2WDRB

E. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Structure of Escherichia Coli Succinate:Quinone Oxidoreductase with an Occupied and Empty Quinone- Binding Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdrB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdrB01
1QOAA 3LB8C 1GT8A 4C7YA 4LTUA 2KMMA 3FC4A 4ZOHC 1JWAD 1TJEA 4YTMB 1RM6C 2WDVB 1XLNA 1ROEA 4YSXB 1XLPA 1J7BA 2JQRB 1DOIA 2K9XA 2PVGC 5EE3A 1GTEA 2N0SB 3CWIA 1DOYA 3NRZA 5AUKA 2Y5CA 1QLBB 3ZYYX 4ZHPA 3ABVB 3FAHA 1RFKA 3CF4A 1N62A 3AE7B 3NVVA 3P4QB 1YJIA 1NYQA 5H8YE 3P63A 1NVID 1OFFA 2LEKA 4JWSC 3EUB2 4A9AA 2HTME 1GTHA 1GAQB 2BS2B 3AE6B 1PUTA 1ZP0B 1VJKA 3PO0A 1FFVA 1RWSA 3HVZA 3W5VB 1DOXA 4US9A 3NVYA 3WCQA 2W54A 1OQQA 1PFDA 1TKGA 1WWTA 1TKYA 1SF0A 1E7PB 3AE4B 3VR9B 4YTNB 1KF6B 1E6EB 1JROA 1QOFA 2E3TA 3BIID 5H92C 3W5UB 1L0VB 1L5PA 1FO4A 1E0ZA 2BS3B 3AE5B 4JWUC 2WDQB 3P4PB 1XO3A 4HROA 2AX5A 4P6VF 1YJJA 3AE8B 1TKEA 1JQ4A 5G5HA 1ZUD2 3RPFC 2WS3B 1SIJA 2FBWB 1ZXIA 2QIEB 3AECB 1QOBA 2K5PA 1KRHA 1WGKA 2CJNA 4US8A 3B2GA 1VDVA 1CJEA 2M19A 2Q5WD 2CJOA 2PIAA 3AM9A 5C2TB 5EE0A 5EE9A 1E10A 1NEKB 5EE1A 1WYGA 1NYRA 1KFYB 1AWDA 1RYJA 2W55A 4IDIA 1UWMA 1CZPA 1QT9A 2PKOA 3KWLA 2MJ3A 1IUEA 3AE3B 1EWYC 1QOGA 2BS4B 2WU5B 1PDXA 1XLOA 1J7AA 5C3JB 2M56B 1FXIA 3ETRA 1FMAD 3AE9B 1N5WA 2CU3A 4YT0B 3L4PA 1JALA 1YQ4B 1OQRA 2DBYA 2DWQA 2WLBA 3AEGB 4WQMA 4USAA 4C80A 4YXDB 2G1EA 2PVOD 2WQYB 1ZOYB 4N59A 5GXGB 4YSYB 1F0ZA 2MJEA 3DWMA 3NVWA 3AE1B 3AEBB 3VRAB 1WXQA 4KX6B 3HRDD 3W9CB 1NI3A 2BT6A 2ACZB 1JRPA 1E9MA 1JW9D 1SB3C 1FM0D 2QJLA 3AN1A 2H89B 3B9JA 3P1MA 5G5GA 1V97A 3DWGC 2MH7A 1L6UA 4HRSA 3P4RB 3B2FA 3AE2B 2L52A 4JX1C 3AEFB 1FFUA 4ZHOA 3AEAB 2WDRB 3VR8B 3AH7A 5AUIA 1XLQA 3CIRB 5MPOA 3VRBB 2EKIA 3AV8A 3HUIA 1AYFA 1N61A 1FRDA 3AEDB 2K22A 2B76B 1N63A 1JWBD 2KAJA 3SFDB 1FXAA 1TYGB 3AB5A 3P4SB 1J7CA 1I7HA 3LXFA 4FXCA 4N58A 1VLBA 1WRIA 2H88B 1V8CA 4N6EB 3AEEB 1N5XA 4WWMA 1B9RA 1FRRA 3NS1A 1A70A 2JX5A 1R7SA 4C7ZA 1GPXA 1QF6A 2MJDA 3NVZA 1NENB 3SFEB 2W3SA 1FIQA 2OHFA 1H7WA 3AMZA 1H7XA 2W3RA 1DGJA 2WU2B 1L6VA 1T3QA 1YQ3B 2WP9B 2L83A 4ITKA 4YTPB 3SR6A 4YSZB 1N60A
chains in the Genus database with same CATH superfamily
3PZDA 1FCLA 1UGMA 4XDCA 4OHJA 4HPPA 3GZNI 2FCNA 1YJIA 1NYQA 2JRHA 2V1YA 1P7FA 3HVZA 4RFBA 4HVBA 4KV2A 5BMIA 3B1LX 3BIID 2DLBA 4YL8A 2KDEB 3AE5B 1T0QC 2KC1A 4GDLA 3I5JC 4IWPA 3R7RA 3W1SC 4TQ0A 2KJ6A 3EGRA 1UGJA 1UUPA 2PIAA 1Q1OA 4MGIE 1MG4A 4K3CA 2WXNA 1IUEA 1QOGA 4XGAB 1PDXA 4LCDE 3EA6A 2KANA 2C7HA 2IDYA 3NY5A 2D5GA 3A9KA 3ZNID 1WXSA 4HXDA 1YX5B 2BT6A 3L54A 5D6JB 3PRMB 4GIVA 1E9MA 3M95A 4XYCA 3A9JA 3B9JA 4RCOA 1V97A 3HM3A 1WZ0A 5L95C 2R61A 1T0RC 2WXLA 3KUCB 5HKHA 4G50A 1OEYJ 2OJRA 3R2IA 2KAJA 2JWZA 3SFDB 2XEWA 2WX1A 2UYZB 2IO2B 3AEEB 3K9PB 2JX5A 1LFDA 2QCZA 3BVZA 3NVZA 1WJUA 3SFEB 4LK0M 2INPE 4NJ7A 1LQBA 1WM2A 2JPHA 1ZXHA 2KT7A 5J18A 3AI5A 4IM2A 4ZOHC 1V9JA 2JQRB 5EE3A 1A5RA 4RH6A 5AUKA 3ZYYX 2K6QA 3H1UA 2L0TA 1JRUA 2JY6A 1ET9A 1TY2A 4M00A 4K3BA 3IT4B 3RULA 3IHPC 4W9JA 2BGFA 4HCPB 3PSEB 1WGDA 4K7SA 1E7PB 1JROA 2CHXA 1FO4A 2V4IB 2BB6A 4X57B 1L5PA 1YN5A 1HTOA 2MX2A 3VFKA 3BWUD 1SIJA 3BK2A 4W9FA 3B2GA 3NJTA 4DHZB 5EE0A 5C2TB 2IY1B 4S0RA 1AWDA 1GNUA 3OAWA 2A4ZA 2L00B 4ZRPA 2GMIC 3RCZA 3P2BA 4I6NB 1F2RI 2KKCA 2ZPNA 1V5TA 3L10B 1OQRA 2WLBA 4WQMA 2JZ3B 5GXGB 1VR9A 2IO3B 3W9CB 1P1AA 1WXQA 4AWJA 4IG7B 3ZW3A 1C9FA 1WYWB 3V60A 1R4NI 1QKZA 1STEA 4ZHOA 1FD6A 5E6NA 3R3MA 3TEXA 2QSDA 3O13A 2WXHA 3R66C 2DX5B 3BINA 1WRIA 5FR6A 3TBLD 1N5XA 4WIPA 3QC8B 2MJDA 2A5UA 3A9KB 3MJ5A 1NBFC 3DBRB 4DDGD 3R2TA 4RM8A 3KUZA 3RYTA 3A1QB 2D3CA 2K9XA 1J7BA 3UI3A 2I2YA 1WX9A 4NAWA 4GXBA 4ZRIA 3ZNZB 4CHKA 2FCQA 1L4DB 3ZIMA 3LYYA 5T8IA 1EWCA 3WAMA 1OFFA 3H6NA 3EUB2 2HTME 4W9LA 3ZRCA 2V3NA 4B6WA 1I4XA 3DDCB 2J0MA 4US9A 4ZYSA 3I3TB 2WXGA 3PRZA 4EZKA 3N30A 4A8XC 1MI0A 1UELA 1GG3A 4MH0E 3TSSA 5G5HA 4MEMA 5JHAA 4US8A 1VDVA 4TV3A 4OZCA 1XXGA 2GB1A 4ASWC 3T3NA 1GB4A 3Q3MC 2OEDA 1XT9B 2BKFA 2M56B 4IM3A 3RNAC 2DBYA 3HVDA 3RUIB 2SEBD 5E6OA 3UF8A 5C1ZA 1TY0A 2M0AA 3GB1A 4ZRQA 4QAYA 4FBJB 1UBIA 1HZ6A 2BF8B 2QJLA 4A6QA 1TS4A 3L16A 2JWUA 4DHJB 3T9LA 2MBOA 4HDQA 1I42A 4OVUA 1HZ5A 4YWGG 1JWBD 1E8ZA 1FXAA 4NJCA 2BTEA 1GPXA 1NENB 3APDA 3VH4B 1JWUD 2W3RA 3N1YC 2VZKB 1YJ1A 1T3QA 1KOTA 5G2NA 2MBEA 3TIXA 5DCNA 1VZ6A 3ZLZA 4MJSB 1XLPA 1OGWA 4BKGA 3A4SC 5DPWA 1QLBB 5DPSA 1N62A 5TR5A 2PPHA 3P63A 1LO5D 3U4EG 5CHVC 2KTRB 1IBXB 4I6PA 2G4SA 1TZOA 3NZSA 2JYEA 5CX3A 1L0YB 2FIDA 2C9WB 3E56A 4MM3A 3OJ3A 1R4MB 5FKAC 3R7QA 2J0JA 2WS3B 2QIEB 2KACA 3WAPA 3ECIA 1E90A 3AM9A 2N4FA 4HK2A 4JL9A 2HJ1A 3PS6A 1I4RA 1WYGA 2DZIA 2KFKA 3M3JA 2MA9B 2ON8A 4UDUC 2KWCA 1YOVB 4MH8A 2N9XA 1U4AA 2IGDA 4L23A 2WU5B 1J8CA 1FMAD 2I1KA 2RPQA 2GBRA 3AEGB 4C80A 4OVZA 3MC8A 2AQ2B 4YSYB 3TL5A 3HHMA 3SEBA 2WXIA 1PGXA 3VRAB 3EFUA 3MHZA 2KDIA 4BKSA 3DCGA 2W9NA 3RMKC 2MH7A 3H9DA 4AJYB 1JMLA 1KLUD 4PS7A 3Q8BA 5CHWA 1AYFA 1ZDXA 2LVQA 5BO4B 3EC8A 5HG2A 1B9RA 1A70A 4M02A 4EZJA 3DVGX 3V6CB 1ZDVA 3VHTC 1Q0WB 2I1JA 4GDKB 3X23A 4PK1A 1VD2A 2DZMA 3P42A 4A90A 3R8BA 1GOZA 5JXVA 4W9KA 1HE8A 2Y5CA 2IYDB 3AE7B 3RN9C 1SBBB 2BYEA 2CHZA 4MGZE 2KTFA 2MHJA 3WCQA 1T5XD 1WJNA 3NZUA 2VH2A 1PFDA 1TKGA 1GC6A 1E6EB 3TEWA 3LJ3A 4DHZE 4DDID 2QMTA 1Z2MA 4LNKA 5KHOA 2N7EA 3KUDB 2RPVA 3M62B 2BVCA 2KJHB 2KQ7A 3WIMA 1Y56A 3Q3JA 4HKZE 1SEBD 3A4RA 1WJ4A 2OJWA 5D2MB 3VUYA 1N6ZA 2KFJA 1L0XB 2G1EA 4M0WB 4HWIB 1XEEA 1G6JA 3U7DA 3ZNGC 3AN1A 1F77A 3SHQA 2D2QA 2DHZA 1XLQA 3AV8A 2INCC 2QEJC 2KYWA 4FULA 3LXFA 5LLIA 1KLVA 5E6JA 2KLGA 1K51A 1WY8A 3KLSX 1FIQA 4TSSA 1V1PB 5EDSA 3I63C 3SD5A 1JWAD 2WDVB 4ARIA 2PVGC 4TMAB 