2WDQB

E. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Structure of Escherichia coli succinate:quinone oxidoreductase with an occupied and empty quinone-binding site.
pubmed doi rcsb
total genus 67
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdqB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdqB01
1AYFA 3WCQA 3HVZA 2QIEB 1I7HA 2CU3A 1TJEA 1IUEA 2BS2B 3ZYYX 5EE0A 3EUB2 2BT6A 3VR8B 1SB3C 1WXQA 1TKGA 1F0ZA 2EKIA 3P4PB 1ZXIA 3NRZA 2HTME 3P1MA 1QOFA 1E6EB 1QLBB 1N62A 5G5HA 3SR6A 3ABVB 2PIAA 2WLBA 1RYJA 2W54A 2CJOA 1A70A 1E9MA 3AE9B 2M56B 2BS4B 1J7CA 2WDRB 1RWSA 1WWTA 4LTUA 1JALA 3AE1B 1AWDA 2H89B 2AX5A 3BIID 3RPFC 1CJEA 1SIJA 3AEGB 2ACZB 1N5XA 1XLPA 3AEAB 3P4RB 2OHFA 4JWUC 3CF4A 1L6VA 5EE9A 5H8YE 1J7BA 2MJ3A 3AE7B 3DWGC 3CIRB 4C7YA 2WU2B 3AE6B 5AUKA 3AEBB 3HUIA 4P6VF 1NEKB 2FBWB 5C2TB 3SFEB 1GT8A 1DOIA 1GAQB 1VJKA 1YJIA 3AV8A 3FAHA 2W3SA 2BS3B 1L5PA 2DWQA 1R7SA 1XLOA 3VRAB 1E10A 2CJNA 2L52A 4YXDB 1OFFA 2N0SB 4US8A 1JWAD 1V8CA 1YQ3B 3NVZA 4IDIA 2WDVB 1N63A 1FM0D 1N5WA 3CWIA 4N59A 4FXCA 1EWYC 1FO4A 1FRDA 1KFYB 2MJEA 1DOYA 4WWMA 1OQQA 1PDXA 2DBYA 3ETRA 1QOBA 1L6UA 1ZOYB 3AEDB 1JQ4A 4YTMB 2LEKA 3W5UB 3W5VB 1SF0A 1GPXA 4HROA 4YSXB 2G1EA 2WDQB 3AB5A 2L83A 4USAA 4US9A 1OQRA 3B2FA 5EE3A 3AE8B 1VLBA 5MPOA 1J7AA 1E7PB 1WYGA 4HRSA 2MJDA 4ZHOA 2W55A 3HRDD 1NYQA 1GTEA 1CZPA 1NENB 2MH7A 4C7ZA 1JRPA 4YTPB 4YT0B 5C3JB 1FXAA 2W3RA 4ZHPA 1FXIA 1RFKA 2H88B 2WS3B 4YTNB 3W9CB 3AECB 1JROA 3FC4A 5AUIA 1KF6B 4YSYB 1PUTA 1JW9D 3LXFA 3NVYA 5H92C 1T3QA 1KRHA 1GTHA 1FIQA 2JQRB 1WRIA 2WQYB 3L4PA 1QF6A 2PVGC 2K5PA 1QOGA 3AE3B 4ITKA 4JWSC 3NVWA 3NVVA 3P4SB 1PFDA 2Q5WD 2WU5B 3P4QB 3AE4B 1N60A 1FFVA 3KWLA 3DWMA 3SFDB 1UWMA 1H7XA 2M19A 3AH7A 1B9RA 1NI3A 3VRBB 3AMZA 4N58A 1YQ4B 1WGKA 4WQMA 3VR9B 1TYGB 5G5GA 4ZOHC 4C80A 1XLNA 1RM6C 1DGJA 3AEFB 3AE5B 2KAJA 3PO0A 1JWBD 1FRRA 3LB8C 3AEEB 4KX6B 1ZUD2 1XLQA 2E3TA 4N6EB 1TKEA 3AN1A 1ROEA 2KMMA 3NS1A 1QT9A 1N61A 4A9AA 5GXGB 1E0ZA 1XO3A 2JX5A 3AM9A 1QOAA 2K22A 1V97A 2Y5CA 5EE1A 2WP9B 1H7WA 1FFUA 1DOXA 1L0VB 1FMAD 4JX1C 1NYRA 2B76B 4YSZB 3B2GA 3B9JA 1NVID 1ZP0B 1TKYA 2QJLA 1YJJA 2K9XA 3P63A 3AE2B 2PKOA 1VDVA 2PVOD
chains in the Genus database with same CATH superfamily
2QIEB 4FBJB 3I63C 2NMQA 3P1MA 5HI1A 3ABVB 2JYEA 2CJOA 1LGRA 2LGIA 3NG0A 4MGYE 1XCQL 3N32A 3QARA 2H89B 2IZVB 2OJWA 4J3OD 1H8CA 3MJWA 5EE9A 5H8YE 2Y5PA 3UINB 4EZJA 2I38A 3DHIC 2KLCA 2D3AA 4JIOU 3IAM1 2NPTB 3PVLA 1FCCC 2JWZA 2PLPA 3DBRB 4IG7B 2JRHA 1ZXHA 4MACA 3AEDB 2JSVX 2RDHA 4EE2A 5HG2A 4AUQC 3ZJUA 4HROA 1GNUA 3EFUA 3CSFA 2HD5B 1WM3A 1ET6A 2EKEC 3U30A 2QEJC 1YX6B 4G0NB 4CQNA 2LHDA 2KWDA 4DXGA 1I4RA 1WGHA 1C3TA 1HE8A 3HHMA 4JWSC 3R2IA 4ZYSA 3A9KB 1GG3A 3PSEB 2M17A 4XDDA 1UD7A 1EUVB 2KTRA 3VVWB 1CMXB 3VUXA 3C19A 1ZPSA 2J0JA 1V5TA 4N6EB 3JW0X 2A4ZA 3M3JA 4N9F4 2JX5A 2AL6A 4ZDVA 2XK5A 3VFKA 1FFUA 1L0VB 3A9JB 4HVBA 1JWMD 4DHZE 3R66C 1TKYA 2EMTA 4W9DA 5TR5A 5D6JB 2CU3A 3TIXA 4W9IA 4A6QA 3PPAA 5AZFA 4HJGE 2ZCCA 4PK1A 1N62A 1KJTA 2SAKA 1MHXA 3PRZA 1F52A 5D3IB 2M56B 2BS4B 4WAFA 3EC8A 1VR9A 4E74A 1SIJA 3Q14C 1N5XA 1XLPA 3P4RB 2MJ3A 2INNE 3Q8AA 4C7YA 1YJ1A 3FAHA 3IAS1 3L13A 3MC8A 4S17A 3JSVB 1GJZA 2KJ6A 4IM3A 2L0TA 4LNKA 1K50A 1V8CA 3W1SC 2BVCA 3CWIA 3L0WB 4N59A 2LJIA 1WYWB 2MCNB 1QOBA 1G6JA 3W5UB 1K51A 3CSTA 4DXAB 1FEHA 2D3BA 5EE3A 1LXDA 2C9WB 2FUG1 3JSVA 4K7SA 2JRIB 2KQ4X 3W9CB 1D4BA 2GBMA 3GE3C 1RRBA 2BWFA 4BBNF 1FIQA 1BUIC 4WIPA 5AZGA 3N9YC 2KANA 2CR5A 2BF8B 5BMGA 5BYQA 4B0MA 1VRAB 5D94A 2DLBA 2EELA 2QHOA 3I9V1 1HTQA 4W9FA 2AWTA 1YNTE 3AEFB 2KAJA 1JWBD 3KYDD 1XLQA 3U4EG 4RGNA 1WE6A 4A3PA 3NS8A 1V97A 3GZNI 1FNWA 3MHSD 2X8XX 5FR3A 2PW9A 5HKHA 3ZKJC 4MSQB 1HA5A 3ML8A 2PKOA 1YN4A 1TS4A 1TZOA 4MJSA 4ASWC 1F0ZA 3KH0A 2EKIA 1ZXIA 1E6EB 1LQBA 3LDZE 3NHEB 2PE6B 1KLVA 5CHWA 2WDRB 4NJ7A 1EO6A 2BYFA 5DPSA 3RPFC 1AN8A 3HK0A 1FPYA 3N1YC 4JWUC 4DBGA 4MJSB 3AEBB 1DOXA 5FR6A 3AV8A 1YJIA 1A5RA 2GMIC 1LFDA 2L52A 3U8ZA 3RFZB 4TMAB 1FM0D 2KDFB 4NNJB 2J7QB 3Q8EA 1FRDA 2E6XA 3Q8CA 2R61A 1L4DB 1JRUA 1GOZA 1Z5SB 4RM8A 2WXNA 3R2TA 4FJYA 1B1ZA 1OTRB 4J6IA 4RCOA 1GC6A 4TKNA 5IAAC 2IO3B 4PS3A 1VLBA 1E7PB 2EMSA 2W55A 3DVGY 3QA8A 2VRRB 1CZPA 4RGOS 1N6ZA 1FXAA 5AZHA 3APCA 2FCNA 4WJOA 2V1YA 3AECB 2MBEA 2KDBA 1KRHA 2L76A 4HXDA 1YN3A 1FFVA 4D2KA 1UWMA 5DPWA 1FNUA 2MQJA 5C23A 4W9EA 4AP4C 3TMPB 3UGBB 3NZUA 1E8YA 4XE0A 2K8CA 5LLIA 3AEEB 4WURA 1GB1A 1V81A 2J52A 3DCGA 2FCQA 2I1KA 4DDID 3AI5A 4WWNA 1KTKA 1PGAA 1TS5A 4US9A 2HDEA 4BVUC 1UGJA 5BMHA 2DZIA 1T0SC 3ZJVA 3ZXRA 3QX1A 1V1PB 4FN2A 2IBIB 3SDLC 2LFIA 2PIAA 1D5MC 2BGFA 2W54A 2XK5B 3JYUA 1J7CA 1SIFA 2BW2A 1WJ4A 4O1NA 1SE4A 3AE7B 1MJDA 3S2AA 2KDEB 3C0RB 1PGBA 1L5PA 2RDGA 4H2AA 3PT2B 4US8A 4BFRA 4A55A 4R3DA 1FO4A 2MJEA 3EA6A 2DBYA 1ZOYB 1Q0WB 2AL3A 2M1MA 3TBLD 4HPLB 1FNVA 3L08A 4EUTA 3ZXVA 5I4DA 5CX3A 2ZW1A 4YTPB 1TT5B 4F1SA 1C79A 3DDCB 3M63B 3W1YA 2JQRB 2WXRA 1S3SG 3P4SB 1PFDA 2DYOA 2M19A 1JWSD 3AMZA 2LRUA 2OEDA 4P1CC 2Y5BB 2ZPNA 1TYGB 1XLNA 4KIKA 2VZKD 1E7UA 2MP2B 2L32A 3V05A 2D3CA 2FCSA 3IT4B 4BKSD 4L23A 4DK5A 1VCBA 2N7JA 2O2VA 3Q6BA 1NYRA 3KW5B 1SXTA 1NVID 2QC8A 3OJ3A 2LI5A 1VDVA 1R4NB 3L10B 3PZDA 2WHIA 3U52E 5JXVA 4BBNC 3EUB2 2ZVNA 1GUAB 2WNMA 4NY0A 2LXCA 3V6CB 2KLGA 1Y8RC 4EOYA 3RN9C 1WWTA 1E90A 4AQ7A 1OQYA 4FULA 2ACZB 3HIZA 3Q3FA 1NI2A 1L0YB 3TL5A 1XEEA 4ZRIA 1R4NI 4MM3A 3MHZA 4P6VF 3VUYA 1SE3A 1I4HA 1WZ3A 1IP9A 1R7SA 3J9CA 3IHPC 1E10A 1JWAD 1WM2A 5FK9C 3DBRI 1WY8A 2PE9A 4WWMA 4BOSC 1FCLA 5E6JA 1L6UA 1XF5L 1BMLC 2I1JA 1L2NA 3RMKC 1PQSA 4USAA 4PT5A 3BYYB 1WYGA 3BINA 3R7QA 3P2BA 2RPQA 2K39A 2NVUI 1TGZB 5JHBA 1JRPA 4ZHPA 2WS3B 