2WDPA

Crystal structure of ligand free human caspase-6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
263
structure length
224
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVPSAIGKKQVPCFASMLTKKLHFFPKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Caspase-6, a Selective Effector of Axonal Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASPASE-6
total genus 74
structure length 224
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wdpA00
4PS0A 3EDQA 4D3YA 3P4UA 3H1PA 2J32A 1NMEA 2HBRA 1PYOA 4AWAA 1NMSA 2H48A 5I9BA 4EHKA 2FUNB 4I1PA 4JB8A 4HQRA 2Y1LA 2QLFA 5IAEA 1ICEA 4N6GA 3IBFA 3SIPA 2HBZA 4QUIA 1RHQA 1SC4A 2HBQA 4NOJA 5IBCA 1QX3A 2CNNA 3EDRA 1M72A 4JQZA 3R5KA 3DEHA 4QUGA 1BMQA 2NN3C 3BIJA 1RWNA 4NBLA 3H11A 3DEJA 1SC3A 4D3ZA 5IANA 1RHRA 4PRYA 1SHLA 4ZVUA 4JJEA 3QNWA 2FP3A 1GQFA 3K7EA 3PCXA 1K86A 1CP3A 3NR2A 4JR1A 4N7JA 4ZVRA 3GJSA 5IBRA 1I4OA 2FQQA 1I3OA 4ZVOA 4FEAA 3S70A 1F9EA 4QUJA 1K88A 4ZVTA 4JJ7A 3UOAB 2K7ZA 2XYPA 4EHFA 4I1RA 2CNOA 4QUAA 2C2ZA 2XZTA 5K20A 3R7SA 1IBCA 5I9TA 4EJFA 4IEFB 4FDLA 4QUDA 4AW9A 3GJRA 3ITNA 1I4EB 2XYGA 4JQYA 3UO8B 3GJQA 2XZDA 2Y0BA 1NW9B 1RWKA 3H13A 4EHHA 3NKFA 4FGUA 4ZVQA 4DCPA 4EHAA 5IABA 4QUBA 1RWXA 2WDPA 4NOKA 5IBPA 3V4LA 4QTYA 4ZVPA 3OD5A 4N6NA 1QTNA 1RWMA 4QTXA 3R7BA 3NS7A 1JXQA 2C2MA 3R6GA 4N7MA 5IARA 3H0EA 1RHKA 3PD0A 3RJMA 4QU8A 3GJTA 3R5JA 1RWVA 2H54A 2CDRA 2H51A 2J30A 4QULA 3IBCA 4N6OA 1RWPA 1NMQA 1RHUA 3V6MA 3V3KA 2XYHA 4HVAA 4AWBA 4IYRA 5IAJA 1KMCA 3PD1A 2DKOA 2HBYA 5LUBA 4EHDA 3D6FA 2CNKA 3D6HA 4JR2A 4NOMA 1I51A 3P45A 4DCJA 1PAUA 1SC1A 2QLBA 5IAGA 4PS1A 2CNLA 4QU0A 4QUHA 2J33A 4DCOA 2P2CA 3V6LA 5LU8A 4JR0A 1QDUA 5JFTA 4NOLA 1RHJA 3H11B 3V4OA 3E4CA 4NBKA 2AR9A 2H65A 1F1JA 2C2KA 1RWOA 3D6MA 4QU9A 5IASA 3KJFA 2CJXA 2QL9A 5LUAA 4EHNA 1GFWA 4JJ8A 3R7NA 5IC4A 3DEIA 2QL5A 2H5JA 2C1EA 2J31A 2H4WA 2QLJA 5H0IA 4D3XA 3DEKA 2H4YA 4M9RA 2C2OA 4PRZA 4FXOA 3KJQA 4NBNA 1SHJA 4HQ0A 4QUEA 3KJNA 5IC6A 3V55A 4LSZA 3SIRA 3S8EA 1RWWA 4ZVSA 5IAKA 4N5DA 1RE1A 5LU9A 2H5IA 2QL7A 1RHMA 4QU5A 2CJYA 3R6LA 1CVRA 4EHLA
chains in the Genus database with same CATH superfamily
1UC4B 3O2QB 4H7FA 2OUKA 4MW9A 5D3KA 4AZ0B 2IA5A 2VAVA 2AA3A 1DAOA 3DL2A 1EB9A 2VPWA 4MXDA 4RU1A 4DFDA 4YUWA 4LFBB 4HRAA 4BUCA 1SU7A 1YCFA 2JGKA 3RSFA 4DG8A 4RTLA 1XL0A 4XLTA 1U0JA 1TA0A 5EQDA 3KWJA 4N4AA 5G0TA 2A5LA 1BXRA 3H0KA 3LDGA 4IIHA 5ALEA 4CIVA 1BEUB 4F97A 5M5BA 3SYNA 3V2HA 3ZCSA 1Q22A 1TZMA 3I4FA 1WDKA 3QKIA 4Q39A 1E2JA 1T5OA 3EDYA 2MSDB 3V80A 1WABA 2PU5A 2QW0X 4RENA 2DETA 4TYMA 2D1TA 1X1RA 3T6KA 2ZRHA 1JE1A 3UAXA 5EC8A 2FI1A 2O52A 1M75A 4A16A 1NJFA 3ZZTA 4W9MC 3VPXA 4BFZA 2QR2A 3S27A 3AQ4A 4G4GA 4ZVOA 3MXOA 2F43B 2FZLA 3DF7A 4JJKA 2OV4A 2XDQB 2VK8A 4LY0A 4YH1A 3ZY2A 3EDOA 3VNQA 1QGAA 3KXDA 4MO2A 1G8GA 1EWQA 1DAEA 1H1LA 2DCUA 1FA9A 2D74A 2DPXA 2CXRA 2E85A 4L2IB 4PLGA 4TQUS 5KTMA 1CUUA 3ZQUA 2OO7A 3QBVA 2Z09A 4KAAA 4PIVA 3MIZA 4UVEA 1Y8QA 4M7WA 3KU4A 1WDWB 3WLKX 1JHXA 2O0MA 4YVFA 3U19A 1VG9B 3T0IA 4YRJA 4EHHA 4GH5A 1I6MA 4JFRA 3EK2A 3O2SB 3SQMA 3QOYA 5DW0A 4JC4A 2JBAB 2AOTB 1Z18A 3PTLA 1F5NA 2O14A 5I47A 1RS0A 2BRUA 4LV5B 2PBLA 1RHKA 5SZHB 5EJGA 2BUCA 1EJ2A 2QRVA 4ZCSA 4BYMA 1RWVA 3AEUB 3M5PA 5FYDA 5BR4A 2AN1A 3W78A 4IZHA 4JN6B 2VF4X 1H2EA 1FFBA 5G4KB 3UAVA 3ZW7A 1QGDA 1ADCA 5K3FA 2ATVA 5JNVA 1D6MA 3GBSA 3AY6A 1TU3A 5EJ7A 4O5AA 3ACBA 4TWZA 3LLMA 1KH2A 4AU1A 1KZYC 1OBFO 3K9BA 4TYNA 1BA3A 1PR4A 4GGPA 1ENPA 1MPXA 2G1AA 3I1FA 3KVOA 4BO3A 1R6AA 4LHVA 3JQ8B 4F3CA 3IERA 5BV8A 3AP3A 4IL5A 4PHHA 3N0TA 4YJHA 2W6ZA 2BSXA 2QAJA 1OC4A 3ZHZA 2I7XA 2CUNA 4ZFNA 3OJLA 2A1UB 4K6MA 3OQBA 1PZFA 3ANNA 1E3SA 3KHKA 4Z9YA 2C04A 1I10A 3C5HA 3FBWA 4HADA 1L4UA 3J81A 2HQRA 5CW1A 1M74A 1TQ8A 1N4DA 3WQSB 5ALSA 1F8YA 5KYWB 1ISJA 5JADA 4DREA 2ECQA 4OP2A 3GGDA 1E2EA 1RWQA 4TSFA 1TAQA 4DV6B 1YOVB 3HDTA 4KWEA 4DUGA 3ZWQA 2V1UA 1U1IA 4FSDA 4C4AA 2G77B 3M3PA 4BRZA 4FFLA 3QU5A 2V55B 3VO1A 2VXYA 4LISA 4FYWA 4XGNA 1CLUA 3CO5A 4MWCA 2GOYA 1CE8A 2II6A 3VRHA 1YBHA 4QO8A 4Q24A 1BW9A 1JA0A 1GFZA 4IDCA 5AVTA 2HO5A 2NYAA 2P91A 3EEQA 3D4OA 1JR3E 2XOKA 3MELA 4N0PA 1C41A 3VNAA 3WG9A 4AYWA 4WBNB 1TM3E 5AKLA 4GC5A 2PKYX 1XQXA 2NNWB 3P20A 4M60A 3KTOA 4Q93A 5C53B 2ZIAA 1P7WA 4IGAA 2ACKA 1SPBS 2NO5A 3EVBA 5IT5A 3CX6A 2PAAA 5AKZA 2OHOA 2DBVO 2GHIA 3K0FA 5J23A 4RMIA 5JH7F 2QLTA 1DQPA 1TEZA 3L5OA 3LOPA 4O4HA 1Q0RA 3PL1A 4EP1A 4HNVA 2EOAA 2Y66A 3PCXA 4OHYA 3P97A 3WICA 1AA9A 3JAKA 5IZ4A 3I12A 3AR4A 1PK7A 1A7JA 4B09A 4BQRA 1FDIA 4BWFB 5CBPB 3HM9A 1U4OA 2GT1A 5H1YA 2C61A 1MCZA 1A69A 1V5WA 3V4ZA 1XLUA 5I48A 3ORQA 4WKGA 1FOEB 1JN0A 3H2ZA 3N8HA 4MUJA 1W2HA 1Y7LA 1PJSA 2HY7A 3VOBA 5CDGA 2Y71A 2GEVA 3WAJA 5BVHA 1L7BA 4I8DA 1NZDA 3RS4A 1T4CA 2GA9A 4GSKA 2HHLA 2UYGA 4JLAA 1J8VA 4ZD6A 3RG8A 2PRYA 2RI6A 2AEJA 3D7LA 5I8WA 1P4GA 3TNFA 5CPFA 3KP1A 3PHGA 3JD2A 1DIRA 1Y37A 1ZA2A 3O94A 5KTPA 5CM9C 1G291 2G70A 5BUQA 2RAVA 4OJQA 4QHTA 3BD6A 2JIOA 1VLJA 1XK7A 1XNHA 1FNCA 3F90A 2CHUA 3HFRA 3A4VA 3IJEB 4HNAB 1JXQA 1KP3A 2EGHA 1QKIA 4JI0B 1V26A 1QNFA 2ZEJA 2H54A 3TN7A 2GBCA 2XTJA 2L42A 