2WDPA

Crystal structure of ligand free human caspase-6
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
263
structure length
224
Chain Sequence
FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVPSAIGKKQVPCFASMLTKKLHFFPKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-6
publication title The Crystal Structure of Caspase-6, a Selective Effector of Axonal Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 224
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wdpA00
1NMEA 5LUBA 3EDQA 2H65A 5IBPA 1RHRA 4ZVOA 4AWAA 3D6MA 3R7SA 2CNLA 3S70A 3V6LA 3NKFA 4QU8A 2FUNB 2Y0BA 3D6HA 4ZVSA 4D3XA 1SC4A 4DCJA 3S8EA 3H0EA 4JQZA 1RWXA 2XYPA 3BIJA 4QUHA 1RWWA 4I1PA 3DEJA 2C2KA 2H48A 2HBYA 3OD5A 4NOKA 3D6FA 1NMQA 4FXOA 4NOJA 4N7MA 2H51A 5IAKA 4NBKA 3V3KA 4AWBA 4D3ZA 4JJEA 5IAEA 4EHHA 3V6MA 1QDUA 2C1EA 3GJTA 1RWKA 3KJQA 1RHQA 1SHLA 3KJFA 5IAJA 1I4OA 3K7EA 4ZVRA 4ZVPA 2CNNA 5IBCA 3IBFA 3DEKA 2AR9A 2H54A 2NN3C 4HQ0A 2CDRA 4QU9A 2CJYA 3KJNA 4JR0A 4PS1A 2H4YA 4N6OA 2XZTA 2HBRA 5JFTA 2HBQA 1PYOA 4LSZA 5IBRA 4EHNA 4PRYA 4JR2A 4N6GA 1CP3A 2J30A 5IAGA 1GFWA 3PD1A 4JQYA 1SC1A 2HBZA 3R7NA 3P4UA 3SIPA 4EHDA 1K88A 3H13A 3ITNA 4FEAA 4HQRA 4AW9A 2FQQA 2J31A 3GJRA 1SC3A 3GJSA 4QUAA 4DCOA 1QX3A 1CVRA 1M72A 2CNOA 4HVAA 2H4WA 2P2CA 5K20A 1JXQA 4JJ8A 4QULA 3NS7A 5LUAA 1RWPA 2Y1LA 2FP3A 4QUIA 1F1JA 3V4OA 1SHJA 3RJMA 1RHKA 1I4EB 1GQFA 1RE1A 4DCPA 4QUBA 2H5IA 2J32A 2QLFA 3PCXA 1RHMA 4EHKA 4NBLA 1RWNA 1RWOA 3R7BA 2QL7A 3R6LA 4NOMA 1RWVA 5I9TA 1NW9B 4I1RA 4NOLA 4QU5A 2WDPA 1I51A 2XYHA 3EDRA 4PRZA 4QUJA 5IASA 5LU8A 4EHFA 1BMQA 1I3OA 1IBCA 4JR1A 3UO8B 3V4LA 3H11B 2K7ZA 3H11A 4M9RA 3P45A 2CNKA 1NMSA 3R5KA 5H0IA 5IC6A 4N7JA 2CJXA 3R5JA 5IANA 1RHJA 4QU0A 1RHUA 5IC4A 2XZDA 2QLJA 3E4CA 4JB8A 4JJ7A 1ICEA 4N6NA 3SIRA 4EHAA 4EHLA 2J33A 4PS0A 4EJFA 3DEIA 1PAUA 4IYRA 4QUEA 4ZVUA 1F9EA 1KMCA 3QNWA 2C2OA 2XYGA 5I9BA 1QTNA 4QTXA 4QUDA 2H5JA 4IEFB 1RWMA 3GJQA 3IBCA 4ZVTA 2DKOA 2QL9A 5LU9A 3UOAB 3R6GA 4ZVQA 2QLBA 5IABA 4FGUA 2C2MA 4FDLA 4QUGA 2C2ZA 3H1PA 5IARA 2QL5A 3V55A 4D3YA 4QTYA 3NR2A 4N5DA 1K86A 3DEHA 3PD0A 4NBNA
chains in the Genus database with same CATH superfamily
4ZO6A 2AWNA 3LCRA 3A9CA 1WO8A 2R87A 2ZJ5A 1F2UA 4KOAA 4QU8A 5CH3A 4XOUA 2BONA 1QGAA 1DKLA 821PA 1V8DA 4IJQA 3K30A 5AI9A 1CW2B 5DLDA 2B8EA 16PKA 3K9GA 1EM8B 5CM8B 3O8BA 4YT2A 5KTSA 2QRLA 4ADSG 1AKTA 1AT1A 3BRSA 4IIJA 4KVZA 4R5HA 1RXVA 1E0KA 4YJKA 1E92A 1EJ6A 3B3JA 3VU1A 4Q3OA 4AJJA 1UXKA 3IP7A 3ISJA 1FLDA 3AEUA 3OIFA 2GA9A 4J0QA 5GJBA 3T4PA 4HB4A 3DUFB 5EWMA 5LLDA 2PUJA 2X7HA 3UAVA 3KEMA 1ZONA 4NBTA 3G7NA 5BNTA 2FRDA 1CF2O 2WKSA 2A5GA 4MI6A 3RFTA 2ODWA 3VH4A 4GZ6A 4O4HB 2XTMA 1W52X 1ESZA 2UZ1A 3BOSA 3CH7A 3FF1A 3KJNA 1JFRA 4GR4A 1DFIA 5IVKA 1PNRA 4PPNA 1KJZA 2BFDA 1E2NA 4B84A 4F1JA 5JJ5A 3RHSA 4A0GA 1NUHA 4D8VA 1Y5NA 2VOEA 2UVQA 2HMVA 3OX4A 4EGFA 2AMYA 2VF7A 1TAQA 4G1EB 5IAGA 4TLCA 3D6VA 5EQJB 5AVZA 3HKEB 1SC1A 4TTJA 1JSZA 5KTRA 2Y1OA 2D5IA 1GUBA 1KS9A 1PJ4A 2G17A 2J7PA 2VBIA 2ALJA 2ZVJA 3LUFA 1E2DA 4FVTA 2V1UA 2C1XA 5AUQA 1XTVA 2ZR9A 2HPZA 3HQ4O 5JW6A 1OB2A 1J06A 5B7PA 2QGFA 3M81A 3QHAA 4J2HA 4MGZR 3RUAA 4HWKA 3T7KA 3ZDFA 1L6IA 4NTZA 4QXRA 4XRRA 5TV2A 1O94A 2Q0SA 4EPXA 1CUEA 1V8PA 2ECOA 2XB9A 4ZAZA 3L5OA 2Y0CA 3B9PA 1QFMA 3CN9A 1MT3A 2JFWA 2CFSA 1XCBA 3KEOA 3PHHA 2IHUA 1P6XA 4X1IA 5K8LA 3LQQA 4U0KA 2AFVA 3ZJYA 3I72A 2BMFA 2Z9DA 1V1JA 1VBNA 3LGSA 1Z2AA 3PUXA 3A6JA 2O0JA 2XSZD 4K05A 1BH6A 4PX2A 3E70C 4RL6A 5DYWA 3D8BA 3U31A 4P4LA 3DD5A 4PGGA 4Q4HA 5EEGA 2EJUA 3RRMA 5FKJA 1MZPA 2D1QA 1OLUA 5EWLB 5JI2E 2A9QA 2HDNB 3I9OA 4HDNA 4MKIA 2FSPA 4H3VA 2YINC 5AKXA 5CDGA 3KOOA 4ARIA 4NMLA 1FA9A 4QFMA 4FFBB 2HIAA 1AQ6A 3WNQA 4JI0B 3JPWA 1Q2UA 2PYDA 4KH0A 2YXBA 4ZA2A 2ZRJA 4YMVA 5KOJB 2IS4A 1FL9A 1TCUA 2OO7A 2P0EA 4A8HA 2R1TA 2VHZA 4GWKA 4RK5A 4BUZA 1UBFA 4NY1A 2HLHA 4TTIA 4AY6A 5A0TA 3ZK9A 2B1RA 2HRZA 1S3SA 2QTVA 3ND8A 4RABA 5BY2A 1TEVA 5EXSA 2NZYA 1KMQA 1UZAA 1R5NA 3BB4A 4G0NA 3ZHUA 3C8MA 4U3JA 4EGSA 5EJEA 4D9EA 1Y9DA 1J0BA 2B20A 3ITEA 1NL3A 3AL2A 3B9RA 2XUIA 3EXHC 3D64A 3A70A 3QE9Y 5KYYB 3NTRA 2PR7A 3X3HA 1EZZA 5J1TB 1C50A 1PUXA 1Q12A 2UYYA 5AM4A 3UJCA 3WDSA 5I7EA 5DNYB 4GGPA 1TZJA 2CXXA 4Q37A 4PFJA 1BDMA 2C2ZA 1MNAA 4FYYA 2DBZA 3USES 5AI5A 1C80A 4C2BA 1B8PA 3AY0A 2ARKA 3PUVA 1FYDA 1KBZA 4PW0A 1I8TA 4KR2A 1TX4B 1M2VB 1OREA 8OHMA 5A3JA 3UJ8A 1L4BA 3OZGA 5FWXA 1EM6A 5CB4A 4XYLA 1G8AA 4UPEA 3EZYA 3QEJA 1Q50A 4W5JA 1HT3A 1CR6A 1XOIA 2A1TS 3Q8WA 4NBKA 2HW8A 1AHIA 3HN6A 1C3LA 2SECE 1E4VA 4P5DA 3OWOA 4ZQFA 1JPNA 1OFIA 4L27A 4XFJA 1RAHA 2VYNA 1RRFA 5CT5A 2M6SA 2A9KA 1Y6GA 1O0SA 1R9GA 1ZD3A 1ZM9A 2QE7A 2O5RA 1TL7C 1WD7A 3Q2OA 4M99A 4QICA 4WN9A 1PBTA 2GZRA 2JW5A 3O3CA 4I6JA 3T5DA 5DWQA 3WLRA 2J9ZB 1HE2A 1ZD2P 4M8SA 1K7YA 3RSOA 1OY1A 4KIFA 3FOAA 1BNCA 2QLNA 4R16A 1N3LA 3MD0A 1UQUA 5KQPA 1DEOA 5ALLA 4F2GA 3NMUF 1GL6A 2QF7A 4HBZA 3W8DA 3F46A 3IRVA 3P2MA 1YA4A 2YIMA 3H4IA 5A3SA 1G3QA 1MJGA 1UMBA 4UVDA 3STTA 2GHQA 3T35A 1JLSA 4KIUA 5IS2A 2V0GA 1JKXA 3EAFA 5JAZA 2H31A 1E69A 2NX2A 2CNOA 2GNPA 4F9EA 5BRJA 5K6AA 1YQWA 3KQKA 