4I6LB 1PUTA 3A1QB 3SEBA 4JLCA 1QF6A 2PVGC 2LGDA 4RGTA 1XD3B 3VUWA 3KWLA 3O13A 2JZPA 1B9RA 4XGAB 4TQ0A 2G45B 4BOZB 4MGIE 4NJ6A 2YVCA 3L16A 2KMAA 3QWZB 1KH0A 3LJ3A 2KQSA 3B1LX 3DBHB 3EFCA 2QJLA 4TUUA 1E8XA 1C78A 1IPGA 2LD9A 3WCQA 1NDDA 3MFGA 3ZYYX 5EE0A 3VR8B 4IW0A 5G5HA 2L3ZA 2FIDA 3Q3NC 3AU4A 5JZEB 3U7ZA 4GDLB 3LYYA 2D07B 4IOIE 3OJ4B 1YOVB 2CS4A 3DPDA 3CIRB 4KKIA 2KOXA 1VJKA 4KVGB 4AJYB 4IWQA 3VRAB 2WXHA 4TV3A 1WFYA 2AEHA 2BKRB 1WI0A 3MC9A 1IGCA 4IDIA 3NOBA 1WX9A 2INCC 1KFYB 5BMIA 1WR1A 3ETRA 3Q3OC 3PS6A 1WRDB 4M0WB 4P7IA 4IUMB 2CU1A 3K9PB 3AE8B 2WXJA 1Z2MA 1IBXA 2KXJA 1UWXA 1P7FA 2JU6X 1VD2A 2VH2A 2N1WA 4MEMA 2VH1A 3FILA 2MW5A 3GOEA 2KX3A 1FD6A 4XC2A 1JW9D 3NVYA 1UBIA 3PTFC 2ICIA 2K5PA 5E6NA 2QDFA 1TY0A 4C00A 1Y56A 4KZ0A 1IBXB 1BT0A 5EDSA 2KFKA 2UU7A 2GRIA 2IPKD 2JZZA 2KWCA 3UI3A 2KHWB 3GZNB 3DVGX 2RMMA 1FMAD 2IGDA 3BZDB 4NAMA 2INPE 2W82A 3WALA 4KIKB 3ECIA 3WAPA 1K8RB 1VZ8A 2DAFA 4FLHA 3PHXB 5D7GA 4TSSA 1CQVA 1V9JA 2G4SA 2J53A 3ZNZB 2BYEA 3ZTCA 2LUEA 1OEYJ 3GE8C 1RWSA 3K9OB 2O2VB 3BIID 3DBLB 3B0AA 4K7UA 3ZDTA 2OHFA 2JUOA 3V62A 1YMHE 2DZJA 1WMHB 2FAZA 4ICUA 1WZ0A 5C2TB 2MRPA 3QIJA 1C9FA 2IY1B 1WF9A 2NBVB 4E3CA 1IYFA 2DAJA 4CYEA 2JPHA 2KWUB 3ZNID 3HM6X 3ZGZA 3RT3B 3EECA 4ZYNA 2C60A 4MELA 1EWCA 2PJHA 4EKUA 2FCMA 3T8MA 4HRSA 3H6NA 4KV2A 3BYTB 3PV1A 1GTEA 4JGHB 2W3RA 4RH6A 1HZ5A 3CMMB 2IO1B 4GIVA 3V61A 1E8WA 4G3XB 4E71A 2M8SA 2KJRA 2BTEA 4B6WA 4W9HA 2KO3A 2G3QB 4WJNA 4KDLB 1XXGA 1LM8B 4MT5A 1H4RA 3AE5B 4K1RB 1OGWA 3A1QA 2LGYA 1UF0A 2LASA 2LRWA 4KDIC 3DHHC 2IY0B 2D10A 2FNJB 2LUMA 3QK0A 4M8MA 5TSSA 4PYZA 2V4LA 2KNBA 4IM0A 4B0EA 1EU4A 1PGXA 4ZRJA 2XN9C 1D3ZA 1AYFA 1UBQA 4KSLC 2YLMA 4ZRQA 3U7DA 4K3CA 2KJHB 1JMLA 3T3NA 2JZ3B 2V3SA 1V86A 1QOFA 5L83A 3EGRA 2DHZA 1RYJA 1SSNA 2MX2A 2HJ1A 2KN5A 4FJVB 2N9LA 3ZRCA 3M62B 2B3AA 2MHJA 1L6VA 4AOFA 2DZMA 2N4FA 2V3PA 1NEKB 1EF1A 4LNNA 2ZNVC 4I6PA 4OVZA 2DWQA 2GBJA 1SE9A 3OWEB 1WX8A 1XCTL 3A4SC 4DDGD 1C4PA 4GGQA 3N20C 4FXCA 2O6VB 4FADA 1OQQA 5GMVA 3W5VB 1SF0A 1WSPA 2J4XA 1VZ6A 2DZKA 2GB1A 4HEA1 3HVDA 3KUZA 5IA7A 3R3MA 4RF1A 4C7ZA 1EU3A 1FXIA 2H88B 3FC4A 2O6VA 3DQVA 3RCZA 2LMCA 1KM7A 1QOGA 3ZO5B 3CF6E 3ALBA 4MSMB 5IN7A 1STEA 5IP4D 4TQ1A 4W9GA 1WGKA 3PRMB 3WA0A 4K3BA 3PZ8A 1E7VA 3H7PB 3KLSX 4PYUA 2AYOB 4S0RA 3BVZA 2KKCA 2WXOA 1ROEA 1N61A 2BYVE 2C7MB 4X57B 1E0ZA 4L2YA 3WANA 2ZPYA 2ZW0A 1H7WA 4K81A 3SD5A 3TJPA 2M4NA 2PPHA 2WXLA 3P63A 1YX5B 2K9XA 2PVOD 4C4VA 1MG8A 2FIFA 4HCPB 1UH6A 2N9XA 2BT6A 2DYMA 2VZKB 1SB3C 3O65B 2Z0DB 2WGSA 2K1FA 1PYWD 4HLEA 4HPPA 5CHFA 3AE9B 5KHQA 1C1YB 4ZRKA 4NAWB 4C4VB 3I3TB 2R2QA 3HUIA 3BK1A 3SFEB 2BS3B 1XLOA 4W9LA 5T8IA 2IJ0A 4FHKA 1SJED 1YQ3B 4F8CB 3TEWA 4HKQA 2KMCA 2JYTA 1PDXA 2KZRA 1K52A 4XZ4A 4NAWA 2G1EA 3D32A 4REZA 1J7AA 4GSWA 1HEZE 3VAWA 4FA6A 1NENB 4YT0B 2Z8LA 4YSYB 5CHVC 4GMVA 1RAXA 1UZXB 1GTHA 2G4DB 3AE3B 3ZNHB 3NVVA 2KACA 1WE7A 2L7RA 3IFWB 1WGDA 3QHTA 4N58A 4I6NB 2V9HA 2ZEQA 5L95C 5BYSA 1WIAA 2LVOA 3R8BA 3BY4B 2E3TA 4A90A 4JE3B 2RGFA 2BWES 1V1OA 4IC7B 3URYA 3A9KA 2WXFA 3DBHI 5EE1A 2J42A 4RMAA 4XWWA 2B76B 4YSZB 2DENB 3WAMA 2MEKA 3MTNB 4LCDE 5J17A 4W9KA 1P9DU 4JQWC 1I42A 2L0FA 1I7HA 1YIWA 2KC2A 1TJEA 1IUEA 3DOWA 3QJZA 2GBKA 2D5GA 2N9EB 3NRZA 3P4PB 1ZGUB 4KKJA 5C1ZA 3Q8FA 3RYTA 4BAXA 3DVNU 2RDBC 2IO0B 1GC7A 3VTVA 1J7BA 1P98A 1OEYA 2WU2B 1ESFA 4RM9A 1WJ6A 5J18A 4IKGA 1L4ZB 4YXDB 2N0SB 3Q8BA 4MGZE 4LNIA 3BK2A 2IYDB 1JWUD 1JQ4A 4YTMB 4HWIB 4KSKC 2WDQB 5MPOA 2D2QA 1CK1A 2V3NA 2CKHB 1U4AA 4WJPA 3N1ZC 1WR6E 3A33B 1ZW7A 4GB9A 3NUHB 1KLUD 2SEBD 1WGRA 4GN1A 3ZRFA 4DWFA 2UYZB 2LGXA 4BZAA 2C5LC 2WU5B 5IOIA 4AWJA 5JH5C 1WX7A 1H7XA 3BVGA 1YQ4B 4BKSA 4MH8A 1ZDXA 3PO0A 1VZ7A 4XWTA 2UWQA 3AN1A 3NS1A 1Q10A 4P1BC 3RNAC 2K0PA 2K8BA 3PLUA 2K25A 4NPNA 3E9SA 1WXAA 2ON8A 4B95A 4JX1C 4XX5A 3SU8X 3B9JA 4ANXA 3Q2AC 4EFOA 3FKYA 4WH4A 2AQ3B 3R7RA 2GI9A 2X38A 1WXQA 1WXVA 2KTFA 3GS2A 2LHEA 2MBQA 1QLBB 1I4PA 3A4RA 1T5XD 3PGEA 1E9MA 3V6EB 4GDKB 4DHZB 3NZ3A 2QSDA 4G50A 2NBUA 5IO9A 2CHXA 3RNFC 5G55A 2JXTA 2CJNA 3VH3B 2WDVB 2WXIA 2NTSA 1EWYC 2CHZA 3KUDB 2KFJA 2K8HA 3W2DA 4OZAA 2DX5B 1UELA 1KOTA 2REXA 2M0XA 3I5JC 5D2MB 2MJDA 1V80A 3M95A 4GU2A 2KVRA 3QAQA 1RFKA 2D11A 4K7WA 1KF6B 2J0MA 2M0AA 2RPVA 3KWVA 4A20A 1UNSA 1Q5WB 2LXAA 2Q5WD 1EM7A 1ET9A 2PTLA 3VTUA 2N9PC 3GP7A 5HHDG 3ZUNA 2KYWA 2GLSA 2WXMA 1P3QU 3RUIB 4KX6B 4PS7A 1S1QB 3KVFB 3NZSA 1WXMA 4GDLA 3RZFA 4DHJB 4JPSA 1WJUA 3DBLI 2LJ5A 3SR6A 3IT6B 2WXKA 1A70A 1AARA 2KVZA 1SGHA 3UQBA 3UIPB 1AWDA 1MHHE 4UDUC 4WJQA 5D3DA 2I2YA 4HDQA 4XYCA 1F2RI 3L54A 2XEWA 3AE6B 5AUKA 1F9JA 1DOIA 4LDTD 1V1PA 2G9HD 1OFFA 2LWPA 2PMVA 2MWSB 4AS1A 1QKZA 2KWVB 1BXTA 3DHGC 2BYTA 4IWPA 1P1AA 4LNOA 1T0QC 4YSXB 2BPSA 3APDA 1I35A 1J8CA 2MLBA 1AW7A 1K53A 2WWZA 4HDOA 4RFBA 3GB1A 4F7ZA 4ZRPA 2L05A 2NBWB 2RD0A 1C4AA 3T9LA 4OVUA 3NVWA 4ANWA 2OJRA 4QAYA 1C77A 4II2B 2IGHA 4ANUA 1WXSA 2KD0A 4WQMA 3SHQA 3WAOA 1JCKB 5G2NA 2GBNA 1DGJA 3ENEA 1YQBA 3ZLZA 1FRRA 1P0RA 1ZUD2 4M00A 2DNFA 1L0XB 3MC0B 2MBHA 1V2YA 3L17A 2WP9B 2QILA 1RFAA 3MJ5A 2IO2B 3ZVVA 3EHVA 3IBEA 2BQQA 3TEYA 1HXYD 4MM3B 1TS3A 2BS2B 1TKGA 4PS8A 1TBEA 2O6VD 3UQAA 4EZLA 4EZKA 4ANVA 1L7YA 2NCNA 3ZW3A 3VDZA 3IVFA 4ICVA 4LDTB 3PRPB 1XT9B 4KGRA 3W1SA 3B08A 1MVKA 1GT8A 5CTRC 3TCAA 2NR2A 4BKGA 2JF5A 2N1VA 3ONSA 1WGGA 2LZ6A 2OOBB 4MGKE 3HM3A 1D5XC 3KYCD 3V3XA 3N30A 1T6BX 2CHWA 3AB5A 1QZEA 2A5UA 4NQLB 4DQOC 1QILA 2AQ1B 5C3JB 4M8NA 3TSSA 4OZBA 3RD2A 1EF5A 4FHJA 1T3QA 3RNBC 5LXHA 3Q3MC 3RZWC 3IG3A 1MFWA 3SFDB 1T0RC 3ZDMC 2L1AA 3VRBB 5HFYA 5KHOA 3VR9B 5G5GA 4W9CA 4ZOHC 3VQIA 2KT7A 4ARCA 1QQRA 2YEPB 1TY2A 3AU5A 3QCAA 4FJZA 3V60A 5GXGB 1XO3A 2AQ2B 3AM9A 