3IBCA 4R7GA 3C41J 4U4AA 3NLLA 3SXPA 2JJ8A 5J5CA 1VOTA 1J25A 1NNI1 3X1MA 3EGOA 5HUHA 2P5TB 3L1VA 3LZDA 5IMBA 3GFOA 3DL4A 5AM5A 3LBFA 2GM4A 2KM1A 1CQWA 5CGZA 1SKUA 2X8LA 2Q9BA 5MFPA 3KB8A 1U6KA 4MEBA 1BMTA 3SG0A 2VR1A 1KPIA 1O3YA 1T9AA 3L06A 5E6SA 3SKVA 1Y8CA 1VLHA 4RIIA 4CG2A 2ZT7A 3O9ZA 5DW3A 2ECPA 1NE2A 3EIUA 2XQIA 2LIPA 2O2ZA 2OCBA 5DHAA 4LSWA 5FD8A 3OQIA 1EZ1A 3L02A 5ENVA 3RUIA 2RB4A 3ZVRA 3IVAA 4EY6A 4S04A 1GRNA 2VT6A 2E1RA 3NYIA 1LXCA 1LCIA 4C03A 2J7PD 2QNIA 4X1IB 3GT3A 4OYYA 1AZSC 1DIAA 1THTA 2B5VA 1JBQA 2VK1A 3H7AA 3WIBA 2VDQB 2QI9C 3X2EA 1XLTA 1NUTA 1GUBA 4V1CB 4V0SA 5DVZA 3B85A 4CQLA 5KTOA 5A4FS 3AUAA 2ODAA 1SCIA 3IDQA 4DR5B 1U02A 3ZV3A 3KOXA 1C7FA 2Y2UA 3D8SA 3DJYA 1L2TA 1PYOA 3TLYA 1YHNA 2QRLA 4RK0A 5D5QA 5IXSA 2W22A 1US8A 3PHJA 2MJLA 4IH4A 1ULUA 1VSBA 1F0NA 2GVZC 4HVTA 2FX5A 4UREA 4CKYA 1NF2A 4P38A 4I81A 3PNVA 4O8ZA 4N8EA 3ZGLA 1Z0UA 4QGHA 3I9JA 1XX6A 2Q46A 2I29A 2MMGA 1NIPA 4YCDA 1M0WA 3ADPA 3LHFA 3K9LA 3LHIA 2ZYSA 2WYIA 4FBLA 2D7DA 2HXSA 2NU6B 1RLOA 2P78A 4M0MA 5K0CA 4QSHA 4CHGA 5JLJA 3QG1A 1WXXA 2XMDA 2WVGA 1FTNA 2IODA 3FHOA 3TPCA 1PNVA 1XZCA 2QG4A 1JILA 1E9EA 1SWWA 3DG9A 5CJPA 5HW0A 2VXOA 3LQQA 5FLKA 4DIUA 3AW8A 1X9HA 1ND5A 3LFUA 4K9DA 5EIBC 5FI3A 5E6RB 1IXKA 2FVXA 3QXCA 4HV4A 1YZKA 3ICVA 1AGYA 4WNAB 1CWUA 1EFUA 2Q9AA 2R5NA 1RQXA 2WKPA 5GOTA 3WKDA 5HP4A 2JANA 1QFJA 4B34A 4IF6A 2ZBFA 2NPIA 1DCTA 1VJDA 2EFHB 2WSLA 2HIAA 2WKQA 2JAPA 2ZG6A 3NHJA 4NZ9A 1OT5A 2J3LA 5DOZA 3RANA 5JQWA 4M1KA 5JU6A 1Z25A 1GVNB 5HF6A 4EVSA 2ARKA 3ZHOA 1JW9B 2AMYA 4G97A 5AI4A 4HI0E 3VDXA 2GB4A 1IEQA 1ZI9A 2NX2A 1DBWA 2LDXA 3IXMA 3FPBA 5FWDA 4ZV4A 4LF4B 2RHTA 2XUPA 1OGYA 5TSDA 3D3WB 4UTZA 3ZXUB 1V16A 3CRQA 3GHHA 1GGNA 5KNDA 3HKDB 1EGQA 3LY9A 2BVNA 4M1QA 1ONBA 2IYTA 4FYYA 1FSGA 3QBTA 1Y1SA 3ZK9A 4OBBA 5FOQA 2XUFA 3OIYA 1RZRD 2PXCA 4GMKA 5KSYA 2L19A 4HO1X 1WXQA 3HVIA 4TN1A 4B3FX 2R62A 2MCFA 4TYPA 5HRCA 2PGOA 2KHZA 2IL1A 3NQ41 3GRCA 3CBGA 1FL9A 1Q7GA 2JJQA 2AK3A 2Q6KA 1IOLA 1WAMA 4HOYA 1F8XA 1KJWA 3UANA 2OQ2A 2FQXA 2W6CX 1CY8A 1D2CA 3NANA 5L3SA 1GOTA 1NMQA 1FUKA 2LKCA 4E33A 1ULZA 1LBHA 1O4VA 4J8PA 4Q9JA 3T5GA 1E0AA 3U48A 3Q87B 1K8QA 2MSCB 4X6UA 5HKLA 3AFGA 1CIJA 5K2MA 1OIVA 4IH9A 1YBFA 5DNCA 4JX9A 3QUBA 4KI7A 4MLDA 3D3JA 1TNDA 3I6MA 3CKMA 3RJ9A 3VPAA 4LF9B 1EVKA 3TRHA 1DWQA 2WJHA 4C21A 5KIAA 4DV2B 1G4AE 1CQIB 3U4IA 2EP5A 3D54D 1W73A 3UJNA 3L7MA 4LDZA 3UATA 1XZ8A 3NHLA 3SR0A 2V7QD 2JBAA 3ZVLA 2UZ0A 1RQPA 1YC2A 4AO6A 1O57A 2W9XA 1WMSA 3CZRA 3ULKA 2WDZA 3N07A 4MQEA 4KREA 1ODTC 1V48A 4FFPA 1GFWA 1UBKS 4Q5IA 1DB3A 1RPAA 4W5HA 3ZNPA 1ZJYA 5AW4A 1PN3A 3DEFA 4YAEA 1WCWA 4LHEA 3BGIA 1JNXX 4QXRA 5ALLA 3WV4A 2Q2OA 3DNMA 4ACBA 4AY3A 4EUSA 1ZVVA 3STYA 1G16A 2NZXA 3WLIA 2QN1A 3U7FB 2G80A 3I8OA 4MGIR 2QLMA 5A4AA 1M8PA 2IPAB 3KOMA 2P3LA 4MJXA 1X80A 2VG8A 1W44A 2GETA 4GRIA 1CY0A 2ZOSA 5I5GA 1U3UA 1XTUA 3RS9A 1UEXC 1YH3A 3B2NA 1O5OA 3HCBA 4G63A 3ZV4A 4P7FA 4PS0A 1TD9A 2RAFA 5A3JA 1W36D 2ATEA 4EK9A 1M7BA 3OM9A 1KJZA 1KDTA 1V4VA 3C5CA 3PBKA 5DRYA 4FHDA 1E9AA 2A4KA 2JH9A 4K88A 3VBEA 5DHPA 3RNOA 2BHSA 1JFFA 1VKJA 2AI3A 2AJTA 2V03A 1JIJA 2WAXA 4HMPA 3HV0A 4NAUA 5GAJA 1LBQA 3AESB 3AF3A 1L8QA 4J9UE 1J2EA 4OREX 1FS4A 1A1SA 3HE3A 4RTOA 3SYMA 4NPAA 4PAQA 3USZA 3RSSA 4YRRA 3C4JA 3COYA 2BZSA 4XWGA 1QWOA 3DVAA 2E18A 1UUFA 1LPPA 4UNRA 2D5LA 3LC1O 1QGED 3MYYA 1YFKA 1T9KA 2GMWA 4N7BA 1Z7GA 4OHMA 4ZCRA 3M9XA 3DR3A 4FR0A 4PG6A 2ZT5A 4A1OA 4B4UA 1XNRB 5B3JA 2OV6A 2BFEB 4GMDA 4J4BA 4BNFA 5BR8B 5DLEA 2IIPA 4CIDA 4KTTE 4C0JA 4D0LB 4F8EA 4LVOA 3KUDA 2OHXA 1I0LA 5EP3A 3KD3A 4FGJA 4EX6A 1CETA 1ZG3A 3IT3A 1N9ZA 3WHIA 4CL3A 1P45A 4CDNA 2AKEA 1O89A 3QX3A 4A6PA 4EZIA 4QPPA 3H17A 2WTUA 4QJ5A 3D4NA 1GNRA 3FMPB 3FFWA 1RCFA 2FLKA 3NH9A 4DJJA 5LNK6 3UT5B 3ZV6A 3OUZA 3QELA 3AJEA 3EGWA 4ZC8A 2XLCA 5D3ZA 3V1MA 3CFYA 4KE8A 4E03A 5C18A 4Y6QA 2R9VA 3I6BA 5A3SA 4OA8A 4LFCB 3E9ZA 2NSHA 4WFKA 3DZBA 2HFJA 2C2GA 3AU8A 4CIWA 2R79A 3M2PA 4GSLA 1J0AA 4RDHA 4U9IS 1USUA 4KFTA 4C4YA 3AVYA 1FQJA 2ZZMA 4TTQA 3DTVA 5EZSA 5C46F 1NYQA 1N9KA 4HVCA 4NV1A 5BR1A 3CJQA 1BQEA 1KJQA 1XHEA 2P30A 3EHDA 3OT1B 4RV4A 3MAGA 3N7TA 4P35A 5IYZB 3HXQA 4L50A 3JZDA 4R7TA 3DE4X 4PF1A 5DM4A 4EYEA 1LDEA 3ZKWA 1ZD5A 2QY9A 2ZQYA 4BMCA 1U63A 4JD5A 1DTEA 4DJ5X 3EEFA 5AKEA 1M8FA 4HS4A 2PHZA 4OQXA 4PLCA 4MDEA 2WYVA 5JRZA 1ZY2A 4YT8A 4XLZA 2X19A 2Z9BA 1NLZA 1X94A 5CU7A 3ZGYA 4XE5A 3T1NA 4ETIA 1DJOA 5FTLA 1W5EA 1PR3A 1OAOC 1KK2A 1KVTA 3RIYA 2F9FA 2H1LA 2OGUA 4P4GA 3JSAA 2WFMA 3PXAA 2AMFA 1D4OA 1W35A 5H02A 5H0IA 3TH5A 1WBBA 4FYVA 3AEYA 3MWEB 2ZUWA 3Q72A 4I4LA 4RGYA 3ZDRA 4V0NA 1FFEA 1L3BA 2HAEA 2WFLB 3VSBA 1RQ2A 1AK1A 4KJXA 2B94A 3N28A 3VYSB 1AURA 2AI1A 1M2JA 1QKJA 2PZAA 2JL1A 4IRMA 4BCBA 3RARA 5A2GA 5CFNA 2XUQA 3QWFA 1W5BA 1QFSA 1I3KA 4CLRA 1JGTA 3MS4A 4PQFA 2E6KA 2JI9A 1MFPA 5D87A 3FHTA 3K6RA 1V3UA 2J5RA 4I9FA 5TMDA 1TB4A 1JQ5A 1NSYA 1QVAA 2HADA 3EVAA 4N41A 3BD9A 3C6ZA 2XD9A 4PFQA 3LDFA 2Q3DA 3HABA 1LV8A 2J6BA 1GEEA 1HE2A 2XUZA 3B1WA 2XRFA 4EGCB 1LSUA 1IMJA 3MGBA 3ER6A 1NVGA 4DADA 4QL3A 1WU7A 3GAFA 3U0BA 1B3RA 3U81A 4DHEA 1P8AA 1WS6A 2RMKA 