2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
b'DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
molecule tags Hydrolase/protein binding
source organism Plasmodium falciparum
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
2Q2UA 4DV6H 3T5LA 2DWCA 3JALM 5EOYA 5L1JA 3L4KA 4I7HA 4DV4H 4PDBA 1Y1WA 2FPIB 3KAKA 1PX2A 4JUZA 2R0OA 1BNCA 4UCRA 3FERA 3U9SA 4FBTA 1HNXH 1JKJB 5EZYF 5KFFA 3ORQA 2XGPA 3H4DA 1WJOA 3MR3A 3RGZA 1E4FT 3HORA 2Y0SA 3R5HA 4LH7A 1J5EH 4LFBH 3M9MB 4DV1H 1BJTA 1A0IA 2FE3A 4HNUA 4AYBA 2YZNA 1GSAA 2V5AA 4F50A 1WYRA 1JIHA 5L1IA 3OSNA 4EGQA 2R86A 4B3MH 3G6VA 4MA0A 2C2EA 4EG0A 4C5BA 3RJ0A 4X65H 2UUAH 1R9TA 2W6OA 1IOWA 4ECSA 4YJ2F 1RYSA 4MV6A 4A3BG 3CQZA 3RV3A 5C4XG 3U9TA 2PMZA 1T36A 2BQUA 3HOXG 4Q59A 2YZGA 3GILA 4G3IA 3KHRA 1V9PA 5KT7A 1I94H 4EFEA 1AUXA 5KFIA 3MR2A 3BQ1A 1M0TA 2JA5A 5IYCG 2MCTA 5A36A 2R6FA 2CW7A 2JA7A 5KFPA 3JRWA 1P5SA 3GIMA 3IG0A 4DV2H 4EFBA 3SI8A 1SEIA 4UCSA 4RNNA 4U7CA 3KMUB 5BPFA 5KG2A 1GSOA 3PW4A 3GTLA 1FVIA 3KTMA 4RB1A 1IOVA 2W70A 1W96A 2W8KA 1IBKH 3G8CA 1MZBA 1B6SA 3I4NG 2W6ZA 2WDTA 2DLNA 5KFTA 4UFZA 2DK9A 4YJ3F 4EBEA 1A9XA 2CW8A 5GONF 2CQYA 2VUMA 3KAJA 2J6SA 2XD4A 4ECUA 4RAZA 2V9WA 2R8UA 4RZRA 4IRKA 4MV7A 3BQ2A 2OWOA 3Q1KA 3PN1A 2NU9B 2YCHA 5EWGA 2WTFA 4B3TH 5KG4A 3ORRA 4MV4A 3FMAA 1GYFA 1EHIA 3ETJA 3L2PA 1VAJA 4A93G 2YL2A 2V59A 2W9BA 4EYHB 1GLVA 3RGXA 3KMWB 4APMA 1CE8A 3RV4A 1ZHSA 5D1OB 4EGJA 2EYNA 1E4EA 2XCLA 4ECWA 3CVZA 4JI1H 2YS6A 4JI4H 4J9RA 4TV8F 2JA7G 2D85A 1SH5A 4J9NA 4A3LG 3OTOH 1WYQA 1Y14B 3MWDA 4ECXA 4FM9A 4TUYF 5I47A 4ED1A 1IBLH 2XCPA 2W8LA 3RTXA 3TQTA 4TXKA 2FK1A 1Z2NX 5D1PA 5LMUH 4DR5H 2JEJA 2UVWA 1ZQ7A 2FKLA 5BR8H 3BA8A 2L3GA 3HOZG 3REPB 4HQ6A 1TWFA 4NXNH 4J0MA 3GLKA 2EYIA 2QK4A 1X9NA 1MB8A 2C28A 2IGPA 2NUAB 1JX4A 5KFMA 1UEGA 2JEIA 5DQHA 3GTMA 5KFDA 1M7JA 4QW8A 4RUCA 4RB3C 4QWEA 4GKKH 3H3VH 2EE7A 2Y0SE 2YYAA 3JRXA 5LOVF 3PR5B 2VA2A 5J8EA 4I50F 2ATLA 4EDMA 1SFOA 1EZ1A 1PK8A 