3PHWB 3NY5A 2KFKB 2NS5A 5JHAA 1MG4A 1YJJA 2KC1A 3TEZA 4B9KA 3RI7C 2D3GA 4EEWA 4HPMB 3AXCA 1D5ZC 2Y3AA 1ACCA 2WLBA 1FXTB 1YN5A 4W9JA 2Z59B 2ZCBA 3AE1B 2AX5A 4WQOB 3QQ8B 1J19A 1CJEA 4ACFA 3AEGB 5AEKB 4M0WA 1TIFA 3I57A 3DWGC 2IDYA 4KGTA 2JWUA 1C4CA 4YL8A 2V4IB 4JL9A 3TUOA 1ZKHA 4HKZE 3MP9A 5FKAC 4GXBA 1C76A 2BKFA 1R4MI 1KLGD 2ONQA 3QC8B 2L83A 2V0GA 1OQRA 1I4GA 1M94A 5BYRA 4ZHOA 4G11A 1NYQA 3TEXA 2MBBB 3ZNGC 2WX1A 1UGMA 4HJKA 2MSED 2W9NA 3KUCB 3Q3JA 3BWUD 5LXIB 5H92C 2L00B 2QMTA 4CO7A 1DYQA 1SBBB 1F77A 3P4QB 1N60A 1P7EA 1E5WA 3PREA 4HCNB 3VXWA 2JVCA 4NJCA 1V5OA 4IM2A 1WGYA 1R4MB 3LB8C 2WDTB 3C8YA 3OLMD 2RSUA 4ARIA 2IGGA 3RNEC 3DVNV 1SE2A 4L1BA 2KQ7A 3B2GA 4LK0M 2J0KA 3AE2B 1ENFA 2BBCA 1WMHA 4AJWA 2INDC 2MP2A 2GOWA 2HTME 3P42A 4KZCA 2NPTA 2WXPA 1JALA 4M02A 1NBFC 4IWOA 4LJPB 4M01A 1MI0A 4GOCA 3CF4A 2K3UA 2JY6A 4URKA 2ZZPB 2C7HA 2LGSA 4NQKE 4WAAA 4OZCA 2HTHA 2Z0EB 4P16A 2FUHB 5IKCM 2DYBA 1N5WA 2BB6A 4RNAA 2WYQA 1T0YA 5E6PA 5LNK1 3H9DA 4CHKA 3KQ4A 3ZJTA 3H1UA 3VTWA 4DHJD 3HRDD 3PZ7A 2KTRB 2MA9B 1JROA 5AUIA 3E56A 3LXFA 2KDIA 2BB5A 4OW0A 1WRIA 2WQYB 2ASQA 1TS2A 5BO4B 2KK8A 3AULA 3AE4B 2C7NB 2XBBC 1GB4A 3AH7A 1NI3A 3A9JA 1F1HA 2JXXA 1MPEA 4WWOA 2LVQA 1I4QA 4DXFA 4C80A 2ZNVB 1RM6C 3VH4B 3VHTC 2K6DB 1UUPA 1WJNA 1QT9A 2R2OA 4A9AA 3RULA 3DBSA 2JT4B 1WH3A 2YEPF 4WWPA 2KDMA 3PLVA 2LVPA 1HZ6A 2N7DA 4Q2JA 2ZJDA 2QCZA 2ZVOA 3RNCC 3N3KB 1GPXA 4NZLB 4OHJA 3HVZA 3ZTDA 2K6QA 3ZIMA 2TSSA 1I4XA 1HTOA 1M4VA 3H7SA 2GBRA 5DCNA 1ISNA 1HQRD 4MDKE 4LTUA 1LO5D 1J0GA 2KN4A 3WIMA 2L8JA 2HE7A 3AEAB 4HK2A 3BVMA 1YD8U 3IXSA 1ZDVA 2NTTA 4RF0A 2FBWB 4XDCA 3H8HA 3OG5A 1GAQB 1E8ZA 4GLSC 1Q1OA 2W3SA 3APFA 2N7EA 2HJ8A 1TTNA 2N9KA 1SJHD 4BKTA 1TZ1A 3NVZA 1ZE3D 1N63A 4MH0E 4II3B 2XNAC 1DOYA 1RLFA 3OAWA 1XQQA 3T3OA 3ML9A 1V49A 3X0WA 3B2FA 5DPRA 4LNFA 4KGSA 2WXQA 5DPTA 2PEAA 3UIOB 2MH7A 3H7PA 4YTNB 2KX0A 4OVVA 2MBOA 3L4PA 4ITKA 3NJTA 3N1XC 2FE8A 3DWMA 3ZQ4A 1F2RC 1D6EC 2WX0A 4RGMA 4YWGG 3U2SC 4LLGM 1SEBD 4C56C 3FILB 4A8XC 5E6OA 3X23A 1IGDA 3RNGC 2RR9A 1TKEA 2KMMA 4LJOB 5J2RA 1QOAA 2K22A 2Y5CA 1V6EA 4GDKA 4A3OA 1X1MA 3Q69A 3UF8A 1ZP0B 2LEKA 3JVZX 2WXGA
chains in the Genus database with same CATH topology
3TEYA 2QIEB 1HXYD 4MM3B 3U52E 1TS3A 5JXVA 2BS2B 2NMQA 3EUB2 2BT6A 2DYMA 2VZKB 1SB3C 1TKGA 2WNMA 3P1MA 1PYWD 5HI1A 3ABVB 2JYEA 2CJOA 3AE9B 2LGIA 1WWTA 1XCQL 2H89B 4AQ7A 2ACZB 4J3OD 4NAWB 1L0YB 5EE9A 2Y5PA 1XEEA 4KGRA 5H8YE 3W1SA 1MVKA 3HUIA 3MHZA 3BK1A 3SFEB 2I38A 1GT8A 1I4HA 1SE3A 4P6VF 2BS3B 1R7SA 1XLOA 5T8IA 3J9CA 2IJ0A 1E10A 3IAM1 1FCCC 1JWAD 1YQ3B 1SJED 3TEWA 4HKQA 5FK9C 2PLPA 4WWMA 2JYTA 1FCLA 1PDXA 1D5XC 5E6JA 1ZXHA 1K52A 1L6UA 3AEDB 2JSVX 1XF5L 2RDHA 4MACA 3V3XA 4EE2A 1BMLC 1T6BX 5HG2A 3ZJUA 4HROA 2G1EA 3AB5A 4USAA 4REZA 1J7AA 4PT5A 3BYYB 1HEZE 1WYGA 1ET6A 4DQOC 1NENB 1JRPA 1QILA 2AQ1B 4YT0B 5C3JB 4ZHPA 2QEJC 2WS3B 2Z8LA 4CQNA 3TSSA 2LHDA 1PUTA 4YSYB 2KWDA 4OZBA 4DXGA 1I4RA 1T3QA 3SEBA 1GTHA 1QF6A 2PVGC 4RGTA 3AE3B 4JWSC 3R2IA 3NVVA 4ZYSA 2KACA 3KWLA 3SFDB 3O13A 2JZPA 1B9RA 2L1AA 4XDDA 3VRBB 4TQ0A 4N58A 5HFYA 3VR9B 5G5GA 5BYSA 4ZOHC 3VQIA 3R8BA 4ARCA 1QQRA 2YEPB 1TY2A 1ZPSA 2E3TA 4A90A 4N6EB 4JE3B 5GXGB 1KH0A 1XO3A 1V1OA 2AQ2B 2JX5A 3AM9A 3URYA 2WXFA 5EE1A 2J42A 1FFUA 1L0VB 4XWWA 2B76B 4YSZB 1JWMD 1TKYA 2QJLA 2MEKA 1YJJA 3TEZA 1C78A 3WCQA 1I7HA 2CU3A 4A6QA 1TJEA 1IUEA 3MFGA 3ZYYX 5EE0A 3VR8B 1D5ZC 2D5GA 3NRZA 3P4PB 5G5HA 4HJGE 1N62A 2Y3AA 4KKJA 2SAKA 1MHXA 1ACCA 2WLBA 5D3IB 3U7ZA 2M56B 2BS4B 1YN5A 3Q8FA 4WAFA 4GDLB 3LYYA 1VR9A 3AE1B 4IOIE 2AX5A 1CJEA 1SIJA 3AEGB 4M0WA 1N5XA 1XLPA 3P4RB 3I57A 1J7BA 2MJ3A 2INNE 3DWGC 3Q8AA 3CIRB 2IDYA 4C7YA 2WU2B 4KKIA 1ESFA 3FAHA 1VJKA 3IAS1 4KGTA 3VRAB 2JWUA 1C4CA 2WXHA 1L4ZB 4IKGA 2V4IB 3TUOA 4YXDB 2N0SB 3Q8BA 1IGCA 1K50A 1V8CA 4HKZE 4IDIA 3BK2A 3CWIA 4N59A 2LJIA 1KFYB 3MP9A 5BMIA 5FKAC 3ETRA 1QOBA 1JWUD 1JQ4A 4YTMB 1C76A 3W5UB 1K51A 1KLGD 2WDQB 2ONQA 1FEHA 2L83A 2V0GA 1OQRA 5EE3A 3AE8B 2WXJA 5MPOA 1IBXA 1CK1A 1UWXA 1I4GA 5BYRA 2FUG1 1P7FA 2JU6X 2V3NA 4ZHOA 1NYQA 3TEXA 3FILA 2KQ4X 3NUHB 1FD6A 1KLUD 3W9CB 1JW9D 3NVYA 1D4BA 3BWUD 2SEBD 5H92C 1FIQA 2ICIA 2QMTA 1BUIC 1DYQA 1SBBB 4WIPA 1F77A 2K5PA 3N9YC 2WU5B 3P4QB 1TY0A 1N60A 1Y56A 5BYQA 5BMGA 1P7EA 1H7XA 4B0MA 3BVGA 1VRAB 1IBXB 1YQ4B 2DLBA 2EELA 3I9V1 2GRIA 4NJCA 4MH8A 1YNTE 3AEFB 1ZDXA 2KAJA 3PO0A 1JWBD 1VZ7A 2IPKD 3LB8C 4XWTA 3C8YA 1XLQA 3U4EG 3UI3A 3AN1A 3NS1A 4ARIA 1Q10A 2IGGA 4RGNA 2K0PA 1SE2A 1V97A 3E9SA 2RMMA 2ON8A 4L1BA 1FNWA 5FR3A 1FMAD 2IGDA 2PW9A 3B2GA 3BZDB 3B9JA 4JX1C 4LK0M 1HA5A 4NAMA 3AE2B 2PKOA 1YN4A 2INPE 2W82A 1ENFA 1TS4A 1TZOA 4WH4A 2BBCA 2AQ3B 1VZ8A 2GI9A 2X38A 1WXQA 1F0ZA 3GS2A 2EKIA 5D7GA 1ZXIA 2LHEA 2HTME 1E6EB 1QLBB 4TSSA 1CQVA 1I4PA 3P42A 2J53A 1T5XD 1E9MA 2WXPA 2WDRB 1RWSA 4GDKB 1JALA 1MI0A 3BIID 3RPFC 3NZ3A 1AN8A 2OHFA 3CF4A 4JWUC 2K3UA 1YMHE 2QSDA 3AEBB 1DOXA 5C2TB 3AV8A 1YJIA 2JXTA 4OZCA 2CJNA 2L52A 1C9FA 4P16A 3RFZB 4TMAB 2WDVB 2WXIA 1FM0D 1N5WA 2BB6A 2NTSA 1EWYC 3Q8EA 1FRDA 2E6XA 4RNAA 3Q8CA 2R61A 1L4DB 5LNK1 1GOZA 3W2DA 4OZAA 3ZGZA 2WXNA 3R2TA 3KQ4A 3ZJTA 1B1ZA 4RCOA 1EWCA 1VLBA 1E7PB 4HRSA 2MJDA 2W55A 3BYTB 3HRDD 3PZ7A 1GTEA 1CZPA 4RGOS 1FXAA 2W3RA 4RH6A 1RFKA 1HZ5A 3AECB 1JROA 5AUIA 1KF6B 2M0AA 2RPVA 3E56A 3KWVA 3LXFA 1UNSA 1KRHA 2BB5A 4OW0A 1WRIA 2WQYB 1TS2A 2Q5WD 1EM7A 1YN3A 3AE4B 1ET9A 1FFVA 2PTLA 4D2KA 1UWMA 3AH7A 2BTEA 1GB4A 1NI3A 3GP7A 1FNUA 5HHDG 1MPEA 1XXGA 4MT5A 1I4QA 4DXFA 4C80A 1RM6C 2WXMA 4XE0A 3AE5B 1UUPA 3AEEB 4KX6B 4WURA 1GB1A 2J52A 1QT9A 2LUMA 4A9AA 2YEPF 2KDMA 5TSSA 1HZ6A 4Q2JA 1KTKA 1PGAA 4B0EA 1EU4A 1TS5A 4US9A 2WXGA 1PGXA 2HDEA 