1L4EA 5ECDA 2RHWA 1G9XA 3OWOA 2ZI9A 4FONA 2ZJ5A 3BIXA 3OLQA 3ZGOA 1C80A 2YW2A 4GWGA 3D0RA 2J07A 4V2UA 1YIOA 4RSHA 4WK4B 2Z8YA 3AUXA 1HYEA 1I7NA 2ECOA 3NR2A 4X6LA 4H08A 4IZ6A 4Q1BA 1QHHB 3UF0A 1KXJA 3H6GA 4LGVA 3QI2A 5LB2A 5KTTA 3S81A 1FP7A 4NTZA 5LDDC 4YUVA 4D4HA 1V1RA 1T8SA 3HTXA 1XTIA 3TLJA 2CNOA 4QFDA 5HOEA 1UJCA 2ZIXA 4QVKA 4PYNA 4G1MB 2MSKA 4DNPA 5ARCA 1GT6A 4RHEA 4N5MA 5DASA 1EFLA 3LCRA 4WNIA 2VA8A 2Y1CA 2HRQA 1JDNA 1EM8B 3EAFA 2Y1FA 2A14A 4PAMA 1W5TA 3NKFA 2D5BA 5EERA 2YJ3A 5K5EA 1L4NA 1UK8A 1C8VB 2O2IA 3ZYCA 3QE0A 3H04A 3A37A 1KH3A 1XV5A 2QU8A 4G1CA 5DZSA 4KSYA 4CG1A 3ORFA 3OE1A 1SBIA 4WEOA 5AW7A 5FWYA 2RBEA 5LXTA 2J9RA 3QRWA 1DBRA 2KMLA 3BWVA 5TMPA 1DELA 2VBIA 3SC6A 2YJ6A 1Z6QA 2FSVC 2W6IA 4DR1B 4XCVA 2DQSA 4TKLA 4YLYA 4EZBA 2OXRA 4CLDA 2XYVA 4RF4A 1E89A 3NTVA 5NULA 5FUXA 2D7CA 4R01A 5HS4A 1J07A 3BJZA 3IAS6 1S02A 1G3RA 1TMYA 3T5CA 5B3LA 2C5FA 4ND6A 1MXHA 5DSXA 1LH0A 3O0TA 3B3JA 4PCAA 2IH4A 3LA6A 1N6RA 4YBZA 4G5YA 1B8VA 1II0A 1W4AA 2ZAOA 3EQ2A 3BL6A 4OQQA 5AKGA 3IO5A 3GA5A 1EGHA 4DQ0A 5ULLA 4I8IA 2DG2A 4K86A 4R40A 5CT5A 4OQZA 1VSQA 3LGXA 2J0UB 4MKIA 1RE0A 1RWOA 2PGXA 1DPFA 1JLLA 3UAWA 3WYGA 3OU6A 5CDHA 3FF1A 4KH0A 5FHQA 3R8CA 3VV3A 4GPD1 1PV1A 4K3VA 4TUYF 2C9DA 4CM1A 3CTPA 2JK1A 2D6FA 4RVSA 4M0FA 5E6UB 1KY5A 4OQNA 2B99A 1UL1X 2WHYA 1DARA 1QO0D 1RZ3A 4FQ8A 2UZ4A 4NMXB 3OSUA 3GB9A 3Q7SA 3BCSA 3KBOA 4MS3A 4RJIA 1NAIA 2VDLB 5JHGB 2BM9A 3EBPA 2LW7A 4ABYA 1IZ7A 2GS9A 2WWFA 2Y4NA 3IUYA 4D0RA 2CMDA 1W34A 3M6VA 2J3KA 4Q1FA 1TCAA 2FFRA 2PK3A 3F5SA 3ZV5A 1CY2A 1PK8A 3ELBA 2NP6A 2V0GA 2QUAA 3GLIE 5AQ1A 1L5OA 3P9ZA 5LB4A 4Q7MB 1II8B 3CXUA 4DLXA 3MOIA 2VBCA 1JF8A 3GROA 4GGMX 3O8LA 4ZDJA 2FH5B 2ONYA 4WK6A 2O1EA 4W9NC 4MLZA 3Q3JB 4E11A 1MGOA 3N5KA 2POCA 3DCYA 1P1HA 1QX3A 5FBHA 4GZLA 1CEQA 3MT9A 3LS2A 2UYCA 1A4UA 1GN9A 1LQUA 1EVIA 2A5JA 3NKVA 3T9BA 3BCHA 3JALA 2VIIA 3H5WA 4C06A 3H2YA 2BCGY 1XJCA 4ILEA 5JWHA 4F38A 2ZXFA 1KY3A 3N6VA 2PL9A 2ET6A 3MPOA 5INTA 1TK9A 4M86A 4O4LA 2MINB 3UCFA 4DEVA 4DLTA 4EG8A 1ZM9A 1KIMA 3VYVA 3REFA 3PQEA 4BN0A 2OR3A 3IIMA 4JWKA 2ZM5A 4H7HA 4KIJA 2Z04A 3LOUA 1C3OB 3VHRA 3URMA 3C74A 4IWNA 3I5MA 1BJRE 4NWIA 1UCFA 6YASA 3NHBA 5BRAA 3W5VA 4ML3A 4WZZA 3WP0A 4AZTA 4K28A 1QGUA 1ZL2A 4B6FA 5FEUA 2E2WA 4UMVA 4BZZA 4E12A 5JMWA 4F7WA 3FMOB 2ZU6A 5TJHA 4OH1A 2IYUA 5LR6A 2XYGA 1U3VA 4RWEA 4EJMA 4I6GA 4I36A 1K66A 2OMKA 3CPJB 5ALIA 5FOSA 3CZ5A 4ZEMA 3QVWA 5IMSA 1EK0A 4RNDB 2OQVA 1XD2B 1QIDA 1JFRA 3O3OB 2IIBA 4D0NA 3IRUA 2I54A 3V4LA 2EQAA 2C7GA 2XDYA 2JI4A 2FEKA 2YBDA 3NHUA 4LZOA 2B5OA 4YNBA 2XUJA 3T7IA 1AVTA 4KQCA 1EUDA 3PENA 4HUQA 3FGZA 1DDIA 4NICA 3R5JA 3TPFA 3JAWA 3LTNC 4NI5A 1QCZA 1SXQA 2VA9A 2PX5A 3LXXA 1HNZB 7ADHA 4UHCA 4BIIA 2QX6A 1EWTA 4PO1A 1ZNYA 2JGRA 3RFCA 4P9NA 4Y67A 4UUPA 4RMNA 4HGZA 4BC1A 1XCPA 2NO9A 2ZGVA 4OQPA 3VR3D 4Q1EA 5AJHA 3S2FA 3QXHA 4LHSA 5KNLA 4ZI5A 4P2BA 3T95A 2QX8A 3KJHA 2JW5A 4YP9A 4CKEB 2YV4A 3CEMA 5KS2A 1RM5A 1JHYA 5TXGA 3SU8A 3T3GA 3TJMA 1YMQA 4B6RA 2BH2A 1X1QA 2I03A 3HLYA 2YXDA 4BN4A 2Z58A 3CF4G 5AW9A 4QGFA 3QIAA 4CWAA 3ADDA 4EPYA 1NN0A 1S4MA 1YGPA 4XJXA 1HQKA 2PS0A 3ELDA 1DG1G 2J08A 3UJDA 1XQ9A 4FE4A 2IYYA 3WDMA 1H2YA 3Q7TA 4Z4QA 5JSHA 1AGXA 3DXZA 1XN4A 5TPWB 1MDFA 3C24A 4BX2A 1U0EA 1JQAA 2HC9A 3RW9A 5AM3A 1T9GR 1U0LA 3PGLA 1Y6RA 6Q21A 2JGMA 3C5VA 4IJKA 3KVVA 3ED5A 4UUAA 1S2DA 3KJNA 2PMEA 1V3VA 3IUPA 4BWGA 1TYZA 1LDYA 2Q6TA 5E4YA 2VRNA 4QTTB 3I9NA 3R3ZA 4EAQA 5CFOA 1R3DA 3FETA 3T4UA 4KB5A 1CQXA 4G1BA 2XE8A 2IPXA 3C3JA 1G21B 1I5EA 4DCUA 1YDFA 1R2QA 1U0GA 2G76A 3TS1A 2HU5A 4JJIA 5IM4A 4DMKA 4LHXA 4PYOA 4HB3A 2X0DA 2V6IA 3KAKA 3RH0A 4IX1A 4ZT3A 2FW1A 2LVBA 1AA6A 2R8ZA 5FF9A 4YUAA 1TLLA 4PX9A 3ABOB 3LBHA 3AF1A 4F9TA 3FDIA 3GJ8A 3SX2A 1F60A 5GINE 4J2HA 4QE3A 4IGFA 4JUCA 4KVGA 4WGFA 2PUTA 1GAQA 1XZMA 2NN3C 4UM9D 4IV0A 4J2TA 3BD8A 3HRIA 3SHQA 1NI4B 2AI2A 3DHYA 4LDQA 5FL3A 3FWPA 4B2IA 1MRSA 4MUAA 1TFUA 3VH2A 1D2NA 3UIEA 3AIKA 3VSCA 2HF8A 1VLZA 1T3ZA 4WUTA 1L4BA 5EL0A 7REQB 3CR7A 2ZIFA 4XX1A 1RXEA 3UC9A 4DPLA 2CDNA 5TRTA 1JYSA 2NTEA 1QWSA 3P0JA 5IF9A 4W5RA 3QKSA 4G0UA 5TIIA 3UWMA 2QZJA 4C89A 4ENRA 3WB0A 3NHPA 1WKBA 4OLAA 3RHZA 2XZTA 3NP7A 4IIJF 1CUJA 1EWKA 2CXNA 2XOXA 3F6CA 3OQJA 2O50A 4D8VA 1F51E 3TJZA 1U4SA 1ES9A 1E3LA 1P31A 1R4NA 1XKQA 1Z2PX 2REQB 2UUOA 2BCJQ 2YVKA 4MPPA 4TOIA 5FL7A 2WF7A 2GARA 4YJKA 1Q50A 2UYOA 3ZNQA 3FA2A 1ZOIA 1L1FA 2P0YA 4DCMA 4KXFB 5I7OA 3Q0IA 3AEKA 3H19A 5L95A 1Z5ZA 3D1VA 2QBYB 1EVLA 2RGWA 2Y99A 4KN6A 1KOFA 4RWZA 5LLTA 2ZUFA 2XODA 4KLAA 3FSGA 3GHYA 3MCVA 1ADFA 5JQGF 1NP6A 4UPEA 1LNSA 2Y1GA 1A7AA 3A9RA 3G7UA 2FMHA 4XQ9A 1V4NA 2VHWA 3DBHA 1E3DA 3TMAA 1LY1A 2Z4RA 3G3EA 1OI4A 4B7UA 1OLUB 2GBGA 3KYIB 2AMJA 3FBTA 2R4QA 2RHOA 2ZIXB 3ZX5A 3OOWA 1VHWA 3HCPA 1DG3A 4KQ1A 4R8MA 5F73A 5JS6A 4UHFA 1GO2A 2DU8A 4G0XA 3KHSA 3OJEA 3SZ3A 4O4LF 2HEGA 3IKVA 3AUUA 4OY3A 4KK4A 3RVPA 1VQ1A 3CWCA 3NKLA 4IIJA 3ZTYA 4RY9A 3N2EA 2J4FA 3UKOA 3SJUA 2IOYA 3E9YA 1VZ3A 3H9GA 2W2MA 4K40A 4KDCA 1VTKA 2GKSA 4HNUA 1LPBB 4D9GA 2AR9A 3D81A 2I55A 3PNMA 4CN9A 3DMGA 4WCDA 3QG5A 1INLA 1Q6YA 3OKPA 4J07A 5G1OA 