3JSNA 3GIKA 4J9PA 2K3SA 2HHHH 4J9SA 1GO3E 2RGVA 4U6PA 1M6VA 4MTEA 4YQWA 2R7ZG 2FPPB 2GPWA 3HXLA 1N33H 5KFKA 3EPGA 4GC6A 2J6UA 3VPDA 1GSHA 2FB9A 4MV1A 3FKIA 4HNTA 5IT9W 1S03G 3IN5A 5L9XA 1L2ZA 2PMZE 2FLPA 4J9LA 2E9KA 1TWAA 1TWHA 3FKIG 3GIQA 4AQYH 1V4YA 4MA5A 4JI0H 2CZGA 2R93A 4DV5H 5CAEB 2IBKA 5KFXA 3VP7A 2V4RA 4Q44A 4JI5H 4A2AA 4LFAH 1S97A 2QJXA 1E4EB 3F8NA 1N34H 4R8UA 2FP4B 2BQ3A 4Q8FA 4LF8H 1UC9A 5JH7F 3SE7A 4A3GG 1TJTA 2W7PA 2VQFH 1BKRA 1KEEA 3HKZA 1TAEA 1S68A 2NU7B 3BAAA 3TIIA 2R8HA 4F4WA 1IBMH 2W6PA 2D89A 2C2DA 4O3RA 1VBGA 2R7MA 5EDWA 4DR4H 4ZHQF 5KFBA 2UVRA 4ZQIA 4B7LA 3TINA 1V5KA 3GV8B 4ECRA 3K3VA 3K5HA 5F9NA 2R87A 5L0OA 1WH2A 4I4TF 4QIWE 4DL7A 3QFFA 2CKZB 2K2RA 4YAKB 3Q8QB 4FS1A 4XZ3B 2UU9H 3HOYG 3HOWG 2XC9A 2VUGA 4IZOA 3RB0A 4F4YA 1OWTA 4K0KH 4WBNF 4YBZB 3T1HH 1AA2A 1EUDB 4BY1G 5LL6b 4QW9A 3RF2A 4AYBE 4GC7A 4YP3A 4YR3A 3V4SA 1AUVA 1T94A 5IP9G 3HOUG 5DLGA 4O3OA 4DL4A 1SH6A 2R84A 1JXLA 2W71A 4O3QA 1B33N 4TXIA 2M05A 4B3RH 4JV5H 3T5KA 3N41B 4Q43A 1UJOA 5CA1F 3KHLA 1QAGA 3V6KA 4A3DG 3GTGA 5BVRA 1CQJB 2R8IA 2R7NA 5KG5A 4R7RA 4DR1H 4LF6H 4FBUA 1K1SA 5C8YF 5JUMA 5KG1A 4DL6A 2HL8A 3R5XA 5LP6F 3RBEA 2PN1A 2W9CA 4ED8A 4ED6A 2HGSA 4QWDA 1S0MA 5KFZA 5KFRA 4TQRA 2ZDQA 2YU9A 4EEQA 5A4BA 1I3QA 2AU0A 1SYXB 1JDEA 5CA0F 4ETSA 3G6YA 4DR6H 4EEYA 4O3NA 5KT3A 1PA7A 3PW5A 4LSXA 2WA5A 1E4GT 3M9OB 2R8GA 5C1OA 1I6UA 2QJZA 3EYYA 5KFVA 3R5FA 2XIGA 3GTOA 1KJIA 2IP4A 2ZDGA 3KXYT 3GTJA 4X64H 1DIKA 2YRXA 2W6NA 5DG9A 1M0WA 1HNZH 2PBZA 3HOCA 2ASLA 3RAXA 1WYPA 5FD6A 4EDNA 2VOBA 4FU0A 3WO1A 2BR0A 4NXMH 3RIZA 4ED0A 4M9UA 5A38A 4XX0B 1DGSA 4YR0A 4A3KG 4HR7A 3TQ1A 1EUVA 1TWGA 2O03A 2VPSA 2E5LH 2UXCH 3VMMA 2SCUB 4GKJH 5JVLA 2V4QA 4O3SA 3I6XA 4JV0A 3TIGA 4C2MA 4YB8B 4GLXA 1FKAH 4RU9A 4RB0A 5HV6A 5F9LA 3OSPA 4JV1A 3MWEA 3JAKM 3FDSA 2XGQA 2JV9A 2R7ZA 5C3EG 1T3NA 4RUAA 1CS0A 3GV7B 3V6JA 5L1KA 2IA6A 3PR4A 3QZ8A 4F4ZA 3V6HA 2NVYA 3LP8A 3N8DA 3Q8SB 3E5NA 3OHAA 4RZQA 2UVUA 