2XN9C 1GPXA 1AYFA 4NZLB 1UGJA 4OHJA 3HVZA 4JPSA 5BMHA 4ZRQA 3ZJVA 1JMLA 3T3NA 2TSSA 1I4XA 1V1PB 1M4VA 1QOFA 3EGRA 3SR6A 2LFIA 3IT6B 2WXKA 2PIAA 1HQRD 1RYJA 1SSNA 1D5MC 2W54A 1A70A 1J7CA 4LTUA 1LO5D 2N9LA 1AWDA 1MHHE 2BW2A 2KN4A 4UDUC 5D3DA 2I2YA 4O1NA 3AEAB 3BVMA 1L6VA 1SE4A 3AE7B 1F2RI 3IXSA 1ZDVA 3AE6B 2V3PA 5AUKA 2NTTA 4RF0A 1NEKB 2FBWB 1DOIA 3H8HA 1GAQB 4XDCA 4OVZA 4GLSC 2W3SA 1PGBA 1L5PA 2DWQA 1V1PA 2N9KA 2RDGA 4H2AA 3OWEB 2G9HD 1SJHD 1XCTL 1OFFA 2PMVA 4US8A 3NVZA 1C4PA 4AS1A 1ZE3D 1N63A 1QKZA 4A55A 4R3DA 1FO4A 4FXCA 2MJEA 1BXTA 2XNAC 1DOYA 1OQQA 3EA6A 2DBYA 2BYTA 1ZOYB 3W5VB 1SF0A 3T3OA 1WSPA 2J4XA 4YSXB 3B2FA 1FNVA 1VZ6A 5I4DA 2GB1A 4HEA1 3HVDA 1AW7A 1K53A 4KGSA 2WXQA 4RFBA 4RF1A 2MH7A 3GB1A 4C7ZA 2ZW1A 4ZRPA 4YTPB 1EU3A 1FXIA 2H88B 4YTNB 1C79A 3FC4A 3L4PA 2JQRB 2LMCA 4ITKA 1C4AA 1QOGA 2WXRA 3NVWA 3P4SB 1PFDA 2DYOA 2FE8A 1C77A 3DWMA 1STEA 2M19A 1F2RC 2IGHA 3ZQ4A 1D6EC 1JWSD 3AMZA 4RGMA 4TQ1A 2OEDA 4YWGG 1WGKA 3U2SC 4WQMA 4LLGM 1SEBD 1TYGB 1JCKB 1XLNA 4C56C 3FILB 1DGJA 4A8XC 2VZKD 3PZ8A 1IGDA 3KLSX 1FRRA 1ZUD2 3BVZA 2L32A 3V05A 2WXOA 1TKEA 1ROEA 2KMMA 1N61A 3IT4B 4L23A 1E0ZA 1L0XB 3MC0B 1QOAA 4L2YA 2K22A 2ZW0A 2Y5CA 2N7JA 2WP9B 1H7WA 2QILA 1NYRA 3MJ5A 1SXTA 1NVID 1ZP0B 2WXLA 3P63A 2LEKA 2K9XA 3Q69A 1VDVA 2PVOD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYF A;  3WCQ A;  3HVZ A;  2QIE B;  1I7H A;  2CU3 A;  1TJE A;  1IUE A;  2BS2 B;  3ZYY X;  5EE0 A;  3EUB 2;  2BT6 A;  3VR8 B;  1SB3 C;  1WXQ A;  1TKG A;  1F0Z A;  2EKI A;  3P4P B;  1ZXI A;  3NRZ A;  2HTM E;  3P1M A;  1QOF A;  1E6E B;  1QLB B;  1N62 A;  5G5H A;  3SR6 A;  3ABV B;  2PIA A;  2WLB A;  1RYJ A;  2W54 A;  2CJO A;  1A70 A;  1E9M A;  3AE9 B;  2M56 B;  2BS4 B;  1J7C A;  2WDR B;  1RWS A;  1WWT A;  4LTU A;  1JAL A;  3AE1 B;  1AWD A;  2H89 B;  2AX5 A;  3BII D;  3RPF C;  1CJE A;  1SIJ A;  3AEG B;  2ACZ B;  1N5X A;  1XLP A;  3AEA B;  3P4R B;  2OHF A;  4JWU C;  3CF4 A;  1L6V A;  5EE9 A;  5H8Y E;  1J7B A;  2MJ3 A;  3AE7 B;  3DWG C;  3CIR B;  4C7Y A;  2WU2 B;  3AE6 B;  5AUK A;  3AEB B;  3HUI A;  4P6V F;  1NEK B;  2FBW B;  5C2T B;  3SFE B;  1GT8 A;  1DOI A;  1GAQ B;  1VJK A;  1YJI A;  3AV8 A;  3FAH A;  2W3S A;  2BS3 B;  1L5P A;  2DWQ A;  1R7S A;  1XLO A;  3VRA B;  1E10 A;  2CJN A;  2L52 A;  4YXD B;  1OFF A;  2N0S B;  4US8 A;  1JWA D;  1V8C A;  1YQ3 B;  3NVZ A;  4IDI A;  2WDV B;  1N63 A;  1FM0 D;  1N5W A;  3CWI A;  4N59 A;  4FXC A;  1EWY C;  1FO4 A;  1FRD A;  1KFY B;  2MJE A;  1DOY A;  4WWM A;  1OQQ A;  1PDX A;  2DBY A;  3ETR A;  1QOB A;  1L6U A;  1ZOY B;  3AED B;  1JQ4 A;  4YTM B;  2LEK A;  3W5U B;  3W5V B;  1SF0 A;  1GPX A;  4HRO A;  4YSX B;  2G1E A;  2WDQ B;  3AB5 A;  2L83 A;  4USA A;  4US9 A;  1OQR A;  3B2F A;  5EE3 A;  3AE8 B;  1VLB A;  5MPO A;  1J7A A;  1E7P B;  1WYG A;  4HRS A;  2MJD A;  4ZHO A;  2W55 A;  3HRD D;  1NYQ A;  1GTE A;  1CZP A;  1NEN B;  2MH7 A;  4C7Z A;  1JRP A;  4YTP B;  4YT0 B;  5C3J B;  1FXA A;  2W3R A;  4ZHP A;  1FXI A;  1RFK A;  2H88 B;  2WS3 B;  4YTN B;  3W9C B;  3AEC B;  1JRO A;  3FC4 A;  5AUI A;  1KF6 B;  4YSY B;  1PUT A;  1JW9 D;  3LXF A;  3NVY A;  5H92 C;  1T3Q A;  1KRH A;  1GTH A;  1FIQ A;  2JQR B;  1WRI A;  2WQY B;  3L4P A;  1QF6 A;  2PVG C;  2K5P A;  1QOG A;  3AE3 B;  4ITK A;  4JWS C;  3NVW A;  3NVV A;  3P4S B;  1PFD A;  2Q5W D;  2WU5 B;  3P4Q B;  3AE4 B;  1N60 A;  1FFV A;  3KWL A;  3DWM A;  3SFD B;  1UWM A;  1H7X A;  2M19 A;  3AH7 A;  1B9R A;  1NI3 A;  3VRB B;  3AMZ A;  4N58 A;  1YQ4 B;  1WGK A;  4WQM A;  3VR9 B;  1TYG B;  5G5G A;  4ZOH C;  4C80 A;  1XLN A;  1RM6 C;  1DGJ A;  3AEF B;  3AE5 B;  2KAJ A;  3PO0 A;  1JWB D;  1FRR A;  3LB8 C;  3AEE B;  4KX6 B;  1ZUD 2;  1XLQ A;  2E3T A;  4N6E B;  1TKE A;  3AN1 A;  1ROE A;  2KMM A;  3NS1 A;  1QT9 A;  1N61 A;  4A9A A;  5GXG B;  1E0Z A;  1XO3 A;  2JX5 A;  3AM9 A;  1QOA A;  2K22 A;  1V97 A;  2Y5C A;  5EE1 A;  2WP9 B;  1H7W A;  1FFU A;  1DOX A;  1L0V B;  1FMA D;  4JX1 C;  1NYR A;  2B76 B;  4YSZ B;  3B2G A;  3B9J A;  1NVI D;  1ZP0 B;  1TKY A;  2QJL A;  1YJJ A;  2K9X A;  3P63 A;  3AE2 B;  2PKO A;  1VDV A;  2PVO D; 
#chains in the Genus database with same CATH topology
 2QIE B;  4FBJ B;  3I63 C;  2NMQ A;  3P1M A;  5HI1 A;  3ABV B;  2JYE A;  2CJO A;  1LGR A;  2LGI A;  3NG0 A;  4MGY E;  1XCQ L;  3N32 A;  3QAR A;  2H89 B;  2IZV B;  2OJW A;  4J3O D;  1H8C A;  3MJW A;  5EE9 A;  5H8Y E;  2Y5P A;  3UIN B;  4EZJ A;  2I38 A;  3DHI C;  2KLC A;  2D3A A;  4JIO U;  3IAM 1;  2NPT B;  3PVL A;  1FCC C;  2JWZ A;  2PLP A;  3DBR B;  4IG7 B;  2JRH A;  1ZXH A;  4MAC A;  3AED B;  2JSV X;  2RDH A;  4EE2 A;  5HG2 A;  4AUQ C;  3ZJU A;  4HRO A;  1GNU A;  3EFU A;  3CSF A;  2HD5 B;  1WM3 A;  1ET6 A;  2EKE C;  3U30 A;  2QEJ C;  1YX6 B;  4G0N B;  4CQN A;  2LHD A;  2KWD A;  4DXG A;  1I4R A;  1WGH A;  1C3T A;  1HE8 A;  3HHM A;  4JWS C;  3R2I A;  4ZYS A;  3A9K B;  1GG3 A;  3PSE B;  2M17 A;  4XDD A;  1UD7 A;  1EUV B;  2KTR A;  3VVW B;  1CMX B;  3VUX A;  3C19 A;  1ZPS A;  2J0J A;  1V5T A;  4N6E B;  3JW0 X;  2A4Z A;  3M3J A;  4N9F 4;  2JX5 A;  2AL6 A;  4ZDV A;  2XK5 A;  3VFK A;  1FFU A;  1L0V B;  3A9J B;  4HVB A;  1JWM D;  4DHZ E;  3R66 C;  1TKY A;  2EMT A;  4W9D A;  5TR5 A;  5D6J B;  2CU3 A;  3TIX A;  4W9I A;  4A6Q A;  3PPA A;  5AZF A;  4HJG E;  2ZCC A;  4PK1 A;  1N62 A;  1KJT A;  2SAK A;  1MHX A;  3PRZ A;  1F52 A;  5D3I B;  2M56 B;  2BS4 B;  4WAF A;  3EC8 A;  1VR9 A;  4E74 A;  1SIJ A;  3Q14 C;  1N5X A;  1XLP A;  3P4R B;  2MJ3 A;  2INN E;  3Q8A A;  4C7Y A;  1YJ1 A;  3FAH A;  3IAS 1;  3L13 A;  3MC8 A;  4S17 A;  3JSV B;  1GJZ A;  2KJ6 