2EMSA 2IY0B 1EU4A 4P16A 1MJDA 1ZW7A 4ZHPA 1JWMD 3CF4A 2JT4B 3NVVA 1TS5A 1FNVA 2QDFA 1GTHA 1YN3A 1KM7A 3AE6B 4GB9A 1ZP0B 3IXSA 5IOIA 3VXWA 4MELA 2RSUA 1EU3A 3AU4A 3CF6E 3VR9B 4J6IA 1FXTB 1VZ8A 4JWUC 1DYQA 4WJQA 2J53A 3DVGY 4HROA 1IYFA 2IPKD 3RPFC 1C78A 2K5PA 2ZCCA 5BYRA 2X38A 4C4VA 4BOZB 2KO3A 3VTWA 3HM6X 2KMCA 3Q8FA 4FADA 4P1BC 1QQRA 1QT9A 2WNMA 5H92C 1R4NB 3ALBA 2CU3A 3L4PA 4E71A 2MCNB 3PHWB 1ZOYB 1RRBA 4PS8A 1KJTA 1RAXA 3DWMA 3NVWA 3BZDB 2WXKA 3AEBB 5D3DA 1NI3A 1WM3A 2CHWA 2WXPA 4RMAA 1OTRB 1HA5A 4ZYNA 4EFOA 2L1AA 3DWGC 2ZW0A 3VVWB 3B2FA 4W9DA 1C1YB 2V9HA 5AUIA 3ZDTA 4CYEA 4EUTA 3UQBA 2KWDA 3HUIA 3ZJUA 3V62A 3Q6BA 3AEDB 1WGYA 2WXQA 1J7CA 3N32A 3PZ7A 3TMPB 1V8CA 3JVZX 2N7JA 1ET6A 2SAKA 2N9KA 3A1QA 5LNK1 2G9HD 2WU2B 2WP9B 3JSVB 5HHDG 2JXXA 1OEYA 1RM6C 1C79A 1BT0A 1YMHE 3HIZA 3IFWB 1DOYA 3QJZA 4Q2JA 1V80A 4HCNB 4XE0A 3KWVA 2DZJA 4ICUA 4JE3B 4A9AA 1UZXB 5J2RA 2YEPF 2KLCA 1V5OA 4OW0A 4NQKE 4XC2A 2BKRB 2FUHB 4WAFA 1IP9A 3DHHC 2RGFA 1TKYA 3ONSA 3AE4B 2QHOA 1UWXA 4IW0A 4LLGM 1E7UA 1YX6B 1YJJA 3H7SA 1T0YA 1CJEA 4IOIE 5EE9A 3U2SC 5I4DA 3BK1A 2LFIA 4B0EA 3DBHB 2MJ3A 3U8ZA 2KDBA 2BS4B 3ETRA 2FNJB 4DQOC 4PYUA 2Z59B 4DHJD 1XF5L 1D5MC 3ZXVA 2KWUB 2D3GA 1WE7A 1K50A 4F8CB 2DYMA 4J3OD 1FFUA 4C4VB 3PVLA 4EEWA 3E9SA 4AOFA 1RLFA 3DHGC 1L4ZB 2VZKD 1EM7A 2FCMA 1VLBA 2BYFA 2D3AA 3CMMB 4BVUC 2MWSB 4AP4C 2AL3A 1SE4A 1WMHA 3HK0A 1KTKA 4G3XB 2ZVNA 3GOEA 2NVUI 3L17A 3M63B 4MJSA 2JRIB 2AQ3B 3IAS1 4YTPB 4KZCA 2BB5A 2IBIB 2LGYA 4LJOB 2KMMA 4XWWA 2AL6A 3TEYA 2D11A 1EF5A 2KTRA 3EHVA 2LWPA 1IBXA 3IG3A 3PLVA 3KQ4A 2PE9A 3MTNB 5JZEB 4I6LB 5D3IB 2BS2B 5AZFA 1CMXB 1MHXA 1OQQA 3ZUNA 3TUOA 4HKQA 4NAMA 3TJPA 3MHSD 3Q3OC 4KGRA 2JF5A 1WF9A 1AN8A 2AX5A 2IO0B 3UGBB 3ENEA 4HLEA 5BYQA 4DWFA 2LI5A 2WXRA 4FJVB 2N7DA 2CJOA 5E6PA 1KFYB 1TT5B 1UWMA 2M1MA 3AE3B 5TSSA 3AU5A 4FXCA 4YT0B 2ZW1A 2RDHA 4P1CC 3EFCA 1TTNA 2DZKA 4F7ZA 2LHDA 3H7PB 4KX6B 2WDTB 4XWTA 4AJWA 2H89B 3RD2A 1V1OA 1UF0A 2HDEA 3L0WB 1BMLC 4KSLC 1F52A 3Q69A 1SIFA 2KC2A 2V3SA 3AXCA 1Y8RC 2RDGA 4B9KA 1VRAB 4ZRKA 3ZNHB 2HTHA 4WWMA 3QA8A 4GDKA 2ZCBA 2JZZA 2KQSA 1YQBA 2D07B 2JZPA 5IAAC 3PV1A 4YSZB 2ONQA 1N60A 2B3AA 1ROEA 4YSXB 1DOIA 2K8HA 4A3OA 2LJIA 1WX8A 2EMTA 1GJZA 3DBLI 3WANA 1VCBA 4S17A 2HE7A 2AQ1B 3TCAA 2GOWA 3N1XC 1WWTA 1WMHB 3PGEA 1KF6B 3ZQ4A 4RGNA 2JU6X 4KGSA 2M0XA 1QZEA 3QIJA 2FBWB 1ZXIA 1IGCA 3C0RB 1QOBA 3U30A 1WGKA 1WIAA 4KKIA 3D32A 1LM8B 4W9EA 5CHFA 2K3UA 4BFRA 1GC7A 2XBBC 4WH4A 2LVOA 2R2OA 4C00A 2LHEA 2CS4A 4M0WA 1XLOA 2LVPA 1K53A 1FXIA 2ZNVB 3RZWC 2O2VB 3QARA 1C76A 2DWQA 4USAA 3U52E 2WQYB 2MW5A 5IN7A 4NJ6A 4LJPB 5IKCM 2WYQA 3DPDA 4JIOU 4KIKB 1WX7A 4MT5A 1P98A 2K25A 2X8XX 4ZRJA 3NG0A 3RNEC 3PTFC 2NCNA 3AH7A 3CIRB 1YN4A 3Q8AA 1ZE3D 2EKIA 2G4DB 2IJ0A 3A33B 1HQRD 2V0GA 2DNFA 3OWEB 4BKSD 4GGQA 1TS3A 1V1PA 1FRRA 4C7ZA 2CKHB 4LDTB 2KXJA 4RGTA 4A3PA 1WI0A 2OHFA 1SE3A 1SE2A 1ZGUB 2BYTA 4OVVA 3OLMD 4G11A 4C7YA 4ANUA 2HJ8A 4BKTA 2YLMA 1K8RB 4GU2A 3NS8A 3RT3B 4PYZA 3ML8A 4NZLB 1I35A 4CQNA 1TBEA 4EE2A 3FAHA 1D3ZA 3WA0A 1V6EA 2CU1A 4NQLB 1WZ3A 1WH3A 2PW9A 4TKNA 3ZTCA 1PUTA 1VJKA 3GZNB 3N9YC 1DOXA 1V81A 2GBJA 4FLHA 2ZJDA 3QX1A 1WE6A 2XN9C 2MQJA 3W5UB 1FNWA 2C7NB 1D5ZC 2MBHA 4WWPA 4HJGE 1JQ4A 2KHWB 3CSFA 2BW2A 3C19A 3NHEB 2Q5WD 1WR1A 1BUIC 5EE1A 1WJ6A 1ACCA 3N20C 4NY0A 1RYJA 4FJZA 3GS2A 1UNSA 2R2QA 5AZHA 4CO7A 3QWZB 4KSKC 5C3JB 3AE9B 1JALA 4D2KA 1EO6A 1LXDA 1M4VA 5GMVA 1UD7A 1V2YA 4YXDB 4LNIA 4O1NA 1WFYA 5FK9C 2WXMA 2VRRB 2Z0DB 2J7QB 1SGHA 2ACZB 4RF1A 2K6DB 2KMAA 1JW9D 4BBNF 1VZ7A 2BQQA 4M8MA 1L6UA 3VUXA 2NBWB 2LZ6A 1D4BA 3T3OA 2GLSA 1JWSD 4ANWA 1WGHA 2OOBB 3PRPB 3W2DA 3EECA 4WWNA 3AB5A 1TGZB 4N58A 1E8XA 3KYDD 2KK8A 3V3XA 2NR2A 3JSVA 3Q3FA 2NTTA 2PEAA 4LNNA 2Y3AA 1V49A 5L83A 1QOAA 1ENFA 2E6XA 3ML9A 1AW7A 2N0SB 4GLSC 4M01A 4WJNA 1BXTA 4W9CA 3P4QB 1NVID 4JLCA 2MBBB 2LGDA 2MLBA 2IGGA 3DVNU 2L3ZA 4IUMB 4FA6A 1HTQA 2KX3A 3VDZA 4KKJA 3V61A 2KD0A 2RMMA 2G3QB 1L0VB 4PT5A 3VQIA 3P4PB 1RFAA 3J9CA 1SXTA 4ICVA 5IO9A 3ZRFA 2YEPB 2CJNA 1P0RA 3FILB 4IWOA 4WJOA 3KWLA 2LMCA 1ZKHA 4ZDVA 5LXIB 4A55A 1N5WA 2KDFB 2MP2B 2UWQA 4TQ1A 4N59A 1S1QB 2XK5B 3ZJVA 1E5WA 4WURA 2D3BA 2MEKA 2LGSA 4JQWC 3ZXRA 2DYBA 2ZPYA 3PLUA 4WWOA 3VAWA 3X0WA 3DQVA 4BAXA 4JX1C 3AEAB 3BYYB 1Q10A 3VR8B 4K1RB 1TS2A 4W9IA 1N61A 3IBEA 1SSNA 2JXTA 3QHTA 4OZAA 4C56C 2JVCA 4ARCA 2GBKA 3KW5B 2LXCA 1C4PA 3B08A 2PMVA 3AMZA 4GSWA 3SDLC 5DPTA 3S2AA 1L6VA 3RNCC 1YQ3B 1QOFA 4JGHB 2CR5A 1XCTL 4LTUA 3NUHB 2IZVB 4HDOA 2NS5A 4XX5A 1RFKA 5LXHA 1YIWA 3ZKJC 2LEKA 3UQAA 1UBQA 1FFVA 2WXFA 1WXAA 3W5VB 1YD8U 3NVYA 4KDIC 4IM0A 2W54A 2DYOA 2LRWA 4BZAA 1OQYA 4K7WA 1SF0A 1SE9A 4MSQB 2E3TA 2I38A 2K39A 4BOSC 3ZVVA 3BYTB 3IAM1 4A20A 2IGHA 2TSSA 2WDQB 1XO3A 3AE8B 2KQ4X 1KRHA 3VUWA 2KWVB 3Q8EA 2M19A 4M8NA 2BYVE 2RD0A 4G0NB 2NBVB 4XDDA 2PKOA 3OJ4B 3ZTDA 3IVFA 1QILA 4HEA1 3VH3B 3H7PA 3PPAA 4K7UA 1EF1A 1F0ZA 4DK5A 1F9JA 1MVKA 1CQVA 1SB3C 1E8YA 2KOXA 4FHJA 4HRSA 3ZGZA 1ZPSA 5C23A 4DXFA 4AQ7A 1F1HA 2K1FA 3UINB 2NPTA 3TEZA 2O6VB 2KVRA 4HJKA 1C4AA 1N63A 3L08A 1TYGB 3L13A 3JYUA 2DENB 3IT6B 3LDZE 1GUAB 3DBLB 1QF6A 2ASQA 2W3SA 3BVGA 3RNGC 5JH5C 1DGJA 3VTVA 2L83A 2AWTA 1CK1A 3BY4B 3ZDMC 4YTMB 4MDKE 2D10A 1S3SG 3CWIA 4RM9A 3QCAA 4KDLB 3UIPB 3KVFB 4MSMB 2MSED 3DBSA 4DBGA 1V86A 1PGAA 1L7YA 2YVCA 4RGOS 2DAFA 2BWFA 2KX0A 3BVMA 1WXVA 2N9EB 4EZLA 3AECB 4RNAA 2PLPA 1FEHA 2Y5BB 4GDLB 2N1VA 1E10A 1LGRA 4B95A 2O2VA 5G55A 1WGGA 2JSVX 4L2YA 3DOWA 1J7AA 1WRDB 1ESFA 2JUOA 1P9DU 4KIKA 2MRPA 3QK0A 1T0SC 1K52A 4RGMA 4MGYE 2EKEC 4B0MA 2QILA 1ISNA 1Q5WB 4H2AA 3I9V1 2ZVOA 3AE2B 3DHIC 4LDTD 1H8CA 3A9JB 4AS1A 3SU8X 2KNBA 3VRBB 