4YY3H 3PO3G 1N48A 5KG7A 3T5HA 3HBLA 4Q45A 3M4IA 4IR9A 5KG3A 5J2TF 2DPIA 5KFJA 4DUYH 2ALZA 2D88A 3HOPA 3OUZA 5FMTA 3EAYA 4QJFA 2GLTA 3BA9A 3BQ0A 2W6QA 4UCOA 3Q8PB 4X66H 2ZJTA 4JI3H 2WFNA 5KFSA 1AN7A 4MV9A 3NGDA 2VPQA 2E2IA 4ME6A 2VZIB 5LXTF 4O3PA 2R7LA 5KT4A 2FK2A 5FPRA 3RUPA 1C30A 2YRWA 3L4JA 2HL9A 1BHDA 1EYZA 2DZDA 5K2MA 4MTDA 4E4TA 3Q8RB 1I50A 4F4XA 1S0OA 2WE6A 4IHJF 5FPOA 5J2UF 5KFUA 5KFLA 3RB3A 3MWMA 4BWSC 1C3OA 5A2QW 2EQOA 5KT2A 4IRCA 2C00A 2W9AA 1WCMG 3GTKA 2UUBH 3BJYA 4LF9H 2WAQE 5IYDG 1RJQA 4YR2A 3GTPA 1VS0A 2OLSA 1Z2PX 4O2AF 3J81W 1Y1WG 4OX9H 4ZI7F 5D8DA 4NLGA 5C5JA 3PW2A 2DIKA 2VZCA 3GIIA 4A3CG 1WIXA 1CQIB 2FK3A 4LSAA 1Z2OX 4Q0YA 4ED3A 3HKZE 1KJ9A 4EBCA 2P0AA 2VE7A 5KFWA 2D87A 2KSWA 3GIPA 5KT6A 1GGOA 1VKAA 2D86A 4LVPA 3C0FB 4A2BA 5JQWA 5DG7A 3PW7A 3LWBA 1XDNA 4A3EG 4JI8H 3EPIA 3GIDA 1K1QA 2HVQA 3RBDA 2YZMA 5BMVF 5IWAH 4RNOA 3MJFA 4Q57B 3RAQA 2VQEH 1KC7A 4EBDA 1KJ8A 4RAYA 1RT8A 3OHBA 4DR7H 2XCAA 1H67A 5LYJF 3H0GA 2JEGA 2R82A 5IYBG 2W7OA 2C22A 4ECQA 2FJZA 2OH2A 2WA7A 1AOAA 2VZDA 1BGWA 5KG6A 4QIWA 4X62H 2YW2A 4LMYA 3J7AK 2B63G 3PO2G 2J6TA 4C5CA 4RNMA 3I12A 3JAMW 4HNVA 4QWBA 1XMOH 4BY7G 4O2BF 5IP7G 4DR3H 4J9KA 2HVRA 2PVPA 3KALA 5KX5F 2RDJA 4DL2A 5KG0A 2UXBH 1PXYA 3JZIA 2WAQA 3PZPA 4YHHH 3T5JA 1TWCA 3N42B 4CC5A 3DF7A 5FLMG 5LMNH 1XNRH 2RR8A 2DPJA 1DXXA 2FMAA 4R8UB 4ECZA 4O4LF 3VPCA 5DQGA 3GV5B 3K5IA 2VA3A 5HBRB 1I7NA 1O75A 3WNZA 5KFEA 5KT5A 3I4MG 4J9MA 5KFAA 2W6MA 2W9CB 2AGOA 5LA6F 4C5AA 5A37A 4DR2H 3K3PA 5H80A 4DV0H 4A3JG 3LMLA 5DQIA 4JYAH 2I8CA 2NU6B 4MAMA 5FD5A 5KFQA 2RDIA 3WO0A 4QWCA 4Q8EA 3H4BA 3UQ8A 3HB9A 3H40A 1FJGH 4BBRG 4DDPA 1I7LA 3MFHA 4QWAA 3PVXA 1DV1A 1XNQH 2NVXA 5CB4F 3AYHB 3BG5A 5KFOA 5DLFA 1TA8A 4ECVA 2FLLA 3JARM 1K83A 1KJJA 4ED7A 1HR0H 4YAJB 1S9FA 2B63A 4WD3A 1N36H 1WYLA 5KFCA 4DL3A 4PWQA 5FJ8G 2C2RA 2YS7A 1KBLA 3MR5A 2X0SA 2VZGB 4J9QA 4JI6H 4JI7H 4ED2A 2UXDH 3V4ZA 1W93A 4Q58A 4A3MG 5DGBA 4J9OA 2FLNA 4B3SH 1HNWH 2JA8G 