2WDPA

Crystal structure of ligand free human caspase-6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
263
structure length
224
Chain Sequence
b'FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVPSAIGKKQVPCFASMLTKKLHFFPKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-6
publication title The Crystal Structure of Caspase-6, a Selective Effector of Axonal Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 224
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wdpA00
4EHDA 1RWXA 1QDUA 2J32A 5LU8A 2FP3A 3NKFA 1NMEA 3H11B 4N5DA 4JQZA 4FEAA 2QLBA 1F9EA 4D3XA 4PRZA 3EDRA 4EHKA 4AW9A 4DCPA 1SC4A 4QUIA 5IAEA 1RHJA 3H11A 4DCOA 3E4CA 4QU9A 4JR0A 2J30A 4IEFB 2H5JA 3H0EA 2H51A 3R6LA 4QUDA 2XZDA 1RHKA 2CJXA 3D6FA 5IC4A 3S70A 3NR2A 1CVRA 2H4YA 4ZVTA 2XYPA 5K20A 4FXOA 2QLFA 2AR9A 5LUBA 5LU9A 4ZVQA 4QUAA 4EHFA 4ZVUA 2NN3C 2P2CA 1F1JA 1RWOA 3ITNA 4JJ8A 4JJ7A 4JB8A 2DKOA 4EHHA 5LUAA 4N6GA 2CDRA 4DCJA 3R5JA 4PS1A 2CNKA 3V4OA 4AWAA 3DEJA 2H65A 3GJSA 2WDPA 5IAGA 4FGUA 2K7ZA 4QU5A 3R7NA 5H0IA 1M72A 2HBYA 2C2MA 3NS7A 4QUGA 5IARA 2J31A 3GJRA 5IC6A 3IBCA 3D6HA 1GFWA 3UO8B 5IAKA 5IBRA 3EDQA 4QUJA 2CNNA 1RWVA 3SIPA 1QTNA 3K7EA 4ZVSA 3V6LA 2QL7A 4JQYA 4PS0A 3QNWA 5IBPA 4HQ0A 1QX3A 3H1PA 4EHLA 3D6MA 2HBZA 4QUBA 1K88A 4M9RA 2XZTA 4NOKA 4PRYA 1SHLA 2FQQA 3KJFA 1RHQA 1RE1A 4N7JA 1RWPA 1SC1A 2Y1LA 5IAJA 5I9BA 3V4LA 4D3YA 3UOAB 3RJMA 4N7MA 1I4OA 1ICEA 4JR2A 1GQFA 2H48A 2C2OA 4FDLA 5IANA 2H5IA 1KMCA 1NMQA 3GJQA 3OD5A 1RHRA 4JJEA 4I1RA 2QL5A 3KJNA 3PCXA 4NBLA 2QLJA 1RHMA 2C2KA 2CNOA 3H13A 4QTYA 4I1PA 2XYHA 1BMQA 1RHUA 1SHJA 3R7SA 3P4UA 5IABA 1I4EB 5JFTA 2QL9A 2H4WA 4HQRA 4ZVRA 2C2ZA 4NOJA 4ZVOA 1RWKA 3P45A 1NMSA 3V3KA 4NOMA 4EHNA 1IBCA 5I9TA 4JR1A 4NBNA 4IYRA 2J33A 1NW9B 2HBQA 3GJTA 4LSZA 2H54A 2CJYA 4QUEA 5IASA 4ZVPA 1PYOA 3DEKA 2XYGA 3DEIA 1RWMA 3SIRA 3R5KA 1PAUA 3R7BA 3V55A 4HVAA 4NBKA 4N6OA 4EJFA 3DEHA 3R6GA 5IBCA 4QU8A 4QTXA 3BIJA 4EHAA 3V6MA 4AWBA 1RWNA 4N6NA 3PD1A 4QUHA 1JXQA 3PD0A 2CNLA 1K86A 4D3ZA 2HBRA 1I3OA 1RWWA 1CP3A 3IBFA 4NOLA 3KJQA 4QU0A 3S8EA 1I51A 2Y0BA 1SC3A 2FUNB 4QULA 2C1EA
chains in the Genus database with same CATH superfamily
2EAUA 3JY6A 2REQA 5FI5A 1NMEA 1Y4SA 1E1RD 1WXXA 2BHNA 2XRFA 3AG5A 4LVCA 4MUXA 3CH7A 4V2UA 4BO4A 3MJEA 2DECA 5F52A 3BREA 3IKTA 1O87A 4C21A 3GNSA 4CF4A 4EI8A 1G3UA 2BYTA 1S4MA 3CNHA 3I5MA 3R6LA 1Q3TA 1JDNA 3IA2A 1X19A 2OG2A 5CGQB 2Y77A 2FSVA 1PK7A 2VHUA 3HI6A 3B5IA 1M54A 4MKRA 1P19A 4O5AA 1IFXA 4YQFA 2G9RA 1DEOA 4ZK2A 4L8VA 2E37A 2VTVA 2MYNA 3PXBA 1E60A 2QGFA 4NENA 2EFEB 2FPMA 2ZS7A 2CWWA 1M8FA 1E2QA 1AJEA 1JIVA 1KKLA 3ONVA 5KYKA 1HTBA 2C2HA 2G72A 1ZGAA 1H4VB 3QP9A 1MCZA 1A8QA 4CLRA 2YASA 3GAAA 4URFA 2WJ4A 3INRA 3VO1A 4CMJA 4LGVA 4J0DA 2WUEA 3P1JA 1XU9A 2VDWA 4FJ2A 4NU0A 3TOXA 2AD1A 1Q5PA 3LY8A 3QKUA 4M60A 2FAXA 2PUHA 3AT1A 5JS6A 4Y6GB 1G7SA 1NN1A 1S96A 3CLUC 1UXHA 3BMOA 5CNJA 4HEA1 1BQ3A 5KQGA 2LV8A 1NTOA 1KH1A 2WPNA 1ZZEA 2IIPA 1U7PA 3O5AA 4FR5A 2WNSA 1IOVA 3CURA 2WZQA 3IAEA 5D3QA 1J8FA 1NR1A 5ISMA 2EBFX 3PX2A 4A26A 3WA7A 2HU2A 1NOJA 1OXKB 1PS0A 1H2AS 1Z16A 2XD9A 3INGA 3O8OA 1CUDA 1X74A 2IOQA 3M4XA 2Z6UA 4DG9A 5IMBA 1OV6A 2ZKIA 4R3UC 5T4FA 3GCDA 4K6GA 5ANRB 2AI1A 1TU3A 1KMQA 4NS1A 3V33A 1MA3A 4WXRA 1MB2A 4CN9A 3QH4A 1IBKB 4DBVO 2ZRNA 3DAFA 3R5TA 4B7AA 4F4CA 2QMUA 1GITA 1PW5A 3QVXA 3ZV5A 2NYVA 2C9DA 4RL4A 3EARA 3RIHA 5A5FA 4XX0A 1M2OA 3OZWA 4GZ6A 5H3HA 1Z0UA 1W1WA 1QIMA 1E0JA 1T2CA 1W1UA 3CZMA 2IUFA 4PANA 1R4NB 3BFPA 3LBYA 5HE8A 4RZQA 2QRGA 3R2JA 2O3QA 3HYRA 3PE3A 2IEIA 2YY6A 3DV9A 3BH0A 3LCVB 1JT9A 3LSTA 4YNBA 4NNOA 1VG9B 4PLFA 3LUBA 4TROA 5A3QA 1Q57A 4UCQA 1WULS 4CQMB 4U2EA 4HV4A 5FOQA 2NXEA 1FFAA 2OLEA 4QSHA 3M1YA 1DI0A 1DUVG 1KKUA 3OVMA 4OD0A 3I5XA 3DLIA 4G85A 5F9MA 1JF8A 3TCXB 5HKAA 3FPSA 4BV9A 2X4GA 3C3YA 4Q6WA 4MGHA 2WD8A 3BWVA 3E2MA 3E9EA 4ZRDA 5ITVA 1HSOA 1ZGHA 3AHCA 2LKCA 4FN4A 3O3OB 3T9EA 4CIXA 2D7CA 3I4LA 3SHTA 2A5LA 3DUFB 2CYAA 3CRMA 3D1VA 1ZWKA 5E6RB 2ATCA 4CKWB 3P96A 5FWXA 3OU6A 5B58T 5LU8A 3CX3A 1XD8A 1G8AA 1PFQA 1DBIA 4MTCA 5BVGA 3PTZA 1VCMA 2IYNA 3G2LA 2GWRA 3O1IC 3K0FB 4I1IA 1GG5A 3NIDB 3DWGA 2VT3A 1GUZA 1V5FA 3OM0A 2YKGA 2EWWA 1STOA 2A3NA 1L7AA 2HA7A 3LVFO 1DBVO 1TLLA 3FTCA 3GK3A 3QRWA 2XZDA 4OQMA 2BDEA 3NYWA 2JGNA 3L8ZA 1YQEA 2H4YA 2PWBA 3EXG2 1NLYA 4AO6A 4D81A 2IOFK 2GWHA 3K9WA 1ZD3A 2RAPA 1JW9B 2CHQA 3R5FA 2IYUA 4BVJA 1E2IA 4NK4A 2J3HA 4KBGA 1UP7A 4MJ3A 1ABBA 1A9XA 3WQBA 3X3HA 1PV1A 3HEBA 2IWRA 1NVUQ 1Z7YA 4N18A 1PO7A 2ZR8A 1P31A 1YCDA 3BTUA 4OAQA 2OA0A 3U3ZA 3ZDQA 4NATA 5LLDA 4OH1A 1IIBA 1S3SA 1OZAA 1KOJA 5ALHA 4A03A 2O3SA 2Z1DA 1RRMA 1KZ7B 1R64A 3W2HA 4WBNB 1E2KA 1Z22A 5F4BA 1OMOA 1FU8A 2EP7A 2Q7XA 1M8KA 3QUTA 4JSTA 2XMGA 2X77A 2AJLI 5IBRA 1AN9A 4CKCA 3C74A 2G7MC 2VAPA 3WB0A 4CV1A 1SC9A 1QHFA 2V7PA 3GLIB 3OX1A 3SMQA 1Y6ZA 3VA7A 4LJAA 2GUGA 3HUEA 3D54D 5HMMA 1TTHA 2ST1A 3NVDA 3RSFA 1S3GA 4C20A 1GYQA 2XKJE 3D6JA 1K4YA 1YDFA 3DL4A 2V0CA 4LRUA 2X8JB 3JQPA 1RTTA 4C03A 3AHEA 3O8DA 4AMVA 2HQOA 5IH7A 1TTQB 1ICEA 4H27A 5FPHA 5C3MA 3N1UA 4CLOA 4BP9A 2PLWA 3RKRA 2ACWA 4GLOA 4FE7A 