2WDQB

E. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Structure of Escherichia coli succinate:quinone oxidoreductase with an occupied and empty quinone-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdqB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdqB01
2BS3B 2PKOA 2WDQB 3P4RB 3VR9B 5C2TB 1FMAD 1DOXA 3P4PB 1FO4A 2K5PA 1J7AA 1L5PA 2G1EA 3FAHA 3PO0A 4ZHOA 1NENB 4YTPB 1DGJA 4YTNB 2CU3A 4N6EB 1RYJA 3FC4A 5G5GA 1TJEA 1CZPA 1OQRA 1GTHA 3LB8C 1QT9A 4C7ZA 1T3QA 1QOFA 1RWSA 1V97A 1FM0D 1RM6C 1E7PB 2B76B 3VRBB 1L6VA 1PFDA 1TKGA 1XLPA 2LEKA 4HRSA 1ZOYB 4YSZB 1N5WA 2WDVB 1NEKB 1WWTA 2KMMA 1PDXA 4HROA 3NVYA 5EE1A 5AUIA 2MJEA 1TKEA 3SR6A 1F0ZA 2JQRB 1R7SA 1E0ZA 2BT6A 3CIRB 3L4PA 1WXQA 4JX1C 3AN1A 5EE9A 1KRHA 4YSYB 3P63A 3AE4B 1EWYC 1JROA 1XLQA 2QIEB 1E9MA 2OHFA 2HTME 1VJKA 3W5VB 3AE3B 2AX5A 1JALA 3HUIA 3AEGB 1NYQA 3AEAB 2L83A 1GPXA 2WP9B 3B2FA 1NI3A 1JW9D 1J7CA 2WS3B 1N62A 1FIQA 1FXAA 4LTUA 3AV8A 3NVZA 1YJIA 3VRAB 2W54A 2BS4B 2MJDA 3HRDD 3AB5A 2ACZB 1NVID 1SB3C 2M19A 3AEEB 3BIID 4US9A 4C7YA 1SIJA 3DWGC 2BS2B 3P4SB 3DWMA 5H8YE 4C80A 3ABVB 3AEBB 1N5XA 1GAQB 1XLOA 3AE1B 2KAJA 5EE3A 3NS1A 4JWUC 2L52A 2N0SB 2WU5B 1XLNA 2MH7A 4WWMA 3RPFC 4ZHPA 1A70A 5AUKA 1B9RA 3AE9B 1OFFA 2CJNA 3AE8B 3B2GA 3P4QB 1ZP0B 1KFYB 1YQ4B 1FRDA 3B9JA 3NVVA 1OQQA 1FFVA 1N60A 3KWLA 4YTMB 4N59A 2QJLA 4USAA 2Y5CA 3W5UB 3WCQA 4YSXB 4N58A 1N61A 2JX5A 2PVOD 3AE5B 1QLBB 1JRPA 2EKIA 1I7HA 1YJJA 3HVZA 1AYFA 1QOAA 2PVGC 3W9CB 1ZUD2 2WU2B 1PUTA 1ZXIA 3AE7B 2M56B 3P1MA 2FBWB 4JWSC 1AWDA 2WDRB 2PIAA 2W55A 2MJ3A 1L0VB 2CJOA 1IUEA 2Q5WD 3CWIA 4P6VF 4ZOHC 5GXGB 2K22A 2W3SA 3ETRA 2WQYB 4US8A 1JQ4A 2WLBA 3LXFA 3NVWA 2K9XA 3AEDB 1FRRA 1XO3A 1QF6A 1WYGA 1E10A 1YQ3B 1E6EB 3AM9A 4FXCA 1GT8A 4IDIA 3AMZA 1JWBD 1V8CA 3AE2B 3AEFB 5MPOA 1J7BA 1QOGA 3AE6B 1TYGB 1WRIA 1DOYA 1WGKA 1QOBA 1JWAD 1UWMA 4ITKA 5EE0A 1H7XA 2H88B 3CF4A 3AECB 1RFKA 1VDVA 2DWQA 3SFDB 1N63A 4KX6B 1CJEA 2W3RA 3EUB2 3ZYYX 3NRZA 5H92C 2DBYA 1VLBA 1TKYA 1ROEA 4A9AA 1FFUA 2H89B 1KF6B 4YT0B 3VR8B 1SF0A 1H7WA 1L6UA 4WQMA 3SFEB 4YXDB 5G5HA 1DOIA 1NYRA 5C3JB 3AH7A 1FXIA 1GTEA 2E3TA
chains in the Genus database with same CATH superfamily
2KQ7A 1ZDVA 2WGSA 1WZ3A 2NVUI 3MFGA 3ZDMC 4W9FA 1NI2A 2LGDA 4MGZE 4JLCA 5IP4D 3AU4A 2KVRA 4K1RB 3VVWB 2ZW0A 3H7SA 5EE9A 1CMXB 3P63A 2M0XA 4XC2A 5L95C 4EZKA 2WX1A 1ET6A 2SAKA 3E56A 3T8MA 4KSLC 2AWTA 4QAYA 1AW7A 1JW9D 1I4HA 5CHFA 2YLMA 4B6WA 2LUEA 2W54A 3ZRFA 5D2MB 1IBXA 3B08A 4MM3A 2DAFA 4ASWC 4NAWA 2D3BA 3FILA 3PS6A 4JWUC 1WXMA 4WJOA 2DHZA 4TQ1A 4AS1A 1VZ6A 2JYEA 2V3NA 3PHWB 1RRBA 3PPAA 4LNNA 3QA8A 4RF1A 1N61A 4EFOA 4PS8A 1C76A 4DHJD 4ZYSA 1I42A 2KWVB 1WGDA 3PV1A 2Z0EB 4UDUC 4IOIE 3AEDB 3VTWA 2WXOA 1VD2A 1XCQL 3ZTCA 1FCLA 4IG7B 1WMHA 2DX5B 1C1YB 1J7BA 2BWFA 3ZLZA 2M19A 4ANVA 2CKHB 1KF6B 2R2QA 3QX1A 5G5HA 2LHDA 1L7YA 3HIZA 2ON8A 3BYYB 4MDKE 3HVDA 1VCBA 1SBBB 3PO0A 4OZBA 1TBEA 4GDLA 1P9DU 1X1MA 1RYJA 3RMKC 1JWSD 3NG0A 3H6NA 1SXTA 4IWOA 1QKZA 2IGDA 1E0ZA 5CX3A 3AE4B 1JROA 3VFKA 1YIWA 2O6VB 3GE8C 1NYQA 2L7RA 2NR2A 4DQOC 2CHWA 2M8SA 2IY1B 2MHJA 5G2NA 4C80A 3URYA 3ABVB 1V49A 2KFKB 5C23A 5D6JB 4NQKE 2DENB 3O65B 1B9RA 4TKNA 1ZP0B 4IUMB 4I6NB 1UH6A 2D2QA 1TIFA 4K7UA 1UELA 3DBHI 1ZXIA 2WYQA 3I9V1 3KUCB 4XX5A 3TUOA 1B1ZA 1XCTL 4WH4A 3OLMD 1E10A 1J8CA 4G0NB 4DBGA 2KWUB 3AE2B 4W9LA 5IOIA 4XGAB 1UWMA 1MHXA 2XNAC 3KUZA 4L1BA 3QJZA 3VR8B 3ONSA 3PZ8A 5T8IA 3WANA 4PYUA 4YXDB 1SEBD 1NYRA 4OVUA 2W82A 3EA6A 3SU8X 3P4RB 3VR9B 2FCMA 4JE3B 4M02A 1Y8RC 1KLUD 2KMCA 3X0WA 4LK0M 5E6NA 2LZ6A 1F77A 4N6EB 1SE9A 4I6PA 1CZPA 2GBMA 1MJDA 3U2SC 3R7QA 1XD3B 4NJ7A 1SE3A 4W9EA 4NY0A 3VQIA 4IC7B 2W9NA 1K52A 4XWWA 3B2FA 4WAFA 3C19A 2MWSB 3A9JB 4MEMA 3VUWA 1FNUA 3ZO5B 4GGQA 2UWQA 3QAQA 4II3B 4RGMA 2BS2B 4OHJA 4E74A 2HDEA 3T3OA 3MP9A 1XLOA 2LXAA 2KYWA 2KHWB 2WXKA 4EEWA 3TEWA 2XN9C 2DNFA 2QEJC 1TTNA 1ZDXA 2UYZB 5BYQA 4USAA 4C7YA 2XK5B 5HG2A 2RGFA 3WCQA 3FILB 4YSXB 4GU2A 4WURA 4PS7A 1T0QC 5LNK1 3MTNB 2KZRA 1AYFA 3DBLI 2K3UA 3EECA 2FBWB 3IG3A 1I35A 1AWDA 1P1AA 2B3AA 1JWMD 2BW2A 2Q5WD 4GN1A 4ZOHC 1YX5B 2C7HA 3Q3JA 4ZRJA 1LO5D 4WJQA 2N9EB 4RNAA 3Q8CA 3RYTA 3Q69A 4FXCA 1RAXA 1UBIA 4WWOA 2I1KA 2L3ZA 4CQNA 1C78A 4ZYNA 4KX6B 3TIXA 3ZIMA 1WXSA 3NRZA 2BB6A 2V3PA 4MGKE 3R8BA 1H7WA 2K6QA 3W5UB 3H8HA 4WQOB 1C79A 1I4QA 4RMAA 4S0RA 4DXAB 4KSKC 1XF5L 1QQRA 4WIPA 1T3QA 5BMIA 1V97A 1E7PB 1L6VA 2LEKA 3VH4B 2KDMA 1ZOYB 1ZKHA 2MJEA 5CHVC 1NBFC 5DPWA 2RD0A 4YSYB 3VDZA 2J42A 1HTQA 2JF5A 4A20A 2BWES 3BY4B 2KD0A 4C56C 3AULA 3U7ZA 2LFIA 3AEAB 3M95A 4B9KA 1GNUA 1AARA 4YL8A 2KJ6A 3SEBA 1L4ZB 2BS4B 3AB5A 3Q8EA 4US9A 2LASA 3DWMA 3MC8A 3UF8A 4RCOA 1N5XA 1T6BX 3UQBA 3NS1A 1E8YA 3VTVA 4ZHPA 3RNFC 3B2GA 5EE3A 1FFVA 5E6PA 1KJTA 4N9F4 4XDDA 2Y5CA 4EZJA 2PVOD 2LUMA 4E3CA 1GB4A 3HVZA 2RR9A 3AE7B 2RPVA 2MJ3A 1FD6A 4A6QA 4PYZA 3A9KA 4M8NA 2K22A 4CHKA 2WLBA 1TZ1A 4MACA 1JMLA 2INCC 4LDTB 4F8CB 3O13A 2LXCA 2MBQA 2V9HA 4KKJA 4ANXA 3MHSD 2BYFA 2Z8LA 4BAXA 1V1PB 1TZOA 4ANWA 4MH0E 4IWPA 3NHEB 3N1ZC 1MG4A 4AQ7A 1J19A 3NZ3A 2NBUA 2QCZA 3BWUD 3IAS1 3UGBB 1M4VA 1DGJA 4XZ4A 2WXRA 2LJ5A 3KQ4A 2K25A 4OZCA 4EE2A 1WX9A 2ZVOA 2Z59B 3N1YC 1VZ7A 1V5OA 3KYDD 1KRHA 2VZKD 4KDIC 4KV2A 3W5VB 1MPEA 1UZXB 4BKTA 3AEGB 3S2AA 1OEYA 2RDHA 4HPMB 5E6OA 2KJHB 3DBHB 1WJNA 1MI0A 2ACZB 2KLGA 5IO9A 1UF0A 1KM7A 2NMQA 2YEPF 3AEBB 1GG3A 4M0WA 4IM2A 3ZUNA 4D2KA 2QILA 1CQVA 2KVZA 3ZVVA 1D6EC 2OOBB 3NVVA 3IBEA 4FHJA 2JX5A 3AE5B 2GBNA 1I7HA 2MCNB 1WM2A 2FCQA 2ZNVC 4HJKA 4K3BA 2HJ8A 4XYCA 2X8XX 2WU2B 3BINA 5BMGA 3NUHB 3DHHC 2PPHA 4DHJB 2KC2A 3C0RB 4HKZE 4P6VF 2K9XA 3W1YA 1E8WA 3AM9A 2GI9A 1U4AA 1OTRB 