2WCIA

Structure of e. coli monothiol glutaredoxin grx4 homodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Delivery of the Intact [Fe2S2] Cluster by Monothiol Glutaredoxin.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN-4
molecule tags Electron transport
source organism Escherichia coli
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wciA01
2VCVA 2H1GA 2H19A 4FIWA 5DAKB 9GSSA 5IMVA 1PSQA 4AJ6A 1ERTA 2GQLA 5A4UA 1K3OA 1EZKA 4TXVA 1XBSA 3KGKA 2RUFA 5ECIB 2CT6A 4KDXA 1O81A 2K6VA 3P2AA 1PQNA 1ZGNA 3VLNA 2VAFA 2A4VA 1Q98A 5IMFA 3HJPA 3DKSA 4K1FA 5KN2A 1OE7A 4ZILA 1LU4A 4G19A 5D9WA 4KX4A 5F07A 4MZWA 1X5DA 2JZTA 3UVTA 2GS3A 4HI7A 3KIJA 3GX8A 4XHMA 1J08A 4OFNA 1O73A 5JCGA 4XS1A 1TW9A 2KP2A 1A2LA 3CSJA 1PKWA 3H1NA 2I3YA 2K9FA 4FYCA 4MCUA 4AJ8A 5LD0A 2DIYA 5ECLB 1PD21 2ALBA 4X43A 2YN1A 4O5RA 5A4WA 3UEMA 2EIOA 3KEBA 2HYXA 5HR1A 3HY2A 4MABA 1FB6A 2ZCTA 1XVWA 3EMXA 4WR4A 3UVHA 2OBIA 2VL9A 4KDUA 5G2ZA 3BCIA 4JE1A 2ZUPA 2AB6A 1XWCA 1OC9B 2MBSA 1ABAA 1LBKA 3C1RA 4KCEA 4J56E 1TKDB 3H79A 3ZITA 4J2FA 4I97A 4ISDA 1A23A 4IJIA 2O8VB 2C80A 3ERWA 2EIQA 3UOMA 8GSSA 2V32A 1T4ZA 2IFQB 4F2IA 4KCAA 2B5XA 1TU8A 1PX6A 1OE8A 3ZFBA 4PQHA 1FW1A 2H1BA 2FGXA 3QFBC 2WJUA 1XPVA 1I9DA 3IBHA 12GSA 3TOUA 1YF1A 4ID0A 1F3BA 1H75A 2MZCA 2N5BA 2RM6A 4Z7XA 1GSQA 2YP6A 1GUHA 3P7XA 1X5EA 3J7Yk 4KH7A 5IMDA 3IC4A 3A2VA 1QMVA 3GL5A 1ZMAA 3CXGA 5AN1A 4E8EA 1JZOA 2C0GA 3RHBA 2VM2A 3LORA 3DIEA 4Q5RA 1EP8A 3G9BA 4F0BA 5KEJA 4PNGA 3HVXA 3ISOA 3KTLA 5HQPA 1T7PB 3QAWA 3DRNA 4N10A 3TRQA 1B4QA 4HZ4A 2O7KA 3EWLA 1WMJA 2PN8A 5INYA 3CYNA 2O89A 2D2ZA 2VM1A 4I2UA 4OCFA 1NSWA 13GSA 2FNOA 4NHWA 1GTIA 3L78A 2DJKA 1SYRA 3VWXA 2V2GA 3E3EA 3QD9A 2AV4A 4NAXA 4IVFA 1TU7A 4JZQA 2HFDA 4IBPA 3TDGA 2I81A 2PUKC 4PURA 4XRDA 3TJGA 4F9ZA 2WFCA 1DSBA 1AC1A 4IN0A 3KXOA 4IKHA 3VURA 3QDNA 1YKCA 1O7UA 4ML6A 2HRNA 3D4TA 2ES7A 3LG6A 3F6FA 3UARA 1QFNA 5IOWA 1T1VA 3F4SA 3DYRA 2C1YA 4PXOA 2EC4A 2CX4A 2L4QA 3ERGA 5J9CA 5COHA 4WF5A 6GSSA 5B6NA 4NWYA 4K0GA 1SJ6A 2LSTA 3EC3A 2GTUA 5IMAA 1A2JA 2ON7A 18GSA 3HJOA 1NHOA 2WZ9A 3D0ZA 3DEXA 3EU4A 2LJAA 3KD0A 1O85A 5IPGA 3UBLA 5H5SA 1FHEA 2JZSA 4POMA 3C71A 1JLWA 1URMA 4TR3A 2QC7A 3TKPA 2K18A 2YWIA 20GSA 1SKWB 3EU3A 3PH9A 5D96A 3FKFA 1MDIA 3EMPA 3GFKA 1NM3A 5A4VA 4I6XA 2IMDA 2H74A 1X5CA 2GSRA 3ZMKA 1KEBA 4TW5A 5ELGA 1ERWA 4WR5A 2NPBA 2N5FA 4K9ZA 4BVXA 4XIHA 3W6GA 2L57A 2DMMA 4N0VA 1QUWA 4MF5A 1XOBA 4HZ2A 2H73A 3L9VA 2LS5A 5EY6A 3CSHA 2XHFA 3ME8A 5JWOB 5DDLA 1EGRA 1SL2B 2E0QA 4MA9A 5ECNB 3QOUA 1TXXA 1F2EA 3N5OA 2H1DA 4YAPA 5CO3A 5LCZA 2JSZA 2DBCA 3FYGA 3LYKA 4XS4B 2IIYA 4O32A 3IV4A 4CDOA 2FWGA 2M72A 1M2AA 2OE1A 5B8AA 1WIKA 4RUVA 2OBKA 2LV3A 4JBBA 1IYHA 2CA8A 4K7NA 4TXOB 5AGYA 5C00A 4DSQA 4WXTA 3GL3A 1TK8B 5GZZB 2FCHA 3KP9A 1THOA 3W8JA 1FO5A 4IHUA 1MDKA 3D6IA 3QPMA 5IMZA 4KSMA 2VL2A 6GSXA 2AHEA 1X9MB 1YF0A 5C04A 4F0CA 2H76A 3FW2A 4MLYA 5ENUA 1YJ6A 3CRUA 4DSRA 3IOSA 6GSUA 1XZOA 1HNCA 2MMZA 3A2XA 3HXSA 2HNLA 1RW1A 3ZIVA 5GAND 3KH7A 4TRXA 4KGIA 1AQXA 1XVQA 5D9VA 2VO4A 1WWJA 1JZRA 4MF7A 2C4JA 2XBIA 3TUEA 5G1LA 5CRGA 3GNJA 1GUMA 2LQOA 3ZZXA 1JZWA 4E8HA 2PWJA 2VUPA 3ZFLA 4D73B 1SD9A 1XWGA 5F0GA 3GURA 5D73A 4ZL8A 1GH2A 2HSYA 1U88A 3UBKA 1TRVA 3HHVA 4EDZA 1PMTA 1SL0B 2QKEA 2I4AA 3FZ4A 2LEGA 3C7MA 1TK0B 3TKSE 5EL8A 2RM5A 3TJKA 5DJMA 4KA0A 3KMNA 3TRXA 2L59A 4EE0A 3ZVJD 2GGTA 4ZBDA 1S3AA 2N5AA 1A0FA 2E7PA 5JWRB 1J9BA 2JZRA 3R2QA 1V57A 4NMUA 17GSA 4L0UA 4BWQA 1V98A 2YWMA 2G2QA 4G2EA 2RUEA 3H93A 1GSYA 4MZCA 4JEDA 3GX0A 4FH8A 4NV2A 3FHKA 1CQHA 4AF2A 4GQFA 1BYEA 3FZ5A 2R37A 1OVNA 4BWSA 4K2DA 4LA1A 5AIXA 2NTOA 5G5FA 1WRYA 1U6TA 3TJJA 1TRSA 4ACSA 2YJHA 1ZZYA 3MAKA 3ZYWA 2FWHA 1Y6EA 1QXHA 1G0TA 4BVYA 2BMXA 5G5EA 3BD2A 2DJJA 1JLVA 1G6YA 1Z5YE 2CX3A 4GSTA 4N0ZA 4OWYA 3IAS2 1XWBA 7GSSA 2R4VA 2BJXA 4F03A 3Q18A 4ZBAA 1XW6A 2H72A 2LJRA 5IO0A 2B3SA 1ON4A 5ABRA 1AQWA 1PGTA 2DLXA 4GSSA 4BPYA 4WBJA 4K6XA 1YDKA 3UJ1A 2PVQA 4K8MA 6GSVA 5DVBA 1Y25A 1R26A 5CAXA 3DVWA 2P5QA 1TDIA 3WGEA 1Z6NA 2CVBA 3EINA 4MK3A 2LNTA 1GSSA 3TJBA 4L5LA 3NIVA 2A2SA 1Z6MA 2YWNA 3KM6A 4I2TA 2CZ2A 3EYTA 5KN3A 1UN2A 4JU5A 1PX7A 3DGQA 5DJLA 1PL2A 4HS1A 2KP1A 3S9FA 4WF4A 2H0HA 1AQVA 2R3XA 3GA4A 2YANA 5DALB 4XS4A 5IQYA 3D4MA 3D5JA 5JCUA 3A5WA 5ECHB 4EKZA 4BA7A 3C1SA 3FRCA 4TXOA 4X0XA 4TKYA 3F3RA 3TKSA 1EGOA 3K8NA 2J23A 4ILFA 3FZ9A 3GMFA 2FUG2 1ERUA 3F3QA 3TOTA 4X1UA 2JU5A 3LQ7A 3KMOA 2AJQB 1EEJA 2IPAA 6GSWA 3CTGA 4ML1A 4IW9A 1G7OA 1AW9A 2HE3A 2I9HA 3KJYA 3WT2A 4ECJA 2LRCA 3CRTA 1AUCA 4IGJA 2WGRA 1QK8A 4XTSA 5EPFA 1S3CA 4MJCA 3GTUB 4GLTA 1J0FA 2HT9A 5KN0A 4RQXA 1F9MA 1M99A 3M9JA 4EVMA 3GKNA 4JR4A 2C8UA 1YEXA 2JL4A 2NVLA 3F6DA 3OR5A 3IR4A 4MF6A 1BX9A 5A5KA 4K7OA 2XPDA 3ZLPA 1UA5A 1AAZA 1K0AA 3QFAC 1B8XA 2YZHA 4QL9A 1V9WA 2FLSA 2B7JA 1NHYA 3F4TA 5J3RA 1WJKA 3RBTA 5H5RA 1CQGA 3WT1A 4QL7A 2F8FA 4ZB9A 3U6VA 1RK4A 4HDEA 3APQA 4MPGA 1VF1A 2F3MA 4DSSB 4TN8A 2WS2A 2KOKA 2C0EA 4HQZA 4DEJA 1T4YA 4G9HA 1M2DA 4ZL7A 2OADA 4LL1B 5DQSA 4MJAA 5CRHA 1PKZA 1GL8A 3F4RA 2X8CA 3GV1A 1GULA 5DQYA 3C73A 5IIZA 1EEMA 3LEFA 2YJ7A 3VFIA 2FY6A 4JR6A 1LJRA 5HFKA 3US3A 4FO5A 4TR4A 3F9UA 2MMOA 2E2GA 2VL2C 4ECCA 1OKDA 2F9SA 5L71A 2PERA 2IL3A 1A24A 4LLRA 2PBJA 4MH3A 2L6DA 2C3NA 1GSFA 2VCXA 4O7HA 4EUYA 1ILOA 4O92A 3DWVA 3GHAA 5DAKA 2VCQA 3LYPA 2KHPA 1Z7RA 1THXA 1M0UA 3ME7A 3HDCA 1Z9HA 5ELAA 4LMVA 4PX1A 3D22A 1HNAA 2OE0A 2MMAA 2H6ZA 3HZ8A 2DC5A 2PVOC 1RQMA 2V41A 4HEA2 2DJ1A 4ECBA 4K7IA 2H66A 5ECOB 3IHQA 5ID2B 1ZOFA 5G31A 1VRSD 4RI6A 3IRAA 1B9XC 1U87A 2GLRA 1FOVA 3A2WA 2ON5A 3JCML 2YPMA 3ZMLA 5D9TA 2KLXA 3E9JB 1ST9A 5F06A 3Q74A 3MDKA 5H5QA 4RI7A 2VLVA 3VWUA 3GH9A 1HYUA 4L0WA 2CVDA 5ECPB 3ZL5A 3GRXA 3IK7A 4IS0A 4HJ2A 1FAAA 2YCDA 5IOXA 1VGLA 1XW5A 5HFIA 3LWAA 1GSUA 3HJMA 2NDOA 2H30A 4EXJA 1SJIA 4AJ7A 2HZEB 2FWFA 4MPFA 2DMLA 2R2JA 1M7TA 3KZQA 4BL7A 2KUCA 5ECSA 3MNGA 2OE3A 2V6KA 5IO2A 2L6CA 1EV4A 4Q5QA 3UAPA 1TK5B 2L4CA 1OC9A 1WOUA 2EIRA 3NOFA 5DALA 3IPZA 2I1UA 2B5EA 5E4WA 1AIUA 4ZB8A 4IQ1A 5F8BA 1YQ1A 3BOAA 2XPEA 2CAQA 2IFQA 2B6MA 2LUSA 3IE3A 4WBRD 4OFMA 1SJZA 1XWKA 2GQKA 1X0RA 1E6BA 3QAVA 2GZZA 2GSQA 3LSZA 3TKRA 3SWLA 5J5NA 3HVVA 4GSNA 5B8BA 3SBCA 5IPHA 1N8JA 2CZ3A 3GSTA 4GF0A 4PGTA 2L5OA 4MZBA 3L0HA 3ZIJA 1FB0A 1G6WA 4EL1A 2E2MA 5GAPD 2XBQA 4JRRA 4GQCA 5ECQB 1EWXA 1TOFA 1SL1B 2C3QA 3APSA 2LRTA 3GTUA 2Z9SA 1TI1A 2VCTA 2OACA 4KE3A 4ZIJA 2GZYA 3CBUA 3ZREA 4MMMA 5GSSA 3LJRA 5HR2A 3AY8A 2MYGA 3IAM2 3KCMA 2IJYA 5ECRB 3VWWA 1EOGA 4XS6A 4ZL9A 2GSSA 2K8VA 1MD3A 1K0NA 1XCCA 5D8IA 3BBYA 5D93A 3HCZA 1R7HA 4ECIA 2P5RA 4J57E 3I69A 2QGVA 2YV7A 1N2AA 1IYIA 5G1KA 1O8XA 2OJLA 1C72A 3VWVA 4EO3A 3GN3A 2X99A 3EE2A 4ZXGA 3LXTA 1KTEA 1B48A 1B4PA 5E59A 1BG5A 2YNXA 1GNEA 1XWAA 1U3IA 3O76A 3VK9A 3WGDA 2VD1A 2LNSA 2VOCA 3CSIA 3O6TA 1T00A 4EDYA 3RAZA 1W89A 4ZBBA 1FVJA 1VF3A 4MH2A 14GSA 1JHBA 4YQUA 4PUAA 3CTFA 5J9BA 2CAIA 11GSA 4IP1A 3APOA 5J4UA 1T8EB 4N11A 2P0GA 4PNFA 1DBYA 2H0GA 2DIZA 2FHEA 2JADA 4V2LA 2WB9A 3ED3A 2WCIA 3GIXA 4HU7A 3DD3A 1K0DA 5B7CA 4V1Ap 2F51A 2NBSA 4V2MA 4TR0A 10GSA 3L4NA 2YOIA 2O87A 4ZB6A 1M9AA 1PL1A 1H4OA 2VIMA 3Q19A 2A2RA 1SKSB 5IMCA 1ML6A 1TTZA 2RLIA 1HQOA 1DE1A 3L9SA 2L5LA 3G7JA 2CVKA 4WEYA 3H8QA 1PRXA 1GSEA 4LMWA 5ID2A 3P8WA 2IMEA 5CP1A 3G7IA 4POBA 2YZUA 1B9YC 2VCWA 1GNWA 2MBTA 3GKXA 3DMLA 1GTAA 4TR1B 3FR3A 1NW2A 1TJDA 1VF4A 3C8EA 4NV5A 3GKMA 3WYWA 3WGXA 4KSOA 2WRTA 3RPPA 4MJEA 5DBQA 5D9XA 3ZRDA 4PQ1A 2F8AA 2IMKA 2GVPA 1R5PA 4F82A 4N30A 1U3AA 4P3YB 2AUVA 4NHZA 2GT5A 1Z3EA 2VLUA 2JACA 4Q5FA 3HKRA 1XOAA 1EOHA 1GWCA 3TCOA 2H75A 2HZEA 2TIRA 3M8NA 1T3BA 1YZXA 4KAEA 2PU9C 1K0CA 5LNKe 3NZNA 1SK1A 3WD6A 4EC0A 5DCGA 4IELA 2AAWA 3G7YA 4EF0A 1XIYA 1BEDA 3FR6A 5F05A 3H4KA 1FVKA 3VI5A 1GTBA 3F63A 4GTUA 3GYKA 1JZDA 3FEUA 1K0MA 5FWGA 3U5RE 1TRWA 1MEKA 1EV9A 1GLQA 3W8SA 2YV9A 1HD2A 1GSDA 3N9JA 1ZCPA 3M3MA 4XRAA 4ULXA 2B7KA 2H6YA 4PUFC 2V6OA 3FY7A 4KUNA 3QMXA 3FR9A 1YKAA 1F6MC 2FD3A 1TI3A 3IA1A 3HA9A 2O85A 5B6MA 2CV4A 1K3YA 2X64A 4CHSA 4Q5NA 2HI7A 4D73A 3TB2A 2OKAA 2G0FA 2WDUA 2R5GA 1ERVA 5CYYA 4HQSA 3V1WA 3UMAA 1A8YA 3ERFA 3TJFA 4HJMA 3KH9A 1WE0A 4OFTA 5ECKB 2HXKA 2HLSA 2IMFA 3GSSA 1X9WB 2C0FA 3Q6OA 1SENA 2M80A 3FZAA 1A2MA 4PQIA 3EURA 5JCWA 2IWTA 3PINA 1TP9A 3M1GA 2VCZA 3VPTA 1K3LA 1UC7A 2LQQA 5FT3A 4AGSA 4OCEA 2H0IA 1M9BA 4CW9A 3PGTA 1MTCA 3RPNA 1R5AA 2H1AA 1V58A 4GWRA 4TOPA 1XXUA 1GLPA 1MDJA 1BQ7A 1OC8A 4QQ7A 1G7EA 5CRDA 2WULA 3MSZA 4HUAA 3LGCA 3UL3A 1K0OA 2MMNA 5AIVA 2H8LA 2R6KA 5DCHA 1JFUA 2H71A 2ZNMA 1TRUA 2FWEA 1E2YA 3HD5A 1GUKA 4WETA 5KN1A 2HZFA 1OKTA 4FYBA 2HSHA 3BJ5A 3GKKA 3KP8A 3HVSA 1AXDA 1WPIA 4MP4A 3DXBA 2JSYA 4FYUA 1Q4JA 1OAZA 2X8HA 1MD4A 1QQ2A 2DSAA 3CMIA 3I6AA 4NXIA 2YWOA 2IMIA 1SK0A 3PR8A 3QAGA 2V1MA 2BTOT 4LL4B 4L5OA 3TKQA 4H86A 1GTUA 1F3AA 2C0DA 3F0IA 3HZ4A 2FA8A 2TRCP 2LKUA 1SKRB 5HR3A 1OYJA 1PA3A 1PN9A 1DUGA 1SU9A 1GP1A 1HNBA 1XFLA 3ZTLA 4MDCA 3UIWA 2TRXA 3A3TA 3GUSA 1SD8A 1GRXA 2GSTA 5CRWA 2DJ2A 4POKA 2PMTA 1W4VA 4OMVA 4KB3A 4OD7A 1BAYA 3IDVA 2REMA 3M9KA 5AISA 2OA7A 3TRPA 4V2NA 5CREA 2XC2A 3E0UA 5FHIA 2GT6A 5GSTA 4GXZA 3O3TA 5G30A 5ECMB 1O6JA 3LXZA 5JWQB 4TR1A 1USBA 1BJXA 1F37A 3ZVJA 3KTBA 3LFLA 2H01A 4KW6A 2GDRA 1Z7PA 1WP0A 3M0FA 1OC3A 2RIIA 4I5QA 1M2BA 2GZPA 4K0NA 1I5GA 4HU9A 2PGTA 4OO5A 2P31A 4HOJA 4XCSA 4KDYA 2GQMA 3DVXA 3L9UA 1O8WA 4GCIA 4RQRA 2K8SA 4YAVA 3GH6A 2X8GA 4IJ3A 3I43A 1SK2A 1R4WA 3EVIA 2LRNA 3IXRA 2HRFA 1ACVA 4WKWA 3TGZA 4DVCA 4MJBA 1V40A 2IN3A 2H70A 5CNWA 5HR0A 6GSTA 19GSA 1DE2A 1ZYQB 22GSA 1ZL9A 3BCKA 4G10A 1A0RP 2J9HA 2DJ0A 3RHCA 5IM9A 4L8EA 3J7Yb 2VLTA 3F8UA 3P90A 3QR6A 3I9V2 1S3DA 1EP7A 1KNGA 4YQMA 4OO4A 4YH2A 2B1KA 4V1Ag 2QSIA 3QCPA 1SYXA 1XW9A 2H6XA 4TVEA 3FK8A 4GRFA 3IK9A 1V2AA 2VL3A 1ZYEA 2B5YA 4KNDA 5J41A 5EVOA 2C3TA 2PPTA 4YQVA 4NPBA 2CQ9A 4DSSA 1KBNA 1VF2A 6GSYA 2VD0A 3VI7A 4POLA 1K0BA 2FA4A 2LJKA 4IP6A 1A8LA 2LTKA 1QGVA 4IQAA 3MWHA 2AYTA 2DJ3A 3HYPA 3RDWA 2B1LA 3D21A 5HFGA 4I8BA 3TKSC 1YEPA 1X9SB 1UVZA 1FG4A 3VPQA 2M46A 1YY7A 16GSA