3ZDXB 1L8XA 1PJLA 2OM6A 3UV6A 3GFTA 1I2ZA 2AZ4A 2G5CA 1DADA 1CY8A 5B30A 2FUG1 4F7WA 1RCUA 1N8NA 1V8BA 3PA6A 2G5GX 3VTFA 4CIXA 3ZDAA 4D5EA 3THWA 3R5XA 4NBLA 5GVRA 4LJAA 4AMUA 2VS1A 5CUQA 3ZWAA 4CLEA 1FQKA 3AI3A 1NJ8A 3O2SB 4FQ7A 1X39A 2YJ4A 2ZBFA 3CPEA 4YNBA 4XUGB 1ESMA 1HC7A 2ZDQA 4HD8A 1EG7A 4R9VA 5ENZA 2PUDA 3DOCA 4A82A 1J21A 5D6OA 4JLVA 4JLBA 4W1PA 5LJLA 1ZI6A 1HX7A 3R77A 4RJ2A 4HS4A 4MLDA 2YVUA 1DQPA 2PAAA 2X0DA 4TZ6A 1QUFA 3WMWA 2MJLA 2QJFA 4MP8A 1C1HA 1EX1A 4C3OB 3OZXA 3V2UA 2ATCA 2CNKA 3NEJA 4ISBA 4Z4EA 1QYVA 5AK5A 2FUG6 4B6RA 1A76A 4KPEC 4FOTA 3HCBA 3A1NA 2PQ6A 3M1AA 3T06B 2AEMA 5A3RA 5AUNB 8LDHA 3F4LA 2I9KA 1AG9A 4ZXFA 1AZTA 2B5WA 2F7SA 3BGOS 3DEIA 3IHWA 4JXZA 5IDWA 3AF5A 1F12A 1LBHA 3LC0A 3LECA 4PHCA 4QTXA 3HYNA 3LA6A 2NSJA 2IZ5A 2I4RA 3EXHA 1LV7A 1V6CA 1THMA 5LYJA 2B61A 2FMXA 4ZZIA 3Q0EA 3OOEA 1LSJA 2P9HA 2XD4A 4Z49A 4HJXA 4RIHA 1JHAA 5ARCA 3UCXA 1L9XA 4GLOA 3WYFA 5JH7B 2M6KA 5DBFA 1BXRB 2VAMA 4N41A 1Y7PA 1NW8A 2C42A 1N5RA 2JFUA 1EJBA 4H1TA 4U7PB 4FMBB 3UW1A 1Y4DE 3EJ6A 4FT2A 1K7FB 3H0EA 5C5IA 5J4VA 3DAPA 2DFPA 3HI4A 4AX4A 2CFCA 3LUHA 3ZGYA 1P6QA 2BC9A 4ICIA 4Y0AA 3KQLA 1GRNA 4G6ZA 4AF6A 1RW4A 3KSDO 4KN6A 4INAA 1TC2A 3JSAA 3P9ZA 4BX3A 4W5QA 1N0UA 4R84A 3GGPA 3RYTC 4OXNA 4O4IB 4CLOB 2YVLA 4DRXB 3ZOKA 3E1KA 4IAOA 2OAP1 1X1RA 2PZGA 3ZCTA 2PHZA 2ZSIA 5KC8A 3E03A 1NKSA 3JQFC 4FCCA 4BCDA 5B3AA 5K8IA 2CWDA 1XSEA 3L8YA 2BFFA 1XNHA 1U0JA 4PZUA 1AX9A 3BXEA 1W88B 3H3JA 1BU5A 3G2IA 2BMJA 3SEQA 2WKWA 3RM3A 3SYLA 1PYOA 1HYGA 1TZMA 3F47A 4V03A 1SELA 4JZYA 2QP4A 2CHEA 2FX3A 2I67A 3A6FA 2NXNA 3DE0X 4J03A 3P0RA 3FDZB 5C1PA 3RH0A 5D2CA 1R3UA 4FMDF 4FX5A 4KX3A 2W6IA 1ZIYA 3G59A 3GYGA 4UATA 4YJ3A 4EAQA 2ZYHA 3D2BA 5KQLA 3AERB 4UZEA 5TJHA 1ANKA 2W2XA 3O8DA 3U9SA 3EIQA 3ZWNA 2P9TA 1YGYA 1JYEA 2JD1A 4HNGA 4NCNA 3SE7A 3L7AA 4PAWA 4URHA 2FKNA 4I7EA 4TKZA 3RAPR 1L8LA 4MRRA 3UTCA 4RE5A 2RJ3A 1AUOA 1EDOA 5CLHA 4KU4A 4E1AA 5KOIA 2FZWA 3TFOA 4XSVA 5IJXA 2NWQA 1S2NA 2YOHA 2IS2A 2OHOA 1X1SA 2XJ4A 4ALKA 3NIBA 2M6LA 4UCXA 1W0KD 2AJTA 1J49A 2N42A 2WC1A 4HNQA 3DDWA 4L74A 3ISVA 3FPSA 4E32A 4RELA 1SCQA 3DNMA 2J9FB 1IHYA 1Y34E 3W05A 2NACA 1NIPA 2POCA 3KHTA 5SZIA 4X64B 2X0KA 1E1QA 3MERA 4URXR 1I9CA 2FJPA 2L82A 3TSAA 4N82A 2JBAB 4Q3NA 2C94A 3IIJA 1XXHE 2Z5VA 5LA6B 2XY4A 3TBKA 2AL7A 3OF3A 3M9LA 2HJGA 1Z38A 5AVKA 3C70A 3GJ7A 1BCSB 3N1UA 4EUSA 1KYQA 4RD2A 3MQ4A 3E53A 4DDTA 4TV9F 1XTTA 3OJCA 3E6AA 2ODQA 1T6ZA 1BEUB 2WVGA 3CW2A 4F6LA 1WVGA 1UJNA 3HDGA 1WG8A 2YY6A 4ARZB 1DAEA 1YAJA 4CV2A 4ZYZA 2ZG6A 2WMNB 1QB7A 5A4MS 3DFUA 3K70B 2PEZA 4E5DA 3H2ZA 4CYMA 2HD4A 3MOIA 2ZXUA 4ND2A 2QNRA 2X40A 3EG9B 4RK1A 1HFKA 2I1QA 1CY2A 3AEQB 5AKEA 4ZJZA 5KOHB 5LVAA 3GFSA 2C7QA 1A8UA 3TPCA 4NP6A 4F1KA 1TQHA 1R0CA 2I2DA 3K8ZA 4CUZA 3UMMA 4XIYA 4RLQA 1FXWA 3G0DA 3PFIA 4Q7JB 1CFJA 1TM4E 3NC4A 3BJRA 1TT7A 3JR7A 4JX9A 2HCTA 4L7VA 5ES4B 4QL3A 2Z2ZA 1HSOA 2OTCA 4DDWA 5PNTA 4U5XA 1Q2XA 3Q7TA 2EBHX 3QRWA 3W7BA 2QMHA 2V6MA 2NMVA 3A3OA 1JIKA 2F1JA 1C1YA 1TKAA 2C4HA 1DXYA 2AG0A 1A9TA 5JBIA 2O7RA 5DBIA 3TPFA 2WIDA 3QI2A 2CEKA 2RHHA 3H1TA 3ADBA 3LZ6A 4PG8A 2YJ3A 3O1IC 4G1VA 3QEBZ 2ZRBA 2SKDA 4MH0R 4D3ZA 4Y8VA 2F9FA 2KX7A 4KN9S 3MJ4A 3T3EA 1ABEA 5AVSA 3EA0A 4K8OA 3ZTYA 4KFCA 2FPWA 4IJ6A 4URWR 2ZSJA 5E9AA 4NMWA 1Z2PX 4KFUA 1Y3BE 5EHIA 3NHPA 2CLIB 3L4EA 4NESA 4PQYA 3ADDA 2DUUA 3JQFA 3CG0A 6YASA 1U2GA 2ZS8A 1RADA 3OETA 2FG6C 3VO9A 5CDHA 3N86A 1QH8A 1FIUA 4MPDA 1GPMA 4NYIR 4OUDA 2P67A 3ND9A 2EV9A 3KPJA 5D5HA 4G25A 4QASA 3I2KA 2YXEA 1HDYA 1P2DA 1TPYA 3BDVA 2YDXA 4JXKA 4WK2B 4B17A 4X65B 5DGTA 2XZLA 1DRVA 4JU8A 5J2TA 1ZNXA 2BF7A 3KVOA 4TL7A 3SIPA 1DAPA 4DR2B 1TT5A 2EW2A 4JJZA 5ENDA 4H3SA 3UUWA 1GQSA 2B78A 2RGYA 2AJCA 4TYQA 2FFRA 2IUEA 4HPJB 3ETDA 5H4HA 4RGBA 3DP7A 3SHVA 2V8OA 1OFVA 3NS7A 4BX2A 4OU5A 1M8GA 3W4JA 3O4IA 3FMOB 1IZZA 1BX3A 4DQXA 1QIFA 4U9HS 4FILA 2TRSB 3SAJA 5L3SB 2HPVA 2BFEB 3FXAA 1A4XA 3A4YA 2XNKA 5F1PA 3UB3A 3A1UA 3RI3A 2LWIA 1QO0A 4XUEA 1E3MA 3DAGA 4JMPA 1D03A 5HIIA 3HMKA 1DCMA 5CXSA 1QC5A 2XXAB 1TAHA 1CQZA 3GVPA 3ED1A 2VTBA 5JS1A 2OGTA 1CZLA 2X0JA 5CITA 4MR7A 5LZ2A 1E9BA 2ZYDA 2YFYA 3H3FA 3TG8A 3D0OA 3Q7EA 3KKQA 1TCCA 1ZLXA 3H2HA 4FGJA 3S27A 2CSXA 3WISA 2J5KA 4Y0VA 2HFKA 2OFXA 3PEEA 1R4MB 3D3WA 4FGZA 5CA1B 4DXHA 4KYVA 4UBIA 4LWOA 5L53A 3ZU6A 5IC6A 1JE1A 2VRCD 4I5DA 1J00A 1MQAA 1BVRA 4R1UA 2NTJA 3IRUA 3ZPXA 1ZMXA 4R41A 4L5JA 1LC3A 1E7MA 2EAUA 4WADA 4LZWA 3LSTA 3VZDA 3LKDA 1RKUA 2EYUA 2GR9A 2IY7A 4H9GA 3BJMA 5JZBA 4LOLA 1YVRA 1VI2A 3KDSE 1U90A 2Q5LA 2FN3A 3LG2A 1N2JA 2RBEA 1ZC4A 1QTNA 3G23A 3USCS 4XIGS 3BL8A 3IA7A 5BSGA 3DTNA 3E7WA 2ZROA 4HR7A 2DVMA 1JMKC 1NLZA 2QMQA 4MI1A 1KDRA 2VL7A 4JVSB 3E7FA 3D4BA 5DSTA 4UCFA 1JSRA 5DM2A 5H83A 1C7EA 3EDQA 3SZUA 4Q48A 4M76B 4FBGA 3PR1A 4XPZA 4FYIA 4NJEB 2NU9B 2ZJ0A 5F9HA 1M3SA 3PG5A 1Q57A 5JAOA 4IOMA 3GLGA 2VT6A 4XH9B 2CV1A 3NHFA 3NX4A 2ZB8A 3INGA 1RZ3A 1NYLA 4NU8X 3HSSA 1R5OA 4LYFA 1YRWA 4OD0A 1MR3F 1QIEA 1YMUA 2IYOA 4RQUA 2B37A 4ME6A 1LLCA 1VDMA 1MBZA 2VTVA 3GG2A 3GJXC 4GS5A 4H0FA 4AP6A 3IULA 4HEHA 3T1VA 1A9YA 1EFLA 4J9UE 4ZQHA 4L8WB 1WULS 4NABA 