2N4FA 1V8CA 2G4SA 4RGOS 1RFKA 3RI7C 5KHOA 1I4PA 1TT5B 3BK2A 2BBCA 5I4DA 1PGAA 4W9HA 1DOIA 3A1QA 2WDQB 4P7IA 3N32A 3OJ4B 3EGRA 5JXVA 2AYOB 3V60A 2BVCA 3Q3FA 1C4CA 4M8MA 3DVNV 2BTEA 2K39A 1QT9A 2N7DA 3HM6X 4LLGM 3DHIC 5D7GA 1OGWA 2A4ZA 5AZFA 3ZXVA 2HJ1A 4IM0A 1VZ8A 4TUUA 5EE1A 1NEKB 2KMMA 4HROA 2FCNA 3AI5A 4AP4C 2BT6A 3Q3OC 4GIVA 2JPHA 3WAOA 2G4DB 1EWYC 2JZZA 2ZPNA 2HTME 2K1FA 4EKUA 4MJSB 1WZ0A 4BVUC 1HE8A 2FNJB 4PT5A 3TBLD 1FXAA 1TS4A 3DBLB 3JYUA 3WALA 3L54A 3BYTB 5BYRA 1ZXHA 2NBWB 2PTLA 3KLSX 3BIID 1Z5SB 5C1ZA 3KYCD 3UINB 3RULA 2LHEA 3R2TA 4IM3A 1BT0A 1F2RC 4N58A 3TEYA 2M4NA 1V81A 1UNSA 2GBJA 1QOAA 3QIJA 4MGYE 2ZCCA 3B0AA 1WE6A 5IKCM 2KO3A 1L0VB 4TQ0A 1KLGD 2WQYB 1WR6E 1SJED 2PMVA 3NVWA 3L17A 1STEA 1SIFA 2IZVB 4BKSD 4AJWA 5MPOA 4KIKA 4C4VB 2MEKA 2K6DB 2REXA 2W3RA 1CJEA 3KVFB 2Y5BB 2AEHA 1FFUA 2ASQA 3QWZB 2CS4A 3V6CB 1V86A 2MBBB 5C3JB 1PDXA 2INNE 1UUPA 1WX7A 2JWZA 5EDSA 4YTPB 2CU3A 1AN8A 1TJEA 3LB8C 1TS3A 3Q3NC 2SEBD 4OVZA 2WDVB 1WWTA 2INDC 4AOFA 2RDBC 5GMVA 1WF9A 2FAZA 4K7WA 1V9JA 3N3KB 4CO7A 3LJ3A 2D3AA 3EC8A 2AX5A 5HKHA 2JY6A 3P42A 2MSED 2KTRB 2GB1A 1KOTA 1WXAA 1YJIA 4KZCA 2MJDA 2WXJA 4DK5A 1E7UA 3BZDB 1D4BA 3P4SB 2V3SA 4XE0A 3ALBA 4KGTA 3A4SC 2JZPA 1YN4A 3RPFC 2KDIA 2EKEC 3AE9B 1P3QU 1FPYA 1S3SG 3V05A 4DWFA 1WE7A 1MG8A 2KC1A 5AZGA 4FBJB 3EHVA 2EKIA 2C7MB 4RGNA 1V6EA 2VH1A 2PW9A 4JPSA 1IGCA 1L2NA 2M56B 3JVZX 3GP7A 2WDRB 1H4RA 2JZ3B 4W9IA 2LWPA 5GXGB 4NQLB 3NJTA 3RT3B 1GC7A 3EFUA 2KN5A 1LFDA 3K9OB 3QQ8B 3RN9C 1K50A 3TJPA 4BFRA 1L4DB 3DBRB 1F2RI 1YMHE 5EE0A 4RFBA 2FUHB 2JXTA 3DPDA 4HKQA 4NPNA 2Z0DB 2LI5A 2INPE 1EWCA 4WQMA 3A4RA 1A5RA 2MP2A 3GZNB 3JSVA 1F0ZA 2PKOA 1C4AA 2J52A 2K5PA 2NCNA 4YTNB 3ZKJC 2CR5A 1OQRA 2X38A 3VUXA 4RM8A 4LJPB 2FIFA 2LGIA 3R66C 2GBKA 4HJGE 3D32A 3AN1A 3BVMA 4B95A 2KWCA 1WYWB 2NS5A 4RM9A 3WA0A 4WWPA 4M00A 5J2RA 1ZGUB 2WDTB 2PE6B 4A90A 1IYFA 3W2DA 3R7RA 2IYDB 5H8YE 3AE1B 2WXGA 5AEKB 2Y3AA 1GOZA 3WIMA 1P7FA 4ZRQA 3AE8B 3P4QB 2J4XA 1WM3A 3B9JA 2MBEA 4OVVA 4P1BC 4MT5A 1SE4A 1QLBB 1ET9A 4TSSA 4LNKA 1HA5A 3DOWA 4HK2A 2CJOA 3ZJUA 2YVCA 3V61A 3U8ZA 4BKSA 1FRRA 1IBXB 3NOBA 5BO4B 1R4NI 1CK1A 4MM3B 3AEFB 4NAWB 1PGBA 2WXFA 1JWAD 2LMCA 2IO0B 4FJVB 1V80A 3U4EG 3ZJTA 4OZAA 3RNBC 3NVYA 3J9CA 3AU5A 2NPTA 2LGXA 1WXVA 2G1EA 3PRPB 3HHMA 1GTHA 1JRUA 1QOFA 3NZUA 2NBVB 3RNAC 2IO2B 1C9FA 4GMVA 2I38A 3DCGA 1R7SA 4OW0A 1WMHB 1WXQA 3ZNID 3VXWA 3IT4B 1ESFA 1JCKB 1XLQA 2PEAA 2ZJDA 3TEZA 1VJKA 3CSFA 2KDBA 4EOYA 2FUG1 1N6ZA 3NZSA 2N9KA 4LTUA 1EO6A 4DDGD 4YWGG 1T5XD 2QSDA 3ZDTA 5LLIA 4GDLB 3U52E 4W9KA 3P2BA 2KAJA 2JSVX 3MHZA 1WGRA 2E6XA 2PLPA 5D3DA 1WJUA 5DPTA 4ZRPA 2ONQA 3T9LA 1TY0A 4YTMB 2KOXA 1UGJA 1UWXA 2KWDA 2ZNVB 3RFZB 1IGDA 2AQ1B 1PUTA 2BKFA 4NJ6A 4MELA 3P1MA 1GUAB 4A3OA 2PIAA 2C60A 3WAMA 2GBRA 1IUEA 5L83A 1WY8A 4NJCA 4S17A 3RZWC 3ZTDA 3LXFA 3PLVA 3ZQ4A 2K0PA 3Q6BA 2LRWA 5IA7A 2MLBA 3AE6B 2D5GA 1WGKA 2WWZA 5AUIA 2DWQA 2MX2A 3SHQA 4BOSC 3GB1A 3SDLC 1V2YA 4GLSC 2L00B 3AH7A 1FXIA 2JXXA 2KXJA 3U30A 3BVZA 3U7DA 2JUOA 4PK1A 2RPQA 2RSUA 2WXPA 2KJRA 1IP9A 3VUYA 2L0FA 2MP2B 3Q2AC 1WRDB 2PJHA 4FHKA 3VRBB 1TKGA 1YN3A 2ZW1A 4FLHA 4FADA 2V1YA 4NNJB 1E8ZA 4K81A 3DVGY 3PREA 2N7EA 3UIOB 1G6JA 4X57B 2WP9B 4W9GA 2K8CA 3QARA 1FNVA 2N9PC 1SIJA 1T0SC 3UIPB 3ZXRA 2IDYA 1E8XA 3PHXB 2WU5B 1WR1A 2C5LC 4GOCA 1A70A 1UGMA 4WWNA 4F7ZA 4G3XB 4JIOU 4GB9A 4TV3A 1YJJA 3PVLA 4II2B 3MJ5A 3APCA 1F9JA 1YD8U 3PT2B 1TY2A 3CWIA 4KDLB 3V3XA 3ML8A 1TGZB 3GS2A 1LM8B 3AMZA 2DYOA 1T0YA 2MW5A 2KKCA 1Q0WB 5G55A 3TSSA 3Q14C 2QC8A 5HFYA 2L76A 4PS3A 4A55A 2WXLA 5C2TB 3ZRCA 1Q5WB 2DLBA 1YX6B 1DYQA 4E71A 4FULA 1SGHA 5JZEB 3Q3MC 1RWSA 1E5WA 2ICIA 1LQBA 3SR6A 4MGIE 3CIRB 2DZMA 3DHGC 4FN2A 3KW5B 2QIEB 2J0JA 2WHIA 2KN4A 1WX8A 3ZNHB 4P16A 3I57A 1GPXA 4DHZB 4HLEA 3ECIA 1WI0A 1J7CA 2WS3B 5DCNA 2ZVNA 3UI3A 2FCSA 3MC9A 3ZJVA 5HHDG 1L0XB 2AL3A 3KUDB 4MH8A 2C9WB 2G9HD 4LDTD 3I63C 1Z2MA 2HTHA 1XLNA 3H9DA 1GB1A 2CU1A 3NS8A 3DVGX 2CJNA 2JYTA 2G45B 3L13A 1FRDA 1OQQA 4ICUA 1N60A 1EF5A 1L0YB 2BGFA 1QILA 2TSSA 1JRPA 3W9CB 1ZUD2 2IO1B 2XEWA 2MRPA 1K51A 2DYBA 2EMSA 2ZZPB 1WYGA 2BYTA 2KMAA 3E9SA 2VH2A 1GT8A 1XXGA 3H7PA 1TYGB 3HM3A 5FK9C 1JWUD 1ACCA 3X23A 5TR5A 2QDFA 4LNFA 5J18A 5CHWA 3SD5A 3A9JA 2E3TA 2IGGA 4W9JA 2D10A 3BK1A 3RNGC 2CHZA 1NENB 2A5UA 3MJWA 3FC4A 2DZIA 2D11A 3A9KB 3W1SC 4DXGA 1RLFA 2Y5PA 1N5WA 3C8YA 1FCCC 1TKEA 3PTFC 3Q8BA 1WGHA 1WFYA 2XK5A 1MVKA 1I4XA 3RZFA 2OEDA 3I5JC 4HWIB 1YQBA 3HUIA 2L83A 1OEYJ 2WXNA 3WAPA 1N62A 1C3TA 3PGEA 3AXCA 1NVID 1SB3C 3IHPC 1WSPA 3RCZA 1Y56A 3KWVA 3QCAA 3H1UA 1SSNA 2BF8B 2M1MA 1D5MC 2QJLA 2N1WA 2AQ2B 4KKIA 2JRHA 2JWUA 3IXSA 4ARCA 3ENEA 3VHTC 4REZA 3GE3C 4US8A 3ETRA 2KANA 2MA9B 4LCDE 1LGRA 3UQAA 1K8RB 4BOZB 3LDZE 3PZDA 1TS2A 1WRIA 3L10B 4M0WB 1QOBA 3PZ7A 3RNCC 3CF4A 4A3PA 3M62B 3N30A 5FR6A 1D5ZC 2H89B 2C7NB 4MSMB 4IDIA 1KTKA 4K3CA 3M3JA 3LYYA 3P4PB 3R3MA 1ISNA 4FA6A 2DZJA 2J0MA 4Q2JA 4HRSA 1ENFA 1V5TA 4ICVA 1M94A 4L2YA 1I4RA 4L23A 2GLSA 1ZW7A 3L4PA 3DVNU 3DBSA 4M01A 1FEHA 2LVPA 4A8XC 2N9LA 4G50A 3A1QB 1LXDA 3AEEB 1EF1A 3DWGC 4G11A 4DDID 4LNIA 3L16A 4DHZE 3EFCA 1K53A 5IAAC 5AUKA 1WJ6A 1V1PA 2ZCBA 1C77A 1YQ4B 3N20C 4HPLB 4XWTA 4AWJA 1R4MI 3VAWA 2ZEQA 1HQRD 4C00A 3APDA 1MHHE 3CMMB 1RFAA 4HEA1 2K8BA 1XO3A 2PE9A 4P1CC 3PLUA 2KLCA 4GXBA 5J17A 4H2AA 1EM7A 3RD2A 1JWBD 1F1HA 1YJ1A 2L8JA 2WXMA 2N9XA 3SFDB 1HZ5A 3ZYYX 5H92C 1TKYA 4A9AA 4YT0B 4I6LB 4O1NA 3V62A 3ZNZB 5LXIB 1P98A 3H7PB 5BYSA 2KNBA 1BUIC 2KX0A 2BS3B 2D3GA 2RDGA 3TMPB 3W1SA 1DOXA 4NAMA 1FO4A 1EUVB 4FJZA 3FAHA 4BZAA 2HE7A 2WXHA 3JW0X 2RMMA 3FKYA 5JHBA 4C7ZA 3GOEA 5JHAA 1FM0D 2KK8A 4F1SA 4ZDVA 2B76B 