chains in the Genus database with same CATH superfamily
2VCVA 2H1GA 2H19A 4FIWA 5DAKB 9GSSA 5IMVA 1PSQA 4AJ6A 1ERTA 2GQLA 5A4UA 1K3OA 1EZKA 4TXVA 1XBSA 3KGKA 1M3JA 2RUFA 5ECIB 2CT6A 4KDXA 4G0LA 1O81A 2K6VA 3P2AA 1PQNA 4YKFA 1ZGNA 3VLNA 2VAFA 2A4VA 1Q98A 5IMFA 3HJPA 3DKSA 4K1FA 5KN2A 1OE7A 4ZILA 1LU4A 4G19A 5D9WA 4KX4A 4BVXB 5F07A 4MZWA 1X5DA 2JZTA 3UVTA 2GS3A 4HI7A 3KIJA 3GX8A 4XHMA 1J08A 4OFNA 1O73A 5JCGA 4XS1A 1TW9A 2KP2A 1A2LA 3CSJA 1PKWA 3H1NA 2I3YA 2K9FA 4FYCA 4MCUA 4AJ8A 5LD0A 2DIYA 5ECLB 1PD21 2ALBA 4X43A 2YN1A 4O5RA 5A4WA 3UEMA 2EIOA 3KEBA 2HYXA 5HR1A 3HY2A 4MABA 1FB6A 2ZCTA 1XVWA 3EMXA 4WR4A 3UVHA 2OBIA 4HSCX 2VL9A 4BL7B 4KDUA 5G2ZA 3BCIA 4JE1A 2ZUPA 2AB6A 1XWCA 1OC9B 2MBSA 1ABAA 1LBKA 3C1RA 4KCEA 4J56E 1TKDB 3H79A 3ZITA 4J2FA 4I97A 4ISDA 1A23A 4IJIA 2O8VB 2C80A 3ERWA 2EIQA 3UOMA 8GSSA 2V32A 1T4ZA 2HSMA 2IFQB 4F2IA 4Z2UA 4KCAA 2B5XA 1TU8A 1PX6A 1OE8A 3ZFBA 4PQHA 1FW1A 2H1BA 2FGXA 3QFBC 2WJUA 1XPVA 1I9DA 3IBHA 12GSA 3TOUA 1YF1A 4ID0A 1F3BA 1H75A 2MZCA 2N5BA 2RM6A 4Z7XA 1GSQA 2YP6A 1GUHA 3P7XA 1X5EA 3J7Yk 4KH7A 2R0GA 5IMDA 3IC4A 3A2VA 1QMVA 3GL5A 1ZMAA 3CXGA 4PTSA 5AN1A 1JZOA 4E8EA 2C0GA 3RHBA 2VM2A 3LORA 3DIEA 4Q5RA 1EP8A 3G9BA 4F0BA 5KEJA 2UZ8A 4PNGA 3HVXA 3ISOA 3KTLA 5HQPA 1T7PB 3QAWA 3DRNA 4N10A 3TRQA 1B4QA 4HZ4A 2O7KA 3EWLA 1WMJA 2PN8A 5INYA 3CYNA 2O89A 2D2ZA 2VM1A 4I2UA 4OCFA 1NSWA 13GSA 2FNOA 4NHWA 1GTIA 3L78A 2DJKA 1SYRA 3VWXA 2V2GA 3E3EA 3QD9A 2AV4A 4NAXA 4IVFA 1TU7A 4JZQA 2HFDA 4IBPA 3TDGA 2I81A 2PUKC 4PURA 4XRDA 3TJGA 4F9ZA 2WFCA 1DSBA 1AC1A 4IN0A 3KXOA 3R3EA 4IKHA 3VURA 3QDNA 1YKCA 4BVYB 1O7UA 4ML6A 2HRNA 3D4TA 2ES7A 3LG6A 3F6FA 3UARA 1QFNA 5IOWA 1T1VA 3F4SA 3DYRA 2C1YA 4PXOA 2EC4A 2CX4A 2A2PA 2L4QA 3ERGA 5J9CA 5COHA 4WF5A 6GSSA 5B6NA 4NWYA 4K0GA 1SJ6A 2LSTA 3EC3A 2GTUA 5IMAA 1A2JA 2ON7A 18GSA 3HJOA 1NHOA 2WZ9A 3D0ZA 3DEXA 3EU4A 2LJAA 3KD0A 1O85A 5IPGA 3UBLA 5H5SA 1FHEA 2JZSA 4EIQA 4POMA 3C71A 1JLWA 1URMA 4TR3A 2QC7A 3TKPA 2K18A 2YWIA 20GSA 1SKWB 3EU3A 3PH9A 5D96A 3FKFA 1MDIA 1ZYPA 3EMPA 4EIPA 3GFKA 1NM3A 5A4VA 4I6XA 2IMDA 2H74A 1X5CA 2GSRA 3ZMKA 1KEBA 4TW5A 5ELGA 1ERWA 4WR5A 2NPBA 2N5FA 4MNNA 4K9ZA 4USSA 4BVXA 4XIHA 3W6GA 2L57A 2DMMA 4N0VA 1QUWA 4MF5A 1XOBA 4HZ2A 2H73A 3L9VA 2LS5A 5EY6A 3CSHA 2XHFA 3ME8A 5JWOB 5DDLA 1EGRA 1SL2B 2E0QA 4MA9A 5ECNB 3QOUA 1TXXA 1F2EA 3N5OA 2H1DA 4YAPA 5CO3A 5LCZA 2JSZA 2DBCA 3FYGA 3LYKA 4XS4B 2IIYA 4O32A 3IV4A 4CDOA 2FWGA 2M72A 1M2AA 2OE1A 5B8AA 1WIKA 4RUVA 2OBKA 4A5PA 2LV3A 4JBBA 1IYHA 4X4JA 2CA8A 4K7NA 4TXOB 5AGYA 5C00A 4DSQA 4WXTA 3GL3A 1TK8B 5GZZB 2FCHA 3KP9A 1THOA 3W8JA 1FO5A 4IHUA 1MDKA 3D6IA 3QPMA 5IMZA 4KSMA 2VL2A 6GSXA 2AHEA 1X9MB 1YF0A 5C04A 4F0CA 4O5UA 2H76A 3FW2A 4MLYA 5ENUA 1YJ6A 3CRUA 4DSRA 3IOSA 6GSUA 1XZOA 1HNCA 2MMZA 3A2XA 3HXSA 2HNLA 1RW1A 3ZIVA 1M3IA 5GAND 3KH7A 4TRXA 4KGIA 1AQXA 1XVQA 5D9VA 2VO4A 1WWJA 1JZRA 4MF7A 2C4JA 2XBIA 3TUEA 4YKGA 5G1LA 5CRGA 3GNJA 1GUMA 3PPUA 2LQOA 3ZZXA 1JZWA 4E8HA 2PWJA 2VUPA 3ZFLA 4D73B 1SD9A 1XWGA 5F0GA 3GURA 5D73A 4ZL8A 1GH2A 2HSYA 2QA2A 1U88A 3MIXA 3HVNA 3UBKA 1TRVA 3HHVA 4EDZA 1PMTA 1SL0B 2QKEA 2I4AA 3FZ4A 2LEGA 3C7MA 1TK0B 3TKSE 5EL8A 2RM5A 3TJKA 5DJMA 4KA0A 3KMNA 3TRXA 2L59A 4EE0A 3ZVJD 2GGTA 4ZBDA 1S3AA 2N5AA 1A0FA 2E7PA 5JWRB 1J9BA 2JZRA 3R2QA 1V57A 4NMUA 17GSA 4L0UA 4BWQA 1V98A 2YWMA 2R0CA 2G2QA 4G2EA 2RUEA 3H93A 1GSYA 4MZCA 4JEDA 3GX0A 4FH8A 4NV2A 3FHKA 1CQHA 4AF2A 4GQFA 1BYEA 3FZ5A 2R37A 1OVNA 4BWSA 4K2DA 4LA1A 5AIXA 2NTOA 5G5FA 1WRYA 1U6TA 3TJJA 1TRSA 4ACSA 2YJHA 1ZZYA 3MAKA 3ZYWA 2FWHA 1Y6EA 1QXHA 1G0TA 4BVYA 2BMXA 5G5EA 3BD2A 2DJJA 1JLVA 1G6YA 1Z5YE 2CX3A 4GSTA 4N0ZA 4OWYA 3IAS2 5KOXA 1XWBA 7GSSA 2R4VA 2BJXA 4F03A 3Q18A 4ZBAA 1XW6A 2H72A 2LJRA 5IO0A 2B3SA 1ON4A 5ABRA 4G0KA 1AQWA 1PGTA 2DLXA 4GSSA 4BPYA 4WBJA 4K6XA 1YDKA 3UJ1A 2PVQA 4K8MA 6GSVA 5DVBA 1Y25A 1R26A 5CAXA 3DVWA 2P5QA 1TDIA 3WGEA 1Z6NA 2CVBA 3EINA 4MK3A 2LNTA 1GSSA 3TJBA 4L5LA 3NIVA 2A2SA 1Z6MA 2YWNA 3KM6A 4I2TA 2CZ2A 3EYTA 5KN3A 1UN2A 4JU5A 1PX7A 3DGQA 5DJLA 1PL2A 4HS1A 2KP1A 3S9FA 4WF4A 2H0HA 1AQVA 2R3XA 3GA4A 2YANA 5DALB 4XS4A 5IQYA 3D4MA 3D5JA 3MYDA 5JCUA 3A5WA 5ECHB 4EKZA 4BA7A 3C1SA 3FRCA 4TXOA 4X0XA 4TKYA 3F3RA 3TKSA 1EGOA 3K8NA 2J23A 4ILFA 3FZ9A 3GMFA 2FUG2 1ERUA 3F3QA 3TOTA 4X1UA 2JU5A 3LQ7A 4CY8A 3KMOA 2AJQB 1EEJA 2IPAA 6GSWA 3CTGA 4ML1A 4IW9A 1G7OA 1AW9A 2HE3A 2I9HA 3LW9A 3KJYA 3WT2A 4ECJA 2LRCA 3CRTA 1AUCA 1S3RA 1FOHA 4IGJA 2WGRA 1QK8A 4XTSA 5EPFA 2X49A 1S3CA 4MJCA 3GTUB 1XG8A 4GLTA 1J0FA 2HT9A 5KN0A 4RQXA 1F9MA 1M99A 3M9JA 4EVMA 3GKNA 4JR4A 2C8UA 1YEXA 2JL4A 2NVLA 3F6DA 3OR5A 3IR4A 4MF6A 1BX9A 5A5KA 4K7OA 2XPDA 3ZLPA 1UA5A 1AAZA 1K0AA 3QFAC 1B8XA 2YZHA 4QL9A 1V9WA 2FLSA 2B7JA 1NHYA 3F4TA 5J3RA 1WJKA 3RBTA 5H5RA 1CQGA 3WT1A 4QL7A 2F8FA 4ZB9A 3U6VA 1RK4A 4HDEA 3APQA 4MPGA 1VF1A 2F3MA 4DSSB 4TN8A 2WS2A 2KOKA 2C0EA 4HQZA 4DEJA 1T4YA 4G9HA 1M2DA 4ZL7A 2OADA 4LL1B 5DQSA 4MJAA 5CRHA 1PKZA 1GL8A 3F4RA 2X8CA 3GV1A 1GULA 5DQYA 3C73A 5IIZA 1EEMA 3LEFA 2YJ7A 3VFIA 2FY6A 4JR6A 1LJRA 5HFKA 3US3A 4FO5A 4TR4A 3F9UA 2MMOA 2E2GA 2VL2C 4ECCA 1OKDA 2F9SA 5L71A 2PERA 2IL3A 1A24A 4LLRA 2PBJA 4MH3A 2L6DA 2C3NA 1GSFA 2VCXA 4O7HA 4EUYA 1ILOA 4O92A 3DWVA 3GHAA 5DAKA 2VCQA 3LYPA 2KHPA 1Z7RA 1THXA 1M0UA 3ME7A 3HDCA 1Z9HA 5ELAA 4LMVA 4PX1A 3D22A 1HNAA 2OE0A 2MMAA 2H6ZA 3HZ8A 2DC5A 2PVOC 1RQMA 2V41A 4HEA2 2DJ1A 4ECBA 4K7IA 2H66A 5ECOB 3IHQA 5ID2B 1ZOFA 5G31A 1VRSD 4RI6A 3IRAA 1B9XC 1U87A 2GLRA 1FOVA 3A2WA 2ON5A 3JCML 2YPMA 3ZMLA 5D9TA 2KLXA 3E9JB 1ST9A 5F06A 3Q74A 3MDKA 5H5QA 4G0IA 4RI7A 2VLVA 3VWUA 3GH9A 1HYUA 4L0WA 2CVDA 5ECPB 3ZL5A 3GRXA 3IK7A 4IS0A 4HJ2A 1FAAA 2YCDA 5IOXA 1VGLA 4Z2TA 1XW5A 5HFIA 3LWAA 1GSUA 3HJMA 2NDOA 2H30A 4EXJA 1SJIA 4AJ7A 2HZEB 2FWFA 4MPFA 2DMLA 2R2JA 1M7TA 3KZQA 4BL7A 2KUCA 5ECSA 3MNGA 2OE3A 2V6KA 5IO2A 2L6CA 1EV4A 4Q5QA 3UAPA 1TK5B 2L4CA 1OC9A 1WOUA 2EIRA 3NOFA 5DALA 3IPZA 2I1UA 2B5EA 5E4WA 1AIUA 4ZB8A 4IQ1A 5F8BA 1YQ1A 3BOAA 2XPEA 2CAQA 2IFQA 2B6MA 2LUSA 3IE3A 4WBRD 4OFMA 1SJZA 1XWKA 2GQKA 1X0RA 1ZYNA 1E6BA 3QAVA 2GZZA 2GSQA 3LSZA 3TKRA 3SWLA 4K5RA 5J5NA 3HVVA 4GSNA 5B8BA 3SBCA 5IPHA 1N8JA 2CZ3A 3GSTA 4GF0A 4PGTA 2L5OA 4MZBA 3L0HA 3ZIJA 1FB0A 1G6WA 4EL1A 2E2MA 4O5QA 5GAPD 2XBQA 4JRRA 4GQCA 5ECQB 1EWXA 1TOFA 1SL1B 2C3QA 3APSA 2LRTA 3GTUA 5BMUA 2Z9SA 1TI1A 2VCTA 2OACA 4KE3A 4ZIJA 2GZYA 3CBUA 3ZREA 4MMMA 5GSSA 3LJRA 5HR2A 3AY8A 2MYGA 3IAM2 3KCMA 2IJYA 5ECRB 3VWWA 1EOGA 4XS6A 4ZL9A 2GSSA 2K8VA 1MD3A 1K0NA 1XCCA 5D8IA 3BBYA 5D93A 3HCZA 1R7HA 4ECIA 2P5RA 4J57E 3I69A 2QGVA 2YV7A 1N2AA 1IYIA 5G1KA 2R0PA 1O8XA 2OJLA 1C72A 3VWVA 4EO3A 3GN3A 2X99A 3EE2A 4ZXGA 3LXTA 1KTEA 1B48A 1B4PA 5E59A 1BG5A 2YNXA 1GNEA 1XWAA 1U3IA 3O76A 3VK9A 3WGDA 2VD1A 2LNSA 2VOCA 3CSIA 3O6TA 1T00A 4EDYA 3RAZA 1W89A 4ZBBA 1FVJA 1VF3A 4MH2A 14GSA 1JHBA 4YQUA 4PUAA 3CTFA 5J9BA 2CAIA 11GSA 4IP1A 3APOA 5J4UA 1T8EB 4N11A 2P0GA 4PNFA 1DBYA 2H0GA 2DIZA 2FHEA 2JADA 4V2LA 2WB9A 3ED3A 2WCIA 3GIXA 4HU7A 3DD3A 1K0DA 5B7CA 4V1Ap 2F51A 2NBSA 4V2MA 4TR0A 10GSA 3L4NA 2YOIA 2O87A 4ZB6A 1M9AA 1PL1A 1H4OA 2VIMA 3Q19A 2A2RA 1SKSB 5IMCA 1ML6A 1TTZA 2RLIA 1HQOA 1DE1A 3L9SA 1PN0A 2L5LA 3G7JA 2CVKA 4WEYA 3H8QA 1PRXA 1GSEA 4LMWA 5ID2A 3P8WA 2IMEA 5CP1A 3G7IA 4POBA 2YZUA 1B9YC 2VCWA 1GNWA 2MBTA 3GKXA 3DMLA 1GTAA 4TR1B 3FR3A 1NW2A 1TJDA 1VF4A 3C8EA 4NV5A 3GKMA 3WYWA 3WGXA 4KSOA 2WRTA 3RPPA 4MJEA 5DBQA 5D9XA 3ZRDA 4PQ1A 2A4HA 2F8AA 2IMKA 4BIKA 2GVPA 1R5PA 4F82A 4N30A 1U3AA 4P3YB 5KOWA 2AUVA 4NHZA 2GT5A 1Z3EA 2VLUA 2JACA 4Q5FA 3HKRA 1XOAA 1EOHA 1GWCA 3TCOA 2H75A 2HZEA 2TIRA 3M8NA 1T3BA 1YZXA 4KAEA 2PU9C 1K0CA 5LNKe 3NZNA 16GSA 1SK1A 3WD6A 4EC0A 5DCGA 4IELA 2AAWA 3G7YA 4EF0A 1XIYA 1BEDA 4CY6A 3FR6A 5F05A 3H4KA 1FVKA 3VI5A 2HRAA 1GTBA 3F63A 4GTUA 3GYKA 1JZDA 3FEUA 1K0MA 5FWGA 3U5RE 1TRWA 1MEKA 1EV9A 2QA1A 1GLQA 3W8SA 2YV9A 1HD2A 1GSDA 3N9JA 1ZCPA 3M3MA 4XRAA 4ULXA 2B7KA 2H6YA 4PUFC 2V6OA 3FY7A 4KUNA 3QMXA 3FR9A 1YKAA 1F6MC 2FD3A 1TI3A 3IA1A 3HA9A 2O85A 5B6MA 2CV4A 1K3YA 2X64A 4CHSA 4K5SA 4Q5NA 2HI7A 4D73A 3TB2A 2OKAA 2G0FA 2WDUA 2R5GA 1ERVA 5CYYA 3FMWA 4HQSA 3V1WA 3UMAA 1A8YA 3ERFA 3TJFA 4HJMA 3KH9A 1WE0A 4ICYA 4OFTA 5ECKB 2HXKA 2HLSA 2IMFA 3GSSA 1X9WB 2C0FA 3Q6OA 1SENA 2M80A 3FZAA 1A2MA 4PQIA 3EURA 5JCWA 2IWTA 3PINA 5BRTA 1TP9A 3M1GA 2VCZA 3VPTA 1K3LA 1UC7A 2LQQA 5FT3A 4AGSA 4OCEA 2H0IA 1M9BA 4CW9A 3EPTA 1MTCA 3PGTA 3RPNA 2DKHA 1R5AA 2H1AA 1V58A 4GWRA 4TOPA 1XXUA 1GLPA 1MDJA 1BQ7A 1OC8A 4QQ7A 1G7EA 5CRDA 2WULA 3MSZA 4HUAA 3LGCA 3UL3A 1K0OA 4FQUA 2MMNA 5AIVA 2H8LA 2R6KA 5DCHA 1JFUA 2H71A 2ZNMA 1TRUA 2FWEA 1E2YA 3HD5A 1GUKA 4WETA 5KN1A 2HZFA 1OKTA 4FYBA 2HSHA 3BJ5A 3GKKA 3KP8A 3HVSA 1AXDA 1WPIA 4MP4A 3DXBA 2JSYA 4FYUA 1Q4JA 1OAZA 2X8HA 1MD4A 1QQ2A 2DSAA 3CMIA 3I6AA 4NXIA 2YWOA 2IMIA 1SK0A 3PR8A 3QAGA 2V1MA 2BTOT 4LL4B 4L5OA 3TKQA 4H86A 1GTUA 1F3AA 2C0DA 3F0IA 3HZ4A 2FA8A 2TRCP 2LKUA 1SKRB 5HR3A 1OYJA 1PA3A 1PN9A 1DUGA 1SU9A 1GP1A 1HNBA 1XFLA 4KF9A 3ZTLA 4MDCA 3UIWA 2TRXA 3A3TA 3GUSA 1SD8A 1GRXA 2GSTA 5CRWA 2DJ2A 4POKA 2DKIA 2PMTA 1W4VA 4OMVA 4KB3A 4OD7A 1BAYA 3IDVA 2REMA 3M9KA 5AISA 2OA7A 3TRPA 4V2NA 5CREA 2XC2A 3E0UA 5FHIA 2GT6A 5GSTA 4GXZA 3O3TA 5G30A 5ECMB 1O6JA 3LXZA 5JWQB 4TR1A 1USBA 1BJXA 1F37A 3ZVJA 3KTBA 4K2XA 3LFLA 2H01A 4KW6A 2GDRA 1Z7PA 1WP0A 3M0FA 1OC3A 2RIIA 4I5QA 1M2BA 2GZPA 2X4AA 4K0NA 1I5GA 4HU9A 2PGTA 4OO5A 2P31A 4HOJA 4XCSA 4KDYA 2GQMA 3DVXA 3L9UA 1O8WA 4GCIA 4RQRA 2K8SA 3CQFA 4YAVA 3GH6A 2X8GA 4IJ3A 3I43A 1SK2A 1R4WA 3EVIA 2LRNA 3IXRA 2HRFA 1ACVA 4WKWA 3A5IA 3TGZA 4DVCA 4MJBA 1V40A 2IN3A 2H70A 5CNWA 5HR0A 6GSTA 19GSA 1DE2A 1ZYQB 22GSA 1ZL9A 3BCKA 4G10A 1A0RP 2J9HA 2DJ0A 3RHCA 5IM9A 4L8EA 3J7Yb 2VLTA 3F8UA 3P90A 3IC8A 3QR6A 3I9V2 1S3DA 1EP7A 1KNGA 4YQMA 4OO4A 4YH2A 2B1KA 4V1Ag 2QSIA 3QCPA 1SYXA 1XW9A 2H6XA 4TVEA 3FK8A 4GRFA 3IK9A 1V2AA 2VL3A 1ZYEA 2B5YA 4KNDA 5J41A 5EVOA 2C3TA 2PPTA 4YQVA 4NPBA 2CQ9A 4DSSA 1KBNA 1VF2A 4Z2RA 6GSYA 2VD0A 3VI7A 4POLA 1K0BA 2FA4A 2LJKA 4IP6A 1A8LA 1PFOA 2LTKA 1QGVA 4IQAA 3MWHA 2AYTA 2DJ3A 3HYPA 3RDWA 2B1LA 3D21A 5HFGA 4I8BA 3TKSC 1YEPA 1X9SB 2HRKA 1UVZA 1FG4A 3VPQA 2M46A 1YY7A 3IHGA
