2WDRB

E. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Structure of Escherichia Coli Succinate:Quinone Oxidoreductase with an Occupied and Empty Quinone- Binding Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 67
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdrB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdrB01
4P6VF 2Q5WD 1H7WA 3P4QB 4YXDB 4C7ZA 2G1EA 3AE3B 3AECB 1J7BA 4C7YA 1ZXIA 3LXFA 1NYQA 2QIEB 1WGKA 2MJ3A 1YJJA 1JWAD 1N5WA 1RFKA 1L6UA 2JX5A 1GTEA 2DBYA 4IDIA 1JROA 4C80A 1FRDA 2WU2B 2PIAA 3NVZA 1OQQA 1I7HA 1QOBA 3B2GA 1NI3A 1FFVA 2Y5CA 2EKIA 4HROA 4N58A 3ETRA 1CJEA 5H92C 3NVVA 1FIQA 3AEFB 3AEBB 4KX6B 3VRAB 3P63A 4JWSC 2W55A 3NVYA 1QF6A 3BIID 3NS1A 4YSYB 3AEEB 3B2FA 3CIRB 1QLBB 1AWDA 1FXIA 1QOFA 3HUIA 5EE3A 1VJKA 1YJIA 2BS2B 1ZUD2 1YQ3B 2WDVB 1J7CA 1R7SA 2KMMA 2W54A 2PVGC 3FC4A 5H8YE 2FBWB 3AEAB 1XLNA 2ACZB 5MPOA 2CJOA 1DOXA 3AE1B 1FMAD 3P4PB 2K22A 3NVWA 2B76B 2LEKA 1NENB 5EE0A 1GTHA 2KAJA 1E7PB 2WLBA 3AE9B 2OHFA 3HVZA 4HRSA 5G5HA 4JWUC 5C3JB 3AB5A 1B9RA 3W5UB 3KWLA 1UWMA 3W5VB 4YTPB 1KRHA 2N0SB 2QJLA 1F0ZA 1NYRA 3CWIA 1WYGA 2CU3A 3DWGC 4WWMA 3VR9B 1H7XA 1GAQB 1ROEA 3P1MA 1E0ZA 4ITKA 2K9XA 1SB3C 4YSXB 1JQ4A 1JRPA 3AEGB 1QT9A 1N63A 3LB8C 1CZPA 3AE7B 1TYGB 3PO0A 3RPFC 5GXGB 4ZOHC 3WCQA 3ZYYX 3CF4A 3AH7A 4FXCA 4A9AA 2BS4B 1N60A 5C2TB 5AUIA 2MH7A 3AV8A 3VRBB 3AEDB 1AYFA 1T3QA 2W3SA 4N59A 4YSZB 1XO3A 3AE2B 4ZHOA 5EE1A 1PUTA 1TJEA 1N62A 2M56B 1FM0D 1L5PA 1V97A 2MJEA 2WU5B 1NVID 2M19A 1QOAA 4YT0B 2L52A 1TKGA 2H88B 2L83A 2E3TA 1FO4A 1OQRA 4YTMB 1NEKB 2H89B 3P4SB 3VR8B 1N5XA 1WRIA 1DGJA 1J7AA 4USAA 1FFUA 3SFDB 3AMZA 5EE9A 2JQRB 1XLPA 1DOYA 3P4RB 3AE6B 1FXAA 4US8A 4WQMA 4US9A 1OFFA 1ZP0B 1SIJA 1XLOA 3AE8B 1KFYB 1KF6B 1VDVA 2AX5A 3SR6A 3ABVB 1JWBD 3DWMA 1L6VA 1GT8A 2DWQA 1E6EB 3AM9A 1E9MA 2WDQB 2WQYB 1DOIA 2BT6A 3FAHA 4LTUA 1WXQA 1PFDA 1RWSA 3AE4B 3AE5B 4YTNB 3W9CB 2WP9B 2W3RA 2WS3B 2BS3B 1FRRA 1IUEA 1RYJA 1L0VB 2WDRB 3L4PA 2HTME 3NRZA 1N61A 4JX1C 5G5GA 4N6EB 1GPXA 3SFEB 4ZHPA 1VLBA 1JALA 1TKYA 1YQ4B 1V8CA 5AUKA 1E10A 1JW9D 1RM6C 2K5PA 3AN1A 3EUB2 3HRDD 1A70A 3B9JA 1WWTA 1XLQA 2MJDA 1SF0A 1ZOYB 2CJNA 2PKOA 1TKEA 1QOGA 2PVOD 1PDXA 1EWYC
chains in the Genus database with same CATH superfamily
4RGNA 1H7WA 3CSFA 1EU4A 3UIPB 4FA6A 3PPAA 4II2B 1WGKA 4MSMB 1JWAD 2AWTA 4AQ7A 1GTEA 2ZW1A 2DENB 2CR5A 2XBBC 3TUOA 1FFVA 3PRMB 2WXMA 4LNOA 4HROA 1WFYA 2M17A 1CJEA 2IZVB 3NZSA 1STEA 3VQIA 2N9EB 4ZRIA 1F2RC 1HXYD 1I4PA 3DBSA 5IA7A 3V61A 3T9LA 1D6EC 4K3CA 3N32A 3VHTC 4MM3A 2K22A 4KDLB 2HDEA 4M0WA 3N20C 4EFOA 4ZYSA 4CQNA 3W1SA 2K8HA 1EO6A 1ET6A 3ZQ4A 3KYCD 1H8CA 4E3CA 4KGSA 1ESFA 4KIKA 3U8ZA 1YX5B 3UINB 2Z8LA 3VUYA 4FXCA 1KTKA 2BS4B 3QWZB 1TY2A 1OEYA 4NQKE 3W1SC 1C9FA 2NBWB 1VZ7A 1PUTA 5EE1A 1N62A 1TY0A 3N1YC 3RI7C 2KC2A 4ZRKA 1WXMA 2IY1B 2YVCA 1WJ4A 2GI9A 2Z0DB 4DHZE 2MRPA 4K7SA 1WM2A 3KYDD 1M4VA 3ZXVA 3SR6A 3ABVB 1ET9A 1SBBB 4M8MA 4F1SA 5CHVC 2DYBA 3DDCB 1M94A 4REZA 2J53A 3KW5B 1S1QB 4GU2A 4MH0E 1E8ZA 3HVDA 3MP9A 2KDMA 5T8IA 3DBHB 3NRZA 1N61A 1NI2A 1P98A 2BWES 1LGRA 4HDOA 1TKEA 2DYMA 3SDLC 4KSKC 2FCQA 1ZE3D 4MM3B 3R7RA 2JYEA 1EUVB 2N4FA 2DBYA 2PIAA 2L8JA 2VZKD 4W9JA 1QOBA 2IDYA 3BVMA 2L0FA 3NVVA 3Q69A 2FNJB 2W55A 5IOIA 3WA0A 3GE8C 1P9DU 1XF5L 2PEAA 4KIKB 1BMLC 4BOSC 3CIRB 2KVRA 3HUIA 2HJ8A 2KMMA 5H8YE 3SD5A 5MPOA 3AE1B 4ACFA 3LYYA 2EKEC 4DHZB 3AULA 2XK5A 1PYWD 2KTRB 3EC8A 2B3AA 2MA9B 1HA5A 1YJ1A 4DDGD 5EDSA 4NAWB 3NZUA 4W9CA 3ZYYX 3OLMD 4N59A 5BO4B 1I4RA 4OVUA 2D11A 2M56B 1V97A 4ZDVA 1TKGA 1NBFC 2QILA 4YWGG 2MLBA 2DZIA 4C4VA 3W1YA 5BYQA 2LFIA 3KVFB 4URKA 3HM6X 2VH1A 4RMAA 3U7ZA 2QCZA 4WJQA 1V81A 2MX2A 1VCBA 2QSDA 2JWZA 1D5XC 1OGWA 4WIPA 2K0PA 2Y5BB 4JX1C 4W9IA 5FKAC 2V0GA 3RULA 1EM7A 3U4EG 1I35A 1WXAA 1TKYA 2M4NA 1CK1A 4W9LA 3ZJUA 2K5PA 2SAKA 1F77A 2NS5A 4GOCA 3VUWA 1XEEA 3R7QA 3IAM1 3A9KA 3TEWA 5D94A 2IY0B 2RDGA 2A5UA 3A9JA 2WWZA 4B0EA 4M01A 1I7HA 4A55A 1T0RC 5IN7A 1BXTA 3TEXA 2LJIA 3I3TB 4DBGA 4G3XB 2GBKA 3OAWA 3VH3B 3MFGA 1WXSA 3A4SC 2ICIA 1WE6A 3L13A 2PW9A 2R2QA 3PT2B 1ZDVA 3NJTA 1C4AA 4P1CC 3HVZA 3HK0A 3ZJVA 1FD6A 4WJPA 1E90A 3PGEA 2RPQA 2N7JA 3JVZX 4WWMA 1ROEA 1BT0A 3HHMA 2JSVX 3Q8EA 1TS5A 4FHKA 1PGXA 3H1UA 4MJSA 4NJ7A 1ZKHA 4R3DA 1EU3A 2KN4A 3I9V1 4ZHOA 3E9SA 2ZVOA 2WXFA 1WM3A 1V2YA 3FILA 2H88B 3GOEA 3H8HA 2KWCA 1J7AA 2CHWA 1FFUA 2G4SA 1UELA 1FXAA 3R2IA 2G3QB 2DZKA 1TZ1A 1C79A 1L6VA 2JYTA 4GSWA 2LJ5A 2W3RA 5IO9A 3TMPB 1ZGUB 2R2OA 3B0AA 2IYDB 2OEDA 3V60A 2KDBA 1LXDA 2LUEA 3VTWA 4LK0M 1D5ZC 3AU4A 2INNE 1WZ0A 1IYFA 3BZDB 1Z2MA 2D3AA 1ZW7A 3RN9C 3NVZA 2MWSB 5DPSA 4A6QA 4GB9A 4XX5A 5D7GA 3GP7A 2KWDA 1V1OA 2ZCBA 5I4DA 1DOXA 2HE7A 3M95A 2D07B 3R3MA 1RLFA 5CHFA 1XLNA 4HJGE 2I38A 2J0KA 2AYOB 1NYRA 4RM8A 1SE3A 3BINA 5LNK1 2OJWA 1JRPA 5CHWA 1K8RB 3AE7B 4ZOHC 3CF4A 3AV8A 3IXSA 5FR6A 2YEPF 5E6PA 1YIWA 4LCDE 2FAZA 2CU1A 2L83A 2Y5PA 2LGIA 1NEKB 2QHOA 4TQ1A 3VH4B 2M8SA 1WSPA 2IO0B 2NBVB 3DVNV 2JPHA 4DXGA 3IFWB 2N1WA 3AE8B 4HWIB 3QC8B 1E6EB 3A1QB 4W9KA 4EEWA 1LM8B 1UH6A 4BVUC 3UQBA 4GDLB 4KGRA 1YN4A 2KDFB 3BYTB 3DHIC 3IBEA 4DWFA 1HEZE 2KFKA 4XC2A 4O1NA 4F8CB 2D3BA 3JSVB 3BK2A 2K25A 1QQRA 3RYTA 2YLMA 4IWPA 1MVKA 5AEKB 2DLBA 4MGYE 1NI3A 3MC9A 5DPRA 1KM7A 3EA6A 2BYFA 4JWSC 2BYEA 2D2QA 4XDCA 2G9HD 1D5MC 1MJDA 1AWDA 1VJKA 3RNGC 3RUIB 3FC4A 2W54A 2C7MB 3P4PB 3U30A 4BBNF 4OVZA 4AS1A 3I5JC 1TTNA 1Y56A 2RGFA 5C3JB 4RGOS 2LMCA 1UWMA 2JZ3B 3L10B 1H7XA 1SB3C 4IKGA 2TSSA 1CZPA 2MW5A 4W9EA 4TV3A 4FJYA 5JH5C 2QMTA 4KDIC 1XO3A 3AE2B 5L83A 3DQVA 3UGBB 4WWPA 5LXIB 1FO4A 3Q14C 4YTMB 1N5XA 1UD7A 3AMZA 3ZTDA 3P4RB 4EZJA 2KHWB 2L00B 2XNAC 3PRZA 2WXNA 