3K9PB 1SE2A 1XEEA 1XLPA 4YSZB 5LXHA 3M63B 1FNWA 4FJYA 2JQRB 2O6VD 5FKAC 2IY0B 4KIKB 4WAAA 1KLVA 1E9MA 3L0WB 2OHFA 2L1AA 5DPRA 1JALA 4RGTA 3OAWA 1J0GA 1ZE3D 1FIQA 3NVZA 2BKRB 3VRAB 2WX0A 1H8CA 3PRMB 3Q8FA 1OQYA 2JVCA 1GAQB 2LVOA 2FIDA 3I3TB 4J3OD 4W9CA 3VTUA 1I4GA 2VZKB 4GDKA 3ML9A 1BXTA 4LJOB 1KFYB 2R61A 2BYVE 2DAJA 3KWLA 2CHXA 4XDCA 5E6JA 1WIAA 2D07B 1UBQA 4IW0A 2J53A 2M0AA 3IFWB 1P0RA 2KDFB 2KDEB 4NZLB 2KQ4X 5D3IB 2L05A 2W3SA 1JQ4A 1HZ6A 2NTSA 2OJRA 4JGHB 3RNEC 2KTFA 2MBOA 2UU7A 2O2VA 2OJWA 1QOGA 5AZHA 2N1VA 2V4LA 2R2OA 2H88B 1VDVA 1N63A 4MJSA 3TEXA 2KT7A 2N7JA 1S1QB 3IAM1 1ROEA 1VR9A 1SF0A 2J0KA 1L6UA 3A33B 3PRZA 4MSQB 1FMAD 5IN7A 1L5PA 4HDQA 4AJYB 4ZHOA 1QZEA 4K7SA 2IO3B 1HXYD 3N1XC 4AUQC 4HDOA 5D94A 4IKGA 3MC0B 1D5XC 2G3QB 2LGSA 4ZRKA 4JX1C 1TS5A 3BVGA 4WJPA 3AE3B 1Q1OA 4WJNA 3B1LX 4KGRA 2M17A 3T3NA 2VRRB 1NI3A 2QMTA 1YOVB 4KGSA 3IT6B 1P7EA 2DZKA 4CYEA 4KVGB 3AV8A 3JSVB 2V0GA 4ZRIA 1E7VA 3HRDD 2V4IB 1IPGA 5TSSA 2YEPB 4J6IA 2MQJA 4C4VA 1SJHD 2LVQA 2L52A 3KH0A 2I1JA 2AQ3B 4WWMA 2GRIA 2MH7A 1C4PA 1GJZA 2EMTA 1KH0A 1OFFA 3IVFA 4KZ0A 3TL5A 4IWQA 4B0EA 1T0RC 4BBNF 2WXIA 1WH3A 2NTTA 2PVGC 2BQQA 2KFJA 1NDDA 5HI1A 1EU4A 4JWSC 2WNMA 5JH5C 2GMIC 1QF6A 1E6EB 2FE8A 1PYWD 4ACFA 4DXFA 2JRIB 1EU3A 1HEZE 3DBRI 1DOYA 3AECB 3QC8B 3Q8AA 1PQSA 2DBYA 3OG5A 3CF6E 3QK0A 4EZLA 3DQVA 2KQSA 4JQWC 2KTRA 3ZW3A 2EELA 3GZNI 4ARIA 1J7AA 4W9DA 5FR3A 5G5GA 3OWEB 2DYMA 4RF0A 1E90A 1RM6C 2D3CA 2K8HA 1YNTE 2XBBC 3ZNGC 1PFDA 2O6VA 4EUTA 1HTOA 3R2IA 2BB5A 1ZPSA 3RUIB 4HVBA 4GSWA 2JT4B 2WXQA 2IPKD 1UD7A 3HK0A 1GC6A 4LNOA 5KHQA 5DPSA 1R4MB 4HCNB 3TCAA 4BBNC 4HCPB 1WGYA 2KFKA 2NPTB 4R3DA 2IJ0A 1BMLC 2L32A 2HD5B 2AL6A 3N9YC 2GOWA 3PSEB 2BPSA 3APFA 1FXTB 1WGGA 2LRUA 3VH3B 2N0SB 4JL9A 2JU6X 3CSTA 2MBHA 1F52A 3QHTA 4N59A 1V1OA 3V6EB 2L0TA 2I2YA 4HXDA 4ANUA 2KACA 1YN5A 3OJ3A 2KX3A 4GDKB 2QHOA 1XT9B 2ZPYA 1Q10A 2W55A 2LD9A 4HPPA 4RH6A 1MFWA 1R4NB 4TMAB 5BMHA 1YQ3B 1VRAB 3ZGZA 2LJIA 3L08A 4URKA 3NY5A 5CTRC 2IBIB 4ITKA 4B0MA 1D3ZA 1H7XA 2LGYA 3EUB2 4BKGA 2BYEA 1XQQA 1VLBA 2J7QB 3DDCB 1WJ4A 2O2VB 3SFEB 2IGHA 1PGXA 1GTEA
chains in the Genus database with same CATH topology
3LYYA 3P4PB 4AQ7A 1ZDVA 2G1EA 3BWUD 3NZ3A 3IAS1 3MFGA 1M4VA 1DGJA 1GTHA 2WXRA 1QOFA 3KQ4A 1C9FA 4OZCA 4Q2JA 4EE2A 4HRSA 1ENFA 4L2YA 1I4RA 2I38A 4L23A 1VZ7A 2ZW0A 1R7SA 4OW0A 3L4PA 1WXQA 5EE9A 3IT4B 1KRHA 2VZKD 1ESFA 3P63A 1JCKB 1XLQA 3TEZA 1VJKA 1FEHA 3W5VB 1MPEA 4A8XC 1ET6A 3AEGB 2FUG1 2N9LA 2SAKA 3E56A 2RDHA 2N9KA 1AW7A 1JW9D 1I4HA 4LTUA 2W54A 1MI0A 4YWGG 1T5XD 2ACZB 1IBXA 2QSDA 3AEEB 3DWGC 4GDLB 3U52E 2NMQA 2YEPF 3AEBB 4M0WA 2KAJA 2JSVX 3FILA 3MHZA 4JWUC 1K53A 4D2KA 2QILA 1CQVA 2E6XA 5AUKA 4TQ1A 1V1PA 4AS1A 1VZ6A 2PLPA 1D6EC 5D3DA 2JYEA 2V3NA 1C77A 1YQ4B 2ONQA 3NVVA 4ZRPA 1TY0A 4YTMB 4XWTA 4RF1A 1N61A 2JX5A 3AE5B 1UGJA 1I7HA 1UWXA 2KWDA 3RFZB 1C76A 4ZYSA 1HQRD 1IGDA 2WU2B 1PUTA 2AQ1B 5BMGA 3P1MA 1MHHE 3NUHB 2PIAA 1IUEA 4HEA1 4NJCA 4UDUC 4HKZE 4IOIE 4P6VF 3LXFA 2K9XA 3AEDB 1XO3A 3ZQ4A 2K0PA 2WXOA 1XCQL 1FCLA 3AM9A 2GI9A 4H2AA 1EM7A 1JWBD 1V8CA 1J7BA 3AE6B 2D5GA 4RGOS 2WXMA 1WGKA 1RFKA 2M19A 2DWQA 5AUIA 3SFDB 1I4PA 1HZ5A 3ZYYX 5H92C 3BK2A 1TKYA 2BBCA 4A9AA 4YT0B 1KF6B 5I4DA 4O1NA 3GB1A 5BYSA 1PGAA 5G5HA 1DOIA 1BUIC 4GLSC 2LHDA 3AH7A 1FXIA 2ON8A 2BS3B 2RDGA 2WDQB 3BYYB 3HVDA 3W1SA 1DOXA 4NAMA 1FO4A 3FAHA 1SBBB 3EGRA 3BVZA 3PO0A 4OZBA 5JXVA 2WXHA 2WXPA 1C4CA 1RYJA 2RMMA 2BTEA 1JWSD 1QT9A 4C7ZA 1SXTA 4LLGM 5D7GA 1FM0D 2B76B 3VRBB 1QKZA 1SE2A 1TKGA 1XEEA 1YN3A 1XLPA 4YSZB 1VZ8A 5EE1A 1NEKB 2ZW1A 1FNWA 2KMMA 4HROA 2IGDA 2JQRB 1E0ZA 2BT6A 5FKAC 3AE4B 1EWYC 1JROA 1E9MA 2OHFA 2HTME 2L1AA 1JALA 1NYQA 4RGTA 2WP9B 4PT5A 4DQOC 1ZE3D 1FIQA 1FXAA 1TS4A 3NVZA 3VRAB 3BYTB 1FNVA 5BYRA 1ZXHA 2PTLA 3KLSX 3BIID 1SIJA 3Q8FA 4C80A 3URYA 3ABVB 2IDYA 1GAQB 2WU5B 4J3OD 1A70A 2LHEA 1B9RA 1I4GA 2VZKB 3R2TA 1ZP0B 1BXTA 1KFYB 2R61A 3KWLA 1F2RC 4XDCA 5E6JA 4N58A 3TEYA 1UNSA 1YJJA 2J53A 2M0AA 1QOAA 3MJ5A 1ZXIA 3I9V1 4NZLB 1L0VB 4TQ0A 2KQ4X 1TY2A 3CWIA 5D3IB 2W3SA 1KLGD 2WQYB 3TUOA 3V3XA 1JQ4A 1SJED 1B1ZA 1XCTL 4WH4A 2PMVA 3NVWA 1HZ6A 3GS2A 1STEA 2NTSA 1E10A 3AMZA 2DYOA 3AE2B 5MPOA 1QOGA 2MEKA 1UWMA 1MHXA 2XNAC 4L1BA 2H88B 1VDVA 2W3RA 1N63A 1CJEA 3TEXA 3TSSA 2N7JA 3IAM1 1ROEA 1VR9A 1FFUA 1SF0A 3VR8B 3PZ8A 1L6UA 5T8IA 5HFYA 4YXDB 1SEBD 1NYRA 5C3JB 2W82A 1PDXA 3EA6A 4A55A 3P4RB 3VR9B 1FMAD 5C2TB 1UUPA 2INNE 2WXLA 4JE3B 2DLBA 1KLUD 1L5PA 4ZHOA 1DYQA 4LK0M 4YTPB 2CU3A 1AN8A 1F77A 1HXYD 4N6EB 1TJEA 1CZPA 3LB8C 1TS3A 1RWSA 3U2SC 4IKGA 3MC0B 2SEBD 1D5XC 2ICIA 4OVZA 2WDVB 1WWTA 1SE3A 3NVYA 3SR6A 3CIRB 4JX1C 3VQIA 1TS5A 2QIEB 3BVGA 2KN4A 3AE3B 2AX5A 4P16A 3I57A 1GPXA 4KGRA 1K52A 4XWWA 3B2FA 3T3NA 1NI3A 2QMTA 4WAFA 4KGSA 3IT6B 1P7EA 1J7CA 2WS3B 3P42A 2GB1A 3AV8A 3UI3A 1YJIA 2V0GA 1FNUA 2MJDA 3HRDD 2WXJA 2V4IB 3BZDB 4RGMA 5HHDG 3ZJVA 1L0XB 5TSSA 1D4BA 2BS2B 3P4SB 4OHJA 2YEPB 4XE0A 2HDEA 3T3OA 3MP9A 1XLOA 1SJHD 4MH8A 4KGTA 2L52A 2G9HD 2AQ3B 2JZPA 2WXKA 1YN4A 3TEWA 2XN9C 1XLNA 2GRIA 2MH7A 1C4PA 4WWMA 3RPFC 1GB1A 3AE9B 1KH0A 1OFFA 2QEJC 2CJNA 2JYTA 1ZDXA 1FRDA 4USAA 5BYQA 1OQQA 4C7YA 1N60A 5HG2A 3V05A 3WCQA 1L0YB 3FILB 4B0EA 4YSXB 4WURA 1QILA 2TSSA 2WXIA 5LNK1 2NTTA 1JRPA 2EKIA 1AYFA 2PVGC 4RGNA 3W9CB 1ZUD2 2PW9A 4JPSA 1IGCA 2M56B 2K3UA 5HI1A 1EU4A 2FBWB 4JWSC 3GP7A 1AWDA 2WDRB 1JWMD 2BW2A 2Q5WD 2WNMA 4ZOHC 5GXGB 1K51A 1QF6A 1LO5D 1WYGA 2BYTA 4RNAA 3Q8CA 3Q69A 1E6EB 4FXCA 2FE8A 3E9SA 1GT8A 1PYWD 4DXFA 1XXGA 1K50A 1L4DB 1EU3A 1HEZE 1F2RI 1TYGB 5FK9C 1YMHE 5EE0A 1C78A 1JWUD 4CQNA 1ACCA 1DOYA 3AECB 3Q8AA 4KX6B 4RFBA 3NRZA 2DBYA 2JXTA 2BB6A 