2WXOA 1TIFA 5HFYA 2LUMA 3GE3C 1Z5SB 2KN4A 3ZJTA 4GMVA 2H88B 4HPMB 4N6EB 2M4NA 1R7SA 4OZBA 2QC8A 3KYCD 2AEHA 4FN2A 3N1ZC 2J52A 1H7XA 3T8MA 2N9PC 4MGKE 1GT8A 2WXJA 1J0GA 1GTEA 2RDBC 4E3CA 2KJRA 2L76A 1C3TA 3ABVB 1I4HA 4REZA 2FUG1 2NPTB 1L2NA 3NZ3A 4ACFA 2L0FA 4EOYA 3W1YA 1RWSA 3V6EB 1PYWD 2ICIA 1E0ZA 3CSTA 4IKGA 2N9LA 5BMGA 2C7MB 5JHBA 1ZUD2 1P3QU 4W9HA 4RF0A 2N1WA 3MJWA 3DBHI 3Q3NC 2L05A 1NYRA 3APCA 4ANXA 2GBNA 3PZ8A 1FPYA 2NMQA 3WALA 1EWYC 5IA7A 2PVOD 2MJEA 3NOBA 3Q2AC 1I4GA 2LD9A 1UH6A 2KDMA 5AZGA 4N9F4 3DVNV 2ZNVC 1PGBA 1JRPA 2L7RA 2GRIA 2V3PA 3P1MA 3O65B 3N3KB 4BBNC 2L52A 5IP4D 2WDRB 2XNAC 5MPOA 2INNE 3C8YA 1M94A 2B76B 1E7VA 1FCCC 2WX0A 2INDC 2ZZPB 2KVZA 1E8WA 2J42A 2NTSA 2RR9A 3UIOB 1PQSA 3SR6A 3K9OB 1I4QA 3FC4A 1XLNA 4P7IA 3RNBC 5BYSA 1YNTE 4IC7B 5DPRA 1P7EA 4FJYA 3Q8CA 3DBRI 3H8HA 2WHIA 4NAWB 3RI7C 2KN5A 5BMHA 4MACA 1KLGD 3GE8C 2WWZA 4YTNB 1EUVB 3OG5A 5CTRC 2PE6B 3MC0B 2NBUA 4P6VF 1TKEA 1AARA 3FILA 1WGRA 2V4LA 2FCSA 2J4XA 4LNFA 2MP2A 2W55A 3QQ8B 2HD5B 4W9GA 1IGDA 3GP7A 2FIFA 2XK5A 4WJPA 1D6EC 2M17A 1X1MA 4II3B 1J19A 3AE1B 2M8SA 1JCKB 1HEZE 3MC9A 2L8JA 3RZFA 2EELA 3P4RB 1C77A 1XCQL 1MG8A 4L1BA 2GI9A 1WXMA 4XZ4A 3Q14C 1IPGA 1FRDA 2K22A 3RNFC 1GB1A 2FE8A 3P4SB 3MP9A 2LGIA 4GN1A 2LASA 1FNUA 3PREA 2Z0EB 4R3DA 1I4PA 3PHXB 4EKUA 2BPSA 2UU7A 2L32A 5FR3A 4KGTA 4II2B 4ITKA 2DAJA 2JYTA 3NS1A 2WGSA 4NNJB 2PTLA 4KZ0A 3LB8C 4WAAA 2Y5PA 1TJEA 5J17A 2BBCA 2C60A 4DXGA 2LRUA 1SJED 2PJHA 3NRZA 5KHQA 5D7GA 2LUEA 3APFA 4LNOA 1MFWA 2C5LC 4E74A 1KH0A 4JWSC 3W1SA 2IO1B 1SJHD 1GAQB 1H4RA 3KH0A 3PO0A 3RFZB 2Z8LA 1B1ZA 3PT2B 4JPSA 1T6BX 4DXAB 1MPEA 2J0KA 2BS3B 4KVGB 3WAOA 2K0PA 2LJ5A 3ZO5B 2LGXA 3URYA 4GOCA 4MM3B 2K8BA 2ZEQA 3FKYA 2FAZA 3MFGA 4NPNA 1WR6E 1NEKB 3QAQA 4ANVA 4WQOB 4IDIA 1CZPA 1WSPA 4TUUA 3B0AA 4AUQC 1R4MI 1NDDA 2KFKB 5H8YE 1MHHE 2G45B 1YQ4B 2BWES 3V05A 3HRDD 2O6VD 1XD3B 2GBMA 1TZ1A 4URKA 2MBQA 1C4CA 1FM0D 2O6VA 5G5GA 1XQQA 4K81A 1F2RC 3AEFB 2K8CA 3U7ZA 4HPLB 2AYOB 4PS3A 3AULA 3VTUA 5HI1A 5D94A 1I7HA 4FHKA 2W82A 5AEKB 3I57A 1HXYD 2LXAA 2KZRA 2REXA 4IWQA 1NI2A 2VH1A 1D5XC 1H7WA 3JW0X 4F1SA
chains in the Genus database with same CATH topology
3P42A 4YTMB 3R8BA 4A90A 1GOZA 1ROEA 4YSXB 1DOIA 5JXVA 1FCLA 3CWIA 2Y5CA 2LJIA 4XDCA 4OHJA 3AE7B 1SBBB 1YJIA 1NYQA 2AQ1B 1P7FA 3HVZA 4RFBA 3WCQA 1T5XD 5BMIA 1PGAA 1PFDA 1TKGA 1WWTA 3BIID 1E6EB 1KF6B 3TEWA 3ZQ4A 2DLBA 4RGOS 3AE5B 2QMTA 3BVMA 4RGNA 2JU6X 4KGSA 2FBWB 1ZXIA 1IGCA 3AECB 1QOBA 4TQ0A 1WGKA 4RNAA 2PLPA 3EGRA 1FEHA 1UGJA 4KKIA 2RPVA 4GDLB 1UUPA 2PIAA 1E10A 2K3UA 4WH4A 1Y56A 4HKZE 1SEBD 1IUEA 2JSVX 2LHEA 2WXNA 4M0WA 1QOGA 4L2YA 1PDXA 1XLOA 1J7AA 1K53A 3EA6A 1FXIA 1ESFA 1C76A 2DWQA 4USAA 1L0XB 2IDYA 2G1EA 3U52E 2WQYB 2D5GA 1K52A 4RGMA 1XEEA 2BT6A 4B0MA 2QILA 4MT5A 1E9MA 3AN1A 1F77A 3B9JA 4RCOA 4H2AA 3I9V1 1V97A 3AE2B 2R61A 3AH7A 1XLQA 2WXLA 3CIRB 4AS1A 1YN4A 3Q8AA 3VRBB 1ZE3D 2EKIA 2WXOA 3AV8A 5HFYA 2LUMA 2QEJC 2IJ0A 3R2IA 2KAJA 3SFDB 3LXFA 2KN4A 1HQRD 2V0GA 3ZJTA 3OWEB 5E6JA 2H88B 4N6EB 3AEEB 1TS3A 1V1PA 1FRRA 2JX5A 1K51A 1R7SA 4C7ZA 4OZBA 3BVZA 3NVZA 3SFEB 3KLSX 4LK0M 4RGTA 2INPE 1FIQA 4TSSA 2OHFA 2J52A 1H7XA 1SE3A 1V1PB 1SE2A 2BYTA 1ZXHA 4C7YA 1GT8A 4ZOHC 2WXJA 1JWAD 2WDVB 4ARIA 2JQRB 2PVGC 4TMAB 5EE3A 1GTEA 4RH6A 4NZLB 1EU4A 4P16A 4CQNA 5AUKA 4ZHPA 3ZYYX 4EE2A 3ABVB 1JWMD 3FAHA 3CF4A 1I4HA 4REZA 3NVVA 1TS5A 2FUG1 3NZ3A 1FNVA 1ET9A 2PW9A 1GTHA 1TY2A 1YN3A 1PUTA 3AE6B 1ZP0B 1VJKA 3IT4B 1RWSA 3N9YC 1DOXA 3IXSA 1EU3A 1PYWD 1E7PB 3VR9B 1JROA 2ICIA 1FO4A 2V4IB 2XN9C 2BB6A 3W5UB 1L5PA 1E0ZA 1FNWA 1VZ8A 1YN5A 4IKGA 1DYQA 4JWUC 2N9LA 1D5ZC 2J53A 4HROA 5BMGA 4HJGE 1JQ4A 1ZUD2 2IPKD 3BWUD 3RPFC 1SIJA 3BK2A 1C78A 2K5PA 4RF0A 5BYRA 2X38A 2BW2A 3B2GA 2Q5WD 5EE0A 5C2TB 1BUIC 5EE1A 1NYRA 1ACCA 3Q8FA 1AWDA 3PZ8A 1RYJA 1QQRA 4ZRPA 1QT9A 2NMQA 3GS2A 1UNSA 1EWYC 1F2RI 5C3JB 2WNMA 5H92C 3L4PA 3AE9B 2CU3A 1JALA 1OQRA 4D2KA 1M4VA 2WLBA 4WQMA 4YXDB 2PVOD 1ZOYB 5GXGB 4O1NA 2MJEA 3DWMA 1VR9A 3NVWA 3BZDB 1I4GA 2WXKA 2KDMA 3AEBB 3W9CB 1WXQA 5FK9C 5D3DA 1NI3A 2WXMA 2WXPA 1PGBA 2ACZB 1JRPA 4RF1A 1JW9D 1VZ7A 1HA5A 2GRIA 2V3PA 3P1MA 1C9FA 2L1AA 3DWGC 2ZW0A 1L6UA 3B2FA 1QKZA 1STEA 2L52A 4ZHOA 1D4BA 1FD6A 2WDRB 3TEXA 5AUIA 3T3OA 2QSDA 2XNAC 5MPOA 2KWDA 3HUIA 3ZJUA 1JWSD 2INNE 3O13A 3C8YA 3AEDB 2B76B 3W2DA 2WXQA 1FCCC 2WXHA 3AB5A 1J7CA 3PZ7A 4N58A 1WRIA 1V8CA 1N5XA 2N7JA 4WIPA 3V3XA 1ET6A 2SAKA 2MJDA 2N9KA 5LNK1 2J42A 2NTSA 2NTTA 3MJ5A 2G9HD 2Y3AA 2WU2B 3SR6A 2WP9B 3R2TA 1QOAA 1I4QA 5HHDG 3FC4A 1RM6C 1C79A 1ENFA 1XLNA 2K9XA 1J7BA 2E6XA 3UI3A 2I2YA 1YMHE 1AW7A 2N0SB 1DOYA 4Q2JA 4GLSC 5BYSA 1YNTE 1BXTA 4XE0A 3KWVA 3P4QB 1L4DB 3LYYA 4JE3B 5T8IA 1EWCA 1NVID 1OFFA 4A9AA 1P7EA 3EUB2 2HTME 2YEPF 3Q8CA 4OW0A 3H8HA 4NAWB 2V3NA 2IGGA 1I4XA 4US9A 4ZYSA 5BMHA 4MACA 4WAFA 2WXGA 4KKJA 1KLGD 2RMMA 1TKYA 3AE4B 4A8XC 4YTNB 1L0VB 1MI0A 1UWXA 3MC0B 4PT5A 4LLGM 3VQIA 3P4PB 4P6VF 3J9CA 1SXTA 1YJJA 1TKEA 3TSSA 5G5HA 3FILA 2YEPB 2CJNA 4US8A 1VDVA 1CJEA 4IOIE 5EE9A 3U2SC 4OZCA 1XXGA 3BK1A 5I4DA 3FILB 2LFIA 2J4XA 2GB1A 2W55A 3T3NA 1GB4A 4B0EA 3KWLA 1IGDA 2LMCA 2MJ3A 3GP7A 2BS4B 2OEDA 3ETRA 2M56B 4A55A 1D6EC 1N5WA 4DQOC 4TQ1A 2DBYA 3HVDA 1XF5L 4N59A 2SEBD 1D5MC 3ZJVA 4WURA 1TY0A 3AE1B 2MEKA 2M0AA 3GB1A 4ZRQA 1JCKB 1HEZE 1HZ6A 2QJLA 4A6QA 1K50A 1TS4A 2EELA 2JWUA 3P4RB 1C77A 2DYMA 4JX1C 1XCQL 1FFUA 4J3OD 3AEAB 3BYYB 4L1BA 1Q10A 3VR8B 2GI9A 3E9SA 1HZ5A 1TS2A 4YWGG 1N61A 1FRDA 1L4ZB 1SSNA 1EM7A 2JXTA 2K22A 2VZKD 1JWBD 1GB1A 2FE8A 1FXAA 4NJCA 4OZAA 2BTEA 3P4SB 3MP9A 2LGIA 1VLBA 4C56C 4ARCA 1FNUA 1SE4A 4R3DA 1C4PA 1I4PA 1KTKA 1GPXA 1NENB 1JWUD 2PMVA 