1YMHE 3DWMA 1P1AA 3K9OB 1MG4A 2QDFA 1E9MA 4MH8A 1I42A 1E8YA 3L54A 4LTUA 1DYQA 2JY6A 4GIVA 3APFA 2NTTA 2C60A 3QHTA 3J9CA 4HPPA 4EUTA 5BYSA 3QAQA 5G5GA 2DX5B 1JALA 1WGHA 4DQOC 1V6EA 3TEZA 2MCNB 1QOGA 3DPDA 1WR1A 1WYWB 2PVOD 3EFUA 4WJOA 3O13A 4C7ZA 1EF1A 1P7EA 2KJHB 3ZJTA 2Z59B 3QJZA 4LJPB 2MSED 4LJOB 1K50A 4XWTA 4BKSA 4GXBA 2K8CA 5AZGA 3RZWC 1GB4A 4KKIA 2PLPA 5E6NA 4YSYB 2J52A 1TBEA 1T0SC 2RPVA 5EE3A 4AJWA 3DBRB 1R7SA 1V49A 1L2NA 2L1AA 2INCC 1E7PB 2KD0A 3AB5A 1WE7A 4ZRPA 3W5UB 2N0SB 2QJLA 1F0ZA 3ZVVA 2FCNA 3RFZB 2RMMA 1RFAA 4OW0A 3N9YC 4PT5A 5C2TB 4EZLA 1T3QA 2NR2A 2RDBC 1TIFA 4HK2A 1TJEA 4FJZA 2DHZA 1WXVA 4JPSA 4E71A 2WU5B 2KMCA 2M19A 5BYRA 4LDTD 1OQRA 3E56A 4PK1A 2LUMA 1S3SG 4L2YA 5FK9C 4AWJA 4US9A 3MTNB 1WX9A 1GUAB 1WIAA 1GNUA 3B08A 2KO3A 4DXAB 4K3BA 2KWUB 2VRRB 2EMSA 2N9PC 4B6WA 2WQYB 3C19A 1SJED 3DVGY 3W9CB 3QARA 4X57B 4QAYA 3DBRI 4H2AA 2KTRA 2WXPA 3SFEB 1J19A 2GB1A 1RM6C 4FULA 2PKOA 1VRAB 3PZDA 4NAWA 2L52A 2C5LC 1QILA 1WGDA 3BYYB 1ZXIA 1K51A 2QIEB 2BBCA 4E74A 4GN1A 3RZFA 2EKIA 4BFRA 4KZ0A 2ZPNA 4RFBA 1WH3A 4BAXA 2KT7A 2DYOA 2ZW0A 1WX8A 1YQ3B 2PVGC 2AQ2B 1KLUD 2WXLA 2NBUA 2LXCA 2J4XA 5DPTA 2FCSA 2B76B 1YN5A 5KHOA 2WLBA 4JWUC 4J6IA 2KK8A 2WYQA 1KRHA 2Z0EB 3UQAA 2CU3A 3DWGC 3VXWA 3SU8X 2NMQA 3AEGB 1N63A 3BVGA 3RPFC 3RNFC 3TL5A 4M02A 1IPGA 2FE8A 3HM3A 1KLVA 1L5PA 3URYA 2LGDA 5BMHA 4G0NB 2ASQA 3P4SB 1XCQL 3QIJA 3MHSD 2JQRB 1OQYA 1OFFA 2KJRA 4TMAB 3QX1A 3CSTA 2BQQA 3UF8A 1L0YB 4CYEA 2NCNA 2PE9A 5LXHA 4RCOA 2BS3B 4I6PA 1ACCA 4DK5A 4B95A 3L4PA 1F2RI 2LVOA 4ZHPA 4AP4C 3AN1A 4C56C 3B9JA 1WWTA 3TBLD 1SF0A 2N7DA 5EE9A 1JRUA 1IP9A 2JWUA 4C7YA 2W82A 5CTRC 3WAMA 4B0MA 4A20A 3D32A 2ZJDA 4C80A 1I4HA 2WU2B 3R66C 2Y5CA 4BKSD 2K6QA 1R4MB 2G45B 3OWEB 2WHIA 3Q8AA 2FIFA 1L4DB 2BWFA 2CS4A 2MEKA 3ZNID 1QLBB 1FXIA 1QOFA 1TS2A 5TR5A 1ZDXA 2N9XA 2KN5A 2KDEB 1V1PA 4HPLB 2LZ6A 1JWSD 1HTQA 1VR9A 2BF8B 1NENB 1E8XA 2MP2B 3AE9B 1H4RA 2MBOA 1HZ6A 4G50A 4WAFA 1V9JA 4AJYB 1WYGA 1UBQA 2LD9A 3P1MA 2OJRA 4XE0A 3LB8C 2DAFA 3ML9A 4CHKA 4HDQA 2K39A 2MH7A 1AYFA 1EWCA 2L7RA 4OVVA 1EF5A 2RSUA 2IGHA 2W9NA 2KJ6A 2KFJA 2IBIB 2LI5A 4EZKA 2V1YA 1V5TA 2WNMA 3OJ3A 3QK0A 4A8XC 1YD8U 3L17A 5J2RA 1GT8A 4EOYA 2DWQA 4PYUA 2SEBD 2WDQB 1MI0A 2LHEA 2ZZPB 5C23A 1R4MI 4ICUA 4MT5A 4OZAA 1WJNA 1IUEA 1C76A 3Q3OC 1LFDA 1XCTL 2C9WB 4NY0A 1SE4A 4GMVA 1WRDB 1PQSA 1YNTE 3DBLB 4PS3A 4ARIA 3RMKC 4P6VF 4M00A 2GBRA 4HJKA 1V1PB 3AECB 2JU6X 2PPHA 1TS4A 1P3QU 2JX5A 4IDIA 2GRIA 3JYUA 3OJ4B 4YL8A 4LNNA 4IUMB 3MC0B 5C1ZA 2I1KA 4EE2A 5JHAA 3CMMB 5D3IB 1FNVA 2AQ1B 1JWMD 2LRWA 1FCLA 3A1QA 3V3XA 1X1MA 1NDDA 4GDLA 2A4ZA 2L3ZA 2FCMA 5IAAC 2GBJA 1A5RA 2ZPYA 2VH2A 4YTPB 2BKRB 2KLCA 3UIOB 3ZRFA 2JRIB 2WX0A 3ZRCA 3RNEC 2BKFA 1N60A 1JMLA 2NVUI 3JSVA 1B1ZA 4ZRQA 3RT3B 2JUOA 2BVCA 3DBLI 4A90A 4K7WA 2E3TA 1QOAA 3ONSA 3I57A 3X23A 1Q5WB 3VR8B 3Q3MC 4OZCA 3DHGC 1ISNA 2J7QB 4P7IA 2V4LA 4IOIE 4OHJA 1L4ZB 1WGGA 3VTUA 1FRRA 5HKHA 2E6XA 4ANUA 3M3JA 1GG3A 2LVPA 1VLBA 3N1ZC 4LNIA 1Y8RC 4AOFA 1G6JA 3ALBA 3MHZA 2MJDA 4JLCA 5JHBA 4ANXA 3ZIMA 2D3CA 3ML8A 4K7UA 3MC8A 2IO1B 4W9GA 1J7BA 3RD2A 1YN3A 2KNBA 1TGZB 3Q2AC 1YJJA 1XQQA 3L16A 1RFKA 2INPE 2EMTA 2JXXA 3NHEB 1VZ8A 3ZDMC 3X0WA 1C4CA 4DXFA 3SEBA 3B2FA 5J18A 2G4DB 3UI3A 1SSNA 3LJ3A 3AEAB 2BB5A 2CJOA 4GDKB 3NVWA 1F52A 2V9HA 4HRSA 2JT4B 2R61A 4NQLB 4Q2JA 2AQ3B 5DPWA 3ZDTA 3QA8A 4ICVA 5LLIA 4A9AA 3N1XC 2X38A 2LHDA 4CO7A 2KX3A 4MGIE 4JIOU 1GB1A 1RAXA 2KQSA 1C1YB 3P42A 2H89B 2KANA 4KZCA 2XEWA 4KKJA 1SJHD 5BMGA 1VDVA 1JWBD 2O2VB 3BK1A 3DHHC 2BT6A 2WX1A 4RNAA 1WXQA 1RWSA 2KACA 3BWUD 3AE4B 3AE5B 5KHQA 2WP9B 2LWPA 4ZYNA 3MJ5A 2DNFA 3TIXA 3EUB2 2WGSA 2CHZA 5E6OA 3KWVA 2IO3B 3PHWB 2JRHA 1YQBA 3WIMA 1E7VA 2KC1A 2WXIA 2KX0A 3IT6B 4MACA 4HCPB 4TSSA 1L6UA 2XN9C 3I63C 1FNWA 1IBXB 3H9DA 2GBMA 1TZOA 3PRPB 3ETRA 2KLGA 4LNFA 3Q8CA 3AEEB 1OEYJ 1T6BX 1LO5D 1J0GA 2LEKA 4IM3A 4BKTA 3IG3A 2KAJA 4NPNA 4G11A 1E5WA 1HE8A 4BBNC 2LASA 3W5VB 2L05A 1SIFA 1N6ZA 1AW7A 1BUIC 2DZMA 2WXJA 3V6EB 4ITKA 4YSXB 5DCNA 3GE3C 2O6VB 1TT5B 2FIDA 3EECA 3KUCB 3AH7A 1D3ZA 3QCAA 4DHJB 3RCZA 1QZEA 2VZKB 1U4AA 2KZRA 2V3PA 3EFCA 5JXVA 4NNJB 2PTLA 2ZNVB 3PTFC 4XZ4A 3N30A 4JQWC 1DOYA 3R2TA 4ANWA 3H7PB 1KF6B 3GB1A 3TCAA 3V62A 2KMAA 3KLSX 4NJCA 4IWOA 2K6DB 1VZ6A 3C8YA 4A3PA 4GLSC 2WS3B 3MJWA 3VUXA 1MHXA 2PE6B 4BKGA 4ZRJA 3PLUA 2N1VA 2L0TA 3JW0X 1Z5SB 1XT9B 1JCKB 2Q5WD 3PREA 2G1EA 4IWQA 2KKCA 3CF6E 1WGYA 3ZTCA 3RNCC 2LVQA 2MJ3A 1JROA 1CQVA 1HZ5A 3RNAC 3H6NA 2ZCCA 4FADA 4ASWC 4N58A 4TKNA 1YOVB 4HXDA 4PYZA 1C4PA 2DZJA 3DCGA 4MGKE 2LRUA 4WQOB 4MELA 1HQRD 3VDZA 4WURA 3SHQA 2FBWB 4J3OD 5D2MB 3Q3NC 1RRBA 1V86A 4K1RB 3QQ8B 4KGTA 3GS2A 3S2AA 3U7DA 3ECIA 3KWLA 2BYTA 1WMHB 3K9PB 3HIZA 4DDID 1GAQB 1JQ4A 1MHHE 1QT9A 1TYGB 4JGHB 3RNBC 3O65B 2MHJA 3VRBB 1XD3B 1P0RA 3ZNZB 4S17A 1FM0D 3T3OA 2KQ7A 2GMIC 4FBJB 3GZNB 1GJZA 3PHXB 3L08A 3ZGZA 1XLPA 3AE6B 3ZNGC 1XLOA 5JZEB 2AX5A 1FNUA 2LXAA 2O6VD 3WALA 5IP4D 1DOIA 3VVWB 2Y3AA 1K53A 4DHJD 4M0WB 3WAPA 4JL9A 4RGMA 1SE9A 2MP2A 4LLGM 1L0VB 2WDRB 2V3SA 2MBHA 2J0JA 1A70A 2CJNA 3NZ3A 4MGZE 4C00A 3ZLZA 3EHVA 2WXOA 1CMXB 1WZ3A 1GC7A 2V3NA 4RM9A 1I4XA 4FHJA 3IHPC 1FEHA 1LQBA 2KDIA 2C7NB 1J8CA 3N3KB 1P7FA 5H92C 1FIQA 3R8BA 3AEBB 3P63A 3NVYA 4XGAB 1QF6A 5BMIA 1HTOA 3DVGX 1V5OA 2KXJA 2BS2B 3DBHI 4KSLC 1E8WA 5G55A 2HTHA 2DAJA 5D6JB 3GZNI 4W9FA 5G5HA 2OHFA 3V6CB 2LGYA 1PGBA 2ZEQA 1UNSA 4S0RA 1F9JA 2WDTB 2UWQA 2EELA 4L23A 4OZBA 1E7UA 4IG7B 3CWIA 1T5XD 3A4RA 3WCQA 2RDHA 4M8NA 4W9DA 1GOZA 1UGJA 3PSEB 2W3SA 3DVNU 1T0YA 3VAWA 4YSZB 1TS3A 2JF5A 4I6NB 4UDUC 3M63B 2MJEA 4K81A 2I2YA 2WXGA 1WRIA 5FR3A 1R4NB 4WH4A 2K8BA 3NY5A 4MSQB 1SIJA 