5DCUA 5FOXA 3I28A 1KP9A 1ZK4A 3I01A 1N0UA 4S1OA 3CTPA 1FDIA 3I12A 2O8EB 1V8FA 3RFCA 1RPZA 1UK8A 1VSBA 1Y3BE 2OCXA 3K2EA 3KSRA 3L0SA 4TOIA 2O8BB 3A37A 4HRXA 4QRDA 4AP5A 4DA9A 1UAAA 4GLFA 1JB1A 3II6X 3QKIA 4F2HA 4KN6A 5AVQA 2BLNA 3KE9A 3RR2A 2IF0A 4L4SA 2IVFA 4G63A 1RCUA 3GB9A 1TMKA 2A0KA 3BJIC 3L7NA 4H6PA 4KGZA 1PK9A 3D3EA 4IS2A 1Q6ZA 3AM4A 4YRSA 4LCEA 4BGDA 1D4ZA 2GT1A 2WD7B 4AQDA 4Y2QA 3VYUB 3RYFB 3MRVA 4X1KA 4B3JA 2QN6A 1A5ZA 4X7RA 2JBAA 4KFCA 3WFIA 3GRYA 4KSCA 4CVNA 3QVTA 4ZYUA 4ZJUA 2R751 3O8NA 2BGNA 2O20A 3LFHA 1Z5ZA 3DDUA 1XJWA 1CEYA 4AECA 1YAJA 3HUFA 4I4LA 3VR1A 4JUDX 1S3FA 1AQUA 4TV8A 3EVBA 1KHTA 1TKRA 2C82A 5JAPA 1EFVB 4FYJA 5J5AA 5F9HA 3F2VA 1WDLA 3B6KA 2JZNA 2FP3A 4GSKA 4O25A 4KQKA 3UTDA 1BDHA 1FYXA 2EHDA 1QPZA 4KQ2A 4EA9A 4TXJA 1MAUA 4LG1A 1T1JA 3OO0A 2HIGA 4XZ3A 5GZ6A 1NF8A 4NABA 3DR3A 3GMTA 5IAEA 5BMVA 3KZMA 1PIWA 3BWMA 1GSOA 5EA2A 1XRLA 3KIPA 4IKOA 4RGYA 1J8QA 2B1QA 3EXFB 5B4UA 1GPNA 3I6BA 3LGAA 2IYAA 5CPBA 1JIUA 1OH8A 1U0NA 4RAQA 4QPPA 4EARA 2X2FA 1SUDA 1COWA 3IDSA 1QZUA 3JRNA 2O8VA 3EULA 3DLPX 1KYTA 1NQUA 4K1LA 5AW3A 2JH8A 1LPSA 1BDBA 3K0AB 1Y8RA 1LEHA 5ENZA 2BE9A 1P39A 2BZSA 2YS7A 3HHPA 4B3HA 3D2LA 4HZUB 1NJ5A 2PL5A 3FGNA 4HEJA 2HQBA 4N9QA 4PWZA 5CR9A 5DCLA 4YHHB 3RSGA 3CKLA 5LXTF 3CHYA 1DTWA 5JNLA 3I4FA 4KQXA 5B6IA 2C2MA 1KR2A 3P9QA 1RI1A 3KJGA 4LDNA 5BR1A 5FT9A 4HDMA 3RRJA 1YU6A 4LK3A 2IH4A 1D04A 2MWMA 3AEQA 1Y3HA 3OFSA 4MAMA 3HG7A 5A02A 5CX4A 3DB2A 4IJMA 2ZRGA 4LY0A 4DPMA 4PRLA 3T34A 3Q15C 4QBHA 1CV2A 3MTIA 3MS2A 4KX3A 1NKSA 3UJDA 3J7AC 4GWGA 4WLNA 2ACKA 1JHUA 1UZAA 1COZA 2J67A 1F48A 1N25A 2DKNA 3NHRA 3MGGA 5INTA 3G79A 1L8AA 2GHIA 2ZUCA 1FUIA 3NEJA 2ZPAA 1JH8A 3EXG1 1NLFA 1XUOA 1ZXLA 2AFHB 1WW2A 4BZZA 4FCCA 1J4AA 3KQHA 3AGPA 3B9PA 1IEWA 3CUEF 5HTOA 1NUTA 3O9MA 3TOVA 3P71T 3DHEA 3ELWA 4G0MA 5GV7A 1QQTA 3TM5A 2PD3A 4AZSA 3U7RA 1FDWA 4JLVA 1E4EA 4G8CA 5CLLA 1DO0A 3WI7A 1JR3D 2WU3A 1OBVA 2G25A 3K9HA 4HLUC 4JT4A 5B3JC 4DR2B 4RA6B 1JHMA 3ZNNA 3EXEB 3P2MA 4TKMA 3S0JA 1GG9A 3EZ6A 2P9YA 1T5DX 1L8QA 1EUDB 1GKYA 2PRKA 4MCHA 1UOPA 2AEFA 2WM3A 3IR7A 4E6EA 4KUGA 4X54A 1V6SA 1JDUA 2VNHA 1PP4A 4DHWA 2AZMA 3JASB 2P9BA 5AVOA 4BVAA 4ARSA 1U90A 5I9TA 5P8WA 4NBNA 3Q8MA 5EMMA 5IDVA 3M2TA 4OEHA 1CS4C 2HSWA 3TXXA 4UTZA 1OF1A 2J6BA 3HH8A 4TMFA 2KB0A 1GAQA 3OKPA 4JI3B 2KS6A 5B6JA 3CKYA 2OO7A 2ZWVA 2QN2A 3TLMA 1BHQ1 3PFGA 3R6GA 1T1IA 3TYXA 3RRMA 4BFZA 1XAGA 4G09A 4B34A 5BNWA 5IJ0A 3F47A 4PZDA 3C7KA 1CETA 4HAZA 2HHJA 3UK1A 1G16A 3VR2A 5EJ9A 5CLFA 5EINA 1F2TB 3EG9A 4PPGA 1SPXA 1QQ6A 2J4CA 3ZWKA 3LT0A 1Y81A 2PX0A 1I80A 1M2HA 3NHSA 3OOSA 4MCIA 1O0CA 1TT5B 4TLLB 3G49A 1IATA 4EG7A 4JQZA 1YR9A 4Q3KA 1E6WA 4RPCA 4B6JA 1R10A 2GZ1A 4JLUA 3C1TA 2R1VB 1NXWA 1VC2A 4Y2HA 1WXHA 2VUUA 4IDQA 1D5CA 1IDN1 1OPRA 2HV8A 2O2SA 4KDCA 4EG1A 3VFDA 2GNPA 2R8YA 1D4AA 5TC4A 2OAP1 2PKEA 4MVJM 1NJFA 3DE6X 1U8XX 4HNTA 2ONYA 1ZA2A 2AH5A 2NZWA 4M2LA 5CLHA 1EBUA 1ZGJA 5JXWA 3B60A 3HN6A 4QIHA 1M2NA 3UH1A 2GN2A 3W8RA 5JAHA 3H4MA 4JX9A 4MMYB 3FPBA 1EA5A 1QFXA 2WAXA 4TWRA 3UKJA 1C9YA 1DWUA 2A8YA 2PH7A 3JR7A 4UBKA 3QX3A 1KRXA 3PGJA 3A4MA 2W6ZA 4KE6A 2B2NA 4E4TA 2VAWA 2Q3JA 2COEA 1BN6A 1AQJA 1O97C 1QRTA 4YK7A 4OQXA 3H19A 2XCRB 3OTOB 2KSQA 3MRSA 3RRXA 2FKAA 2J31A 3PNBA 4FN5A 1H22A 2LIVA 3U44B 5KJ1A 3AF6A 3B9QA 3ISTA 3L02A 2VYNA 3U3OA 2D54A 2OWEA 4PQFA 1IQ0A 1Y9JA 4H2DA 4L7QA 2CNWD 1JYFA 5CURA 3NUQA 4JUIA 3JS5A 3L7OA 1RJ9A 4PZPA 1SKYE 3DL7A 4X6YA 3VZRA 4HGRA 1YA6A 3TNFA 2VRCA 1BWRA 1R3UA 1SC1A 3JV7A 1JIKA 1FTQA 1JAZA 1QVRA 2HCBA 3HDHA 2WUFA 4LUCA 4M1KA 3A2LA 2PAFA 3CS3A 2PA0A 5LN1A 2OMKA 1W94A 3MGKA 3NHAA 3O82A 4IVPA 4A0HA 5TIIA 1AMOA 1EESA 5AK6A 1DKRA 1KEWA 1FSGA 2XYRA 1X77A 1ISPA 3CF4G 4JZYA 5IVDA 1E64A 5KQSA 4HAWA 3PQ2A 3CGGA 1QHSA 1MABB 4UBIA 4UU7A 1MDBA 4YPOA 4ND5A 2HRDA 2Q5JA 2OPHA 3K9CA 4XDZA 3U49A 1Y8QB 4MB6A 1FTNA 4GBMA 5BVHA 3BXFA 3TRDA 5JR3A 4HGPA 3RIXA 3P9KA 3T5CA 1WUIS 2WHYA 2EJVA 4IW3B 5E9JA 4YGYA 2K2WA 3WKEA 1GG2A 2IU4A 5ALKA 1GN8A 4FDVA 4RVNA 5SYNA 1JQKA 3HY6A 5IASA 3QV1A 4RAOA 4MRNA 1C1XB 1E2EA 1TVMA 3PFNA 2BN4A 3PPYA 3RSLA 2DBRA 4CIDA 3OCYA 2NT4A 3THOA 1J9GA 1FPMA 1G8JA 1I01A 4KXWA 5ES4B 1YZNA 4QREA 5JYBA 2ZRBA 4C87A 1SOVA 2I2CA 4JP2A 1MT3A 3GVPA 2ZZNA 1AK1A 1E92A 2O3UA 3DBIA 3U48A 2OQRA 1H2WA 3EFBA 3SOPA 1CY2A 1TM2A 2VZ8A 1TVEA 3ENNA 1NVKA 3OQBA 1OB2A 5T6BA 3R7WA 1QX4A 3B89A 5REQA 1NW8A 3I5UA 1X6VA 4MS3B 4QTTB 1RFGE 1USUA 2PX8A 4KRGA 4IDGA 4WPGA 3N2KA 4O4IF 2N1BA 3GLKA 5KC9A 2FSGA 4OF4A 4KO8A 2J6CA 3C14C 3L07A 4KTVE 3ZNPA 4KIGA 4KYVA 2D8AA 4FCTA 2XD4A 4M9UA 3TWOA 1ND5A 3KR9A 3ODPA 5I45A 4UUQA 4DWWA 2IYWA 1L4NA 4PAWA 2YJNA 1I8TA 3PIRA 1MVNA 1OLXA 1V1MA 4O08A 4X6XA 2F43B 4ITUA 4LBYA 4KLNA 5KPDA 2ZTMA 2VHQA 4ND6A 5KAMA 4ENWA 3BKWA 1URPA 1VJCA 2FOLA 2QAJA 3FWKA 3GEHA 2HWXA 3IEPA 4BHTA 2IUSA 1DFHA 1YBVA 2OT3B 4FT4A 3NBAA 4TKLA 4M1OA 1U0RA 5EFZA 2ORIA 4B3MB 121PA 1LBIA 4AYXA 4P4SB 5F4ZA 3GZNA 3W8EA 1MQ9A 2GRAA 3GMSA 2Q2OA 3DXFA 4M0UA 3MLEA 4MICA 3LT2A 3CO5A 3LPCA 1EK1A 4JU9A 1B73A 1QMGA 1ULBA 4FW8A 4M0KA 1W5TA 1RVV1 5EJ6A 2VA9A 1PZNA 3H9EO 3HA7A 1FPQA 