3AMZA 2L32A 5FR3A 2W3RA 4KGTA 2VZKB 1L6VA 1T3QA 2AQ3B 1YQ3B 1QOFA 2JYTA 3IAS1 4YTPB 3NS1A 4ITKA 2PTLA 2BB5A 3LB8C 2Y5PA 2KMMA 1TJEA 1VZ6A 1XCTL 4LTUA 2BBCA 1XLPA 3NUHB 4DXGA 4XWWA 3TEYA 1SJED 3NRZA 1IBXA 1QLBB 1RFKA 1N62A 3KQ4A 5D7GA 3P63A 1LO5D 1KH0A 2LEKA 4JWSC 3U4EG 3W1SA 1SJHD 1GAQB 5D3IB 1IBXB 2BS2B 3PO0A 1FFVA 3RFZB 2WXFA 2Z8LA 1MHXA 3W5VB 1B1ZA 3NVYA 2W54A 1TZOA 2DYOA 4JPSA 1OQQA 1T6BX 3TUOA 2JYEA 1SF0A 4HKQA 1L0YB 2E3TA 4NAMA 2I38A 1MPEA 4KGRA 3E56A 3BYTB 2BS3B 3IAM1 2IGHA 2TSSA 2WDQB 2K0PA 1XO3A 1AN8A 2AX5A 3AE8B 5FKAC 2WS3B 2QIEB 2KACA 3URYA 2KQ4X 1KRHA 5BYQA 4MM3B 2WXRA 3Q8EA 2M19A 3AM9A 2CJOA 3MFGA 1NEKB 1I4RA 1WYGA 1KFYB 2ON8A 4IDIA 1UWMA 1CZPA 1WSPA 4UDUC 4XDDA 2PKOA 3AE3B 5TSSA 4MH8A 2IGDA 4L23A 2WU5B 1QILA 4HEA1 4FXCA 1FMAD 5H8YE 4YT0B 1MHHE 1YQ4B 2ZW1A 3AEGB 4C80A 2RDHA 4OVZA 3V05A 2AQ2B 4YSYB 1F0ZA 3SEBA 2WXIA 2LHDA 1PGXA 3VRAB 4KX6B 3HRDD 1MVKA 4XWTA 1CQVA 1SB3C 1C4CA 1FM0D 3MHZA 2H89B 1V1OA 5G5GA 2HDEA 2MH7A 3ZGZA 4HRSA 1F2RC 1BMLC 1JMLA 3AEFB 3U7ZA 1ZPSA 4DXFA 1KLUD 4AQ7A 3Q69A 3Q8BA 3TEZA 1AYFA 1ZDXA 1C4AA 5HI1A 1N63A 1TYGB 1I7HA 2RDGA 2W82A 3I57A 1VRAB 5HG2A 3IT6B 1HXYD 4WWMA 1B9RA 1A70A 1QF6A 1ZDVA 2W3SA 1D5XC 1H7WA 3BVGA 2JZPA 1DGJA 2L83A 4GDKB 1CK1A 4YSZB 2ONQA 1N60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOA A;  3LB8 C;  1GT8 A;  4C7Y A;  4LTU A;  2KMM A;  3FC4 A;  4ZOH C;  1JWA D;  1TJE A;  4YTM B;  1RM6 C;  2WDV B;  1XLN A;  1ROE A;  4YSX B;  1XLP A;  1J7B A;  2JQR B;  1DOI A;  2K9X A;  2PVG C;  5EE3 A;  1GTE A;  2N0S B;  3CWI A;  1DOY A;  3NRZ A;  5AUK A;  2Y5C A;  1QLB B;  3ZYY X;  4ZHP A;  3ABV B;  3FAH A;  1RFK A;  3CF4 A;  1N62 A;  3AE7 B;  3NVV A;  3P4Q B;  1YJI A;  1NYQ A;  5H8Y E;  3P63 A;  1NVI D;  1OFF A;  2LEK A;  4JWS C;  3EUB 2;  4A9A A;  2HTM E;  1GTH A;  1GAQ B;  2BS2 B;  3AE6 B;  1PUT A;  1ZP0 B;  1VJK A;  3PO0 A;  1FFV A;  1RWS A;  3HVZ A;  3W5V B;  1DOX A;  4US9 A;  3NVY A;  3WCQ A;  2W54 A;  1OQQ A;  1PFD A;  1TKG A;  1WWT A;  1TKY A;  1SF0 A;  1E7P B;  3AE4 B;  3VR9 B;  4YTN B;  1KF6 B;  1E6E B;  1JRO A;  1QOF A;  2E3T A;  3BII D;  5H92 C;  3W5U B;  1L0V B;  1L5P A;  1FO4 A;  1E0Z A;  2BS3 B;  3AE5 B;  4JWU C;  2WDQ B;  3P4P B;  1XO3 A;  4HRO A;  2AX5 A;  4P6V F;  1YJJ A;  3AE8 B;  1TKE A;  1JQ4 A;  5G5H A;  1ZUD 2;  3RPF C;  2WS3 B;  1SIJ A;  2FBW B;  1ZXI A;  2QIE B;  3AEC B;  1QOB A;  2K5P A;  1KRH A;  1WGK A;  2CJN A;  4US8 A;  3B2G A;  1VDV A;  1CJE A;  2M19 A;  2Q5W D;  2CJO A;  2PIA A;  3AM9 A;  5C2T B;  5EE0 A;  5EE9 A;  1E10 A;  1NEK B;  5EE1 A;  1WYG A;  1NYR A;  1KFY B;  1AWD A;  1RYJ A;  2W55 A;  4IDI A;  1UWM A;  1CZP A;  1QT9 A;  2PKO A;  3KWL A;  2MJ3 A;  1IUE A;  3AE3 B;  1EWY C;  1QOG A;  2BS4 B;  2WU5 B;  1PDX A;  1XLO A;  1J7A A;  5C3J B;  2M56 B;  1FXI A;  3ETR A;  1FMA D;  3AE9 B;  1N5W A;  2CU3 A;  4YT0 B;  3L4P A;  1JAL A;  1YQ4 B;  1OQR A;  2DBY A;  2DWQ A;  2WLB A;  3AEG B;  4WQM A;  4USA A;  4C80 A;  4YXD B;  2G1E A;  2PVO D;  2WQY B;  1ZOY B;  4N59 A;  5GXG B;  4YSY B;  1F0Z A;  2MJE A;  3DWM A;  3NVW A;  3AE1 B;  3AEB B;  3VRA B;  1WXQ A;  4KX6 B;  3HRD D;  3W9C B;  1NI3 A;  2BT6 A;  2ACZ B;  1JRP A;  1E9M A;  1JW9 D;  1SB3 C;  1FM0 D;  2QJL A;  3AN1 A;  2H89 B;  3B9J A;  3P1M A;  5G5G A;  1V97 A;  3DWG C;  2MH7 A;  1L6U A;  4HRS A;  3P4R B;  3B2F A;  3AE2 B;  2L52 A;  4JX1 C;  3AEF B;  1FFU A;  4ZHO A;  3AEA B;  2WDR B;  3VR8 B;  3AH7 A;  5AUI A;  1XLQ A;  3CIR B;  5MPO A;  3VRB B;  2EKI A;  3AV8 A;  3HUI A;  1AYF A;  1N61 A;  1FRD A;  3AED B;  2K22 A;  2B76 B;  1N63 A;  1JWB D;  2KAJ A;  3SFD B;  1FXA A;  1TYG B;  3AB5 A;  3P4S B;  1J7C A;  1I7H A;  3LXF A;  4FXC A;  4N58 A;  1VLB A;  1WRI A;  2H88 B;  1V8C A;  4N6E B;  3AEE B;  1N5X A;  4WWM A;  1B9R A;  1FRR A;  3NS1 A;  1A70 A;  2JX5 A;  1R7S A;  4C7Z A;  1GPX A;  1QF6 A;  2MJD A;  3NVZ A;  1NEN B;  3SFE B;  2W3S A;  1FIQ A;  2OHF A;  1H7W A;  3AMZ A;  1H7X A;  2W3R A;  1DGJ A;  2WU2 B;  1L6V A;  1T3Q A;  1YQ3 B;  2WP9 B;  2L83 A;  4ITK A;  4YTP B;  3SR6 A;  4YSZ B;  1N60 A; 
#chains in the Genus database with same CATH topology
 3PZD A;  1FCL A;  1UGM A;  4XDC A;  4OHJ A;  4HPP A;  3GZN I;  2FCN A;  1YJI A;  1NYQ A;  2JRH A;  2V1Y A;  1P7F A;  3HVZ A;  4RFB A;  4HVB A;  4KV2 A;  5BMI A;  3B1L X;  3BII D;  2DLB A;  4YL8 A;  2KDE B;  3AE5 B;  1T0Q C;  2KC1 A;  4GDL A;  3I5J C;  4IWP A;  3R7R A;  3W1S C;  4TQ0 A;  2KJ6 A;  3EGR A;  1UGJ A;  1UUP A;  2PIA A;  1Q1O A;  4MGI E;  1MG4 A;  4K3C A;  2WXN A;  1IUE A;  1QOG A;  4XGA B;  1PDX A;  4LCD E;  3EA6 A;  2KAN A;  2C7H A;  2IDY A;  3NY5 A;  2D5G A;  3A9K A;  3ZNI D;  1WXS A;  4HXD A;  1YX5 B;  2BT6 A;  3L54 A;  5D6J B;  3PRM B;  4GIV A;  1E9M A;  3M95 A;  4XYC A;  3A9J A;  3B9J A;  4RCO A;  1V97 A;  3HM3 A;  1WZ0 A;  5L95 C;  2R61 A;  1T0R C;  2WXL A;  3KUC B;  5HKH A;  4G50 A;  1OEY J;  2OJR A;  3R2I A;  2KAJ A;  2JWZ A;  3SFD B;  2XEW A;  2WX1 A;  2UYZ B;  2IO2 B;  3AEE B;  3K9P B;  2JX5 A;  1LFD A;  2QCZ A;  3BVZ A;  3NVZ A;  1WJU A;  3SFE B;  4LK0 M;  2INP E;  4NJ7 A;  1LQB A;  1WM2 A;  2JPH A;  1ZXH A;  2KT7 A;  5J18 A;  3AI5 A;  4IM2 A;  4ZOH C;  1V9J A;  2JQR B;  5EE3 A;  1A5R A;  4RH6 A;  5AUK A;  3ZYY X;  2K6Q A;  3H1U A;  2L0T A;  1JRU A;  2JY6 A;  1ET9 A;  1TY2 A;  4M00 A;  4K3B A;  3IT4 B;  3RUL A;  3IHP C;  4W9J A;  2BGF A;  4HCP B;  3PSE B;  1WGD A;  4K7S A;  1E7P B;  1JRO A;  2CHX A;  1FO4 A;  2V4I B;  2BB6 A;  4X57 B;  1L5P A;  1YN5 A;  1HTO A;  2MX2 A;  3VFK A;  3BWU D;  1SIJ A;  3BK2 A;  4W9F A;  3B2G A;  3NJT