chains in the Genus database with same CATH topology
2VCVA 2H1GA 2H19A 4FIWA 5DAKB 9GSSA 5IMVA 1PSQA 4AJ6A 1ERTA 2GQLA 5A4UA 1K3OA 1EZKA 4TXVA 1XBSA 3KGKA 2RUFA 5ECIB 2CT6A 4KDXA 4G0LA 1O81A 2K6VA 3P2AA 1PQNA 4YKFA 1ZGNA 3VLNA 2VAFA 2A4VA 1Q98A 5IMFA 3HJPA 3DKSA 4K1FA 5KN2A 1OE7A 4ZILA 1LU4A 4G19A 5D9WA 4KX4A 4BVXB 5F07A 4MZWA 1X5DA 2JZTA 3UVTA 2GS3A 4HI7A 3KIJA 3GX8A 4XHMA 1J08A 4OFNA 1O73A 5JCGA 4XS1A 1TW9A 2KP2A 1A2LA 3CSJA 1PKWA 3H1NA 2I3YA 2K9FA 4FYCA 4MCUA 4AJ8A 5LD0A 2DIYA 5ECLB 1PD21 2ALBA 4X43A 2YN1A 4O5RA 5A4WA 3UEMA 2EIOA 3KEBA 2HYXA 5HR1A 3HY2A 4MABA 1FB6A 2ZCTA 1XVWA 3EMXA 4WR4A 3UVHA 2OBIA 2VL9A 4BL7B 4KDUA 5G2ZA 3BCIA 4JE1A 2ZUPA 2AB6A 1XWCA 1OC9B 2MBSA 1ABAA 1LBKA 3C1RA 4KCEA 4J56E 1TKDB 3H79A 3ZITA 4J2FA 4I97A 4ISDA 1A23A 4IJIA 2O8VB 2C80A 3ERWA 2EIQA 3UOMA 8GSSA 2V32A 1T4ZA 2HSMA 2IFQB 4F2IA 4Z2UA 4KCAA 2B5XA 1TU8A 1PX6A 1OE8A 3ZFBA 4PQHA 1FW1A 2H1BA 2FGXA 3QFBC 2WJUA 1XPVA 1I9DA 3IBHA 12GSA 3TOUA 1YF1A 4ID0A 1F3BA 1H75A 2MZCA 2N5BA 2RM6A 4Z7XA 1GSQA 2YP6A 1GUHA 3P7XA 1X5EA 3J7Yk 4KH7A 2R0GA 5IMDA 3IC4A 3A2VA 1QMVA 3GL5A 1ZMAA 3CXGA 4PTSA 5AN1A 1JZOA 4E8EA 2C0GA 3RHBA 2VM2A 3LORA 3DIEA 4Q5RA 1EP8A 3G9BA 4F0BA 5KEJA 2UZ8A 4PNGA 3HVXA 3ISOA 3KTLA 5HQPA 1T7PB 3QAWA 3DRNA 4N10A 3TRQA 1B4QA 4HZ4A 2O7KA 3EWLA 1WMJA 2PN8A 5INYA 3CYNA 2O89A 2D2ZA 2VM1A 4I2UA 4OCFA 1NSWA 13GSA 2FNOA 4NHWA 1GTIA 3L78A 2DJKA 1SYRA 3VWXA 2V2GA 3E3EA 3QD9A 2AV4A 4NAXA 4IVFA 1TU7A 4JZQA 2HFDA 4IBPA 3TDGA 2I81A 2PUKC 4PURA 4XRDA 3TJGA 4F9ZA 2WFCA 1DSBA 1AC1A 4IN0A 3KXOA 3R3EA 4IKHA 3VURA 3QDNA 1YKCA 4BVYB 1O7UA 4ML6A 2HRNA 3D4TA 2ES7A 3LG6A 3F6FA 3UARA 1QFNA 5IOWA 1T1VA 3F4SA 3DYRA 2C1YA 4PXOA 2EC4A 2CX4A 2A2PA 2L4QA 3ERGA 5J9CA 5COHA 4WF5A 6GSSA 5B6NA 4NWYA 4K0GA 1SJ6A 2LSTA 3EC3A 2GTUA 5IMAA 1A2JA 2ON7A 18GSA 3HJOA 1NHOA 2WZ9A 3D0ZA 3DEXA 3EU4A 2LJAA 3KD0A 1O85A 5IPGA 3UBLA 5H5SA 1FHEA 2JZSA 4EIQA 4POMA 3C71A 1JLWA 1URMA 4TR3A 2QC7A 3TKPA 2K18A 2YWIA 20GSA 1SKWB 3EU3A 3PH9A 5D96A 3FKFA 1MDIA 1ZYPA 3EMPA 4EIPA 3GFKA 1NM3A 5A4VA 4I6XA 2IMDA 2H74A 1X5CA 2GSRA 3ZMKA 1KEBA 4TW5A 5ELGA 1ERWA 4WR5A 2NPBA 2N5FA 4MNNA 4K9ZA 4USSA 4BVXA 4XIHA 3W6GA 2L57A 2DMMA 4N0VA 1QUWA 4MF5A 1XOBA 4HZ2A 2H73A 3L9VA 2LS5A 5EY6A 3CSHA 2XHFA 3ME8A 5JWOB 5DDLA 1EGRA 1SL2B 2E0QA 4MA9A 5ECNB 3QOUA 1TXXA 1F2EA 3N5OA 2H1DA 4YAPA 5CO3A 5LCZA 2JSZA 2DBCA 3FYGA 3LYKA 4XS4B 2IIYA 4O32A 3IV4A 4CDOA 2FWGA 2M72A 1M2AA 2OE1A 5B8AA 1WIKA 4RUVA 2OBKA 4A5PA 2LV3A 4JBBA 1IYHA 4X4JA 2CA8A 4K7NA 4TXOB 5AGYA 5C00A 4DSQA 4WXTA 3GL3A 1TK8B 5GZZB 2FCHA 3KP9A 1THOA 3W8JA 1FO5A 4IHUA 1MDKA 3D6IA 3QPMA 5IMZA 4KSMA 2VL2A 6GSXA 2AHEA 1X9MB 1YF0A 5C04A 4F0CA 4O5UA 2H76A 3FW2A 4MLYA 5ENUA 1YJ6A 3CRUA 4DSRA 3IOSA 6GSUA 1XZOA 1HNCA 2MMZA 3A2XA 3HXSA 2HNLA 1RW1A 3ZIVA 5GAND 3KH7A 4TRXA 4KGIA 1AQXA 1XVQA 5D9VA 2VO4A 1WWJA 1JZRA 4MF7A 2C4JA 2XBIA 3TUEA 4YKGA 5G1LA 5CRGA 3GNJA 1GUMA 3PPUA 2LQOA 3ZZXA 1JZWA 4E8HA 2PWJA 2VUPA 3ZFLA 4D73B 1SD9A 1XWGA 5F0GA 3GURA 5D73A 4ZL8A 1GH2A 2HSYA 2QA2A 1U88A 3MIXA 3UBKA 1TRVA 3HHVA 4EDZA 1PMTA 1SL0B 2QKEA 2I4AA 3FZ4A 2LEGA 3C7MA 1TK0B 3TKSE 5EL8A 2RM5A 3TJKA 5DJMA 4KA0A 3KMNA 3TRXA 2L59A 4EE0A 3ZVJD 2GGTA 4ZBDA 1S3AA 2N5AA 1A0FA 2E7PA 5JWRB 1J9BA 2JZRA 3R2QA 1V57A 4NMUA 17GSA 4L0UA 4BWQA 1V98A 2YWMA 2R0CA 2G2QA 4G2EA 2RUEA 3H93A 1GSYA 4MZCA 4JEDA 3GX0A 4FH8A 4NV2A 3FHKA 1CQHA 4AF2A 4GQFA 1BYEA 3FZ5A 2R37A 1OVNA 4BWSA 4K2DA 4LA1A 5AIXA 2NTOA 5G5FA 1WRYA 1U6TA 3TJJA 1TRSA 4ACSA 2YJHA 1ZZYA 3MAKA 3ZYWA 2FWHA 1Y6EA 1QXHA 1G0TA 4BVYA 2BMXA 5G5EA 3BD2A 2DJJA 1JLVA 1G6YA 1Z5YE 2CX3A 4GSTA 4N0ZA 4OWYA 3IAS2 5KOXA 1XWBA 7GSSA 2R4VA 2BJXA 4F03A 3Q18A 4ZBAA 1XW6A 2H72A 2LJRA 5IO0A 2B3SA 1ON4A 5ABRA 4G0KA 1AQWA 1PGTA 2DLXA 4GSSA 4BPYA 4WBJA 4K6XA 1YDKA 3UJ1A 2PVQA 4K8MA 6GSVA 5DVBA 1Y25A 1R26A 5CAXA 3DVWA 2P5QA 1TDIA 3WGEA 1Z6NA 2CVBA 3EINA 4MK3A 2LNTA 1GSSA 3TJBA 4L5LA 3NIVA 2A2SA 1Z6MA 2YWNA 3KM6A 4I2TA 2CZ2A 3EYTA 5KN3A 1UN2A 4JU5A 1PX7A 3DGQA 5DJLA 1PL2A 4HS1A 2KP1A 3S9FA 4WF4A 2H0HA 1AQVA 2R3XA 3GA4A 2YANA 5DALB 4XS4A 5IQYA 3D4MA 3D5JA 3MYDA 5JCUA 3A5WA 5ECHB 4EKZA 4BA7A 3C1SA 3FRCA 4TXOA 4X0XA 4TKYA 3F3RA 3TKSA 1EGOA 3K8NA 2J23A 4ILFA 3FZ9A 3GMFA 2FUG2 1ERUA 3F3QA 3TOTA 4X1UA 2JU5A 3LQ7A 4CY8A 3KMOA 2AJQB 1EEJA 2IPAA 6GSWA 3CTGA 4ML1A 4IW9A 1G7OA 1AW9A 2HE3A 2I9HA 3LW9A 3KJYA 3WT2A 4ECJA 2LRCA 3CRTA 1AUCA 1FOHA 4IGJA 2WGRA 1QK8A 4XTSA 5EPFA 2X49A 1S3CA 4MJCA 3GTUB 4GLTA 1J0FA 2HT9A 5KN0A 4RQXA 1F9MA 1M99A 3M9JA 4EVMA 3GKNA 4JR4A 2C8UA 1YEXA 2JL4A 2NVLA 3F6DA 3OR5A 3IR4A 4MF6A 1BX9A 5A5KA 4K7OA 2XPDA 3ZLPA 1UA5A 1AAZA 1K0AA 3QFAC 1B8XA 2YZHA 4QL9A 1V9WA 2FLSA 2B7JA 1NHYA 3F4TA 5J3RA 1WJKA 3RBTA 5H5RA 1CQGA 3WT1A 4QL7A 2F8FA 4ZB9A 3U6VA 1RK4A 4HDEA 3APQA 4MPGA 1VF1A 2F3MA 4DSSB 4TN8A 2WS2A 2KOKA 2C0EA 4HQZA 4DEJA 1T4YA 4G9HA 1M2DA 4ZL7A 2OADA 4LL1B 5DQSA 4MJAA 5CRHA 1PKZA 1GL8A 3F4RA 2X8CA 3GV1A 1GULA 5DQYA 3C73A 5IIZA 1EEMA 3LEFA 2YJ7A 3VFIA 2FY6A 4JR6A 1LJRA 5HFKA 3US3A 4FO5A 4TR4A 3F9UA 2MMOA 2E2GA 2VL2C 4ECCA 1OKDA 2F9SA 5L71A 2PERA 2IL3A 1A24A 4LLRA 2PBJA 4MH3A 2L6DA 2C3NA 1GSFA 2VCXA 4O7HA 4EUYA 1ILOA 4O92A 3DWVA 3GHAA 5DAKA 2VCQA 3LYPA 2KHPA 1Z7RA 1THXA 1M0UA 3ME7A 3HDCA 1Z9HA 5ELAA 4LMVA 4PX1A 3D22A 1HNAA 2OE0A 2MMAA 2H6ZA 3HZ8A 2DC5A 2PVOC 1RQMA 2V41A 4HEA2 2DJ1A 4ECBA 4K7IA 2H66A 5ECOB 3IHQA 5ID2B 1ZOFA 5G31A 1VRSD 4RI6A 3IRAA 1B9XC 1U87A 2GLRA 1FOVA 3A2WA 2ON5A 3JCML 2YPMA 3ZMLA 5D9TA 2KLXA 3E9JB 1ST9A 5F06A 3Q74A 3MDKA 5H5QA 4G0IA 4RI7A 2VLVA 3VWUA 3GH9A 1HYUA 4L0WA 2CVDA 5ECPB 3ZL5A 3GRXA 3IK7A 4IS0A 4HJ2A 1FAAA 2YCDA 5IOXA 1VGLA 4Z2TA 1XW5A 5HFIA 3LWAA 1GSUA 3HJMA 2NDOA 2H30A 4EXJA 1SJIA 4AJ7A 2HZEB 2FWFA 4MPFA 2DMLA 2R2JA 1M7TA 3KZQA 4BL7A 2KUCA 5ECSA 3MNGA 2OE3A 2V6KA 5IO2A 2L6CA 1EV4A 4Q5QA 3UAPA 1TK5B 2L4CA 1OC9A 1WOUA 2EIRA 3NOFA 5DALA 3IPZA 2I1UA 2B5EA 5E4WA 1AIUA 4ZB8A 4IQ1A 5F8BA 1YQ1A 3BOAA 2XPEA 2CAQA 2IFQA 2B6MA 2LUSA 3IE3A 4WBRD 4OFMA 1SJZA 1XWKA 2GQKA 1X0RA 1ZYNA 1E6BA 3QAVA 2GZZA 2GSQA 3LSZA 3TKRA 3SWLA 4K5RA 5J5NA 3HVVA 4GSNA 5B8BA 3SBCA 5IPHA 1N8JA 2CZ3A 3GSTA 4GF0A 4PGTA 2L5OA 4MZBA 3L0HA 3ZIJA 1FB0A 1G6WA 4EL1A 2E2MA 4O5QA 5GAPD 2XBQA 4JRRA 4GQCA 5ECQB 1EWXA 1TOFA 1SL1B 2C3QA 3APSA 2LRTA 3GTUA 5BMUA 2Z9SA 1TI1A 2VCTA 2OACA 4KE3A 4ZIJA 2GZYA 3CBUA 3ZREA 4MMMA 5GSSA 3LJRA 5HR2A 3AY8A 2MYGA 3IAM2 3KCMA 2IJYA 5ECRB 3VWWA 1EOGA 4XS6A 4ZL9A 2GSSA 2K8VA 1MD3A 1K0NA 1XCCA 5D8IA 3BBYA 5D93A 3HCZA 1R7HA 4ECIA 2P5RA 4J57E 3I69A 2QGVA 2YV7A 1N2AA 1IYIA 5G1KA 2R0PA 1O8XA 2OJLA 1C72A 3VWVA 4EO3A 3GN3A 2X99A 3EE2A 4ZXGA 3LXTA 1KTEA 1B48A 1B4PA 5E59A 1BG5A 2YNXA 1GNEA 1XWAA 1U3IA 3O76A 3VK9A 3WGDA 2VD1A 2LNSA 2VOCA 3CSIA 3O6TA 1T00A 4EDYA 3RAZA 1W89A 4ZBBA 1FVJA 1VF3A 4MH2A 14GSA 1JHBA 4YQUA 4PUAA 3CTFA 5J9BA 2CAIA 11GSA 4IP1A 3APOA 5J4UA 1T8EB 4N11A 2P0GA 4PNFA 1DBYA 2H0GA 2DIZA 2FHEA 2JADA 4V2LA 2WB9A 3ED3A 2WCIA 3GIXA 4HU7A 3DD3A 1K0DA 5B7CA 4V1Ap 2F51A 2NBSA 4V2MA 4TR0A 10GSA 3L4NA 2YOIA 2O87A 4ZB6A 1M9AA 1PL1A 1H4OA 2VIMA 3Q19A 2A2RA 1SKSB 5IMCA 1ML6A 1TTZA 2RLIA 1HQOA 1DE1A 3L9SA 1PN0A 2L5LA 3G7JA 2CVKA 4WEYA 3H8QA 1PRXA 1GSEA 4LMWA 5ID2A 3P8WA 2IMEA 5CP1A 3G7IA 4POBA 2YZUA 1B9YC 2VCWA 1GNWA 2MBTA 3GKXA 3DMLA 1GTAA 4TR1B 3FR3A 1NW2A 1TJDA 1VF4A 3C8EA 4NV5A 3GKMA 3WYWA 3WGXA 4KSOA 2WRTA 3RPPA 4MJEA 5DBQA 5D9XA 3ZRDA 4PQ1A 2A4HA 2F8AA 2IMKA 2GVPA 1R5PA 4F82A 4N30A 1U3AA 4P3YB 5KOWA 2AUVA 4NHZA 2GT5A 1Z3EA 2VLUA 2JACA 4Q5FA 3HKRA 1XOAA 1EOHA 1GWCA 3TCOA 2H75A 2HZEA 2TIRA 3M8NA 1T3BA 1YZXA 4KAEA 2PU9C 1K0CA 5LNKe 3NZNA 16GSA 1SK1A 3WD6A 4EC0A 5DCGA 4IELA 2AAWA 3G7YA 4EF0A 1XIYA 1BEDA 4CY6A 3FR6A 5F05A 3H4KA 1FVKA 3VI5A 2HRAA 1GTBA 3F63A 4GTUA 3GYKA 1JZDA 3FEUA 1K0MA 5FWGA 3U5RE 1TRWA 1MEKA 1EV9A 2QA1A 1GLQA 3W8SA 2YV9A 1HD2A 1GSDA 3N9JA 1ZCPA 3M3MA 4XRAA 4ULXA 2B7KA 2H6YA 4PUFC 2V6OA 3FY7A 4KUNA 3QMXA 3FR9A 1YKAA 1F6MC 2FD3A 1TI3A 3IA1A 3HA9A 2O85A 5B6MA 2CV4A 1K3YA 2X64A 4CHSA 4K5SA 