4AJIA 2R8ZA 3RRJA 1QHFA 2BDEA 1VGQA 1ZINA 3DHYA 3DH0A 4A8JB 4KCGA 5KZMB 3TJZA 1JGTA 2AQIA 3PIIA 4U9UA 2KE5A 4ZMBA 5M7EA 2CC2A 5BXQC 1BVUA 4MUHA 3HXLA 3ZDZB 5CBPA 4QGBA 1JSXA 1DWUA 4G0XA 1KZ1A 3MUFA 4DUYB 4QO8A 1C9MA 4WLUA 4Y98A 3N2YA 1KXJA 4OQNA 3M2TA 3B6KA 3JALB 4QPPA 2PLAA 4RPCA 3C7AA 3WQSB 2X8AA 5J4HA 1BRMA 2XGGA 1M1UA 4S1TA 3RPEA 2Z5LA 2CHGA 2V7XA 4O08A 5FADA 2WP8J 4M9ZA 1Z83A 4A6EA 3ILSA 3G9UA 3KBOA 4EIWA 1VJ1A 2I7DA 4KHPB 2Q49A 5CD9A 4D26A 2GILA 1NMYA 3GEDA 5D3ZA 1Z4OA 2GRUA 1O57A 3VV3A 5B7NA 1P31A 1RKBA 3FUWA 3AFMA 2IYYA 2HA0A 5NLLA 3NTVA 4RAQA 3DDHA 1A50B 1K1EA 4B4WA 5AVYA 2PSDA 4XD7A 4XB2A 1DIRA 1KJQA 2P6NA 3O7WA 3JZDA 3I8SA 3QKRB 2Q3LA 3WRWA 4UTNA 3CBQA 5IFKA 4CCWA 1TFRA 3LX4A 4X20B 5F1OA 1V35A 4ZHSA 1ESCA 2K5UA 1AHNA 2FWNA 1R8XA 1L8OA 3CF4G 1CE8B 2XUJA 4LWZA 4LRSB 4KB5A 5BW8A 4LDZA 2ATIA 5ALMA 1LV8A 1HFEL 2HA3A 2HDWA 2VKTA 5C7YA 1FLNA 5IN4A 3VPDA 3OC0A 3RU3A 3K20A 3P9QA 2IP1A 4OBEA 5DCWA 3PIRA 3B2EA 3AGQA 5B7GA 3KOXA 2BHSA 4C43A 1D6NA 4DN6A 2YICA 3N2EA 4KWEA 3I45A 4DBLE 4QJ3A 5FD8A 2QTCA 1UKEA 1ZOLA 4P98A 4ZVVA 4YYEA 1HNWB 2F4VB 3NDIA 1H22A 2ECFA 2NXEA 3R3YA 3H11A 3L8FA 5K4HA 1OGIA 1Y4ZA 3DYBA 4J0EA 2J3MA 1LK0A 1CXZA 2X77A 1YDFA 2W6QA 2IL1A 4S24A 5I7SA 4I9UA 4BQRA 5HDQA 5IF3A 1W6UA 3NGXA 4BAUA 3FCYA 1QIKA 4G1CA 3N7UA 1LF5A 2QVBA 3K53A 1XVLA 3A37A 4MR8B 4OB7A 5F76A 4DCGA 4DLPA 5JC8A 4UPDA 5JVDF 3D2CA 3ASUA 4II7A 2QN7A 5AM2A 5FB3A 1G4AE 2PRZA 3RAJA 4A7PA 3JQDA 4TKLA 4JX8A 3RE1A 3GUZA 5IBQA 1G4HA 3BZWA 1AF4A 1OXMA 3Q3EA 3Q3JB 2DKOA 1GGFA 2OHGA 4JCOA 3QEKA 4G01B 4Y2JA 3ZNPA 4C7VA 3ZDCA 2CLFB 2R3SA 4ND5A 3SN6A 1RZRD 3WLNA 4XWOA 5THXA 2RK3A 4QBGB 1Q3TA 4BFUA 3AO0B 1QIMA 1DFGA 1TLFA 2XNDA 4RKFA 2IEYA 3DC7A 4M22A 1RHRA 2R44A 2WSIA 1U1DA 4LJ9A 4ZVOA 1DJMA 4W5RA 1OBFO 3FCXA 2VPXA 2HNBA 5TE9A 4EGQA 4GR5A 4PXYA 5FLYA 2HQRA 3FJOA 1U0NA 5HWSA 5ALJA 4LXYA 4HWOA 1Z73A 2FEMA 3RTBA 5ICEA 4JUAA 1G21B 2CUKA 1JNXX 1IB6A 4YAUA 4CM6A 1GL9B 1KVQA 2GN1A 4UFOA 1EGMB 1ZMBA 2RHJA 5DXFA 5K0BA 5JFOA 2DFTA 3K73O 4IMJB 3NRCA 4R1LA 3SJBA 3CZ9A 1J7JA 3AIKA 2Z1NA 3G2MA 3I1YA 4W5NA 3ESCA 2WUGA 4I1IA 4C4YA 3JZAA 1IJKA 1CS0B 3DDZX 3NHBA 4F9GA 3DVSX 2O0LA 2I99A 2D13A 4L6AA 4QLAA 4BO9A 4AI6A 1AKVA 5BSTA 2C4VA 3LCMA 3AFIA 3GF4A 3PTZA 1PX2A 4LIPD 1PR2A 1T3TA 4MITA 4RIGA 7YASA 4HAZA 2WSBA 4LSZA 2CMGA 2QU7A 5KDOA 5B1IA 4EEXA 3NEPX 4ECAA 1F8XA 2LTAA 4YJFA 3GDFA 2NZ2A 5DIFA 2V7QD 4UEQA 4UU7A 3WO1A 3W2TA 2E2WA 3N8IA 1QCCA 3JYLA 4Z3KA 2PANA 2B2CA 2GLTA 1I0LA 4PQGA 1P4AA 4TPKA 2WTMA 1INLA 3AZPA 3HTXA 1RCFA 3KZ1E 4KAFA 2JI4A 5B12A 2WD7A 5IXYA 1DMRA 3DA8A 3J81A 2HEGA 1G98A 1NE2A 2ZRHA 3BQMB 2BTEA 4Q7LA 3PFHA 3HMQA 1E1NA 4YUWA 3NWPA 1K8YB 1HL7A 4EFMA 1LB1B 1YB6A 5ALUA 4BATA 2GMWA 3SSOA 5CYFA 2AOWA 2A1IA 3KUUA 1RXYA 1JDUA 1JDTA 1DRKA 1DVRA 1YE3A 1I5EA 2WQZA 3CUTA 1QANA 2HV9A 3GFQA 4L2IB 3T6KA 2ZUWA 1QH1A 2AQKA 4GO1A 4MZXA 1Z9BA 3RF6A 3K0SA 3A2KA 3IUEA 3OCYA 1V3TA 4QE3A 2HRRA 5AH0A 4UHFA 4MUJA 3QFTA 1J8FA 1U1CA 3V8BA 5I6DA 1WKCA 3MWDA 4NH4A 2X2EA 1KPHA 3R7WA 2ZSFA 4Q9HA 2ZS7A 1D6SA 2X9QA 3N3AC 4X6YA 2V6BA 2X0RA 1OC4A 3H4TA 1OLOA 2DJ5A 2EGUA 1OLSA 1DCKA 1U9CA 3NNDA 3TI9A 2NT4A 2ZKIA 1U8TA 4QYIA 5AMXA 5F4ZA 4LBWA 1JHQA 1UM8A 4WA7A 2FMHA 2GPTA 3GFBA 1IPEA 4GC9A 5EUCA 3JAWA 3TLJA 1IATA 3NOXA 1KSFX 1JBQA 1DKQA 1NX9A 4HAVA 4PSVA 2L69A 4BGVA 4CLRA 2XF8A 4PC7A 3E35A 3FNBA 3T9BA 3IR5A 4YJ3F 2PUGA 3AHDA 2ZIXA 3L1VA 3MTQA 4JELA 4BB9A 1RLIA 3NHLA 3L1UA 4WDQA 2I4IA 1P33A 3TQOA 4BDSA 2JFFA 5JZOA 4IZOA 3TL6A 1BKYA 1SUAA 2NIPA 3I53A 3MFQA 3PK0A 4OA5A 5GONA 5KYWA 3W6UA 3NT5A 1VZ3A 2OGUA 3M1YA 3E81A 2QTBA 3AJ9A 4R1QA 3HABA 5FCDA 5TF4A 3ZU4A 5KX5A 1JEDA 3R24A 4P58A 1RVV1 2D0DA 2XYPA 4H17A 4X1YB 3GV0A 1T91A 4XVHA 3SJZA 3R5FA 1NXSA 4EG5A 5JQGF 1A95A 3HO1A 3AY6A 4L5IA 5I47A 1O5IA 4RLHA 4E1VA 3AKDA 2D1TA 3JS5A 2EZ9A 1FFEA 2I54A 3KBBA 3WGYA 3OX2A 1C9DB 3KELA 1WY5A 1BS9A 2KB0A 3TI7A 4C0HA 3CX4A 5THQA 1XAGA 4IHAA 5FH9A 4C03A 2P7IA 3LUCA 2R65A 2AD5A 3L77A 3OCVA 1YACA 5H02A 3WJAA 3IDQA 3O8RA 5FPSA 2W2OA 5HYVA 3DEAA 2FPPA 1T9DA 1J9EA 4KL8S 1PWYE 1MRSA 2JI8A 4O63O 4ZOEA 1P73A 3GJ0A 3W5DA 1W7AA 3NAMA 4GH5A 1CRLA 4HNVA 3MJHA 4B47A 2GBIA 1J4AA 5JG7A 3DTTA 1MRNA 4FLMA 3ZE2B 4TUYF 4EMSA 1WW3A 1Z8HA 5K0ZA 2CF5A 3BQ9A 2F1IA 3NLLA 4F60A 3OTIA 3L0BA 4MW0A 4MPTA 4LV5B 4YQYA 2XB8A 1U6JA 1EP9A 1WXWA 3BEOA 4JB0A 2OFOA 2K2QB 4WXMA 1NHWA 2AZTA 5IJ9B 2JIMA 1JQ3A 3PNOA 3WWZA 3SKXA 4ITUA 3LDGA 5ICSA 4ZO7A 3BTOA 3AUAA 3RS2A 1FTGA 3DZFA 1XHLA 4ZOLA 3TMKA 2OHIA 3L7LA 3CO0S 4PAOA 2E5LB 5JDIC 1J25A 1Z17A 4CMIA 2IXEA 5CBKA 3HJTA 1DT5A 2BY4A 1RHMA 5BUSA 1C8KA 3SFZA 2R6JA 3B82A 3VNAA 4CM9D 1GL7A 5A1JA 5KJEA 4NBVA 3BMCB 2X9NA 3D8SA 3EUEA 1WEKA 4FCWA 4WLFA 1GG9A 2FRVA 1VIAA 2I71A 4UNPA 2XCIA 3K8OE 3FLAA 1AK2A 4YRFA 2ZVPX 3GQBB 4DM7A 1P2BA 5IZCC 1F7UA 3DZDA 1Y3AA 2GAIA 2GDZA 3W3AD 2CDCA 4RFLA 5BOVA 4QXPA 4PPFA 4H7HA 3HJUA 2P41A 4O3FA 2ZI6A 1CHNA 3PE3A 4GRIA 4MVJA 2YV1A 1CV2A 3ETGA 3VSBA 3SKVA 2FAXA 4PWYA 4RY2A 3WGZA 4LOJA 1HWYA 1ZSYA 1ZC3A 4RSMA 4E0BA 3S1LA 5AM1A 3GH3A 4B2PA 1ZJ5A 2R7KA 1N2OA 2XQKA 5DBOA 1CS4C 3E48A 