2H7XA 4L8GA 2W2KA 4YBRA 1JPUA 3L0CA 4A23A 4JOCA 4XSGA 5C8YA 1H0RA 2WWYA 4E22A 4P3NA 5EZ6B 5KWVA 2IZ6A 3NHZA 4UM9B 3IEUA 5DN6A 1V5IA 1Z7WA 3NPAA 1J20A 3INTA 4OH7A 5KO2A 1GQSA 1MORA 1P7PA 3CCBA 3CX3A 1N6NA 4NY1A 3ZH2A 1T9GS 2J5QA 3BB4A 1SXPA 3DMTC 1SA0A 3TLBA 5DYYA 2OBMA 4OHOA 4EVQA 4O08A 1TRHA 1WTCA 2B6NA 2QRHA 2HV9A 3OG9A 1CE8B 1UIMA 1YNSA 3NB0A 5B53A 3S44A 1SN7A 1OX4B 1U3CA 1T4GA 3GVCA 2W8BB 1A9OA 2GYVA 1GCOA 4NFSA 3GZ4A 1HYQA 5AK5A 4HAIA 1U65A 2BFNA 1OH5A 1BMFA 2HCBA 1Z8DA 4XTRA 5H3CA 4C2BA 3I01A 4EX7A 5BWBA 4B32A 2PGLA 4D4IA 3IVGA 1QHYA 4GX0A 3QXJA 4Q18A 2QG9A 3UTCA 3DL7A 4C7OA 5ADUS 1HKUA 1T0JB 2G5TA 2ZWOA 1QUEA 1TPYA 1Y3AA 1Z12A 2N75A 1YOBA 2VQSA 2WAAA 1X1DA 4FDMA 3M1IA 5KYTA 5HSGA 2WF8A 5DLQC 4QODA 4DQKA 4PLHA 5GADl 3FNFA 2I71A 1R8SA 2R4UA 2BEUA 2VNKA 5KYXB 3URKA 5KNBD 4PYJA 1PDOA 4MYTA 4CFZA 5GIOE 4TXLA 1VL6A 1SXHA 4QFMA 1TZBA 4H59A 2P2ZA 5J2UA 3C6QA 3NP9A 3VV2A 3UUFA 2X8JB 5FQNA 3VPDA 4EPXA 3PC6A 1ZK0A 1TYCA 2Q41A 4H0NA 5EGNA 3L6BA 5HIMA 3TIFA 4X1YB 3UN1A 3ZI0A 4F6RB 1N92A 3WLAA 4D9CA 3SKYA 3CF6R 2Q5CA 1L7QA 5C0OE 4UMFA 3HJUA 3U4QA 1ELOA 2HDHA 5FWXA 4CKEA 3CLVA 1E6EA 4FMCB 4IDDA 5FNVB 2SICE 4FQ7A 3DLHA 3ZD9A 5DB4A 4Q9NA 2H6EA 3R7BA 2Y05A 1L6RA 3B6EA 3BB3A 3UHAA 2NO4A 2DQKA 4BAUA 2BFAA 3INGA 3WTCA 4UNQA 5JSZB 3PRJA 3DTVB 1VJGA 2B9EA 2QXUA 1JA1A 1ZN2A 4RL6A 3NHFA 3ZZ1A 3BWMA 1Q0ZA 4GWLA 3WLSA 4BMVA 1RSZA 1ESDA 1K8XB 1K8RA 3N74A 2GZRA 3QKRB 1U8TA 1Z4LA 1T9CA 4H1UA 5CH5A 2IV3A 1EA7A 3GQBB 4B6SA 4B75A 4D74A 2BGMA 3KL4A 2FXIA 1RQNA 1JDJA 4C20A 4QM7A 3HWWA 3ZTTA 3U9SA 1RQRA 1GPKA 2GESA 2WVHA 1TVKA 1XZEA 2FMKA 3N8NA 2FNAA 4R2MA 3WMFA 4ENUA 1MO3A 3USES 4Z4CA 2J3IA 1QIGA 2NU8A 2BGLA 1CJSA 2ZRFA 1THMA 1JEDA 2BKLA 2R1VA 3MHPA 4AZ0A 2YICA 4PBSA 2DFLA 2ZE6A 4E1BA 2FEOA 3I0ZA 2HA5A 3ZEIA 4MPJA 3BULA 1N7JA 3MM4A 3VKUA 3KETA 2F1KA 1Y7HA 1XDZA 2R48A 3IDAA 2H4YA 3E61A 3PITA 4RA6A 5AK0A 5F76A 2KX7A 3CUVA 4FNMA 4IKOA 4EB6B 3ABRB 3RYIA 1OFTA 3OIDA 4BNDB 2ZUVA 1ACMA 1TQ4A 4D80A 1PJQA 1XO1A 1W8DA 5BOSB 2P2DA 4DWWA 3S99A 4KAFA 3O3MB 1OD6A 4RW0A 1E99A 3MD0A 5KTNA 3WBJA 1NMEA 4ZOCA 3QENA 1F2TA 3WTBA 3LUAA 5LOVB 1QU2A 1R7RA 2YVQA 2DR3A 1I5OA 2B3DA 3DQZA 3I28A 4GICA 2L0XA 3SIWA 2H1WA 4I1PA 2HA7A 1WSAA 3LVQE 3KT3A 3QOWA 1ENZA 2Y8EA 3H1AA 2Q5EA 4G85A 4KXXA 1OXVA 1T8YA 1OIWA 2PZFA 4GYKA 4U2BA 1KO8A 4BLRA 4G0PA 4F06A 1RI4A 2ZDHA 3NWEA 2Z1MA 4UZEA 1L7RA 5ED4A 2H08A 3K1YA 4IVQA 4R0VA 4UBIA 4JC8A 4IPTA 2V6JA 4GM1A 3SLKA 2ZVDA 3KJIA 1RRGA 2D2IA 4R83A 1Z13A 1QKKA 3RRXA 5BN4A 3CZCA 3F96A 5I9IA 3I9V1 4BCDA 1W36C 4H3VA 6REQB 1PSWA 2I6QA 2L18A 1K86A 2YVUA 3T52A 4BU1A 5EIEA 4MQLA 1KSGA 1IN4A 1YI0A 4PZ9A 2OVFA 3ZJ4A 3G1TA 2I3GA 5HBGA 4D45A 4D5GA 4FYIA 1FDTA 4HZGA 1U2GC 1M2NA 1UJ4A 2A9JA 4AD8A 2XCLA 3K6JA 4RFSA 1FNNA 4NMMA 1KDZA 1G7SA 5ESRA 4B84A 1AO0A 1P74A 2J9FA 1HLPA 1XALA 4D92A 3S1AB 1RC0A 2X77A 2D2VA 4IXWA 4F4CA 3ICEA 1IPHA 5JY6A 2CC2A 5IUNC 3VX4A 2AYYA 4ZOLA 3S2SA 3ZHCA 4AMVA 3ZWBA 3TSZA 2V7VA 3N87A 1HXHA 5HZKA 3DE0X 2XITA 3T34A 4HDKA 3T1VA 1V25A 1ZINA 2ODBA 4RPIA 3QV1A 3PA8A 2KI5A 2ZS9A 2QDXA 3Q8XB 5FR1A 3AR6A 3NTRA 4BVBA 3H1BA 2BHTA 4UU1A 4F2DA 5BV2P 1L1EA 3ANMA 2P75A 1R10A 1U8EA 1YJCA 2ZYWX 3CSSA 1GIAA 1TD1A 2W43A 4ZRNA 5EIAA 3CLTD 3E7PA 4IFTA 5ALTA 1C1DA 5EE3A 5A4DA 3A4TA 1H2ZA 1OLSB 1SKAA 2P2SA 2PM8A 1HEUA 3O4HA 4QG7A 5T8KC 3VR6A 2QRMA 4YYEA 5JAIA 5KOHA 1M6NA 2QVZX 3C14C 4X3OA 1NLMA 3B3AA 1X7XA 3LX8A 1VL8A 2BI8A 2WT9A 3DGEC 3PGVA 1Y63A 5ALJA 1GG8A 4PZZA 3MUEA 2AJCA 4KP7A 3UOWA 2Z6QA 4X95A 3EXIA 1KAQA 1BS1A 2G0TA 3IP8A 4WI1A 3TGPA 3QSGA 3O2NA 1REQB 2AT1A 3REGA 1C30A 4F46A 5JAHA 5AW3A 1PR0A 5IUKC 1SCBA 2CWDA 2I7VA 3LO5A 4IGIA 3U60B 1EFVA 1YUNA 1GPAA 4LWPA 5T4FA 3QU9A 2O57A 4PZPA 1DKUA 2Q3LA 1FMCA 3A26A 4UEQA 1M54A 1BROA 4MIOA 4CXMA 1GEGA 2BC9A 3A06A 3N5CA 3P2YA 4FVTA 2TYSB 2WKSA 2Y77A 4INPA 3VH1A 1FJHA 4D9HA 1JR6A 2EYUA 4V0QA 4KO3S 1JSCA 2V1XA 3VAZA 2XKAA 4MW2A 4J3NA 1SIWA 1SD5A 1FPMA 3L7OA 4X8LA 3RBXA 3CT4A 3BXPA 1DQRA 1UMBA 2XXBA 1QC5A 2B34A 1WSDA 2XT0A 4K7JA 3ZH9B 2WHRA 4EY3A 2PVPA 2HREA 2ZETA 4RAQA 3F5MA 2J9GA 4NHOA 4K2HA 4OK5A 3R5HA 2JLSA 2ZWAA 3ROEA 2V5VA 4M7RA 2R7LA 2AMVA 4UVIA 4EARA 2P2LA 1EKXA 3U13A 2AN5A 1U5BA 4DWJA 2BGRA 3BMXA 3I1YA 3ZE0B 2OHFA 1NRXA 3A9UA 3FCXA 4KIGA 3TVDA 1NLYA 4EPRA 4LFAB 1YDGA 2G8LA 1L7PA 2GNOA 3SX4A 4BP8A 5KKNB 1AUXA 1L7NA 3Q3VA 3GMIA 1S2IA 1E8MA 4J03A 1G21E 4XOIA 4WESA 5LLDA 2W2XA 4WA8A 5C34B 3E22A 4COKA 4KX3A 3UJ3X 3IS3A 3TVYA 4PQRA 2BELA 2KQUA 5ICMA 4V38A 4GSYA 4BX9A 2CCJA 3QYAA 2H8GA 1DIGA 3JD0A 4ZO8A 1FEZA 4DCNA 4ZGBA 4XIIA 1DO8A 2WD8A 2BEVB 2OAEA 1ZVMA 4KQIA 4GI3A 3AHFA 1JB9A 1G7RA 5DRTA 3FYDA 5HKKD 2ZATA 3WKBA 1QOPB 1J8FA 1DRWA 1U7WA 2ZRQA 4IYJA 1H6AA 3K92A 3WY9A 5AXDA 4CL2A 1KQ3A 3E70C 4TN5A 3TRIA 1LB1B 1JSZA 4BMYA 3HB7A 4GR4A 2VJPA 1Q44A 4DQXA 1ODKA 2Q3MA 2QSJA 2CW5A 3TL6A 2OYSA 2YNMA 1WP4A 4DMUB 2A9KA 1GYPA 3M2TA 2QUIA 2XTMA 4QAJA 4U7JA 3VNUA 1JHAA 2A1TR 2O5VA 3OO0A 3CG4A 3Q8MA 1ZR2A 1KWKA 1JLMA 2HU8A 1ZUNA 3E15A 5L7WA 3F8TA 3R20A 3RJMA 2PZBA 1KKMA 1KKLA 3IDOA 1GRCA 2QVYX 4C30A 3KZKA 2A9QA 2GILA 2CMKA 