2V3PA 4HKQA 3R8BA 1H7WA 2INPE 1EWCA 4WQMA 1F0ZA 2E3TA 3W5UB 2EELA 2IGGA 1C79A 2PKOA 1C4AA 1I4QA 3H8HA 4ARIA 2J52A 2K5PA 3BK1A 1J7AA 1NENB 4YTNB 5FR3A 3FC4A 1XF5L 5G5GA 1QQRA 4WIPA 2X38A 1OQRA 3OWEB 1T3QA 5BMIA 1V97A 2DYMA 4RF0A 1RM6C 1YNTE 1E7PB 1L6VA 1PFDA 2LEKA 2LGIA 4DXGA 2KDMA 2Y5PA 1ZOYB 1N5WA 3C8YA 4HJGE 2MJEA 3R2IA 1FCCC 1TKEA 2BB5A 3Q8BA 1ZPSA 1MVKA 3BVMA 3AN1A 4YSYB 1I4XA 2OEDA 2J42A 2WXQA 4C56C 2IPKD 3U7ZA 2LFIA 3HUIA 3AEAB 2L83A 4A90A 2WXNA 1N62A 3SEBA 1L4ZB 2BS4B 4R3DA 2IJ0A 1BMLC 3AB5A 3W2DA 1NVID 3Q8EA 2L32A 1SB3C 4US9A 1WSPA 3N9YC 1Y56A 3DWMA 5H8YE 3KWVA 4RCOA 1N5XA 1T6BX 3AE1B 3NS1A 2WXGA 2Y3AA 1GOZA 2N0SB 1P7FA 2JU6X 4ZHPA 1SSNA 4ZRQA 3AE8B 1D5MC 3P4QB 2J4XA 3B2GA 4N59A 1V1OA 3B9JA 5EE3A 1FFVA 4XDDA 2QJLA 2Y5CA 4MT5A 1SE4A 2PVOD 2I2YA 2AQ2B 1QLBB 2LUMA 1ET9A 1GB4A 4KKIA 4TSSA 3HVZA 2KACA 1YN5A 2JWUA 4GDKB 3IXSA 3AE7B 4ARCA 1Q10A 1HA5A 2RPVA 2W55A 2MJ3A 1FD6A 2CJOA 4A6QA 4REZA 3ZJUA 4RH6A 4US8A 2K22A 3ETRA 2WLBA 1FRRA 4TMAB 4MACA 1IBXB 5BMHA 1YQ3B 1JMLA 1VRAB 3ZGZA 2LJIA 1CK1A 4MM3B 4IDIA 1TS2A 3AEFB 3O13A 1WRIA 1PGBA 4NAWB 1QOBA 1JWAD 2LMCA 2WXFA 3PZ7A 4ITKA 1H7XA 3CF4A 4KKJA 4B0MA 3EUB2 2Z8LA 1VLBA 1V1PB 1TZOA 1D5ZC 2H89B 3U4EG 3ZJTA 3SFEB 4OZAA 2IGHA 3J9CA 1PGXA 1KTKA 1GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  2PKO A;  2WDQ B;  3P4R B;  3VR9 B;  5C2T B;  1FMA D;  1DOX A;  3P4P B;  1FO4 A;  2K5P A;  1J7A A;  1L5P A;  2G1E A;  3FAH A;  3PO0 A;  4ZHO A;  1NEN B;  4YTP B;  1DGJ A;  4YTN B;  2CU3 A;  4N6E B;  1RYJ A;  3FC4 A;  5G5G A;  1TJE A;  1CZP A;  1OQR A;  1GTH A;  3LB8 C;  1QT9 A;  4C7Z A;  1T3Q A;  1QOF A;  1RWS A;  1V97 A;  1FM0 D;  1RM6 C;  1E7P B;  2B76 B;  3VRB B;  1L6V A;  1PFD A;  1TKG A;  1XLP A;  2LEK A;  4HRS A;  1ZOY B;  4YSZ B;  1N5W A;  2WDV B;  1NEK B;  1WWT A;  2KMM A;  1PDX A;  4HRO A;  3NVY A;  5EE1 A;  5AUI A;  2MJE A;  1TKE A;  3SR6 A;  1F0Z A;  2JQR B;  1R7S A;  1E0Z A;  2BT6 A;  3CIR B;  3L4P A;  1WXQ A;  4JX1 C;  3AN1 A;  5EE9 A;  1KRH A;  4YSY B;  3P63 A;  3AE4 B;  1EWY C;  1JRO A;  1XLQ A;  2QIE B;  1E9M A;  2OHF A;  2HTM E;  1VJK A;  3W5V B;  3AE3 B;  2AX5 A;  1JAL A;  3HUI A;  3AEG B;  1NYQ A;  3AEA B;  2L83 A;  1GPX A;  2WP9 B;  3B2F A;  1NI3 A;  1JW9 D;  1J7C A;  2WS3 B;  1N62 A;  1FIQ A;  1FXA A;  4LTU A;  3AV8 A;  3NVZ A;  1YJI A;  3VRA B;  2W54 A;  2BS4 B;  2MJD A;  3HRD D;  3AB5 A;  2ACZ B;  1NVI D;  1SB3 C;  2M19 A;  3AEE B;  3BII D;  4US9 A;  4C7Y A;  1SIJ A;  3DWG C;  2BS2 B;  3P4S B;  3DWM A;  5H8Y E;  4C80 A;  3ABV B;  3AEB B;  1N5X A;  1GAQ B;  1XLO A;  3AE1 B;  2KAJ A;  5EE3 A;  3NS1 A;  4JWU C;  2L52 A;  2N0S B;  2WU5 B;  1XLN A;  2MH7 A;  4WWM A;  3RPF C;  4ZHP A;  1A70 A;  5AUK A;  1B9R A;  3AE9 B;  1OFF A;  2CJN A;  3AE8 B;  3B2G A;  3P4Q B;  1ZP0 B;  1KFY B;  1YQ4 B;  1FRD A;  3B9J A;  3NVV A;  1OQQ A;  1FFV A;  1N60 A;  3KWL A;  4YTM B;  4N59 A;  2QJL A;  4USA A;  2Y5C A;  3W5U B;  3WCQ A;  4YSX B;  4N58 A;  1N61 A;  2JX5 A;  2PVO D;  3AE5 B;  1QLB B;  1JRP A;  2EKI A;  1I7H A;  1YJJ A;  3HVZ A;  1AYF A;  1QOA A;  2PVG C;  3W9C B;  1ZUD 2;  2WU2 B;  1PUT A;  1ZXI A;  3AE7 B;  2M56 B;  3P1M A;  2FBW B;  4JWS C;  1AWD A;  2WDR B;  2PIA A;  2W55 A;  2MJ3 A;  1L0V B;  2CJO A;  1IUE A;  2Q5W D;  3CWI A;  4P6V F;  4ZOH C;  5GXG B;  2K22 A;  2W3S A;  3ETR A;  2WQY B;  4US8 A;  1JQ4 A;  2WLB A;  3LXF A;  3NVW A;  2K9X A;  3AED B;  1FRR A;  1XO3 A;  1QF6 A;  1WYG A;  1E10 A;  1YQ3 B;  1E6E B;  3AM9 A;  4FXC A;  1GT8 A;  4IDI A;  3AMZ A;  1JWB D;  1V8C A;  3AE2 B;  3AEF B;  5MPO A;  1J7B A;  1QOG A;  3AE6 B;  1TYG B;  1WRI A;  1DOY A;  1WGK A;  1QOB A;  1JWA D;  1UWM A;  4ITK A;  5EE0 A;  1H7X A;  2H88 B;  3CF4 A;  3AEC B;  1RFK A;  1VDV A;  2DWQ A;  3SFD B;  1N63 A;  4KX6 B;  1CJE A;  2W3R A;  3EUB 2;  3ZYY X;  3NRZ A;  5H92 C;  2DBY A;  1VLB A;  1TKY A;  1ROE A;  4A9A A;  1FFU A;  2H89 B;  1KF6 B;  4YT0 B;  3VR8 B;  1SF0 A;  1H7W A;  1L6U A;  4WQM A;  3SFE B;  4YXD B;  5G5H A;  1DOI A;  1NYR A;  5C3J B;  3AH7 A;  1FXI A;  1GTE A;  2E3T A; 
#chains in the Genus database with same CATH topology
 2KQ7 A;  1ZDV A;  2WGS A;  1WZ3 A;  2NVU I;  3MFG A;  3ZDM C;  4W9F A;  1NI2 A;  2LGD A;  4MGZ E;  4JLC A;  5IP4 D;  3AU4 A;  2KVR A;  4K1R B;  3VVW B;  2ZW0 A;  3H7S A;  5EE9 A;  1CMX B;  3P63 A;  2M0X A;  4XC2 A;  5L95 C;  4EZK A;  2WX1 A;  1ET6 A;  2SAK A;  3E56 A;  3T8M A;  4KSL C;  2AWT A;  4QAY A;  1AW7 A;  1JW9 D;  1I4H A;  5CHF A;  2YLM A;  4B6W A;  2LUE A;  2W54 A;  3ZRF A;  5D2M B;  1IBX A;  3B08 A;  4MM3 A;  2DAF A;  4ASW C;  4NAW A;  2D3B A;  3FIL A;  3PS6 A;  4JWU C;  1WXM A;  4WJO A;  2DHZ A;  4TQ1 A;  4AS1 A;  1VZ6 A;  2JYE A;  2V3N A;  3PHW B;  1RRB A;  3PPA A;  4LNN A;  3QA8 A;  4RF1 A;  1N61 A;  4EFO A;  4PS8 A;  1C76 A;  4DHJ D;  4ZYS A;  1I42 A;  2KWV B;  1WGD A;  3PV1 A;  2Z0E B;  4UDU C;  4IOI E;  3AED B;  3VTW A;  2WXO A;  1VD2 A;  1XCQ L;  3ZTC A;  1FCL A;  4IG7 B;  1WMH A;  2DX5 B;  1C1Y B;  1J7B A;  2BWF A;  3ZLZ A;  2M19 A;  4ANV A;  2CKH B;  1KF6 B;  2R2Q A;  3QX1 A;  5G5H A;  2LHD A;  1L7Y A;  3HIZ A;  2ON8 A;  3BYY B;  4MDK E;  3HVD A;  1VCB A;  1SBB B;  3PO0 A;  4OZB A;  1TBE A;  4GDL A;  1P9D U;  1X1M A;  1RYJ A;  3RMK C;  1JWS D;  3NG0 A;  3H6N A;  1SXT A;  4IWO A;  1QKZ A;  2IGD A;  1E0Z A;  5CX3 A;  3AE4 B;  1JRO A;  3VFK A;  1YIW A;  2O6V B;  3GE8 C;  1NYQ A;  2L7R A;  2NR2 A;  4DQO C;  2CHW A;  2M8S A;  2IY1 B;  2MHJ A;  5G2N A;  4C80 A;  3URY A;  3ABV B;  1V49 A;  2KFK B;  5C23 A;  5D6J B;  4NQK E;  2DEN B;  3O65 B;  