3OE1A 1XLWA 3D8BA 3DE4X 3LDUA 3TAHA 2PVPA 1NQVA 2NQ8A 3MW8A 1TYBE 1Z29A 4UEWA 4U4AA 4V39A 5L51A 2CD7A 3TL2A 1JFLA 4MA0A 3GQBA 5GIOE 3ZNOA 3OEHA 1CJBA 1COWD 1AV7A 2D5CA 4EUFA 1BGXT 2IBMA 3ND5A 3DUWA 1PD0A 4NDAA 4ZXPA 3D6MA 3C4JA 2UV8A 4TSKA 4U9UA 3V8NA 3AUUA 2Q46A 1UPUA 1AT1A 3Q88A 2C4MA 4H1TA 3T0IA 2VAMA 3ZCSA 5ALYA 1WCYA 3BSFA 1X38A 2X41A 3ECCA 4G01B 1MNQA 2FHPA 3FLMA 4L22A 4MVJF 4LTDA 4EENA 3NAGA 4BU1A 5CB6A 2QMOA 1PFGA 1U2ZA 3A6DA 2QAGA 1JZTA 3ZE7A 4WNAB 3I61A 2NSHA 2WJVA 3K70D 3O3MB 3PC4A 2VDMB 1K06A 3QLVA 1WV1A 5KNBA 1T3ZA 4ZT7A 4M8SA 3GVHA 4ERXA 1Y33E 5DEOA 5ILOA 2A9VA 2P6PA 3NG1A 1T9ZA 3DE0X 4RK5A 4DBLE 4QTYA 4ZJZA 4D0SA 3KB6A 1TAHA 3CX6A 4G9BA 4MLCA 4P22A 1L5FA 2BIFA 2WTAA 5DW0A 1YHYA 4XJSA 1RR6A 1F8GA 1QYRA 3CSSA 3FUTA 4US0R 4X85A 4J1QA 4FZVA 5JPDA 5K0BA 3AWIA 5KX5A 4LDAA 4W5OA 2CLMB 3IQDB 3E7WA 4WK0B 2DM6A 4LS3A 1E1CA 4ZVOA 4AD8A 1A9YA 2HB6A 4LMPA 3N2GA 3QELA 4C4PA 3TRHA 1EWVA 3DLAA 4ND7A 1IBCA 3CX4A 3VNBA 1XZLA 1YZGA 2ID4A 1WD7A 4FHZA 3UW3A 5K09A 1MTOA 2JEYA 1Q15A 4DMHA 3PWKA 4Q7EA 1Z88A 3OJEA 3TIFA 4XWKA 4NCBA 1RYDA 4OJNA 3WDLA 1V2GA 3X1KA 4HB2A 5CDGA 4IV8A 4ZO9A 1K3UB 2GSDA 3GXOA 4RY9A 3STHA 10MHA 1FLNA 1U2GC 5SV2A 4KLRA 4HYTA 5H9VA 5HFJA 5GAJA 1W581 4AI6A 4P5EA 1Y6JA 2PRIA 5I51A 1Y8ZA 4MV4A 5AJTA 2X0KA 3LV8A 4IUCS 4DA6A 1GD1O 1RYYA 4UOEA 3PJRA 1T8TA 3JRWA 3KKPA 3DW3X 1JALA 2QTTA 3OIDA 2WIBA 4RU1A 4KWCA 5J9FA 3WK5A 2M98A 3JVUA 3KSZO 2FQWA 3C6ZA 5DH9A 2ISCA 3RK4A 4BWYA 4Q3CA 1GR1A 2CY0A 2UZIR 4WFJA 4JR0A 4Q1CA 5FOWA 2XT9A 3WBBA 2B3TA 4YT8A 2GZRA 5HKBA 5IXYA 2PTHA 3KL2A 3WWEA 3D1JA 4ARCA 1AK9A 4MQFB 4JP1A 3RCBA 1Y5RA 5A3VA 2I22A 3DL0A 2JA1A 2OUIA 2QLFA 1M33A 2WM9B 4IIBA 4CNBA 2KJQA 3VR2D 4BMVA 5ALUA 1Q19A 3NOVA 5DZSA 2V1XA 1E6EA 3EIQA 3IAAA 4E09A 1LJLA 3MT9A 1UXGA 4JXJA 4QASA 4TM7A 4ZOLF 3EMKA 2REBA 1UXJA 4YUAA 3SYKA 1P2VA 4V0KA 1ULZA 2BBWA 4RQTA 3IV9A 5I48A 1PSWA 2VJPA 2Y2UA 1NATA 3EQ2A 4JXZA 2GN0A 4HX9A 4RZ2A 7GPBA 4OYHA 5TT0A 1W30A 2YWJA 1RI3A 2WZDA 1HETA 5GOZA 3E9DA 1MJGA 4YJGA 5CRIA 2P6RA 2O48X 3KD3A 4K9QA 3ICEA 1KK3A 4OBXA 1FFYA 3M4ZA 4R4JA 4G5YA 1AD2A 2FK7A 1UFRA 3O26A 1SWWA 3RRBA 2QNBA 5JU6A 2LPMA 1HFWA 4PZUA 4W1SA 2GD6A 4WASA 3K4PA 3CMMA 1RABA 4KPUA 5CFMA 5GJVC 4R1OA 2I67A 4RDXA 1J2JA 1CS0B 5AJXA 1DQNA 4H1HA 1MIHA 2WQZA 2EZ9A 3DHVA 1QZ3A 2TRSB 3F3SA 4RM2A 4B2YA 3E2PA 3ZVNA 3GFRA 4UASA 4WY8A 4Y9SA 4MI1A 3UJNA 3Q8KA 2LCIA 2YXNA 1ENYA 3ANNA 1A4UA 3ICVA 4JHXA 3WLTA 2WTUA 1TUBA 1K7EB 1RBQA 1GTJ1 4B6GA 1AUXA 1U5CA 4JNKA 5E2AA 2O8EA 1ZK0A 3UAYA 3LQFA 5DJ5A 3QLJA 1PR5A 1ONNA 3NXKA 5ICSA 1YVEI 3T4PA 1M0WA 3DYVA 5GM1A 3ULKA 3UUFA 2R2AA 4LIPD 3V4VB 2YWBA 4JBHA 4DXAA 3PUJA 1H9BA 3BL8A 5T4BA 5K6TA 1GGJA 4G1EB 3ZDDA 1L5WA 1HF3A 2XUHA 1C3LA 1IBRA 4DHEA 5CG1A 3H1EA 3JZIA 2Y9MB 5D1HA 3U3MA 2VRCD 4QUKA 1QAQA 1JKJA 5C51B 5FEMA 1C3XA 2IUTA 4EOGA 1CP2A 2IHUA 2W0SA 1OBFO 3HL4A 1VIVA 1JHDA 3UWDA 3TBHA 2CSXA 3GELA 2OZKA 3DBRA 2FETA 2IZ0A 3DV0B 3ZWWA 4C3UA 4RTOA 4DQUA 1KC3A 1J6UA 3TW0A 4UM7A 3T35A 4UAJA 5AKKA 3ZCQA 2NNLD 4KNWA 2NZ2A 5AM3A 2W6PA 3FZGA 3WRYA 2Q0HA 1FMTA 5DGIA 4KVZA 3BA6A 4NICA 3EZ2A 4DA0A 4X20A 5DTEA 4F92B 2XCLA 3L1UA 2CV1A 2DPGA 2FSVC 3BDVA 3C16C 3HEMA 2JAHA 3NHLA 1EQAA 1PWEA 3IBFA 1L4YA 4FDUA 3FCYA 4R1TA 4RSGA 1Z83A 3H05A 3UFXB 3UK0A 1B26A 4CJXA 2C1EA 3OJLA 5HUJA 2IYSA 3IEKA 3SJCA 1K6JA 3RSSA 4NX2A 1ORDA 2JFNA 1M66A 3B9RA 3TX2A 2HJ9A 2HYDA 2QA5A 3I2IA 3ZJTA 4I6GA 4KN8A 3ZU2A 1UJ6A 2B25A 4L73A 3C6BA 2KLBA 4RVUA 3IEIA 4BQEA 1MIOB 3S70A 1AXEA 2XQFA 5DF1A 2DR3A 1SD5A 3IT1A 5HCNA 1T1SA 1E6MA 5JRZA 1O1YA 4RTJA 2ZK7A 3KJIA 3ZS9A 5FXMA 2JLSA 4MWCA 1AKEA 3L4SO 1TYCA 4ZI2A 2WWFA 4MPJA 1LCIA 3A58B 4PTZA 3WGOA 2FFQA 1EXVA 3FI0A 5L6LB 2VJQA 1XVVA 2VQ6A 2OL4A 4RK6A 4OQ4A 2FX3A 5CEEA 4WLEA 1LSUA 2Q27A 1IONA 1T2FA 3ILSA 5EXXA 3MWEB 4IHJB 4ZYXA 5EKDA 3RWBA 3LCRA 3MMZA 2CDBA 4DKXA 5B1EA 4TWIA 4BMPB 1H3FA 3HB9A 2QD1A 2G4CA 2H9YA 4ENUA 3AM1A 2GVDC 3VYWA 2JAOA 4DIDA 2IEZA 1NUQA 3QPUA 3DNMA 2YV4A 2XA2A 1BKSB 1RWVA 1WB5A 4MYRA 3I4CA 2N46A 1UPFA 1YR3A 2P1RA 3K9NA 5HJ5A 2FSUA 2X58A 2GEFA 2Q1YA 3DMRA 4G0NA 4P7KA 4CM9D 1HE1C 3ERCA 1TK9A 2ZRQA 3SLGA 2CFCA 2CLKB 2AG6A 2QORA 2O54A 4E2XA 1VHWA 2C7BA 2XRMA 1K0UA 1N7IA 4UDNA 4C7JA 3FY4A 1DWPA 2GN1A 1YBMA 1XEWX 2NUTB 3GQVA 5EE3A 1M7HA 3D8TA 5C1PA 3GX1A 1A5AB 2QT9A 2R60A 2VUHB 3HE3A 5TV2A 1LU9A 2QRVB 2ICAA 3ADPA 5F5LA 4OYRA 1VLJA 2BGLA 2WIKA 1LXCA 3EEOA 1FSPA 1IWBB 1IE3A 3TTYA 4C3OB 4XXHA 2C84A 1QJCA 2FEMA 2HJVA 2OE2A 2CNOA 2PSEA 4I19A 2BR5A 3O2JA 2WF6A 4A6XA 4C9BA 4RGQA 2I4IA 1AXRA 1OX6A 4JXKA 3T5GA 1A4RA 3EJWA 1BMTA 5C3UA 1OFGA 2WJWA 2BH9A 3L41A 4UEOA 1W0JA 4YT4A 2D5LA 4TT8A 3DNFA 2F3UA 4BX3A 4DR6B 5D3ZA 2JJYA 2P27A 4LHZA 3A1UA 5EQDA 4E5KA 3ZCVA 1HE4A 4S35A 5AVRA 8AT1A 2CMGA 3TLAA 1HDRA 2AI3A 1V1RA 3NAQA 1TVKB 2BWJA 3IAFA 3JQRA 4YECA 3D3WA 5HDQA 1LBSA 3KS9A 3WY9A 5DNCA 2WA2A 2G77B 2YS6A 4OK6A 3DFUA 4JDPA 2AOVA 1QV6A 4DZZA 1HC7A 4QPJC 1PAUA 3A6ZA 2RSLA 3GDHA 4IDFA 3Q0IA 4PAQA 1L5LA 2IX3A 2FEXA 1TB4A 2AVDA 4OHWA 1XQWA 3NBXX 4H16A 2W2LA 3NVMB 4WI1A 1MO4A 3FPGA 4X61A 4BLUA 2QP9X 3R6TA 4K9NA 4Y1FA 