1GT91 3BMQA 3IPAA 4FS3A 3BM5A 3AZOA 4U2KA 3T41A 1LPMA 2IRWA 3VJMA 2FCAA 3ROFA 3INNA 4BIMA 4PV7A 5EVJA 4JP8A 5CT6A 4YRBA 4CF7A 4LGMA 4GLOA 1PFUA 1BHO1 2NVUA 5F7OA 4JL8A 2EWVA 3RWBA 2GEJA 3AP1A 4ISBA 1ZA1A 1PS9A 4B5LA 2WJAA 4QEKA 1XNQB 4D7AA 2QMZA 3UJ8A 5BN5A 1DIHA 3QU2A 4WWHA 5HUQA 1P73A 2VDPB 2IXFA 5FHRA 4ZQFA 1NAHA 3VR0A 3OJ0A 1DLIA 2C0CA 4YV2A 3NVMB 5ESXA 4CEIB 2CBZA 2G4CA 1UM8A 3MGKA 3JR3A 1A4IA 3SGLA 3CXRA 2FUG1 3HCAA 2Q3HA 3U1TA 4DLZA 2OPBA 2H4WA 4Z5XA 2Q1TA 3DVRX 1LRKA 1C9KA 1JIXA 4IS3A 5EXTA 1M34A 1NVXQ 2WSBA 3R3HA 3LPMA 3U3ZA 1DP4A 2UZIR 3WS7A 3N7AA 3ZHVA 2DFDA 2A0FA 2OV1A 4BVFA 1M2HA 4HDKB 4Q48A 2XDAA 4XM0A 5EKDA 4LCBA 4DAOA 5KOJB 2XUHA 1G64A 4QU5A 4CKBA 1KERA 1NV9A 3NUZA 1GV0A 5HNKA 1K3FA 4RXMA 1N5LA 1IQ0A 4KOEC 1KJ9A 4YMSA 2YOGA 3EGDA 5ELMA 1ZD1A 3VZQA 3WA6A 3HFSA 2OBXA 1WUIS 4YRKA 3SVLA 1CUVA 6LDHA 4GYJA 4TTSA 2O7SA 3REQA 3GEDA 3ISTA 2X6TA 1Q83A 4JL5A 2PWZA 1IUOA 1FSSA 1MIOB 1X38A 1NM5C 5KU7A 2WT4A 3ENNA 4PG7A 2WP0A 2AJ8A 2X76A 2YDYA 4Q4HA 3GLGB 4YAUA 3RYIB 1G59A 3IAS1 4D3FA 1UT6A 5HCNA 1WB5A 1OGJA 2BEJA 2V7BA 5C8YF 3GFVA 5E95A 4Q82A 2PS9A 1G7TA 1FXWF 1T2DA 1J2UA 5CA1F 4P0QB 3AEZA 3C6YA 4LE1A 4M87A 3GBVA 5FV7A 4CR8A 1YRHA 2OHHA 3DHEA 3KAPA 1W581 2MMCA 3IEXA 3HB4X 3OLYA 2QN7A 4HFNA 4YAWA 4X20B 4BE4A 2WTMA 4RPCA 4ZO9A 1O77A 2EX1A 2ZPUA 2QN6A 1KEPA 1YZNA 1BU8A 2YHSA 3D6UA 3FNHA 3ZCPA 3DOEA 1SZCA 1YR6A 3C3CA 1DU4A 1O6CA 1SCJA 1Y8QB 2B2NA 1ZJ5A 3AWIA 3NDIA 1KEVA 4KPGA 1C9JA 2N1MA 1F2TB 1WCXA 1RJDA 2OCLA 5IJZA 2Z5GA 2AXEA 4PY2A 3EG5A 5JO0A 1K5PA 4F4IA 2DY1A 2Q28A 1B8NA 2SECE 3P4XA 3WFZA 2IOHA 1R8JA 3PS9A 3PJDA 4F96A 1OVMA 5BSVA 4CV3A 4PCVA 4BKPA 4EB8A 3L41A 2XIQA 1K9SA 2BAGA 3M8KA 4HMOA 2I4TA 1F9AA 1GA6A 5JROA 3IQHX 1EFRA 3AUJB 4B6GA 1TVKB 5F1PA 2J9ZB 4CM4B 3S2GA 1PYGA 2GK6A 3OOEA 4NZYA 1WCIA 4ADSG 5LOVF 4IEIA 1D6JA 2IEDA 1W6UA 4D8WA 3CH6A 1JAIA 5A9TA 1BNCA 4P93A 3DA8A 1JV2B 5BSMA 4EL5A 5CD1A 2H1OA 4MRPA 5LQJA 5JH7A 2W6OA 5FTWA 4PC1A 3E9EA 1B0UA 1OFVA 5LBUA 5CCEA 5IG2A 3GAZA 4OQMA 1IL0A 3G8BA 4ISCA 2CMHA 1Q0SA 4YMUA 4BNDA 3ZZUA 4B3TB 4MRAA 1NC3A 2X1VA 4LXQA 3UY4A 4NULA 3GDOA 3EIEA 1JAYA 2QPLA 2EWWA 2WZQA 3OETA 1RXIA 3EGVA 3H6KA 5JXGA 1EIZA 5CNIA 2G88A 2H4HA 2GKGA 1GA1A 2Q3JA 3IAHA 1EM8A 4J49A 4Y0NA 3IRVA 1U4NA 3EF3A 3DDSA 2ZQZA 1R9MA 4CMCA 3WB2A 4BPRA 4LYHA 4ZYZA 4A6DA 4CMGA 1UMDA 2F3RA 3NVAA 1FX0A 5K8CA 1QVWA 2A8YA 3AONB 1UDCA 3RIHA 5AVXA 3WV5A 2V3CC 4UU8A 2ID4A 2XXAB 5HQTA 3ZQKA 3S29A 4LOKA 5IF3A 1KFCB 1L5SA 2IF0A 5GWXA 2HSDA 2IV2X 5LBIA 3LXUX 3P96A 4S1NA 2O23A 4MINA 2HTFA 3PX3A 2J9XB 1OX4A 1ZSVA 5B12A 5K0BA 2X40A 4M6WB 2BEUB 1TIKA 1SKYE 1YFZA 3SJBA 1JIUA 1PR1A 2ZP1A 1R0SA 2DTDA 4RZXA 1K0UA 4JZYA 1NXVA 3SQDA 4EF4A 1EGMB 1CUXA 2ZROA 4KUHA 3EZ7A 3O26A 3NEAA 4UBOA 3B6JA 2QTAA 4YXWD 3MS2A 1SU6A 1XMIA 3SWWA 5LJLA 3GLIA 1CJKC 1JR2A 1FNSA 3G2PA 3L01A 2K7FA 3BFKA 4FWIB 4AZSA 3RVRA 2I9PA 1DMSA 3ZHXA 1QNLA 3LKDA 1YU9A 4Y0VA 1XTPA 3FAZA 3E1KA 4KPUB 3S28A 1VYTA 2ALJA 3LQKA 3WLFA 4I5DA 2X5XA 3AETB 3F7OA 4LK2A 1Z2EA 4DG5A 1PG2A 2NQ8A 1JQKA 4TLMB 5K8IA 1HQYE 3TKYA 1P19A 1PGPA 2PFKA 2VC2B 4LNHA 1BCSA 1WOYA 4X7MA 4O5OA 3UAYA 1A82A 3Q5EA 1PFWA 2RH8A 2IDJA 3WR5A 5AESA 3T3PB 4RSMA 4YP0A 3RVNA 4KVAA 5JECA 1JEQA 2ZSHA 1CVIA 4Y6RA 1ISFA 4ZRMA 3C1AA 4PNEA 4YRZA 4WW0A 4FOPA 5JZMA 3LLVA 2RGXA 2XE4A 3MTJA 3P8ZA 3R23A 5JAZA 1MC4A 2B1JA 5DBFA 4FIZA 4DMHA 5KMGB 1N5DA 3F2IA 2QSYA 3F3SA 1MO4A 2ODEA 4NOKA 1QM5A 1XZPA 2GH1A 2LTAA 3D0OA 5THKA 3DTNA 1YFLA 3O84A 4CNQA 5BV7A 1GQ2A 1NP7A 5KYUB 4R1OA 2CK3A 3E22B 5LQSA 3WYNA 1A8SA 4X7RA 4AJOA 2VJMB 1ZMBA 4GGOA 4WINA 1W4BA 4TM8A 5HIJA 4C7VA 3BGDA 3JARA 1QQ5A 5T7BA 3I9KA 3KJGA 1T1GA 1I36A 1TGYA 3C3MA 5LUBA 2FUCA 3D02A 5JC1A 2I6XA 1N2ZA 1GSOA 1Y1PA 2NSJA 4B2LA 2ZKIA 3TXAA 2FJ0A 2UVPB 4BVAA 4HAWA 1U81A 1QIEA 1B6SA 2F3UA 3S7ZA 1GAXA 5SYNA 3FD8A 1P9OA 1TEHA 3TW8A 4WLOA 3M6FA 4XUGB 1RP1A 2R7NA 5HCIA 9LDTA 4HG2A 2CXHA 3C4VA 2H2AA 1RFLA 4FR5A 3BSSA 3FTFA 2FPIB 2ZAGA 2DHEA 4TGLA 2RHDA 5FBLB 2XKKA 2HNKA 1ZWLA 2PT9A 3JQEA 3JASA 4L85A 3WBKA 4G37A 4DNXA 2A9OA 1M1XB 1XYVA 2YS7A 5C8XA 3DDOA 4U2FA 4URYR 3R74A 3GUUA 1S3SA 1PVDA 1UJ2A 3KCNA 3W2FA 3M6IA 3FG9A 4OP3A 3ST7A 1ADJA 3PUVA 3K73O 4P33A 4EELA 2IZ0A 5D84A 2CB0A 1Z5WA 4II7A 1FYFA 5C8VA 4RPGA 1AJEA 3PC8C 5HZMA 1Y5IA 3VUEA 1P1CA 5ADVA 4FCVA 3A6PC 3MNFA 2Z2IA 1P2TA 4DJAA 1HDCA 2R47A 3EWSA 3KLPX 4ZMBA 1MJ5A 1Z29A 5AI8A 2COKA 3VR4D 1AS2A 4Y9SA 3U1VA 2BGWA 2R6DA 1S7CA 3FMFA 2BKEA 4I5IA 1HETA 3SF0A 3U09A 2O8CB 2QP3A 3E9NA 2FWJA 5TB5A 3JQGA 5CA0B 1R0BA 4RVNA 3FH0A 1J6UA 2FW7A 4B3MB 4LIPD 5GVRA 1CRQA 5MGNA 2WUWE 3R76A 4WY8A 1Q2UA 3UJPA 2VUTA 2I3AA 4TXJA 4RUKA 4ECEA 3AVXA 3LGAA 2I2XB 4FLFA 4JL6A 4CU2A 1N77A 1XZLA 1MOPA 4HDRA 2WWTA 1PFVA 1E96A 1SB9A 3H65A 2PUAA 4WKPA 2P9QA 3I76A 2C2XA 3UENA 2AF4C 2ZAYA 4BQSA 2V3WA 4GO1A 3R3YA 1L4YA 2IZ7A 1MQAA 4N5LA 3E58A 2YWCA 3QK7A 3FUTA 4MI3A 4RIEA 3RUEA 3SSMA 1T24A 1E69A 4RVUA 4RZ2A 5FEMA 4MQ5A 4XDYA 3JYNA 3QVMA 1IAQA 3AL2A 3LL4A 3AVVA 4XCXA 1WX1A 2VQFB 4O29A 5GQSA 4DV3B 2BFDA 3N2ZB 1ABEA 1E3TA 2ZJFA 3M7IA 2D59A 3ZXSA 4OOEA 2O8EA 5EHNA 