4Q5NA 2HI7A 4D73A 3TB2A 2OKAA 2G0FA 2WDUA 2R5GA 1ERVA 5CYYA 3FMWA 4HQSA 3V1WA 3UMAA 1A8YA 3ERFA 3TJFA 4HJMA 3KH9A 1WE0A 4ICYA 4OFTA 5ECKB 2HXKA 2HLSA 2IMFA 3GSSA 1X9WB 2C0FA 3Q6OA 1SENA 2M80A 3FZAA 1A2MA 4PQIA 3EURA 5JCWA 2IWTA 3PINA 5BRTA 1TP9A 3M1GA 2VCZA 3VPTA 1K3LA 1UC7A 2LQQA 5FT3A 4AGSA 4OCEA 2H0IA 1M9BA 4CW9A 3EPTA 1MTCA 3PGTA 3RPNA 2DKHA 1R5AA 2H1AA 1V58A 4GWRA 4TOPA 1XXUA 1GLPA 1MDJA 1BQ7A 1OC8A 4QQ7A 1G7EA 5CRDA 2WULA 3MSZA 4HUAA 3LGCA 3UL3A 1K0OA 4FQUA 2MMNA 5AIVA 2H8LA 2R6KA 5DCHA 1JFUA 2H71A 2ZNMA 1TRUA 2FWEA 1E2YA 3HD5A 1GUKA 4WETA 5KN1A 2HZFA 1OKTA 4FYBA 2HSHA 3BJ5A 3GKKA 3KP8A 3HVSA 1AXDA 1WPIA 4MP4A 3DXBA 2JSYA 4FYUA 1Q4JA 1OAZA 2X8HA 1MD4A 1QQ2A 2DSAA 3CMIA 3I6AA 4NXIA 2YWOA 2IMIA 1SK0A 3PR8A 3QAGA 2V1MA 2BTOT 4LL4B 4L5OA 3TKQA 4H86A 1GTUA 1F3AA 2C0DA 3F0IA 3HZ4A 2FA8A 2TRCP 2LKUA 1SKRB 5HR3A 1OYJA 1PA3A 1PN9A 1DUGA 1SU9A 1GP1A 1HNBA 1XFLA 4KF9A 3ZTLA 4MDCA 3UIWA 2TRXA 3A3TA 3GUSA 1SD8A 1GRXA 2GSTA 5CRWA 2DJ2A 4POKA 2DKIA 2PMTA 1W4VA 4OMVA 4KB3A 4OD7A 1BAYA 3IDVA 2REMA 3M9KA 5AISA 2OA7A 3TRPA 4V2NA 5CREA 2XC2A 3E0UA 5FHIA 2GT6A 5GSTA 4GXZA 3O3TA 5G30A 5ECMB 1O6JA 3LXZA 5JWQB 4TR1A 1USBA 1BJXA 1F37A 3ZVJA 3KTBA 4K2XA 3LFLA 2H01A 4KW6A 2GDRA 1Z7PA 1WP0A 3M0FA 1OC3A 2RIIA 4I5QA 1M2BA 2GZPA 2X4AA 4K0NA 1I5GA 4HU9A 2PGTA 4OO5A 2P31A 4HOJA 4XCSA 4KDYA 2GQMA 3DVXA 3L9UA 1O8WA 4GCIA 4RQRA 2K8SA 4YAVA 3GH6A 2X8GA 4IJ3A 3I43A 1SK2A 1R4WA 3EVIA 2LRNA 3IXRA 2HRFA 1ACVA 4WKWA 3A5IA 3TGZA 4DVCA 4MJBA 1V40A 2IN3A 2H70A 5CNWA 5HR0A 6GSTA 19GSA 1DE2A 1ZYQB 22GSA 1ZL9A 3BCKA 4G10A 1A0RP 2J9HA 2DJ0A 3RHCA 5IM9A 4L8EA 3J7Yb 2VLTA 3F8UA 3P90A 3IC8A 3QR6A 3I9V2 1S3DA 1EP7A 1KNGA 4YQMA 4OO4A 4YH2A 2B1KA 4V1Ag 2QSIA 3QCPA 1SYXA 1XW9A 2H6XA 4TVEA 3FK8A 4GRFA 3IK9A 1V2AA 2VL3A 1ZYEA 2B5YA 4KNDA 5J41A 5EVOA 2C3TA 2PPTA 4YQVA 4NPBA 2CQ9A 4DSSA 1KBNA 1VF2A 4Z2RA 6GSYA 2VD0A 3VI7A 4POLA 1K0BA 2FA4A 2LJKA 4IP6A 1A8LA 2LTKA 1QGVA 4IQAA 3MWHA 2AYTA 2DJ3A 3HYPA 3RDWA 2B1LA 3D21A 5HFGA 4I8BA 3TKSC 1YEPA 1X9SB 2HRKA 1UVZA 1FG4A 3VPQA 2M46A 1YY7A 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCV A;  2H1G A;  2H19 A;  4FIW A;  5DAK B;  9GSS A;  5IMV A;  1PSQ A;  4AJ6 A;  1ERT A;  2GQL A;  5A4U A;  1K3O A;  1EZK A;  4TXV A;  1XBS A;  3KGK A;  2RUF A;  5ECI B;  2CT6 A;  4KDX A;  1O81 A;  2K6V A;  3P2A A;  1PQN A;  1ZGN A;  3VLN A;  2VAF A;  2A4V A;  1Q98 A;  5IMF A;  3HJP A;  3DKS A;  4K1F A;  5KN2 A;  1OE7 A;  4ZIL A;  1LU4 A;  4G19 A;  5D9W A;  4KX4 A;  5F07 A;  4MZW A;  1X5D A;  2JZT A;  3UVT A;  2GS3 A;  4HI7 A;  3KIJ A;  3GX8 A;  4XHM A;  1J08 A;  4OFN A;  1O73 A;  5JCG A;  4XS1 A;  1TW9 A;  2KP2 A;  1A2L A;  3CSJ A;  1PKW A;  3H1N A;  2I3Y A;  2K9F A;  4FYC A;  4MCU A;  4AJ8 A;  5LD0 A;  2DIY A;  5ECL B;  1PD2 1;  2ALB A;  4X43 A;  2YN1 A;  4O5R A;  5A4W A;  3UEM A;  2EIO A;  3KEB A;  2HYX A;  5HR1 A;  3HY2 A;  4MAB A;  1FB6 A;  2ZCT A;  1XVW A;  3EMX A;  4WR4 A;  3UVH A;  2OBI A;  2VL9 A;  4KDU A;  5G2Z A;  3BCI A;  4JE1 A;  2ZUP A;  2AB6 A;  1XWC A;  1OC9 B;  2MBS A;  1ABA A;  1LBK A;  3C1R A;  4KCE A;  4J56 E;  1TKD B;  3H79 A;  3ZIT A;  4J2F A;  4I97 A;  4ISD A;  1A23 A;  4IJI A;  2O8V B;  2C80 A;  3ERW A;  2EIQ A;  3UOM A;  8GSS A;  2V32 A;  1T4Z A;  2IFQ B;  4F2I A;  4KCA A;  2B5X A;  1TU8 A;  1PX6 A;  1OE8 A;  3ZFB A;  4PQH A;  1FW1 A;  2H1B A;  2FGX A;  3QFB C;  2WJU A;  1XPV A;  1I9D A;  3IBH A;  12GS A;  3TOU A;  1YF1 A;  4ID0 A;  1F3B A;  1H75 A;  2MZC A;  2N5B A;  2RM6 A;  4Z7X A;  1GSQ A;  2YP6 A;  1GUH A;  3P7X A;  1X5E A;  3J7Y k;  4KH7 A;  5IMD A;  3IC4 A;  3A2V A;  1QMV A;  3GL5 A;  1ZMA A;  3CXG A;  5AN1 A;  4E8E A;  1JZO A;  2C0G A;  3RHB A;  2VM2 A;  3LOR A;  3DIE A;  4Q5R A;  1EP8 A;  3G9B A;  4F0B A;  5KEJ A;  4PNG A;  3HVX A;  3ISO A;  3KTL A;  5HQP A;  1T7P B;  3QAW A;  3DRN A;  4N10 A;  3TRQ A;  1B4Q A;  4HZ4 A;  2O7K A;  3EWL A;  1WMJ A;  2PN8 A;  5INY A;  3CYN A;  2O89 A;  2D2Z A;  2VM1 A;  4I2U A;  4OCF A;  1NSW A;  13GS A;  2FNO A;  4NHW A;  1GTI A;  3L78 A;  2DJK A;  1SYR A;  3VWX A;  2V2G A;  3E3E A;  3QD9 A;  2AV4 A;  4NAX A;  4IVF A;  1TU7 A;  4JZQ A;  2HFD A;  4IBP A;  3TDG A;  2I81 A;  2PUK C;  4PUR A;  4XRD A;  3TJG A;  4F9Z A;  2WFC A;  1DSB A;  1AC1 A;  4IN0 A;  3KXO A;  4IKH A;  3VUR A;  3QDN A;  1YKC A;  1O7U A;  4ML6 A;  2HRN A;  3D4T A;  2ES7 A;  3LG6 A;  3F6F A;  3UAR A;  1QFN A;  5IOW A;  1T1V A;  3F4S A;  3DYR A;  2C1Y A;  4PXO A;  2EC4 A;  2CX4 A;  2L4Q A;  3ERG A;  5J9C A;  5COH A;  4WF5 A;  6GSS A;  5B6N A;  4NWY A;  4K0G A;  1SJ6 A;  2LST A;  3EC3 A;  2GTU A;  5IMA A;  1A2J A;  2ON7 A;  18GS A;  3HJO A;  1NHO A;  2WZ9 A;  3D0Z A;  3DEX A;  3EU4 A;  2LJA A;  3KD0 A;  1O85 A;  5IPG A;  3UBL A;  5H5S A;  1FHE A;  2JZS A;  4POM A;  3C71 A;  1JLW A;  1URM A;  4TR3 A;  2QC7 A;  3TKP A;  2K18 A;  2YWI A;  20GS A;  1SKW B;  3EU3 A;  3PH9 A;  5D96 A;  3FKF A;  1MDI A;  3EMP A;  3GFK A;  1NM3 A;  5A4V A;  4I6X A;  2IMD A;  2H74 A;  1X5C A;  2GSR A;  3ZMK A;  1KEB A;  4TW5 A;  5ELG A;  1ERW A;  4WR5 A;  2NPB A;  2N5F A;  4K9Z A;  4BVX A;  4XIH A;  3W6G A;  2L57 A;  2DMM A;  4N0V A;  1QUW A;  4MF5 A;  1XOB A;  4HZ2 A;  2H73 A;  3L9V A;  2LS5 A;  5EY6 A;  3CSH A;  2XHF A;  3ME8 A;  5JWO B;  5DDL A;  1EGR A;  1SL2 B;  2E0Q A;  4MA9 A;  5ECN B;  3QOU A;  1TXX A;  1F2E A;  3N5O A;  2H1D A;  4YAP A;  5CO3 A;  5LCZ A;  2JSZ A;  2DBC A;  3FYG A;  3LYK A;  4XS4 B;  2IIY A;  4O32 A;  3IV4 A;  4CDO A;  2FWG A;  2M72 A;  1M2A A;  2OE1 A;  5B8A A;  1WIK A;  4RUV A;  2OBK A;  2LV3 A;  4JBB A;  1IYH A;  2CA8 A;  4K7N A;  4TXO B;  5AGY A;  5C00 A;  4DSQ A;  4WXT A;  3GL3 A;  1TK8 B;  5GZZ B;  2FCH A;  3KP9 A;  1THO A;  3W8J A;  1FO5 A;  4IHU A;  1MDK A;  3D6I A;  3QPM A;  5IMZ A;  4KSM A;  2VL2 A;  6GSX A;  2AHE A;  1X9M B;  1YF0 A;  5C04 A;  4F0C A;  2H76 A;  3FW2 A;  4MLY A;  5ENU A;  1YJ6 A;  3CRU A;  4DSR A;  3IOS A;  6GSU A;  1XZO A;  1HNC A;  2MMZ A;  3A2X A;  3HXS A;  2HNL A;  1RW1 A;  3ZIV A;  5GAN D;  3KH7 A;  4TRX A;  4KGI A;  1AQX A;  1XVQ A;  5D9V A;  2VO4 A;  1WWJ A;  1JZR A;  4MF7 A;  2C4J A;  2XBI A;  3TUE A;  5G1L A;  5CRG A;  3GNJ A;  1GUM A;  2LQO A;  3ZZX A;  1JZW A;  4E8H A;  2PWJ A;  2VUP A;  3ZFL A;  4D73 B;  1SD9 A;  1XWG A;  5F0G A;  3GUR A;  5D73 A;  4ZL8 A;  1GH2 A;  2HSY A;  1U88 A;  3UBK A;  1TRV A;  3HHV A;  4EDZ A;  1PMT A;  1SL0 B;  2QKE A;  2I4A A;  3FZ4 A;  2LEG A;  3C7M A;  1TK0 B;  3TKS E;  5EL8 A;  2RM5 A;  3TJK A;  5DJM A;  4KA0 A;  3KMN A;  3TRX A;  2L59 A;  4EE0 A;  3ZVJ D;  2GGT A;  4ZBD A;  1S3A A;  2N5A A;  1A0F A;  2E7P A;  5JWR B;  1J9B A;  2JZR A;  3R2Q A;  1V57 A;  4NMU A;  17GS A;  4L0U A;  4BWQ A;  1V98 A;  2YWM A;  2G2Q A;  4G2E A;  2RUE A;  3H93 A;  1GSY A;  4MZC A;  4JED A;  3GX0 A;  4FH8 A;  4NV2 A;  3FHK A;  1CQH A;  4AF2 A;  4GQF A;  1BYE A;  3FZ5 A;  2R37 A;  1OVN A;  4BWS A;  4K2D A;  4LA1 A;  5AIX A;  2NTO A;  5G5F A;  1WRY A;  1U6T A;  3TJJ A;  1TRS A;  4ACS A;  2YJH A;  1ZZY A;  3MAK A;  3ZYW A;  2FWH A;  1Y6E A;  1QXH A;  1G0T A;  4BVY A;  2BMX A;  5G5E A;  3BD2 A;  2DJJ A;  1JLV A;  1G6Y A;  1Z5Y E;  2CX3 A;  4GST A;  4N0Z A;  4OWY A;  3IAS 2;  1XWB A;  7GSS A;  2R4V A;  2BJX A;  4F03 A;  3Q18 A;  4ZBA A;  1XW6 A;  2H72 A;  2LJR A;  5IO0 A;  2B3S A;  1ON4 A;  5ABR A;  1AQW A;  1PGT A;  2DLX A;  4GSS A;  4BPY A;  4WBJ A;  4K6X A;  1YDK A;  3UJ1 A;  2PVQ A;  4K8M A;  6GSV A;  5DVB A;  1Y25 A;  1R26 A;  5CAX A;  3DVW A;  2P5Q A;  1TDI A;  3WGE A;  1Z6N A;  2CVB A;  3EIN A;  4MK3 A;  2LNT A;  1GSS A;  3TJB A;  4L5L A;  3NIV A;  2A2S A;  1Z6M A;  2YWN A;  3KM6 A;  4I2T A;  2CZ2 A;  3EYT A;  5KN3 A;  1UN2 A;  4JU5 A;  1PX7 A;  3DGQ A;  5DJL A;  1PL2 A;  4HS1 A;  2KP1 A;  3S9F A;  4WF4 A;  2H0H A;  1AQV A;  2R3X A;  3GA4 A;  2YAN A;  5DAL B;  4XS4 A;  5IQY A;  3D4M A;  3D5J A;  5JCU A;  3A5W A;  5ECH B;  4EKZ A;  4BA7 A;  3C1S A;  3FRC A;  4TXO A;  4X0X A;  4TKY A;  3F3R A;  3TKS A;  1EGO A;  3K8N A;  2J23 A;  4ILF A;  3FZ9 A;  3GMF A;  2FUG 2;  1ERU A;  3F3Q A;  3TOT A;  4X1U A;  2JU5 A;  3LQ7 A;  3KMO A;  2AJQ B;  1EEJ A;  2IPA A;  6GSW A;  3CTG A;  4ML1 A;  4IW9 A;  1G7O A;  1AW9 A;  2HE3 A;  2I9H A;  3KJY A;  3WT2 A;  4ECJ A;  2LRC A;  3CRT A;  1AUC A;  4IGJ A;  2WGR A;  1QK8 A;  4XTS A;  5EPF A;  1S3C A;  4MJC A;  3GTU B;  4GLT A;  1J0F A;  2HT9 A;  5KN0 A;  4RQX A;  1F9M A;  1M99 A;  3M9J A;  4EVM A;  3GKN A;  4JR4 A;  2C8U A;  1YEX A;  2JL4 A;  2NVL A;  3F6D A;  3OR5 A;  3IR4 A;  4MF6 A;  1BX9 A;  5A5K A;  4K7O A;  2XPD A;  3ZLP A;  1UA5 A;  1AAZ A;  1K0A A;  3QFA C;  1B8X A;  2YZH A;  4QL9 A;  1V9W A;  2FLS A;  2B7J A;  1NHY A;  3F4T A;  5J3R A;  1WJK A;  3RBT A;  5H5R A;  1CQG A;  3WT1 A;  4QL7 A;  2F8F A;  4ZB9 A;  3U6V A;  1RK4 A;  4HDE A;  3APQ A;  4MPG A;  1VF1 A;  2F3M A;  4DSS B;  4TN8 A;  2WS2 A;  2KOK A;  2C0E A;  4HQZ A;  4DEJ A;  1T4Y A;  4G9H A;  1M2D A;  4ZL7 A;  2OAD A;  4LL1 B;  5DQS A;  4MJA A;  5CRH A;  1PKZ A;  1GL8 A;  3F4R A;  2X8C A;  3GV1 A;  1GUL A;  5DQY A;  3C73 A;  5IIZ A;  1EEM A;  3LEF A;  2YJ7 A;  3VFI A;  2FY6 A;  4JR6 A;  1LJR A;  5HFK A;  3US3 A;  4FO5 A;  4TR4 A;  3F9U A;  2MMO A;  2E2G A;  2VL2 C;  4ECC A;  1OKD A;  2F9S A;  5L71 A;  2PER