A;  4DHZ B;  5EE0 A;  5C2T B;  2IY1 B;  4S0R A;  1AWD A;  1GNU A;  3OAW A;  2A4Z A;  2L00 B;  4ZRP A;  2GMI C;  3RCZ A;  3P2B A;  4I6N B;  1F2R I;  2KKC A;  2ZPN A;  1V5T A;  3L10 B;  1OQR A;  2WLB A;  4WQM A;  2JZ3 B;  5GXG B;  1VR9 A;  2IO3 B;  3W9C B;  1P1A A;  1WXQ A;  4AWJ A;  4IG7 B;  3ZW3 A;  1C9F A;  1WYW B;  3V60 A;  1R4N I;  1QKZ A;  1STE A;  4ZHO A;  1FD6 A;  5E6N A;  3R3M A;  3TEX A;  2QSD A;  3O13 A;  2WXH A;  3R66 C;  2DX5 B;  3BIN A;  1WRI A;  5FR6 A;  3TBL D;  1N5X A;  4WIP A;  3QC8 B;  2MJD A;  2A5U A;  3A9K B;  3MJ5 A;  1NBF C;  3DBR B;  4DDG D;  3R2T A;  4RM8 A;  3KUZ A;  3RYT A;  3A1Q B;  2D3C A;  2K9X A;  1J7B A;  3UI3 A;  2I2Y A;  1WX9 A;  4NAW A;  4GXB A;  4ZRI A;  3ZNZ B;  4CHK A;  2FCQ A;  1L4D B;  3ZIM A;  3LYY A;  5T8I A;  1EWC A;  3WAM A;  1OFF A;  3H6N A;  3EUB 2;  2HTM E;  4W9L A;  3ZRC A;  2V3N A;  4B6W A;  1I4X A;  3DDC B;  2J0M A;  4US9 A;  4ZYS A;  3I3T B;  2WXG A;  3PRZ A;  4EZK A;  3N30 A;  4A8X C;  1MI0 A;  1UEL A;  1GG3 A;  4MH0 E;  3TSS A;  5G5H A;  4MEM A;  5JHA A;  4US8 A;  1VDV A;  4TV3 A;  4OZC A;  1XXG A;  2GB1 A;  4ASW C;  3T3N A;  1GB4 A;  3Q3M C;  2OED A;  1XT9 B;  2BKF A;  2M56 B;  4IM3 A;  3RNA C;  2DBY A;  3HVD A;  3RUI B;  2SEB D;  5E6O A;  3UF8 A;  5C1Z A;  1TY0 A;  2M0A A;  3GB1 A;  4ZRQ A;  4QAY A;  4FBJ B;  1UBI A;  1HZ6 A;  2BF8 B;  2QJL A;  4A6Q A;  1TS4 A;  3L16 A;  2JWU A;  4DHJ B;  3T9L A;  2MBO A;  4HDQ A;  1I42 A;  4OVU A;  1HZ5 A;  4YWG G;  1JWB D;  1E8Z A;  1FXA A;  4NJC A;  2BTE A;  1GPX A;  1NEN B;  3APD A;  3VH4 B;  1JWU D;  2W3R A;  3N1Y C;  2VZK B;  1YJ1 A;  1T3Q A;  1KOT A;  5G2N A;  2MBE A;  3TIX A;  5DCN A;  1VZ6 A;  3ZLZ A;  4MJS B;  1XLP A;  1OGW A;  4BKG A;  3A4S C;  5DPW A;  1QLB B;  5DPS A;  1N62 A;  5TR5 A;  2PPH A;  3P63 A;  1LO5 D;  3U4E G;  5CHV C;  2KTR B;  1IBX B;  4I6P A;  2G4S A;  1TZO A;  3NZS A;  2JYE A;  5CX3 A;  1L0Y B;  2FID A;  2C9W B;  3E56 A;  4MM3 A;  3OJ3 A;  1R4M B;  5FKA C;  3R7Q A;  2J0J A;  2WS3 B;  2QIE B;  2KAC A;  3WAP A;  3ECI A;  1E90 A;  3AM9 A;  2N4F A;  4HK2 A;  4JL9 A;  2HJ1 A;  3PS6 A;  1I4R A;  1WYG A;  2DZI A;  2KFK A;  3M3J A;  2MA9 B;  2ON8 A;  4UDU C;  2KWC A;  1YOV B;  4MH8 A;  2N9X A;  1U4A A;  2IGD A;  4L23 A;  2WU5 B;  1J8C A;  1FMA D;  2I1K A;  2RPQ A;  2GBR A;  3AEG B;  4C80 A;  4OVZ A;  3MC8 A;  2AQ2 B;  4YSY B;  3TL5 A;  3HHM A;  3SEB A;  2WXI A;  1PGX A;  3VRA B;  3EFU A;  3MHZ A;  2KDI A;  4BKS A;  3DCG A;  2W9N A;  3RMK C;  2MH7 A;  3H9D A;  4AJY B;  1JML A;  1KLU D;  4PS7 A;  3Q8B A;  5CHW A;  1AYF A;  1ZDX A;  2LVQ A;  5BO4 B;  3EC8 A;  5HG2 A;  1B9R A;  1A70 A;  4M02 A;  4EZJ A;  3DVG X;  3V6C B;  1ZDV A;  3VHT C;  1Q0W B;  2I1J A;  4GDK B;  3X23 A;  4PK1 A;  1VD2 A;  2DZM A;  3P42 A;  4A90 A;  3R8B A;  1GOZ A;  5JXV A;  4W9K A;  1HE8 A;  2Y5C A;  2IYD B;  3AE7 B;  3RN9 C;  1SBB B;  2BYE A;  2CHZ A;  4MGZ E;  2KTF A;  2MHJ A;  3WCQ A;  1T5X D;  1WJN A;  3NZU A;  2VH2 A;  1PFD A;  1TKG A;  1GC6 A;  1E6E B;  3TEW A;  3LJ3 A;  4DHZ E;  4DDI D;  2QMT A;  1Z2M A;  4LNK A;  5KHO A;  2N7E A;  3KUD B;  2RPV A;  3M62 B;  2BVC A;  2KJH B;  2KQ7 A;  3WIM A;  1Y56 A;  3Q3J A;  4HKZ E;  1SEB D;  3A4R A;  1WJ4 A;  2OJW A;  5D2M B;  3VUY A;  1N6Z A;  2KFJ A;  1L0X B;  2G1E A;  4M0W B;  4HWI B;  1XEE A;  1G6J A;  3U7D A;  3ZNG C;  3AN1 A;  1F77 A;  3SHQ A;  2D2Q A;  2DHZ A;  1XLQ A;  3AV8 A;  2INC C;  2QEJ C;  2KYW A;  4FUL A;  3LXF A;  5LLI A;  1KLV A;  5E6J A;  2KLG A;  1K51 A;  1WY8 A;  3KLS X;  1FIQ A;  4TSS A;  1V1P B;  5EDS A;  3I63 C;  3SD5 A;  1JWA D;  2WDV B;  4ARI A;  2PVG C;  4TMA B;  2EMS A;  2IY0 B;  1EU4 A;  4P16 A;  1MJD A;  1ZW7 A;  4ZHP A;  1JWM D;  3CF4 A;  2JT4 B;  3NVV A;  1TS5 A;  1FNV A;  2QDF A;  1GTH A;  1YN3 A;  1KM7 A;  3AE6 B;  4GB9 A;  1ZP0 B;  3IXS A;  5IOI A;  3VXW A;  4MEL A;  2RSU A;  1EU3 A;  3AU4 A;  3CF6 E;  3VR9 B;  4J6I A;  1FXT B;  1VZ8 A;  4JWU C;  1DYQ A;  4WJQ A;  2J53 A;  3DVG Y;  4HRO A;  1IYF A;  2IPK D;  3RPF C;  1C78 A;  2K5P A;  2ZCC A;  5BYR A;  2X38 A;  4C4V A;  4BOZ B;  2KO3 A;  3VTW A;  3HM6 X;  2KMC A;  3Q8F A;  4FAD A;  4P1B C;  1QQR A;  1QT9 A;  2WNM A;  5H92 C;  1R4N B;  3ALB A;  2CU3 A;  3L4P A;  4E71 A;  2MCN B;  3PHW B;  1ZOY B;  1RRB A;  4PS8 A;  1KJT A;  1RAX A;  3DWM A;  3NVW A;  3BZD B;  2WXK A;  3AEB B;  5D3D A;  1NI3 A;  1WM3 A;  2CHW A;  2WXP A;  4RMA A;  1OTR B;  1HA5 A;  4ZYN A;  4EFO A;  2L1A A;  3DWG C;  2ZW0 A;  3VVW B;  3B2F A;  4W9D A;  1C1Y B;  2V9H A;  5AUI A;  3ZDT A;  4CYE A;  4EUT A;  3UQB A;  2KWD A;  3HUI A;  3ZJU A;  3V62 A;  3Q6B A;  3AED B;  1WGY A;  2WXQ A;  1J7C A;  3N32 A;  3PZ7 A;  3TMP B;  1V8C A;  3JVZ X;  2N7J A;  1ET6 A;  2SAK A;  2N9K A;  3A1Q A;  5LNK 1;  2G9H D;  2WU2 B;  2WP9 B;  3JSV B;  5HHD G;  2JXX A;  1OEY A;  1RM6 C;  1C79 A;  1BT0 A;  1YMH E;  3HIZ A;  3IFW B;  1DOY A;  3QJZ A;  4Q2J A;  1V80 A;  4HCN B;  4XE0 A;  3KWV A;  2DZJ A;  4ICU A;  4JE3 B;  4A9A A;  1UZX B;  5J2R A;  2YEP F;  2KLC A;  1V5O A;  4OW0 A;  4NQK E;  4XC2 A;  2BKR B;  2FUH B;  4WAF A;  1IP9 A;  3DHH C;  2RGF A;  1TKY A;  3ONS A;  3AE4 B;  2QHO A;  1UWX A;  4IW0 A;  4LLG M;  1E7U A;  1YX6 B;  1YJJ A;  3H7S A;  1T0Y A;  1CJE A;  4IOI E;  5EE9 A;  3U2S C;  5I4D A;  3BK1 A;  2LFI A;  4B0E A;  3DBH B;  2MJ3 A;  3U8Z A;  2KDB A;  2BS4 B;  3ETR A;  2FNJ B;  4DQO C;  4PYU A;  2Z59 B;  4DHJ D;  1XF5 L;  1D5M C;  3ZXV A;  2KWU B;  2D3G A;  1WE7 A;  1K50 A;  4F8C B;  2DYM A;  4J3O D;  1FFU A;  4C4V B;  3PVL A;  4EEW A;  3E9S A;  4AOF A;  1RLF A;  