1S10A 2VQDA 4MV8A 1WR2A 2NU8B 4JI2H 1ZETA 4FS2A 2BQRA 2R8KA 1EUCB 2HKPA 1B6RA 4XYLB 4LVRA 5C1PA 3N6XA 2ZM6H 2UVVA 2R7KA 5EWFA 2F4VH 4IR1A 1DV2A 2R85A 3RFCA 1UC8A 3KHHA 4DV7H 2YRNA 4A3FG 2JA6A 4EDLA 5DGAA 3H20A 4TQSA 3KHGA 3GIJA 2RGRA 4JV2A 2WB1E 4O4IF 3CO1A 2J9GA 3H0GG 3N40P 1WKUA 1ULZA 1WCMA 3N44B 4IWYA 4XYMB 4ZOLF 5KKNB 4DL5A 2W57A 4I55F 3GQCA 5L1LA 1RYRA 3MFIA 2HVSA 1RJPA 3UFXB 1Y1VA 3M9NB 1RJRA 4ECYA 1Y1VG 2WB1A 4L1KA 4KHPH 1VBHA 2VUMG 2C35B 4O4HF 4DUZH 2I87A 3ETHA 4DV3H 3MR6A 4LF7H 3F7PA 5EWEA 1JLLB 4IRDA 2GPSA 4MV3A 1KJQA 1SCUB 2R92A 3R23A 2VR1A 1B04A 4BXXG 3GTQA 2R93G 4M7EA 2R92G 4Y8VB 4LH6A 5KFNA 4LFCH 1WYNA 3J80W 4BBSG 1UNNC 3QZ7A 1BXRA 1ZHQA 1P8LA 3G6XA 1RK6A 1WYOA 2RF4A 2FPGB 4IAJA 1S0NA 2JEFA 2UUCH 2JA5G 4LF4H 2I80A 2ASJA 4HYKA 4ECTA 4RB2C 1VKZA 5KFHA 2Q2TA 4CC6A 5BPHA 4UCVA 4LF5H 2ASDA 3VPBA 5DG8A 2HJWA 3PW0A 1P2XA 4IWXA 1V51A 5T14A 1N32H 2E2HA 5JVDF 1WSCA 3KY9A 3JSLA 4UCTA 2AGQA 3RB6A 5D1OA 4EYIB 5KFGA 2AGPA 2QYZA 2R8JA 5KFYA 3BABA 2W9BB 3OUUA 1XMQH 5IYZF 2V58A 2WYOA 2WA6A 4UCUA 3T1YH 4A3IG 5FMUA 3RB4A 2JA6G 1RK5A 1N56A 3N43B 4DLKA 2AQ4A 3HOVG 2ZDHA 3Q2OA 5C44G 1WYMA 4TV9F 2IMWP 2VE7C 5FLXW 1JDBB
chains in the Genus database with same CATH topology
2VPSA 2Q2UA 4DV6H 4GKJH 1O75A 3JSNA 2HHHH 5EOYA 4PDBA 3L4KA 2RGVA 4I7HA 4DV4H 4GLXA 4MTEA 3KAKA 1FKAH 4RB0A 4DR2H 3HXLA 1N33H 4UCRA 4DV0H 3LMLA 4JYAH 1HNXH 5FD5A 5IT9W 1S03G 3UQ8A 1L2ZA 4RZQA 4YY3H 1FJGH 3RGZA 4DDPA 1E4FT 1XNQH 4LH7A 1J5EH 4AQYH 4LFBH 4JI0H 3M4IA 4DV5H 1TA8A 4DV1H 1HR0H 1BJTA 1A0IA 2FE3A 4DUYH 3VP7A 5FMTA 3EAYA 1N36H 4A2AA 4JI5H 4LFAH 3F8NA 3BA9A 1N34H 4JI6H 4UCOA 4JI7H 4LF8H 3RJ0A 4X65H 2UUAH 4X66H 2UXDH 2ZJTA 2VQFH 4JI3H 4B3SH 1HNWH 1AN7A 1S68A 1TAEA 3BAAA 2E5LH 4MV9A 4JI2H 1IBMH 1V9PA 1I94H 4EFEA 2HKPA 5FPRA 4DR4H 4LVRA 1M0TA 3N6XA 2ZM6H 3L4JA 2F4VH 2HL9A 2MCTA 2CW7A 3K3VA 4MTDA 4DV7H 3IG0A 4DV2H 4EFBA 3H20A 2WE6A 1SEIA 1WH2A 4UCSA 2RGRA 5FPOA 2UU9H 3N40P 4B3MH 