1CRWG 5F7ZA 1MX3A 3IP3A 1C4XA 3ILYA 5DV9A 2XA9A 3I5UA 4XVQA 1QE0A 1Y8QA 2CVQA 4RMGA 1D2HA 1N0VC 4W5HA 1R74A 3ZLTA 3EZ2A 4JYZA 1E3TA 3CKLA 1PR6A 3F71A 3ZH2A 3T95A 2XB4A 1IZ0A 4Y6GB 3UHPA 1XMPA 1PR3A 4QBIA 3LOPA 4FE4A 2XRYA 1SCIA 3NWOA 2AT1A 1G8FA 1JWAB 2YMPA 3FCOA 3SE0A 2GLUA 3VU9B 2JGDA 3VR4A 4YJ2A 2XCUA 1IB0A 1WSDA 4XDYA 2NQ8A 1L4HA 4RYDA 4KPFC 3DS8A 5E1BA 4BUCA 5B55A 1CF4A 4GVLA 6REQA 4D9KA 1U0TA 3UFBA 2OT3B 1SCDA 4XWYA 1KU6A 4MIOA 4CMGA 4PZCA 3TXYA 4P35A 3KTOA 1RWXA 1EAYA 3F49S 1SU6A 2LXNA 1UEJA 1EB9A 3RGGA 5FNZA 4BQSA 1NWHA 5FUQA 1RVDA 5E1MA 3BBPA 4FB4A 2R9VA 3IL2A 1JG6A 5ALRA 4Z9YA 4EO7A 1IUKA 1RT9A 2ZYTX 3CBGA 4TMYA 3LIIA 1W2GA 4S0XA 2C3PA 3AYXB 4WOPA 3W0LB 2DKNA 3OE7A 1EFAA 1D2AA 1BFDA 1IFXA 4P34A 5FJIA 2BI7A 2RHOA 3AP2A 1LBQA 4F97A 1HG1A 3WRYC 2R7LA 2FW7A 1P29A 1RQNA 3PC3A 4YGYA 2XUQA 1N2ZA 1P2GA 2MU1A 2OV3A 3FR8A 5EJ2A 3PUWA 5IXJA 3CX6A 3X1ZA 2NU6B 2PG3A 5J3JA 3C6QA 4HAWA 4OLHA 5I4KA 3Q9SA 5J5CA 1P72A 1R6UA 1QHSA 3HU2A 2WA1A 2I80A 4IXNA 4RKWA 2JIPA 5TGTA 4U02A 2BMDA 1FNCA 1QF9A 5MN6A 3V1TC 3P2IA 4PY2A 1YR9A 2L18A 1PX0A 5L40A 4JYBA 2WZCA 2P2DA 5BSMA 3UOGA 4CF6A 3HN2A 1WSAA 4YQZA 4HUTA 4Z6KA 1TRKA 1J99A 1SMKA 3F1LA 3WG9A 4XJTA 1FFHA 2JFBA 2CUZA 1UIRA 1KI6B 2FR1A 3FTNA 3U19A 1X7XB 4A6PA 1NE7A 4MVJP 1N7HA 1CQIA 4E5VA 3CVJA 4MGEA 3WDKA 1YOVB 3IKMB 1NF9A 2BELA 1SU7A 3IPCA 3CPJB 1DJLA 1WEHA 3DKVA 2OUKA 3EY4A 1N5MA 3OQJA 4U2CA 4AY5A 4WEQA 1EVIA 3H65A 2QAGC 1XZCA 3NIWA 2Z5FA 3IIKA 3TINA 5ERYA 2VYFA 3QJGA 4OGLA 3V5NA 5JDIA 2PAFA 2O05A 1USWA 3UWSA 2JAHA 4RZ2A 1IEVA 3Q10A 1YZLA 1DUVG 4DCVA 4MR9B 3VSAA 3O3MB 3EIWA 3C8DA 4YAJA 4IG4A 2H9AA 3AI7A 4OYHA 1KI8A 4GXQA 4QOEA 2N9UA 1T6NA 2AOXA 2VNAA 3L07A 3ZVMA 2IBSA 4GX1A 3BXGA 1DX4A 5EHGA 3T1NA 4B79A 1GTMA 2IIQA 3CHYA 5IZCA 4WGGA 5EE3A 3C7CB 2P91A 3OHPA 1FX0A 3UG7A 4B44A 5IKOA 3CVVA 1KQNA 1ENYA 2NYVA 3Q9LA 3ZZUA 1EIWA 2XZPA 3K1ZA 2C4UA 1L7XA 4PZEA 4R0NA 1O89A 4M54A 3K0BA 1PZXA 4D9JA 5HTKA 1AV7A 2M2IA 3IC5A 3QJYA 4OQQA 3S2FA 5KYTA 5KPDA 4GPD1 3DFZA 1S2IA 1HDOA 721PA 1PS9A 2ZE6A 2GBGA 3TZHA 1EUQA 1Z36A 3N2KB 3AY3A 4N6NA 4BPBA 1P1HA 4IOJA 1JBKA 1XKTA 4I5FA 3BAZA 5G4LA 3LDFA 1N1DA 2O9JA 2VHQA 4QXAA 4TZKA 4C9BA 4YLYA 3WX0A 5FTLA 5CCBA 3QVKA 4EFKA 2MIIA 2WMYA 2OESA 3HACA 4FZVA 1CJSA 4ZI3A 1L7QA 1Q1NA 2QL9A 2ID7A 4LFCB 1GV1A 2VZLA 4A0HA 3EPLA 3Q7PA 5EJIA 1R64A 2PX5A 3OPQA 4KFTA 5K45A 1R88A 4LRYA 2RCNA 1XXHB 4K1LA 4URYR 3EMBA 2EP5A 4B3HA 3IDSA 1L1RA 3D4LA 5LP1A 1DLIA 4XWWA 4H2DA 1DQNA 2OOKA 1N34B 4I81A 1PR0A 3K1JA 4QWMA 4TL8A 3JTMA 3MVEA 4R8KA 4Z0HO 1S8OA 3LBYA 2NVOA 3L06A 2E5WA 3LP6A 1L7BA 3S3TA 3WLHA 1GUYA 4EVIA 5L45A 2P90A 1U3GA 1HA3A 1ULHA 4BNMA 2JLQA 4AUNA 3EUWA 1A7JA 1D4AA 4RVUA 4TSKA 3LA8A 1VIVA 3GDWA 5T64A 3SNKA 4EI8A 1YV9A 3CTPA 5JEEA 2XQVA 2ZJ2A 1S9HA 2YUTA 4I9GA 2HWUA 4LZNA 4EECA 2J67A 1FRVA 2GEBA 2XF2A 2PSJA 5DLYA 1QKJA 4UNIA 5IAEA 4IOLA 3WYAA 1HEUA 2H2FA 1UXGA 4M55A 3AOEC 4IHJF 1V43A 2QX8A 3KKNA 3KPUA 2EFEB 3WRYA 2VSNA 4AX8A 2FW8A 2QB5A 4DSAA 1YQUA 5KHLB 3JARA 3QWAA 4A6XA 4EUNA 1MOZA 4IVRA 4NDNE 4LF7B 2C0QA 1HDGO 4QGSA 4RUKA 2DPXA 1ORTA 2E55A 1QZXA 2ESRA 2PJDA 3ELBA 1PLKA 4MW7A 3KTFA 2G25A 1RYBA 1GXSB 3PNMA 5J2UB 3INNA 4HTFB 4IXMA 3RKUA 1Q1AA 3JASB 1HK7A 3OJFA 4OQ4A 4Q1AA 4WL0A 3ETLA 1ULAA 2FA9A 3G5TA 1G7CA 3FPBA 3N0XA 5FBRB 1RQRA 4DTIA 4F4UA 1RTKA 3AUTA 3CCBA 2ILVA 1ODSA 4AW9A 4BJ3A 4GKJB 2AUNA 4F3TA 3RRBA 3C3EA 3GELA 1QP0A 1NP7A 4A73A 1A7AA 2YXLA 4HDMB 1IXZA 4HGQA 3WZ2A 1T4BA 3BSFA 2PMCA 5E9JA 1GTL1 1VG8A 3JW8A 3SM3A 4DIUA 5KUTA 1ADBA 3R0XA 3GLVA 1Q74A 2QAGA 3IEUA 1GKLA 3V97A 1QWSA 1T2FA 1HRKA 1X9GA 1F38A 3KPYA 1RR6A 1TMKA 1ZA2A 2G76A 3FVVA 4MIYA 1ZESA 2N0SA 4NENB 4ZQEA 1JECA 4OTZA 2AFIE 1QP8A 2HREA 3VNSA 1TZKA 3N2GB 1RQ7A 2CNDA 1JTVA 1QRDA 2Q9UA 1WWKA 3C3BA 2CUTA 3PQ3A 3C1TA 3A3NA 4KMSA 4YRKA 4YCBA 5HUHA 1U04A 3OAAD 2ZXFA 3JY6A 2ZAOA 4WX2B 2I8CA 1IBSA 2JI7A 2ZBRA 3P9SA 4GXNA 5CLGA 3X1KA 1M1YE 1Z29A 3Q5GA 1G3RA 4TROA 3ADKA 4YEDA 2VH1A 5CDYA 1UDBA 4OGKA 1OLXB 2XMSA 4A0FA 3RUEA 3ZJUA 3OY2A 5FHQA 4PC3A 1KXZA 2JIQA 4JLWA 4P7KA 2ANBA 3AT1A 1V11B 2OHHA 3HFRA 5DBHX 4DYDA 2VUUA 4KXNA 3W1VA 1TVKB 5B3KA 4L8FA 3WP1B 3BXXA 2XJ9A 3PC2A 1E5VA 3K4PA 3EH2A 3H1FA 1H0RA 3P1JA 1YXMA 1TVEA 2JFPA 4QTYA 2I7TA 3KZMA 3QVTA 4L22A 3EW7A 1YK0A 3HO8A 3RSFA 4JT9A 1YKSA 1R6AA 3D6MA 5BQ5A 4UVGA 2FPUA 2E5FA 2JCBA 3BERA 2WTAA 4Q3LA 4GYYA 4X8LA 2A92A 4NF2A 3W04A 1IQRA 1POWA 1WCV1 1JIXA 1RJ9B 2GKSA 2PTHA 4KSBA 1CEXA 2HU5A 2HX1A 2DY0A 4J2TA 1PEAA 4GX5A 4MVCA 4Q4AA 2Q2WA 3G2LA 1FYWA 3RDPA 3D8TA 3WKAA 1GFIA 4Q5IA 1OKKA 3P5BA 3HBNA 3QFFA 4PZZA 5K0TA 3HJCA 3OJLA 3HB4X 5KWJA 3FHJA 4JBYA 3HU5A 2XT0A 1U31A 4LTMA 5BSKA 2DPLA 3KSAC 4BBJA 2WWIA 3UHFA 4GX2A 4MIEA 3FPAA 1ML3A 3AOEA 3U13A 4D74A 3RQIA 3VNVA 5KJ6A 3TLMA 2QSUA 2BFNA 2CNNA 3MBIA 4LBYA 5KNDH 2YWDA 2C5SA 1NURA 1QSGA 2BP7B 3A6EA 3AY7A 1OU4A 3K05A 4H7IA 4XCQA 3SC2A 4E12A 3L1IA 2W58A 3I39X 4RWZA 2AHRA 1PO7A 4H1WA 2YBEA 5MN5A 9MHTA 4PNHA 3ZOZA 4A1FA 4JR2A 3SDZA 1DT3A 2PT6A 1P7YA 4OI4A 2ZAGA 1W5SA 1L8QA 2ZBPA 4RS4A 1UP6A 2B4YA 3WK4A 3PX7A 1YQ9A 1EA7A 1ZY2A 1XTBA 3FYHA 