1B9R A;  4TKN A;  1ZP0 B;  4IUM B;  4I6N B;  1UH6 A;  2D2Q A;  1TIF A;  4K7U A;  1UEL A;  3DBH I;  1ZXI A;  2WYQ A;  3I9V 1;  3KUC B;  4XX5 A;  3TUO A;  1B1Z A;  1XCT L;  4WH4 A;  3OLM D;  1E10 A;  1J8C A;  4G0N B;  4DBG A;  2KWU B;  3AE2 B;  4W9L A;  5IOI A;  4XGA B;  1UWM A;  1MHX A;  2XNA C;  3KUZ A;  4L1B A;  3QJZ A;  3VR8 B;  3ONS A;  3PZ8 A;  5T8I A;  3WAN A;  4PYU A;  4YXD B;  1SEB D;  1NYR A;  4OVU A;  2W82 A;  3EA6 A;  3SU8 X;  3P4R B;  3VR9 B;  2FCM A;  4JE3 B;  4M02 A;  1Y8R C;  1KLU D;  2KMC A;  3X0W A;  4LK0 M;  5E6N A;  2LZ6 A;  1F77 A;  4N6E B;  1SE9 A;  4I6P A;  1CZP A;  2GBM A;  1MJD A;  3U2S C;  3R7Q A;  1XD3 B;  4NJ7 A;  1SE3 A;  4W9E A;  4NY0 A;  3VQI A;  4IC7 B;  2W9N A;  1K52 A;  4XWW A;  3B2F A;  4WAF A;  3C19 A;  2MWS B;  3A9J B;  4MEM A;  3VUW A;  1FNU A;  3ZO5 B;  4GGQ A;  2UWQ A;  3QAQ A;  4II3 B;  4RGM A;  2BS2 B;  4OHJ A;  4E74 A;  2HDE A;  3T3O A;  3MP9 A;  1XLO A;  2LXA A;  2KYW A;  2KHW B;  2WXK A;  4EEW A;  3TEW A;  2XN9 C;  2DNF A;  2QEJ C;  1TTN A;  1ZDX A;  2UYZ B;  5BYQ A;  4USA A;  4C7Y A;  2XK5 B;  5HG2 A;  2RGF A;  3WCQ A;  3FIL B;  4YSX B;  4GU2 A;  4WUR A;  4PS7 A;  1T0Q C;  5LNK 1;  3MTN B;  2KZR A;  1AYF A;  3DBL I;  2K3U A;  3EEC A;  2FBW B;  3IG3 A;  1I35 A;  1AWD A;  1P1A A;  2B3A A;  1JWM D;  2BW2 A;  2Q5W D;  4GN1 A;  4ZOH C;  1YX5 B;  2C7H A;  3Q3J A;  4ZRJ A;  1LO5 D;  4WJQ A;  2N9E B;  4RNA A;  3Q8C A;  3RYT A;  3Q69 A;  4FXC A;  1RAX A;  1UBI A;  4WWO A;  2I1K A;  2L3Z A;  4CQN A;  1C78 A;  4ZYN A;  4KX6 B;  3TIX A;  3ZIM A;  1WXS A;  3NRZ A;  2BB6 A;  2V3P A;  4MGK E;  3R8B A;  1H7W A;  2K6Q A;  3W5U B;  3H8H A;  4WQO B;  1C79 A;  1I4Q A;  4RMA A;  4S0R A;  4DXA B;  4KSK C;  1XF5 L;  1QQR A;  4WIP A;  1T3Q A;  5BMI A;  1V97 A;  1E7P B;  1L6V A;  2LEK A;  3VH4 B;  2KDM A;  1ZOY B;  1ZKH A;  2MJE A;  5CHV C;  1NBF C;  5DPW A;  2RD0 A;  4YSY B;  3VDZ A;  2J42 A;  1HTQ A;  2JF5 A;  4A20 A;  2BWE S;  3BY4 B;  2KD0 A;  4C56 C;  3AUL A;  3U7Z A;  2LFI A;  3AEA B;  3M95 A;  4B9K A;  1GNU A;  1AAR A;  4YL8 A;  2KJ6 A;  3SEB A;  1L4Z B;  2BS4 B;  3AB5 A;  3Q8E A;  4US9 A;  2LAS A;  3DWM A;  3MC8 A;  3UF8 A;  4RCO A;  1N5X A;  1T6B X;  3UQB A;  3NS1 A;  1E8Y A;  3VTV A;  4ZHP A;  3RNF C;  3B2G A;  5EE3 A;  1FFV A;  5E6P A;  1KJT A;  4N9F 4;  4XDD A;  2Y5C A;  4EZJ A;  2PVO D;  2LUM A;  4E3C A;  1GB4 A;  3HVZ A;  2RR9 A;  3AE7 B;  2RPV A;  2MJ3 A;  1FD6 A;  4A6Q A;  4PYZ A;  3A9K A;  4M8N A;  2K22 A;  4CHK A;  2WLB A;  1TZ1 A;  4MAC A;  1JML A;  2INC C;  4LDT B;  4F8C B;  3O13 A;  2LXC A;  2MBQ A;  2V9H A;  4KKJ A;  4ANX A;  3MHS D;  2BYF A;  2Z8L A;  4BAX A;  1V1P B;  1TZO A;  4ANW A;  4MH0 E;  4IWP A;  3NHE B;  3N1Z C;  1MG4 A;  4AQ7 A;  1J19 A;  3NZ3 A;  2NBU A;  2QCZ A;  3BWU D;  3IAS 1;  3UGB B;  1M4V A;  1DGJ A;  4XZ4 A;  2WXR A;  2LJ5 A;  3KQ4 A;  2K25 A;  4OZC A;  4EE2 A;  1WX9 A;  2ZVO A;  2Z59 B;  3N1Y C;  1VZ7 A;  1V5O A;  3KYD D;  1KRH A;  2VZK D;  4KDI C;  4KV2 A;  3W5V B;  1MPE A;  1UZX B;  4BKT A;  3AEG B;  3S2A A;  1OEY A;  2RDH A;  4HPM B;  5E6O A;  2KJH B;  3DBH B;  1WJN A;  1MI0 A;  2ACZ B;  2KLG A;  5IO9 A;  1UF0 A;  1KM7 A;  2NMQ A;  2YEP F;  3AEB B;  1GG3 A;  4M0W A;  4IM2 A;  3ZUN A;  4D2K A;  2QIL A;  1CQV A;  2KVZ A;  3ZVV A;  1D6E C;  2OOB B;  3NVV A;  3IBE A;  4FHJ A;  2JX5 A;  3AE5 B;  2GBN A;  1I7H A;  2MCN B;  1WM2 A;  2FCQ A;  2ZNV C;  4HJK A;  4K3B A;  2HJ8 A;  4XYC A;  2X8X X;  2WU2 B;  3BIN A;  5BMG A;  3NUH B;  3DHH C;  2PPH A;  4DHJ B;  2KC2 A;  3C0R B;  4HKZ E;  4P6V F;  2K9X A;  3W1Y A;  1E8W A;  3AM9 A;  2GI9 A;  1U4A A;  1OTR B;  2N4F A;  1V8C A;  2G4S A;  4RGO S;  1RFK A;  3RI7 C;  5KHO A;  1I4P A;  1TT5 B;  3BK2 A;  2BBC A;  5I4D A;  1PGA A;  4W9H A;  1DOI A;  3A1Q A;  2WDQ B;  4P7I A;  3N32 A;  3OJ4 B;  3EGR A;  5JXV A;  2AYO B;  3V60 A;  2BVC A;  3Q3F A;  1C4C A;  4M8M A;  3DVN V;  2BTE A;  2K39 A;  1QT9 A;  2N7D A;  3HM6 X;  4LLG M;  3DHI C;  5D7G A;  1OGW A;  2A4Z A;  5AZF A;  3ZXV A;  2HJ1 A;  4IM0 A;  1VZ8 A;  4TUU A;  5EE1 A;  1NEK B;  2KMM A;  4HRO A;  2FCN A;  3AI5 A;  4AP4 C;  2BT6 A;  3Q3O C;  4GIV A;  2JPH A;  3WAO A;  2G4D B;  1EWY C;  2JZZ A;  2ZPN A;  2HTM E;  2K1F A;  4EKU A;  4MJS B;  1WZ0 A;  4BVU C;  1HE8 A;  2FNJ B;  4PT5 A;  3TBL D;  1FXA A;  1TS4 A;  3DBL B;  3JYU A;  3WAL A;  3L54 A;  3BYT B;  5BYR A;  1ZXH A;  2NBW B;  2PTL A;  3KLS X;  3BII D;  1Z5S B;  5C1Z A;  3KYC D;  3UIN B;  3RUL A;  2LHE A;  3R2T A;  4IM3 A;  1BT0 A;  1F2R C;  4N58 A;  3TEY A;  2M4N A;  1V81 A;  1UNS A;  2GBJ A;  1QOA A;  3QIJ A;  4MGY E;  2ZCC A;  3B0A A;  1WE6 A;  5IKC M;  2KO3 A;  1L0V B;  4TQ0 A;  1KLG D;  2WQY B;  1WR6 E;  1SJE D;  2PMV A;  3NVW A;  3L17 A;  1STE A;  1SIF A;  2IZV B;  4BKS D;  4AJW A;  5MPO A;  4KIK A;  4C4V B;  2MEK A;  2K6D B;  2REX A;  2W3R A;  1CJE A;  3KVF B;  2Y5B B;  2AEH A;  1FFU A;  2ASQ A;  3QWZ B;  2CS4 A;  3V6C B;  1V86 A;  2MBB B;  5C3J B;  1PDX A;  2INN E;  1UUP A;  1WX7 A;  2JWZ A;  5EDS A;  4YTP B;  2CU3 A;  1AN8 A;  1TJE A;  3LB8 C;  1TS3 A;  3Q3N C;  2SEB D;  4OVZ A;  2WDV B;  1WWT A;  2IND C;  4AOF A;  2RDB C;  5GMV A;  1WF9 A;  2FAZ A;  4K7W A;  1V9J A;  3N3K B;  4CO7 A;  3LJ3 A;  2D3A A;  3EC8 A;  2AX5 A;  5HKH A;  2JY6 A;  3P42 A;  2MSE D;  2KTR B;  2GB1 A;  1KOT A;  1WXA A;  1YJI A;  4KZC A;  2MJD A;  2WXJ A;  4DK5 A;  1E7U A;  3BZD B;  1D4B A;  3P4S B;  2V3S A;  4XE0 A;  3ALB A;  4KGT A;  3A4S C;  2JZP A;  1YN4 A;  3RPF C;  2KDI A;  2EKE C;  3AE9 B;  1P3Q U;  1FPY A;  1S3S G;  3V05 A;  4DWF