1FVIA 3N44B 4RB1A 3MWMA 4BWSC 5A2QW 2VUGA 2EQOA 1MZBA 2W57A 1IBKH 2HVSA 2WDTA 4UFZA 2UUBH 4K0KH 4LF9H 3T1HH 2CW8A 5LL6b 3RF2A 3KAJA 1VS0A 1Z2PX 3J81W 4KHPH 4OX9H 4RAZA 4DUZH 4MV7A 4DV3H 4B3RH 2OWOA 4LF7H 4JV5H 3PN1A 3N41B 2YCHA 1Z2OX 4Q0YA 4LSAA 4B3TH 3FMAA 2VE7A 1GYFA 3L2PA 4R7RA 2KSWA 4DR1H 4LF6H 1B04A 4M7EA 4LVPA 4LH6A 3C0FB 2HL8A 4A2BA 3RGXA 3J80W 4LFCH 1XDNA 4JI8H 4APMA 1ZHQA 2HGSA 1ZHSA 1P8LA 5D1OB 2HVQA 5IWAH 4IAJA 3CVZA 2UUCH 4JI1H 4LF4H 4JI4H 2VQEH 4EEQA 4RB2C 1SYXB 4RAYA 4ETSA 4DR7H 3OTOH 2Q2TA 4CC6A 4DR6H 4FM9A 4UCVA 4LF5H 1IBLH 3RTXA 4LSXA 1N32H 1E4GT 1Z2NX 5D1PA 1I6UA 1BGWA 3EYYA 4X62H 4LMYA 3JSLA 2XIGA 4UCTA 5LMUH 5D1OA 4DR5H 3J7AK 3KXYT 4X64H 5BR8H 3BA8A 3JAMW 3BABA 1XMOH 1M0WA 4NXNH 1HNZH 4J0MA 1X9NA 4DR3H 1XMQH 2WYOA 2HVRA 2IGPA 2UXCH 4UCUA 3KALA 3T1YH 5FMUA 5FD6A 2UXBH 3N43B 2VOBA 4RB3C 4YHHH 4GKKH 3N42B 4CC5A 3DF7A 3RIZA 4NXMH 5LMNH 1XNRH 1DGSA 2VE7C 5FLXW 1EUVA 2O03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 2Q2U A;  4DV6 H;  3T5L A;  2DWC A;  3JAL M;  5EOY A;  5L1J A;  3L4K A;  4I7H A;  4DV4 H;  4PDB A;  1Y1W A;  2FPI B;  3KAK A;  1PX2 A;  4JUZ A;  2R0O A;  1BNC A;  4UCR A;  3FER A;  3U9S A;  4FBT A;  1HNX H;  1JKJ B;  5EZY F;  5KFF A;  3ORQ A;  2XGP A;  3H4D A;  1WJO A;  3MR3 A;  3RGZ A;  1E4F T;  3HOR A;  2Y0S A;  3R5H A;  4LH7 A;  1J5E H;  4LFB H;  3M9M B;  4DV1 H;  1BJT A;  1A0I A;  2FE3 A;  4HNU A;  4AYB A;  2YZN A;  1GSA A;  2V5A A;  4F50 A;  1WYR A;  1JIH A;  5L1I A;  3OSN A;  4EGQ A;  2R86 A;  4B3M H;  3G6V A;  4MA0 A;  2C2E A;  4EG0 A;  4C5B A;  3RJ0 A;  4X65 H;  2UUA H;  1R9T A;  2W6O A;  1IOW A;  4ECS A;  4YJ2 F;  1RYS A;  4MV6 A;  4A3B G;  3CQZ A;  3RV3 A;  5C4X G;  3U9T A;  2PMZ A;  1T36 A;  2BQU A;  3HOX G;  4Q59 A;  2YZG A;  3GIL A;  4G3I A;  3KHR A;  1V9P A;  5KT7 A;  1I94 H;  4EFE A;  1AUX A;  5KFI A;  3MR2 A;  3BQ1 A;  1M0T A;  2JA5 A;  5IYC G;  2MCT A;  5A36 A;  2R6F A;  2CW7 A;  2JA7 