2QR3A 1KI6A 3VM6A 3SZMA 2OXIA 5BN3B 4I08A 1TCBA 4ZCTA 1DXHA 1NW4A 3LT4A 1AUQA 5D5PA 3ZXYA 3TAUA 4BN5A 4B75A 2HT1A 1FVXA 4KQWA 4Y2PA 2B5OA 1PFKA 3QXGA 4FNMA 2Y1KA 4N3GA 3R9WA 1QTQA 1S7GA 4DCPA 4CZ2A 1HTTA 2VT6A 3H8SA 4QELA 1D8AA 4BO7A 5DMHA 1N4DA 1TW2A 3DZJA 1B0ZA 3ZHQA 4M8LA 1U2TA 1XJCA 3OF3A 4EFLA 1YR8A 3D8NA 5CA1F 4B3SB 1TRKA 3W9UA 4ESHA 1YF3A 3NOXA 5ETJA 1YCGA 3Q11A 3ZV3A 3DONA 3TQQA 2BUBA 3SCZA 1TM1E 3P9IA 3HCDA 3ZYCA 2G1UA 3H83A 4G6ZA 3UPUA 3VXKA 2HEGA 1VZ2A 3NWEA 2CDRA 4ZOEA 5JCOA 2WBLC 5C1DA 3ORFA 1ZN9A 1E0DA 4KXYA 4B3RB 3CNOA 1NW6A 1U4OA 2VPIA 2ZJ7A 2V4MA 2WD9A 5D6OA 1LPNA 2G83A 3I6QA 1E6UA 5A5VA 5SICE 2BFOA 3FXAA 2CL7X 1KTIA 5CK4A 3T5AA 3Q3GE 3C3AA 2EIXA 4CG0A 3LPNA 5DI3A 5EPOA 1WMFA 1H0KA 1WG8A 4YP0A 5KOJA 3WDMA 1QV9A 3D4LA 4CLHA 4N03A 3BWYA 3N7AA 3GEDA 5FFNA 3F4KA 3WIDA 1L7DA 3ZWPA 4H6XA 1YTLA 3PDUA 3R3JA 4Y2SA 1KYYA 4MR7A 1XLVA 5B1HA 4ER3A 2A5FA 1FMCA 1AO3A 5K8IA 3GLFB 1HE2A 1E1YA 1BIFA 2ZZKA 4S1NA 3IP8A 1WJGA 1Z13A 2FR8A 2JIRA 2LZ0A 3NYIA 2OILA 1VL8A 4D2IA 2XZOA 5LLTA 2F4NA 2JARA 1YB1A 2B21A 1NU8A 3CEJA 4KIWA 4AZTA 1WKBA 5C5CA 4BKPA 3DE1X 1ZRMA 2YDXA 4LVUA 5F2NA 4IDEA 3DEAA 4M7OA 4E70A 1OI7A 4M87A 4CGYA 1RTKA 3LD9A 4ALLA 1FBTA 1U1GA 3I58A 3IVMA 3UXHA 2I3AA 4O3FA 5FX2A 4Q24A 3C7AA 2HV9A 4E2YA 3BQ9A 4G5QA 1XTVA 3M9LA 2XF8A 3PUVA 3G2OA 3RQIA 2R7KA 4F96A 4FXPA 2GLXA 3HYSA 3KO8A 4RHCA 4WESA 1OXMA 5KJ6A 5IT9A 1I7DA 1IHOA 2GFIA 2XOEA 4PSKA 1UK9A 3ZZMA 2QR2A 5EWMB 2XMZA 3AHJA 3IDAA 4MB0A 1V37A 5FR1A 3HYCA 4EI9A 3JPWA 4M1EA 5F7OA 1MC5A 1MU0A 4G9GA 3TOZA 4FYWA 5I8WA 1CQIA 5JZOA 2ZI9A 5M29A 1C1YA 3R76A 2IJGX 1GAJA 1DRJA 2XY4A 2PN1A 4AZ0A 3H3XA 4U3JA 4RTLA 4EKIA 5IAAA 4Z2AA 1RJDA 4EJ0A 4OHVA 1IUNA 4MJ7A 4LZOA 4PC3A 2RAFA 3JCZA 4B74A 4NYMQ 2NSYA 4JI6B 4N5HX 3JSAA 5CH8A 4Q34A 4FC6A 3LZ6A 2BP7B 2C7PA 1QRDA 1CZOA 5A9SB 3EDYA 1GAEO 5K0TA 4CFYA 1HFKA 2E4AA 4N0QA 5LQDA 1E1QD 4DB2A 2P2SA 3AY6A 5EC8A 3FHLA 3JZFA 5CB8A 3DZFA 4X1YA 2QW1A 3MIIA 4Q4DA 1XLTA 2WFMA 1KXJA 3CH6A 4YX9A 1G4UR 2VP0A 4H7EA 1BWPA 4BO6A 1VPWA 4KH0A 5G0UA 4QHTA 4J0GA 4JYMA 4K0RA 1JQDA 3ZN2A 4YCMA 2W7TA 3WKBA 1XZJA 3EAQA 1P6QA 3SF0A 1P7CA 3RTBA 1ZVQA 3LCCA 2A5GA 4QDOA 4D74A 3IQWA 2J6IA 5FPQA 3SBXA 4DJDC 1VQ1A 3NDBB 5F21A 4QUAA 4L5YA 3JXEA 1JWLA 3PDHA 4OP1A 4I5IA 2QYSA 2Q2WA 1KGSA 4CKEB 3R0JA 1BXGB 4IBOA 4FYMA 4C2TA 2PMKA 5KTKA 1E7YA 3L93A 1P5JA 3CGWA 1EFPB 4P7BA 4LJ5A 3WLPA 1VL2A 3ILYA 5J2TB 4ZT4A 1L4LA 2R7MA 1PZEA 3DKVA 4XFDA 2OYCA 5FLYA 3W8NA 4MP8A 3WMWA 4B1FA 1ZH2A 2J1LA 4LRSB 2FPGA 2UDPA 1P7PA 1G2IA 2GHQA 2VZ0A 1E66A 4KX5A 2F3TA 3HHEA 1P6XA 4QFDA 4U0JA 3U2QA 4PQYA 3ESBA 5J59A 4U7PB 2EP5A 3PRJA 4EJSB 3PSAA 4QGBA 3KELA 4MUMA 3SQNA 4GPIB 2VPZA 3T95A 2C8JA 4BWGA 5CDSA 4QJ4A 4OHOA 4I4TF 5IH3A 3SZOA 5I3ZA 3GMDA 1Y42X 1C9KA 4Y2TA 1Y6FA 3TRKA 3KPUA 5AOAA 1PNVA 1AKYA 3UAXA 5I9BA 4DVJA 3W4IA 3VKVA 1LPOA 5A0TA 1U1IA 1NQAO 2X4LA 2Q45A 4L5JA 3RB8A 2WKPA 2IU6A 4A8PA 1MRSA 4EI7A 4G0VA 2OD9A 2ATEA 1N2BA 1X7DA 2PKQO 2YWDA 4FX5A 5D3KA 2ZUFA 3CJRA 4RJTA 4IDPA 1Q20A 3ZHBA 1UFVA 2KBFA 2P6OA 4B33A 1EB9A 1KY2A 3DDZX 3QY0A 4G23A 4UU1A 4MAFA 4MUAA 1PT7A 2WWIA 4LZAA 2EYUA 3R7SA 2OZEA 2PT6A 3R8CA 3HU3A 1DE0A 2AEEA 2NZVG 4UM8B 1X80A 1OPXA 1DKLA 5E0KB 1UZMA 4II7A 1ZS9A 1QYXA 1BE6A 1KDTA 1TOAA 1UC4B 1V3VA 1LI5A 2X0JA 2X40A 1RQ2A 4NOMA 4BNGA 1J24A 1LVGA 1YUBA 1Z36A 4QBIA 3TL3A 2XH8A 4DDHA 5JAUA 2VQFB 2D7DA 2JJ1A 2XYGA 4XOIA 1I2ZA 2D3TA 2IV2X 2XRYA 1AKMA 3FSEA 4MIKA 3FG9A 3AUAA 4UHHA 5ALGA 5TE9A 5IZCA 2NSJA 4TYWA 3FN4A 1ID1A 1VP3A 1AUVA 1PV2A 1J20A 2G1PA 5JOQA 1Q84A 3M6AA 4FR0A 4G0QA 4JYPA 2CMHA 4GHWA 1B93A 2DH5A 3E58A 5DGHA 2VHWA 4BKQA 3MS7A 3NBKA 1MJHA 1JIIA 1Y9AA 2YW9A 3IB3A 1W0JD 3OJCA 4B82A 1VPDA 3LW7A 2OFOA 3RAJA 5IKMA 3J81k 4MO9A 3PL5A 2H1FA 3GWGA 4CIAA 1ZHHA 3WRXC 3IRUA 5CYGA 3GFOA 2AD5A 2JFHA 4LHEA 5CG2A 2VJKA 3HQ4O 1Y4AE 1T9AA 1A3CA 3JD3A 4GGOA 4MZDA 5BSUA 3PEEA 1T24A 1Q11A 4BTLA 2QV7A 3MF4A 2X7HA 3ROFA 3THSA 3GUYA 1NDQA 3R5HA 1KFCB 2QW8A 1KKMA 1QBKC 3NPAA 3QOYA 3S28A 4J3FA 3TD6A 3VDRA 1M3SA 4LECA 1YJAA 4KQCA 3S2SA 1NI4B 3ZH9B 4COOA 1TEHA 1V45E 3ILHA 1YXMA 1WZUA 2P3SA 1LWNA 2W2LD 1O2DA 2BEJA 4BB5A 5K7SA 1DQYA 5ICMA 1P44A 2VHTA 3A1CA 3LF2A 1M34E 4H7JA 4BLTA 1VSVA 5DTJA 3V34A 1DIAA 1QP0A 3A70A 4MRRA 4G81A 4AUMA 2O3RA 2W6CX 3VAZA 2J4FA 1LI7A 2JLQA 3AFMA 1LVUA 1W35A 1EDDA 2K7ZA 1EFRA 5DN9A 1U28A 2HJWA 2P78A 1TCCA 2Q3FA 1GPAA 4NTZA 3UXMA 2IHZA 2FZ5A 2UZ3A 3O7MA 4RD1A 4CL8A 1B15A 1W44A 5HOEA 4NXNB 5U9CA 1XD2B 1WV0A 2C88A 2GYVA 1UFKA 3ZDYB 2AFIB 3G8BA 3S2GA 1IZZA 2C0QA 2RHDA 4I55B 3U4CA 1ORHA 2JH3A 3AR6A 3SC3A 1Z4JA 4R2XA 1W85B 2BHLA 2IGBA 2NO7A 1EX7A 3JQ8B 2QQFA 5HBGA 2IWHA 3U4MA 1N6OA 2VWQA 3KWJA 1B6SA 2EFYA 4AYTA 4DTCA 4F1KA 2Y1OA 3PLRA 4GI3A 4EA6A 4QVIA 1NPTO 3E18A 5CHYA 3VOSA 1PV4A 4K03A 5ECWA 3W6OA 2JLUA 2BMDA 3IE1A 1J25A 3HJFA 4EAAA 4TS3A 1XQ1A 1BKDR 1V8PA 4FS3A 4QOGA 5HIIA 3UV6A 3LWDA 2O5RA 4ARVA 4BNXA 3F7NA 4KMOA 5GONA 1XNQB 5DHAA 4QOEA 2NOAA 2H2WA 1Z3CA 2X2OA 3EUAA 4HO1X 3T7EA 5A4JA 1V7CA 4H9GA 4BZQA 4D5EA 2HX1A 3EB9A 5AM2A 1SU6A 1Z8HA 2XXJA 2QE7D 1F17A 2P2YA 2Z1MA 1S89A 1WXDA 