5HFYA 1UGMA 4P1BC 2BPSA 2QEJC 3FAHA 3Q8FA 1PFDA 3AI5A 4YTNB 3ENEA 2XK5B 1KLGD 1GC6A 1UUPA 4N6EB 2BW2A 5AUKA 1YQ4B 4HVBA 1I4QA 4I6LB 2AL6A 2IGGA 2IGDA 1EWYC 4HEA1 4YXDB 4TUUA 4HKQA 3LDZE 2KOXA 4D2KA 2AEHA 1NYQA 2I1JA 3PVLA 5CX3A 2X8XX 5HG2A 5IKCM 2BYVE 1KJTA 5HHDG 1UF0A 3B2GA 1WJ6A 1WJUA 1UZXB 3VTVA 1FPYA 3AEFB 4KX6B 2BTEA 4C4VB 1YX6B 2PMVA 3ZUNA 1IGCA 4XYCA 2V4IB 4BOZB 2M0AA 1AN8A 3KH0A 1ZUD2 3B1LX 4ANVA 1C77A 3PV1A 2JVCA 1C78A 1R4NI 3PLVA 1B9RA 2UU7A 3NG0A 4RF1A 4HKZE 4TQ0A 2JZPA 4IM2A 2N7EA 3Q6BA 2KQ4X 3ZXRA 4A3OA 4EKUA 4KV2A 3A9KB 1UWXA 1WX7A 2FUG1 2JZZA 5AUIA 4RF0A 3PZ7A 5D3DA 3A9JB 2GLSA 2BGFA 4LNKA 1VD2A 4XDDA 2LGSA 4YT0B 4WAAA 2KVZA 1DGJA 3SFDB 4WQMA 5TSSA 2MQJA 3NUHB 3APDA 4GDKA 3IVFA 3ZNHB 2HJ1A 3Q3FA 3IT4B 4HPMB 2MBEA 4XWWA 1L0XB 4W9HA 4IC7B 3BY4B 4HLEA 4MJSB 4WJNA 3P2BA 1XXGA 3P4QB 1SEBD 1WGRA 4JE3B 4FJVB 1N5WA 4NZLB 1K52A 4RGTA 3FILB 3U2SC 4F7ZA 1OQQA 2L76A 2AL3A 4PS7A 5G2NA 1ENFA 3VRAB 5HI1A 3BIID 2GOWA 1PGAA 2D3GA 3NS1A 4PS8A 3DOWA 3EGRA 3C0RB 2MBQA 2O2VA 2PJHA 2WDVB 1J7CA 1D4BA 2ON8A 4B9KA 2ACZB 1FMAD 2INDC 4MDKE 3TSSA 1SXTA 3PZ8A 3TJPA 1ZPSA 4WWNA 2QC8A 1E0ZA 5GMVA 2WXHA 3V05A 3TEYA 1FXTB 5GXGB 1Q1OA 1WR6E 4NJ6A 3U52E 2BB6A 3AEDB 2IO2B 2IPKD 2J42A 2NTSA 3NS8A 1IBXA 2N9KA 4NAMA 2KYWA 5AZFA 3A33B 1V80A 1SE2A 1KFYB 5E6JA 4P16A 1T0QC 4N9F4 3WANA 1MPEA 4MEMA 2D10A 1WF9A 2REXA 3AXCA 4IW0A 1JWUD 2HD5B 1RYJA 4RH6A 2K3UA 2HTME 1C3TA 2LGXA 3VFKA 2RD0A 1ZOYB 3ZO5B 2FUHB 2O6VA 2GBNA 4FN2A 3AE3B 1FCCC 2JXTA 2N9LA 3PS6A 3LXFA 2C7HA 2K1FA 1FRDA 2D5GA 4KVGB 4LDTB 2WXQA 2NPTA 1Q10A 3AU5A 4FLHA 3T3NA 1ZXHA 3H7PA 1KH0A 2KWVB 1YJIA 4IM0A 4L1BA 4BZAA 4GGQA 2WXRA 4ARCA 3IAS1 5EE0A 3WAOA 3L0WB 1MFWA 1GTHA 2J0MA 3M62B 2L32A 2CHXA 2UYZB 2ZNVC 2KFKB 1L7YA 3W2DA 5AZHA 1I4GA 3VR9B 2CKHB 4HCNB 1WI0A 1MG8A 2IJ0A 1KOTA 3H7SA 2K9XA 5J17A 1WY8A 3PO0A 3OG5A 4II3B 3KUDB 2MBBB 2KTFA 1UBIA 3KUZA 2WXKA 1QKZA 3Q3JA 2M1MA 3NOBA 1F1HA 3T8MA 2YEPB 1NVID 3FKYA 4WWOA 1SGHA 4USAA 1AARA 1Q0WB 4US8A 1ZP0B 2OOBB 2ZVNA 2ONQA 1IGDA 3AM9A 1OTRB 2M0XA 3BVZA 3ZW3A 3Q8BA 2RR9A 2NPTB 3KQ4A 1GPXA 3ZKJC 1WMHA 3APCA 1E10A 1V8CA 1JW9D 3HRDD 5L95C 1XLQA 4AUQC 1PDXA
chains in the Genus database with same CATH topology
4P6VF 4RGNA 1H7WA 1EU4A 2WXOA 1V1PB 3AECB 2JU6X 2V3NA 3BK2A 1I4XA 1WGKA 1QQRA 1TS4A 1JWAD 4AQ7A 2JX5A 4IDIA 1GTEA 2GRIA 1MVKA 2ZW1A 1FEHA 2DLBA 3TUOA 1NI3A 1FFVA 2WXMA 3MC0B 4HROA 1P7FA 1CJEA 3EA6A 5H92C 1FIQA 3R8BA 3AEBB 4JWSC 3P63A 4EE2A 3NVYA 1QF6A 5BMIA 4XDCA 1STEA 2G9HD 1D5MC 5D3IB 3VQIA 1FNVA 2AQ1B 1AWDA 1VJKA 2BS2B 1F2RC 1HXYD 3FC4A 1I4PA 1JWMD 2W54A 1D6EC 1FCLA 2K22A 3P4PB 2HDEA 3V3XA 4M0WA 4ZYSA 4CQNA 4OVZA 4AS1A 5G5HA 3W1SA 2OHFA 1Y56A 5C3JB 1PGBA 4RGOS 1ET6A 2LMCA 1UNSA 1UWMA 3ZQ4A 4YTPB 2EELA 4L23A 4OZBA 3CWIA 1H7XA 1T5XD 4KGSA 1ESFA 1SB3C 4IKGA 2TSSA 1CZPA 3WCQA 2RDHA 2Z8LA 4FXCA 1GOZA 1KTKA 2BS4B 1UGJA 1N60A 1JMLA 1TY2A 2W3SA 2QMTA 4YSZB 1TS3A 1B1ZA 1C9FA 1XO3A 3AE2B 1VZ7A 1PUTA 5EE1A 4ZRQA 1N62A 1TY0A 4UDUC 4A90A 2MJEA 2E3TA 1QOAA 1FO4A 3I57A 4YTMB 2WXGA 3VR8B 1N5XA 1WRIA 5FR3A 2I2YA 2GI9A 3AMZA 4WH4A 3P4RB 4OZCA 1SIJA 1M4VA 3SR6A 3ABVB 2XNAC 1ET9A 5HFYA 1SBBB 2WXNA 1YMHE 3DWMA 4IOIE 4OHJA 1E9MA 2QEJC 3FAHA 4MH8A 3Q8FA 1L4ZB 4LTUA 4REZA 1PFDA 2J53A 4YTNB 1DYQA 2NTTA 3HVDA 1FRRA 3MP9A 2KDMA 2E6XA 3J9CA 1KLGD 3NRZA 5T8IA 1N61A 5BYSA 5G5GA 1UUPA 4N6EB 2BW2A 1VLBA 1JALA 5AUKA 1YQ4B 4DQOC 1I4QA 3MHZA 2MJDA 3TEZA 2IGGA 1TKEA 1QOGA 2DYMA 2PVOD 2IGDA 1EWYC 4HEA1 4YXDB 3O13A 4C7ZA 4HKQA 4D2KA 1P7EA 3ZJTA 1J7BA 1ZE3D 1NYQA 1YN3A 4MM3B 2JYEA 1YJJA 5HG2A 5HHDG 1RFKA 2INPE 2DBYA 2PIAA 2VZKD 1K50A 3B2GA 1QOBA 2IDYA 4XWTA 3BVMA 3NVVA 1GB4A 3AEFB 4KX6B 1VZ8A 3Q69A 2BTEA 2W55A 4KKIA 2PLPA 2PMVA 1C4CA 1IGCA 4YSYB 1XF5L 2J52A 3SEBA 2V4IB 4DXFA 1BMLC 3B2FA 2RPVA 3CIRB 3HUIA 3UI3A 2M0AA 1AN8A 1SSNA 5EE3A 1ZUD2 1R7SA 2KMMA 5H8YE 1C77A 3AEAB 1C78A 2BB5A 5MPOA 2CJOA 3AE1B 4GDKB 2L1AA 3NVWA 3LYYA 1E7PB 1B9RA 4HRSA 3AB5A 2R61A 4ZRPA 4RF1A 3W5UB 4HKZE 4TQ0A 1PYWD 2JZPA 4Q2JA 2AQ3B 2N0SB 2QJLA 1F0ZA 1HA5A 3RFZB 2KQ4X 4NAWB 2RMMA 4OW0A 3N9YC 1UWXA 2FUG1 3ZYYX 4A9AA 2X38A 5C2TB 4PT5A 2LHDA 5AUIA 1T3QA 4N59A 3PZ7A 4RF0A 5D3DA 1I4RA 1TJEA 2M56B 4JPSA 1V97A 1GB1A 2WU5B 4XDDA 3P42A 2M19A 5BYRA 4YT0B 1TKGA 2QILA 1OQRA 4YWGG 3E56A 2H89B 2LUMA 4L2YA 1DGJA 4KKJA 5FK9C 3SFDB 5BYQA 2LFIA 4WQMA 1SJHD 4US9A 5BMGA 1VDVA 1JWBD 5TSSA 3U7ZA 3NUHB 3BK1A 2WQYB 2BT6A 1SJED 4RNAA 1WXQA 1RWSA 2KACA 2QSDA 3AE4B 3AE5B 3BWUD 3W9CB 2WP9B 1D5XC 4WIPA 3IT4B 2K0PA 3MJ5A 4JX1C 5FKAC 2V0GA 4H2AA 2WXPA 1EM7A 3SFEB 3U4EG 2GB1A 4XWWA 1L0XB 1TKYA 1CK1A 3ZJUA 1RM6C 2K5PA 3EUB2 2SAKA 1F77A 2PKOA 1VRAB 1XEEA 2L52A 3IAM1 1XXGA 3P4QB 3KWVA 3TEWA 1QILA 2WXIA 1SEBD 3BYYB 4JE3B 1ZXIA 3IT6B 1K51A 2QIEB 4MACA 2BBCA 2RDGA 1N5WA 4NZLB 4TSSA 1K52A 1L6UA 2XN9C 1FNWA 1IBXB 4RGTA 3FILB 4B0EA 3U2SC 1OQQA 1I7HA 4A55A 2EKIA 1TZOA 3ETRA 1ENFA 3VRAB 1BXTA 4RFBA 3Q8CA 2LJIA 5HI1A 3TEXA 3BIID 1PGAA 3NS1A 3EGRA 3AEEB 3MFGA 1T6BX 2DYOA 2ZW0A 1LO5D 2ICIA 1YQ3B 2WDVB 1J7CA 2PVGC 1D4BA 2AQ2B 2PW9A 2ON8A 1KLUD 2ACZB 1ZDVA 2WXLA 1FMAD 2J4XA 1C4AA 2B76B 2LEKA 1YN5A 2KAJA 2WLBA 3HVZA 4JWUC 3ZJVA 3W5VB 1FD6A 3TSSA 1KRHA 1SXTA 1AW7A 1BUIC 2N7JA 2CU3A 3PZ8A 3DWGC 4WWMA 1ZPSA 1ROEA 2WXJA 1E0ZA 4ITKA 4YSXB 2JSVX 2NMQA 3AEGB 1TS5A 2WXHA 1N63A 3Q8EA 3V05A 3TEYA 1PGXA 3BVGA 5GXGB 3RPFC 3AH7A 3U52E 2BB6A 4R3DA 3AEDB 1EU3A 2KN4A 2IPKD 2FE8A 3I9V1 4ZHOA 3E9SA 2J42A 2NTSA 2VZKB 2WXFA 2V3PA 1IBXA 1L5PA 2N9KA 4NAMA 3FILA 3URYA 5JXVA 2H88B 2PTLA 5BMHA 3P4SB 3H8HA 1J7AA 1XCQL 1FFUA 1DOYA 2JQRB 3R2TA 1SE2A 1FXAA 1OFFA 3R2IA 1KFYB 1KF6B 4TMAB 3GB1A 