A;  4IM3 A;  2L0T A;  4LNK A;  1K50 A;  1V8C A;  3W1S C;  2BVC A;  3CWI A;  3L0W B;  4N59 A;  2LJI A;  1WYW B;  2MCN B;  1QOB A;  1G6J A;  3W5U B;  1K51 A;  3CST A;  4DXA B;  1FEH A;  2D3B A;  5EE3 A;  1LXD A;  2C9W B;  2FUG 1;  3JSV A;  4K7S A;  2JRI B;  2KQ4 X;  3W9C B;  1D4B A;  2GBM A;  3GE3 C;  1RRB A;  2BWF A;  4BBN F;  1FIQ A;  1BUI C;  4WIP A;  5AZG A;  3N9Y C;  2KAN A;  2CR5 A;  2BF8 B;  5BMG A;  5BYQ A;  4B0M A;  1VRA B;  5D94 A;  2DLB A;  2EEL A;  2QHO A;  3I9V 1;  1HTQ A;  4W9F A;  2AWT A;  1YNT E;  3AEF B;  2KAJ A;  1JWB D;  3KYD D;  1XLQ A;  3U4E G;  4RGN A;  1WE6 A;  4A3P A;  3NS8 A;  1V97 A;  3GZN I;  1FNW A;  3MHS D;  2X8X X;  5FR3 A;  2PW9 A;  5HKH A;  3ZKJ C;  4MSQ B;  1HA5 A;  3ML8 A;  2PKO A;  1YN4 A;  1TS4 A;  1TZO A;  4MJS A;  4ASW C;  1F0Z A;  3KH0 A;  2EKI A;  1ZXI A;  1E6E B;  1LQB A;  3LDZ E;  3NHE B;  2PE6 B;  1KLV A;  5CHW A;  2WDR B;  4NJ7 A;  1EO6 A;  2BYF A;  5DPS A;  3RPF C;  1AN8 A;  3HK0 A;  1FPY A;  3N1Y C;  4JWU C;  4DBG A;  4MJS B;  3AEB B;  1DOX A;  5FR6 A;  3AV8 A;  1YJI A;  1A5R A;  2GMI C;  1LFD A;  2L52 A;  3U8Z A;  3RFZ B;  4TMA B;  1FM0 D;  2KDF B;  4NNJ B;  2J7Q B;  3Q8E A;  1FRD A;  2E6X A;  3Q8C A;  2R61 A;  1L4D B;  1JRU A;  1GOZ A;  1Z5S B;  4RM8 A;  2WXN A;  3R2T A;  4FJY A;  1B1Z A;  1OTR B;  4J6I A;  4RCO A;  1GC6 A;  4TKN A;  5IAA C;  2IO3 B;  4PS3 A;  1VLB A;  1E7P B;  2EMS A;  2W55 A;  3DVG Y;  3QA8 A;  2VRR B;  1CZP A;  4RGO S;  1N6Z A;  1FXA A;  5AZH A;  3APC A;  2FCN A;  4WJO A;  2V1Y A;  3AEC B;  2MBE A;  2KDB A;  1KRH A;  2L76 A;  4HXD A;  1YN3 A;  1FFV A;  4D2K A;  1UWM A;  5DPW A;  1FNU A;  2MQJ A;  5C23 A;  4W9E A;  4AP4 C;  3TMP B;  3UGB B;  3NZU A;  1E8Y A;  4XE0 A;  2K8C A;  5LLI A;  3AEE B;  4WUR A;  1GB1 A;  1V81 A;  2J52 A;  3DCG A;  2FCQ A;  2I1K A;  4DDI D;  3AI5 A;  4WWN A;  1KTK A;  1PGA A;  1TS5 A;  4US9 A;  2HDE A;  4BVU C;  1UGJ A;  5BMH A;  2DZI A;  1T0S C;  3ZJV A;  3ZXR A;  3QX1 A;  1V1P B;  4FN2 A;  2IBI B;  3SDL C;  2LFI A;  2PIA A;  1D5M C;  2BGF A;  2W54 A;  2XK5 B;  3JYU A;  1J7C A;  1SIF A;  2BW2 A;  1WJ4 A;  4O1N A;  1SE4 A;  3AE7 B;  1MJD A;  3S2A A;  2KDE B;  3C0R B;  1PGB A;  1L5P A;  2RDG A;  4H2A A;  3PT2 B;  4US8 A;  4BFR A;  4A55 A;  4R3D A;  1FO4 A;  2MJE A;  3EA6 A;  2DBY A;  1ZOY B;  1Q0W B;  2AL3 A;  2M1M A;  3TBL D;  4HPL B;  1FNV A;  3L08 A;  4EUT A;  3ZXV A;  5I4D A;  5CX3 A;  2ZW1 A;  4YTP B;  1TT5 B;  4F1S A;  1C79 A;  3DDC B;  3M63 B;  3W1Y A;  2JQR B;  2WXR A;  1S3S G;  3P4S B;  1PFD A;  2DYO A;  2M19 A;  1JWS D;  3AMZ A;  2LRU A;  2OED A;  4P1C C;  2Y5B B;  2ZPN A;  1TYG B;  1XLN A;  4KIK A;  2VZK D;  1E7U A;  2MP2 B;  2L32 A;  3V05 A;  2D3C A;  2FCS A;  3IT4 B;  4BKS D;  4L23 A;  4DK5 A;  1VCB A;  2N7J A;  2O2V A;  3Q6B A;  1NYR A;  3KW5 B;  1SXT A;  1NVI D;  2QC8 A;  3OJ3 A;  2LI5 A;  1VDV A;  1R4N B;  3L10 B;  3PZD A;  2WHI A;  3U52 E;  5JXV A;  4BBN C;  3EUB 2;  2ZVN A;  1GUA B;  2WNM A;  4NY0 A;  2LXC A;  3V6C B;  2KLG A;  1Y8R C;  4EOY A;  3RN9 C;  1WWT A;  1E90 A;  4AQ7 A;  1OQY A;  4FUL A;  2ACZ B;  3HIZ A;  3Q3F A;  1NI2 A;  1L0Y B;  3TL5 A;  1XEE A;  4ZRI A;  1R4N I;  4MM3 A;  3MHZ A;  4P6V F;  3VUY A;  1SE3 A;  1I4H A;  1WZ3 A;  1IP9 A;  1R7S A;  3J9C A;  3IHP C;  1E10 A;  1JWA D;  1WM2 A;  5FK9 C;  3DBR I;  1WY8 A;  2PE9 A;  4WWM A;  4BOS C;  1FCL A;  5E6J A;  1L6U A;  1XF5 L;  1BML C;  2I1J A;  1L2N A;  3RMK C;  1PQS A;  4USA A;  4PT5 A;  3BYY B;  1WYG A;  3BIN A;  3R7Q A;  3P2B A;  2RPQ A;  2K39 A;  2NVU I;  1TGZ B;  5JHB A;  1JRP A;  4ZHP A;  2WS3 B;  4I6L B;  1PUT A;  3A1Q B;  3SEB A;  4JLC A;  1QF6 A;  2PVG C;  2LGD A;  4RGT A;  1XD3 B;  3VUW A;  3KWL A;  3O13 A;  2JZP A;  1B9R A;  4XGA B;  4TQ0 A;  2G45 B;  4BOZ B;  4MGI E;  4NJ6 A;  2YVC A;  3L16 A;  2KMA A;  3QWZ B;  1KH0 A;  3LJ3 A;  2KQS A;  3B1L X;  3DBH B;  3EFC A;  2QJL A;  4TUU A;  1E8X A;  1C78 A;  1IPG A;  2LD9 A;  3WCQ A;  1NDD A;  3MFG A;  3ZYY X;  5EE0 A;  3VR8 B;  4IW0 A;  5G5H A;  2L3Z A;  2FID A;  3Q3N C;  3AU4 A;  5JZE B;  3U7Z A;  4GDL B;  3LYY A;  2D07 B;  4IOI E;  3OJ4 B;  1YOV B;  2CS4 A;  3DPD A;  3CIR B;  4KKI A;  2KOX A;  1VJK A;  4KVG B;  4AJY B;  4IWQ A;  3VRA B;  2WXH A;  4TV3 A;  1WFY A;  2AEH A;  2BKR B;  1WI0 A;  3MC9 A;  1IGC A;  4IDI A;  3NOB A;  1WX9 A;  2INC C;  1KFY B;  5BMI A;  1WR1 A;  3ETR A;  3Q3O C;  3PS6 A;  1WRD B;  4M0W B;  4P7I A;  4IUM B;  2CU1 A;  3K9P B;  3AE8 B;  2WXJ A;  1Z2M A;  1IBX A;  2KXJ A;  1UWX A;  1P7F A;  2JU6 X;  1VD2 A;  2VH2 A;  2N1W A;  4MEM A;  2VH1 A;  3FIL A;  2MW5 A;  3GOE A;  2KX3 A;  1FD6 A;  4XC2 A;  1JW9 D;  3NVY A;  1UBI A;  3PTF C;  2ICI A;  2K5P A;  5E6N A;  2QDF A;  1TY0 A;  4C00 A;  1Y56 A;  4KZ0 A;  1IBX B;  1BT0 A;  5EDS A;  2KFK A;  2UU7 A;  2GRI A;  2IPK D;  2JZZ A;  2KWC A;  3UI3 A;  2KHW B;  3GZN B;  3DVG X;  2RMM A;  1FMA D;  2IGD A;  3BZD B;  4NAM A;  2INP E;  2W82 A;  3WAL A;  4KIK B;  3ECI A;  3WAP A;  1K8R B;  1VZ8 A;  2DAF A;  4FLH A;  3PHX B;  5D7G A;  4TSS A;  1CQV A;  1V9J A;  2G4S A;  2J53 A;  3ZNZ B;  2BYE A;  3ZTC A;  2LUE A;  1OEY J;  3GE8 C;  1RWS A;  3K9O B;  2O2V B;  3BII D;  3DBL B;  3B0A A;  4K7U A;  3ZDT A;  2OHF A;  2JUO A;  3V62 A;  1YMH E;  2DZJ A;  1WMH B;  2FAZ A;  4ICU A;  1WZ0 A;  5C2T B;  2MRP A;  3QIJ A;  1C9F A;  2IY1 B;  1WF9 A;  2NBV B;  4E3C A;  1IYF A;  2DAJ A;  4CYE A;  2JPH A;  2KWU B;  3ZNI D;  3HM6 X;  3ZGZ A;  3RT3 B;  3EEC A;  4ZYN A;  2C60 A;  4MEL A;  1EWC A;  2PJH A;  4EKU A;  2FCM A;  3T8M A;  4HRS A;  3H6N A;  4KV2 A;  3BYT