A;  1WE7 A;  1MG8 A;  2KC1 A;  5AZG A;  4FBJ B;  3EHV A;  2EKI A;  2C7M B;  4RGN A;  1V6E A;  2VH1 A;  2PW9 A;  4JPS A;  1IGC A;  1L2N A;  2M56 B;  3JVZ X;  3GP7 A;  2WDR B;  1H4R A;  2JZ3 B;  4W9I A;  2LWP A;  5GXG B;  4NQL B;  3NJT A;  3RT3 B;  1GC7 A;  3EFU A;  2KN5 A;  1LFD A;  3K9O B;  3QQ8 B;  3RN9 C;  1K50 A;  3TJP A;  4BFR A;  1L4D B;  3DBR B;  1F2R I;  1YMH E;  5EE0 A;  4RFB A;  2FUH B;  2JXT A;  3DPD A;  4HKQ A;  4NPN A;  2Z0D B;  2LI5 A;  2INP E;  1EWC A;  4WQM A;  3A4R A;  1A5R A;  2MP2 A;  3GZN B;  3JSV A;  1F0Z A;  2PKO A;  1C4A A;  2J52 A;  2K5P A;  2NCN A;  4YTN B;  3ZKJ C;  2CR5 A;  1OQR A;  2X38 A;  3VUX A;  4RM8 A;  4LJP B;  2FIF A;  2LGI A;  3R66 C;  2GBK A;  4HJG E;  3D32 A;  3AN1 A;  3BVM A;  4B95 A;  2KWC A;  1WYW B;  2NS5 A;  4RM9 A;  3WA0 A;  4WWP A;  4M00 A;  5J2R A;  1ZGU B;  2WDT B;  2PE6 B;  4A90 A;  1IYF A;  3W2D A;  3R7R A;  2IYD B;  5H8Y E;  3AE1 B;  2WXG A;  5AEK B;  2Y3A A;  1GOZ A;  3WIM A;  1P7F A;  4ZRQ A;  3AE8 B;  3P4Q B;  2J4X A;  1WM3 A;  3B9J A;  2MBE A;  4OVV A;  4P1B C;  4MT5 A;  1SE4 A;  1QLB B;  1ET9 A;  4TSS A;  4LNK A;  1HA5 A;  3DOW A;  4HK2 A;  2CJO A;  3ZJU A;  2YVC A;  3V61 A;  3U8Z A;  4BKS A;  1FRR A;  1IBX B;  3NOB A;  5BO4 B;  1R4N I;  1CK1 A;  4MM3 B;  3AEF B;  4NAW B;  1PGB A;  2WXF A;  1JWA D;  2LMC A;  2IO0 B;  4FJV B;  1V80 A;  3U4E G;  3ZJT A;  4OZA A;  3RNB C;  3NVY A;  3J9C A;  3AU5 A;  2NPT A;  2LGX A;  1WXV A;  2G1E A;  3PRP B;  3HHM A;  1GTH A;  1JRU A;  1QOF A;  3NZU A;  2NBV B;  3RNA C;  2IO2 B;  1C9F A;  4GMV A;  2I38 A;  3DCG A;  1R7S A;  4OW0 A;  1WMH B;  1WXQ A;  3ZNI D;  3VXW A;  3IT4 B;  1ESF A;  1JCK B;  1XLQ A;  2PEA A;  2ZJD A;  3TEZ A;  1VJK A;  3CSF A;  2KDB A;  4EOY A;  2FUG 1;  1N6Z A;  3NZS A;  2N9K A;  4LTU A;  1EO6 A;  4DDG D;  4YWG G;  1T5X D;  2QSD A;  3ZDT A;  5LLI A;  4GDL B;  3U52 E;  4W9K A;  3P2B A;  2KAJ A;  2JSV X;  3MHZ A;  1WGR A;  2E6X A;  2PLP A;  5D3D A;  1WJU A;  5DPT A;  4ZRP A;  2ONQ A;  3T9L A;  1TY0 A;  4YTM B;  2KOX A;  1UGJ A;  1UWX A;  2KWD A;  2ZNV B;  3RFZ B;  1IGD A;  2AQ1 B;  1PUT A;  2BKF A;  4NJ6 A;  4MEL A;  3P1M A;  1GUA B;  4A3O A;  2PIA A;  2C60 A;  3WAM A;  2GBR A;  1IUE A;  5L83 A;  1WY8 A;  4NJC A;  4S17 A;  3RZW C;  3ZTD A;  3LXF A;  3PLV A;  3ZQ4 A;  2K0P A;  3Q6B A;  2LRW A;  5IA7 A;  2MLB A;  3AE6 B;  2D5G A;  1WGK A;  2WWZ A;  5AUI A;  2DWQ A;  2MX2 A;  3SHQ A;  4BOS C;  3GB1 A;  3SDL C;  1V2Y A;  4GLS C;  2L00 B;  3AH7 A;  1FXI A;  2JXX A;  2KXJ A;  3U30 A;  3BVZ A;  3U7D A;  2JUO A;  4PK1 A;  2RPQ A;  2RSU A;  2WXP A;  2KJR A;  1IP9 A;  3VUY A;  2L0F A;  2MP2 B;  3Q2A C;  1WRD B;  2PJH A;  4FHK A;  3VRB B;  1TKG A;  1YN3 A;  2ZW1 A;  4FLH A;  4FAD A;  2V1Y A;  4NNJ B;  1E8Z A;  4K81 A;  3DVG Y;  3PRE A;  2N7E A;  3UIO B;  1G6J A;  4X57 B;  2WP9 B;  4W9G A;  2K8C A;  3QAR A;  1FNV A;  2N9P C;  1SIJ A;  1T0S C;  3UIP B;  3ZXR A;  2IDY A;  1E8X A;  3PHX B;  2WU5 B;  1WR1 A;  2C5L C;  4GOC A;  1A70 A;  1UGM A;  4WWN A;  4F7Z A;  4G3X B;  4JIO U;  4GB9 A;  4TV3 A;  1YJJ A;  3PVL A;  4II2 B;  3MJ5 A;  3APC A;  1F9J A;  1YD8 U;  3PT2 B;  1TY2 A;  3CWI A;  4KDL B;  3V3X A;  3ML8 A;  1TGZ B;  3GS2 A;  1LM8 B;  3AMZ A;  2DYO A;  1T0Y A;  2MW5 A;  2KKC A;  1Q0W B;  5G55 A;  3TSS A;  3Q14 C;  2QC8 A;  5HFY A;  2L76 A;  4PS3 A;  4A55 A;  2WXL A;  5C2T B;  3ZRC A;  1Q5W B;  2DLB A;  1YX6 B;  1DYQ A;  4E71 A;  4FUL A;  1SGH A;  5JZE B;  3Q3M C;  1RWS A;  1E5W A;  2ICI A;  1LQB A;  3SR6 A;  4MGI E;  3CIR B;  2DZM A;  3DHG C;  4FN2 A;  3KW5 B;  2QIE B;  2J0J A;  2WHI A;  2KN4 A;  1WX8 A;  3ZNH B;  4P16 A;  3I57 A;  1GPX A;  4DHZ B;  4HLE A;  3ECI A;  1WI0 A;  1J7C A;  2WS3 B;  5DCN A;  2ZVN A;  3UI3 A;  2FCS A;  3MC9 A;  3ZJV A;  5HHD G;  1L0X B;  2AL3 A;  3KUD B;  4MH8 A;  2C9W B;  2G9H D;  4LDT D;  3I63 C;  1Z2M A;  2HTH A;  1XLN A;  3H9D A;  1GB1 A;  2CU1 A;  3NS8 A;  3DVG X;  2CJN A;  2JYT A;  2G45 B;  3L13 A;  1FRD A;  1OQQ A;  4ICU A;  1N60 A;  1EF5 A;  1L0Y B;  2BGF A;  1QIL A;  2TSS A;  1JRP A;  3W9C B;  1ZUD 2;  2IO1 B;  2XEW A;  2MRP A;  1K51 A;  2DYB A;  2EMS A;  2ZZP B;  1WYG A;  2BYT A;  2KMA A;  3E9S A;  2VH2 A;  1GT8 A;  1XXG A;  3H7P A;  1TYG B;  3HM3 A;  5FK9 C;  1JWU D;  1ACC A;  3X23 A;  5TR5 A;  2QDF A;  4LNF A;  5J18 A;  5CHW A;  3SD5 A;  3A9J A;  2E3T A;  2IGG A;  4W9J A;  2D10 A;  3BK1 A;  3RNG C;  2CHZ A;  1NEN B;  2A5U A;  3MJW A;  3FC4 A;  2DZI A;  2D11 A;  3A9K B;  3W1S C;  4DXG A;  1RLF A;  2Y5P A;  1N5W A;  3C8Y A;  1FCC C;  1TKE A;  3PTF C;  3Q8B A;  1WGH A;  1WFY A;  2XK5 A;  1MVK A;  1I4X A;  3RZF A;  2OED A;  3I5J C;  4HWI B;  1YQB A;  3HUI A;  2L83 A;  1OEY J;  2WXN A;  3WAP A;  1N62 A;  1C3T A;  3PGE A;  3AXC A;  1NVI D;  1SB3 C;  3IHP C;  1WSP A;  3RCZ A;  1Y56 A;  3KWV A;  3QCA A;  3H1U A;  1SSN A;  2BF8 B;  2M1M A;  1D5M C;  2QJL A;  2N1W A;  2AQ2 B;  4KKI A;  2JRH A;  2JWU A;  3IXS A;  4ARC A;  3ENE A;  3VHT C;  4REZ A;  3GE3 C;  4US8 A;  3ETR A;  2KAN A;  2MA9 B;  4LCD E;  1LGR A;  3UQA A;  1K8R B;  4BOZ B;  3LDZ E;  3PZD A;  1TS2 A;  1WRI A;  3L10 B;  4M0W B;  1QOB A;  3PZ7 A;  3RNC C;  3CF4 A;  4A3P A;  3M62 B;  3N30 A;  5FR6 A;  1D5Z C;  2H89 B;  2C7N B;  4MSM B;  4IDI A;  1KTK A;  4K3C A;  3M3J A;  3LYY A;  3P4P B;  3R3M A;  1ISN A;  4FA6 A;  2DZJ A;  2J0M A;  4Q2J A;  4HRS A;  1ENF A;  1V5T A;  4ICV A;  1M94 A;  4L2Y A;  1I4R A;  4L23 A;  2GLS A;  1ZW7 A;  3L4P A;  3DVN U;  3DBS A;  4M01 A;  1FEH A;  2LVP A;  4A8X C;  2N9L A;  4G50 A;  3A1Q B;  1LXD A;  3AEE B;  1EF1 