3DHG C;  1L4Z B;  2VZK D;  1EM7 A;  2FCM A;  1VLB A;  2BYF A;  2D3A A;  3CMM B;  4BVU C;  2MWS B;  4AP4 C;  2AL3 A;  1SE4 A;  1WMH A;  3HK0 A;  1KTK A;  4G3X B;  2ZVN A;  3GOE A;  2NVU I;  3L17 A;  3M63 B;  4MJS A;  2JRI B;  2AQ3 B;  3IAS 1;  4YTP B;  4KZC A;  2BB5 A;  2IBI B;  2LGY A;  4LJO B;  2KMM A;  4XWW A;  2AL6 A;  3TEY A;  2D11 A;  1EF5 A;  2KTR A;  3EHV A;  2LWP A;  1IBX A;  3IG3 A;  3PLV A;  3KQ4 A;  2PE9 A;  3MTN B;  5JZE B;  4I6L B;  5D3I B;  2BS2 B;  5AZF A;  1CMX B;  1MHX A;  1OQQ A;  3ZUN A;  3TUO A;  4HKQ A;  4NAM A;  3TJP A;  3MHS D;  3Q3O C;  4KGR A;  2JF5 A;  1WF9 A;  1AN8 A;  2AX5 A;  2IO0 B;  3UGB B;  3ENE A;  4HLE A;  5BYQ A;  4DWF A;  2LI5 A;  2WXR A;  4FJV B;  2N7D A;  2CJO A;  5E6P A;  1KFY B;  1TT5 B;  1UWM A;  2M1M A;  3AE3 B;  5TSS A;  3AU5 A;  4FXC A;  4YT0 B;  2ZW1 A;  2RDH A;  4P1C C;  3EFC A;  1TTN A;  2DZK A;  4F7Z A;  2LHD A;  3H7P B;  4KX6 B;  2WDT B;  4XWT A;  4AJW A;  2H89 B;  3RD2 A;  1V1O A;  1UF0 A;  2HDE A;  3L0W B;  1BML C;  4KSL C;  1F52 A;  3Q69 A;  1SIF A;  2KC2 A;  2V3S A;  3AXC A;  1Y8R C;  2RDG A;  4B9K A;  1VRA B;  4ZRK A;  3ZNH B;  2HTH A;  4WWM A;  3QA8 A;  4GDK A;  2ZCB A;  2JZZ A;  2KQS A;  1YQB A;  2D07 B;  2JZP A;  5IAA C;  3PV1 A;  4YSZ B;  2ONQ A;  1N60 A;  2B3A A;  1ROE A;  4YSX B;  1DOI A;  2K8H A;  4A3O A;  2LJI A;  1WX8 A;  2EMT A;  1GJZ A;  3DBL I;  3WAN A;  1VCB A;  4S17 A;  2HE7 A;  2AQ1 B;  3TCA A;  2GOW A;  3N1X C;  1WWT A;  1WMH B;  3PGE A;  1KF6 B;  3ZQ4 A;  4RGN A;  2JU6 X;  4KGS A;  2M0X A;  1QZE A;  3QIJ A;  2FBW B;  1ZXI A;  1IGC A;  3C0R B;  1QOB A;  3U30 A;  1WGK A;  1WIA A;  4KKI A;  3D32 A;  1LM8 B;  4W9E A;  5CHF A;  2K3U A;  4BFR A;  1GC7 A;  2XBB C;  4WH4 A;  2LVO A;  2R2O A;  4C00 A;  2LHE A;  2CS4 A;  4M0W A;  1XLO A;  2LVP A;  1K53 A;  1FXI A;  2ZNV B;  3RZW C;  2O2V B;  3QAR A;  1C76 A;  2DWQ A;  4USA A;  3U52 E;  2WQY B;  2MW5 A;  5IN7 A;  4NJ6 A;  4LJP B;  5IKC M;  2WYQ A;  3DPD A;  4JIO U;  4KIK B;  1WX7 A;  4MT5 A;  1P98 A;  2K25 A;  2X8X X;  4ZRJ A;  3NG0 A;  3RNE C;  3PTF C;  2NCN A;  3AH7 A;  3CIR B;  1YN4 A;  3Q8A A;  1ZE3 D;  2EKI A;  2G4D B;  2IJ0 A;  3A33 B;  1HQR D;  2V0G A;  2DNF A;  3OWE B;  4BKS D;  4GGQ A;  1TS3 A;  1V1P A;  1FRR A;  4C7Z A;  2CKH B;  4LDT B;  2KXJ A;  4RGT A;  4A3P A;  1WI0 A;  2OHF A;  1SE3 A;  1SE2 A;  1ZGU B;  2BYT A;  4OVV A;  3OLM D;  4G11 A;  4C7Y A;  4ANU A;  2HJ8 A;  4BKT A;  2YLM A;  1K8R B;  4GU2 A;  3NS8 A;  3RT3 B;  4PYZ A;  3ML8 A;  4NZL B;  1I35 A;  4CQN A;  1TBE A;  4EE2 A;  3FAH A;  1D3Z A;  3WA0 A;  1V6E A;  2CU1 A;  4NQL B;  1WZ3 A;  1WH3 A;  2PW9 A;  4TKN A;  3ZTC A;  1PUT A;  1VJK A;  3GZN B;  3N9Y C;  1DOX A;  1V81 A;  2GBJ A;  4FLH A;  2ZJD A;  3QX1 A;  1WE6 A;  2XN9 C;  2MQJ A;  3W5U B;  1FNW A;  2C7N B;  1D5Z C;  2MBH A;  4WWP A;  4HJG E;  1JQ4 A;  2KHW B;  3CSF A;  2BW2 A;  3C19 A;  3NHE B;  2Q5W D;  1WR1 A;  1BUI C;  5EE1 A;  1WJ6 A;  1ACC A;  3N20 C;  4NY0 A;  1RYJ A;  4FJZ A;  3GS2 A;  1UNS A;  2R2Q A;  5AZH A;  4CO7 A;  3QWZ B;  4KSK C;  5C3J B;  3AE9 B;  1JAL A;  4D2K A;  1EO6 A;  1LXD A;  1M4V A;  5GMV A;  1UD7 A;  1V2Y A;  4YXD B;  4LNI A;  4O1N A;  1WFY A;  5FK9 C;  2WXM A;  2VRR B;  2Z0D B;  2J7Q B;  1SGH A;  2ACZ B;  4RF1 A;  2K6D B;  2KMA A;  1JW9 D;  4BBN F;  1VZ7 A;  2BQQ A;  4M8M A;  1L6U A;  3VUX A;  2NBW B;  2LZ6 A;  1D4B A;  3T3O A;  2GLS A;  1JWS D;  4ANW A;  1WGH A;  2OOB B;  3PRP B;  3W2D A;  3EEC A;  4WWN A;  3AB5 A;  1TGZ B;  4N58 A;  1E8X A;  3KYD D;  2KK8 A;  3V3X A;  2NR2 A;  3JSV A;  3Q3F A;  2NTT A;  2PEA A;  4LNN A;  2Y3A A;  1V49 A;  5L83 A;  1QOA A;  1ENF A;  2E6X A;  3ML9 A;  1AW7 A;  2N0S B;  4GLS C;  4M01 A;  4WJN A;  1BXT A;  4W9C A;  3P4Q B;  1NVI D;  4JLC A;  2MBB B;  2LGD A;  2MLB A;  2IGG A;  3DVN U;  2L3Z A;  4IUM B;  4FA6 A;  1HTQ A;  2KX3 A;  3VDZ A;  4KKJ A;  3V61 A;  2KD0 A;  2RMM A;  2G3Q B;  1L0V B;  4PT5 A;  3VQI A;  3P4P B;  1RFA A;  3J9C A;  1SXT A;  4ICV A;  5IO9 A;  3ZRF A;  2YEP B;  2CJN A;  1P0R A;  3FIL B;  4IWO A;  4WJO A;  3KWL A;  2LMC A;  1ZKH A;  4ZDV A;  5LXI B;  4A55 A;  1N5W A;  2KDF B;  2MP2 B;  2UWQ A;  4TQ1 A;  4N59 A;  1S1Q B;  2XK5 B;  3ZJV A;  1E5W A;  4WUR A;  2D3B A;  2MEK A;  2LGS A;  4JQW C;  3ZXR A;  2DYB A;  2ZPY A;  3PLU A;  4WWO A;  3VAW A;  3X0W A;  3DQV A;  4BAX A;  4JX1 C;  3AEA B;  3BYY B;  1Q10 A;  3VR8 B;  4K1R B;  1TS2 A;  4W9I A;  1N61 A;  3IBE A;  1SSN A;  2JXT A;  3QHT A;  4OZA A;  4C56 C;  2JVC A;  4ARC A;  2GBK A;  3KW5 B;  2LXC A;  1C4P A;  3B08 A;  2PMV A;  3AMZ A;  4GSW A;  3SDL C;  5DPT A;  3S2A A;  1L6V A;  3RNC C;  1YQ3 B;  1QOF A;  4JGH B;  2CR5 A;  1XCT L;  4LTU A;  3NUH B;  2IZV B;  4HDO A;  2NS5 A;  4XX5 A;  1RFK A;  5LXH A;  1YIW A;  3ZKJ C;  2LEK A;  3UQA A;  1UBQ A;  1FFV A;  2WXF A;  1WXA A;  3W5V B;  1YD8 U;  3NVY A;  4KDI C;  4IM0 A;  2W54 A;  2DYO A;  2LRW A;  4BZA A;  1OQY A;  4K7W A;  1SF0 A;  1SE9 A;  4MSQ B;  2E3T A;  2I38 A;  2K39 A;  4BOS C;  3ZVV A;  3BYT B;  3IAM 1;  4A20 A;  2IGH A;  2TSS A;  2WDQ B;  1XO3 A;  3AE8 B;  2KQ4 X;  1KRH A;  3VUW A;  2KWV B;  3Q8E A;  2M19 A;  4M8N A;  2BYV E;  2RD0 A;  4G0N B;  2NBV B;  4XDD A;  2PKO A;  3OJ4 B;  3ZTD A;  3IVF A;  1QIL A;  4HEA 1;  3VH3 B;  3H7P A;  3PPA A;  4K7U A;  1EF1 A;  1F0Z A;  4DK5 A;  1F9J A;  1MVK A;  1CQV A;  1SB3 C;  1E8Y A;  2KOX A;  4FHJ A;  4HRS A;  3ZGZ A;  1ZPS A;  5C23 A;  4DXF A;  4AQ7 A;  1F1H A;  2K1F A;  3UIN B;  2NPT A;  3TEZ A;  2O6V B;  2KVR A;  4HJK A;  1C4A A;  1N63 A;  3L08 A;  1TYG B;  3L13 A;  