4KKVA 3SYLA 2C5GA 2RGNC 2Y4OA 3CM0A 4JIMA 1WBDA 4FNAA 2TMYA 4QUBA 5CLHA 2Q3CA 5EP4A 4DBLE 3NH6A 2WMYA 2PX2A 3L43A 2AG6A 4YRLA 1JUDA 1SCAA 4H17A 3GJ3A 5F21A 3FCOA 2SCUB 4W7HA 3I53A 4F6LA 1TM1E 3O8BA 1XG5A 3RM3A 4UU7A 5EZYA 2R66A 2AC2A 2HPZA 1OXSC 4HZIA 4M1WA 4IOKA 4PWYA 4WERA 5BN5B 3UV3A 3TOZA 2KBFA 4QC2A 1V7ZA 5BNIA 1FC0A 3BORA 4ZT4A 3IAFA 3WQHA 5AJVB 3R5TA 4KWTA 4UHBA 3E81A 2OBFA 4M1ZA 3TQFA 4BB9A 1V43A 4E09A 5I5EA 3DYBA 4RVOA 2V59A 3GJYA 1BXGB 1FBTA 1BMDA 3MCZA 1VMDA 4CVNA 3ETDA 3K1AA 4IVNA 2W90A 1M1NA 2GAIA 3G9QA 5FPYA 4Y30A 3OLXA 1XEWY 2RSLA 3K72B 1BRMA 1H8HD 1FP4B 1HLFA 1Y1KE 3PE6A 4QT0A 4RORA 3DB1A 4G2TA 5ICFA 1C9MA 4WLEA 2X2FA 2P8JA 5DLYA 4GPAA 1GFIA 3F7MA 1VG0B 3REOA 4F4FA 3AOGA 2C2OA 4MIYA 3EH2A 1F06A 1LDMA 1K7EB 2WAMA 4U00A 3X1ZA 1KIFA 4LGCA 1AF7A 2QQGA 4LCJA 1GTG1 1XQWA 3VDNB 1YSCA 1MOSA 1KBOA 4QT4A 3RUPA 2FZ5A 1MNAA 3FGOA 2FP4A 4IV5A 4MS4A 5JDIA 5F23A 1KF0A 3FMVA 4OLFA 1M6VB 1X7HA 2JS7A 4G25A 2TMGA 4JDUA 1JJVA 3W8EA 1RYYA 4DUGD 3TLGB 3I2GA 4WOCA 5L45A 5ALOA 5CVEA 4AWAA 3JRWA 1Y8AA 3NJ8A 1FRQA 2BEVA 2ZRDA 4HXGA 3VZCA 1OA1A 4TV8A 5CMLA 4JB8A 4BNHA 1UKAA 1S3FA 4IRUB 2V96A 1E5XA 1T2UA 1X1BA 3GFQA 4DPKA 3OA2A 4KIUA 2JJMA 2FPRA 4I9GA 1C5KA 1PCXA 2C9BA 1MC1A 3GLHB 3FPGA 4NOJA 3DMNA 4E1VA 5H9WA 2GA8A 4KBGA 1Z8HA 1FFHA 3QTTA 1YKFA 3HDVA 4F4JA 3D7MA 3OECA 3OFVA 2TS1A 4PTYA 4MW5A 4XQGA 2FTKE 1FS5A 1BHJA 1O1YA 2IF2A 4NU6A 2XMGA 4X92A 3R6WA 1PL8A 2SKEA 1YV9A 4UDNA 4KR0A 5JNWA 1XC7A 1XQ1A 2H1FA 1BKYA 2PH3A 1IPFA 4AULA 1ESMA 4NMLA 1Z47A 4LTMA 1Z5UA 4Z3OA 1FTYA 4ER3A 4GECA 2QUKA 4P7JA 4KE9A 4GXTA 2R8BA 4KZKA 4ZXPA 1N2OA 5UKDA 2RHMA 5B4UA 3MTBA 3JQBA 1A8QA 4XGQA 3NNSA 4AJ1A 2FMXA 1MG0A 3GJ7A 4YRCA 3RYTC 3ILVA 3QITA 4A7PA 1GL3A 4CTKA 4HFJA 1XRNA 4W1SA 4RCYA 2I2BA 1EX9A 3ILSA 1CJCA 2KSQA 3HA5A 3OZXA 4L7QA 5E6UA 4I8XA 5H70A 5IX8A 4F5ZA 1L0BA 1O96B 3H13A 4RK1A 3II6X 3HKDA 5CT8A 4I14A 3LIIA 3RHSA 5IW8A 1RRPA 3ZLBA 3WIDA 2BFCA 1N33B 3OESA 4KRGA 5LZ9A 1KR2A 2JI6A 2IITA 5FPPA 3S7TA 3NGLA 1QE0A 1F3OA 3PDIB 1KAHA 4YPOA 2FGJA 1Z17A 4N3NA 4PHFA 4RY0A 1UOEA 2OL4A 2QU7A 4TSFD 4ZAGA 5EMJA 2O05A 3RYCB 4Z2AA 4PX5A 3BS4A 2H0QA 5ALMA 1GGKA 2WINI 4RZ3A 4P34A 3VR6H 1U2RA 2W4MA 1XP5A 2J85A 3DWEX 3ER9A 4OQDA 4R8SA 1L5WA 1X14A 1LK0A 3KSDO 3A6JA 5D01A 2BZ0A 3TR5A 4F9GA 3T1TA 1J5EB 2JIZA 4F5EA 4DVGA 10MHA 2ZM6B 1PAUA 4M9UA 5EYPA 1QRRA 3CE9A 3SEFA 4C9BA 1QDUA 2ZIWB 5HM6A 2H2HA 3PG5A 2CL5A 3ICOA 1NJ8A 4QDTA 5M34A 1H4VB 2P9HA 2KW5A 3RVLA 5FR2A 3NV7A 4LKOA 4TUYB 2Q4BA 4LDJA 1J9EA 2ODQA 1G42A 4DIBA 2PMFA 4EHNA 3M9LA 5KJ1A 3FWNA 4BNJA 3R77A 3DS8A 3H05A 4E5UA 2WW8A 3R5SA 4BUZA 2C5SA 4HHEA 2WFLA 3KWMA 1NUHA 4KR9A 4JT4A 1TCVA 4O4IF 3C2QA 1SVIA 1RCUA 2GRAA 3LUGA 3OZFA 4QLOA 5K0SA 1N8KA 1ZUHA 3BK1A 3MUOA 1U3FA 4GI2A 1OA0A 2FRXA 4UMEA 1WULS 3UMJA 2B30A 5B1SA 1T1RA 4A0QA 4NXNB 4ZHSA 2O54A 2Z6UA 4IIDA 1UOQA 3RT1A 5KWSA 1UJBA 4ETMA 4NFHA 4KO8A 1NUQA 1LI5A 1WZEA 3ESCA 4HWSA 4G5RA 1RZVA 1WKCA 3BFJA 3UB4A 3OZGA 2JD2A 5EJ2A 5JVDA 1H6DA 4PNHA 2HPVA 1ILWA 4H77A 4U7GA 4MWZA 4DQDA 2E5FA 3AUYA 3MCAA 1Q12A 1Z0AA 2CVFA 5HJ2A 3KU1A 4A82A 1CS0A 1BGWA 4Z7QB 1TI7A 3KYJB 1T6XA 2PTGA 1DEXA 1SK8A 1NJSA 3NBUA 4YO8A 4QPCA 1VMEA 2ERYA 1QTRA 3MERA 1K2VN 1OFGA 1V7QA 3AY7A 1J8QA 1MC5A 2YZGA 2KYRA 1BDJA 1N2JA 1I2DA 1ZW6A 3C3DA 3KQSA 4GQBA 5AJTA 2LP4Y 3CLUC 3ZS8A 2M1ZA 2H4XA 2IHBA 1LC0A 3AQIA 3AR2A 3E2IA 3KKKA 3PFGA 2BGTA 4FK8A 5DXJA 4RH1A 2V7GA 3EXEB 3O8OA 4WZAA 2GZ3A 1R0KA 1N2XA 1NW4A 1E2HA 3JYLA 3DM5A 3EGXB 5CP8A 3RC7A 1QUFA 1XN1A 1Z4IA 5EWJA 3E0QA 5DULA 3VM6A 3DXYA 5AHXA 1K88A 3JD1A 2NIPA 3JTEA 2QTGA 4PXAA 3RYHB 2WTBA 3BJIC 5B6IA 6PFKA 4RD4A 4YCLA 5EP1A 4RZQA 5CA1B 5LQAA 1WXDA 3IJPA 5JWRA 1WCYA 3NHRA 4J29A 5DIZA 1H5NA 1P77A 4IZIA 2HR1A 2QN2A 3RVSA 3BRWA 1QR2A 1LRJA 2VUHB 3GJ4A 4N65A 1FDOA 1R0LA 2XKJE 4O4HB 5AFSA 3DAFA 2DTXA 3K2IA 3QF4B 3ITNA 2D3TA 4M9CA 5LZ4A 4JQYA 3TAUA 3AKYA 3WOVA 1LLQA 1DAKA 3O47A 3CF0A 4HH1A 3Q5GA 4F1WA 1CRLA 3TFOA 2B8EA 3QVTA 4W63A 5AVYA 2IS4A 1PLJA 1NVVR 2R11A 2XNJA 2G25A 1KHHA 2TMDA 4D4JA 4EUFA 1XGKA 2YOFA 4AJNA 3P19A 4E2WA 3GDGA 5KNDD 2PO7A 4HYQA 4XYLA 3MQFA 4L8YA 3ZBQA 5EP2A 3PD0A 5IKPA 2OCYC 3M4YA 2Z5VA 1T26A 4MVJG 1XWIA 2GYYA 3D3QA 3K2QA 3SF8B 4O2BB 1NNSA 2AVDA 1Z8FA 2H59A 5C7LO 3KTFA 4X24A 1KGDA 1Y1RA 1E7QA 2G72A 2XVAA 1Y9ZA 3EQ7A 4ZA2A 5BSGA 4F6CA 2OHGA 2VWGA 2CJFA 3ORYA 4KWHA 5KHOC 1NLFA 4AJLA 4EG5A 1T5IA 1TF5A 2DYKA 2GSWA 5IDQA 3U7GA 4PS1A 3SZUA 2J33A 5BP7A 4DDHA 2P9BA 1SH7A 2RH9B 1V2GA 2EX0A 1L5RA 2PRZA 3I05A 4JR0A 1E4EA 4W99A 1U8YA 2QZ4A 1ORWA 2V97A 1BXZA 2NU8B 2Y1KA 1SBZA 1F1BA 1ZXBA 4LYFA 4R54A 4B33A 5HJ7A 4ZCQA 1FSPA 5LM3A 2J9FB 2QRUA 3L6RA 1FK8A 3R7NA 4BQPA 3IMFA 2NXWA 1GSHA 2ATIA 4DBLC 1HEYA 3A4IA 4QBFA 4RH0A 2HDNB 2Y1EA 4LDAA 2XNDA 2G82A 4G86A 3O73A 1OR8A 3HXPA 3UYKA 2RCNA 3DZDA 1MDBA 4P5EA 3SEQA 3D9QX 4D8XA 1DV1A 2H06A 3SS9X 3FTCA 5H5JA 1GAEO 1VJRA 4RTKA 3TOVA 4HWGA 1J90A 3GXOA 4Y7CA 3Q3HA 1NQTA 1N6OA 1QRDA 2QPTA 4JP2A 4FB5A 4YMLA 3GIDA 4O8CA 3GVIA 3JD4A 2PFGA 3A4LA 3QW2A 5BWOA 4MAAA 2TECE 4FN4A 1HDGO 4JLVA 3QHPA 2PA0A 1A0OA 1R27A 3CMMA 2WE8A 