5E6JA 4P16A 1C79A 1L6VA 1L0YB 3KLSX 4NJCA 2JYTA 1VZ6A 3C8YA 1MPEA 4GLSC 4RCOA 2W3RA 2WS3B 2BS3B 1ACCA 1JWUD 4RH6A 1RYJA 1MHXA 3L4PA 2OEDA 2K3UA 1F2RI 2HTME 4ZHPA 3AN1A 4LK0M 4C56C 3B9JA 1D5ZC 1WWTA 1SF0A 1ZOYB 1JCKB 2INNE 5EE9A 2Q5WD 3BZDB 2JWUA 2G1EA 3AE3B 1FCCC 2JXTA 2N9LA 4C7YA 3LXFA 2W82A 2MJ3A 4B0MA 1JROA 4C80A 1FRDA 2WU2B 1I4HA 1CQVA 2D5GA 1HZ5A 3NVZA 2Y5CA 2WXQA 4A6QA 4N58A 5D7GA 3GP7A 1Q10A 2KWDA 1C4PA 1V1OA 3OWEB 3Q8AA 1L4DB 3T3NA 2MEKA 1ZXHA 5I4DA 1KH0A 1QLBB 1FXIA 1QOFA 1HQRD 1TS2A 1DOXA 1ZDXA 1YJIA 4L1BA 4WURA 2FBWB 1V1PA 4J3OD 2WXRA 1JWSD 1XLNA 4HJGE 4ARCA 1VR9A 3IAS1 5EE0A 2I38A 1NENB 1GTHA 3AE9B 4KGTA 3GS2A 1HZ6A 2L32A 4WAFA 3KWLA 2BYTA 3W2DA 1I4GA 1NYRA 1WYGA 3VR9B 1GAQB 1SE3A 2IJ0A 3P1MA 2K9XA 1JQ4A 5LNK1 1JRPA 1MHHE 1QT9A 4XE0A 3LB8C 3AE7B 1TYGB 3PO0A 4ZOHC 3CF4A 2MH7A 3AV8A 3VRBB 1AYFA 1EWCA 3IXSA 2WXKA 1QKZA 2IGHA 2YEPF 2YEPB 1FM0D 3T3OA 1NVID 2L83A 2Y5PA 2LGIA 1NEKB 4TQ1A 2WNMA 1WSPA 4USAA 3ZGZA 1XLPA 3AE6B 4US8A 4DXGA 1ZP0B 1XLOA 4A8XC 3AE8B 2AX5A 1FNUA 2ONQA 1GT8A 1IGDA 2DWQA 1E6EB 3AM9A 2SEBD 2WDQB 1DOIA 1MI0A 2LHEA 2Y3AA 1K53A 4MT5A 4GDLB 4KGRA 4OZAA 4RGMA 1YN4A 4LLGM 3BYTB 1IUEA 3BVZA 1L0VB 2WDRB 1C76A 3Q8BA 1XCTL 3KQ4A 1GPXA 1HEZE 1SE4A 1E10A 1V8CA 1JW9D 3HRDD 1A70A 1XLQA 1YNTE 2CJNA 3NZ3A 4O1NA 4ARIA 1PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6V F;  2Q5W D;  1H7W A;  3P4Q B;  4YXD B;  4C7Z A;  2G1E A;  3AE3 B;  3AEC B;  1J7B A;  4C7Y A;  1ZXI A;  3LXF A;  1NYQ A;  2QIE B;  1WGK A;  2MJ3 A;  1YJJ A;  1JWA D;  1N5W A;  1RFK A;  1L6U A;  2JX5 A;  1GTE A;  2DBY A;  4IDI A;  1JRO A;  4C80 A;  1FRD A;  2WU2 B;  2PIA A;  3NVZ A;  1OQQ A;  1I7H A;  1QOB A;  3B2G A;  1NI3 A;  1FFV A;  2Y5C A;  2EKI A;  4HRO A;  4N58 A;  3ETR A;  1CJE A;  5H92 C;  3NVV A;  1FIQ A;  3AEF B;  3AEB B;  4KX6 B;  3VRA B;  3P63 A;  4JWS C;  2W55 A;  3NVY A;  1QF6 A;  3BII D;  3NS1 A;  4YSY B;  3AEE B;  3B2F A;  3CIR B;  1QLB B;  1AWD A;  1FXI A;  1QOF A;  3HUI A;  5EE3 A;  1VJK A;  1YJI A;  2BS2 B;  1ZUD 2;  1YQ3 B;  2WDV B;  1J7C A;  1R7S A;  2KMM A;  2W54 A;  2PVG C;  3FC4 A;  5H8Y E;  2FBW B;  3AEA B;  1XLN A;  2ACZ B;  5MPO A;  2CJO A;  1DOX A;  3AE1 B;  1FMA D;  3P4P B;  2K22 A;  3NVW A;  2B76 B;  2LEK A;  1NEN B;  5EE0 A;  1GTH A;  2KAJ A;  1E7P B;  2WLB A;  3AE9 B;  2OHF A;  3HVZ A;  4HRS A;  5G5H A;  4JWU C;  5C3J B;  3AB5 A;  1B9R A;  3W5U B;  3KWL A;  1UWM A;  3W5V B;  4YTP B;  1KRH A;  2N0S B;  2QJL A;  1F0Z A;  1NYR A;  3CWI A;  1WYG A;  2CU3 A;  3DWG C;  4WWM A;  3VR9 B;  1H7X A;  1GAQ B;  1ROE A;  3P1M A;  1E0Z A;  4ITK A;  2K9X A;  1SB3 C;  4YSX B;  1JQ4 A;  1JRP A;  3AEG B;  1QT9 A;  1N63 A;  3LB8 C;  1CZP A;  3AE7 B;  1TYG B;  3PO0 A;  3RPF C;  5GXG B;  4ZOH C;  3WCQ A;  3ZYY X;  3CF4 A;  3AH7 A;  4FXC A;  4A9A A;  2BS4 B;  1N60 A;  5C2T B;  5AUI A;  2MH7 A;  3AV8 A;  3VRB B;  3AED B;  1AYF A;  1T3Q A;  2W3S A;  4N59 A;  4YSZ B;  1XO3 A;  3AE2 B;  4ZHO A;  5EE1 A;  1PUT A;  1TJE A;  1N62 A;  2M56 B;  1FM0 D;  1L5P A;  1V97 A;  2MJE A;  2WU5 B;  1NVI D;  2M19 A;  1QOA A;  4YT0 B;  2L52 A;  1TKG A;  2H88 B;  2L83 A;  2E3T A;  1FO4 A;  1OQR A;  4YTM B;  1NEK B;  2H89 B;  3P4S B;  3VR8 B;  1N5X A;  1WRI A;  1DGJ A;  1J7A A;  4USA A;  1FFU A;  3SFD B;  3AMZ A;  5EE9 A;  2JQR B;  1XLP A;  1DOY A;  3P4R B;  3AE6 B;  1FXA A;  4US8 A;  4WQM A;  4US9 A;  1OFF A;  1ZP0 B;  1SIJ A;  1XLO A;  3AE8 B;  1KFY B;  1KF6 B;  1VDV A;  2AX5 A;  3SR6 A;  3ABV B;  1JWB D;  3DWM A;  1L6V A;  1GT8 A;  2DWQ A;  1E6E B;  3AM9 A;  1E9M A;  2WDQ B;  2WQY B;  1DOI A;  2BT6 A;  3FAH A;  4LTU A;  1WXQ A;  1PFD A;  1RWS A;  3AE4 B;  3AE5 B;  4YTN B;  3W9C B;  2WP9 B;  2W3R A;  2WS3 B;  2BS3 B;  1FRR A;  1IUE A;  1RYJ A;  1L0V B;  2WDR B;  3L4P A;  2HTM E;  3NRZ A;  1N61 A;  4JX1 C;  5G5G A;  4N6E B;  1GPX A;  3SFE B;  4ZHP A;  1VLB A;  1JAL A;  1TKY A;  1YQ4 B;  1V8C A;  5AUK A;  1E10 A;  1JW9 D;  1RM6 C;  2K5P A;  3AN1 A;  3EUB 2;  3HRD D;  1A70 A;  3B9J A;  1WWT A;  1XLQ A;  2MJD A;  1SF0 A;  1ZOY B;  2CJN A;  2PKO A;  1TKE A;  1QOG A;  2PVO D;  1PDX A;  1EWY C; 
#chains in the Genus database with same CATH topology
 4RGN A;  1H7W A;  3CSF A;  1EU4 A;  3UIP B;  4FA6 A;  3PPA A;  4II2 B;  1WGK A;  4MSM B;  1JWA D;  2AWT A;  4AQ7 A;  1GTE A;  2ZW1 A;  2DEN B;  2CR5 A;  2XBB C;  3TUO A;  1FFV A;  3PRM B;  2WXM A;  4LNO A;  4HRO A;  1WFY A;  2M17 A;  1CJE A;  2IZV B;  3NZS A;  1STE A;  3VQI A;  2N9E B;  4ZRI A;  1F2R C;  1HXY D;  1I4P A;  3DBS A;  5IA7 A;  3V61 A;  3T9L A;  1D6E C;  4K3C A;  3N32 A;  3VHT C;  4MM3 A;  2K22 A;  4KDL B;  2HDE A;  4M0W A;  3N20 C;  4EFO A;  4ZYS A;  4CQN A;  3W1S A;  2K8H A;  1EO6 A;  1ET6 A;  3ZQ4 A;  3KYC D;  1H8C A;  4E3C A;  4KGS A;  1ESF A;  4KIK A;  3U8Z A;  1YX5 B;  3UIN B;  2Z8L A;  3VUY A;  4FXC A;  1KTK A;  2BS4 B;  3QWZ B;  1TY2 A;  1OEY A;  4NQK E;  3W1S C;  1C9F A;  2NBW B;  1VZ7 A;  1PUT A;  5EE1 A;  1N62 A;  1TY0 A;  3N1Y C;  3RI7 C;  2KC2 A;  4ZRK A;  1WXM A;  2IY1 B;  2YVC A;  1WJ4 A;  2GI9 A;  2Z0D B;  4DHZ E;  2MRP A;  4K7S A;  1WM2 A;  3KYD D;  1M4V A;  3ZXV A;  3SR6 A;  3ABV B;  1ET9 A;  1SBB B;  4M8M A;  4F1S A;  5CHV C;  2DYB A;  3DDC B;  1M94 A;  4REZ A;  2J53 A;  3KW5 B;  1S1Q B;  4GU2 A;  4MH0 E;  1E8Z A;  3HVD A;  3MP9 A;  2KDM A;  5T8I A;  3DBH B;  3NRZ A;  1N61 A;  1NI2 A;  1P98 A;  2BWE S;  1LGR A;  4HDO A;  1TKE A;  2DYM A;  3SDL C;  4KSK C;  2FCQ A;  1ZE3 D;  4MM3 B;  3R7R A;  2JYE A;  1EUV B;  2N4F A;  2DBY A;  2PIA A;  2L8J A;  2VZK D;  4W9J A;  1QOB A;  2IDY A;  3BVM A;  