4KTTE 1P17A 4ZU3A 2PS0A 1ICIA 1M74A 1IVNA 3UPTA 5HKLA 1RACA 2C1XA 2R97A 1JRLA 1H0HA 3SIWA 3KOYA 3TINA 4OHBA 3WA6A 4DN6A 4QXRA 1DLIA 2ZCUA 1FFWA 3LUJA 1BA3A 3P9RA 2MTBA 5ARCA 2CEKA 2V6GA 1L5RA 3G2MA 1ULUA 5JSKA 1XEAA 2CNBA 1DSSG 4YDQA 2ZJ0A 4QO8A 1TZBA 1TQ2A 4DXDA 3JAKB 3PDIB 4BRWA 1BA2A 4JKOA 1L5NA 1R5NA 4G8BA 5G3YA 5JRJA 2IPXA 3DEHA 3W9YA 1ZMXA 2IH5A 4XQGA 3SC6A 1VHDA 1RWNA 4XVHA 3LECA 1GWNA 4PYIA 3WHLA 2VK1A 4NAUA 4UUAA 5LMZA 2VP6A 3F4BA 1F5NA 2CFTA 4BN4A 2EGHA 4QU0A 3E15A 2AJBA 3PE4A 1LC0A 4JC0A 2BE7A 1PL0A 4OQPA 1XRRA 2MIIA 3PZBA 4UHBA 3RWMB 1GUYA 3DUFA 4GRDA 4E46A 2II6A 4QG3A 4CKWA 4N7RA 2BUCA 1QFMA 2IE0A 3LHFA 4LDQA 2H1IA 3AEZA 3C6KA 4O2BF 2QZSA 3A9UA 3HZRA 1A8SA 3PBKA 1IYZA 3ISVA 3SS8A 4O1HA 3UJ3X 2H1SA 3VNVA 1B0PA 1NNEA 4UEQA 3NKVA 2YVAA 4RBNA 4FYIA 1GU7A 2HF2A 4YVFA 1I7SB 2PS1A 1E6LA 4WZBB 1SQ0A 4PX2A 2FRVA 5CDUA 1K2WA 2C5LA 1DIOB 1T6XA 1YOVA 3D64A 3DPSA 2VIIA 2JGKA 1VHLA 2YFHA 4Q3NA 1ORIA 3H3FA 3CRQA 4BPBA 3MMSA 3LIPA 5EJIA 1ZIYA 1V7ZA 3VVCA 1SXJC 3ABZA 4GICA 3OPQA 4MWDA 2DT8A 2ZR0A 2QN8A 3ZOZA 4C43A 3LH5A 3ZLTA 3G0OA 1EVYA 3AF4A 4DR7B 3WNCA 5KTSA 2C7OA 2DPYA 3UB4A 4REQB 1SZPA 4FGUA 3DWFA 4ALKA 4I4NA 1WUTA 2Q8NA 2WP8J 3DE7X 4RKRA 4CM8B 4XWTA 1FSSA 1J1UA 2OHHA 4P3KA 2EYQA 1K7FB 2Q4RA 3WBFA 2W2VA 1JE0A 5DYTA 3I39X 1UKBA 2QAGC 1U8EA 3CLTD 3PUKA 3QLVC 4PAOA 1FUKA 4BGIA 2ZUWA 3N2EA 3NJ8A 4Y9RA 1XDWA 4BLSA 1W48A 2OHXA 4DMMA 4M22A 4ZDJA 4YRFA 3QQ5A 4JI8B 1A04A 4AICA 4DLZA 2NPIA 2OBYA 3U4QB 3IUEA 3GLIA 4WQMA 4IJKA 1Q2UA 2H0RA 3CLSD 3R3YA 3ZQ6A 1SGWA 4CUJA 3WSWA 4CL3A 3L40A 3L6CA 1N1EA 3ILVA 1MPTA 1K63A 4FGJA 1ZX1A 2H5IA 3NJ4A 2X8JA 4I9UA 1XPRA 1U11A 1Y8AA 1B76A 3ZD9A 4EGSA 2D06A 2XCQA 1P75A 3FNRA 3WL5A 4FOLA 1NI5A 3H84A 4D25A 3KEOA 5JNSA 2XPCA 1ZG3A 4WA8A 1XCPA 2G0TA 3DFFA 3DNPA 4D82A 4DV0B 3H5LA 4EY7A 3BHMA 4L8FA 1K8ZB 1Z8DA 4G8JA 3G9UA 2VNJA 4RK1A 5D6NA 2TSYB 4YCBA 4EX6A 2JJ8A 2UYYA 4F9FA 1ILEA 4A15A 3W2TA 2L69A 4KREA 4RORA 3K0KA 2O8BA 1O6CA 2J9FB 1WLYA 3HDQA 3BE8A 5FBLB 1EFLA 1ZD4A 4PR0A 3WP0A 2C2YA 5IT0A 1Q0RA 1CR2A 2AL7A 3DTTA 3PITA 2P2DA 2AJTA 5FPSA 4F4JA 3S3TA 3H16A 3CZ4A 3OJWA 1CUEA 4HYEA 4NL4H 3VR4D 1N5IA 4JEIA 1ZOLA 5AKLA 1Z08A 1E1KA 1N2CB 2BI8A 3IUNA 3P5BA 4WZAB 5AI4A 2ZIXB 4DSAA 4CV3A 3EFOA 1HYBA 3QBVA 4GVLA 4E6PA 2W2PA 3PHGA 3M9WA 4UBMA 5DW3A 5B1SA 2FZ4A 4IIFA 1ND6A 5EQJB 1Z4MA 3WYFA 1XI2A 1X8KA 2BF4A 2GERA 3DPIA 4QPCA 1I3CA 2AV6A 2G36A 5YASA 5IW8A 4KO2S 1VCIA 3P9ZA 1O95A 1LTHR 3O90A 4HDRB 1ULTA 1SU8A 1IU9A 4Z9AA 3JWIA 5DYNA 5AVXA 1GTVA 2HA4A 5C8YA 4K9PA 4KXNA 1SKMA 1Z4LA 3FB1A 4YA6A 1TEZA 1WXGA 4ROTA 5EGNA 5DT2A 3H6KA 3BILA 3H9JA 2DERA 2ZB3A 2JJ1D 2O0KA 2HA6A 1ODKA 3QLUC 1JU9A 2H7VA 4QU9A 2OM2A 2VPQA 4DQKA 4KXFB 5FFFA 2R47A 3ZU6A 2ZRMA 3L7DA 2FP4A 5ILGA 5FV7A 5I5GA 2IPMA 3WFJA 1QTIA 3VVLA 4ETNA 1E2FA 4QGAA 5U4QA 3EZGA 1JU3A 4K3UA 3WL4A 3GRRA 4KLAA 4R2HA 2CLFB 3EXIB 3A31A 3UUWA 5CGZA 5EIAA 2PY6A 5TQ0A 3GLGA 1R15A 4ZCIA 1V41E 3GP5A 1GU0A 4MUEA 1JEDA 1GUFA 3V1NA 1VLZA 2Y1CA 4E12A 1NQTA 4NAHA 4MLZA 3L7LA 4EB8A 1W46A 2ODBA 4OIMA 3KEFA 2ABWA 3C15C 4P7GA 5H5JA 3QENA 2AXNA 3RS2A 2QQ5A 4OX9Y 3CH5A 2NX2A 1RC1A 1YSCA 5IAKA 4AWXA 2OBNA 1KAOA 3LPAA 3ENKA 4X94A 3EZNA 1IN5A 1QTNA 2B6NA 4WY5A 1HZZA 1PG5A 3OQNA 4LF7B 5F3RA 4PAGA 4RETA 1EUQA 2ZRAA 3AJRA 4NBTA 5B6PA 2I6TA 1CCWA 2WKRA 4OLFA 4X95A 2RHJA 2IK8A 3CNBA 4Z3OA 3FLAA 3NFYA 5LLSA 3KTAA 4A2WA 4YUZA 2I4NA 2B1GA 2RC5A 3CZPA 4MV9A 1XFAA 1CR4A 4KI7A 3ZE1B 1E0AA 3KSUA 1ZVJA 2VHEA 2YC2C 3A04A 3AY7A 3MJ4A 1S8NA 3LA8A 4W5RA 3BORA 1U0TA 3K1ZA 5F35A 1ONBA 2VXBA 4NVRA 3RBAA 1Y7PA 4B43A 4C2BA 4I1RA 5KNCA 4JFAA 2AFHA 3SFVA 1IZ9A 3BC1A 4KLCA 1XZQA 1Y89A 2PA3A 2TMGA 2ZWIA 3I3OA 2V54A 1PGQA 5E3IA 5EZYF 3V8PA 3ZKWB 1G2OA 4FM9A 1P4SA 4AQ7A 1OU0A 1FRNA 3MBKA 3LUFA 4JROA 1JDTA 4F5ZA 1DMSA 1BEZA 2CYCA 3LU1A 5C1OA 3ZVKA 1YOBA 2XNCA 4DCTA 3WRYC 2ZM5A 6NULA 4RA6A 3BCHA 3EXEA 4QPNA 1P73A 3ADOA 4TTTS 5FD8A 4BE4A 2GPSA 1YIOA 2GZMA 3NHWA 4LNHA 4UXJA 4AKGA 3FPAA 1X87A 3AR7A 4F0JA 1MB4A 1YB6A 2TMKA 4LK2A 4D99A 4FD3A 4O4LF 1T25A 2ZSEA 1QUEA 2JLXA 1Y3FE 3JASA 4KXXA 3P0HA 2Z98A 4CG3A 1H4SA 4BFWA 3TNJA 1K27A 2CYBA 4YAWA 1MO6A 4FD2A 1CJKC 3KVNA 4XLLA 3SVTA 1CR1A 1G17A 1Y4DE 2COUA 3LHIA 3L46A 4TPKA 1JXMA 4CHTA 4D92A 2HRQA 4C1BA 4IWNA 4QTXA 3MTJA 3K6SB 1WZIA 1LH0A 2GD2A 4EQ6A 1DC5A 1M0EA 1KEUA 2CT8A 1XXHE 2DWCA 2G4VA 3G59A 2CF6A 2QX9A 4DTIA 1UMCB 4LGMA 1YZKA 1CUAA 1I3OA 4Y2YA 1QQ5A 4O4JF 4IJ5A 3N39C 1V6CA 2ZIAA 2M6RA 3D6UA 1O9GA 1GUDA 1TQ8A 5LYYA 1V7QA 2MSWA 5LQKA 4KR2A 4L3VA 4N39A 2OYSA 5AKZA 1PLKA 1ZM3A 3DVSX 1OXUA 2ASVA 3IP7A 3I9LA 2ZCVA 4MP3A 2DEUA 1EFUA 3DMNA 3TEMA 4D56A 2ZBPA 1NPDA 2P35A 2XMBA 4G5RA 4ZQGA 4EPVA 2Q62A 2IEGA 1SQSA 5ALOA 1B23P 4RIFA 3E9YA 1TIBA 4C0HA 5HK9A 4NDZA 5FL3A 3TTTA 3D31A 5ARDA 4YALA 5KTYA 3A05A 1SG9A 1P8JA 3AP1A 3BMCA 2REOA 1QYWA 3OOHA 1KE2A 1ACMA 3WFZA 1REQB 2DE0X 3ELYA 3C1UA 2HCFA 3EYWA 3HWX1 5E9AA 4M86A 2YMLA 1HYQA 3SMVA 4YMLA 2JS7A 1Y3AA 3H4IA 3KYDB 2BBTA 2IL1A 4LYYA 4XYLA 3UENA 3OFNA 4XYGA 2VDVE 2O0HA 1ZGCA 1WABA 1WCIB 2AR0A 4QBTA 2WWYA 3V1YA 3PGA1 1IAQA 2FMUA 5BSWA 