A;  5KFP A;  3JRW A;  1P5S A;  3GIM A;  3IG0 A;  4DV2 H;  4EFB A;  3SI8 A;  1SEI A;  4UCS A;  4RNN A;  4U7C A;  3KMU B;  5BPF A;  5KG2 A;  1GSO A;  3PW4 A;  3GTL A;  1FVI A;  3KTM A;  4RB1 A;  1IOV A;  2W70 A;  1W96 A;  2W8K A;  1IBK H;  3G8C A;  1MZB A;  1B6S A;  3I4N G;  2W6Z A;  2WDT A;  2DLN A;  5KFT A;  4UFZ A;  2DK9 A;  4YJ3 F;  4EBE A;  1A9X A;  2CW8 A;  5GON F;  2CQY A;  2VUM A;  3KAJ A;  2J6S A;  2XD4 A;  4ECU A;  4RAZ A;  2V9W A;  2R8U A;  4RZR A;  4IRK A;  4MV7 A;  3BQ2 A;  2OWO A;  3Q1K A;  3PN1 A;  2NU9 B;  2YCH A;  5EWG A;  2WTF A;  4B3T H;  5KG4 A;  3ORR A;  4MV4 A;  3FMA A;  1GYF A;  1EHI A;  3ETJ A;  3L2P A;  1VAJ A;  4A93 G;  2YL2 A;  2V59 A;  2W9B A;  4EYH B;  1GLV A;  3RGX A;  3KMW B;  4APM A;  1CE8 A;  3RV4 A;  1ZHS A;  5D1O B;  4EGJ A;  2EYN A;  1E4E A;  2XCL A;  4ECW A;  3CVZ A;  4JI1 H;  2YS6 A;  4JI4 H;  4J9R A;  4TV8 F;  2JA7 G;  2D85 A;  1SH5 A;  4J9N A;  4A3L G;  3OTO H;  1WYQ A;  1Y14 B;  3MWD A;  4ECX A;  4FM9 A;  4TUY F;  5I47 A;  4ED1 A;  1IBL H;  2XCP A;  2W8L A;  3RTX A;  3TQT A;  4TXK A;  2FK1 A;  1Z2N X;  5D1P A;  5LMU H;  4DR5 H;  2JEJ A;  2UVW A;  1ZQ7 A;  2FKL A;  5BR8 H;  3BA8 A;  2L3G A;  3HOZ G;  3REP B;  4HQ6 A;  1TWF A;  4NXN H;  4J0M A;  3GLK A;  2EYI A;  2QK4 A;  1X9N A;  1MB8 A;  2C28 A;  2IGP A;  2NUA B;  1JX4 A;  5KFM A;  1UEG A;  2JEI A;  5DQH A;  3GTM A;  5KFD A;  1M7J A;  4QW8 A;  4RUC A;  4RB3 C;  4QWE A;  4GKK H;  3H3V H;  2EE7 A;  2Y0S E;  2YYA A;  3JRX A;  5LOV F;  3PR5 B;  2VA2 A;  5J8E A;  4I50 F;  2ATL A;  4EDM A;  1SFO A;  1EZ1 A;  1PK8 A;  3JSN A;  3GIK A;  4J9P A;  2K3S A;  2HHH H;  4J9S A;  1GO3 E;  2RGV A;  4U6P A;  1M6V A;  4MTE A;  4YQW A;  2R7Z G;  2FPP B;  2GPW A;  3HXL A;  1N33 H;  5KFK A;  3EPG A;  4GC6 A;  2J6U A;  3VPD A;  1GSH A;  2FB9 A;  4MV1 A;  3FKI A;  4HNT A;  5IT9 W;  1S03 G;  3IN5 A;  5L9X A;  1L2Z A;  2PMZ E;  2FLP A;  4J9L A;  2E9K A;  1TWA A;  1TWH A;  3FKI