2L0F A;  3NVV A;  3Q69 A;  2FNJ B;  2W55 A;  5IOI A;  3WA0 A;  3GE8 C;  1P9D U;  1XF5 L;  2PEA A;  4KIK B;  1BML C;  4BOS C;  3CIR B;  2KVR A;  3HUI A;  2HJ8 A;  2KMM A;  5H8Y E;  3SD5 A;  5MPO A;  3AE1 B;  4ACF A;  3LYY A;  2EKE C;  4DHZ B;  3AUL A;  2XK5 A;  1PYW D;  2KTR B;  3EC8 A;  2B3A A;  2MA9 B;  1HA5 A;  1YJ1 A;  4DDG D;  5EDS A;  4NAW B;  3NZU A;  4W9C A;  3ZYY X;  3OLM D;  4N59 A;  5BO4 B;  1I4R A;  4OVU A;  2D11 A;  2M56 B;  1V97 A;  4ZDV A;  1TKG A;  1NBF C;  2QIL A;  4YWG G;  2MLB A;  2DZI A;  4C4V A;  3W1Y A;  5BYQ A;  2LFI A;  3KVF B;  4URK A;  3HM6 X;  2VH1 A;  4RMA A;  3U7Z A;  2QCZ A;  4WJQ A;  1V81 A;  2MX2 A;  1VCB A;  2QSD A;  2JWZ A;  1D5X C;  1OGW A;  4WIP A;  2K0P A;  2Y5B B;  4JX1 C;  4W9I A;  5FKA C;  2V0G A;  3RUL A;  1EM7 A;  3U4E G;  1I35 A;  1WXA A;  1TKY A;  2M4N A;  1CK1 A;  4W9L A;  3ZJU A;  2K5P A;  2SAK A;  1F77 A;  2NS5 A;  4GOC A;  3VUW A;  1XEE A;  3R7Q A;  3IAM 1;  3A9K A;  3TEW A;  5D94 A;  2IY0 B;  2RDG A;  2A5U A;  3A9J A;  2WWZ A;  4B0E A;  4M01 A;  1I7H A;  4A55 A;  1T0R C;  5IN7 A;  1BXT A;  3TEX A;  2LJI A;  3I3T B;  4DBG A;  4G3X B;  2GBK A;  3OAW A;  3VH3 B;  3MFG A;  1WXS A;  3A4S C;  2ICI A;  1WE6 A;  3L13 A;  2PW9 A;  2R2Q A;  3PT2 B;  1ZDV A;  3NJT A;  1C4A A;  4P1C C;  3HVZ A;  3HK0 A;  3ZJV A;  1FD6 A;  4WJP A;  1E90 A;  3PGE A;  2RPQ A;  2N7J A;  3JVZ X;  4WWM A;  1ROE A;  1BT0 A;  3HHM A;  2JSV X;  3Q8E A;  1TS5 A;  4FHK A;  1PGX A;  3H1U A;  4MJS A;  4NJ7 A;  1ZKH A;  4R3D A;  1EU3 A;  2KN4 A;  3I9V 1;  4ZHO A;  3E9S A;  2ZVO A;  2WXF A;  1WM3 A;  1V2Y A;  3FIL A;  2H88 B;  3GOE A;  3H8H A;  2KWC A;  1J7A A;  2CHW A;  1FFU A;  2G4S A;  1UEL A;  1FXA A;  3R2I A;  2G3Q B;  2DZK A;  1TZ1 A;  1C79 A;  1L6V A;  2JYT A;  4GSW A;  2LJ5 A;  2W3R A;  5IO9 A;  3TMP B;  1ZGU B;  2R2O A;  3B0A A;  2IYD B;  2OED A;  3V60 A;  2KDB A;  1LXD A;  2LUE A;  3VTW A;  4LK0 M;  1D5Z C;  3AU4 A;  2INN E;  1WZ0 A;  1IYF A;  3BZD B;  1Z2M A;  2D3A A;  1ZW7 A;  3RN9 C;  3NVZ A;  2MWS B;  5DPS A;  4A6Q A;  4GB9 A;  4XX5 A;  5D7G A;  3GP7 A;  2KWD A;  1V1O A;  2ZCB A;  5I4D A;  1DOX A;  2HE7 A;  3M95 A;  2D07 B;  3R3M A;  1RLF A;  5CHF A;  1XLN A;  4HJG E;  2I38 A;  2J0K A;  2AYO B;  1NYR A;  4RM8 A;  1SE3 A;  3BIN A;  5LNK 1;  2OJW A;  1JRP A;  5CHW A;  1K8R B;  3AE7 B;  4ZOH C;  3CF4 A;  3AV8 A;  3IXS A;  5FR6 A;  2YEP F;  5E6P A;  1YIW A;  4LCD E;  2FAZ A;  2CU1 A;  2L83 A;  2Y5P A;  2LGI A;  1NEK B;  2QHO A;  4TQ1 A;  3VH4 B;  2M8S A;  1WSP A;  2IO0 B;  2NBV B;  3DVN V;  2JPH A;  4DXG A;  3IFW B;  2N1W A;  3AE8 B;  4HWI B;  3QC8 B;  1E6E B;  3A1Q B;  4W9K A;  4EEW A;  1LM8 B;  1UH6 A;  4BVU C;  3UQB A;  4GDL B;  4KGR A;  1YN4 A;  2KDF B;  3BYT B;  3DHI C;  3IBE A;  4DWF A;  1HEZ E;  2KFK A;  4XC2 A;  4O1N A;  4F8C B;  2D3B A;  3JSV B;  3BK2 A;  2K25 A;  1QQR A;  3RYT A;  2YLM A;  4IWP A;  1MVK A;  5AEK B;  2DLB A;  4MGY E;  1NI3 A;  3MC9 A;  5DPR A;  1KM7 A;  3EA6 A;  2BYF A;  4JWS C;  2BYE A;  2D2Q A;  4XDC A;  2G9H D;  1D5M C;  1MJD A;  1AWD A;  1VJK A;  3RNG C;  3RUI B;  3FC4 A;  2W54 A;  2C7M B;  3P4P B;  3U30 A;  4BBN F;  4OVZ A;  4AS1 A;  3I5J C;  1TTN A;  1Y56 A;  2RGF A;  5C3J B;  4RGO S;  2LMC A;  1UWM A;  2JZ3 B;  3L10 B;  1H7X A;  1SB3 C;  4IKG A;  2TSS A;  1CZP A;  2MW5 A;  4W9E A;  4TV3 A;  4FJY A;  5JH5 C;  2QMT A;  4KDI C;  1XO3 A;  3AE2 B;  5L83 A;  3DQV A;  3UGB B;  4WWP A;  5LXI B;  1FO4 A;  3Q14 C;  4YTM B;  1N5X A;  1UD7 A;  3AMZ A;  3ZTD A;  3P4R B;  4EZJ A;  2KHW B;  2L00 B;  2XNA C;  3PRZ A;  2WXN A;  1YMH E;  3DWM A;  1P1A A;  3K9O B;  1MG4 A;  2QDF A;  1E9M A;  4MH8 A;  1I42 A;  1E8Y A;  3L54 A;  4LTU A;  1DYQ A;  2JY6 A;  4GIV A;  3APF A;  2NTT A;  2C60 A;  3QHT A;  3J9C A;  4HPP A;  4EUT A;  5BYS A;  3QAQ A;  5G5G A;  2DX5 B;  1JAL A;  1WGH A;  4DQO C;  1V6E A;  3TEZ A;  2MCN B;  1QOG A;  3DPD A;  1WR1 A;  1WYW B;  2PVO D;  3EFU A;  4WJO A;  3O13 A;  4C7Z A;  1EF1 A;  1P7E A;  2KJH B;  3ZJT A;  2Z59 B;  3QJZ A;  4LJP B;  2MSE D;  4LJO B;  1K50 A;  4XWT A;  4BKS A;  4GXB A;  2K8C A;  5AZG A;  3RZW C;  1GB4 A;  4KKI A;  2PLP A;  5E6N A;  4YSY B;  2J52 A;  1TBE A;  1T0S C;  2RPV A;  5EE3 A;  4AJW A;  3DBR B;  1R7S A;  1V49 A;  1L2N A;  2L1A A;  2INC C;  1E7P B;  2KD0 A;  3AB5 A;  1WE7 A;  4ZRP A;  3W5U B;  2N0S B;  2QJL A;  1F0Z A;  3ZVV A;  2FCN A;  3RFZ B;  2RMM A;  1RFA A;  4OW0 A;  3N9Y C;  4PT5 A;  5C2T B;  4EZL A;  1T3Q A;  2NR2 A;  2RDB C;  1TIF A;  4HK2 A;  1TJE A;  4FJZ A;  2DHZ A;  1WXV A;  4JPS A;  4E71 A;  2WU5 B;  2KMC A;  2M19 A;  5BYR A;  4LDT D;  1OQR A;  3E56 A;  4PK1 A;  2LUM A;  1S3S G;  4L2Y A;  5FK9 C;  4AWJ A;  4US9 A;  3MTN B;  1WX9 A;  1GUA B;  1WIA A;  1GNU A;  3B08 A;  2KO3 A;  4DXA B;  4K3B A;  2KWU B;  2VRR B;  2EMS A;  2N9P C;  4B6W A;  2WQY B;  3C19 A;  1SJE D;  3DVG Y;  3W9C B;  3QAR A;  4X57 B;  4QAY A;  3DBR I;  4H2A A;  2KTR A;  2WXP A;  3SFE B;  1J19 A;  2GB1 A;  1RM6 C;  4FUL A;  2PKO A;  1VRA B;  3PZD A;  4NAW A;  2L52 A;  2C5L C;  1QIL A;  1WGD A;  3BYY B;  1ZXI A;  1K51 A;  2QIE B;  2BBC A;  4E74 A;  4GN1 A;  3RZF A;  2EKI A;  4BFR A;  4KZ0 A;  2ZPN A;  4RFB A;  1WH3 A;  4BAX A;  2KT7 A;  2DYO A;  2ZW0 A;  1WX8 A;  1YQ3 B;  2PVG C;  2AQ2 B;  1KLU D;  2WXL A;  2NBU A;  2LXC A;  2J4X A;  5DPT A;  2FCS A;  2B76 B;  1YN5 A;  5KHO A;  2WLB A;  4JWU C;  4J6I A;  2KK8 A;  2WYQ A;  1KRH A;  2Z0E B;  3UQA A;  2CU3 A;  3DWG C;  3VXW A;  3SU8 X;  2NMQ A;  3AEG B;  1N63 A;  3BVG A;  3RPF C;  3RNF C;  3TL5 A;  4M02 A;  1IPG A;  2FE8 A;  3HM3 