B;  3PV1 A;  1GTE A;  4JGH B;  2W3R A;  4RH6 A;  1HZ5 A;  3CMM B;  2IO1 B;  4GIV A;  3V61 A;  1E8W A;  4G3X B;  4E71 A;  2M8S A;  2KJR A;  2BTE A;  4B6W A;  4W9H A;  2KO3 A;  2G3Q B;  4WJN A;  4KDL B;  1XXG A;  1LM8 B;  4MT5 A;  1H4R A;  3AE5 B;  4K1R B;  1OGW A;  3A1Q A;  2LGY A;  1UF0 A;  2LAS A;  2LRW A;  4KDI C;  3DHH C;  2IY0 B;  2D10 A;  2FNJ B;  2LUM A;  3QK0 A;  4M8M A;  5TSS A;  4PYZ A;  2V4L A;  2KNB A;  4IM0 A;  4B0E A;  1EU4 A;  1PGX A;  4ZRJ A;  2XN9 C;  1D3Z A;  1AYF A;  1UBQ A;  4KSL C;  2YLM A;  4ZRQ A;  3U7D A;  4K3C A;  2KJH B;  1JML A;  3T3N A;  2JZ3 B;  2V3S A;  1V86 A;  1QOF A;  5L83 A;  3EGR A;  2DHZ A;  1RYJ A;  1SSN A;  2MX2 A;  2HJ1 A;  2KN5 A;  4FJV B;  2N9L A;  3ZRC A;  3M62 B;  2B3A A;  2MHJ A;  1L6V A;  4AOF A;  2DZM A;  2N4F A;  2V3P A;  1NEK B;  1EF1 A;  4LNN A;  2ZNV C;  4I6P A;  4OVZ A;  2DWQ A;  2GBJ A;  1SE9 A;  3OWE B;  1WX8 A;  1XCT L;  3A4S C;  4DDG D;  1C4P A;  4GGQ A;  3N20 C;  4FXC A;  2O6V B;  4FAD A;  1OQQ A;  5GMV A;  3W5V B;  1SF0 A;  1WSP A;  2J4X A;  1VZ6 A;  2DZK A;  2GB1 A;  4HEA 1;  3HVD A;  3KUZ A;  5IA7 A;  3R3M A;  4RF1 A;  4C7Z A;  1EU3 A;  1FXI A;  2H88 B;  3FC4 A;  2O6V A;  3DQV A;  3RCZ A;  2LMC A;  1KM7 A;  1QOG A;  3ZO5 B;  3CF6 E;  3ALB A;  4MSM B;  5IN7 A;  1STE A;  5IP4 D;  4TQ1 A;  4W9G A;  1WGK A;  3PRM B;  3WA0 A;  4K3B A;  3PZ8 A;  1E7V A;  3H7P B;  3KLS X;  4PYU A;  2AYO B;  4S0R A;  3BVZ A;  2KKC A;  2WXO A;  1ROE A;  1N61 A;  2BYV E;  2C7M B;  4X57 B;  1E0Z A;  4L2Y A;  3WAN A;  2ZPY A;  2ZW0 A;  1H7W A;  4K81 A;  3SD5 A;  3TJP A;  2M4N A;  2PPH A;  2WXL A;  3P63 A;  1YX5 B;  2K9X A;  2PVO D;  4C4V A;  1MG8 A;  2FIF A;  4HCP B;  1UH6 A;  2N9X A;  2BT6 A;  2DYM A;  2VZK B;  1SB3 C;  3O65 B;  2Z0D B;  2WGS A;  2K1F A;  1PYW D;  4HLE A;  4HPP A;  5CHF A;  3AE9 B;  5KHQ A;  1C1Y B;  4ZRK A;  4NAW B;  4C4V B;  3I3T B;  2R2Q A;  3HUI A;  3BK1 A;  3SFE B;  2BS3 B;  1XLO A;  4W9L A;  5T8I A;  2IJ0 A;  4FHK A;  1SJE D;  1YQ3 B;  4F8C B;  3TEW A;  4HKQ A;  2KMC A;  2JYT A;  1PDX A;  2KZR A;  1K52 A;  4XZ4 A;  4NAW A;  2G1E A;  3D32 A;  4REZ A;  1J7A A;  4GSW A;  1HEZ E;  3VAW A;  4FA6 A;  1NEN B;  4YT0 B;  2Z8L A;  4YSY B;  5CHV C;  4GMV A;  1RAX A;  1UZX B;  1GTH A;  2G4D B;  3AE3 B;  3ZNH B;  3NVV A;  2KAC A;  1WE7 A;  2L7R A;  3IFW B;  1WGD A;  3QHT A;  4N58 A;  4I6N B;  2V9H A;  2ZEQ A;  5L95 C;  5BYS A;  1WIA A;  2LVO A;  3R8B A;  3BY4 B;  2E3T A;  4A90 A;  4JE3 B;  2RGF A;  2BWE S;  1V1O A;  4IC7 B;  3URY A;  3A9K A;  2WXF A;  3DBH I;  5EE1 A;  2J42 A;  4RMA A;  4XWW A;  2B76 B;  4YSZ B;  2DEN B;  3WAM A;  2MEK A;  3MTN B;  4LCD E;  5J17 A;  4W9K A;  1P9D U;  4JQW C;  1I42 A;  2L0F A;  1I7H A;  1YIW A;  2KC2 A;  1TJE A;  1IUE A;  3DOW A;  3QJZ A;  2GBK A;  2D5G A;  2N9E B;  3NRZ A;  3P4P B;  1ZGU B;  4KKJ A;  5C1Z A;  3Q8F A;  3RYT A;  4BAX A;  3DVN U;  2RDB C;  2IO0 B;  1GC7 A;  3VTV A;  1J7B A;  1P98 A;  1OEY A;  2WU2 B;  1ESF A;  4RM9 A;  1WJ6 A;  5J18 A;  4IKG A;  1L4Z B;  4YXD B;  2N0S B;  3Q8B A;  4MGZ E;  4LNI A;  3BK2 A;  2IYD B;  1JWU D;  1JQ4 A;  4YTM B;  4HWI B;  4KSK C;  2WDQ B;  5MPO A;  2D2Q A;  1CK1 A;  2V3N A;  2CKH B;  1U4A A;  4WJP A;  3N1Z C;  1WR6 E;  3A33 B;  1ZW7 A;  4GB9 A;  3NUH B;  1KLU D;  2SEB D;  1WGR A;  4GN1 A;  3ZRF A;  4DWF A;  2UYZ B;  2LGX A;  4BZA A;  2C5L C;  2WU5 B;  5IOI A;  4AWJ A;  5JH5 C;  1WX7 A;  1H7X A;  3BVG A;  1YQ4 B;  4BKS A;  4MH8 A;  1ZDX A;  3PO0 A;  1VZ7 A;  4XWT A;  2UWQ A;  3AN1 A;  3NS1 A;  1Q10 A;  4P1B C;  3RNA C;  2K0P A;  2K8B A;  3PLU A;  2K25 A;  4NPN A;  3E9S A;  1WXA A;  2ON8 A;  4B95 A;  4JX1 C;  4XX5 A;  3SU8 X;  3B9J A;  4ANX A;  3Q2A C;  4EFO A;  3FKY A;  4WH4 A;  2AQ3 B;  3R7R A;  2GI9 A;  2X38 A;  1WXQ A;  1WXV A;  2KTF A;  3GS2 A;  2LHE A;  2MBQ A;  1QLB B;  1I4P A;  3A4R A;  1T5X D;  3PGE A;  1E9M A;  3V6E B;  4GDK B;  4DHZ B;  3NZ3 A;  2QSD A;  4G50 A;  2NBU A;  5IO9 A;  2CHX A;  3RNF C;  5G55 A;  2JXT A;  2CJN A;  3VH3 B;  2WDV B;  2WXI A;  2NTS A;  1EWY C;  2CHZ A;  3KUD B;  2KFJ A;  2K8H A;  3W2D A;  4OZA A;  2DX5 B;  1UEL A;  1KOT A;  2REX A;  2M0X A;  3I5J C;  5D2M B;  2MJD A;  1V80 A;  3M95 A;  4GU2 A;  2KVR A;  3QAQ A;  1RFK A;  2D11 A;  4K7W A;  1KF6 B;  2J0M A;  2M0A A;  2RPV A;  3KWV A;  4A20 A;  1UNS A;  1Q5W B;  2LXA A;  2Q5W D;  1EM7 A;  1ET9 A;  2PTL A;  3VTU A;  2N9P C;  3GP7 A;  5HHD G;  3ZUN A;  2KYW A;  2GLS A;  2WXM A;  1P3Q U;  3RUI B;  4KX6 B;  4PS7 A;  1S1Q B;  3KVF B;  3NZS A;  1WXM A;  4GDL A;  3RZF A;  4DHJ B;  4JPS A;  1WJU A;  3DBL I;  2LJ5 A;  3SR6 A;  3IT6 B;  2WXK A;  1A70 A;  1AAR A;  2KVZ A;  1SGH A;  3UQB A;  3UIP B;  1AWD A;  1MHH E;  4UDU C;  4WJQ A;  5D3D A;  2I2Y A;  4HDQ A;  4XYC A;  1F2R I;  3L54 A;  2XEW A;  3AE6 B;  5AUK A;  1F9J A;  1DOI A;  4LDT D;  1V1P A;  2G9H D;  1OFF A;  2LWP A;  2PMV A;  2MWS B;  4AS1 A;  1QKZ A;  2KWV B;  1BXT A;  3DHG C;  2BYT A;  4IWP A;  1P1A A;  4LNO A;  1T0Q C;  4YSX B;  2BPS A;  3APD A;  1I35 A;  1J8C A;  2MLB A;  1AW7 A;  1K53 A;  2WWZ A;  4HDO A;  4RFB A;  3GB1 A;  4F7Z A;  4ZRP A;  2L05 A;  2NBW B;  2RD0 A;  1C4A A;  3T9L A;  4OVU A;  3NVW A;  4ANW A;  2OJR A;  4QAY A;  1C77 A;  4II2 B;  2IGH A;  4ANU A;  1WXS A;  2KD0 A;  4WQM A;  3SHQ A;  3WAO A;  1JCK B;  5G2N A;  2GBN A;  1DGJ A;  3ENE A;  1YQB A;  3ZLZ A;  1FRR A;  1P0R A;  1ZUD 2;  4M00 A;  2DNF A;  1L0X B;  3MC0 B;  2MBH A;  1V2Y A;  3L17 A;  2WP9 B;  2QIL A;  1RFA A;  3MJ5 A;  2IO2 B;  3ZVV A;  3EHV A;  3IBE A;  2BQQ A;  3TEY A;  1HXY D;  4MM3 B;  1TS3 A;  