1T0BA 1CPYA 2FQQA 4JKIA 5D3MB 4CL8A 2I1WA 1DO2A 2VT3A 5HCUA 3AGPA 5K0LA 1TMYA 1WHTA 4G41A 4DKJA 1CRQA 3HNOA 4RGQA 4ARBA 1QU2A 3LYUA 2BR3A 3BN3A 3NKLA 1UBNA 3HCNA 5A9SB 3GD7A 5GOTA 2G08A 1O95C 3II6X 4RVNA 1FYXA 3HRIA 4JWTA 3TAUA 4BEBA 2L42A 2K4MA 2PGJA 3KQVA 1G7TA 1EVZA 2FP4A 1K7EB 3CCFA 1Z68A 3GH1A 3N6VA 3E8MA 2PFSA 3PHCA 4FGKA 3OQIA 5CURA 3S2SA 4A2CA 4AKSA 3TLKA 4JSYA 1XQVA 1TCVA 4NONA 1JS1X 1AZWA 3EDMA 3A9UA 3B6MA 1NZDA 1Z4MA 1EXVA 3GZNB 4DBVO 4LJ8A 3LX8A 2QZZA 4JLUA 5C52B 4BOYA 5LZ9A 1Z6ZA 1F6WA 2RDMA 4AYWA 1Y3HA 2WBLC 2IEGA 4C2AA 1X0VA 4AN4A 1Z2CA 3IEIA 3T7IA 4G1UC 2HAEA 4X0EA 3KL4A 2OZVA 2IIBA 3KQOA 2Y1FA 4GG1A 3I05A 2A58A 2X7JA 2A30A 1OZFA 4W1QA 1IAVA 1XO1A 5CA0F 4QYTA 5JR3A 3G0IA 3K4QA 5D5QA 3G17A 1MABA 1BIFA 3CLTC 5SZKB 3QP9A 5HZGA 3Q8XB 1YK1A 5TT1A 4IX1A 4ZTUB 1E3SA 2O48X 2ZR0A 4M9SA 4N12A 4IYRA 2BSAA 3O1JC 5F7OA 1DKMA 3GRRA 1XDBA 4ZEWA 2XYGA 3TIIA 2EKQA 2XEXA 5EEHA 2JB9A 3QU7A 4NPHA 1JR2A 1ULTA 5A3VA 1TECE 1YC5A 1A98A 2CXTA 1XFDA 2FWPA 3HBLA 3MB8A 2AGVA 2F17A 2J6CA 2QQFA 3DCJA 1G8JA 4I1YA 2C2MA 5BWOA 4D81A 3U09A 5CDFE 1PUIA 3ANSA 4MW6A 1YZYA 1FQOA 3O31A 4QPCA 3SICE 3MTBA 1P4RA 1BJRE 2HHJA 4LQCA 1GZ3A 2AMJA 1I32A 1EUDA 4XGKA 4ZOCA 2LW7A 2C3MA 3TBHA 1FLVA 2QMZA 1XALA 1PZHA 5CFLA 5HRUA 4OLAA 4KZPA 4F8EA 4K6CA 3GRFA 3RBVA 4L50A 4EPWA 3WK5A 4HH1A 5DB4A 4BPRA 3DBOB 1O6ZA 1NQUA 1XLWA 4L72A 3C4QA 4UXIA 1BMDA 2WHPB 4JJ4A 2NU7B 2A5LA 4YXWA 4CKYA 1DINA 4ACAA 2JI6A 5KJFA 3B51X 4BNHA 4R1PA 1IZ8A 1TW2A 2V6IA 3KKPA 3TD6A 3NAQA 5H7XA 3RW9A 4EMTA 3TQFA 3WZLA 4CEHA 2B36A 2IUTA 4UNSA 5AKYA 2RH8A 1K3FA 3S1AB 1FRNA 1FLAA 4CU2A 4ZRNA 2ZE5A 3CRRA 1NVEA 3L7NA 2XNJA 1P8JA 3U49A 2R2GA 2XMPA 2C7OA 3HJBA 3OA2A 4V3CA 4CUJA 2P78A 2I4MA 3F1KA 3I2YX 2O5EA 1GG8A 3IP9A 3LLUA 4X71A 3S28A 3N6RA 1G0NA 4XSGA 3WGHA 1DG1G 1VKZA 1GFWA 3BCUA 3WLOA 5G0WA 3S55A 2BKLA 5WRFA 1O97D 1NRWA 3TZBA 1UR5A 2Q7XA 3ITNA 2EF1A 1X80B 3AJDA 1BWRA 2FG5A 3OMXA 2BGMA 2OVFA 3EX7C 4MIKA 2O2HA 3R76A 3TGPA 1TVMA 2H4WA 4YJ2F 3DOJA 4QULA 1IOWA 1Z0IA 3MUOA 3ZQJA 5JADA 4BNFA 3KSZO 3FUCA 5JALA 2CV2A 1O95A 3PRJA 5FI0B 1K97A 3DMNA 4J7AA 4ZAWA 4ZIRA 3CLSC 5ITWA 1Z3CA 2WIKA 1L4LA 1X42A 2FF5A 2NSDA 1KOFA 4P33A 5K4AA 5LBUA 4ZZ3A 1OXSC 1RWNA 3M6MD 3T7CA 1Q0RA 2BEVA 1PD1A 5CLIA 1FZQA 4YRNA 1AKEA 1QKIA 2WM8A 1CEYA 2VQ6A 3I2IA 1M5TA 3PU6A 5ALTA 4ZREA 4B43A 3MINA 4MMZB 2R48A 3BE4A 4C1NA 5BN4A 1MO5A 3WLTA 1I2DA 1T0HB 4B3SB 1TI7A 1NJ1A 2XUAA 3ANXA 4BLOA 2NUTB 3PDHA 5HKKA 2XYHA 1CDOA 5LU8A 1ITZA 5E2AA 3C4JA 3Q15C 2IYRA 3UO8B 4KWCA 4Q9LA 5IVIA 3U48A 4X7MA 2FUEA 2GFIA 2HWXA 1G42A 2P2YA 3T8YA 2IE0A 3HBJA 5H9VA 1QGED 3P45A 3EW9A 1WF3A 3H9UA 1ZD9A 1GGNA 3ZWCA 4R0MA 5JXGA 4HUQB 2CE2X 2A5DA 1GYPA 1HE1C 1NDHA 1VB5A 4W8HA 2I6SA 5DSXA 3S7ZA 3UM9A 2V59A 3H9JA 3RYIA 4BN5A 5AKIA 4RAOA 1SC9A 1RP1A 3NI2A 2C7VA 1C0PA 1WKVA 3D3QA 3EVGA 4UC0A 1SCNE 4DLTA 4MDHA 4LRQA 5AOCA 2X0FA 3WNZA 4RTPA 1XF9A 4D5GA 3HGQA 3MRVA 1S4QA 3THXA 1C9YA 3MIIA 5EZQA 4ES6A 2PA0A 4LZOA 3TB4A 1L2TA 1TEXA 2OZKA 2QDXA 3U7EB 2GXAA 2CFTA 4HFJA 4GXRA 5T4FA 1Y4SA 2M32A 5F2OA 5FV4A 4UU8A 4Q9NA 3U1BA 2OCXA 2A1UA 4M88A 2VPYA 3DE6X 4BKPA 4N3GA 3UXHA 4ZVKA 1EUCB 2X22A 3BEDA 3OTQA 2BGJA 4E51A 2J7PD 4IGFA 3LUJA 3N70A 1E1CB 2HXSA 2Q6IA 1PGPA 2VEOA 1Q15A 4C2TA 1WCYA 2X8WA 2Z2XA 2G40A 3I52A 1PZMA 3L6DA 3M5PA 4IW3B 4QUHA 1KH2A 3RIXA 3PV0A 4ZO9A 2GTPA 4FOPA 2W22A 3L7MA 3G8CA 1U0EA 4HKTA 1O94D 3U62A 3LQYA 1FFDA 2ZRIA 3MT8A 1D9XA 4BB5A 2EKLA 1RBQA 1FYFA 2HUNA 1HUQA 2GO7A 2JAPA 2QTRA 3GT4A 1E5XA 5K8JB 5GWXA 1YR8A 2NSLA 1QDUA 4CMJA 1QGUB 3EEIA 1A4UA 4DC1A 3KE9A 1YRYE 3WA7A 2Q2NA 1P5RA 3IO3A 1OT5A 4MYCA 2JFOA 4N01A 4UDNA 1OAKA 1I4OA 1Z62A 3PYXA 4TMTA 4YDSA 5EZ6B 3W7VA 1GILA 1Y80A 1JHZA 1MO3A 3IVCA 4LMRA 9LDBA 1S1CA 1EFPA 1E99A 1S2LA 2CJWB 2ZPUA 3HVHA 4MW2A 4KVFA 3OQMA 1Q19A 1ZFNA 2FDRA 5LSAA 5EE1A 1RYYA 3CH5A 3ABIA 4KXFB 5B5SA 1WMEA 3KP1A 2RHMA 4E70A 1EA5A 2V0CA 2GWHA 5G1PA 1JDNA 2BN4A 1X8LA 3EAGA 4J1QA 1M1ZA 4MROA 1LDEA 4PYMA 4QZVA 3PGKA 3HXTA 4D9NA 1ULBA 4DCOA 4QM7A 1J7KA 4G5RA 3U37A 5BNZA 3LCJA 3JRXA 1F2TA 3F7MA 5EIBD 1GV0A 2H1HA 3I73A 4ZDWA 4DQ0A 4G23A 4IKPA 2WYOA 2Y1LA 1G16A 3IKVA 5AKJA 4UKDA 4WY8A 2ZWVA 2G4LA 1GRVA 3JZMA 2AFHA 4GGMX 4PZYA 3LW8A 3ZV5A 1NKVA 2H5IA 1BDHA 3KQSA 1K0UA 2D06A 3GZ4A 3QF7A 1OHHA 2A67A 3I3OA 3IQHX 3ZLUA 1FPQA 3V1MA 5KQRA 2CN1A 2HXYA 3IUPA 3T1HB 4ISCA 4F0JA 5K8TA 4N8EA 1MAWA 1G5IA 5LN1A 2IZ6A 3MCWA 4ZODA 2GEFA 2BM9A 3Q9UA 2ZBVA 3EHEA 3RVOA 1V5GA 3GUCA 3W5SA 2PV7A 1VC2A 3I4LA 2QHXA 4FNAA 4XDGA 1DKUA 4TX1A 4UMVA 4V0QA 4B85A 3A3PA 1RIIA 3KVYA 3TRDA 2PK3A 4OQFA 5J5VA 1MH9A 2QQGA 4PX5A 2YWGA 4JEHA 5EFZA 1T1SA 2G9UA 2GRAA 1F0KA 1Y5MA 3CNLA 1DS6A 1TJ3A 3IELA 1X19A 2FK7A 4KACA 6CHYA 4QC2A 2BEJA 4P92A 3P0HA 5JO9A 1SUSA 2D8MA 2VYND 3G49A 1WBDA 4YVFA 3TKYA 2OXEA 4ZT7A 2QE7D 3QBJA 1RLJA 3DE4X 4UU0A 3LKZA 1PG5A 3NHUA 1SHKA 4FZ5A 3RJZA 3K0FB 5CLJA 2QVLA 2NYUA 4HB3A 2WF7A 3IUBA 1U4NA 3AKYA 2QI9C 3PDUA 3Q3CA 4EF4A 4ND6A 2BGTA 1COZA 2AG1A 1PZFA 1M6WA 1WBBA 3QKUA 3HFJA 5FOSA 3NO4A 4WFKA 4CG0A 5AVQA 3N2ZB 3MRXA 3GLHA 1USVA 2FJ0A 2H7YA 2NUBA 1T29A 3CUUA 