A;  2IL3 A;  1A24 A;  4LLR A;  2PBJ A;  4MH3 A;  2L6D A;  2C3N A;  1GSF A;  2VCX A;  4O7H A;  4EUY A;  1ILO A;  4O92 A;  3DWV A;  3GHA A;  5DAK A;  2VCQ A;  3LYP A;  2KHP A;  1Z7R A;  1THX A;  1M0U A;  3ME7 A;  3HDC A;  1Z9H A;  5ELA A;  4LMV A;  4PX1 A;  3D22 A;  1HNA A;  2OE0 A;  2MMA A;  2H6Z A;  3HZ8 A;  2DC5 A;  2PVO C;  1RQM A;  2V41 A;  4HEA 2;  2DJ1 A;  4ECB A;  4K7I A;  2H66 A;  5ECO B;  3IHQ A;  5ID2 B;  1ZOF A;  5G31 A;  1VRS D;  4RI6 A;  3IRA A;  1B9X C;  1U87 A;  2GLR A;  1FOV A;  3A2W A;  2ON5 A;  3JCM L;  2YPM A;  3ZML A;  5D9T A;  2KLX A;  3E9J B;  1ST9 A;  5F06 A;  3Q74 A;  3MDK A;  5H5Q A;  4RI7 A;  2VLV A;  3VWU A;  3GH9 A;  1HYU A;  4L0W A;  2CVD A;  5ECP B;  3ZL5 A;  3GRX A;  3IK7 A;  4IS0 A;  4HJ2 A;  1FAA A;  2YCD A;  5IOX A;  1VGL A;  1XW5 A;  5HFI A;  3LWA A;  1GSU A;  3HJM A;  2NDO A;  2H30 A;  4EXJ A;  1SJI A;  4AJ7 A;  2HZE B;  2FWF A;  4MPF A;  2DML A;  2R2J A;  1M7T A;  3KZQ A;  4BL7 A;  2KUC A;  5ECS A;  3MNG A;  2OE3 A;  2V6K A;  5IO2 A;  2L6C A;  1EV4 A;  4Q5Q A;  3UAP A;  1TK5 B;  2L4C A;  1OC9 A;  1WOU A;  2EIR A;  3NOF A;  5DAL A;  3IPZ A;  2I1U A;  2B5E A;  5E4W A;  1AIU A;  4ZB8 A;  4IQ1 A;  5F8B A;  1YQ1 A;  3BOA A;  2XPE A;  2CAQ A;  2IFQ A;  2B6M A;  2LUS A;  3IE3 A;  4WBR D;  4OFM A;  1SJZ A;  1XWK A;  2GQK A;  1X0R A;  1E6B A;  3QAV A;  2GZZ A;  2GSQ A;  3LSZ A;  3TKR A;  3SWL A;  5J5N A;  3HVV A;  4GSN A;  5B8B A;  3SBC A;  5IPH A;  1N8J A;  2CZ3 A;  3GST A;  4GF0 A;  4PGT A;  2L5O A;  4MZB A;  3L0H A;  3ZIJ A;  1FB0 A;  1G6W A;  4EL1 A;  2E2M A;  5GAP D;  2XBQ A;  4JRR A;  4GQC A;  5ECQ B;  1EWX A;  1TOF A;  1SL1 B;  2C3Q A;  3APS A;  2LRT A;  3GTU A;  2Z9S A;  1TI1 A;  2VCT A;  2OAC A;  4KE3 A;  4ZIJ A;  2GZY A;  3CBU A;  3ZRE A;  4MMM A;  5GSS A;  3LJR A;  5HR2 A;  3AY8 A;  2MYG A;  3IAM 2;  3KCM A;  2IJY A;  5ECR B;  3VWW A;  1EOG A;  4XS6 A;  4ZL9 A;  2GSS A;  2K8V A;  1MD3 A;  1K0N A;  1XCC A;  5D8I A;  3BBY A;  5D93 A;  3HCZ A;  1R7H A;  4ECI A;  2P5R A;  4J57 E;  3I69 A;  2QGV A;  2YV7 A;  1N2A A;  1IYI A;  5G1K A;  1O8X A;  2OJL A;  1C72 A;  3VWV A;  4EO3 A;  3GN3 A;  2X99 A;  3EE2 A;  4ZXG A;  3LXT A;  1KTE A;  1B48 A;  1B4P A;  5E59 A;  1BG5 A;  2YNX A;  1GNE A;  1XWA A;  1U3I A;  3O76 A;  3VK9 A;  3WGD A;  2VD1 A;  2LNS A;  2VOC A;  3CSI A;  3O6T A;  1T00 A;  4EDY A;  3RAZ A;  1W89 A;  4ZBB A;  1FVJ A;  1VF3 A;  4MH2 A;  14GS A;  1JHB A;  4YQU A;  4PUA A;  3CTF A;  5J9B A;  2CAI A;  11GS A;  4IP1 A;  3APO A;  5J4U A;  1T8E B;  4N11 A;  2P0G A;  4PNF A;  1DBY A;  2H0G A;  2DIZ A;  2FHE A;  2JAD A;  4V2L A;  2WB9 A;  3ED3 A;  2WCI A;  3GIX A;  4HU7 A;  3DD3 A;  1K0D A;  5B7C A;  4V1A p;  2F51 A;  2NBS A;  4V2M A;  4TR0 A;  10GS A;  3L4N A;  2YOI A;  2O87 A;  4ZB6 A;  1M9A A;  1PL1 A;  1H4O A;  2VIM A;  3Q19 A;  2A2R A;  1SKS B;  5IMC A;  1ML6 A;  1TTZ A;  2RLI A;  1HQO A;  1DE1 A;  3L9S A;  2L5L A;  3G7J A;  2CVK A;  4WEY A;  3H8Q A;  1PRX A;  1GSE A;  4LMW A;  5ID2 A;  3P8W A;  2IME A;  5CP1 A;  3G7I A;  4POB A;  2YZU A;  1B9Y C;  2VCW A;  1GNW A;  2MBT A;  3GKX A;  3DML A;  1GTA A;  4TR1 B;  3FR3 A;  1NW2 A;  1TJD A;  1VF4 A;  3C8E A;  4NV5 A;  3GKM A;  3WYW A;  3WGX A;  4KSO A;  2WRT A;  3RPP A;  4MJE A;  5DBQ A;  5D9X A;  3ZRD A;  4PQ1 A;  2F8A A;  2IMK A;  2GVP A;  1R5P A;  4F82 A;  4N30 A;  1U3A A;  4P3Y B;  2AUV A;  4NHZ A;  2GT5 A;  1Z3E A;  2VLU A;  2JAC A;  4Q5F A;  3HKR A;  1XOA A;  1EOH A;  1GWC A;  3TCO A;  2H75 A;  2HZE A;  2TIR A;  3M8N A;  1T3B A;  1YZX A;  4KAE A;  2PU9 C;  1K0C A;  5LNK e;  3NZN A;  1SK1 A;  3WD6 A;  4EC0 A;  5DCG A;  4IEL A;  2AAW A;  3G7Y A;  4EF0 A;  1XIY A;  1BED A;  3FR6 A;  5F05 A;  3H4K A;  1FVK A;  3VI5 A;  1GTB A;  3F63 A;  4GTU A;  3GYK A;  1JZD A;  3FEU A;  1K0M A;  5FWG A;  3U5R E;  1TRW A;  1MEK A;  1EV9 A;  1GLQ A;  3W8S A;  2YV9 A;  1HD2 A;  1GSD A;  3N9J A;  1ZCP A;  3M3M A;  4XRA A;  4ULX A;  2B7K A;  2H6Y A;  4PUF C;  2V6O A;  3FY7 A;  4KUN A;  3QMX A;  3FR9 A;  1YKA A;  1F6M C;  2FD3 A;  1TI3 A;  3IA1 A;  3HA9 A;  2O85 A;  5B6M A;  2CV4 A;  1K3Y A;  2X64 A;  4CHS A;  4Q5N A;  2HI7 A;  4D73 A;  3TB2 A;  2OKA A;  2G0F A;  2WDU A;  2R5G A;  1ERV A;  5CYY A;  4HQS A;  3V1W A;  3UMA A;  1A8Y A;  3ERF A;  3TJF A;  4HJM A;  3KH9 A;  1WE0 A;  4OFT A;  5ECK B;  2HXK A;  2HLS A;  2IMF A;  3GSS A;  1X9W B;  2C0F A;  3Q6O A;  1SEN A;  2M80 A;  3FZA A;  1A2M A;  4PQI A;  3EUR A;  5JCW A;  2IWT A;  3PIN A;  1TP9 A;  3M1G A;  2VCZ A;  3VPT A;  1K3L A;  1UC7 A;  2LQQ A;  5FT3 A;  4AGS A;  4OCE A;  2H0I A;  1M9B A;  4CW9 A;  3PGT A;  1MTC A;  3RPN A;  1R5A A;  2H1A A;  1V58 A;  4GWR A;  4TOP A;  1XXU A;  1GLP A;  1MDJ A;  1BQ7 A;  1OC8 A;  4QQ7 A;  1G7E A;  5CRD A;  2WUL A;  3MSZ A;  4HUA A;  3LGC A;  3UL3 A;  1K0O A;  2MMN A;  5AIV A;  2H8L A;  2R6K A;  5DCH A;  1JFU A;  2H71 A;  2ZNM A;  1TRU A;  2FWE A;  1E2Y A;  3HD5 A;  1GUK A;  4WET A;  5KN1 A;  2HZF A;  1OKT A;  4FYB A;  2HSH A;  3BJ5 A;  3GKK A;  3KP8 A;  3HVS A;  1AXD A;  1WPI A;  4MP4 A;  3DXB A;  2JSY A;  4FYU A;  1Q4J A;  1OAZ A;  2X8H A;  1MD4 A;  1QQ2 A;  2DSA A;  3CMI A;  3I6A A;  4NXI A;  2YWO A;  2IMI A;  1SK0 A;  3PR8 A;  3QAG A;  2V1M A;  2BTO T;  4LL4 B;  4L5O A;  3TKQ A;  4H86 A;  1GTU A;  1F3A A;  2C0D A;  3F0I A;  3HZ4 A;  2FA8 A;  2TRC P;  2LKU A;  1SKR B;  5HR3 A;  1OYJ A;  1PA3 A;  1PN9 A;  1DUG A;  1SU9 A;  1GP1 A;  1HNB A;  1XFL A;  3ZTL A;  4MDC A;  3UIW A;  2TRX A;  3A3T A;  3GUS A;  1SD8 A;  1GRX A;  2GST A;  5CRW A;  2DJ2 A;  4POK A;  2PMT A;  1W4V A;  4OMV A;  4KB3 A;  4OD7 A;  1BAY A;  3IDV A;  2REM A;  3M9K A;  5AIS A;  2OA7 A;  3TRP A;  4V2N A;  5CRE A;  2XC2 A;  3E0U A;  5FHI A;  2GT6 A;  5GST A;  4GXZ A;  3O3T A;  5G30 A;  5ECM B;  1O6J A;  3LXZ A;  5JWQ B;  4TR1 A;  1USB A;  1BJX A;  1F37 A;  3ZVJ A;  3KTB A;  3LFL A;  2H01 A;  4KW6 A;  2GDR A;  1Z7P A;  1WP0 A;  3M0F A;  1OC3 A;  2RII A;  4I5Q A;  1M2B A;  2GZP A;  4K0N A;  1I5G A;  4HU9 A;  2PGT A;  4OO5 A;  2P31 A;  4HOJ A;  4XCS A;  4KDY A;  2GQM A;  3DVX A;  3L9U A;  1O8W A;  4GCI A;  4RQR A;  2K8S A;  4YAV A;  3GH6 A;  2X8G A;  4IJ3 A;  3I43 A;  1SK2 A;  1R4W A;  3EVI A;  2LRN A;  3IXR A;  2HRF A;  1ACV A;  4WKW A;  3TGZ A;  4DVC A;  4MJB A;  1V40 A;  2IN3 A;  2H70 A;  5CNW A;  5HR0 A;  6GST A;  19GS A;  1DE2 A;  1ZYQ B;  22GS A;  1ZL9 A;  3BCK A;  4G10 A;  1A0R P;  2J9H A;  2DJ0 A;  3RHC A;  5IM9 A;  4L8E A;  3J7Y b;  2VLT A;  3F8U A;  3P90 A;  3QR6 A;  3I9V 2;  1S3D A;  1EP7 A;  1KNG A;  4YQM A;  4OO4 A;  4YH2 A;  2B1K A;  4V1A g;  2QSI A;  3QCP A;  1SYX A;  1XW9 A;  2H6X A;  4TVE A;  3FK8 A;  4GRF A;  3IK9 A;  1V2A A;  2VL3 A;  1ZYE A;  2B5Y A;  4KND A;  5J41 A;  5EVO A;  2C3T A;  2PPT A;  4YQV A;  4NPB A;  2CQ9 A;  4DSS A;  1KBN A;  1VF2 A;  6GSY A;  2VD0 A;  3VI7 A;  4POL A;  1K0B A;  2FA4 A;  2LJK A;  4IP6 A;  1A8L A;  2LTK A;  1QGV A;  4IQA A;  3MWH A;  2AYT A;  2DJ3 A;  3HYP A;  3RDW A;  2B1L A;  3D21 A;  5HFG A;  4I8B A;  3TKS C;  1YEP A;  1X9S B;  1UVZ A;  1FG4 A;  3VPQ A;  2M46 A;  1YY7 A;  16GS A; 
#chains in the Genus database with same CATH topology
 2VCV A;  2H1G A;  2H19 A;  4FIW A;  5DAK B;  9GSS A;  5IMV A;  1PSQ A;  4AJ6 A;  1ERT A;  2GQL A;  5A4U A;  1K3O A;  1EZK A;  4TXV A;  1XBS A;  3KGK A;  1M3J A;  2RUF A;  5ECI B;  2CT6 A;  4KDX A;  4G0L A;  1O81 A;  2K6V A;  3P2A A;  1PQN A;  4YKF A;  1ZGN A;  3VLN A;  2VAF A;  2A4V A;  1Q98 A;  5IMF A;  3HJP A;  3DKS A;  4K1F A;  5KN2 A;  1OE7 A;  4ZIL A;  1LU4 A;  4G19 A;  5D9W A;  4KX4 A;  4BVX B;  5F07 A;  4MZW A;  1X5D A;  2JZT A;  3UVT A;  2GS3 A;  4HI7 A;  3KIJ A;  3GX8 A;  4XHM A;  1J08 A;  4OFN A;  1O73 A;  5JCG A;  4XS1 A;  1TW9 A;  2KP2 A;  1A2L A;  3CSJ A;  1PKW A;  3H1N A;  2I3Y A;  2K9F A;  4FYC A;  4MCU A;  4AJ8 A;  5LD0 A;  2DIY A;  5ECL B;  1PD2 1;  2ALB A;  4X43 A;  2YN1 A;  4O5R A;  5A4W A;  3UEM A;  2EIO A;  3KEB A;  2HYX A;  5HR1 A;  3HY2 A;  4MAB A;  1FB6 A;  2ZCT A;  1XVW A;  3EMX A;  4WR4 A;  3UVH A;  2OBI A;  4HSC X;  2VL9 A;  4BL7 B;  4KDU A;  5G2Z A;  3BCI A;  4JE1 A;  2ZUP A;  2AB6 A;  1XWC A;  1OC9 B;  2MBS A;  1ABA A;  1LBK A;  3C1R A;  4KCE A;  4J56 E;  1TKD B;  3H79 A;  3ZIT A;  4J2F A;  4I97 A;  4ISD A;  1A23 A;  4IJI A;  2O8V B;  2C80 A;  3ERW A;  2EIQ A;  3UOM A;  8GSS A;  2V32 A;  1T4Z A;  2HSM A;  2IFQ B;  4F2I A;  4Z2U A;  4KCA A;  2B5X A;  1TU8 A;  1PX6 A;  1OE8 A;  3ZFB A;  4PQH A;  1FW1 A;  2H1B A;  2FGX A;  3QFB C;  2WJU A;  1XPV A;  1I9D A;  3IBH A;  12GS A;  3TOU A;  1YF1 A;  4ID0 A;  1F3B A;  1H75 A;  2MZC A;  2N5B A;  2RM6 A;  4Z7X A;  1GSQ A;  2YP6 A;  1GUH A;  3P7X A;  1X5E A;  3J7Y k;  4KH7 A;  2R0G A;  5IMD A;  3IC4 A;  3A2V A;  1QMV A;  3GL5 A;  1ZMA A;  3CXG A;  4PTS A;  5AN1 A;  1JZO A;  4E8E A;  2C0G A;  3RHB A;  2VM2 A;  3LOR A;  3DIE A;  4Q5R A;  1EP8 A;  3G9B A;  4F0B A;  5KEJ A;  2UZ8 A;  4PNG A;  3HVX A;  3ISO A;  3KTL A;  5HQP A;  1T7P B;  3QAW A;  3DRN A;  4N10 A;  3TRQ A;  1B4Q A;  4HZ4 A;  2O7K A;  3EWL A;  1WMJ A;  2PN8 A;  5INY A;  3CYN A;  2O89 A;  2D2Z A;  2VM1 A;  4I2U A;  4OCF A;  1NSW A;  13GS A;  2FNO A;  4NHW A;  1GTI A;  3L78 A;  2DJK A;  1SYR A;  3VWX A;  2V2G A;  3E3E A;  3QD9 