A;  3DWG C;  4G11 A;  4DDI D;  4LNI A;  3L16 A;  4DHZ E;  3EFC A;  1K53 A;  5IAA C;  5AUK A;  1WJ6 A;  1V1P A;  2ZCB A;  1C77 A;  1YQ4 B;  3N20 C;  4HPL B;  4XWT A;  4AWJ A;  1R4M I;  3VAW A;  2ZEQ A;  1HQR D;  4C00 A;  3APD A;  1MHH E;  3CMM B;  1RFA A;  4HEA 1;  2K8B A;  1XO3 A;  2PE9 A;  4P1C C;  3PLU A;  2KLC A;  4GXB A;  5J17 A;  4H2A A;  1EM7 A;  3RD2 A;  1JWB D;  1F1H A;  1YJ1 A;  2L8J A;  2WXM A;  2N9X A;  3SFD B;  1HZ5 A;  3ZYY X;  5H92 C;  1TKY A;  4A9A A;  4YT0 B;  4I6L B;  4O1N A;  3V62 A;  3ZNZ B;  5LXI B;  1P98 A;  3H7P B;  5BYS A;  2KNB A;  1BUI C;  2KX0 A;  2BS3 B;  2D3G A;  2RDG A;  3TMP B;  3W1S A;  1DOX A;  4NAM A;  1FO4 A;  1EUV B;  4FJZ A;  3FAH A;  4BZA A;  2HE7 A;  2WXH A;  3JW0 X;  2RMM A;  3FKY A;  5JHB A;  4C7Z A;  3GOE A;  5JHA A;  1FM0 D;  2KK8 A;  4F1S A;  4ZDV A;  2B76 B;  3K9P B;  1SE2 A;  1XEE A;  1XLP A;  4YSZ B;  5LXH A;  3M63 B;  1FNW A;  4FJY A;  2JQR B;  2O6V D;  5FKA C;  2IY0 B;  4KIK B;  4WAA A;  1KLV A;  1E9M A;  3L0W B;  2OHF A;  2L1A A;  5DPR A;  1JAL A;  4RGT A;  3OAW A;  1J0G A;  1ZE3 D;  1FIQ A;  3NVZ A;  2BKR B;  3VRA B;  2WX0 A;  1H8C A;  3PRM B;  3Q8F A;  1OQY A;  2JVC A;  1GAQ B;  2LVO A;  2FID A;  3I3T B;  4J3O D;  4W9C A;  3VTU A;  1I4G A;  2VZK B;  4GDK A;  3ML9 A;  1BXT A;  4LJO B;  1KFY B;  2R61 A;  2BYV E;  2DAJ A;  3KWL A;  2CHX A;  4XDC A;  5E6J A;  1WIA A;  2D07 B;  1UBQ A;  4IW0 A;  2J53 A;  2M0A A;  3IFW B;  1P0R A;  2KDF B;  2KDE B;  4NZL B;  2KQ4 X;  5D3I B;  2L05 A;  2W3S A;  1JQ4 A;  1HZ6 A;  2NTS A;  2OJR A;  4JGH B;  3RNE C;  2KTF A;  2MBO A;  2UU7 A;  2O2V A;  2OJW A;  1QOG A;  5AZH A;  2N1V A;  2V4L A;  2R2O A;  2H88 B;  1VDV A;  1N63 A;  4MJS A;  3TEX A;  2KT7 A;  2N7J A;  1S1Q B;  3IAM 1;  1ROE A;  1VR9 A;  1SF0 A;  2J0K A;  1L6U A;  3A33 B;  3PRZ A;  4MSQ B;  1FMA D;  5IN7 A;  1L5P A;  4HDQ A;  4AJY B;  4ZHO A;  1QZE A;  4K7S A;  2IO3 B;  1HXY D;  3N1X C;  4AUQ C;  4HDO A;  5D94 A;  4IKG A;  3MC0 B;  1D5X C;  2G3Q B;  2LGS A;  4ZRK A;  4JX1 C;  1TS5 A;  3BVG A;  4WJP A;  3AE3 B;  1Q1O A;  4WJN A;  3B1L X;  4KGR A;  2M17 A;  3T3N A;  2VRR B;  1NI3 A;  2QMT A;  1YOV B;  4KGS A;  3IT6 B;  1P7E A;  2DZK A;  4CYE A;  4KVG B;  3AV8 A;  3JSV B;  2V0G A;  4ZRI A;  1E7V A;  3HRD D;  2V4I B;  1IPG A;  5TSS A;  2YEP B;  4J6I A;  2MQJ A;  4C4V A;  1SJH D;  2LVQ A;  2L52 A;  3KH0 A;  2I1J A;  2AQ3 B;  4WWM A;  2GRI A;  2MH7 A;  1C4P A;  1GJZ A;  2EMT A;  1KH0 A;  1OFF A;  3IVF A;  4KZ0 A;  3TL5 A;  4IWQ A;  4B0E A;  1T0R C;  4BBN F;  2WXI A;  1WH3 A;  2NTT A;  2PVG C;  2BQQ A;  2KFJ A;  1NDD A;  5HI1 A;  1EU4 A;  4JWS C;  2WNM A;  5JH5 C;  2GMI C;  1QF6 A;  1E6E B;  2FE8 A;  1PYW D;  4ACF A;  4DXF A;  2JRI B;  1EU3 A;  1HEZ E;  3DBR I;  1DOY A;  3AEC B;  3QC8 B;  3Q8A A;  1PQS A;  2DBY A;  3OG5 A;  3CF6 E;  3QK0 A;  4EZL A;  3DQV A;  2KQS A;  4JQW C;  2KTR A;  3ZW3 A;  2EEL A;  3GZN I;  4ARI A;  1J7A A;  4W9D A;  5FR3 A;  5G5G A;  3OWE B;  2DYM A;  4RF0 A;  1E90 A;  1RM6 C;  2D3C A;  2K8H A;  1YNT E;  2XBB C;  3ZNG C;  1PFD A;  2O6V A;  4EUT A;  1HTO A;  3R2I A;  2BB5 A;  1ZPS A;  3RUI B;  4HVB A;  4GSW A;  2JT4 B;  2WXQ A;  2IPK D;  1UD7 A;  3HK0 A;  1GC6 A;  4LNO A;  5KHQ A;  5DPS A;  1R4M B;  4HCN B;  3TCA A;  4BBN C;  4HCP B;  1WGY A;  2KFK A;  2NPT B;  4R3D A;  2IJ0 A;  1BML C;  2L32 A;  2HD5 B;  2AL6 A;  3N9Y C;  2GOW A;  3PSE B;  2BPS A;  3APF A;  1FXT B;  1WGG A;  2LRU A;  3VH3 B;  2N0S B;  4JL9 A;  2JU6 X;  3CST A;  2MBH A;  1F52 A;  3QHT A;  4N59 A;  1V1O A;  3V6E B;  2L0T A;  2I2Y A;  4HXD A;  4ANU A;  2KAC A;  1YN5 A;  3OJ3 A;  2KX3 A;  4GDK B;  2QHO A;  1XT9 B;  2ZPY A;  1Q10 A;  2W55 A;  2LD9 A;  4HPP A;  4RH6 A;  1MFW A;  1R4N B;  4TMA B;  5BMH A;  1YQ3 B;  1VRA B;  3ZGZ A;  2LJI A;  3L08 A;  4URK A;  3NY5 A;  5CTR C;  2IBI B;  4ITK A;  4B0M A;  1D3Z A;  1H7X A;  2LGY A;  3EUB 2;  4BKG A;  2BYE A;  1XQQ A;  1VLB A;  2J7Q B;  3DDC B;  1WJ4 A;  2O2V B;  3SFE B;  2IGH A;  1PGX A;  1GTE A; 
#chains in the Genus database with same CATH homology
 3LYY A;  3P4P B;  4AQ7 A;  1ZDV A;  2G1E A;  3BWU D;  3NZ3 A;  3IAS 1;  3MFG A;  1M4V A;  1DGJ A;  1GTH A;  2WXR A;  1QOF A;  3KQ4 A;  1C9F A;  4OZC A;  4Q2J A;  4EE2 A;  4HRS A;  1ENF A;  4L2Y A;  1I4R A;  2I38 A;  4L23 A;  1VZ7 A;  2ZW0 A;  1R7S A;  4OW0 A;  3L4P A;  1WXQ A;  5EE9 A;  3IT4 B;  1KRH A;  2VZK D;  1ESF A;  3P63 A;  1JCK B;  1XLQ A;  3TEZ A;  1VJK A;  1FEH A;  3W5V B;  1MPE A;  4A8X C;  1ET6 A;  3AEG B;  2FUG 1;  2N9L A;  2SAK A;  3E56 A;  2RDH A;  2N9K A;  1AW7 A;  1JW9 D;  1I4H A;  4LTU A;  2W54 A;  1MI0 A;  4YWG G;  1T5X D;  2ACZ B;  1IBX A;  2QSD A;  3AEE B;  3DWG C;  4GDL B;  3U52 E;  2NMQ A;  2YEP F;  3AEB B;  4M0W A;  2KAJ A;  2JSV X;  3FIL A;  3MHZ A;  4JWU C;  1K53 A;  4D2K A;  2QIL A;  1CQV A;  2E6X A;  5AUK A;  4TQ1 A;  1V1P A;  4AS1 A;  1VZ6 A;  2PLP A;  1D6E C;  5D3D A;  2JYE A;  2V3N A;  1C77 A;  1YQ4 B;  2ONQ A;  3NVV A;  4ZRP A;  1TY0 A;  4YTM B;  4XWT A;  4RF1 A;  1N61 A;  2JX5 A;  3AE5 B;  1UGJ A;  1I7H A;  1UWX A;  2KWD A;  3RFZ B;  1C76 A;  4ZYS A;  1HQR D;  1IGD A;  2WU2 B;  1PUT A;  2AQ1 B;  5BMG A;  3P1M A;  1MHH E;  3NUH B;  2PIA A;  1IUE A;  4HEA 1;  4NJC A;  4UDU C;  4HKZ E;  4IOI E;  4P6V F;  3LXF A;  2K9X A;  3AED B;  1XO3 A;  3ZQ4 A;  2K0P A;  2WXO A;  1XCQ L;  1FCL A;  3AM9 A;  2GI9 A;  4H2A A;  1EM7 A;  1JWB D;  1V8C A;  1J7B A;  3AE6 B;  2D5G A;  4RGO S;  2WXM A;  1WGK A;  1RFK A;  2M19 A;  2DWQ A;  5AUI A;  3SFD B;  1I4P A;  1HZ5 A;  3ZYY X;  5H92 C;  3BK2 A;  