4X7PA 4P83A 5LQSA 3REOA 1A1SA 2JS7A 2UUCB 2Y4OA 1ZCZA 5BNIA 1CUFA 1CWUA 3HB5X 4Q3EA 4DIKA 3PXGA 2DR3A 4WZAE 1O5TA 1W0CA 3VGPA 4ZEXA 2JH9A 3VAAA 5IK2A 3GLKA 2B7LA 1UOOA 2FZ5A 4KXQA 3BMQB 1CU1A 4H60A 1J90A 2H51A 2M9MA 3DONA 4G8JA 3BXOA 2WMDA 2JGKA 4WT7A 3JAKB 3F5FA 4XYEA 3FPEA 1HT0A 3ZV3A 2GJ9A 2PKWA 2E4XA 2I7XA 1H94A 1FJXA 3MJVA 2BGIA 3R3ZA 1ENZA 5H3CA 4F6RB 2R7NA 3L6EA 4JYMA 5AHOA 4JN6B 2P3QA 3DV2A 5AM0A 3QYAA 5G1NA 2DFLA 3OEHA 2YV5A 2JC3A 3O4RA 4GMXA 4HRXA 1Q22A 4YJHA 3C0KA 4G0VA 4FMDB 3E22A 2FMKA 4F5ZA 3PA8A 1ZD8A 3QEMA 1T9CA 3I01A 5B57C 3R44A 3ZBUA 1SUDA 1SBIA 5ENVA 3IT3A 4K87A 1HY3A 4WJZA 3PD1A 4RNCA 4YI3A 4LJKA 3SF0A 4TTAA 3GR6A 5D85A 3C5VA 2AOVA 3M6WA 5EGSA 2P77A 2AA3A 4W1SA 2ZB7A 5L7YA 3KVNA 4ZI7A 3K1YA 1E0DA 1QVVA 3HCFA 3PPWA 4HAOA 4D46A 2Q62A 3H5OA 1MB3A 1IDN1 2RGDA 4PQRA 1LVHA 1NOKA 4B7CA 4XQ9A 2OG2A 3EN0A 3H16A 4OHKA 3RKRA 1NX6A 2CYCA 1X1DA 1DC4A 1X6VA 4M0MA 1GNLA 5TPWB 4CVNA 1O96B 2MWMA 4A5OA 4RD3A 1H2EA 2WVJA 4M8NE 4XB1A 5H3LA 3VNRA 3WFZA 3Q8LA 1G8HA 3B36A 1B73A 3UPDA 1H23A 1ODCA 4E2ZA 2EJWA 3E18A 4N5NA 3RS5A 5JYDA 2IFTA 3GYBA 1I24A 3DTVD 4GBGA 4W99A 2WSLA 1ECCA 1XA0A 2BUBA 3PFCA 4BMCA 2EKDA 3PXXA 3O6VA 1HOTA 3BMOB 1QCZA 3IAUA 3L0CA 3M2PA 4K9LA 1WPQA 2OFPA 3S68A 3ULKA 4C05A 3ZE1B 1RC1A 2Q1UA 2ZYGA 4ZQIA 4XWKA 4F04A 3IBSA 4YUZA 3P2JA 1ECBA 2YOGA 3L8EA 4KNWA 4KUEA 4Y30A 1QOPB 1WQ4A 3ET4A 3QYPA 4IY1A 1I4DD 1IWPB 1X7GA 1EWTA 3A4IA 3KYBA 1X8XA 3IMEA 1XMJA 2ZJYA 3HJAA 2RG1A 1WF6A 1G5RA 2PKCA 5FPYA 2V9CA 2TMKA 3C5CA 1UPUA 1EJ2A 3NJ8A 4AMVA 1E9RA 4TL9A 3T7DA 5BSEA 1D09A 3DG9A 4D0SA 3AFGA 3LV8A 5BVGB 4N5MA 4PANA 5AJVB 1JPVA 4FJ1A 1YNSA 3UC9A 2LIVA 2BGGA 1PW7A 1OWMA 5AJUA 5FI1B 5B1DA 2IBTA 2FFJA 1BN6A 1OYWA 1YDWA 1LTKA 3JX9A 1GUFA 1XZHA 2GXQA 4RJIA 3ES9A 4M9QA 5GZ1A 2AKEA 4HNUA 3H5VA 3A1CA 1PS8A 3KB1A 4WHMA 1U0OC 1SVLA 2XAAA 4O59O 5AW9A 5E7MA 5EGNA 4BVKA 3FNIA 3QSGA 3W5AA 3E2PA 2NPFA 3TMAA 3LUPA 4AWAA 2XBMA 2W6ID 1N2SA 2Y27A 1GT91 2RONA 3BK1A 4F06A 3WYNA 3ZWPA 2JVJA 3M8KA 1YQQA 5IYZF 2CJPA 1V9SA 3KSRA 2J07A 5F1KA 1OX4A 4GVPA 1N5KA 3ZHRA 5IN5A 1EFDN 2IYXA 2O2GA 1AD2A 5TQ0B 3EMDA 1GY8A 1YUNA 4RA9A 2ABWA 2QZ9A 5IAKA 2MSEB 3I5AA 4JODA 4IIBA 2Q99A 1H66A 3BA6A 3H0CA 3KQPA 3SBDA 4F5WA 4F9FA 1LBSA 4RTMA 1VLMA 4X6XA 4BWFB 4FEGA 5BN5A 4BTVA 1NXWA 3EHDA 4S1OA 3ID6C 5K0GA 3H4VA 3VJRA 1DWOA 1WV1A 1KK2A 2NTNA 3DL2A 4WMLA 3FPLA 1QHHA 2NPIA 3L4BC 1E1QD 4KE7A 4IH1A 2J7KA 3CF4A 4BC1A 1JFSA 2HHAA 1OF1A 3QF4B 1Z07A 4CMEC 1GITA 4PR3A 4NHEA 1EDEA 4I4LA 5KTKA 5MDHA 1N2EA 2PGOA 3T12A 1Y5IA 5ITVA 1EM8A 3I9MA 2LGJA 3K35A 2NO0A 4FFSA 4P53A 3H8WA 4XOIA 4MS1B 4I6EA 1M8PA 5C5EA 1JSLA 4HSGA 5GJVC 2YYSA 2QN2A 4WINA 4YPOA 3U7FB 1GVHA 1BHQ1 1T8TA 1KEUA 2B1QA 3P71T 4KGXA 5DYTA 1AOXA 3DUFA 2ASEA 1JRLA 1UPXA 1ODLA 5FR2A 3UATA 3TTYA 3PF9A 3E5HA 1B8NA 1SVOA 2GTHA 4PYOA 1W5EA 3M83A 1P5JA 1RE1A 2BM8A 1N7JA 3IUMA 4GOJA 3D0RA 4LOIA 4Q3DA 4ZVLA 3SPXA 4X3PA 4BKUA 4D4LA 5JJKA 1JH9A 3RUDA 2C2BA 1TTQB 1GG2A 3RSSA 3SHFA 4Q4LA 1E3WB 3A9SA 3ZU2A 4BYMA 4P0PB 1UKCA 3LT5A 4BFTA 2J6HA 5IH3A 1ZNWA 4G36A 2QEQA 3TRFA 3NHRA 3UFXA 4F96A 1R8SA 1RXIA 5C46F 1VL1A 4MTLA 5AFSA 2OBFA 2OV8A 2GEVA 4KR3A 1DHTA 5U4XA 5SYMA 3HKEA 3RASA 4PYKA 2PBLA 5ALDA 4DLXA 1TYBE 5KTNA 2ZJOA 1Y9JA 2HJ9A 1Z0UA 2ZUTA 2PD3A 2Y77A 4TV8F 1XZ8A 5CFQA 2Z6UA 2X1VA 4JQCA 3PFWO 3PUKA 1EXNA 1NUUA 4IYJA 4UUNA 5KTPA 2Y2UA 3R5KA 3DBLB 4FPXA 1R12A 2YRXA 1M73E 1XNRB 1FDOA 3DL7A 1BGXT 5GGXA 4AUMA 3MILA 1OE0A 5KNCA 2B4RO 3EEBA 3FIUA 5FUVA 1O0CA 3FBTA 4M98A 4CF7A 2BLNA 3SQDA 1N57A 2ZYUX 5CNKA 3W6ZA 3UHAA 2IIVA 1KEKA 2P9BA 4OBBA 2ZDHA 2FMIA 2FOXA 4FFNA 2G77B 1LX7A 1ZMOA 1ZJ6A 2NAFA 1HM5A 3GRAA 4PQEA 3M3PA 2XDQB 2GSDA 3IUYA 3I9KA 1SXQA 1TPZA 4JOCA 1G41A 1M8FA 5EWLA 4R9NA 2FG7C 2O8NA 3DZGA 3EULA 4FEAA 4L4SA 1P17A 4HVTA 5E0KB 1OI4A 1JDJA 4FFBA 3WWEA 5JASA 4JD5A 1KJ8A 5KWIA 3RVNA 2AMLA 3UMYA 5KOJA 2XE4A 3RAFC 1GEEA 2V6JA 2VUIB 2JGRA 2PKQO 3NZEA 1PWEA 2H0RA 3OOJA 5FAKA 2A94A 1SPXA 2QN6A 4DLVA 5FBQB 1I3LA 5B37A 2OUIA 4NFSA 1OBCA 4JLOA 3G1TA 1FFBA 3OJEA 3U39A 3EEOA 4JJEA 2C2XA 1UPFA 2Q5HA 4NZPA 3PXUA 4IO1A 3UVEA 2CZGA 3QHQA 4OHUA 4FYPA 4RX1A 1QO0D 5TDHA 3ZLBA 5KYYA 3HVKA 2LR0A 1CZKA 1VP3A 4XARA 5TX7A 4CV3A 1TCBA 3QK7A 1LRJA 1HF3A 2XAUA 1PNVA 3AYZB 2PUVA 2BSQA 1FUEA 2PIDA 3HRHA 3R5TA 3CIFA 4FMCF 1YBMA 1OZHA 5A4AA 2FNAA 4EITA 3CW9A 3L4BA 4J49A 5T6MA 3ZK8A 3DXZA 1M2VA 2R1VB 3SI7A 5DGIA 5ELMA 5JXJA 2YIDA 2BMAA 1X77A 1OMOA 2PGXA 1W46A 2W2VA 1T4CB 4FSDA 4DBZA 4EHBA 3ZQUA 3O1LA 3FJ1A 3ZLJA 1CYEA 5K0CA 1R0LA 4PLWA 5G0TA 5TMBA 3VU3A 1RM3A 2Y3IA 2WK1A 4CQJA 3WDLA 4HWSA 2HTFA 3KL2A 1X13A 5HF5A 2HK8A 4KR6A 2VYQA 4JJ8A 4K9DA 2G83A 1A71A 2HOQA 1DPGA 5JD4A 1IMOA 3VMMA 1DBWA 4K81B 2B35A 3H6KA 1RHKA 3HWX1 1JKMA 1HH4A 5E3HA 4FM9A 2IGBA 3KD3A 3MWGA 5H4GA 1EWRA 3R6WA 4FQ8A 2OV4A 4V0OA 3T5CA 1J5PA 1U5CA 4Y6QA 1K9VF 5A4FS 4RZSA 1Z0JA 2WZQA 5FORA 4KPUB 5EL0A 3GGJA 1NTOA 4NDZA 5JFGA 1J0DA 1ECGA 1T3SA 3GOQA 3TDKA 3BDAA 3GCDA 3WE7A 3ZCPA 1X92A 1ZJ4A 2YMMA 4R83A 4PYLA 4Y9UA 4DZTA 1QGZA 1AY0A 1M34E 1X14A 4GC5A 5CT9A 5AHKA 2B7BA 1QRTA 1SXPA 1MT0A 1XQYA 