3JYU A;  2DEN B;  3IT6 B;  3LDZ E;  1GUA B;  3DBL B;  1QF6 A;  2ASQ A;  2W3S A;  3BVG A;  3RNG C;  5JH5 C;  1DGJ A;  3VTV A;  2L83 A;  2AWT A;  1CK1 A;  3BY4 B;  3ZDM C;  4YTM B;  4MDK E;  2D10 A;  1S3S G;  3CWI A;  4RM9 A;  3QCA A;  4KDL B;  3UIP B;  3KVF B;  4MSM B;  2MSE D;  3DBS A;  4DBG A;  1V86 A;  1PGA A;  1L7Y A;  2YVC A;  4RGO S;  2DAF A;  2BWF A;  2KX0 A;  3BVM A;  1WXV A;  2N9E B;  4EZL A;  3AEC B;  4RNA A;  2PLP A;  1FEH A;  2Y5B B;  4GDL B;  2N1V A;  1E10 A;  1LGR A;  4B95 A;  2O2V A;  5G55 A;  1WGG A;  2JSV X;  4L2Y A;  3DOW A;  1J7A A;  1WRD B;  1ESF A;  2JUO A;  1P9D U;  4KIK A;  2MRP A;  3QK0 A;  1T0S C;  1K52 A;  4RGM A;  4MGY E;  2EKE C;  4B0M A;  2QIL A;  1ISN A;  1Q5W B;  4H2A A;  3I9V 1;  2ZVO A;  3AE2 B;  3DHI C;  4LDT D;  1H8C A;  3A9J B;  4AS1 A;  3SU8 X;  2KNB A;  3VRB B;  2WXO A;  1TIF A;  5HFY A;  2LUM A;  3GE3 C;  1Z5S B;  2KN4 A;  3ZJT A;  4GMV A;  2H88 B;  4HPM B;  4N6E B;  2M4N A;  1R7S A;  4OZB A;  2QC8 A;  3KYC D;  2AEH A;  4FN2 A;  3N1Z C;  2J52 A;  1H7X A;  3T8M A;  2N9P C;  4MGK E;  1GT8 A;  2WXJ A;  1J0G A;  1GTE A;  2RDB C;  4E3C A;  2KJR A;  2L76 A;  1C3T A;  3ABV B;  1I4H A;  4REZ A;  2FUG 1;  2NPT B;  1L2N A;  3NZ3 A;  4ACF A;  2L0F A;  4EOY A;  3W1Y A;  1RWS A;  3V6E B;  1PYW D;  2ICI A;  1E0Z A;  3CST A;  4IKG A;  2N9L A;  5BMG A;  2C7M B;  5JHB A;  1ZUD 2;  1P3Q U;  4W9H A;  4RF0 A;  2N1W A;  3MJW A;  3DBH I;  3Q3N C;  2L05 A;  1NYR A;  3APC A;  4ANX A;  2GBN A;  3PZ8 A;  1FPY A;  2NMQ A;  3WAL A;  1EWY C;  5IA7 A;  2PVO D;  2MJE A;  3NOB A;  3Q2A C;  1I4G A;  2LD9 A;  1UH6 A;  2KDM A;  5AZG A;  4N9F 4;  3DVN V;  2ZNV C;  1PGB A;  1JRP A;  2L7R A;  2GRI A;  2V3P A;  3P1M A;  3O65 B;  3N3K B;  4BBN C;  2L52 A;  5IP4 D;  2WDR B;  2XNA C;  5MPO A;  2INN E;  3C8Y A;  1M94 A;  2B76 B;  1E7V A;  1FCC C;  2WX0 A;  2IND C;  2ZZP B;  2KVZ A;  1E8W A;  2J42 A;  2NTS A;  2RR9 A;  3UIO B;  1PQS A;  3SR6 A;  3K9O B;  1I4Q A;  3FC4 A;  1XLN A;  4P7I A;  3RNB C;  5BYS A;  1YNT E;  4IC7 B;  5DPR A;  1P7E A;  4FJY A;  3Q8C A;  3DBR I;  3H8H A;  2WHI A;  4NAW B;  3RI7 C;  2KN5 A;  5BMH A;  4MAC A;  1KLG D;  3GE8 C;  2WWZ A;  4YTN B;  1EUV B;  3OG5 A;  5CTR C;  2PE6 B;  3MC0 B;  2NBU A;  4P6V F;  1TKE A;  1AAR A;  3FIL A;  1WGR A;  2V4L A;  2FCS A;  2J4X A;  4LNF A;  2MP2 A;  2W55 A;  3QQ8 B;  2HD5 B;  4W9G A;  1IGD A;  3GP7 A;  2FIF A;  2XK5 A;  4WJP A;  1D6E C;  2M17 A;  1X1M A;  4II3 B;  1J19 A;  3AE1 B;  2M8S A;  1JCK B;  1HEZ E;  3MC9 A;  2L8J A;  3RZF A;  2EEL A;  3P4R B;  1C77 A;  1XCQ L;  1MG8 A;  4L1B A;  2GI9 A;  1WXM A;  4XZ4 A;  3Q14 C;  1IPG A;  1FRD A;  2K22 A;  3RNF C;  1GB1 A;  2FE8 A;  3P4S B;  3MP9 A;  2LGI A;  4GN1 A;  2LAS A;  1FNU A;  3PRE A;  2Z0E B;  4R3D A;  1I4P A;  3PHX B;  4EKU A;  2BPS A;  2UU7 A;  2L32 A;  5FR3 A;  4KGT A;  4II2 B;  4ITK A;  2DAJ A;  2JYT A;  3NS1 A;  2WGS A;  4NNJ B;  2PTL A;  4KZ0 A;  3LB8 C;  4WAA A;  2Y5P A;  1TJE A;  5J17 A;  2BBC A;  2C60 A;  4DXG A;  2LRU A;  1SJE D;  2PJH A;  3NRZ A;  5KHQ A;  5D7G A;  2LUE A;  3APF A;  4LNO A;  1MFW A;  2C5L C;  4E74 A;  1KH0 A;  4JWS C;  3W1S A;  2IO1 B;  1SJH D;  1GAQ B;  1H4R A;  3KH0 A;  3PO0 A;  3RFZ B;  2Z8L A;  1B1Z A;  3PT2 B;  4JPS A;  1T6B X;  4DXA B;  1MPE A;  2J0K A;  2BS3 B;  4KVG B;  3WAO A;  2K0P A;  2LJ5 A;  3ZO5 B;  2LGX A;  3URY A;  4GOC A;  4MM3 B;  2K8B A;  2ZEQ A;  3FKY A;  2FAZ A;  3MFG A;  4NPN A;  1WR6 E;  1NEK B;  3QAQ A;  4ANV A;  4WQO B;  4IDI A;  1CZP A;  1WSP A;  4TUU A;  3B0A A;  4AUQ C;  1R4M I;  1NDD A;  2KFK B;  5H8Y E;  1MHH E;  2G45 B;  1YQ4 B;  2BWE S;  3V05 A;  3HRD D;  2O6V D;  1XD3 B;  2GBM A;  1TZ1 A;  4URK A;  2MBQ A;  1C4C A;  1FM0 D;  2O6V A;  5G5G A;  1XQQ A;  4K81 A;  1F2R C;  3AEF B;  2K8C A;  3U7Z A;  4HPL B;  2AYO B;  4PS3 A;  3AUL A;  3VTU A;  5HI1 A;  5D94 A;  1I7H A;  4FHK A;  2W82 A;  5AEK B;  3I57 A;  1HXY D;  2LXA A;  2KZR A;  2REX A;  4IWQ A;  1NI2 A;  2VH1 A;  1D5X C;  1H7W A;  3JW0 X;  4F1S A; 
#chains in the Genus database with same CATH homology
 3P42 A;  4YTM B;  3R8B A;  4A90 A;  1GOZ A;  1ROE A;  4YSX B;  1DOI A;  5JXV A;  1FCL A;  3CWI A;  2Y5C A;  2LJI A;  4XDC A;  4OHJ A;  3AE7 B;  1SBB B;  1YJI A;  1NYQ A;  2AQ1 B;  1P7F A;  3HVZ A;  4RFB A;  3WCQ A;  1T5X D;  5BMI A;  1PGA A;  1PFD A;  1TKG A;  1WWT A;  3BII D;  1E6E B;  1KF6 B;  3TEW A;  3ZQ4 A;  2DLB A;  4RGO S;  3AE5 B;  2QMT A;  3BVM A;  4RGN A;  2JU6 X;  4KGS A;  2FBW B;  1ZXI A;  1IGC A;  3AEC B;  1QOB A;  4TQ0 A;  1WGK A;  4RNA A;  2PLP A;  3EGR A;  1FEH A;  1UGJ A;  4KKI A;  2RPV A;  4GDL B;  1UUP A;  2PIA A;  1E10 A;  2K3U A;  4WH4 A;  1Y56 A;  4HKZ E;  1SEB D;  1IUE A;  2JSV X;  2LHE A;  2WXN A;  4M0W A;  1QOG A;  4L2Y A;  1PDX A;  1XLO A;  1J7A A;  1K53 A;  3EA6 A;  1FXI A;  1ESF A;  1C76 A;  2DWQ A;  4USA A;  1L0X B;  2IDY A;  2G1E A;  3U52 E;  2WQY B;  2D5G A;  1K52 A;  4RGM A;  1XEE A;  2BT6 A;  4B0M A;  2QIL A;  4MT5 A;  1E9M A;  3AN1 A;  1F77 A;  3B9J A;  4RCO A;  4H2A A;  3I9V 1;  1V97 A;  3AE2 B;  2R61 A;  3AH7 A;  1XLQ A;  2WXL A;  3CIR B;  4AS1 A;  1YN4 A;  3Q8A A;  3VRB B;  1ZE3 D;  2EKI A;  2WXO A;  3AV8 A;  5HFY A;  2LUM A;  2QEJ C;  2IJ0 A;  3R2I A;  2KAJ A;  3SFD B;  3LXF A;  2KN4 A;  1HQR D;  2V0G A;  3ZJT A;  3OWE B;  5E6J A;  2H88 B;  4N6E B;  3AEE B;  1TS3 A;  1V1P A;  1FRR A;  2JX5 A;  1K51 A;  1R7S A;  4C7Z A;  4OZB A;  3BVZ A;  3NVZ A;  3SFE B;  3KLS X;  4LK0 M;  4RGT A;  2INP E;  1FIQ A;  4TSS A;  2OHF A;  2J52 A;  1H7X A;  1SE3 A;  1V1P B;  1SE2 A;  2BYT A;  