A;  1KLV A;  1L5P A;  3URY A;  2LGD A;  5BMH A;  4G0N B;  2ASQ A;  3P4S B;  1XCQ L;  3QIJ A;  3MHS D;  2JQR B;  1OQY A;  1OFF A;  2KJR A;  4TMA B;  3QX1 A;  3CST A;  2BQQ A;  3UF8 A;  1L0Y B;  4CYE A;  2NCN A;  2PE9 A;  5LXH A;  4RCO A;  2BS3 B;  4I6P A;  1ACC A;  4DK5 A;  4B95 A;  3L4P A;  1F2R I;  2LVO A;  4ZHP A;  4AP4 C;  3AN1 A;  4C56 C;  3B9J A;  1WWT A;  3TBL D;  1SF0 A;  2N7D A;  5EE9 A;  1JRU A;  1IP9 A;  2JWU A;  4C7Y A;  2W82 A;  5CTR C;  3WAM A;  4B0M A;  4A20 A;  3D32 A;  2ZJD A;  4C80 A;  1I4H A;  2WU2 B;  3R66 C;  2Y5C A;  4BKS D;  2K6Q A;  1R4M B;  2G45 B;  3OWE B;  2WHI A;  3Q8A A;  2FIF A;  1L4D B;  2BWF A;  2CS4 A;  2MEK A;  3ZNI D;  1QLB B;  1FXI A;  1QOF A;  1TS2 A;  5TR5 A;  1ZDX A;  2N9X A;  2KN5 A;  2KDE B;  1V1P A;  4HPL B;  2LZ6 A;  1JWS D;  1HTQ A;  1VR9 A;  2BF8 B;  1NEN B;  1E8X A;  2MP2 B;  3AE9 B;  1H4R A;  2MBO A;  1HZ6 A;  4G50 A;  4WAF A;  1V9J A;  4AJY B;  1WYG A;  1UBQ A;  2LD9 A;  3P1M A;  2OJR A;  4XE0 A;  3LB8 C;  2DAF A;  3ML9 A;  4CHK A;  4HDQ A;  2K39 A;  2MH7 A;  1AYF A;  1EWC A;  2L7R A;  4OVV A;  1EF5 A;  2RSU A;  2IGH A;  2W9N A;  2KJ6 A;  2KFJ A;  2IBI B;  2LI5 A;  4EZK A;  2V1Y A;  1V5T A;  2WNM A;  3OJ3 A;  3QK0 A;  4A8X C;  1YD8 U;  3L17 A;  5J2R A;  1GT8 A;  4EOY A;  2DWQ A;  4PYU A;  2SEB D;  2WDQ B;  1MI0 A;  2LHE A;  2ZZP B;  5C23 A;  1R4M I;  4ICU A;  4MT5 A;  4OZA A;  1WJN A;  1IUE A;  1C76 A;  3Q3O C;  1LFD A;  1XCT L;  2C9W B;  4NY0 A;  1SE4 A;  4GMV A;  1WRD B;  1PQS A;  1YNT E;  3DBL B;  4PS3 A;  4ARI A;  3RMK C;  4P6V F;  4M00 A;  2GBR A;  4HJK A;  1V1P B;  3AEC B;  2JU6 X;  2PPH A;  1TS4 A;  1P3Q U;  2JX5 A;  4IDI A;  2GRI A;  3JYU A;  3OJ4 B;  4YL8 A;  4LNN A;  4IUM B;  3MC0 B;  5C1Z A;  2I1K A;  4EE2 A;  5JHA A;  3CMM B;  5D3I B;  1FNV A;  2AQ1 B;  1JWM D;  2LRW A;  1FCL A;  3A1Q A;  3V3X A;  1X1M A;  1NDD A;  4GDL A;  2A4Z A;  2L3Z A;  2FCM A;  5IAA C;  2GBJ A;  1A5R A;  2ZPY A;  2VH2 A;  4YTP B;  2BKR B;  2KLC A;  3UIO B;  3ZRF A;  2JRI B;  2WX0 A;  3ZRC A;  3RNE C;  2BKF A;  1N60 A;  1JML A;  2NVU I;  3JSV A;  1B1Z A;  4ZRQ A;  3RT3 B;  2JUO A;  2BVC A;  3DBL I;  4A90 A;  4K7W A;  2E3T A;  1QOA A;  3ONS A;  3I57 A;  3X23 A;  1Q5W B;  3VR8 B;  3Q3M C;  4OZC A;  3DHG C;  1ISN A;  2J7Q B;  4P7I A;  2V4L A;  4IOI E;  4OHJ A;  1L4Z B;  1WGG A;  3VTU A;  1FRR A;  5HKH A;  2E6X A;  4ANU A;  3M3J A;  1GG3 A;  2LVP A;  1VLB A;  3N1Z C;  4LNI A;  1Y8R C;  4AOF A;  1G6J A;  3ALB A;  3MHZ A;  2MJD A;  4JLC A;  5JHB A;  4ANX A;  3ZIM A;  2D3C A;  3ML8 A;  4K7U A;  3MC8 A;  2IO1 B;  4W9G A;  1J7B A;  3RD2 A;  1YN3 A;  2KNB A;  1TGZ B;  3Q2A C;  1YJJ A;  1XQQ A;  3L16 A;  1RFK A;  2INP E;  2EMT A;  2JXX A;  3NHE B;  1VZ8 A;  3ZDM C;  3X0W A;  1C4C A;  4DXF A;  3SEB A;  3B2F A;  5J18 A;  2G4D B;  3UI3 A;  1SSN A;  3LJ3 A;  3AEA B;  2BB5 A;  2CJO A;  4GDK B;  3NVW A;  1F52 A;  2V9H A;  4HRS A;  2JT4 B;  2R61 A;  4NQL B;  4Q2J A;  2AQ3 B;  5DPW A;  3ZDT A;  3QA8 A;  4ICV A;  5LLI A;  4A9A A;  3N1X C;  2X38 A;  2LHD A;  4CO7 A;  2KX3 A;  4MGI E;  4JIO U;  1GB1 A;  1RAX A;  2KQS A;  1C1Y B;  3P42 A;  2H89 B;  2KAN A;  4KZC A;  2XEW A;  4KKJ A;  1SJH D;  5BMG A;  1VDV A;  1JWB D;  2O2V B;  3BK1 A;  3DHH C;  2BT6 A;  2WX1 A;  4RNA A;  1WXQ A;  1RWS A;  2KAC A;  3BWU D;  3AE4 B;  3AE5 B;  5KHQ A;  2WP9 B;  2LWP A;  4ZYN A;  3MJ5 A;  2DNF A;  3TIX A;  3EUB 2;  2WGS A;  2CHZ A;  5E6O A;  3KWV A;  2IO3 B;  3PHW B;  2JRH A;  1YQB A;  3WIM A;  1E7V A;  2KC1 A;  2WXI A;  2KX0 A;  3IT6 B;  4MAC A;  4HCP B;  4TSS A;  1L6U A;  2XN9 C;  3I63 C;  1FNW A;  1IBX B;  3H9D A;  2GBM A;  1TZO A;  3PRP B;  3ETR A;  2KLG A;  4LNF A;  3Q8C A;  3AEE B;  1OEY J;  1T6B X;  1LO5 D;  1J0G A;  2LEK A;  4IM3 A;  4BKT A;  3IG3 A;  2KAJ A;  4NPN A;  4G11 A;  1E5W A;  1HE8 A;  4BBN C;  2LAS A;  3W5V B;  2L05 A;  1SIF A;  1N6Z A;  1AW7 A;  1BUI C;  2DZM A;  2WXJ A;  3V6E B;  4ITK A;  4YSX B;  5DCN A;  3GE3 C;  2O6V B;  1TT5 B;  2FID A;  3EEC A;  3KUC B;  3AH7 A;  1D3Z A;  3QCA A;  4DHJ B;  3RCZ A;  1QZE A;  2VZK B;  1U4A A;  2KZR A;  2V3P A;  3EFC A;  5JXV A;  4NNJ B;  2PTL A;  2ZNV B;  3PTF C;  4XZ4 A;  3N30 A;  4JQW C;  1DOY A;  3R2T A;  4ANW A;  3H7P B;  1KF6 B;  3GB1 A;  3TCA A;  3V62 A;  2KMA A;  3KLS X;  4NJC A;  4IWO A;  2K6D B;  1VZ6 A;  3C8Y A;  4A3P A;  4GLS C;  2WS3 B;  3MJW A;  3VUX A;  1MHX A;  2PE6 B;  4BKG A;  4ZRJ A;  3PLU A;  2N1V A;  2L0T A;  3JW0 X;  1Z5S B;  1XT9 B;  1JCK B;  2Q5W D;  3PRE A;  2G1E A;  4IWQ A;  2KKC A;  3CF6 E;  1WGY A;  3ZTC A;  3RNC C;  2LVQ A;  2MJ3 A;  1JRO A;  1CQV A;  1HZ5 A;  3RNA C;  3H6N A;  2ZCC A;  4FAD A;  4ASW C;  4N58 A;  4TKN A;  1YOV B;  4HXD A;  4PYZ A;  1C4P A;  2DZJ A;  3DCG A;  4MGK E;  2LRU A;  4WQO B;  4MEL A;  1HQR D;  3VDZ A;  4WUR A;  3SHQ A;  2FBW B;  4J3O D;  5D2M B;  3Q3N C;  1RRB A;  1V86 A;  4K1R B;  3QQ8 B;  4KGT A;  3GS2 A;  3S2A A;  3U7D A;  3ECI A;  3KWL A;  2BYT A;  1WMH B;  3K9P B;  3HIZ A;  4DDI D;  1GAQ B;  1JQ4 A;  1MHH E;  1QT9 A;  1TYG B;  4JGH B;  3RNB C;  3O65 B;  2MHJ A;  3VRB B;  1XD3 B;  1P0R A;  3ZNZ B;  4S17 A;  1FM0 D;  3T3O A;  2KQ7 A;  2GMI C;  4FBJ B;  3GZN B;  1GJZ A;  3PHX B;  3L08 A;  3ZGZ A;  1XLP A;  3AE6 B;  3ZNG C;  1XLO A;  5JZE B;  2AX5 A;  1FNU A;  2LXA A;  2O6V D;  3WAL A;  5IP4 D;  1DOI A;  3VVW B;  2Y3A A;  1K53 A;  4DHJ D;  4M0W B;  3WAP A;  4JL9 A;  4RGM A;  1SE9 A;  2MP2 A;  4LLG M;  1L0V B;  2WDR B;  2V3S A;  2MBH A;  2J0J A;  1A70 A;  2CJN A;  3NZ3 A;  4MGZ E;  4C00 A;  3ZLZ A;  3EHV A;  2WXO A;  1CMX B;  1WZ3 