3NP7A 4LX8A 3FVQA 5C31A 1PK7A 2C8JA 3HB0A 4M9RA 5HKLA 3PXAA 2CLSA 3WV4A 2DETA 1GAJA 3FE2A 4ENPA 1NBWB 4WJKB 5JVDB 3T99A 3CUKA 1DX6A 2CK3D 5FA8A 3D1LA 3EUFA 5CB6A 2CHFA 3TQRA 2C5GA 2QD1A 5DX1A 1C30A 1T2AA 3DWIA 3QM1A 1E8NA 4INJA 1HTWA 1J07A 3V8PA 3UJ9A 2W48A 5E4FA 3AB8A 4M46A 2AYXA 1AH2A 5IM4A 3MMSA 1Z82A 1R5BA 3BB3A 2PYIA 2WWGA 1DJQA 3E2IA 2JD2A 3MPOA 3A6HA 4PSCA 1E20A 2FEPA 3IERA 4GI7A 5IABA 3VR2A 5BSVA 2ZTVA 4QUGA 1LLDA 3NHKA 3C3PA 1G1MA 3QBDA 2XGSA 2L17A 4UASA 1TIBA 3HYCA 2IA5A 2WSSA 4O4LF 4U6NA 3ZW9A 4YWHA 3X2SA 2EL7A 1DLJA 1LQTA 2XADA 4DA7A 4CKXA 4EZBA 1MO6A 1SVKA 2JZOA 5CVTA 4TMFA 3K6KA 1RWWA 2NV0A 4PINA 2CYAA 3BICA 1W9MA 4RK6A 4ZZ0A 5FULA 5JYCA 1IIRA 1BMTA 4LK2A 3ENZA 4NOJA 4Q1BA 4RA6A 1KEZA 3A10A 4XD7D 5FPPA 3K70C 1BAPA 2ZS9A 4H6WA 1VIDA 3RHZA 4EPRA 3C3DA 3K16A 4ZYTA 4O29A 1H3FA 2GCOB 4JUBA 3TW4A 1WUIS 4BFSA 4OCZA 3CB2A 3ZD9A 2Q6LA 3QLJA 3MTJA 1T3ZA 4BFXA 3IAHA 4M83A 2IZ7A 2YN4A 1HKUA 1D2GA 4BLPA 1KBOA 4PLVA 2Z6AA 3ZS9A 1E2MA 1EQUA 1J97A 1VA5A 2WDZA 2VG8A 4KNVA 5JH7A 4AQ7A 1BXRA 2XGJA 2O6LA 4R71A 2GUGA 4QFCA 1DEKA 3I83A 2OBMA 2CL5A 2PZEA 4J3NA 4QJ5A 1Y7IA 2IH4A 1CY1A 1JJVA 2BKVA 4PZLA 4KQIA 2H2IA 4OU4A 1ISRA 1NI4A 4Z9FA 1G2OA 1UT6A 2AN1A 2Z43A 3PVZA 3QELB 1EDDA 1ZJZA 2IQ5A 1PGJA 1YB4A 3DTVB 3J7TA 1Y89A 3MAJA 4QUAA 1Y3CE 4BE7B 4DA0A 2AF3C 3CVUA 2IDJA 4X7BA 2B0JA 5M29A 5BO5A 1U8AA 2C5EA 3FLMA 2B21A 4O4IA 1I3MA 3KQQA 4CLOA 1KOGA 4QTZA 2QTGA 4BL5A 5H80A 4NXNB 1AKNA 4C0BA 3FUXA 4KGDA 4BNNA 2CL7X 2G28A 1SUEA 1J9ZA 4MGHA 2WYIA 4R6XA 4HB0A 3U4MA 3AVQA 4I1UA 3OICA 1GKUB 4R8VA 3FTCA 3JZIA 4GW3A 4MI3A 3GARA 1W88A 3PT9A 3O9VA 4AO8A 1XVAA 1KRHA 2HJHA 1H1TA 2O2SA 3CZ5A 3EK2A 2N1MA 3FTPA 4JITA 1AK9A 2XNDD 1O9GA 2OQ2A 4BLTA 2WYHA 4M37A 3P0EA 3PRYA 4QU5A 5CH5A 1CETA 3FDZA 1IN5A 2H3EA 3EOAI 3FY4A 1LA2A 1NFQA 1NSTA 1OJ7A 3JQEA 4QTTB 3SM9A 1EGQA 1JFFA 3HSKA 3ZD6A 3T5MA 1Y37A 4LRUA 4QRHA 5A4IS 3AERA 4EM6A 2C83A 3N6XA 4XASA 1VLVA 2QD5A 1JAXA 4YMUA 2JI9A 2PNFA 4CF4A 1CDZA 4D98A 2WPDD 2P5UA 5G0VA 4B2IA 1P5ZB 2HV8A 3SDBA 1TK3A 3JD4A 4QU0A 3ED5A 4U7JA 3RC9A 5EJ6A 4KK3A 2EX0A 3VPFA 1F3LA 3C24A 5I3CA 1P60A 4MQEB 3DLAA 3SJCA 2BBSA 3K8QA 5JRZA 2WWFA 3VX3A 1EHYA 1N25A 3CB4A 1LW7A 4J0KA 4C7BA 4DQKA 2J9FA 1QG2A 2P4EA 2PL5A 4IIHA 3H75A 2YYYA 4ZI7F 5AUPB 5L51A 2JJ8A 4GMGA 4IJ5A 4ND3A 5DCLA 3IIEA 2YZNA 1L5QA 4FDLA 4JYAB 2AVNA 3GFPA 2JBAA 4IIFA 2N75A 3QTTA 2IHVA 3HC7A 1K6XA 3PJDA 1F48A 1NMEA 1YTUA 1F8UA 5LA6A 1CUGA 2O3RA 4R40A 5JQGB 3S70A 4AM8A 3G2OA 5EJFA 4F92B 4X97A 2FUNB 1VGRA 1TF7A 2CLDX 4G1FA 1BCSA 1WXQA 1ZO8A 2JF0A 4Q7MB 1RABA 1OZAA 3N74A 1HBJA 3K15A 4WN3A 3C4VA 1WPXA 1E9EA 3IP8A 3H2KA 1SAYA 5AJTA 2E3JA 4ARZA 3UB4A 4EA9A 1EP1B 5JCJA 2V8BA 4DA9A 2QMEA 2EW1A 3OECA 4QOJA 4EJMA 1WNTA 5BW4A 3OZDA 4OHVA 4L4RA 3W6OA 1XHFA 1K4KA 3EG9A 1JAHA 1XVVA 4X7RA 2QDKA 3AEQA 4BZWA 1RC8A 5KOHA 4TUYB 2CMHA 4ZZ1A 2O8VA 4U7FA 1OIXA 2H54A 2OQRA 6LDHA 3DSRA 4ZKEA 3OX1A 1UDCA 1KJWA 4JJ6A 3ZHBA 5BPHA 3BH7A 4PFKA 2WJHA 3ZY5A 1DAHA 2FW0A 4CEIB 2VVTA 1MH1A 4JUFA 1IVYA 3A32A 1WMBA 1Q21A 3KFLA 3KUXA 2ACWA 4P6VF 2ZWIA 1ZCFA 4FHEA 5DNCA 1KBQA 4MUEA 2ZVQX 4UQPA 5C53B 2AE2A 4KTVE 2EERA 4NZYA 3IESA 2HO4A 1D7OA 2Q8QA 3EC7A 3F8SA 3ZY4A 5KNDD 5TS2A 1D0SA 2J9GA 4AWXA 1AJEA 2XUFA 3FVTA 1O77A 4K3VA 4OQXA 4Z9XA 1AMOA 3ZTTA 2QI9F 3M3DA 1A7UA 2GD2A 4A8JC 4UTPA 2FFAA 1MENA 1AXGA 1XCOA 3KHKA 3FAKA 4GZ3A 4JT8A 5JS7A 1M10A 3VDRA 3NHSA 3VKHA 3B3FA 3RFFA 4N3BA 3LPMA 1EBUA 3ETNA 1H5NA 2F3QA 2OZEA 3IE0A 4DR7B 1ZRHA 1GZSA 5D87A 5LB4A 2OILA 3LT4A 1NKTA 2A4MA 3KALA 3BTVA 2E37A 1PDOA 2HF2A 4TYYA 2O7SA 5EZYA 5BNWA 1QHNA 1G6HA 5F35A 3QNMA 1YBVA 4C4ZA 1NLFA 3G89A 5AW7A 1SOUA 4B6JA 5CPBA 2W43A 4XTRA 3SZLA 5IAAA 2JHFA 4DE5A 2XSZA 3GVCA 1XP5A 1VMKA 4JDPA 4CTJA 2G9NA 3EPRA 2V54A 3ZWXA 4CMCA 1KERA 4D8WA 4EL5A 1BE1A 1PDWA 2JFGA 4H6PA 4JL6A 4PG5A 1TYAE 3AF1A 1EX7A 2D1RA 3HL0A 3NTLA 1CK4A 4PCAA 3G8AA 4ZPXA 5IDVA 1Z2DA 1D3AA 3CY6A 4N49A 2DY1A 4WBNA 1IUOA 4DMHA 5EKSA 3PS9A 3UH0A 3ROFA 4AK9A 5IC4A 2VI5A 2BFEA 5L3SA 1YO6A 4OL0A 1BD4A 3UTDA 3WYCA 4UREA 5CVCA 2Y0EA 5GZ3A 1XWIA 2C4KA 3MCTA 3AUSA 1VIMA 4JROA 2HQ1A 3NBMA 1NQTA 3FTEA 1RSZA 3LY8A 2C3UA 2ZT8A 4H1UA 3JPYA 3WQQA 5I9IA 4P82A 2XXAA 1AU9A 1FP7A 2GN4A 1MXFA 2PSHA 1Y1SA 1IMJA 1AXEA 3TJRA 3H1PA 1EGHA 4NBRA 3V1YA 5BT8A 3KLOA 3EVEA 1E0SA 2H65A 3PE6A 4NQRA 5BV0A 4NV1A 1ZNZA 3M70A 2WYWA 4JLAA 1R4MA 3GNSA 5CA1A 2C3OA 3V33A 1L8AA 1V16B 5E1DA 1MAVA 2C7RA 4O4HF 2Q4TA 5EJGA 3EFBA 4FZRA 2VNSA 3E9NA 3ELDA 2Y99A 3MELA 4PLPA 4BFCA 2JGLA 3AOGA 3JYPA 4FXOA 3BUSA 5CTAA 1FUYB 1S8FA 1G8SA 3SX0A 4UM9D 2H2DA 2WJ4A 5DNAA 5ESDA 4YP9A 2QK4A 3LZDA 2HNKA 1NVXQ 2D2EA 2GBLC 4O8CA 4U2EA 2GBFA 2OZPA 3CR7A 4B2LA 4EGAA 4HY3A 3WBKA 1RXSA 3I9V1 5K4GA 4XR9A 4XXHA 1T9ZA 4JJFA 1JIUA 2NZWA 2AI2A 4AU1A 2FN7A 3PX3A 4DM3A 1C9EA 1U3FA 1ID8A 2V7WA 2X15A 2EATA 4E14A 4FR0A 3N76A 3QXHA 4NJEA 4RNDB 3EVBA 3VTAA 1ZA1A 4LVCA 2QSJA 3FYTA 5B6PA 1XPOA 4TTSA 3FRJA 4FHFA 3CVOA 3UXYA 3T1YB 1EFCA 1JVSA 1I33A 2FMFA 2CDAA 2VH2A 4FUQA 2XHZA 3LL4A 4OFZA 5C7OO 3UPUA 1E2EA 1JXAA 5G0UA 2OBNA 2ZB3A 2BUAA 2B9VA 1R0KA 1X1EA 2VDUE 