1ZXH A;  4C7Y A;  1GT8 A;  4ZOH C;  2WXJ A;  1JWA D;  2WDV B;  4ARI A;  2JQR B;  2PVG C;  4TMA B;  5EE3 A;  1GTE A;  4RH6 A;  4NZL B;  1EU4 A;  4P16 A;  4CQN A;  5AUK A;  4ZHP A;  3ZYY X;  4EE2 A;  3ABV B;  1JWM D;  3FAH A;  3CF4 A;  1I4H A;  4REZ A;  3NVV A;  1TS5 A;  2FUG 1;  3NZ3 A;  1FNV A;  1ET9 A;  2PW9 A;  1GTH A;  1TY2 A;  1YN3 A;  1PUT A;  3AE6 B;  1ZP0 B;  1VJK A;  3IT4 B;  1RWS A;  3N9Y C;  1DOX A;  3IXS A;  1EU3 A;  1PYW D;  1E7P B;  3VR9 B;  1JRO A;  2ICI A;  1FO4 A;  2V4I B;  2XN9 C;  2BB6 A;  3W5U B;  1L5P A;  1E0Z A;  1FNW A;  1VZ8 A;  1YN5 A;  4IKG A;  1DYQ A;  4JWU C;  2N9L A;  1D5Z C;  2J53 A;  4HRO A;  5BMG A;  4HJG E;  1JQ4 A;  1ZUD 2;  2IPK D;  3BWU D;  3RPF C;  1SIJ A;  3BK2 A;  1C78 A;  2K5P A;  4RF0 A;  5BYR A;  2X38 A;  2BW2 A;  3B2G A;  2Q5W D;  5EE0 A;  5C2T B;  1BUI C;  5EE1 A;  1NYR A;  1ACC A;  3Q8F A;  1AWD A;  3PZ8 A;  1RYJ A;  1QQR A;  4ZRP A;  1QT9 A;  2NMQ A;  3GS2 A;  1UNS A;  1EWY C;  1F2R I;  5C3J B;  2WNM A;  5H92 C;  3L4P A;  3AE9 B;  2CU3 A;  1JAL A;  1OQR A;  4D2K A;  1M4V A;  2WLB A;  4WQM A;  4YXD B;  2PVO D;  1ZOY B;  5GXG B;  4O1N A;  2MJE A;  3DWM A;  1VR9 A;  3NVW A;  3BZD B;  1I4G A;  2WXK A;  2KDM A;  3AEB B;  3W9C B;  1WXQ A;  5FK9 C;  5D3D A;  1NI3 A;  2WXM A;  2WXP A;  1PGB A;  2ACZ B;  1JRP A;  4RF1 A;  1JW9 D;  1VZ7 A;  1HA5 A;  2GRI A;  2V3P A;  3P1M A;  1C9F A;  2L1A A;  3DWG C;  2ZW0 A;  1L6U A;  3B2F A;  1QKZ A;  1STE A;  2L52 A;  4ZHO A;  1D4B A;  1FD6 A;  2WDR B;  3TEX A;  5AUI A;  3T3O A;  2QSD A;  2XNA C;  5MPO A;  2KWD A;  3HUI A;  3ZJU A;  1JWS D;  2INN E;  3O13 A;  3C8Y A;  3AED B;  2B76 B;  3W2D A;  2WXQ A;  1FCC C;  2WXH A;  3AB5 A;  1J7C A;  3PZ7 A;  4N58 A;  1WRI A;  1V8C A;  1N5X A;  2N7J A;  4WIP A;  3V3X A;  1ET6 A;  2SAK A;  2MJD A;  2N9K A;  5LNK 1;  2J42 A;  2NTS A;  2NTT A;  3MJ5 A;  2G9H D;  2Y3A A;  2WU2 B;  3SR6 A;  2WP9 B;  3R2T A;  1QOA A;  1I4Q A;  5HHD G;  3FC4 A;  1RM6 C;  1C79 A;  1ENF A;  1XLN A;  2K9X A;  1J7B A;  2E6X A;  3UI3 A;  2I2Y A;  1YMH E;  1AW7 A;  2N0S B;  1DOY A;  4Q2J A;  4GLS C;  5BYS A;  1YNT E;  1BXT A;  4XE0 A;  3KWV A;  3P4Q B;  1L4D B;  3LYY A;  4JE3 B;  5T8I A;  1EWC A;  1NVI D;  1OFF A;  4A9A A;  1P7E A;  3EUB 2;  2HTM E;  2YEP F;  3Q8C A;  4OW0 A;  3H8H A;  4NAW B;  2V3N A;  2IGG A;  1I4X A;  4US9 A;  4ZYS A;  5BMH A;  4MAC A;  4WAF A;  2WXG A;  4KKJ A;  1KLG D;  2RMM A;  1TKY A;  3AE4 B;  4A8X C;  4YTN B;  1L0V B;  1MI0 A;  1UWX A;  3MC0 B;  4PT5 A;  4LLG M;  3VQI A;  3P4P B;  4P6V F;  3J9C A;  1SXT A;  1YJJ A;  1TKE A;  3TSS A;  5G5H A;  3FIL A;  2YEP B;  2CJN A;  4US8 A;  1VDV A;  1CJE A;  4IOI E;  5EE9 A;  3U2S C;  4OZC A;  1XXG A;  3BK1 A;  5I4D A;  3FIL B;  2LFI A;  2J4X A;  2GB1 A;  2W55 A;  3T3N A;  1GB4 A;  4B0E A;  3KWL A;  1IGD A;  2LMC A;  2MJ3 A;  3GP7 A;  2BS4 B;  2OED A;  3ETR A;  2M56 B;  4A55 A;  1D6E C;  1N5W A;  4DQO C;  4TQ1 A;  2DBY A;  3HVD A;  1XF5 L;  4N59 A;  2SEB D;  1D5M C;  3ZJV A;  4WUR A;  1TY0 A;  3AE1 B;  2MEK A;  2M0A A;  3GB1 A;  4ZRQ A;  1JCK B;  1HEZ E;  1HZ6 A;  2QJL A;  4A6Q A;  1K50 A;  1TS4 A;  2EEL A;  2JWU A;  3P4R B;  1C77 A;  2DYM A;  4JX1 C;  1XCQ L;  1FFU A;  4J3O D;  3AEA B;  3BYY B;  4L1B A;  1Q10 A;  3VR8 B;  2GI9 A;  3E9S A;  1HZ5 A;  1TS2 A;  4YWG G;  1N61 A;  1FRD A;  1L4Z B;  1SSN A;  1EM7 A;  2JXT A;  2K22 A;  2VZK D;  1JWB D;  1GB1 A;  2FE8 A;  1FXA A;  4NJC A;  4OZA A;  2BTE A;  3P4S B;  3MP9 A;  2LGI A;  1VLB A;  4C56 C;  4ARC A;  1FNU A;  1SE4 A;  4R3D A;  1C4P A;  1I4P A;  1KTK A;  1GPX A;  1NEN B;  1JWU D;  2PMV A;  3AMZ A;  2L32 A;  5FR3 A;  2W3R A;  4KGT A;  2VZK B;  1L6V A;  1T3Q A;  2AQ3 B;  1YQ3 B;  1QOF A;  2JYT A;  3IAS 1;  4YTP B;  3NS1 A;  4ITK A;  2PTL A;  2BB5 A;  3LB8 C;  2Y5P A;  2KMM A;  1TJE A;  1VZ6 A;  1XCT L;  4LTU A;  2BBC A;  1XLP A;  3NUH B;  4DXG A;  4XWW A;  3TEY A;  1SJE D;  3NRZ A;  1IBX A;  1QLB B;  1RFK A;  1N62 A;  3KQ4 A;  5D7G A;  3P63 A;  1LO5 D;  1KH0 A;  2LEK A;  4JWS C;  3U4E G;  3W1S A;  1SJH D;  1GAQ B;  5D3I B;  1IBX B;  2BS2 B;  3PO0 A;  1FFV A;  3RFZ B;  2WXF A;  2Z8L A;  1MHX A;  3W5V B;  1B1Z A;  3NVY A;  2W54 A;  1TZO A;  2DYO A;  4JPS A;  1OQQ A;  1T6B X;  3TUO A;  2JYE A;  1SF0 A;  4HKQ A;  1L0Y B;  2E3T A;  4NAM A;  2I38 A;  1MPE A;  4KGR A;  3E56 A;  3BYT B;  2BS3 B;  3IAM 1;  2IGH A;  2TSS A;  2WDQ B;  2K0P A;  1XO3 A;  1AN8 A;  2AX5 A;  3AE8 B;  5FKA C;  2WS3 B;  2QIE B;  2KAC A;  3URY A;  2KQ4 X;  1KRH A;  5BYQ A;  4MM3 B;  2WXR A;  3Q8E A;  2M19 A;  3AM9 A;  2CJO A;  3MFG A;  1NEK B;  1I4R A;  1WYG A;  1KFY B;  2ON8 A;  4IDI A;  1UWM A;  1CZP A;  1WSP A;  4UDU C;  4XDD A;  2PKO A;  3AE3 B;  5TSS A;  4MH8 A;  2IGD A;  4L23 A;  2WU5 B;  1QIL A;  4HEA 1;  4FXC A;  1FMA D;  5H8Y E;  4YT0 B;  1MHH E;  1YQ4 B;  2ZW1 A;  3AEG B;  4C80 A;  2RDH A;  4OVZ A;  3V05 A;  2AQ2 B;  4YSY B;  1F0Z A;  3SEB A;  2WXI A;  2LHD A;  1PGX A;  3VRA B;  4KX6 B;  3HRD D;  1MVK A;  4XWT A;  1CQV A;  1SB3 C;  1C4C A;  1FM0 D;  3MHZ A;  2H89 B;  1V1O A;  5G5G A;  2HDE A;  2MH7 A;  3ZGZ A;  4HRS A;  1F2R C;  1BML C;  1JML A;  3AEF B;  3U7Z A;  1ZPS A;  4DXF A;  1KLU D;  4AQ7 A;  3Q69 A;  3Q8B A;  3TEZ A;  1AYF A;  1ZDX A;  1C4A A;  5HI1 A;  1N63 A;  1TYG B;  1I7H A;  2RDG A;  2W82 A;  3I57 A;  1VRA B;  5HG2 A;  3IT6 B;  1HXY D;  4WWM A;  1B9R A;  1A70 A;  1QF6 A;  1ZDV A;  2W3S A;  1D5X C;  1H7W A;  3BVG A;  2JZP A;  1DGJ A;  2L83 A;  4GDK B;  1CK1 A;  4YSZ B;  2ONQ A;  1N60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...