A;  2AV4 A;  4NAX A;  4IVF A;  1TU7 A;  4JZQ A;  2HFD A;  4IBP A;  3TDG A;  2I81 A;  2PUK C;  4PUR A;  4XRD A;  3TJG A;  4F9Z A;  2WFC A;  1DSB A;  1AC1 A;  4IN0 A;  3KXO A;  3R3E A;  4IKH A;  3VUR A;  3QDN A;  1YKC A;  4BVY B;  1O7U A;  4ML6 A;  2HRN A;  3D4T A;  2ES7 A;  3LG6 A;  3F6F A;  3UAR A;  1QFN A;  5IOW A;  1T1V A;  3F4S A;  3DYR A;  2C1Y A;  4PXO A;  2EC4 A;  2CX4 A;  2A2P A;  2L4Q A;  3ERG A;  5J9C A;  5COH A;  4WF5 A;  6GSS A;  5B6N A;  4NWY A;  4K0G A;  1SJ6 A;  2LST A;  3EC3 A;  2GTU A;  5IMA A;  1A2J A;  2ON7 A;  18GS A;  3HJO A;  1NHO A;  2WZ9 A;  3D0Z A;  3DEX A;  3EU4 A;  2LJA A;  3KD0 A;  1O85 A;  5IPG A;  3UBL A;  5H5S A;  1FHE A;  2JZS A;  4EIQ A;  4POM A;  3C71 A;  1JLW A;  1URM A;  4TR3 A;  2QC7 A;  3TKP A;  2K18 A;  2YWI A;  20GS A;  1SKW B;  3EU3 A;  3PH9 A;  5D96 A;  3FKF A;  1MDI A;  1ZYP A;  3EMP A;  4EIP A;  3GFK A;  1NM3 A;  5A4V A;  4I6X A;  2IMD A;  2H74 A;  1X5C A;  2GSR A;  3ZMK A;  1KEB A;  4TW5 A;  5ELG A;  1ERW A;  4WR5 A;  2NPB A;  2N5F A;  4MNN A;  4K9Z A;  4USS A;  4BVX A;  4XIH A;  3W6G A;  2L57 A;  2DMM A;  4N0V A;  1QUW A;  4MF5 A;  1XOB A;  4HZ2 A;  2H73 A;  3L9V A;  2LS5 A;  5EY6 A;  3CSH A;  2XHF A;  3ME8 A;  5JWO B;  5DDL A;  1EGR A;  1SL2 B;  2E0Q A;  4MA9 A;  5ECN B;  3QOU A;  1TXX A;  1F2E A;  3N5O A;  2H1D A;  4YAP A;  5CO3 A;  5LCZ A;  2JSZ A;  2DBC A;  3FYG A;  3LYK A;  4XS4 B;  2IIY A;  4O32 A;  3IV4 A;  4CDO A;  2FWG A;  2M72 A;  1M2A A;  2OE1 A;  5B8A A;  1WIK A;  4RUV A;  2OBK A;  4A5P A;  2LV3 A;  4JBB A;  1IYH A;  4X4J A;  2CA8 A;  4K7N A;  4TXO B;  5AGY A;  5C00 A;  4DSQ A;  4WXT A;  3GL3 A;  1TK8 B;  5GZZ B;  2FCH A;  3KP9 A;  1THO A;  3W8J A;  1FO5 A;  4IHU A;  1MDK A;  3D6I A;  3QPM A;  5IMZ A;  4KSM A;  2VL2 A;  6GSX A;  2AHE A;  1X9M B;  1YF0 A;  5C04 A;  4F0C A;  4O5U A;  2H76 A;  3FW2 A;  4MLY A;  5ENU A;  1YJ6 A;  3CRU A;  4DSR A;  3IOS A;  6GSU A;  1XZO A;  1HNC A;  2MMZ A;  3A2X A;  3HXS A;  2HNL A;  1RW1 A;  3ZIV A;  1M3I A;  5GAN D;  3KH7 A;  4TRX A;  4KGI A;  1AQX A;  1XVQ A;  5D9V A;  2VO4 A;  1WWJ A;  1JZR A;  4MF7 A;  2C4J A;  2XBI A;  3TUE A;  4YKG A;  5G1L A;  5CRG A;  3GNJ A;  1GUM A;  3PPU A;  2LQO A;  3ZZX A;  1JZW A;  4E8H A;  2PWJ A;  2VUP A;  3ZFL A;  4D73 B;  1SD9 A;  1XWG A;  5F0G A;  3GUR A;  5D73 A;  4ZL8 A;  1GH2 A;  2HSY A;  2QA2 A;  1U88 A;  3MIX A;  3HVN A;  3UBK A;  1TRV A;  3HHV A;  4EDZ A;  1PMT A;  1SL0 B;  2QKE A;  2I4A A;  3FZ4 A;  2LEG A;  3C7M A;  1TK0 B;  3TKS E;  5EL8 A;  2RM5 A;  3TJK A;  5DJM A;  4KA0 A;  3KMN A;  3TRX A;  2L59 A;  4EE0 A;  3ZVJ D;  2GGT A;  4ZBD A;  1S3A A;  2N5A A;  1A0F A;  2E7P A;  5JWR B;  1J9B A;  2JZR A;  3R2Q A;  1V57 A;  4NMU A;  17GS A;  4L0U A;  4BWQ A;  1V98 A;  2YWM A;  2R0C A;  2G2Q A;  4G2E A;  2RUE A;  3H93 A;  1GSY A;  4MZC A;  4JED A;  3GX0 A;  4FH8 A;  4NV2 A;  3FHK A;  1CQH A;  4AF2 A;  4GQF A;  1BYE A;  3FZ5 A;  2R37 A;  1OVN A;  4BWS A;  4K2D A;  4LA1 A;  5AIX A;  2NTO A;  5G5F A;  1WRY A;  1U6T A;  3TJJ A;  1TRS A;  4ACS A;  2YJH A;  1ZZY A;  3MAK A;  3ZYW A;  2FWH A;  1Y6E A;  1QXH A;  1G0T A;  4BVY A;  2BMX A;  5G5E A;  3BD2 A;  2DJJ A;  1JLV A;  1G6Y A;  1Z5Y E;  2CX3 A;  4GST A;  4N0Z A;  4OWY A;  3IAS 2;  5KOX A;  1XWB A;  7GSS A;  2R4V A;  2BJX A;  4F03 A;  3Q18 A;  4ZBA A;  1XW6 A;  2H72 A;  2LJR A;  5IO0 A;  2B3S A;  1ON4 A;  5ABR A;  4G0K A;  1AQW A;  1PGT A;  2DLX A;  4GSS A;  4BPY A;  4WBJ A;  4K6X A;  1YDK A;  3UJ1 A;  2PVQ A;  4K8M A;  6GSV A;  5DVB A;  1Y25 A;  1R26 A;  5CAX A;  3DVW A;  2P5Q A;  1TDI A;  3WGE A;  1Z6N A;  2CVB A;  3EIN A;  4MK3 A;  2LNT A;  1GSS A;  3TJB A;  4L5L A;  3NIV A;  2A2S A;  1Z6M A;  2YWN A;  3KM6 A;  4I2T A;  2CZ2 A;  3EYT A;  5KN3 A;  1UN2 A;  4JU5 A;  1PX7 A;  3DGQ A;  5DJL A;  1PL2 A;  4HS1 A;  2KP1 A;  3S9F A;  4WF4 A;  2H0H A;  1AQV A;  2R3X A;  3GA4 A;  2YAN A;  5DAL B;  4XS4 A;  5IQY A;  3D4M A;  3D5J A;  3MYD A;  5JCU A;  3A5W A;  5ECH B;  4EKZ A;  4BA7 A;  3C1S A;  3FRC A;  4TXO A;  4X0X A;  4TKY A;  3F3R A;  3TKS A;  1EGO A;  3K8N A;  2J23 A;  4ILF A;  3FZ9 A;  3GMF A;  2FUG 2;  1ERU A;  3F3Q A;  3TOT A;  4X1U A;  2JU5 A;  3LQ7 A;  4CY8 A;  3KMO A;  2AJQ B;  1EEJ A;  2IPA A;  6GSW A;  3CTG A;  4ML1 A;  4IW9 A;  1G7O A;  1AW9 A;  2HE3 A;  2I9H A;  3LW9 A;  3KJY A;  3WT2 A;  4ECJ A;  2LRC A;  3CRT A;  1AUC A;  1S3R A;  1FOH A;  4IGJ A;  2WGR A;  1QK8 A;  4XTS A;  5EPF A;  2X49 A;  1S3C A;  4MJC A;  3GTU B;  1XG8 A;  4GLT A;  1J0F A;  2HT9 A;  5KN0 A;  4RQX A;  1F9M A;  1M99 A;  3M9J A;  4EVM A;  3GKN A;  4JR4 A;  2C8U A;  1YEX A;  2JL4 A;  2NVL A;  3F6D A;  3OR5 A;  3IR4 A;  4MF6 A;  1BX9 A;  5A5K A;  4K7O A;  2XPD A;  3ZLP A;  1UA5 A;  1AAZ A;  1K0A A;  3QFA C;  1B8X A;  2YZH A;  4QL9 A;  1V9W A;  2FLS A;  2B7J A;  1NHY A;  3F4T A;  5J3R A;  1WJK A;  3RBT A;  5H5R A;  1CQG A;  3WT1 A;  4QL7 A;  2F8F A;  4ZB9 A;  3U6V A;  1RK4 A;  4HDE A;  3APQ A;  4MPG A;  1VF1 A;  2F3M A;  4DSS B;  4TN8 A;  2WS2 A;  2KOK A;  2C0E A;  4HQZ A;  4DEJ A;  1T4Y A;  4G9H A;  1M2D A;  4ZL7 A;  2OAD A;  4LL1 B;  5DQS A;  4MJA A;  5CRH A;  1PKZ A;  1GL8 A;  3F4R A;  2X8C A;  3GV1 A;  1GUL A;  5DQY A;  3C73 A;  5IIZ A;  1EEM A;  3LEF A;  2YJ7 A;  3VFI A;  2FY6 A;  4JR6 A;  1LJR A;  5HFK A;  3US3 A;  4FO5 A;  4TR4 A;  3F9U A;  2MMO A;  2E2G A;  2VL2 C;  4ECC A;  1OKD A;  2F9S A;  5L71 A;  2PER A;  2IL3 A;  1A24 A;  4LLR A;  2PBJ A;  4MH3 A;  2L6D A;  2C3N A;  1GSF A;  2VCX A;  4O7H A;  4EUY A;  1ILO A;  4O92 A;  3DWV A;  3GHA A;  5DAK A;  2VCQ A;  3LYP A;  2KHP A;  1Z7R A;  1THX A;  1M0U A;  3ME7 A;  3HDC A;  1Z9H A;  5ELA A;  4LMV A;  4PX1 A;  3D22 A;  1HNA A;  2OE0 A;  2MMA A;  2H6Z A;  3HZ8 A;  2DC5 A;  2PVO C;  1RQM A;  2V41 A;  4HEA 2;  2DJ1 A;  4ECB A;  4K7I A;  2H66 A;  5ECO B;  3IHQ A;  5ID2 B;  1ZOF A;  5G31 A;  1VRS D;  4RI6 A;  3IRA A;  1B9X C;  1U87 A;  2GLR A;  1FOV A;  3A2W A;  2ON5 A;  3JCM L;  2YPM A;  3ZML A;  5D9T A;  2KLX A;  3E9J B;  1ST9 A;  5F06 A;  3Q74 A;  3MDK A;  5H5Q A;  4G0I A;  4RI7 A;  2VLV A;  3VWU A;  3GH9 A;  1HYU A;  4L0W A;  2CVD A;  5ECP B;  3ZL5 A;  3GRX A;  3IK7 A;  4IS0 A;  4HJ2 A;  1FAA A;  2YCD A;  5IOX A;  1VGL A;  4Z2T A;  1XW5 A;  5HFI A;  3LWA A;  1GSU A;  3HJM A;  2NDO A;  2H30 A;  4EXJ A;  1SJI A;  4AJ7 A;  2HZE B;  2FWF A;  4MPF A;  2DML A;  2R2J A;  1M7T A;  3KZQ A;  4BL7 A;  2KUC A;  5ECS A;  3MNG A;  2OE3 A;  2V6K A;  5IO2 A;  2L6C A;  1EV4 A;  4Q5Q A;  3UAP A;  1TK5 B;  2L4C A;  1OC9 A;  1WOU A;  2EIR A;  3NOF A;  5DAL A;  3IPZ A;  2I1U A;  2B5E A;  5E4W A;  1AIU A;  4ZB8 A;  4IQ1 A;  5F8B A;  1YQ1 A;  3BOA A;  2XPE A;  2CAQ A;  2IFQ A;  2B6M A;  2LUS A;  3IE3 A;  4WBR D;  4OFM A;  1SJZ A;  1XWK A;  2GQK A;  1X0R A;  1ZYN A;  1E6B A;  3QAV A;  2GZZ A;  2GSQ A;  3LSZ A;  3TKR A;  3SWL A;  4K5R A;  5J5N A;  3HVV A;  4GSN A;  5B8B A;  3SBC A;  5IPH A;  1N8J A;  2CZ3 A;  3GST A;  4GF0 A;  4PGT A;  2L5O A;  4MZB A;  3L0H A;  3ZIJ A;  1FB0 A;  1G6W A;  4EL1 A;  2E2M A;  4O5Q A;  5GAP D;  2XBQ A;  4JRR A;  4GQC A;  5ECQ B;  1EWX A;  1TOF A;  1SL1 B;  2C3Q A;  3APS A;  2LRT A;  3GTU A;  5BMU A;  2Z9S A;  1TI1 A;  2VCT A;  2OAC A;  4KE3 A;  4ZIJ A;  2GZY A;  3CBU A;  3ZRE A;  4MMM A;  5GSS A;  3LJR A;  5HR2 A;  3AY8 A;  2MYG A;  3IAM 2;  3KCM A;  2IJY A;  5ECR B;  3VWW A;  1EOG A;  4XS6 A;  4ZL9 A;  2GSS A;  2K8V A;  1MD3 A;  1K0N A;  1XCC A;  5D8I A;  3BBY A;  5D93 A;  3HCZ A;  1R7H A;  4ECI A;  2P5R A;  4J57 E;  3I69 A;  2QGV A;  2YV7 A;  1N2A A;  1IYI A;  5G1K A;  2R0P A;  1O8X A;  2OJL A;  1C72 A;  3VWV A;  4EO3 A;  3GN3 A;  2X99 A;  3EE2 A;  4ZXG A;  3LXT A;  1KTE A;  1B48 A;  1B4P A;  5E59 A;  1BG5 A;  2YNX A;  1GNE A;  1XWA A;  1U3I A;  3O76 A;  3VK9 A;  3WGD A;  2VD1 A;  2LNS A;  2VOC A;  3CSI A;  3O6T A;  1T00 A;  4EDY A;  3RAZ A;  1W89 A;  4ZBB A;  1FVJ A;  1VF3 A;  4MH2 A;  14GS A;  1JHB A;  4YQU A;  4PUA A;  3CTF A;  5J9B A;  2CAI A;  11GS A;  4IP1 A;  3APO A;  5J4U A;  1T8E B;  4N11 A;  2P0G A;  4PNF A;  1DBY A;  2H0G A;  2DIZ A;  2FHE A;  2JAD A;  4V2L A;  2WB9 A;  3ED3 A;  2WCI A;  3GIX A;  4HU7 A;  3DD3 A;  1K0D A;  5B7C A;  4V1A p;  2F51 A;  2NBS A;  4V2M A;  4TR0 A;  10GS A;  3L4N A;  2YOI A;  2O87 A;  4ZB6 A;  1M9A A;  1PL1 A;  1H4O A;  2VIM A;  3Q19 A;  2A2R A;  1SKS B;  5IMC A;  1ML6 A;  1TTZ A;  2RLI A;  1HQO A;  1DE1 A;  3L9S A;  1PN0 A;  2L5L A;  3G7J A;  2CVK A;  4WEY A;  3H8Q A;  1PRX A;  1GSE A;  4LMW A;  5ID2 A;  3P8W A;  2IME A;  5CP1 A;  3G7I A;  4POB A;  2YZU A;  1B9Y C;  2VCW A;  1GNW A;  2MBT A;  3GKX A;  3DML A;  1GTA A;  4TR1 B;  3FR3 A;  1NW2 A;  1TJD A;  1VF4 A;  3C8E A;  4NV5 A;  3GKM A;  3WYW A;  3WGX A;  4KSO A;  2WRT A;  3RPP A;  4MJE A;  5DBQ A;  5D9X A;  3ZRD A;  4PQ1 A;  2A4H A;  2F8A A;  2IMK A;  4BIK A;  2GVP A;  1R5P A;  4F82 A;  4N30 A;  1U3A A;  4P3Y B;  5KOW A;  2AUV A;  4NHZ A;  2GT5 A;  1Z3E A;  2VLU A;  2JAC A;  4Q5F A;  3HKR A;  1XOA A;  1EOH A;  1GWC A;  3TCO A;  2H75 A;  2HZE A;  2TIR A;  3M8N A;  1T3B A;  1YZX A;  4KAE A;  2PU9 C;  1K0C A;  5LNK e;  3NZN A;  16GS A;  1SK1 A;  3WD6 A;  4EC0 A;  5DCG A;  4IEL A;  2AAW A;  3G7Y A;  4EF0 A;  1XIY A;  1BED A;  4CY6 A;  3FR6 A;  5F05 A;  