1KMIY 1B6RA 3EFHA 4NZNA 2WT8A 1WCIB 4UEKA 3JD3A 5K6RA 3YASA 1WR8A 4OXIA 3TRKA 4OI2A 3R74A 2A9VA 3I9V6 3KTDA 4MJ3A 1P4GA 3W79A 1I7SB 1YFJA 4Z7NB 2ODAA 1SHJA 4A8JA 1NN1A 1NQAO 2X0NA 3Q0IA 3TOXA 2JLUA 3EPKA 5I4CA 2I76A 3IHLA 5C4MA 2R6ZA 2W6OA 2PMDA 3VR4D 4PU0A 2HO5A 3N0TA 1V0JA 1F6DA 1PKXA 2RKOA 3FUVA 2W6JD 3P0FA 4PG7A 3RROA 3ET5A 3LPLA 4B3GA 1VFPA 2DU8A 4PV7A 1JT9A 4NE2A 5K0EA 1ZW1A 4UNQA 1YMQA 3TQCA 1GPWB 3AEZA 1NRXA 1P2UA 1V8OA 1C4OA 2EWWA 3EMVA 3OM8A 4RTNA 3E9DA 4MV0A 3KOWA 3R9XA 1QV7A 4HAYA 2BW0A 2XKBA 3KTAB 4HTAA 4S1NA 1GQQA 1D8TA 3I9LA 4DZRA 3CE6A 1MOPA 4IDHA 5HA5A 4R51A 3H5RA 2V74B 3B1ZA 3CRMA 4JL5A 3I64A 5H0IA 5GM2A 1WZIA 4K03A 2FWIA 1K63A 3VPAA 3I34X 4YRIA 3FHLA 3LY9A 1KEPA 1SXJE 4NMXB 1YR7A 4JIMA 4ASUA 2ZIAA 2GWRA 3IJEB 2RBGA 3QKRA 4WY5A 3WBFA 3SIRA 5DN6A 4CPDA 2JG3A 4L4YA 1LNSA 1EFUA 4X20A 1C3JA 3OEYA 3OQVA 2D0IA 2H4FA 3JU3A 5KYVA 1KO7A 2ZFUA 5D84A 1CE8A 2CHVA 1VG1A 5FI3A 2WF5A 4MULA 1MV8A 4HWRA 1G7SA 2JLCA 4K5QA 4HL6A 1Z18A 2ZR8A 1QR6A 3KAPA 2Q4DA 2Z83A 2BI8A 3Q3HA 4BNKA 4QVKA 2JCYA 3LGAA 3K0AB 1HRDA 1FFSA 1ONNA 1T0PA 3N58A 5EWJB 4QUIA 3V8RA 3RFCA 4KQHA 1DARA 2GD6A 3HJHA 4N3CA 3SJUA 1ETUA 2PBZA 3OIYA 3R7SA 3V6LA 5JAPA 2BPOA 4G84A 4RD6A 4A27A 5IT4A 3GBVA 1N33B 5I7OA 1W8DA 1VIYA 3WIVA 2EJBA 2C77A 3ESBA 4OQYA 3OQPA 5FBKA 5L3QB 4Z4IA 4RO0A 1OGJA 2X6QA 1BHSA 3PEWA 1YT5A 2ZRMA 5HILA 2ZWAA 3R2JA 4FFRA 1WSWA 4IHJB 3IO5A 4X95A 4V0MA 1CR2A 1ZRNA 2JFNA 2D2XA 2I2WA 4MR8A 3SWWA 3O94A 1PL8A 5FOVA 1ADYA 3VVCA 5I7WA 1EVYA 1IG0A 3D81A 3IIMA 1IN7A 4MAAA 1VCIA 4N5HX 1Q91A 2OFWA 3CURA 1JVNA 2Y92A 1JKIA 2IGTA 3S0JA 2GBLA 1XHEA 2HDOA 1L7MA 3BWVA 4ZRMA 3TR0A 1NR1A 3MMPA 3IQGX 4HO1X 3RVLA 3SHOA 1NXVA 4B46A 4DMUB 3S40A 3HV2A 4Q34A 2WFAA 4KWIA 4B3DA 2C00A 5BR7A 1NBME 1ILWA 7MDHA 3KD2A 4MKXA 5AVJA 2RB5A 3LXRA 3OY7A 3KXIA 5EKTA 1N8SA 1Z5ZA 4BVLA 1ISHA 2WE7A 2AS0A 5DISB 4DC9A 2FX5A 1JV2B 1BFKA 5FUWA 5FDFA 4A23A 5DM70 5I7RA 1APBA 1KSGA 4UNNA 1F6BA 4TSFA 5GINE 4H7FA 2I87A 3ESAA 2FLWA 3Q6MA 2JAXA 2IP4A 3DFIA 1G21A 4MDYA 3L04A 4MKFA 4O5OA 4FYHA 2G36A 4O5AA 3B1VA 2OK7A 3L3BA 3TW8B 5GY7A 4MARA 1V6SA 4OJYA 4I50F 3KQYA 2CFIA 4K9OA 1MDBA 5IFLA 2Z57A 2J6IA 1OPRA 4MJLA 4MB2A 1MV5A 1RMQA 4RSHA 1DIBA 1Z5PA 1TOAA 4V0KA 2O8BB 4J9VA 5T67A 4M87A 3OHSX 3A14A 1NU8A 3HN7A 1CUSA 2PZBA 4N9QA 2BH9A 2OD7A 2YHAA 4RZIA 4TXJA 1UMCB 3WGKA 3KETA 1PVOA 2QXTA 4HN9A 2A5JA 4ER6A 5K3OA 1KO1A 1L4YA 2HSEA 3H7IA 4GLJA 3Q8KA 4UE2A 2YVAA 2PT7A 2NQ2C 2F00A 1CUAA 4RTJA 1MVOA 4B6OA 1EGVB 4BKQA 5EIAA 1JEYB 2HA6A 1QRSA 1NATA 1VE7A 3DZBA 5ALPA 3DLTA 2HRDA 5DWVA 4G56A 3U5ZB 1VKHA 1X94A 4ZYXA 1I0ZA 2X19A 4FLFA 3NEAA 3LMKA 1QE5A 2GPJA 5CT4A 4Q00A 4OLJA 4QDKA 1FS4A 1UF9A 3TLCA 3U16A 4IDAA 5ESRA 3D2AA 1HE4A 2VK8A 3O0DA 3WYDA 4ND8B 4MGKR 2PMFA 3TIFA 4B4OA 4GNKA 2QV7A 4YCCA 2AMVA 1AO0A 4QXOA 3DKKA 2PH3A 4WKPA 4J7XA 2XUPA 3CA8A 3VR5D 4BLUA 2AOUB 2RH9B 5DM60 2R8XA 2J33A 3O90A 1SC6A 3SJ7A 5EP4A 4A16A 1T3LA 3ZHQA 1OH6A 5K8UA 1ZEMA 3IR7A 4FFMA 3W9UA 3PC7A 2Z4RA 4L2IA 3S81A 2MINB 1PEKE 4KP7A 1M7HA 2FPLA 4US0R 5LXTF 3ZIAA 1L5MA 4DV4B 3BWCA 3LIPA 3VAYA 3G82C 1XTKA 4D4MA 1GZ5A 2BKXA 1Z63A 1LX6A 4NEQA 4ZEMA 1T5LA 1W76A 5IJAA 3AW9A 4CI0B 3UNXA 3U6BA 4PAGA 1N4AA 3GPDG 4JOQA 3SMQA 2DPYA 2Z5GA 2DB3A 4D0RA 2LDXA 2P5SA 1VGVA 2R66A 1I7LA 2OCPA 2FRXA 2HMWA 1NSFA 4E4TA 1FSZA 1JVBA 3BWBA 3EARA 3GGGA 1ZM2A 4E03A 1XN1A 2CCGA 4PC1A 3F5MA 2JBHA 2ZWOA 3GCGA 4G2TA 3CRZA 4LE0A 4X85A 1OI7A 1YDMA 4BQPA 2XW6A 4KFSA 4MRAA 1GSAA 4OLFA 5JJBA 5JRDS 2WSYB 1KP2A 3NBQA 2OCDA 4II3A 1JI0A 4NCBA 1DUIA 2EX1A 3V2IA 4XZ3A 4WZZA 3VRHA 4CDGA 4JUIA 1DELA 2WWWA 2WZBA 3TMYA 4M0CA 1AIPA 1MB4A 3IPAA 3LBIA 1GUAA 2VHJA 4LHZA 3AX6A 4BNXA 1NNLA 3R75A 4GBED 3DULA 2V4ZA 3IOMA 1P4SA 4CN8A 2RCYA 4KHZA 3AEKB 4MUMA 4NBUA 4YP6A 1HGXA 4LJ4A 1OA1A 5B1YA 3O3OB 2IUFA 1E4YA 1YA8A 1XPUA 1W0JA 2FSGA 4OH7A 4WACA 4N6GA 1LPBB 3KLBA 1QCDA 3OTHA 1U7HA 1GNTA 2JIRA 4X1YA 1Z25A 4JQYA 5DHRA 1YH3A 5BV8A 3AVTA 3KS9A 5IPFA 3CZ4A 4DV2B 2PVSA 2Z3WA 1UAYA 3FCUB 4XWAA 3CPSA 1ZSNA 1ECJA 1O6CA 1SK8A 1U28C 1W30A 4RLSA 3HL4A 5EIFA 3SQLA 3T5TA 3TDMA 1GCAA 3VHRA 3TLEA 5ABPA 5H5JA 2IXDA 3TEJA 3RADC 1DIAA 5GP1A 3TSWA 4JK3A 4EZEA 5I8WA 1SY7A 1SQGA 3AETB 4GQAA 1E94E 4AULA 4C3UA 3WYBA 4DSZA 4YV2A 5CNMA 4CFZA 2UZAA 4DS3A 4N65A 2YMQA 3N3BC 1H9BA 1UT5A 4XUCA 3ITKA 4QKQA 4RE6A 4R2HA 5J58A 1T8WA 2QIPA 2XCLA 3ZJVA 1HL3A 2GT1A 3IUQA 1MVLA 4UAGA 4YFVA 4D9GA 3SXJA 4UFPA 2W11A 2W2MA 2I8AA 1IUNA 3C3YA 1N3IA 5DM4A 1LK7A 4AJOA 3IE1A 1PT9A 3CM0A 3I9JA 3X1MA 5BVHB 3V4LA 5CA0B 5IJ9A 2F3TA 1X2EA 4M49A 2AZXA 1N78A 1U9YA 3KEFA 3LO5A 4TN5A 4ZV4A 4XFKA 2HPAA 1WOYA 2QP3A 1FTNA 2X1HA 3C6MA 4XJXA 4G9BA 4OJTA 4POAA 3VX4A 5JAIA 1OKKD 1WQ1R 3QE4A 4M0UA 3HLKA 4PRLA 1I7QB 3CYFA 5A4KA 4HNHA 2PD6A 3DPSA 4J91A 1PFGA 4JJ7A 4KLRA 1ISPA 2ZRPA 4TMKA 1CUBA 2H92A 4WPGA 4ENTA 3BMCA 4RBNA 1GPLA 2ACKA 3ENNA 3IUJA 4JT2A 1WJGA 3LE8A 3QNWA 3WJ1A 3N28A 2HHCA 1XEXB 4UHDA 3VU8A 4WLNA 5LU9A 1M74A 2RD2A 3GJ6A 4W5OA 2W71A 3SEAA 3GQBA 5DCUA 1VPTA 1Y3FE 2UZIR 4IF4A 4QOFA 5CAEB 1Z56C 2JNWA 4FOOA 1XELA 2F90A 2ZJ1A 4MQ4A 5AW5A 2F2TA 3NCH