2BS2 B;  1TKG A;  4PS8 A;  1TBE A;  2O6V D;  3UQA A;  4EZL A;  4EZK A;  4ANV A;  1L7Y A;  2NCN A;  3ZW3 A;  3VDZ A;  3IVF A;  4ICV A;  4LDT B;  3PRP B;  1XT9 B;  4KGR A;  3W1S A;  3B08 A;  1MVK A;  1GT8 A;  5CTR C;  3TCA A;  2NR2 A;  4BKG A;  2JF5 A;  2N1V A;  3ONS A;  1WGG A;  2LZ6 A;  2OOB B;  4MGK E;  3HM3 A;  1D5X C;  3KYC D;  3V3X A;  3N30 A;  1T6B X;  2CHW A;  3AB5 A;  1QZE A;  2A5U A;  4NQL B;  4DQO C;  1QIL A;  2AQ1 B;  5C3J B;  4M8N A;  3TSS A;  4OZB A;  3RD2 A;  1EF5 A;  4FHJ A;  1T3Q A;  3RNB C;  5LXH A;  3Q3M C;  3RZW C;  3IG3 A;  1MFW A;  3SFD B;  1T0R C;  3ZDM C;  2L1A A;  3VRB B;  5HFY A;  5KHO A;  3VR9 B;  5G5G A;  4W9C A;  4ZOH C;  3VQI A;  2KT7 A;  4ARC A;  1QQR A;  2YEP B;  1TY2 A;  3AU5 A;  3QCA A;  4FJZ A;  3V60 A;  5GXG B;  1XO3 A;  2AQ2 B;  3AM9 A;  3PHW B;  3NY5 A;  2KFK B;  2NS5 A;  5JHA A;  1MG4 A;  1YJJ A;  2KC1 A;  3TEZ A;  4B9K A;  3RI7 C;  2D3G A;  4EEW A;  4HPM B;  3AXC A;  1D5Z C;  2Y3A A;  1ACC A;  2WLB A;  1FXT B;  1YN5 A;  4W9J A;  2Z59 B;  2ZCB A;  3AE1 B;  2AX5 A;  4WQO B;  3QQ8 B;  1J19 A;  1CJE A;  4ACF A;  3AEG B;  5AEK B;  4M0W A;  1TIF A;  3I57 A;  3DWG C;  2IDY A;  4KGT A;  2JWU A;  1C4C A;  4YL8 A;  2V4I B;  4JL9 A;  3TUO A;  1ZKH A;  4HKZ E;  3MP9 A;  5FKA C;  4GXB A;  1C76 A;  2BKF A;  1R4M I;  1KLG D;  2ONQ A;  3QC8 B;  2L83 A;  2V0G A;  1OQR A;  1I4G A;  1M94 A;  5BYR A;  4ZHO A;  4G11 A;  1NYQ A;  3TEX A;  2MBB B;  3ZNG C;  2WX1 A;  1UGM A;  4HJK A;  2MSE D;  2W9N A;  3KUC B;  3Q3J A;  3BWU D;  5LXI B;  5H92 C;  2L00 B;  2QMT A;  4CO7 A;  1DYQ A;  1SBB B;  1F77 A;  3P4Q B;  1N60 A;  1P7E A;  1E5W A;  3PRE A;  4HCN B;  3VXW A;  2JVC A;  4NJC A;  1V5O A;  4IM2 A;  1WGY A;  1R4M B;  3LB8 C;  2WDT B;  3C8Y A;  3OLM D;  2RSU A;  4ARI A;  2IGG A;  3RNE C;  3DVN V;  1SE2 A;  4L1B A;  2KQ7 A;  3B2G A;  4LK0 M;  2J0K A;  3AE2 B;  1ENF A;  2BBC A;  1WMH A;  4AJW A;  2IND C;  2MP2 A;  2GOW A;  2HTM E;  3P42 A;  4KZC A;  2NPT A;  2WXP A;  1JAL A;  4M02 A;  1NBF C;  4IWO A;  4LJP B;  4M01 A;  1MI0 A;  4GOC A;  3CF4 A;  2K3U A;  2JY6 A;  4URK A;  2ZZP B;  2C7H A;  2LGS A;  4NQK E;  4WAA A;  4OZC A;  2HTH A;  2Z0E B;  4P16 A;  2FUH B;  5IKC M;  2DYB A;  1N5W A;  2BB6 A;  4RNA A;  2WYQ A;  1T0Y A;  5E6P A;  5LNK 1;  3H9D A;  4CHK A;  3KQ4 A;  3ZJT A;  3H1U A;  3VTW A;  4DHJ D;  3HRD D;  3PZ7 A;  2KTR B;  2MA9 B;  1JRO A;  5AUI A;  3E56 A;  3LXF A;  2KDI A;  2BB5 A;  4OW0 A;  1WRI A;  2WQY B;  2ASQ A;  1TS2 A;  5BO4 B;  2KK8 A;  3AUL A;  3AE4 B;  2C7N B;  2XBB C;  1GB4 A;  3AH7 A;  1NI3 A;  3A9J A;  1F1H A;  2JXX A;  1MPE A;  4WWO A;  2LVQ A;  1I4Q A;  4DXF A;  4C80 A;  2ZNV B;  1RM6 C;  3VH4 B;  3VHT C;  2K6D B;  1UUP A;  1WJN A;  1QT9 A;  2R2O A;  4A9A A;  3RUL A;  3DBS A;  2JT4 B;  1WH3 A;  2YEP F;  4WWP A;  2KDM A;  3PLV A;  2LVP A;  1HZ6 A;  2N7D A;  4Q2J A;  2ZJD A;  2QCZ A;  2ZVO A;  3RNC C;  3N3K B;  1GPX A;  4NZL B;  4OHJ A;  3HVZ A;  3ZTD A;  2K6Q A;  3ZIM A;  2TSS A;  1I4X A;  1HTO A;  1M4V A;  3H7S A;  2GBR A;  5DCN A;  1ISN A;  1HQR D;  4MDK E;  4LTU A;  1LO5 D;  1J0G A;  2KN4 A;  3WIM A;  2L8J A;  2HE7 A;  3AEA B;  4HK2 A;  3BVM A;  1YD8 U;  3IXS A;  1ZDV A;  2NTT A;  4RF0 A;  2FBW B;  4XDC A;  3H8H A;  3OG5 A;  1GAQ B;  1E8Z A;  4GLS C;  1Q1O A;  2W3S A;  3APF A;  2N7E A;  2HJ8 A;  1TTN A;  2N9K A;  1SJH D;  4BKT A;  1TZ1 A;  3NVZ A;  1ZE3 D;  1N63 A;  4MH0 E;  4II3 B;  2XNA C;  1DOY A;  1RLF A;  3OAW A;  1XQQ A;  3T3O A;  3ML9 A;  1V49 A;  3X0W A;  3B2F A;  5DPR A;  4LNF A;  4KGS A;  2WXQ A;  5DPT A;  2PEA A;  3UIO B;  2MH7 A;  3H7P A;  4YTN B;  2KX0 A;  4OVV A;  2MBO A;  3L4P A;  4ITK A;  3NJT A;  3N1X C;  2FE8 A;  3DWM A;  3ZQ4 A;  1F2R C;  1D6E C;  2WX0 A;  4RGM A;  4YWG G;  3U2S C;  4LLG M;  1SEB D;  4C56 C;  3FIL B;  4A8X C;  5E6O A;  3X23 A;  1IGD A;  3RNG C;  2RR9 A;  1TKE A;  2KMM A;  4LJO B;  5J2R A;  1QOA A;  2K22 A;  2Y5C A;  1V6E A;  4GDK A;  4A3O A;  1X1M A;  3Q69 A;  3UF8 A;  1ZP0 B;  2LEK A;  3JVZ X;  2WXG A; 
#chains in the Genus database with same CATH homology
 3TEY A;  2QIE B;  1HXY D;  4MM3 B;  3U52 E;  1TS3 A;  5JXV A;  2BS2 B;  2NMQ A;  3EUB 2;  2BT6 A;  2DYM A;  2VZK B;  1SB3 C;  1TKG A;  2WNM A;  3P1M A;  1PYW D;  5HI1 A;  3ABV B;  2JYE A;  2CJO A;  3AE9 B;  2LGI A;  1WWT A;  1XCQ L;  2H89 B;  4AQ7 A;  2ACZ B;  4J3O D;  4NAW B;  1L0Y B;  5EE9 A;  2Y5P A;  1XEE A;  4KGR A;  5H8Y E;  3W1S A;  1MVK A;  3HUI A;  3MHZ A;  3BK1 A;  3SFE B;  2I38 A;  1GT8 A;  1I4H A;  1SE3 A;  4P6V F;  2BS3 B;  1R7S A;  1XLO A;  5T8I A;  3J9C A;  2IJ0 A;  1E10 A;  3IAM 1;  1FCC C;  1JWA D;  1YQ3 B;  1SJE D;  3TEW A;  4HKQ A;  5FK9 C;  2PLP A;  4WWM A;  2JYT A;  1FCL A;  1PDX A;  1D5X C;  5E6J A;  1ZXH A;  1K52 A;  1L6U A;  3AED B;  2JSV X;  1XF5 L;  2RDH A;  4MAC A;  3V3X A;  4EE2 A;  1BML C;  1T6B X;  5HG2 A;  3ZJU A;  4HRO A;  2G1E A;  3AB5 A;  4USA A;  4REZ A;  1J7A A;  4PT5 A;  3BYY B;  1HEZ E;  1WYG A;  1ET6 A;  4DQO C;  1NEN B;  1JRP A;  1QIL A;  2AQ1 B;  4YT0 B;  5C3J B;  4ZHP A;  2QEJ C;  2WS3 B;  2Z8L A;  4CQN A;  3TSS A;  2LHD A;  1PUT A;  4YSY B;  2KWD A;  4OZB A;  4DXG A;  1I4R A;  1T3Q A;  3SEB A;  1GTH A;  1QF6 A;  2PVG C;  4RGT A;  3AE3 B;  4JWS C;  3R2I A;  3NVV A;  4ZYS A;  2KAC A;  3KWL A;  3SFD B;  3O13 A;  2JZP A;  1B9R A;  2L1A A;  4XDD A;  3VRB B;  4TQ0 A;  4N58 A;  5HFY A;  3VR9 B;  5G5G A;  5BYS A;  4ZOH C;  3VQI A;  3R8B A;  4ARC A;  1QQR A;  2YEP B;  1TY2 A;  1ZPS A;  2E3T A;  4A90 A;  4N6E B;  4JE3 B;  5GXG B;  1KH0 A;  1XO3 A;  1V1O A;  2AQ2 B;  2JX5 