1DOAA 2IPNA 5K8TA 1QF7A 1GV0A 4FZRA 2JD2A 2YJ5A 5FLEX 3SK0A 4J43A 3ENZA 1OJLA 1NFRA 3JWGA 1D1TA 1GA6A 4RV5A 1EZ4A 4K6FA 4Z2YA 3OPYI 1S8FA 3U44A 4DZRA 1QDEA 1UEXC 4E7OA 1NYQA 2Q9CA 2BR4A 2Y6UA 4HQ0A 3TIVA 4AUEA 2WC1A 4J0IA 4L9SA 4RFVA 1M8JA 3FYTA 3LYUA 4Z9XA 4DMKA 4MOWA 2WU8A 3UOAB 5AVTA 4DW8A 3WIEA 2XZLA 4NZ9A 4QBFA 2X1HA 2OO5A 5EZ5A 1N9ZA 1JEEA 2VDLB 5K8CA 1XN1A 2JAUA 1GPUA 2GBIA 1VBNA 2NO5A 3HSYA 3LUDA 4D0LB 4D96A 4EPWA 2AZXA 1E9FA 2B30A 1PQPA 4BO3A 3YASA 5DFAA 3PHCA 4RK4A 3L06A 3C43A 2EBUA 2JFXA 1WMBA 3G9ZA 4OQLA 3LX6A 4YAFA 5KC8A 1I33A 1NRJB 3VKUA 2IIVA 2CMFA 2GYUA 2J7PA 2CW5A 5JYEA 4TV9B 1ZZGA 1JPNA 5A6VA 2BT4A 1IOZA 1XZEA 3NWBA 3GCWA 3QYAA 1GVNB 3V3KA 2BMFA 1Y8QA 1YQQA 4OJKA 4AMBA 1N5JA 2FN3A 1Z9BA 2VNKA 3C5WP 3IAXA 3QG1A 1FU7A 1NXPA 1TU4A 4BFVA 2FXVA 3PXAA 4MA4A 5BYBA 5HUHA 1WTCA 2BC9A 4WLOA 3SJAA 1SCQA 5F3DA 1FJGB 4JJ6A 3AUYA 5EIEA 1SK9A 2PCJA 1C1XA 2ZI5A 4ISCA 2RD2A 3ANMA 4IL5A 4MQUA 1PT8A 2ZRFA 3BF7A 1Z5VA 2DBYA 4C6SA 3LY9A 4YI5A 2VSQA 2R7NA 4KSYA 3FROA 1ST3A 5TRTA 1SIUA 2P77A 2WVJA 5LQRA 1JSXA 4BMCA 1Z39A 1FF9A 2FYTA 3MSXA 3FGOA 4PNHA 1SC3A 3B3QA 3FJYA 2PBLA 1RC8A 5ALPA 4XVRA 2ZT6A 1JBKA 1TYEB 2QVCA 4PSUA 4UVEA 5JCOC 2JI4A 2YYZA 4KQHA 4ZPJA 3ME5A 2YFQA 4BNIA 3LXRA 1QYIA 4QOFA 3MHPA 3Q2KA 1B3BA 5JARA 5KVSA 3G82C 4GX1A 4MTLA 5SYAA 1XP5A 3ITEA 4P84A 4Z0NA 1I4TD 2NVUB 4C7OA 1ZOSA 2D59A 4P93A 3IDZA 4QXQA 4C7KA 1Y34E 3KSMA 2BEKA 2OZVA 5CD9A 2G09A 1O95D 4Q00A 2A33A 1U1EA 2G82A 1BX0A 3FETA 2F43A 4TLAA 3FI9A 4C0JA 3H2YA 3AERB 4G0OA 1MBZA 2DKOA 4PVCA 3KT8A 3QKRA 1QHNA 4BYMA 2BDUA 5AUOB 1PS9A 2ODTX 1WW8A 1CZHA 5H3CA 7YASA 3VR5H 3K0EA 1SCDA 1RXCA 1ZK3A 2EJWA 1X14A 2Q5IA 2WVHA 4QDZA 3VX4A 4DY6A 4Z6KA 4WD3A 1OIVA 4ZGGA 3LXMA 3M9XA 3PDJA 4L6IA 1VXRA 2O59A 2FR8C 5FL7A 4EB3A 3HFGA 1VKHA 4KE9A 4UFPA 1SHKA 3HB4X 1HLGA 4YWJA 4TMKA 3PC8A 1CW2B 1MRNA 1PGJA 3Q85A 1F60A 3EGVA 1K75A 1OA1A 2C4KA 1ISRA 2XB9A 2ODPA 5E1OA 4GC9A 3RS8A 5ALVA 5BV0A 3VJRA 1HDYA 4BKUA 5TVGA 1SQ6A 2BFEB 4QECA 4KWEA 4Z4QA 5CIQA 3JQBA 4PBSA 1R27A 2PZJA 1I0ZA 4Y6PA 1DRWA 3C3PA 4DCCA 2AT1A 5J3JA 4XH9B 1V8DA 3OFJA 4PNZA 2P30A 3FVWA 3DTVB 1PUJA 3EZ9A 4G07A 2Q6TA 3WHIA 1CD5A 4RTRA 3E9MA 3VMFA 2J46A 4NBLA 5G1PA 4B80A 4IIXA 1ZRSA 1Y4UA 4X91A 5LQJA 1WHTB 4UVDA 3DXYA 1RHMA 2H3HA 5E95A 4YS6A 3A1WA 1PJQA 3O74A 3IIIA 4UD2A 5JXJA 1Z4NA 3DFMA 4FI3C 1ZOPA 5JH7B 4WK4B 3PJGA 1G3IA 1D5WA 2WYIA 2Z5LA 3T5DA 3GXBA 2Q1UA 4IRMA 4PGAA 4Q9JA 5J5VA 2IV7A 2QJTA 4KDRA 2I6SA 3BXEA 2E4VA 3VO8A 1H6DA 2IA5A 3T9AA 1KZYC 1SUWA 3Q87B 1ZGZA 1DJQA 5GVRA 3PQ6A 3UJCA 4R9NA 4B17A 2HRZA 2UVQA 1T0UA 1YVUA 3OMWA 5KPJA 3AF5A 1X3LA 1J5XA 5A5EA 5JROA 4Q4JA 5DWDA 5KNCD 1UEJA 5BPFA 4CXMA 1DJOA 5GJBA 1E7WA 4Q3BA 2BHTA 5EMKA 3ZE2B 1X1AA 2J3EA 2VK4A 1V16A 2FVXA 1L1QA 5F64A 4F2DA 1ZD5A 4EG0A 4DY4A 2EV9A 4KZKA 4MUGA 1M6HA 4MRVA 4TKZA 2GMWA 2GAFA 3KQTA 4OBWA 1SFRA 3VV3A 3OLYA 2M1XA 5HQ3B 4E1VA 1GQYA 1QG4A 1C7QA 4GX0A 4PG5A 1LGYA 2DUJA 3Q98A 5EP4A 2V6BA 5FPYA 1V9LA 2GVZC 2XWPA 3BGSA 4LGYA 4C7XA 2R00A 2WDZA 1BFDA 1I6LA 2P5UA 3IGFA 2QLBA 4HNAB 3PYXA 1F9EA 4MV8A 4XPZA 5ALWA 5B53A 5LR6A 1KWKA 2V5VA 2NAPA 4CM3A 2I2DA 3EAGA 5ALEA 3B6ZA 3WGYA 1OZFA 3G9QA 3UV3A 4DPLA 4PRKA 2JANA 4UEJA 5EMJA 3ZQKA 1EHYA 1QO0A 3NDJA 2B8EA 2JIZA 2PDAA 4Q66C 1A7AA 2EVWX 2PXCA 5CVDA 1QONA 5A0FA 3HY3A 4HQOA 3RNOA 5LUBA 3TZEA 3W6PA 1Y8CA 3MCVA 2YV2A 4GOOD 5DM60 1OYYA 2GESA 4UEKA 2Q6KA 4UHCA 1GAXA 1F1JA 3IVRA 3GIWA 5DX8A 3DXZA 4L74A 5HJ7A 1H2BA 4YUVA 1MVOA 3H5RA 4K9SA 1B00A 1V4VA 3P9SA 3R3HA 2AZTA 3WP1B 3HZHA 2WIFA 2C20A 4X7MA 1QNFA 1WDMA 1XRNA 2WWXA 3PQ3A 1ATIA 1CYDA 1DX4A 1Q3KA 3G8YA 2QXTA 4ZU1X 4K3VA 3NZEA 4DUGA 2HHLA 1EEXB 4R31A 3CIFA 3Q8XB 5FQOA 1IPHA 5H1YA 3OKCA 4R9VA 1JSRA 3NLLA 2CZGA 4RLQA 1TIPA 1QGDA 3ROMA 1W8IA 3CZAA 1HQKA 1U63A 2P9FA 3EPPA 5LP6B 4F7DA 5IDQA 4GLJA 4KQFA 5LDGA 1S2IA 2IHVA 2CL0X 2Y66A 5GINE 1MFZA 2E82A 2NU7A 3T41A 3TTXA 4HF7A 4TGLA 2V97A 4LOAA 3UT0A 1UIRA 2WP0A 3NTXA 4IIJB 5E1DA 3NMUF 4D3YA 1CS0A 5CAEB 3UGKA 5DM2A 4M0FA 2JNWA 4JR2A 3OFND 4DV5B 1JSZA 4U1RA 5DHFA 3G88A 1W5FA 2UUOA 1XROA 1J56A 3AKYA 3FVTA 4KMSA 4NV0A 4URHA 3HCBA 2RGYA 1ZHOA 5FOVA 1W88B 3JVIA 4D02A 3SKVA 1SOAA 1I94B 1O6GA 1TK2A 5GJCA 2FWMX 3SQXA 2GCNA 1B8UA 2PGAA 4BQSA 3M6FA 2GCOB 4TL6A 4UUNA 5IZCC 1A5SB 3OOJA 3SWWA 3I09A 3ZC3A 1NMXA 2JDIA 4XR9A 3WWCA 2VPYA 4Y18A 4GLLA 4IEEA 3TW8B 3UA4A 3BB4A 1TF2A 1C14A 2OOKA 2YYAA 3C5EA 1DAFA 3D1LA 3OT4A 1OB5A 1G59A 1T1EA 1J2TA 2X15A 1ZOOA 1XTQA 1V2HE 2OXCA 5HJEA 3E1GA 3RUAA 4F4HA 2ZAOA 4BVLA 2ZDQA 2ZQYA 3DBVO 4KITB 1Z38A 1L3CA 4P34A 1RPTA 4MUYA 4MIOA 3RDPA 2R8RA 3KT0A 2CHEA 1YQDA 5HF8A 1HURA 1SKYB 1GNRA 5G1NA 3OSUA 4J90A 4MKIA 3RW9A 1CX9B 1B1AA 3BSWA 4F3YA 2OLJA 1X7XB 3TZHA 1N0HA 1HDZA 2RH4A 4UFNA 2GCPA 2QDKA 4Y6RA 4Q1BA 3DQPA 4U2KA 5T5QA 3SC2A 2IIQA 5BMVF 1KBQA 4AT1A 3KJQA 1V11B 5DVZA 4OHRA 1QIGA 5CEFA 5TLSA 3PFKA 1IN7A 3UFXA 1RBMA 3QK7A 3WISA 2ZVPX 1BHJA 3AKCA 2Q29A 1RXSA 3AXSA 2OEPA 2JKYA 2ORYA 3EVDA 3LBNA 3LZDA 5JWOA 2Q28A 1JUDA 2V7VA 2CLHB 3RT1A 1U28C 1IXKA 3G8CA 3NHBA 4B7CA 1MAVA 3N5CA 1Y6GA 1U9ZA 3CTMA 4G8DA 3AR9A 5G41A 