3H4K A;  1FVK A;  3VI5 A;  2HRA A;  1GTB A;  3F63 A;  4GTU A;  3GYK A;  1JZD A;  3FEU A;  1K0M A;  5FWG A;  3U5R E;  1TRW A;  1MEK A;  1EV9 A;  2QA1 A;  1GLQ A;  3W8S A;  2YV9 A;  1HD2 A;  1GSD A;  3N9J A;  1ZCP A;  3M3M A;  4XRA A;  4ULX A;  2B7K A;  2H6Y A;  4PUF C;  2V6O A;  3FY7 A;  4KUN A;  3QMX A;  3FR9 A;  1YKA A;  1F6M C;  2FD3 A;  1TI3 A;  3IA1 A;  3HA9 A;  2O85 A;  5B6M A;  2CV4 A;  1K3Y A;  2X64 A;  4CHS A;  4K5S A;  4Q5N A;  2HI7 A;  4D73 A;  3TB2 A;  2OKA A;  2G0F A;  2WDU A;  2R5G A;  1ERV A;  5CYY A;  3FMW A;  4HQS A;  3V1W A;  3UMA A;  1A8Y A;  3ERF A;  3TJF A;  4HJM A;  3KH9 A;  1WE0 A;  4ICY A;  4OFT A;  5ECK B;  2HXK A;  2HLS A;  2IMF A;  3GSS A;  1X9W B;  2C0F A;  3Q6O A;  1SEN A;  2M80 A;  3FZA A;  1A2M A;  4PQI A;  3EUR A;  5JCW A;  2IWT A;  3PIN A;  5BRT A;  1TP9 A;  3M1G A;  2VCZ A;  3VPT A;  1K3L A;  1UC7 A;  2LQQ A;  5FT3 A;  4AGS A;  4OCE A;  2H0I A;  1M9B A;  4CW9 A;  3EPT A;  1MTC A;  3PGT A;  3RPN A;  2DKH A;  1R5A A;  2H1A A;  1V58 A;  4GWR A;  4TOP A;  1XXU A;  1GLP A;  1MDJ A;  1BQ7 A;  1OC8 A;  4QQ7 A;  1G7E A;  5CRD A;  2WUL A;  3MSZ A;  4HUA A;  3LGC A;  3UL3 A;  1K0O A;  4FQU A;  2MMN A;  5AIV A;  2H8L A;  2R6K A;  5DCH A;  1JFU A;  2H71 A;  2ZNM A;  1TRU A;  2FWE A;  1E2Y A;  3HD5 A;  1GUK A;  4WET A;  5KN1 A;  2HZF A;  1OKT A;  4FYB A;  2HSH A;  3BJ5 A;  3GKK A;  3KP8 A;  3HVS A;  1AXD A;  1WPI A;  4MP4 A;  3DXB A;  2JSY A;  4FYU A;  1Q4J A;  1OAZ A;  2X8H A;  1MD4 A;  1QQ2 A;  2DSA A;  3CMI A;  3I6A A;  4NXI A;  2YWO A;  2IMI A;  1SK0 A;  3PR8 A;  3QAG A;  2V1M A;  2BTO T;  4LL4 B;  4L5O A;  3TKQ A;  4H86 A;  1GTU A;  1F3A A;  2C0D A;  3F0I A;  3HZ4 A;  2FA8 A;  2TRC P;  2LKU A;  1SKR B;  5HR3 A;  1OYJ A;  1PA3 A;  1PN9 A;  1DUG A;  1SU9 A;  1GP1 A;  1HNB A;  1XFL A;  4KF9 A;  3ZTL A;  4MDC A;  3UIW A;  2TRX A;  3A3T A;  3GUS A;  1SD8 A;  1GRX A;  2GST A;  5CRW A;  2DJ2 A;  4POK A;  2DKI A;  2PMT A;  1W4V A;  4OMV A;  4KB3 A;  4OD7 A;  1BAY A;  3IDV A;  2REM A;  3M9K A;  5AIS A;  2OA7 A;  3TRP A;  4V2N A;  5CRE A;  2XC2 A;  3E0U A;  5FHI A;  2GT6 A;  5GST A;  4GXZ A;  3O3T A;  5G30 A;  5ECM B;  1O6J A;  3LXZ A;  5JWQ B;  4TR1 A;  1USB A;  1BJX A;  1F37 A;  3ZVJ A;  3KTB A;  4K2X A;  3LFL A;  2H01 A;  4KW6 A;  2GDR A;  1Z7P A;  1WP0 A;  3M0F A;  1OC3 A;  2RII A;  4I5Q A;  1M2B A;  2GZP A;  2X4A A;  4K0N A;  1I5G A;  4HU9 A;  2PGT A;  4OO5 A;  2P31 A;  4HOJ A;  4XCS A;  4KDY A;  2GQM A;  3DVX A;  3L9U A;  1O8W A;  4GCI A;  4RQR A;  2K8S A;  3CQF A;  4YAV A;  3GH6 A;  2X8G A;  4IJ3 A;  3I43 A;  1SK2 A;  1R4W A;  3EVI A;  2LRN A;  3IXR A;  2HRF A;  1ACV A;  4WKW A;  3A5I A;  3TGZ A;  4DVC A;  4MJB A;  1V40 A;  2IN3 A;  2H70 A;  5CNW A;  5HR0 A;  6GST A;  19GS A;  1DE2 A;  1ZYQ B;  22GS A;  1ZL9 A;  3BCK A;  4G10 A;  1A0R P;  2J9H A;  2DJ0 A;  3RHC A;  5IM9 A;  4L8E A;  3J7Y b;  2VLT A;  3F8U A;  3P90 A;  3IC8 A;  3QR6 A;  3I9V 2;  1S3D A;  1EP7 A;  1KNG A;  4YQM A;  4OO4 A;  4YH2 A;  2B1K A;  4V1A g;  2QSI A;  3QCP A;  1SYX A;  1XW9 A;  2H6X A;  4TVE A;  3FK8 A;  4GRF A;  3IK9 A;  1V2A A;  2VL3 A;  1ZYE A;  2B5Y A;  4KND A;  5J41 A;  5EVO A;  2C3T A;  2PPT A;  4YQV A;  4NPB A;  2CQ9 A;  4DSS A;  1KBN A;  1VF2 A;  4Z2R A;  6GSY A;  2VD0 A;  3VI7 A;  4POL A;  1K0B A;  2FA4 A;  2LJK A;  4IP6 A;  1A8L A;  1PFO A;  2LTK A;  1QGV A;  4IQA A;  3MWH A;  2AYT A;  2DJ3 A;  3HYP A;  3RDW A;  2B1L A;  3D21 A;  5HFG A;  4I8B A;  3TKS C;  1YEP A;  1X9S B;  2HRK A;  1UVZ A;  1FG4 A;  3VPQ A;  2M46 A;  1YY7 A;  3IHG A; 
#chains in the Genus database with same CATH homology
 2VCV A;  2H1G A;  2H19 A;  4FIW A;  5DAK B;  9GSS A;  5IMV A;  1PSQ A;  4AJ6 A;  1ERT A;  2GQL A;  5A4U A;  1K3O A;  1EZK A;  4TXV A;  1XBS A;  3KGK A;  2RUF A;  5ECI B;  2CT6 A;  4KDX A;  4G0L A;  1O81 A;  2K6V A;  3P2A A;  1PQN A;  4YKF A;  1ZGN A;  3VLN A;  2VAF A;  2A4V A;  1Q98 A;  5IMF A;  3HJP A;  3DKS A;  4K1F A;  5KN2 A;  1OE7 A;  4ZIL A;  1LU4 A;  4G19 A;  5D9W A;  4KX4 A;  4BVX B;  5F07 A;  4MZW A;  1X5D A;  2JZT A;  3UVT A;  2GS3 A;  4HI7 A;  3KIJ A;  3GX8 A;  4XHM A;  1J08 A;  4OFN A;  1O73 A;  5JCG A;  4XS1 A;  1TW9 A;  2KP2 A;  1A2L A;  3CSJ A;  1PKW A;  3H1N A;  2I3Y A;  2K9F A;  4FYC A;  4MCU A;  4AJ8 A;  5LD0 A;  2DIY A;  5ECL B;  1PD2 1;  2ALB A;  4X43 A;  2YN1 A;  4O5R A;  5A4W A;  3UEM A;  2EIO A;  3KEB A;  2HYX A;  5HR1 A;  3HY2 A;  4MAB A;  1FB6 A;  2ZCT A;  1XVW A;  3EMX A;  4WR4 A;  3UVH A;  2OBI A;  2VL9 A;  4BL7 B;  4KDU A;  5G2Z A;  3BCI A;  4JE1 A;  2ZUP A;  2AB6 A;  1XWC A;  1OC9 B;  2MBS A;  1ABA A;  1LBK A;  3C1R A;  4KCE A;  4J56 E;  1TKD B;  3H79 A;  3ZIT A;  4J2F A;  4I97 A;  4ISD A;  1A23 A;  4IJI A;  2O8V B;  2C80 A;  3ERW A;  2EIQ A;  3UOM A;  8GSS A;  2V32 A;  1T4Z A;  2HSM A;  2IFQ B;  4F2I A;  4Z2U A;  4KCA A;  2B5X A;  1TU8 A;  1PX6 A;  1OE8 A;  3ZFB A;  4PQH A;  1FW1 A;  2H1B A;  2FGX A;  3QFB C;  2WJU A;  1XPV A;  1I9D A;  3IBH A;  12GS A;  3TOU A;  1YF1 A;  4ID0 A;  1F3B A;  1H75 A;  2MZC A;  2N5B A;  2RM6 A;  4Z7X A;  1GSQ A;  2YP6 A;  1GUH A;  3P7X A;  1X5E A;  3J7Y k;  4KH7 A;  2R0G A;  5IMD A;  3IC4 A;  3A2V A;  1QMV A;  3GL5 A;  1ZMA A;  3CXG A;  4PTS A;  5AN1 A;  1JZO A;  4E8E A;  2C0G A;  3RHB A;  2VM2 A;  3LOR A;  3DIE A;  4Q5R A;  1EP8 A;  3G9B A;  4F0B A;  5KEJ A;  2UZ8 A;  4PNG A;  3HVX A;  3ISO A;  3KTL A;  5HQP A;  1T7P B;  3QAW A;  3DRN A;  4N10 A;  3TRQ A;  1B4Q A;  4HZ4 A;  2O7K A;  3EWL A;  1WMJ A;  2PN8 A;  5INY A;  3CYN A;  2O89 A;  2D2Z A;  2VM1 A;  4I2U A;  4OCF A;  1NSW A;  13GS A;  2FNO A;  4NHW A;  1GTI A;  3L78 A;  2DJK A;  1SYR A;  3VWX A;  2V2G A;  3E3E A;  3QD9 A;  2AV4 A;  4NAX A;  4IVF A;  1TU7 A;  4JZQ A;  2HFD A;  4IBP A;  3TDG A;  2I81 A;  2PUK C;  4PUR A;  4XRD A;  3TJG A;  4F9Z A;  2WFC A;  1DSB A;  1AC1 A;  4IN0 A;  3KXO A;  3R3E A;  4IKH A;  3VUR A;  3QDN A;  1YKC A;  4BVY B;  1O7U A;  4ML6 A;  2HRN A;  3D4T A;  2ES7 A;  3LG6 A;  3F6F A;  3UAR A;  1QFN A;  5IOW A;  1T1V A;  3F4S A;  3DYR A;  2C1Y A;  4PXO A;  2EC4 A;  2CX4 A;  2A2P A;  2L4Q A;  3ERG A;  5J9C A;  5COH A;  4WF5 A;  6GSS A;  5B6N A;  4NWY A;  4K0G A;  1SJ6 A;  2LST A;  3EC3 A;  2GTU A;  5IMA A;  1A2J A;  2ON7 A;  18GS A;  3HJO A;  1NHO A;  2WZ9 A;  3D0Z A;  3DEX A;  3EU4 A;  2LJA A;  3KD0 A;  1O85 A;  5IPG A;  3UBL A;  5H5S A;  1FHE A;  2JZS A;  4EIQ A;  4POM A;  3C71 A;  1JLW A;  1URM A;  4TR3 A;  2QC7 A;  3TKP A;  2K18 A;  2YWI A;  20GS A;  1SKW B;  3EU3 A;  3PH9 A;  5D96 A;  3FKF A;  1MDI A;  1ZYP A;  3EMP A;  4EIP A;  3GFK A;  1NM3 A;  5A4V A;  4I6X A;  2IMD A;  2H74 A;  1X5C A;  2GSR A;  3ZMK A;  1KEB A;  4TW5 A;  5ELG A;  1ERW A;  4WR5 A;  2NPB A;  2N5F A;  4MNN A;  4K9Z A;  4USS A;  4BVX A;  4XIH A;  3W6G A;  2L57 A;  2DMM A;  4N0V A;  1QUW A;  4MF5 A;  1XOB A;  4HZ2 A;  2H73 A;  3L9V A;  2LS5 A;  5EY6 A;  3CSH A;  2XHF A;  3ME8 A;  5JWO B;  5DDL A;  1EGR A;  1SL2 B;  2E0Q A;  4MA9 A;  5ECN B;  3QOU A;  1TXX A;  1F2E A;  3N5O A;  2H1D A;  4YAP A;  5CO3 A;  5LCZ A;  2JSZ A;  2DBC A;  3FYG A;  3LYK A;  4XS4 B;  2IIY A;  4O32 A;  3IV4 A;  4CDO A;  2FWG A;  2M72 A;  1M2A A;  2OE1 A;  5B8A A;  1WIK A;  4RUV A;  2OBK A;  4A5P A;  2LV3 A;  4JBB A;  1IYH A;  4X4J A;  2CA8 A;  4K7N A;  4TXO B;  5AGY A;  5C00 A;  4DSQ A;  4WXT A;  3GL3 A;  1TK8 B;  5GZZ B;  2FCH A;  3KP9 A;  1THO A;  3W8J A;  1FO5 A;  4IHU A;  1MDK A;  3D6I A;  3QPM A;  5IMZ A;  4KSM A;  2VL2 A;  6GSX A;  2AHE A;  1X9M B;  1YF0 A;  5C04 A;  4F0C A;  4O5U A;  2H76 A;  3FW2 A;  4MLY A;  5ENU A;  1YJ6 A;  3CRU A;  4DSR A;  3IOS A;  6GSU A;  1XZO A;  1HNC A;  2MMZ A;  3A2X A;  3HXS A;  2HNL A;  1RW1 A;  3ZIV A;  5GAN D;  3KH7 A;  4TRX A;  4KGI A;  1AQX A;  1XVQ A;  5D9V A;  2VO4 A;  1WWJ A;  1JZR A;  4MF7 A;  2C4J A;  2XBI A;  3TUE A;  4YKG A;  5G1L A;  5CRG A;  3GNJ A;  1GUM A;  3PPU A;  2LQO A;  3ZZX A;  1JZW A;  4E8H A;  2PWJ A;  2VUP A;  3ZFL A;  4D73 B;  1SD9 A;  1XWG A;  5F0G A;  3GUR A;  5D73 A;  4ZL8 A;  1GH2 A;  2HSY A;  2QA2 A;  1U88 A;  3MIX A;  3UBK A;  1TRV A;  3HHV A;  4EDZ A;  1PMT A;  1SL0 B;  2QKE A;  2I4A A;  3FZ4 A;  2LEG A;  3C7M A;  1TK0 B;  3TKS E;  5EL8 A;  2RM5 A;  3TJK A;  5DJM A;  4KA0 A;  3KMN A;  3TRX A;  2L59 A;  4EE0 A;  3ZVJ D;  2GGT A;  4ZBD A;  1S3A A;  2N5A A;  1A0F A;  2E7P A;  5JWR B;  1J9B A;  2JZR A;  3R2Q A;  1V57 A;  4NMU A;  17GS A;  4L0U A;  4BWQ A;  1V98 A;  2YWM A;  2R0C A;  2G2Q A;  4G2E A;  2RUE A;  3H93 A;  1GSY A;  4MZC A;  4JED A;  3GX0 A;  4FH8 A;  4NV2 A;  3FHK A;  1CQH A;  4AF2 A;  4GQF A;  1BYE A;  3FZ5 A;  2R37 A;  1OVN A;  4BWS A;  4K2D A;  4LA1 A;  5AIX A;  2NTO A;  5G5F A;  1WRY A;  1U6T A;  3TJJ A;  1TRS A;  4ACS A;  2YJH A;  1ZZY A;  3MAK A;  3ZYW A;  2FWH A;  1Y6E A;  1QXH A;  1G0T A;  4BVY A;  2BMX A;  5G5E A;  3BD2 A;  2DJJ A;  1JLV A;  1G6Y A;  1Z5Y E;  2CX3 A;  4GST A;  4N0Z A;  4OWY A;  3IAS 2;  5KOX A;  1XWB A;  7GSS A;  2R4V A;  2BJX A;  4F03 A;  3Q18 A;  4ZBA A;  1XW6 A;  2H72 A;  2LJR A;  5IO0 A;  2B3S A;  1ON4 A;  5ABR A;  4G0K A;  1AQW A;  1PGT A;  2DLX A;  4GSS A;  4BPY A;  4WBJ A;  4K6X A;  1YDK A;  3UJ1 A;  2PVQ A;  4K8M A;  6GSV A;  5DVB A;  1Y25 A;  1R26 A;  5CAX A;  3DVW A;  