3HEBA 3RS3A 4EJSC 3FPSA 1MZVA 1UBJS 3VUFA 1RR6A 5LD2B 3RUCA 1PKEA 3A3OA 3I30X 5T3UA 2W70A 4HTAA 4LSGA 4J0FA 1F4PA 1ORRA 1RAEA 2FFAA 3W9YA 2LNDA 3E5MA 3CH7A 3GBPA 5HKAA 2ZVPX 1KDPA 1BVHA 1VE9A 2WB2A 1H6CA 3SIXA 1TRKA 4MYCA 4RE5A 1TA4A 3FDZB 2G4VA 3W3AD 2QAGC 5IN4A 3IUSA 3Q2OA 1C4OA 2DFVA 1KL7A 1GQFA 4I2NA 3SYKA 4H4CA 3VPFA 5A4JA 1O5IA 1CY7A 2NXCA 1E5TA 3PNBA 1Q3HA 2ZSEA 5JFOA 1MMFB 1YULA 3OEEA 1QQAA 1SUDA 3B7PA 3SS7X 2Q6IA 1U9CA 3VVCA 4QARA 2DBYA 1S7GA 1VI6A 1JBKA 3NPMA 4ZOQI 3HRHA 3W06A 4DR3B 1GPMA 3ZK7A 5J59A 2YHIB 3J80A 4RPKA 1RLIA 4OLHA 3SC2B 1FTSA 2E82A 3K5HA 1QV9A 3LVRE 1OKKA 3DONA 1I0ZA 4NK4A 5EGSA 3ZR4B 5C81A 1UBLS 1GQYA 4NDZA 4RIFA 4EG3A 4KQJA 1VCHA 1XKXA 5ALKA 1YJ5A 5IABA 3IXLA 1KEKA 2ZDGA 2XCSB 2AGVA 2VQ3A 2VPXA 3RD5A 1C0KA 3V7WA 2HH9A 1S2MA 4LWQA 2WFZA 5DSTA 4E88A 4XR9A 1TEXA 4FFMA 1JKMA 1CFJA 3FSRA 2CDRA 13PKA 3BDVA 1R64A 3BUSA 3JASB 3DYVA 4OX9Y 3JQ9A 3JWGA 4S2UA 2VSFA 3UUWA 2PIDA 2XNCA 3H42B 4Z1MA 3RVQA 1KMIY 4N5HX 3P9SA 1KMHA 3DFFA 4XSVA 1RKVA 3C7KA 4FILA 4BNIA 1VIVA 2E55A 2B7LA 4Q19A 4XGIA 4FI3C 3SHFA 3OTWA 3DWIA 2CE7A 3G17A 1CQIA 3P0FA 2TRSB 4ZCMA 1IY1A 2FE4A 1OXKB 3D1JA 5BMVB 2F6RA 3P0RA 1FZTA 3JY6A 5AUNB 3D6TB 3GT7A 3TUJC 3RAGA 3KKEA 2Y3IA 2E9SA 2GPAA 3IAEA 4UUOA 2Y9PB 3OTIA 4YIKA 5DYIA 4ZAFA 3RFXA 3WX0A 1EUYA 4LVUA 4AJ4A 3DEIA 5TDHA 1MU0A 1PP4A 2YBEA 1PWYE 4M8NE 2ZYDA 4U6QA 1TK2A 2BTQB 2C1EA 1UK6A 3LY5A 1Z22A 3WIOA 3TQHA 4UE2A 3SQXA 4ES6A 1KZ6A 4WZBA 5LBTA 3TCKA 2GSDA 3LYAA 5BSWA 2G5CA 9MHTA 3HCFA 5CJ2A 1TUEA 2WLSA 3JCZA 4MYSA 2HK8A 4GKVA 2NXNA 3EXG1 4ER5A 2UUCB 3LT2A 2EKQA 3HVUA 4PONA 3HNPA 4L0CA 3D3EA 1LW7A 1YS6A 1IJBA 1R4MA 3MTGA 4WCFA 1VBNA 4CV2A 5AW5A 1BZYA 1T1JA 2DQZA 2JRLA 1KI4A 3SFZA 4EHKA 4YAIA 3DE3X 4HC4A 3COJA 3VHLB 4G1VA 2QLFA 2XVYA 2NO7A 1DX4A 1ICEA 1J7KA 3ZWDA 3PF8A 3QVVA 5EYPB 1RZUA 9LDBA 1D04A 1YACA 2JJ2A 2YMQA 4B9EA 1N5JA 3SZRA 1DEAA 1SHTX 4J0JA 4C4XA 2VHUA 4H18A 4NLLA 1D6NA 1NTOA 1PEAA 1VL0A 4N8DA 4NYJQ 3TLCA 3N76A 4PAGA 3CCCA 2ZBGA 3LTEA 4UNNA 4X93A 4QUKA 2V4ZA 1VBFA 4N5IX 4YJ3B 4F45A 2EDAA 3ZCRA 5I4BA 2VOEA 1ANKA 4I50A 3MJEA 3U7IA 1TYBE 5EEGA 4N8SA 1Z73A 4Q9KA 5KNBH 4AUMA 4RD2A 2GJ4A 4M76B 1FRZA 4G65A 1VPDA 1FCJA 3NU1A 1BD4A 4P58A 4PLVA 5EKXA 5BYJA 4NZZA 3DTVD 1TZKA 3SMQA 1K4MA 3WRXA 1Z33A 4G5FA 1F9EA 2JAHA 3F5FA 3QVLA 3E5RA 5ECYA 3QWAA 1A04A 2GJKA 4NU0A 4ESVA 2RHHA 3EFEA 5F2OA 1GKKA 2YCBA 3SK0A 4IIYA 5AVQA 4B3RB 4HWKA 4ZYUA 1IB0A 2VDKB 4E5PA 2P9EA 3HU5A 4DV4B 1AKQA 2NGRA 2F8SA 2IT1A 3O5AA 5JE8A 4F2WA 5CFRA 4UARA 3HN7A 4Q9LA 4NENA 1U0BB 3I2JA 2XZDA 1NY5A 4URXR 4G41A 1KKUA 4QD3A 1KVSA 3ISVA 4KMSA 2FZVA 5ICGA 2FPXA 1BGXT 3KKOA 3LCVB 1DQYA 3KDPA 3OCYA 3PEVA 4LNUA 4ZVPA 3P9CA 3W1WA 5CFZA 1NMXA 4QVIA 3TTYA 1ISRA 2AC7A 4C4OA 1G20A 1CEEA 2BFBA 2BR4A 3PT5A 1SUAA 3LH5A 2EW8A 2GO1A 2FSSA 4OIFA 4QU8A 1QRUA 4AI6A 1LVUA 1Q57A 1V11B 3PFIA 5T4HA 4IZOA 3NM6B 1DZ3A 2PU7A 3QNUA 1MAAA 3S68A 2ZUUA 4MO9A 5JXIA 4M4SA 1AV7A 3ILYA 2K6GA 2DPYA 5AUQA 3NRCA 1W1IA 1GZ5A 1OFIA 3MOGA 1LPAB 1YR1A 3D6HA 3L6OO 4TQAA 1HSZA 4GBMA 3ZKWB 2B25A 4CNBA 3JWEA 4M0PA 2ZSBA 4DV5B 4CG0A 4HJRA 2ID8A 3MD9A 4RH3A 5TF4A 4C22A 1JJFA 1VKOA 2A3NA 4TYYA 3HJBA 4FGKA 1FUUA 1YRWA 3QM1A 2B0JA 1U8FO 2H1SA 2H2GA 2P6NA 1OLOA 2ZYTX 4R2KA 1GU0A 3OU7A 4OHVA 2WA1A 4OK3A 4BMPB 1U7UA 4PXSA 1RAAA 4YB8A 3KYDB 3M9WA 1M1YE 4CQMD 4JJ6A 2WNSA 4DIFA 4QRDA 1U0FA 2FVYA 2WF6A 5H81A 1U80A 5G3YA 3F71A 4DB4A 5F2EA 4KE6A 5ESDA 4K9RA 5L3VA 2AWNA 2FR8A 2BJHA 2HPHA 5MF6A 2MTBA 5FOUA 1GG5A 1GTMA 4INAA 3GV0A 4TTTS 1AHPA 4ZTUB 1NT4A 1SXJD 1G0NA 3PZRA 1ULTA 1DADA 4Y9DA 4EQ6A 3N70A 1JECA 2V8OA 3D3NA 3SJZA 5CIYA 3MRVA 2BDTA 2VXBA 4P08A 3P27A 4J6EA 5B2EA 3GDHA 3R3XA 1E1CB 3JR7A 3TR6A 1GFSA 3UUEA 1G8YA 3MF4A 1FU8A 3OPYB 4YDSA 3RI3A 3HJTA 3SZOA 3TRKA 4JBXA 5JS8A 2AMLA 3BHJA 4FYXA 1N3BA 4WJKB 1UC9A 4H6WA 3IA2A 1CDOA 3JD3A 2IDMA 2ZXEA 4Q02A 4EYOA 2JASA 4ITUA 3FWYA 1P2BA 3GRAA 3K0CA 4AG6A 1QAOA 1QDLB 2HJRA 3ZE2B 2A4MA 1EH5A 1D9XA 3PGXA 4B6QA 4MVJI 5LKRA 3F4LA 5AOCA 2IUYA 1IOZA 2GN2A 4IOLA 4JBIA 3PHBE 3WP1B 2AK2A 3G7SA 5HFNA 2C42A 3R5FA 4MVJF 4QDJA 3OPQA 1Z0FA 1MVLA 4OUDB 4UD2A 2JIPA 1JHRA 1XEWX 3L7JA 5FRDA 2BTEA 2B8NA 1P1IA 2Q5QA 2R8YA 2GXQA 1LTKA 2A59A 2Q0SA 4K8OA 2OCKA 3JPYA 3K7EA 4GOOD 4I4TB 4DLUA 5ECGC 2BDUA 1U0NA 4HEA1 2ZBQA 2X0NA 3BOSA 4Z9XA 1L3CA 3IV6A 1K3UB 2H2DA 1V8ZA 1H2RS 4E4RA 4WH0A 1CB7A 1NVMB 3ZDXB 2XNSA 3ZCTA 1I2CA 5F9HA 5L4NA 1XZHA 1MLDA 1Q92A 2YXLA 4RVCA 1CQJB 5TVKA 5LQDA 5BMVF 3HY3A 3KQLA 4KXQA 4RS3A 3VR5A 3W79A 1EZ4A 4QWWA 1ECGA 2VNJA 1I7LA 1HFEL 1XU4A 2WD9A 5DK4A 3L4EA 1NKSA 2VTVA 2AHRA 3LUDA 3DOIA 1PR5A 4RYLA 3DT6A 5DGXA 4N9WA 3IMKA 1QX4A 1M2OB 2Y0BA 5EJAA 1YRLA 3RS0A 1O94C 4NYJR 5A6SB 1II8A 2JJ1A 1Z4OA 3I32A 2OBNA 4H7KA 1LJLA 4DCPA 4LJYA 1BX3A 2PT6A 2XYRA 1UPCA 3IKMB 1EFRD 5DPMA 3C3YA 3ENWA 4J16C 1FFCA 1HE4A 3P1JA 1KU0A 4TMWA 2Q50A 2C3YA 1GPWB 3JRNA 4QBGB 3VX3A 2COEA 3C7DB 4LRYA 4XAQA 2Z8ZA 2GBPA 2XRMA 3B6ZA 3PE4A 5CLFA 1EQ2A 2EJWA 2AX3A 3COZA 3QH4A 1MT3A 2NNLD 1BS2A 3SVZA 1YT5A 2W6QA 3BRSA 4FZ5A 4H7PA 1NC1A 1TT7A 1WZUA 4MSUA 2H1IA 1O87A 3AI7A 3WGKA 3ZDZB 