2ODWA 2AWNA 4CPDA 2H2HA 4AULA 3SR4A 3DF9A 2J41A 4RPJA 2ZTVA 5HGXA 1LDEA 3GGCA 1MIOA 3V7UA 1YDMA 4OFWA 4G89A 4J4HA 3NASA 1JV2B 4F8EA 5BQPA 5JZSA 2BSXA 2R8EA 2QUBA 2MR5A 3DJYA 3EOZA 4XCQA 3R44A 3F97A 1J22A 3RV3A 3V4OA 4PINA 3ROEA 2GPBA 3KAJA 3OCXA 2WICA 1JKXA 2R1TB 2O57A 3H9UA 5FO0A 4LJYA 1ZOIA 3UA3A 2IP2A 3DZCA 3EMVA 4CF6A 4KQIA 3B1KA 1ES9A 3AGQA 3CF6R 3MWEA 1SHTX 1ESEA 1P4HA 3NATA 4IHJA 4NR0A 4TMYA 1BYIA 2Y1EA 3P0RA 1PEYA 5FBWB 2ZW9A 3SYLA 3TIGA 2PSDA 3UKDA 5BRAA 3FUUA 5DP1A 3K53A 4Y9DA 2YJ4A 2CFIA 2DAPA 5I7SA 2JC3A 3ZDAA 1YZLA 3KDPA 2Q9AA 2FN4A 2DHDA 1E98A 4NZNA 2JBHA 2WYHA 1XDSA 1NW7A 2J3IA 3DDHA 3R77A 2VYFA 1OXVA 1C3VA 1K08A 3BIWA 2BFPA 3E35A 4DIEA 2JLYA 4ZAWA 3WO0A 1RE0A 2QEQA 4B6QA 4DUZB 4W5NA 2X9LA 3C6XA 4GKKB 2OBBA 3QI7A 1OAOA 1T8UA 2ZTHA 4BFXA 2VXOA 1CVIA 5LQSA 2GILA 2Z3VA 3CE9A 1SCJA 4LDZA 1EE2A 1KC1A 2CXTA 2AFVA 2ONZA 2NUTA 4I5FA 5H16A 1BXRA 3G9XA 4QFMA 1MGPA 4FJ1A 5FL7D 3W9SA 2WMOB 1FX0A 4FC7A 1CJSA 4YRZA 3AXTA 3BE5A 3O9VA 2Q8QA 2VFAA 2XR1A 2XUAA 3J7TA 1MFPA 1F3OA 1E8DA 1QLJA 2EEPA 3AUXA 3BTVA 1EHCA 1QG2A 4DZTA 2Q9UA 2CXXA 2IUEA 4M1WA 2QRNA 5DHUA 4I3HA 2GF9A 4MAAA 1EWRA 3QFTA 4MS1A 3F78A 1T0BA 5LNK6 3FAKA 5C7OO 1TQ4A 1JG1A 1NM5A 2D1YA 5IJ9B 4NULA 1NQOA 2KQUA 4MKHA 2UZ1A 1DCFA 3BWCA 3KYJB 2CJFA 4RHYA 5DWQA 1E3MA 5H7XA 4IM7A 4WLUA 4YROA 4YBRA 3GVXA 5LJLA 1U7ZA 2D1TA 4WCFB 1HE5A 3IMFA 4KFUA 4PW0A 5CH5A 4ZAZA 4QYWA 3ZJUA 4I7EA 4UAVA 1TVKA 1U3UA 4O1IA 3QEBZ 1IG3A 3VHLB 3DMFA 3SQDA 2PJDA 4J9VA 4EVRA 2WSIA 2HF8A 1NF2A 5EKSA 1OHHA 2C57A 4Q21A 5BYJA 3CKMA 4ZGBA 3FDJA 5EJMA 1J70A 2F9LA 4RS3A 3ZY3A 2LCFA 5KCMA 4UNRA 2JG3A 1AZWA 1ZEMA 2FUNB 2C3OA 1TECE 3RTEA 1XFDA 1UBJS 2ORWA 4EP1A 4BXOB 4FEYA 3V7NA 4ZHQB 5BN3A 2C5SA 4QATA 5IDXA 2AUNA 3IJPA 2YHIB 3B3GA 3M33A 1YE5A 3RJ5A 2F8TA 2QRLA 5F1KA 3JPYA 3DDCA 4PLHA 1Z5UA 2PG3A 2DJIA 4D79A 2CHGA 4OREX 4WAUA 4KQGA 5J1SB 3OQHA 3MWKA 4LAFA 2BCEA 3T54A 4NCAA 2WTMA 5TMDA 2R0QC 3IAM6 3SX2A 3U0BA 3SJ7A 4JI4B 1QYVA 2OXTA 1AXGA 1V25A 4JLPA 1DBQA 3B36A 4PIVA 4R1SA 4RD6A 1XTRA 2VDOB 3A4TA 3KYBA 3QBTA 4QODA 1IL0A 3QNUA 3WYGA 3RJZA 1LDMA 3DWEX 4JB8A 4KE7A 2ONCA 4RGVA 3U5ZB 4RTKA 3FH0A 2DG2A 2OP1A 1RMYA 3DB1A 3OZCA 2CN1A 4K9KA 3IP9A 3IAS6 4II3A 4KN9S 4Q39A 1D1SA 5A3SA 3UANA 3Q7QA 3UT5B 2A35A 2EX0A 4WSOA 3UUEA 3AL0C 3ZHYA 3QEKA 2QMZA 1X1DA 3RS4A 5DLQC 3FR8A 2I9KA 2MSCB 3MIZA 4ARZB 2J85A 3KJZA 2G06A 3UO8B 2BFMA 2Q6LA 2YCBA 2H1CA 3HKEB 3W8DA 1QO0D 3BDAA 2JIZD 1VIMA 2NU6B 4O6VA 2MSKA 5AXCA 2PX3A 3TZKA 3ETCA 4IXNA 8MHTA 5I7UA 4FFMA 3IIEA 3LWBA 3AF1A 4BV2A 3GEMA 5L4LA 3MGAA 1G8YA 4BVGA 1NI3A 2DUNA 4HD8A 3MXTA 3W9BA 2HSGA 2GA9A 2C29D 3IQHX 5DBGA 4RS4A 3ZLBA 3QVOA 4IOMA 4DUGD 3PIIA 1HWYA 3E82A 3DC2A 1J90A 1QHXA 3DPUA 4QWWA 4C0KA 4A6EA 1IVYA 4XQEA 4R8SA 1EXDA 3C5HA 2V96A 5HCIA 2FSFA 1S9DA 2UVDA 3F71A 2PGIA 2Q8PA 1WCWA 5AUNB 4JFRA 3THYB 3MWDA 4U8GA 2QX4A 5FOUA 2QK4A 4Q3DA 3UAGA 4Q18A 3QBEA 4IHAA 1NUAA 4YRNA 1VBKA 3WXBA 2HJSA 5KTNA 1UBRS 1OGJA 1J06A 3L4EA 4UHFA 3PCRB 5AM5A 3SDSA 2I4OA 2BEWA 2CCGA 1LRJA 5CM8B 4BFLA 1RRCA 2W4MA 1P4GA 3EODA 5K8JB 4O4HB 4WFKA 3H2GA 4P08A 2B4AA 3PTLA 5LOVB 3PNVA 4P3YA 4K87A 3P20A 2J33A 1J7KA 3H97A 1Q1NA 2QHXA 2I7VA 4DGSA 2H2FA 4QGFA 4ZVPA 2IYZA 3M1IA 2ZDHA 1FU4A 4MKGA 4OMDA 5EWMA 4BQFA 3W5HA 3LBAA 2RGRA 3L0ZA 2GUWA 3W5BA 4TZ0A 4AZWA 3K71B 3ZTTA 4IRUB 5E7IA 2BEVB 3CLHA 5HCUA 3SEAA 1YS9A 2BF7A 4GO1A 1RPJA 1O89A 4LJRA 3VH3A 3PNKA 1G8GA 4IGIA 4PZAA 1NNLA 1F20A 4H7IA 4FX2A 1R6UA 2PGOA 3ZHOA 1ADCA 1BGVA 3I45A 3VOBA 5ALZA 2HK9A 2RGGA 3WRVA 1NVXQ 5J4YA 4R68A 5HR5A 3WWPA 1Z4OA 5MGNA 4FK8A 1GOTA 5FUWA 4MQMA 1GRCA 1SEPA 2BP7A 3P2EA 2C7VA 4PVDA 4K6OA 3EGXB 4O2AF 4OI4A 4AJ9A 4JLAA 1VE1A 2VN8A 4C06A 5A9SA 5HWSA 1XHEA 2X3YA 3B13B 4EY3A 1M67A 1FLVA 3G85A 4EZBA 1EWTA 5IVHA 1P1FA 1V9SA 4YFVA 3O94A 1UMDB 1NVBA 1R5BA 3FMOB 4BECA 1ZK1A 2RONA 2HA2A 4FIZA 4PYOA 2QUJA 3L1VA 5FOTA 3KFXA 4UC0A 4XQCA 3O1HB 1AB6A 3TX6A 1OXSC 3PA8A 3OAAD 1RYMA 2CL6X 2JGEA 2NO4A 1L5HB 3L4BA 5LU9A 4I50B 1Y80A 3AETA 4PGMA 4F45A 3CT4A 3GIDA 2KYRA 4A3SA 4DJFC 4DLLA 4URYR 3UOWA 1JMVA 1WDKA 3PJFA 3V9PA 2YR0A 2TMYA 5E8RA 4N5LA 3DEJA 1N1GA 5TGTA 4E5SA 2DQZA 1PHPA 4CKEA 4D4IA 1U94A 1M0SA 5JVDB 3T7KA 1F3LA 2HUNA 3PXDA 2WKSA 4QUGA 4ER0A 3GNQA 3M4JA 3OCWA 2A9JA 3EH2A 3SYRA 1EFPA 1FP7A 2I6UA 4MWBA 2WB4A 3ZIAD 5B55A 2ZXUA 5K6RA 2SKDA 3NDIA 3FDIA 3FLEA 1SXPA 1QJ4A 4L07A 4PXAA 4PPNA 4YP9A 3K7EA 2V9PA 3CRVA 2D2IA 2WJIA 2X5KO 3URKA 4EY5A 2W9XA 4OFZA 1I36A 3CY6A 3M34A 1X9IA 2JLRA 4UATA 1BS1A 4YONB 3T1TA 1U5BA 4Q7MB 4X45A 5C80A 5K0EA 1FOEB 2EW8A 4GVXA 4OI2A 5AI9A 3DVAB 1U9CA 2J0UB 4OL9A 1CJMA 1B2LA 2D00A 1V8OA 1I5EA 1QS0B 2E5LB 4GI1A 3N70A 1K98A 4KN5A 2BFDB 1NMQA 4B0PA 5AW6A 4QYTA 5HQJA 3LTNC 3X1DA 5KX5F 2XMCA 4UPDA 1X94A 3M6IA 5EE1A 4TRJA 3HXLA 3C45A 3FOCA 4XUCA 1U9JA 3CBGA 3ROQA 3VMMA 3EXHB 4LEIA 3WX0A 4D0NA 4DLUA 3E3OA 2FFJA 2JLAA 5DN6D 4I1PA 2JRCA 3G89A 4DJJA 4NG4A 4ND8B 3RF6A 4L5IA 4AKTA 3AMVA 2OYRA 2VQDA 1E3SA 1T8PA 3NM4A 3ETEA 2O7VA 4ZI7F 4B85A 4C22A 3AEKB 1J42A 3TQRA 2B94A 1OC4A 2ISQA 2QROA 3W5UA 5HKOA 1N36B 1SY7A 5A1TA 3SDZA 2LUOA 3K4HA 