A;  1GC7 A;  2V3N A;  4RM9 A;  1I4X A;  4FHJ A;  3IHP C;  1FEH A;  1LQB A;  2KDI A;  2C7N B;  1J8C A;  3N3K B;  1P7F A;  5H92 C;  1FIQ A;  3R8B A;  3AEB B;  3P63 A;  3NVY A;  4XGA B;  1QF6 A;  5BMI A;  1HTO A;  3DVG X;  1V5O A;  2KXJ A;  2BS2 B;  3DBH I;  4KSL C;  1E8W A;  5G55 A;  2HTH A;  2DAJ A;  5D6J B;  3GZN I;  4W9F A;  5G5H A;  2OHF A;  3V6C B;  2LGY A;  1PGB A;  2ZEQ A;  1UNS A;  4S0R A;  1F9J A;  2WDT B;  2UWQ A;  2EEL A;  4L23 A;  4OZB A;  1E7U A;  4IG7 B;  3CWI A;  1T5X D;  3A4R A;  3WCQ A;  2RDH A;  4M8N A;  4W9D A;  1GOZ A;  1UGJ A;  3PSE B;  2W3S A;  3DVN U;  1T0Y A;  3VAW A;  4YSZ B;  1TS3 A;  2JF5 A;  4I6N B;  4UDU C;  3M63 B;  2MJE A;  4K81 A;  2I2Y A;  2WXG A;  1WRI A;  5FR3 A;  1R4N B;  4WH4 A;  2K8B A;  3NY5 A;  4MSQ B;  1SIJ A;  5HFY A;  1UGM A;  4P1B C;  2BPS A;  2QEJ C;  3FAH A;  3Q8F A;  1PFD A;  3AI5 A;  4YTN B;  3ENE A;  2XK5 B;  1KLG D;  1GC6 A;  1UUP A;  4N6E B;  2BW2 A;  5AUK A;  1YQ4 B;  4HVB A;  1I4Q A;  4I6L B;  2AL6 A;  2IGG A;  2IGD A;  1EWY C;  4HEA 1;  4YXD B;  4TUU A;  4HKQ A;  3LDZ E;  2KOX A;  4D2K A;  2AEH A;  1NYQ A;  2I1J A;  3PVL A;  5CX3 A;  2X8X X;  5HG2 A;  5IKC M;  2BYV E;  1KJT A;  5HHD G;  1UF0 A;  3B2G A;  1WJ6 A;  1WJU A;  1UZX B;  3VTV A;  1FPY A;  3AEF B;  4KX6 B;  2BTE A;  4C4V B;  1YX6 B;  2PMV A;  3ZUN A;  1IGC A;  4XYC A;  2V4I B;  4BOZ B;  2M0A A;  1AN8 A;  3KH0 A;  1ZUD 2;  3B1L X;  4ANV A;  1C77 A;  3PV1 A;  2JVC A;  1C78 A;  1R4N I;  3PLV A;  1B9R A;  2UU7 A;  3NG0 A;  4RF1 A;  4HKZ E;  4TQ0 A;  2JZP A;  4IM2 A;  2N7E A;  3Q6B A;  2KQ4 X;  3ZXR A;  4A3O A;  4EKU A;  4KV2 A;  3A9K B;  1UWX A;  1WX7 A;  2FUG 1;  2JZZ A;  5AUI A;  4RF0 A;  3PZ7 A;  5D3D A;  3A9J B;  2GLS A;  2BGF A;  4LNK A;  1VD2 A;  4XDD A;  2LGS A;  4YT0 B;  4WAA A;  2KVZ A;  1DGJ A;  3SFD B;  4WQM A;  5TSS A;  2MQJ A;  3NUH B;  3APD A;  4GDK A;  3IVF A;  3ZNH B;  2HJ1 A;  3Q3F A;  3IT4 B;  4HPM B;  2MBE A;  4XWW A;  1L0X B;  4W9H A;  4IC7 B;  3BY4 B;  4HLE A;  4MJS B;  4WJN A;  3P2B A;  1XXG A;  3P4Q B;  1SEB D;  1WGR A;  4JE3 B;  4FJV B;  1N5W A;  4NZL B;  1K52 A;  4RGT A;  3FIL B;  3U2S C;  4F7Z A;  1OQQ A;  2L76 A;  2AL3 A;  4PS7 A;  5G2N A;  1ENF A;  3VRA B;  5HI1 A;  3BII D;  2GOW A;  1PGA A;  2D3G A;  3NS1 A;  4PS8 A;  3DOW A;  3EGR A;  3C0R B;  2MBQ A;  2O2V A;  2PJH A;  2WDV B;  1J7C A;  1D4B A;  2ON8 A;  4B9K A;  2ACZ B;  1FMA D;  2IND C;  4MDK E;  3TSS A;  1SXT A;  3PZ8 A;  3TJP A;  1ZPS A;  4WWN A;  2QC8 A;  1E0Z A;  5GMV A;  2WXH A;  3V05 A;  3TEY A;  1FXT B;  5GXG B;  1Q1O A;  1WR6 E;  4NJ6 A;  3U52 E;  2BB6 A;  3AED B;  2IO2 B;  2IPK D;  2J42 A;  2NTS A;  3NS8 A;  1IBX A;  2N9K A;  4NAM A;  2KYW A;  5AZF A;  3A33 B;  1V80 A;  1SE2 A;  1KFY B;  5E6J A;  4P16 A;  1T0Q C;  4N9F 4;  3WAN A;  1MPE A;  4MEM A;  2D10 A;  1WF9 A;  2REX A;  3AXC A;  4IW0 A;  1JWU D;  2HD5 B;  1RYJ A;  4RH6 A;  2K3U A;  2HTM E;  1C3T A;  2LGX A;  3VFK A;  2RD0 A;  1ZOY B;  3ZO5 B;  2FUH B;  2O6V A;  2GBN A;  4FN2 A;  3AE3 B;  1FCC C;  2JXT A;  2N9L A;  3PS6 A;  3LXF A;  2C7H A;  2K1F A;  1FRD A;  2D5G A;  4KVG B;  4LDT B;  2WXQ A;  2NPT A;  1Q10 A;  3AU5 A;  4FLH A;  3T3N A;  1ZXH A;  3H7P A;  1KH0 A;  2KWV B;  1YJI A;  4IM0 A;  4L1B A;  4BZA A;  4GGQ A;  2WXR A;  4ARC A;  3IAS 1;  5EE0 A;  3WAO A;  3L0W B;  1MFW A;  1GTH A;  2J0M A;  3M62 B;  2L32 A;  2CHX A;  2UYZ B;  2ZNV C;  2KFK B;  1L7Y A;  3W2D A;  5AZH A;  1I4G A;  3VR9 B;  2CKH B;  4HCN B;  1WI0 A;  1MG8 A;  2IJ0 A;  1KOT A;  3H7S A;  2K9X A;  5J17 A;  1WY8 A;  3PO0 A;  3OG5 A;  4II3 B;  3KUD B;  2MBB B;  2KTF A;  1UBI A;  3KUZ A;  2WXK A;  1QKZ A;  3Q3J A;  2M1M A;  3NOB A;  1F1H A;  3T8M A;  2YEP B;  1NVI D;  3FKY A;  4WWO A;  1SGH A;  4USA A;  1AAR A;  1Q0W B;  4US8 A;  1ZP0 B;  2OOB B;  2ZVN A;  2ONQ A;  1IGD A;  3AM9 A;  1OTR B;  2M0X A;  3BVZ A;  3ZW3 A;  3Q8B A;  2RR9 A;  2NPT B;  3KQ4 A;  1GPX A;  3ZKJ C;  1WMH A;  3APC A;  1E10 A;  1V8C A;  1JW9 D;  3HRD D;  5L95 C;  1XLQ A;  4AUQ C;  1PDX A; 
#chains in the Genus database with same CATH homology
 4P6V F;  4RGN A;  1H7W A;  1EU4 A;  2WXO A;  1V1P B;  3AEC B;  2JU6 X;  2V3N A;  3BK2 A;  1I4X A;  1WGK A;  1QQR A;  1TS4 A;  1JWA D;  4AQ7 A;  2JX5 A;  4IDI A;  1GTE A;  2GRI A;  1MVK A;  2ZW1 A;  1FEH A;  2DLB A;  3TUO A;  1NI3 A;  1FFV A;  2WXM A;  3MC0 B;  4HRO A;  1P7F A;  1CJE A;  3EA6 A;  5H92 C;  1FIQ A;  3R8B A;  3AEB B;  4JWS C;  3P63 A;  4EE2 A;  3NVY A;  1QF6 A;  5BMI A;  4XDC A;  1STE A;  2G9H D;  1D5M C;  5D3I B;  3VQI A;  1FNV A;  2AQ1 B;  1AWD A;  1VJK A;  2BS2 B;  1F2R C;  1HXY D;  3FC4 A;  1I4P A;  1JWM D;  2W54 A;  1D6E C;  1FCL A;  2K22 A;  3P4P B;  2HDE A;  3V3X A;  4M0W A;  4ZYS A;  4CQN A;  4OVZ A;  4AS1 A;  5G5H A;  3W1S A;  2OHF A;  1Y56 A;  5C3J B;  1PGB A;  4RGO S;  1ET6 A;  2LMC A;  1UNS A;  1UWM A;  3ZQ4 A;  4YTP B;  2EEL A;  4L23 A;  4OZB A;  3CWI A;  1H7X A;  1T5X D;  4KGS A;  1ESF A;  1SB3 C;  4IKG A;  2TSS A;  1CZP A;  3WCQ A;  2RDH A;  2Z8L A;  4FXC A;  1GOZ A;  1KTK A;  2BS4 B;  1UGJ A;  1N60 A;  1JML A;  1TY2 A;  2W3S A;  2QMT A;  4YSZ B;  1TS3 A;  1B1Z A;  1C9F A;  1XO3 A;  3AE2 B;  1VZ7 A;  1PUT A;  5EE1 A;  4ZRQ A;  1N62 A;  1TY0 A;  4UDU C;  4A90 A;  2MJE A;  2E3T A;  1QOA A;  1FO4 A;  3I57 A;  4YTM B;  2WXG A;  3VR8 B;  1N5X A;  1WRI A;  5FR3 A;  2I2Y A;  2GI9 A;  3AMZ A;  4WH4 A;  3P4R B;  4OZC A;  1SIJ A;  1M4V A;  3SR6 A;  3ABV B;  2XNA C;  1ET9 A;  5HFY A;  1SBB B;  2WXN A;  1YMH E;  3DWM A;  4IOI E;  4OHJ A;  1E9M A;  2QEJ C;  3FAH A;  4MH8 A;  3Q8F A;  