1U8XX 4HLNA 1O95A 1DWOA 3N05A 4NH0A 4QFCA 1QQ7A 4IAOA 5SYMA 3WL8A 3STHA 3HU1A 1WRBA 2R8RA 2IUFA 2HMSA 2VPZA 1DUSA 3ONVA 3P2KA 4GAEA 3HO8A 1HQCA 5AOBA 3ZGZA 1QYIA 1QXSA 4Z86A 4TRRA 4LHWA 1Y9JA 1RKXA 2BI7A 3NASA 5GONF 3ZWMA 4I5FA 2O2DA 4GX1A 1KO5A 3TE7A 2QSUA 1ISSA 2DZDA 2IP2A 3Q6IA 4YGXB 4EGSA 1PT5A 4BB0A 1T9BA 2ETXA 2NW6A 3L46A 1YB4A 3G5TA 3JQRA 1N5OX 4OQYA 4F4HA 1H4SA 3UMBA 3HMQA 5JDIC 2IHZA 3DO6A 2WHXA 1O08A 3FKQA 4MK4A 3UKJA 3CLHA 2H07A 1WHTA 1SVMA 1Z06A 2IXEA 4NJMB 2EARA 2JGNA 3DPSA 5IDXA 4Z7NB 2QQ0A 1SKYB 3NIBA 1L5NA 5LQNA 3Q11A 1QGZA 1ZGBA 4L4ZA 1O94A 1SEVA 1JTVA 3HCNA 4DMRA 1LJUA 2CKDA 4JVNA 3ZD7A 3KC2A 3KXKA 1KQGA 2QXYA 4D43A 3L0YA 1A9RA 3O4FA 4EA6A 1Q7CA 1ESEA 3CNLA 4MCHA 4BRUA 1F14A 2O7VA 3PDHA 3UAGA 1PSZA 2EFDB 2CY0A 2UV8A 4R1UA 3UH0A 3UK7A 5ILOA 3SAJA 2A67A 2B37A 4ZYXA 4Q1AA 1CBUA 4ZP1A 1XCGB 3RV3A 1DKOA 2BKXA 5E1OA 5KX5B 2QGZA 3VA7A 4A03A 3MIIA 1ZH6A 4KRFA 4BP9A 5AUOB 5A4MS 2ZBEA 4V1CI 4QEDA 1XQ6A 2R0QC 2OLKA 1TU0A 1V7PC 1QAQA 1TJPB 2RBKA 2YMMA 2BFFA 2E4XA 3QV2A 5DM1A 5DYTA 4HJXA 3N6RA 8GPBA 5IBRA 3DO8A 4ZKDA 1Y9AA 3VR3A 3P94A 4JYZA 4ETNA 121PA 2GR9A 3USCS 1RD4A 1R0WA 1VLQA 4OJKA 1QSGA 3T0FA 5FBVB 4EQ6B 3DAHA 1BH6A 1MHPA 3GRRA 4D9NA 3ZNOA 3C8DA 4FFWA 1O97C 3E5NA 1NVUQ 1N36B 4IJQA 5M29A 2AWOA 5AJUA 2QJRA 1F8FA 1XXHA 1WW2A 2EF0A 1Y5MA 1GQQA 5ARBA 3SX0A 1IM8A 4EHJA 5AW1A 3AJ9A 1JVBA 3DKVA 1IXZA 2I3BA 2JGIA 1AKWA 3FOCA 4NONA 1Q1GA 2ZE5A 4YI5A 2RD2A 3DFUA 3HJNA 4HB2A 3EWNA 2M6SA 4OG2A 5BW5A 1GUDA 4YJ3F 2XZOA 1QLHA 1SBNE 2VYND 3O4JA 3MMSA 1YD7A 1ZESA 4ICIA 2UXBB 4HFMA 4IH1A 1DTWB 5CUQA 5J4KA 2HCJB 3CSUA 2HT1A 4K9NA 3H9UA 3UWKA 1HKHA 1KO4A 5KSZA 3QE9Y 3AKCA 3LK7A 4ZT5A 4CMKA 2OORC 5IJ9B 1IRIA 3VO9A 2XYHA 4HNTA 4FFBB 5BSHA 2WFAA 3OZWA 1IY0A 1Q84A 1ABFA 2P5SA 3DJFA 3EDMA 1G18A 2AZTA 3LO8A 4PZYA 4WASA 4Y0AA 1ILEA 2YN0A 4C2TA 4DA0A 2GI4A 3N86A 1U7DA 4YRNA 3Q6NA 1JSXA 5IAGA 2IPNA 2VJAA 2NSDA 3FN4A 5F52A 4PXYA 3M49A 4KQHA 5JD6A 3HDQA 2ZI3A 4JBHA 2ZRNA 1AB6A 3CY6A 5A0FA 3WGJA 3LE8A 5GZ6A 3UV6A 3HJAA 3WYCA 4RZHA 1SD2A 2PMCA 3U0VA 5F5XA 4HAXA 5CDFE 2FETA 4MKRA 1OILA 3RABA 1A9PA 4FLMA 2X0EA 4Z3DA 5L51A 2X0KA 3G2JA 3I2FA 5GJWC 1T6NA 1O6ZA 4ZI7B 3O90A 1CX9B 3CE6A 3EOBI 1LX7A 1EGAA 1FMJA 1SRQA 1VL5A 2WWXA 3DCJA 4OSEA 5EHZA 4XB2A 5EAIA 2CLKB 2C5EA 3FNIA 4YJGB 5FA6A 2WWVD 3DV0B 5J1TB 1DKMA 3BTVA 4WLFA 3G0CA 2GK3A 2ZRJA 4RK7A 2EBUA 5CTAA 3HV2A 3OCXA 3E27A 3MLBA 1WY7A 4IHJF 1N6IA 1TGVA 2PGAA 3EGCA 3MYRA 2P2GA 2OK8A 5C1IA 2ZR7A 4C6RA 2WQ7A 2NZWA 1TYDE 2RG7A 3H1PA 1RBZA 3EZ9A 2VFAA 1DE0A 3CX7A 4I5GA 4AJJA 4JBNA 4RX1A 3DDWA 3WWPA 3RIEA 1GXSB 3H2IA 3WHKA 3TEFA 3K6SA 1E7SA 1JNYA 2EW1A 4CKXA 3V9PA 3GRPA 2PV0A 2PCLA 1KU6A 4XVHA 5JNLA 1T15A 3X1WA 2JPDA 4R9RA 1P9RA 5EJ6A 2OXFA 1B1AA 3OCJA 1GHTA 2XB6A 2Q8QA 2IIQA 4FKBA 1LDGA 1G41A 3GZNA 4WBNF 4YCAA 5HR5A 3K0AB 4H35A 4Z8YA 3T4XA 4NVRA 2HLDA 1IVSA 2WVAA 4TWJA 5EWLB 1OI2A 1MRZA 3PNSA 4TLDA 1YE8A 3LCJA 4RQAA 2RHRA 4MYUA 3PRHA 1CZKA 4FYKA 3O4VA 4IHJB 4YQEA 1FX1A 1WOMA 2AXQA 5EE0A 5JOQA 2X1LA 3LUKA 5ER9A 4P80A 4OXIA 1ZVKA 5AKYA 1NBAA 4N0EA 1CDZA 4CDRA 3KKQA 1G63A 2BUAA 2EFCB 2JVJA 3ODGA 2YIMA 5AI0A 1AQUA 1B2RA 2IYRA 4NYMQ 3STUA 2DTEA 2JAQA 1ZDMA 4TT3A 2OCAA 4HQOA 3A6GA 4CV1A 1C81A 1ZNXA 1OWMA 1R37A 1RM0A 2XDWA 2FSFA 1H5QA 1JBEA 2B3TA 2FSUA 2I8LA 1W0KD 3HKCA 3ETLA 3W4KA 1ZOLA 2C8KA 2WJ4A 1ZEMA 1XDDA 1PHRA 2GLUA 5DU2A 4ZEWA 1ZM4A 1WZCA 2ZRIA 1B93A 1R4ZA 4CUZA 1M0SA 2C8JA 1CC1S 1CY4A 1DO2A 1N2CE 1HURA 3PQCA 4UUMA 3TZQA 4B43A 5C4MA 4JXJA 1EAMA 3KSUA 5BRJA 5DI9A 3F4BA 4ZU6X 3RSGA 3GD5A 3T3MB 5LKAA 2EL9A 2HFKA 4QYIB 2WF9A 2WM8A 3ZHRA 1Q0QA 1NOJA 1KFEB 4RMJA 3U5TA 1JALA 4XVQA 5C7YA 1HTBA 1MB0A 1G20E 1YI8A 2BFMA 1UXKA 1ZU5A 4CCYB 2NLOA 4CUJA 2ZRCA 3EA4A 1W7AA 3SNHA 4CQMA 3MW8A 4EDHA 1D2HA 4PQGA 1R12A 3IAM1 4J1TA 3F5DA 5AVUA 2C0PA 3WSTA 4BVKA 4Z53A 2X2OA 3PQDA 2P2CA 3RSOA 4U39A 1PLKA 2EEZA 4UM8B 4DHWA 4QWMA 1HRDA 1LTQA 1OV4A 4N03A 4L8WB 1P3DA 4UUQA 4LC0A 1O0BA 3H5LA 3DBIA 1NOKA 1XDUA 3LUBA 1RXUA 3R3WA 4Y8VA 4YAFA 1GNVA 4I6JA 4CR6A 1KZ9A 3LWZA 3NALA 5DYWA 3IFSA 4JEIA 3ZPXA 5HX7A 1NMYA 2R60A 3Q0EA 1WL8A 3T9AA 2QN9A 2FN4A 4BYGA 3G8DA 4UCXA 4BLUA 4DAEA 5IYZA 1R9NA 3ZJUA 1G8FA 1KYQA 2DPGA 1YR7A 4A8HA 4R1NA 3RSZA 2FR1A 3T94A 1MUUA 2QTZA 4HDCA 3TIIA 5LU9A 3ZJTA 1ZZGA 1I4DD 2JFQA 2IY8A 4LXXA 4PO3X 3GMDA 3G9TA 4Z99A 3NHYA 2JHFA 1G5HA 1SUEA 3FCEA 3BF7A 3LY7A 5JD4A 2PAFA 3NM5A 3QEOA 1VA5A 3FOAA 4NYMR 4O3FA 4JVMA 3ED1A 1NMSA 4Q21A 5F78A 3VYUB 1ECBA 3FI0A 4Y2TA 4IVPA 3HXMA 1P5RA 4P22A 3V46A 3F3YA 4EJSB 1XMPA 1RM3A 1FFXB 4LC1A 2XA1A 2QT1A 3FB4A 3L0DA 3LT0A 5THXA 3S55A 4X66B 3EISA 5I7EA 5F33A 3DT8A 2H1VA 3TQTA 2ZIZA 2CXOA 4IIGA 2Q8PA 1OBHA 1EBUA 2KPOA 2GNAA 4W1QA 5NLLA 4FZRA 2VDWB 3IJ5A 4NL4H 2Z0MA 2HWKA 3BH0A 4OQEA 4Q4AA 4RD6A 4AJIA 5I3CA 3AGPA 4KQKA 5K3EA 2QAGB 3TGLA 2PD4A 3ZE1B 4PNPA 2P1DA 3K8YA 1RADA 4MWGA 1V1MA 4JI8B 3ZBPA 1OZHA 3UG6A 2GWHA 1ZNQO 4WJZA 4EL0A 1RTTA 2FW9A 1JA9A 2J87A 4IMPA 4ZI7F 3I73A 3W8NA 2XNKA 1H22A 1YRAA 3A7EA 1D2GA 3CC8A 3MT0A 3NC1C 3WYEA 5JEEA 2X7JA 5FT9A 1DAFA 1KOJA 2QKYA 1HL3A 4MDHA 2JJ1D