3EBOA 5CNMA 2X8AA 1MC8A 3GD5A 4HC4A 4RENA 5GM2A 4CM6A 2JFPA 3JZDA 2H54A 4BP8A 1ADBA 1ITZA 1NZJA 1XVAA 4HLQB 3GJ6A 4URUR 5A71A 4QZVA 4MO2A 1W25A 2FZWA 2Q4BA 5EUMA 2B4RO 3QSYA 3AL2A 1A9PA 3SIRA 2UXBB 3BMQA 2FWBA 3KUKA 1RJFA 2XV1A 1UANA 2ZWAA 1X13A 3L2OB 4HVAA 4U6QA 3U4GA 2G5GX 4ZAFA 5M5BA 2OGSA 2QPAA 3G3EA 1V47A 5LQMA 2QD3A 5DYIA 5LDHA 3KK0A 5LZ5A 1NBIA 1IQRA 2WV7A 3TZCA 3GC6A 4E15A 4Z7QB 4V3CA 5DGXA 3NTOA 1A1SA 2XBMA 4CW7A 2GD0A 1KSFX 2PO7A 5KTRA 3GU3A 2LGJA 1ZGBA 3VH4A 1LS6A 1DPFA 4GZ5A 4R0NA 4NMMA 1KSGA 1A76A 4UBJA 3W3AD 3WE7A 3QTLA 2C8VA 1SOWA 2DJ5A 2WTBA 1DRUA 1RKVA 1NT2A 1UAYA 2GN6A 2UUAB 1GL9B 3U5TA 2F3RA 1TMYA 3I2JA 5T4EA 2R8BA 4H35A 4HGQA 3OTGA 4OK3A 1LC3A 4I5GA 4RVHA 3AW9A 2VUSA 4P53A 4TUYB 2HHHB 5DLYA 5DBHX 4NE2A 2QTZA 2VJOA 1G41A 4DNXA 2IYRA 1FC0A 3AFIA 2PZFA 1OZ0A 3EHEA 5EGSA 3OM9A 4BFYA 3RH0A 1OHHD 5J1TB 1U3GA 1NI4A 1WWKA 2DGDA 1UINA 3BWEA 1T4CB 4V0SA 3I1JA 5G4KA 3KZVA 4G1VA 3BN3A 4ADSG 3LAWA 1JSCA 3LXXA 3HK2A 3CR3C 1KO5A 4L3OA 4A2CA 1D3AA 4RQBA 1CZKA 4DDWA 1JMKC 4GUAA 2CHUA 3RVPA 4KGDA 1IHYA 5F1YA 3RUDA 1WUJS 4EWLA 3VHXB 3VNQA 3BTSA 5EHZA 3AUKA 4K1XA 4JB3A 1SA0B 4EJMA 4E5DA 4DQXA 3DD1A 4LHVA 1M1YA 2J9YB 5BWCA 4D8YA 1KYVA 2OO5C 2K4MA 3IMGA 4MVJA 1PN3A 4U2DA 1KYZA 2HQRA 1X9HA 4EVQA 5BQFA 1BVRA 3RIMA 2Q3HA 1DRVA 4OHZA 1HL7A 3B5JA 2CLEB 4IOJA 4FW9A 4I55A 4KXUA 3K92A 4CHGA 1OVMA 1DU4A 1W85A 4LKRA 4IUYA 1QIKA 2I87A 4UQLA 5HQTA 4KDEA 4XB2A 3SBEA 1VLHA 3D7SA 5JEDA 4XAQA 3N74A 1I1HA 2AQHA 1QE3A 2VK8A 3MQ2A 3KG2A 2BSQA 5CCBA 3I9V1 4BMZA 3NTVA 3PENA 4YCDA 2XVYA 4EDHA 2P67A 2CLOB 3MYRA 1KEPA 2R5WA 3TOSA 1T5BA 3AI7A 1UPCA 1EXMA 4QEKA 4TT3A 4J1SA 5A2QA 1DAEA 1Q21A 2IBTA 3WK4A 4A5SA 4J94A 1V71A 4IDDA 5B7PA 2P4QA 3B6MA 3VUEA 1XP8A 4M6WB 1YJ5A 4FMDF 1G20E 5IWCA 5JNWA 3V2UA 3SE7A 2C0PA 2GK6A 2ANBA 2QB5A 5E3JA 3RIYA 2ZJFA 4BO8A 5LIRA 5CT9A 1ZXXA 5FJJA 4GPBA 3BEDA 2HEIA 5AHWA 1YFLA 2QX6A 3SICE 3AF0A 2EBHX 1Y48E 1QQBA 5F7ZA 1E3EA 1DJLA 4UW9A 6ABPA 4B6SA 2Z2XA 4IGEA 1P61B 4KE8A 4MHSA 5G1OA 4TKUB 4NKRA 4FFPA 4QU8A 1MF7A 4FE4A 3W5AA 4WKNA 1CE8B 3JAKA 4B81A 1FNNA 1UCFA 1VJ5A 2Z6VA 3OPMA 3F1LA 4KAXA 5C5IA 1W59A 2PV7A 1OLUB 2WVGA 4L02A 3TLJA 3I32A 2OB2A 2ENUA 4GEGA 1ZVVA 3FDFA 5JS7A 3KXLA 4MWOA 4GM0A 2C9MA 4R40A 1VJGA 4ZDWA 2H7CA 2HLDA 1EG7A 1H6AA 5MGBA 1PSDA 4Y1RB 3NTRA 2PS3A 3RUPA 4YP7A 3DCIA 5A3RA 1E2DA 1BW9B 3Q7RA 4DCSA 3J81A 1N6NA 4DIMA 4EY4A 4FYVA 2Q5QA 1GJRA 3HCPA 3UMFA 1UFQA 2VQEB 1J07A 1VLMA 3D6FA 3NOOA 4O3MA 3GBVA 3WIBA 5JI2E 4N7BA 3N9IA 2G67A 4L8GA 3NGMA 2XWSA 1OFTA 3G68A 5DNAA 1LQUA 3MOIA 3OUUA 3A28A 4L78A 3DHYA 4WKPA 1CQJB 4WZBA 4Y7DA 4D1YA 4DCVA 1TEXA 2VJLA 5EE0A 3PC8C 1G9TA 1GUAA 2R62A 3W0LB 3RVNA 5LC1A 4CTKA 1DTEA 2Z4TA 2XX3A 3JVEA 4OQZA 4ZVKA 1MP0A 1E2JA 3JQBC 1D07A 2QRMA 1BFKA 2VJAA 3RV4A 1H85A 3VPDA 1PF7E 3LL7A 1UBMS 4H4CA 2IXTA 3RFUA 2GB4A 3O92A 1M10A 2FWPA 2GM9A 2P9ZA 3HJNA 3VZCA 3MAJA 4ZZ0A 1B4DA 1RYNA 1R0ZA 1DAGA 2W6QA 1XQXA 3IJEB 3N2YA 4TKVB 4XVQA 1D9XA 5MFPA 4Q9IA 1RYBA 3ENQA 4HKTA 4ALNA 4DE5A 8OHMA 3RS9A 1ONSA 2D5BA 1XSEA 2W8BA 1PTJA 4Q1DA 2HFKA 4DLWA 1QLWA 3TK1A 1JKMA 4LRTB 1M2VA 1ESCA 1X1CA 5GP1A 4FYXA 1UWVA 3AI2A 4B84A 1PR3A 2A0FA 2JFGA 2WLTA 2YZKA 1Q0PA 2ZJBA 5CLIA 2W6IA 3OQVA 5LP1A 2CB0A 2YVKA 5KJEA 2IXFA 3PC7A 2WR8A 2V7XA 3URMA 3LO8A 2BM9A 1U2PA 1BQEA 2X0RA 5KQPA 1PL7A 2FX2A 3U7EB 2OTCA 3LWZA 1XCGB 1ZN7A 2AN5A 3C3MA 1ODCA 3LDHA 4LISA 1KPHA 4QXAA 2BFFA 3KXPA 4RD4A 4RXUA 2FSIA 4UKDA 4FGKA 1A8IA 1HLPA 1OGIA 1P5ZB 1W2HA 2XA1A 4RMJA 4QTUB 3W05A 2GYWA 4W1QA 1VPVA 2FUEA 2VSYA 3IO3A 4IHKA 5CH3A 4DL9A 1TM3E 4XM2A 2CGEA 2WT8A 1WKCA 2ERXA 2GEUA 5B58C 3FPCA 2GXQA 3N8NA 3GBPA 2PUEA 4XLZA 4PYMA 4QDTA 1G6Q1 4X3OA 3K9BA 3DFKA 3VZBA 1RADA 4Q47A 3FUWA 3R20A 4MP6A 3COVA 4A2QA 2D1RA 2E5FA 2B8JA 5EUCA 4EZEA 1I4WA 3TR6A 4EB6A 2FEWB 4YLEA 3ZCRA 2YOHA 1GPBA 2JD0A 2I2AA 3CRRA 2R00C 1NXQA 1KMMA 1DBRA 4U7GA 3FAZA 3G7SA 4WZAA 4C3ZA 3C3BA 1JIJA 2JAPA 4OGGA 2ZIXA 5DSTA 4PO3X 1FP6A 4Q37A 4UOQA 4V0MA 5CDFE 4DNFA 1BROA 1U0GA 1W96A 3S1AA 4HUJA 1KE1A 4CUZA 1RJEA 3E3MA 1RPAA 3O0DA 3ZZNA 2CUNA 1YRLA 3FGZA 1PQUA 5FPPA 1VXOA 4LXIA 1Y6QA 1EVLA 3B7GA 1EQ2A 1QF6A 4IF6A 3FBWA 4RW0A 2EWVA 4ZDKA 4GPAA 1G6KA 3RYIB 4IZ6A 3C3KA 4NBVA 2HK6A 1FFHA 3LOUA 1Z0ZA 4FKMA 1IBSA 2C77A 1IZ0A 4PRZA 1OH5A 1EFCA 2G6TA 1NIJA 1R4MA 3WGTA 3OLWA 5AW9A 1THGA 3RG8A 5IU6A 3PLAE 2NYAA 3MTAA 1G64A 3E9NA 5B1DA 4PFJA 2JK1A 3SEQA 1VHTA 5BQ5A 2CLSA 3W7AA 3OF2A 5IT5A 1JJFA 3TZQA 4G26A 3L84A 1Q91A 1PNTA 2A9OA 4UTRA 2CJPA 2MINA 1C30B 3QVLA 4LWQA 5DTMA 1JZSA 1RAHA 5EXEA 2BGGA 4Y98A 3RC8A 4LI0A 4MIYA 4TLMB 5JC8A 1MQSA 4HY3A 4X5OA 2GM3A 3OCVA 2WNHA 1V3QE 4HAUA 3ZWMA 3EXIA 3F6YA 3KTOA 1F12A 3WBKA 4BJ6A 2ADFA 4YLGA 5DHTA 3T7IA 3H1TA 3M5DA 3Q0EA 2PL9A 4F8JA 3D4PA 4LN1A 4L72A 3EVEA 5H9WA 2AIRA 5K4HA 4EF5A 2ZAGA 3DMDA 4B3IA 1CULC 2V6FA 2WYOA 2RG1A 3EBPA 3KQVA 2HJRA 1D7OA 4LJ9A 1Q0SA 1ZMRA 3FDZB 5ALRA 1Q16A 1XGKA 3VO2A 2WTNA 1KQFA 1FFEA 4ODIA 3LXUX 5AM0A 4MUBA 5LZ2A 3QNWA 4H7DA 4K6HA 3A6FA 4PZ9A 4QDKA 2YX1A 3RS3A 1WMAA 2N42A 4OOEA 2FK8A 3ZXUB 4GGMX 4CMAA 4XWOA 2YYSA 4NJOA 3M6WA 1KMHB <