1L4Z B;  4LTU A;  4REZ A;  1PFD A;  2J53 A;  4YTN B;  1DYQ A;  2NTT A;  3HVD A;  1FRR A;  3MP9 A;  2KDM A;  2E6X A;  3J9C A;  1KLG D;  3NRZ A;  5T8I A;  1N61 A;  5BYS A;  5G5G A;  1UUP A;  4N6E B;  2BW2 A;  1VLB A;  1JAL A;  5AUK A;  1YQ4 B;  4DQO C;  1I4Q A;  3MHZ A;  2MJD A;  3TEZ A;  2IGG A;  1TKE A;  1QOG A;  2DYM A;  2PVO D;  2IGD A;  1EWY C;  4HEA 1;  4YXD B;  3O13 A;  4C7Z A;  4HKQ A;  4D2K A;  1P7E A;  3ZJT A;  1J7B A;  1ZE3 D;  1NYQ A;  1YN3 A;  4MM3 B;  2JYE A;  1YJJ A;  5HG2 A;  5HHD G;  1RFK A;  2INP E;  2DBY A;  2PIA A;  2VZK D;  1K50 A;  3B2G A;  1QOB A;  2IDY A;  4XWT A;  3BVM A;  3NVV A;  1GB4 A;  3AEF B;  4KX6 B;  1VZ8 A;  3Q69 A;  2BTE A;  2W55 A;  4KKI A;  2PLP A;  2PMV A;  1C4C A;  1IGC A;  4YSY B;  1XF5 L;  2J52 A;  3SEB A;  2V4I B;  4DXF A;  1BML C;  3B2F A;  2RPV A;  3CIR B;  3HUI A;  3UI3 A;  2M0A A;  1AN8 A;  1SSN A;  5EE3 A;  1ZUD 2;  1R7S A;  2KMM A;  5H8Y E;  1C77 A;  3AEA B;  1C78 A;  2BB5 A;  5MPO A;  2CJO A;  3AE1 B;  4GDK B;  2L1A A;  3NVW A;  3LYY A;  1E7P B;  1B9R A;  4HRS A;  3AB5 A;  2R61 A;  4ZRP A;  4RF1 A;  3W5U B;  4HKZ E;  4TQ0 A;  1PYW D;  2JZP A;  4Q2J A;  2AQ3 B;  2N0S B;  2QJL A;  1F0Z A;  1HA5 A;  3RFZ B;  2KQ4 X;  4NAW B;  2RMM A;  4OW0 A;  3N9Y C;  1UWX A;  2FUG 1;  3ZYY X;  4A9A A;  2X38 A;  5C2T B;  4PT5 A;  2LHD A;  5AUI A;  1T3Q A;  4N59 A;  3PZ7 A;  4RF0 A;  5D3D A;  1I4R A;  1TJE A;  2M56 B;  4JPS A;  1V97 A;  1GB1 A;  2WU5 B;  4XDD A;  3P42 A;  2M19 A;  5BYR A;  4YT0 B;  1TKG A;  2QIL A;  1OQR A;  4YWG G;  3E56 A;  2H89 B;  2LUM A;  4L2Y A;  1DGJ A;  4KKJ A;  5FK9 C;  3SFD B;  5BYQ A;  2LFI A;  4WQM A;  1SJH D;  4US9 A;  5BMG A;  1VDV A;  1JWB D;  5TSS A;  3U7Z A;  3NUH B;  3BK1 A;  2WQY B;  2BT6 A;  1SJE D;  4RNA A;  1WXQ A;  1RWS A;  2KAC A;  2QSD A;  3AE4 B;  3AE5 B;  3BWU D;  3W9C B;  2WP9 B;  1D5X C;  4WIP A;  3IT4 B;  2K0P A;  3MJ5 A;  4JX1 C;  5FKA C;  2V0G A;  4H2A A;  2WXP A;  1EM7 A;  3SFE B;  3U4E G;  2GB1 A;  4XWW A;  1L0X B;  1TKY A;  1CK1 A;  3ZJU A;  1RM6 C;  2K5P A;  3EUB 2;  2SAK A;  1F77 A;  2PKO A;  1VRA B;  1XEE A;  2L52 A;  3IAM 1;  1XXG A;  3P4Q B;  3KWV A;  3TEW A;  1QIL A;  2WXI A;  1SEB D;  3BYY B;  4JE3 B;  1ZXI A;  3IT6 B;  1K51 A;  2QIE B;  4MAC A;  2BBC A;  2RDG A;  1N5W A;  4NZL B;  4TSS A;  1K52 A;  1L6U A;  2XN9 C;  1FNW A;  1IBX B;  4RGT A;  3FIL B;  4B0E A;  3U2S C;  1OQQ A;  1I7H A;  4A55 A;  2EKI A;  1TZO A;  3ETR A;  1ENF A;  3VRA B;  1BXT A;  4RFB A;  3Q8C A;  2LJI A;  5HI1 A;  3TEX A;  3BII D;  1PGA A;  3NS1 A;  3EGR A;  3AEE B;  3MFG A;  1T6B X;  2DYO A;  2ZW0 A;  1LO5 D;  2ICI A;  1YQ3 B;  2WDV B;  1J7C A;  2PVG C;  1D4B A;  2AQ2 B;  2PW9 A;  2ON8 A;  1KLU D;  2ACZ B;  1ZDV A;  2WXL A;  1FMA D;  2J4X A;  1C4A A;  2B76 B;  2LEK A;  1YN5 A;  2KAJ A;  2WLB A;  3HVZ A;  4JWU C;  3ZJV A;  3W5V B;  1FD6 A;  3TSS A;  1KRH A;  1SXT A;  1AW7 A;  1BUI C;  2N7J A;  2CU3 A;  3PZ8 A;  3DWG C;  4WWM A;  1ZPS A;  1ROE A;  2WXJ A;  1E0Z A;  4ITK A;  4YSX B;  2JSV X;  2NMQ A;  3AEG B;  1TS5 A;  2WXH A;  1N63 A;  3Q8E A;  3V05 A;  3TEY A;  1PGX A;  3BVG A;  5GXG B;  3RPF C;  3AH7 A;  3U52 E;  2BB6 A;  4R3D A;  3AED B;  1EU3 A;  2KN4 A;  2IPK D;  2FE8 A;  3I9V 1;  4ZHO A;  3E9S A;  2J42 A;  2NTS A;  2VZK B;  2WXF A;  2V3P A;  1IBX A;  1L5P A;  2N9K A;  4NAM A;  3FIL A;  3URY A;  5JXV A;  2H88 B;  2PTL A;  5BMH A;  3P4S B;  3H8H A;  1J7A A;  1XCQ L;  1FFU A;  1DOY A;  2JQR B;  3R2T A;  1SE2 A;  1FXA A;  1OFF A;  3R2I A;  1KFY B;  1KF6 B;  4TMA B;  3GB1 A;  5E6J A;  4P16 A;  1C79 A;  1L6V A;  1L0Y B;  3KLS X;  4NJC A;  2JYT A;  1VZ6 A;  3C8Y A;  1MPE A;  4GLS C;  4RCO A;  2W3R A;  2WS3 B;  2BS3 B;  1ACC A;  1JWU D;  4RH6 A;  1RYJ A;  1MHX A;  3L4P A;  2OED A;  2K3U A;  1F2R I;  2HTM E;  4ZHP A;  3AN1 A;  4LK0 M;  4C56 C;  3B9J A;  1D5Z C;  1WWT A;  1SF0 A;  1ZOY B;  1JCK B;  2INN E;  5EE9 A;  2Q5W D;  3BZD B;  2JWU A;  2G1E A;  3AE3 B;  1FCC C;  2JXT A;  2N9L A;  4C7Y A;  3LXF A;  2W82 A;  2MJ3 A;  4B0M A;  1JRO A;  4C80 A;  1FRD A;  2WU2 B;  1I4H A;  1CQV A;  2D5G A;  1HZ5 A;  3NVZ A;  2Y5C A;  2WXQ A;  4A6Q A;  4N58 A;  5D7G A;  3GP7 A;  1Q10 A;  2KWD A;  1C4P A;  1V1O A;  3OWE B;  3Q8A A;  1L4D B;  3T3N A;  2MEK A;  1ZXH A;  5I4D A;  1KH0 A;  1QLB B;  1FXI A;  1QOF A;  1HQR D;  1TS2 A;  1DOX A;  1ZDX A;  1YJI A;  4L1B A;  4WUR A;  2FBW B;  1V1P A;  4J3O D;  2WXR A;  1JWS D;  1XLN A;  4HJG E;  4ARC A;  1VR9 A;  3IAS 1;  5EE0 A;  2I38 A;  1NEN B;  1GTH A;  3AE9 B;  4KGT A;  3GS2 A;  1HZ6 A;  2L32 A;  4WAF A;  3KWL A;  2BYT A;  3W2D A;  1I4G A;  1NYR A;  1WYG A;  3VR9 B;  1GAQ B;  1SE3 A;  2IJ0 A;  3P1M A;  2K9X A;  1JQ4 A;  5LNK 1;  1JRP A;  1MHH E;  1QT9 A;  4XE0 A;  3LB8 C;  3AE7 B;  1TYG B;  3PO0 A;  4ZOH C;  3CF4 A;  2MH7 A;  3AV8 A;  3VRB B;  1AYF A;  1EWC A;  3IXS A;  2WXK A;  1QKZ A;  2IGH A;  2YEP F;  2YEP B;  1FM0 D;  3T3O A;  1NVI D;  2L83 A;  2Y5P A;  2LGI A;  1NEK B;  4TQ1 A;  2WNM A;  1WSP A;  4USA A;  3ZGZ A;  1XLP A;  3AE6 B;  4US8 A;  4DXG A;  1ZP0 B;  1XLO A;  4A8X C;  3AE8 B;  2AX5 A;  1FNU A;  2ONQ A;  1GT8 A;  1IGD A;  2DWQ A;  1E6E B;  3AM9 A;  2SEB D;  2WDQ B;  1DOI A;  1MI0 A;  2LHE A;  2Y3A A;  1K53 A;  4MT5 A;  4GDL B;  4KGR A;  4OZA A;  4RGM A;  1YN4 A;  4LLG M;  3BYT B;  1IUE A;  3BVZ A;  1L0V B;  2WDR B;  1C76 A;  3Q8B A;  1XCT L;  3KQ4 A;  1GPX A;  1HEZ E;  1SE4 A;  1E10 A;  1V8C A;  1JW9 D;  3HRD D;  1A70 A;  1XLQ A;  1YNT E;  2CJN A;  3NZ3 A;  4O1N A;  4ARI A;  1PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...