2P5Q A;  1TDI A;  3WGE A;  1Z6N A;  2CVB A;  3EIN A;  4MK3 A;  2LNT A;  1GSS A;  3TJB A;  4L5L A;  3NIV A;  2A2S A;  1Z6M A;  2YWN A;  3KM6 A;  4I2T A;  2CZ2 A;  3EYT A;  5KN3 A;  1UN2 A;  4JU5 A;  1PX7 A;  3DGQ A;  5DJL A;  1PL2 A;  4HS1 A;  2KP1 A;  3S9F A;  4WF4 A;  2H0H A;  1AQV A;  2R3X A;  3GA4 A;  2YAN A;  5DAL B;  4XS4 A;  5IQY A;  3D4M A;  3D5J A;  3MYD A;  5JCU A;  3A5W A;  5ECH B;  4EKZ A;  4BA7 A;  3C1S A;  3FRC A;  4TXO A;  4X0X A;  4TKY A;  3F3R A;  3TKS A;  1EGO A;  3K8N A;  2J23 A;  4ILF A;  3FZ9 A;  3GMF A;  2FUG 2;  1ERU A;  3F3Q A;  3TOT A;  4X1U A;  2JU5 A;  3LQ7 A;  4CY8 A;  3KMO A;  2AJQ B;  1EEJ A;  2IPA A;  6GSW A;  3CTG A;  4ML1 A;  4IW9 A;  1G7O A;  1AW9 A;  2HE3 A;  2I9H A;  3LW9 A;  3KJY A;  3WT2 A;  4ECJ A;  2LRC A;  3CRT A;  1AUC A;  1FOH A;  4IGJ A;  2WGR A;  1QK8 A;  4XTS A;  5EPF A;  2X49 A;  1S3C A;  4MJC A;  3GTU B;  4GLT A;  1J0F A;  2HT9 A;  5KN0 A;  4RQX A;  1F9M A;  1M99 A;  3M9J A;  4EVM A;  3GKN A;  4JR4 A;  2C8U A;  1YEX A;  2JL4 A;  2NVL A;  3F6D A;  3OR5 A;  3IR4 A;  4MF6 A;  1BX9 A;  5A5K A;  4K7O A;  2XPD A;  3ZLP A;  1UA5 A;  1AAZ A;  1K0A A;  3QFA C;  1B8X A;  2YZH A;  4QL9 A;  1V9W A;  2FLS A;  2B7J A;  1NHY A;  3F4T A;  5J3R A;  1WJK A;  3RBT A;  5H5R A;  1CQG A;  3WT1 A;  4QL7 A;  2F8F A;  4ZB9 A;  3U6V A;  1RK4 A;  4HDE A;  3APQ A;  4MPG A;  1VF1 A;  2F3M A;  4DSS B;  4TN8 A;  2WS2 A;  2KOK A;  2C0E A;  4HQZ A;  4DEJ A;  1T4Y A;  4G9H A;  1M2D A;  4ZL7 A;  2OAD A;  4LL1 B;  5DQS A;  4MJA A;  5CRH A;  1PKZ A;  1GL8 A;  3F4R A;  2X8C A;  3GV1 A;  1GUL A;  5DQY A;  3C73 A;  5IIZ A;  1EEM A;  3LEF A;  2YJ7 A;  3VFI A;  2FY6 A;  4JR6 A;  1LJR A;  5HFK A;  3US3 A;  4FO5 A;  4TR4 A;  3F9U A;  2MMO A;  2E2G A;  2VL2 C;  4ECC A;  1OKD A;  2F9S A;  5L71 A;  2PER A;  2IL3 A;  1A24 A;  4LLR A;  2PBJ A;  4MH3 A;  2L6D A;  2C3N A;  1GSF A;  2VCX A;  4O7H A;  4EUY A;  1ILO A;  4O92 A;  3DWV A;  3GHA A;  5DAK A;  2VCQ A;  3LYP A;  2KHP A;  1Z7R A;  1THX A;  1M0U A;  3ME7 A;  3HDC A;  1Z9H A;  5ELA A;  4LMV A;  4PX1 A;  3D22 A;  1HNA A;  2OE0 A;  2MMA A;  2H6Z A;  3HZ8 A;  2DC5 A;  2PVO C;  1RQM A;  2V41 A;  4HEA 2;  2DJ1 A;  4ECB A;  4K7I A;  2H66 A;  5ECO B;  3IHQ A;  5ID2 B;  1ZOF A;  5G31 A;  1VRS D;  4RI6 A;  3IRA A;  1B9X C;  1U87 A;  2GLR A;  1FOV A;  3A2W A;  2ON5 A;  3JCM L;  2YPM A;  3ZML A;  5D9T A;  2KLX A;  3E9J B;  1ST9 A;  5F06 A;  3Q74 A;  3MDK A;  5H5Q A;  4G0I A;  4RI7 A;  2VLV A;  3VWU A;  3GH9 A;  1HYU A;  4L0W A;  2CVD A;  5ECP B;  3ZL5 A;  3GRX A;  3IK7 A;  4IS0 A;  4HJ2 A;  1FAA A;  2YCD A;  5IOX A;  1VGL A;  4Z2T A;  1XW5 A;  5HFI A;  3LWA A;  1GSU A;  3HJM A;  2NDO A;  2H30 A;  4EXJ A;  1SJI A;  4AJ7 A;  2HZE B;  2FWF A;  4MPF A;  2DML A;  2R2J A;  1M7T A;  3KZQ A;  4BL7 A;  2KUC A;  5ECS A;  3MNG A;  2OE3 A;  2V6K A;  5IO2 A;  2L6C A;  1EV4 A;  4Q5Q A;  3UAP A;  1TK5 B;  2L4C A;  1OC9 A;  1WOU A;  2EIR A;  3NOF A;  5DAL A;  3IPZ A;  2I1U A;  2B5E A;  5E4W A;  1AIU A;  4ZB8 A;  4IQ1 A;  5F8B A;  1YQ1 A;  3BOA A;  2XPE A;  2CAQ A;  2IFQ A;  2B6M A;  2LUS A;  3IE3 A;  4WBR D;  4OFM A;  1SJZ A;  1XWK A;  2GQK A;  1X0R A;  1ZYN A;  1E6B A;  3QAV A;  2GZZ A;  2GSQ A;  3LSZ A;  3TKR A;  3SWL A;  4K5R A;  5J5N A;  3HVV A;  4GSN A;  5B8B A;  3SBC A;  5IPH A;  1N8J A;  2CZ3 A;  3GST A;  4GF0 A;  4PGT A;  2L5O A;  4MZB A;  3L0H A;  3ZIJ A;  1FB0 A;  1G6W A;  4EL1 A;  2E2M A;  4O5Q A;  5GAP D;  2XBQ A;  4JRR A;  4GQC A;  5ECQ B;  1EWX A;  1TOF A;  1SL1 B;  2C3Q A;  3APS A;  2LRT A;  3GTU A;  5BMU A;  2Z9S A;  1TI1 A;  2VCT A;  2OAC A;  4KE3 A;  4ZIJ A;  2GZY A;  3CBU A;  3ZRE A;  4MMM A;  5GSS A;  3LJR A;  5HR2 A;  3AY8 A;  2MYG A;  3IAM 2;  3KCM A;  2IJY A;  5ECR B;  3VWW A;  1EOG A;  4XS6 A;  4ZL9 A;  2GSS A;  2K8V A;  1MD3 A;  1K0N A;  1XCC A;  5D8I A;  3BBY A;  5D93 A;  3HCZ A;  1R7H A;  4ECI A;  2P5R A;  4J57 E;  3I69 A;  2QGV A;  2YV7 A;  1N2A A;  1IYI A;  5G1K A;  2R0P A;  1O8X A;  2OJL A;  1C72 A;  3VWV A;  4EO3 A;  3GN3 A;  2X99 A;  3EE2 A;  4ZXG A;  3LXT A;  1KTE A;  1B48 A;  1B4P A;  5E59 A;  1BG5 A;  2YNX A;  1GNE A;  1XWA A;  1U3I A;  3O76 A;  3VK9 A;  3WGD A;  2VD1 A;  2LNS A;  2VOC A;  3CSI A;  3O6T A;  1T00 A;  4EDY A;  3RAZ A;  1W89 A;  4ZBB A;  1FVJ A;  1VF3 A;  4MH2 A;  14GS A;  1JHB A;  4YQU A;  4PUA A;  3CTF A;  5J9B A;  2CAI A;  11GS A;  4IP1 A;  3APO A;  5J4U A;  1T8E B;  4N11 A;  2P0G A;  4PNF A;  1DBY A;  2H0G A;  2DIZ A;  2FHE A;  2JAD A;  4V2L A;  2WB9 A;  3ED3 A;  2WCI A;  3GIX A;  4HU7 A;  3DD3 A;  1K0D A;  5B7C A;  4V1A p;  2F51 A;  2NBS A;  4V2M A;  4TR0 A;  10GS A;  3L4N A;  2YOI A;  2O87 A;  4ZB6 A;  1M9A A;  1PL1 A;  1H4O A;  2VIM A;  3Q19 A;  2A2R A;  1SKS B;  5IMC A;  1ML6 A;  1TTZ A;  2RLI A;  1HQO A;  1DE1 A;  3L9S A;  1PN0 A;  2L5L A;  3G7J A;  2CVK A;  4WEY A;  3H8Q A;  1PRX A;  1GSE A;  4LMW A;  5ID2 A;  3P8W A;  2IME A;  5CP1 A;  3G7I A;  4POB A;  2YZU A;  1B9Y C;  2VCW A;  1GNW A;  2MBT A;  3GKX A;  3DML A;  1GTA A;  4TR1 B;  3FR3 A;  1NW2 A;  1TJD A;  1VF4 A;  3C8E A;  4NV5 A;  3GKM A;  3WYW A;  3WGX A;  4KSO A;  2WRT A;  3RPP A;  4MJE A;  5DBQ A;  5D9X A;  3ZRD A;  4PQ1 A;  2A4H A;  2F8A A;  2IMK A;  2GVP A;  1R5P A;  4F82 A;  4N30 A;  1U3A A;  4P3Y B;  5KOW A;  2AUV A;  4NHZ A;  2GT5 A;  1Z3E A;  2VLU A;  2JAC A;  4Q5F A;  3HKR A;  1XOA A;  1EOH A;  1GWC A;  3TCO A;  2H75 A;  2HZE A;  2TIR A;  3M8N A;  1T3B A;  1YZX A;  4KAE A;  2PU9 C;  1K0C A;  5LNK e;  3NZN A;  16GS A;  1SK1 A;  3WD6 A;  4EC0 A;  5DCG A;  4IEL A;  2AAW A;  3G7Y A;  4EF0 A;  1XIY A;  1BED A;  4CY6 A;  3FR6 A;  5F05 A;  3H4K A;  1FVK A;  3VI5 A;  2HRA A;  1GTB A;  3F63 A;  4GTU A;  3GYK A;  1JZD A;  3FEU A;  1K0M A;  5FWG A;  3U5R E;  1TRW A;  1MEK A;  1EV9 A;  2QA1 A;  1GLQ A;  3W8S A;  2YV9 A;  1HD2 A;  1GSD A;  3N9J A;  1ZCP A;  3M3M A;  4XRA A;  4ULX A;  2B7K A;  2H6Y A;  4PUF C;  2V6O A;  3FY7 A;  4KUN A;  3QMX A;  3FR9 A;  1YKA A;  1F6M C;  2FD3 A;  1TI3 A;  3IA1 A;  3HA9 A;  2O85 A;  5B6M A;  2CV4 A;  1K3Y A;  2X64 A;  4CHS A;  4K5S A;  4Q5N A;  2HI7 A;  4D73 A;  3TB2 A;  2OKA A;  2G0F A;  2WDU A;  2R5G A;  1ERV A;  5CYY A;  3FMW A;  4HQS A;  3V1W A;  3UMA A;  1A8Y A;  3ERF A;  3TJF A;  4HJM A;  3KH9 A;  1WE0 A;  4ICY A;  4OFT A;  5ECK B;  2HXK A;  2HLS A;  2IMF A;  3GSS A;  1X9W B;  2C0F A;  3Q6O A;  1SEN A;  2M80 A;  3FZA A;  1A2M A;  4PQI A;  3EUR A;  5JCW A;  2IWT A;  3PIN A;  5BRT A;  1TP9 A;  3M1G A;  2VCZ A;  3VPT A;  1K3L A;  1UC7 A;  2LQQ A;  5FT3 A;  4AGS A;  4OCE A;  2H0I A;  1M9B A;  4CW9 A;  3EPT A;  1MTC A;  3PGT A;  3RPN A;  2DKH A;  1R5A A;  2H1A A;  1V58 A;  4GWR A;  4TOP A;  1XXU A;  1GLP A;  1MDJ A;  1BQ7 A;  1OC8 A;  4QQ7 A;  1G7E A;  5CRD A;  2WUL A;  3MSZ A;  4HUA A;  3LGC A;  3UL3 A;  1K0O A;  4FQU A;  2MMN A;  5AIV A;  2H8L A;  2R6K A;  5DCH A;  1JFU A;  2H71 A;  2ZNM A;  1TRU A;  2FWE A;  1E2Y A;  3HD5 A;  1GUK A;  4WET A;  5KN1 A;  2HZF A;  1OKT A;  4FYB A;  2HSH A;  3BJ5 A;  3GKK A;  3KP8 A;  3HVS A;  1AXD A;  1WPI A;  4MP4 A;  3DXB A;  2JSY A;  4FYU A;  1Q4J A;  1OAZ A;  2X8H A;  1MD4 A;  1QQ2 A;  2DSA A;  3CMI A;  3I6A A;  4NXI A;  2YWO A;  2IMI A;  1SK0 A;  3PR8 A;  3QAG A;  2V1M A;  2BTO T;  4LL4 B;  4L5O A;  3TKQ A;  4H86 A;  1GTU A;  1F3A A;  2C0D A;  3F0I A;  3HZ4 A;  2FA8 A;  2TRC P;  2LKU A;  1SKR B;  5HR3 A;  1OYJ A;  1PA3 A;  1PN9 A;  1DUG A;  1SU9 A;  1GP1 A;  1HNB A;  1XFL A;  4KF9 A;  3ZTL A;  4MDC A;  3UIW A;  2TRX A;  3A3T A;  3GUS A;  1SD8 A;  1GRX A;  2GST A;  5CRW A;  2DJ2 A;  4POK A;  2DKI A;  2PMT A;  1W4V A;  4OMV A;  4KB3 A;  4OD7 A;  1BAY A;  3IDV A;  2REM A;  3M9K A;  5AIS A;  2OA7 A;  3TRP A;  4V2N A;  5CRE A;  2XC2 A;  3E0U A;  5FHI A;  2GT6 A;  5GST A;  4GXZ A;  3O3T A;  5G30 A;  5ECM B;  1O6J A;  3LXZ A;  5JWQ B;  4TR1 A;  1USB A;  1BJX A;  1F37 A;  3ZVJ A;  3KTB A;  4K2X A;  3LFL A;  2H01 A;  4KW6 A;  2GDR A;  1Z7P A;  1WP0 A;  3M0F A;  1OC3 A;  2RII A;  4I5Q A;  1M2B A;  2GZP A;  2X4A A;  4K0N A;  1I5G A;  4HU9 A;  2PGT A;  4OO5 A;  2P31 A;  4HOJ A;  4XCS A;  4KDY A;  2GQM A;  3DVX A;  3L9U A;  1O8W A;  4GCI A;  4RQR A;  2K8S A;  4YAV A;  3GH6 A;  2X8G A;  4IJ3 A;  3I43 A;  1SK2 A;  1R4W A;  3EVI A;  2LRN A;  3IXR A;  2HRF A;  1ACV A;  4WKW A;  3A5I A;  3TGZ A;  4DVC A;  4MJB A;  1V40 A;  2IN3 A;  2H70 A;  5CNW A;  5HR0 A;  6GST A;  19GS A;  1DE2 A;  1ZYQ B;  22GS A;  1ZL9 A;  3BCK A;  4G10 A;  1A0R P;  2J9H A;  2DJ0 A;  3RHC A;  5IM9 A;  4L8E A;  3J7Y b;  2VLT A;  3F8U A;  3P90 A;  3IC8 A;  3QR6 A;  3I9V 2;  1S3D A;  1EP7 A;  1KNG A;  4YQM A;  4OO4 A;  4YH2 A;  2B1K A;  4V1A g;  2QSI A;  3QCP A;  1SYX A;  1XW9 A;  2H6X A;  4TVE A;  3FK8 A;  4GRF A;  3IK9 A;  1V2A A;  2VL3 A;  1ZYE A;  2B5Y A;  4KND A;  5J41 A;  5EVO A;  2C3T A;  2PPT A;  4YQV A;  4NPB A;  2CQ9 A;  4DSS A;  1KBN A;  1VF2 A;  4Z2R A;  6GSY A;  2VD0 A;  3VI7 A;  4POL A;  1K0B A;  2FA4 A;  2LJK A;  4IP6 A;  1A8L A;  2LTK A;  1QGV A;  4IQA A;  3MWH A;  2AYT A;  2DJ3 A;  3HYP A;  3RDW A;  2B1L A;  3D21 A;  5HFG A;  4I8B A;  3TKS C;  1YEP A;  1X9S B;  2HRK A;  1UVZ A;  1FG4 A;  3VPQ A;  2M46 A;  1YY7 A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...