1TKY A;  2BBC A;  4A9A A;  4YT0 B;  1KF6 B;  5I4D A;  4O1N A;  3GB1 A;  5BYS A;  1PGA A;  5G5H A;  1DOI A;  1BUI C;  4GLS C;  2LHD A;  3AH7 A;  1FXI A;  2ON8 A;  2BS3 B;  2RDG A;  2WDQ B;  3BYY B;  3HVD A;  3W1S A;  1DOX A;  4NAM A;  1FO4 A;  3FAH A;  1SBB B;  3EGR A;  3BVZ A;  3PO0 A;  4OZB A;  5JXV A;  2WXH A;  2WXP A;  1C4C A;  1RYJ A;  2RMM A;  2BTE A;  1JWS D;  1QT9 A;  4C7Z A;  1SXT A;  4LLG M;  5D7G A;  1FM0 D;  2B76 B;  3VRB B;  1QKZ A;  1SE2 A;  1TKG A;  1XEE A;  1YN3 A;  1XLP A;  4YSZ B;  1VZ8 A;  5EE1 A;  1NEK B;  2ZW1 A;  1FNW A;  2KMM A;  4HRO A;  2IGD A;  2JQR B;  1E0Z A;  2BT6 A;  5FKA C;  3AE4 B;  1EWY C;  1JRO A;  1E9M A;  2OHF A;  2HTM E;  2L1A A;  1JAL A;  1NYQ A;  4RGT A;  2WP9 B;  4PT5 A;  4DQO C;  1ZE3 D;  1FIQ A;  1FXA A;  1TS4 A;  3NVZ A;  3VRA B;  3BYT B;  1FNV A;  5BYR A;  1ZXH A;  2PTL A;  3KLS X;  3BII D;  1SIJ A;  3Q8F A;  4C80 A;  3URY A;  3ABV B;  2IDY A;  1GAQ B;  2WU5 B;  4J3O D;  1A70 A;  2LHE A;  1B9R A;  1I4G A;  2VZK B;  3R2T A;  1ZP0 B;  1BXT A;  1KFY B;  2R61 A;  3KWL A;  1F2R C;  4XDC A;  5E6J A;  4N58 A;  3TEY A;  1UNS A;  1YJJ A;  2J53 A;  2M0A A;  1QOA A;  3MJ5 A;  1ZXI A;  3I9V 1;  4NZL B;  1L0V B;  4TQ0 A;  2KQ4 X;  1TY2 A;  3CWI A;  5D3I B;  2W3S A;  1KLG D;  2WQY B;  3TUO A;  3V3X A;  1JQ4 A;  1SJE D;  1B1Z A;  1XCT L;  4WH4 A;  2PMV A;  3NVW A;  1HZ6 A;  3GS2 A;  1STE A;  2NTS A;  1E10 A;  3AMZ A;  2DYO A;  3AE2 B;  5MPO A;  1QOG A;  2MEK A;  1UWM A;  1MHX A;  2XNA C;  4L1B A;  2H88 B;  1VDV A;  2W3R A;  1N63 A;  1CJE A;  3TEX A;  3TSS A;  2N7J A;  3IAM 1;  1ROE A;  1VR9 A;  1FFU A;  1SF0 A;  3VR8 B;  3PZ8 A;  1L6U A;  5T8I A;  5HFY A;  4YXD B;  1SEB D;  1NYR A;  5C3J B;  2W82 A;  1PDX A;  3EA6 A;  4A55 A;  3P4R B;  3VR9 B;  1FMA D;  5C2T B;  1UUP A;  2INN E;  2WXL A;  4JE3 B;  2DLB A;  1KLU D;  1L5P A;  4ZHO A;  1DYQ A;  4LK0 M;  4YTP B;  2CU3 A;  1AN8 A;  1F77 A;  1HXY D;  4N6E B;  1TJE A;  1CZP A;  3LB8 C;  1TS3 A;  1RWS A;  3U2S C;  4IKG A;  3MC0 B;  2SEB D;  1D5X C;  2ICI A;  4OVZ A;  2WDV B;  1WWT A;  1SE3 A;  3NVY A;  3SR6 A;  3CIR B;  4JX1 C;  3VQI A;  1TS5 A;  2QIE B;  3BVG A;  2KN4 A;  3AE3 B;  2AX5 A;  4P16 A;  3I57 A;  1GPX A;  4KGR A;  1K52 A;  4XWW A;  3B2F A;  3T3N A;  1NI3 A;  2QMT A;  4WAF A;  4KGS A;  3IT6 B;  1P7E A;  1J7C A;  2WS3 B;  3P42 A;  2GB1 A;  3AV8 A;  3UI3 A;  1YJI A;  2V0G A;  1FNU A;  2MJD A;  3HRD D;  2WXJ A;  2V4I B;  3BZD B;  4RGM A;  5HHD G;  3ZJV A;  1L0X B;  5TSS A;  1D4B A;  2BS2 B;  3P4S B;  4OHJ A;  2YEP B;  4XE0 A;  2HDE A;  3T3O A;  3MP9 A;  1XLO A;  1SJH D;  4MH8 A;  4KGT A;  2L52 A;  2G9H D;  2AQ3 B;  2JZP A;  2WXK A;  1YN4 A;  3TEW A;  2XN9 C;  1XLN A;  2GRI A;  2MH7 A;  1C4P A;  4WWM A;  3RPF C;  1GB1 A;  3AE9 B;  1KH0 A;  1OFF A;  2QEJ C;  2CJN A;  2JYT A;  1ZDX A;  1FRD A;  4USA A;  5BYQ A;  1OQQ A;  4C7Y A;  1N60 A;  5HG2 A;  3V05 A;  3WCQ A;  1L0Y B;  3FIL B;  4B0E A;  4YSX B;  4WUR A;  1QIL A;  2TSS A;  2WXI A;  5LNK 1;  2NTT A;  1JRP A;  2EKI A;  1AYF A;  2PVG C;  4RGN A;  3W9C B;  1ZUD 2;  2PW9 A;  4JPS A;  1IGC A;  2M56 B;  2K3U A;  5HI1 A;  1EU4 A;  2FBW B;  4JWS C;  3GP7 A;  1AWD A;  2WDR B;  1JWM D;  2BW2 A;  2Q5W D;  2WNM A;  4ZOH C;  5GXG B;  1K51 A;  1QF6 A;  1LO5 D;  1WYG A;  2BYT A;  4RNA A;  3Q8C A;  3Q69 A;  1E6E B;  4FXC A;  2FE8 A;  3E9S A;  1GT8 A;  1PYW D;  4DXF A;  1XXG A;  1K50 A;  1L4D B;  1EU3 A;  1HEZ E;  1F2R I;  1TYG B;  5FK9 C;  1YMH E;  5EE0 A;  1C78 A;  1JWU D;  4CQN A;  1ACC A;  1DOY A;  3AEC B;  3Q8A A;  4KX6 B;  4RFB A;  3NRZ A;  2DBY A;  2JXT A;  2BB6 A;  2V3P A;  4HKQ A;  3R8B A;  1H7W A;  2INP E;  1EWC A;  4WQM A;  1F0Z A;  2E3T A;  3W5U B;  2EEL A;  2IGG A;  1C79 A;  2PKO A;  1C4A A;  1I4Q A;  3H8H A;  4ARI A;  2J52 A;  2K5P A;  3BK1 A;  1J7A A;  1NEN B;  4YTN B;  5FR3 A;  3FC4 A;  1XF5 L;  5G5G A;  1QQR A;  4WIP A;  2X38 A;  1OQR A;  3OWE B;  1T3Q A;  5BMI A;  1V97 A;  2DYM A;  4RF0 A;  1RM6 C;  1YNT E;  1E7P B;  1L6V A;  1PFD A;  2LEK A;  2LGI A;  4DXG A;  2KDM A;  2Y5P A;  1ZOY B;  1N5W A;  3C8Y A;  4HJG E;  2MJE A;  3R2I A;  1FCC C;  1TKE A;  2BB5 A;  3Q8B A;  1ZPS A;  1MVK A;  3BVM A;  3AN1 A;  4YSY B;  1I4X A;  2OED A;  2J42 A;  2WXQ A;  4C56 C;  2IPK D;  3U7Z A;  2LFI A;  3HUI A;  3AEA B;  2L83 A;  4A90 A;  2WXN A;  1N62 A;  3SEB A;  1L4Z B;  2BS4 B;  4R3D A;  2IJ0 A;  1BML C;  3AB5 A;  3W2D A;  1NVI D;  3Q8E A;  2L32 A;  1SB3 C;  4US9 A;  1WSP A;  3N9Y C;  1Y56 A;  3DWM A;  5H8Y E;  3KWV A;  4RCO A;  1N5X A;  1T6B X;  3AE1 B;  3NS1 A;  2WXG A;  2Y3A A;  1GOZ A;  2N0S B;  1P7F A;  2JU6 X;  4ZHP A;  1SSN A;  4ZRQ A;  3AE8 B;  1D5M C;  3P4Q B;  2J4X A;  3B2G A;  4N59 A;  1V1O A;  3B9J A;  5EE3 A;  1FFV A;  4XDD A;  2QJL A;  2Y5C A;  4MT5 A;  1SE4 A;  2PVO D;  2I2Y A;  2AQ2 B;  1QLB B;  2LUM A;  1ET9 A;  1GB4 A;  4KKI A;  4TSS A;  3HVZ A;  2KAC A;  1YN5 A;  2JWU A;  4GDK B;  3IXS A;  3AE7 B;  4ARC A;  1Q10 A;  1HA5 A;  2RPV A;  2W55 A;  2MJ3 A;  1FD6 A;  2CJO A;  4A6Q A;  4REZ A;  3ZJU A;  4RH6 A;  4US8 A;  2K22 A;  3ETR A;  2WLB A;  1FRR A;  4TMA B;  4MAC A;  1IBX B;  5BMH A;  1YQ3 B;  1JML A;  1VRA B;  3ZGZ A;  2LJI A;  1CK1 A;  4MM3 B;  4IDI A;  1TS2 A;  3AEF B;  3O13 A;  1WRI A;  1PGB A;  4NAW B;  1QOB A;  1JWA D;  2LMC A;  2WXF A;  3PZ7 A;  4ITK A;  1H7X A;  3CF4 A;  4KKJ A;  4B0M A;  3EUB 2;  2Z8L A;  1VLB A;  1V1P B;  1TZO A;  1D5Z C;  2H89 B;  3U4E G;  3ZJT A;  3SFE B;  4OZA A;  2IGH A;  3J9C A;  1PGX A;  1KTK A;  1GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...