A;  3AM9 A;  3URY A;  2WXF A;  5EE1 A;  2J42 A;  1FFU A;  1L0V B;  4XWW A;  2B76 B;  4YSZ B;  1JWM D;  1TKY A;  2QJL A;  2MEK A;  1YJJ A;  3TEZ A;  1C78 A;  3WCQ A;  1I7H A;  2CU3 A;  4A6Q A;  1TJE A;  1IUE A;  3MFG A;  3ZYY X;  5EE0 A;  3VR8 B;  1D5Z C;  2D5G A;  3NRZ A;  3P4P B;  5G5H A;  4HJG E;  1N62 A;  2Y3A A;  4KKJ A;  2SAK A;  1MHX A;  1ACC A;  2WLB A;  5D3I B;  3U7Z A;  2M56 B;  2BS4 B;  1YN5 A;  3Q8F A;  4WAF A;  4GDL B;  3LYY A;  1VR9 A;  3AE1 B;  4IOI E;  2AX5 A;  1CJE A;  1SIJ A;  3AEG B;  4M0W A;  1N5X A;  1XLP A;  3P4R B;  3I57 A;  1J7B A;  2MJ3 A;  2INN E;  3DWG C;  3Q8A A;  3CIR B;  2IDY A;  4C7Y A;  2WU2 B;  4KKI A;  1ESF A;  3FAH A;  1VJK A;  3IAS 1;  4KGT A;  3VRA B;  2JWU A;  1C4C A;  2WXH A;  1L4Z B;  4IKG A;  2V4I B;  3TUO A;  4YXD B;  2N0S B;  3Q8B A;  1IGC A;  1K50 A;  1V8C A;  4HKZ E;  4IDI A;  3BK2 A;  3CWI A;  4N59 A;  2LJI A;  1KFY B;  3MP9 A;  5BMI A;  5FKA C;  3ETR A;  1QOB A;  1JWU D;  1JQ4 A;  4YTM B;  1C76 A;  3W5U B;  1K51 A;  1KLG D;  2WDQ B;  2ONQ A;  1FEH A;  2L83 A;  2V0G A;  1OQR A;  5EE3 A;  3AE8 B;  2WXJ A;  5MPO A;  1IBX A;  1CK1 A;  1UWX A;  1I4G A;  5BYR A;  2FUG 1;  1P7F A;  2JU6 X;  2V3N A;  4ZHO A;  1NYQ A;  3TEX A;  3FIL A;  2KQ4 X;  3NUH B;  1FD6 A;  1KLU D;  3W9C B;  1JW9 D;  3NVY A;  1D4B A;  3BWU D;  2SEB D;  5H92 C;  1FIQ A;  2ICI A;  2QMT A;  1BUI C;  1DYQ A;  1SBB B;  4WIP A;  1F77 A;  2K5P A;  3N9Y C;  2WU5 B;  3P4Q B;  1TY0 A;  1N60 A;  1Y56 A;  5BYQ A;  5BMG A;  1P7E A;  1H7X A;  4B0M A;  3BVG A;  1VRA B;  1IBX B;  1YQ4 B;  2DLB A;  2EEL A;  3I9V 1;  2GRI A;  4NJC A;  4MH8 A;  1YNT E;  3AEF B;  1ZDX A;  2KAJ A;  3PO0 A;  1JWB D;  1VZ7 A;  2IPK D;  3LB8 C;  4XWT A;  3C8Y A;  1XLQ A;  3U4E G;  3UI3 A;  3AN1 A;  3NS1 A;  4ARI A;  1Q10 A;  2IGG A;  4RGN A;  2K0P A;  1SE2 A;  1V97 A;  3E9S A;  2RMM A;  2ON8 A;  4L1B A;  1FNW A;  5FR3 A;  1FMA D;  2IGD A;  2PW9 A;  3B2G A;  3BZD B;  3B9J A;  4JX1 C;  4LK0 M;  1HA5 A;  4NAM A;  3AE2 B;  2PKO A;  1YN4 A;  2INP E;  2W82 A;  1ENF A;  1TS4 A;  1TZO A;  4WH4 A;  2BBC A;  2AQ3 B;  1VZ8 A;  2GI9 A;  2X38 A;  1WXQ A;  1F0Z A;  3GS2 A;  2EKI A;  5D7G A;  1ZXI A;  2LHE A;  2HTM E;  1E6E B;  1QLB B;  4TSS A;  1CQV A;  1I4P A;  3P42 A;  2J53 A;  1T5X D;  1E9M A;  2WXP A;  2WDR B;  1RWS A;  4GDK B;  1JAL A;  1MI0 A;  3BII D;  3RPF C;  3NZ3 A;  1AN8 A;  2OHF A;  3CF4 A;  4JWU C;  2K3U A;  1YMH E;  2QSD A;  3AEB B;  1DOX A;  5C2T B;  3AV8 A;  1YJI A;  2JXT A;  4OZC A;  2CJN A;  2L52 A;  1C9F A;  4P16 A;  3RFZ B;  4TMA B;  2WDV B;  2WXI A;  1FM0 D;  1N5W A;  2BB6 A;  2NTS A;  1EWY C;  3Q8E A;  1FRD A;  2E6X A;  4RNA A;  3Q8C A;  2R61 A;  1L4D B;  5LNK 1;  1GOZ A;  3W2D A;  4OZA A;  3ZGZ A;  2WXN A;  3R2T A;  3KQ4 A;  3ZJT A;  1B1Z A;  4RCO A;  1EWC A;  1VLB A;  1E7P B;  4HRS A;  2MJD A;  2W55 A;  3BYT B;  3HRD D;  3PZ7 A;  1GTE A;  1CZP A;  4RGO S;  1FXA A;  2W3R A;  4RH6 A;  1RFK A;  1HZ5 A;  3AEC B;  1JRO A;  5AUI A;  1KF6 B;  2M0A A;  2RPV A;  3E56 A;  3KWV A;  3LXF A;  1UNS A;  1KRH A;  2BB5 A;  4OW0 A;  1WRI A;  2WQY B;  1TS2 A;  2Q5W D;  1EM7 A;  1YN3 A;  3AE4 B;  1ET9 A;  1FFV A;  2PTL A;  4D2K A;  1UWM A;  3AH7 A;  2BTE A;  1GB4 A;  1NI3 A;  3GP7 A;  1FNU A;  5HHD G;  1MPE A;  1XXG A;  4MT5 A;  1I4Q A;  4DXF A;  4C80 A;  1RM6 C;  2WXM A;  4XE0 A;  3AE5 B;  1UUP A;  3AEE B;  4KX6 B;  4WUR A;  1GB1 A;  2J52 A;  1QT9 A;  2LUM A;  4A9A A;  2YEP F;  2KDM A;  5TSS A;  1HZ6 A;  4Q2J A;  1KTK A;  1PGA A;  4B0E A;  1EU4 A;  1TS5 A;  4US9 A;  2WXG A;  1PGX A;  2HDE A;  2XN9 C;  1GPX A;  1AYF A;  4NZL B;  1UGJ A;  4OHJ A;  3HVZ A;  4JPS A;  5BMH A;  4ZRQ A;  3ZJV A;  1JML A;  3T3N A;  2TSS A;  1I4X A;  1V1P B;  1M4V A;  1QOF A;  3EGR A;  3SR6 A;  2LFI A;  3IT6 B;  2WXK A;  2PIA A;  1HQR D;  1RYJ A;  1SSN A;  1D5M C;  2W54 A;  1A70 A;  1J7C A;  4LTU A;  1LO5 D;  2N9L A;  1AWD A;  1MHH E;  2BW2 A;  2KN4 A;  4UDU C;  5D3D A;  2I2Y A;  4O1N A;  3AEA B;  3BVM A;  1L6V A;  1SE4 A;  3AE7 B;  1F2R I;  3IXS A;  1ZDV A;  3AE6 B;  2V3P A;  5AUK A;  2NTT A;  4RF0 A;  1NEK B;  2FBW B;  1DOI A;  3H8H A;  1GAQ B;  4XDC A;  4OVZ A;  4GLS C;  2W3S A;  1PGB A;  1L5P A;  2DWQ A;  1V1P A;  2N9K A;  2RDG A;  4H2A A;  3OWE B;  2G9H D;  1SJH D;  1XCT L;  1OFF A;  2PMV A;  4US8 A;  3NVZ A;  1C4P A;  4AS1 A;  1ZE3 D;  1N63 A;  1QKZ A;  4A55 A;  4R3D A;  1FO4 A;  4FXC A;  2MJE A;  1BXT A;  2XNA C;  1DOY A;  1OQQ A;  3EA6 A;  2DBY A;  2BYT A;  1ZOY B;  3W5V B;  1SF0 A;  3T3O A;  1WSP A;  2J4X A;  4YSX B;  3B2F A;  1FNV A;  1VZ6 A;  5I4D A;  2GB1 A;  4HEA 1;  3HVD A;  1AW7 A;  1K53 A;  4KGS A;  2WXQ A;  4RFB A;  4RF1 A;  2MH7 A;  3GB1 A;  4C7Z A;  2ZW1 A;  4ZRP A;  4YTP B;  1EU3 A;  1FXI A;  2H88 B;  4YTN B;  1C79 A;  3FC4 A;  3L4P A;  2JQR B;  2LMC A;  4ITK A;  1C4A A;  1QOG A;  2WXR A;  3NVW A;  3P4S B;  1PFD A;  2DYO A;  2FE8 A;  1C77 A;  3DWM A;  1STE A;  2M19 A;  1F2R C;  2IGH A;  3ZQ4 A;  1D6E C;  1JWS D;  3AMZ A;  4RGM A;  4TQ1 A;  2OED A;  4YWG G;  1WGK A;  3U2S C;  4WQM A;  4LLG M;  1SEB D;  1TYG B;  1JCK B;  1XLN A;  4C56 C;  3FIL B;  1DGJ A;  4A8X C;  2VZK D;  3PZ8 A;  1IGD A;  3KLS X;  1FRR A;  1ZUD 2;  3BVZ A;  2L32 A;  3V05 A;  2WXO A;  1TKE A;  1ROE A;  2KMM A;  1N61 A;  3IT4 B;  4L23 A;  1E0Z A;  1L0X B;  3MC0 B;  1QOA A;  4L2Y A;  2K22 A;  2ZW0 A;  2Y5C A;  2N7J A;  2WP9 B;  1H7W A;  2QIL A;  1NYR A;  3MJ5 A;  1SXT A;  1NVI D;  1ZP0 B;  2WXL A;  3P63 A;  2LEK A;  2K9X A;  3Q69 A;  1VDV A;  2PVO D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...