3GYK A;  3VWW A;  2RM6 A;  2AUV A;  2LUS A;  1WE0 A;  5KN0 A;  3I9V 2;  2FNO A;  2MBT A;  1G7O A;  5F06 A;  3LQ7 A;  3H93 A;  1FVJ A;  3D22 A;  3DYR A;  5JCW A;  1YKA A;  1EV9 A;  2YJ7 A;  4LL1 B;  1MDJ A;  4Q5N A;  5GAP D;  4IGJ A;  3GMF A;  3F3Q A;  2J23 A;  3PPU A;  2C1Y A;  3FYG A;  1U3A A;  2VL2 A;  3NIV A;  2DJJ A;  4NMU A;  3C71 A;  1WIK A;  2DMM A;  4EDY A;  1M9B A;  4AGS A;  1GSS A;  4Z2U A;  2L5L A;  1W4V A;  1PX7 A;  1K3L A;  4XS6 A;  1ST9 A;  2R37 A;  5IO2 A;  4IQA A;  4HQZ A;  2DIZ A;  1GWC A;  1X5D A;  2C0F A;  3ERF A;  1EOH A;  2OBK A;  4USS A;  3IK7 A;  2DC5 A;  2I81 A;  2YNX A;  3F0I A;  2HYX A;  5DQS A;  3UAR A;  4WR4 A;  3HCZ A;  3Q74 A;  3ZZX A;  4IP1 A;  2I9H A;  1AQW A;  2HZF A;  1B4P A;  5GAN D;  3ZIJ A;  1GSY A;  5DDL A;  1TU8 A;  3CSJ A;  3G7J A;  4IHU A;  1XVQ A;  1SJ6 A;  1MD4 A;  1FOV A;  3W6G A;  3DWV A;  2VLV A;  2LRN A;  3GL5 A;  2L4Q A;  2F8A A;  2A2R A;  2B5E A;  5ECN B;  1TRV A;  1TJD A;  1F3B A;  4ILF A;  3MNG A;  2H6X A;  1A2M A;  1M99 A;  1SKS B;  6GSV A;  5KOW A;  2LV3 A;  4GRF A;  2X8H A;  1ERW A;  3FZ4 A;  1V2A A;  1I9D A;  3GX8 A;  2LEG A;  2YP6 A;  1NHO A;  1KNG A;  4D73 A;  2BJX A;  4G0K A;  1BX9 A;  2PPT A;  4N0V A;  3N9J A;  1F9M A;  1V57 A;  3LSZ A;  3LOR A;  1FB6 A;  4XS4 B;  3M3M A;  1WOU A;  4HDE A;  1JFU A;  3GL3 A;  3GKX A;  3MWH A;  2F3M A;  2H74 A;  2KLX A;  4CHS A;  2L6C A;  2ZNM A;  3D0Z A;  3QOU A;  1GLQ A;  4E8E A;  4DSQ A;  2X49 A;  4QL9 A;  5DBQ A;  2VD1 A;  5ECH B;  5ECI B;  4MJB A;  2WUL A;  3RAZ A;  1G7E A;  1ZYN A;  4EIP A;  1WJK A;  3EUR A;  1SK0 A;  5A4W A;  2YV7 A;  1Z7P A;  2H6Y A;  4K9Z A;  5IOX A;  1FOH A;  3MYD A;  1EP7 A;  3TKP A;  3FZ9 A;  1ZYP A;  2OAD A;  6GSS A;  5D9X A;  4BL7 A;  4O7H A;  4V2L A;  3KH9 A;  1SYR A;  3FEU A;  4YKG A;  1K0A A;  3PH9 A;  4KH7 A;  2IN3 A;  2GSR A;  3BOA A;  4KF9 A;  3GHA A;  2PMT A;  4G2E A;  1C72 A;  5ID2 A;  2YCD A;  4TW5 A;  3UIW A;  4RQX A;  3L9U A;  1QUW A;  1PKZ A;  22GS A;  2IMK A;  3GTU B;  4V1A p;  4EXJ A;  1Z5Y E;  3L78 A;  3LYK A;  2FD3 A;  4GSS A;  1F6M C;  5A5K A;  4WBR D;  2LQQ A;  3W8S A;  1U88 A;  4FQU A;  1V58 A;  3BD2 A;  5G1K A;  1JLV A;  4N30 A;  2EC4 A;  3C1R A;  5B6N A;  4YKF A;  4BWS A;  4KX4 A;  2LST A;  5IMC A;  1TRW A;  1YQ1 A;  4RQR A;  2GLR A;  3PIN A;  4NHW A;  4O32 A;  6GSX A;  4PNG A;  3F9U A;  3A2X A;  4AJ8 A;  3US3 A;  4G10 A;  1BG5 A;  3UBK A;  2X64 A;  4BVY B;  2EIQ A;  2ES7 A;  3UL3 A;  3J7Y b;  3I69 A;  1OVN A;  3C73 A;  1HYU A;  4TR1 B;  3ZIV A;  3L9V A;  2G2Q A;  2ON7 A;  3H8Q A;  5ECQ B;  2RUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...