G;  3GIQ A;  4AQY H;  1V4Y A;  4MA5 A;  4JI0 H;  2CZG A;  2R93 A;  4DV5 H;  5CAE B;  2IBK A;  5KFX A;  3VP7 A;  2V4R A;  4Q44 A;  4JI5 H;  4A2A A;  4LFA H;  1S97 A;  2QJX A;  1E4E B;  3F8N A;  1N34 H;  4R8U A;  2FP4 B;  2BQ3 A;  4Q8F A;  4LF8 H;  1UC9 A;  5JH7 F;  3SE7 A;  4A3G G;  1TJT A;  2W7P A;  2VQF H;  1BKR A;  1KEE A;  3HKZ A;  1TAE A;  1S68 A;  2NU7 B;  3BAA A;  3TII A;  2R8H A;  4F4W A;  1IBM H;  2W6P A;  2D89 A;  2C2D A;  4O3R A;  1VBG A;  2R7M A;  5EDW A;  4DR4 H;  4ZHQ F;  5KFB A;  2UVR A;  4ZQI A;  4B7L A;  3TIN A;  1V5K A;  3GV8 B;  4ECR A;  3K3V A;  3K5H A;  5F9N A;  2R87 A;  5L0O A;  1WH2 A;  4I4T F;  4QIW E;  4DL7 A;  3QFF A;  2CKZ B;  2K2R A;  4YAK B;  3Q8Q B;  4FS1 A;  4XZ3 B;  2UU9 H;  3HOY G;  3HOW G;  2XC9 A;  2VUG A;  4IZO A;  3RB0 A;  4F4Y A;  1OWT A;  4K0K H;  4WBN F;  4YBZ B;  3T1H H;  1AA2 A;  1EUD B;  4BY1 G;  5LL6 b;  4QW9 A;  3RF2 A;  4AYB E;  4GC7 A;  4YP3 A;  4YR3 A;  3V4S A;  1AUV A;  1T94 A;  5IP9 G;  3HOU G;  5DLG A;  4O3O A;  4DL4 A;  1SH6 A;  2R84 A;  1JXL A;  2W71 A;  4O3Q A;  1B33 N;  4TXI A;  2M05 A;  4B3R H;  4JV5 H;  3T5K A;  3N41 B;  4Q43 A;  1UJO A;  5CA1 F;  3KHL A;  1QAG A;  3V6K A;  4A3D G;  3GTG A;  5BVR A;  1CQJ B;  2R8I A;  2R7N A;  5KG5 A;  4R7R A;  4DR1 H;  4LF6 H;  4FBU A;  1K1S A;  5C8Y F;  5JUM A;  5KG1 A;  4DL6 A;  2HL8 A;  3R5X A;  5LP6 F;  3RBE A;  2PN1 A;  2W9C A;  4ED8 A;  4ED6 A;  2HGS A;  4QWD A;  1S0M A;  5KFZ A;  5KFR A;  4TQR A;  2ZDQ A;  2YU9 A;  4EEQ A;  5A4B A;  1I3Q A;  2AU0 A;  1SYX B;  1JDE A;  5CA0 F;  4ETS A;  3G6Y A;  4DR6 H;  4EEY A;  4O3N A;  5KT3 A;  1PA7 A;  3PW5 A;  4LSX A;  2WA5 A;  1E4G T;  3M9O B;  2R8G A;  5C1O A;  1I6U A;  2QJZ A;  3EYY A;  5KFV A;  3R5F A;  2XIG A;  3GTO A;  1KJI A;  2IP4 A;  2ZDG A;  3KXY T;  3GTJ A;  4X64 H;  1DIK A;  2YRX A;  2W6N A;  5DG9 A;  1M0W A;  1HNZ H;  2PBZ A;  3HOC A;  2ASL A;  3RAX A;  1WYP A;  5FD6 A;  4EDN A;  2VOB A;  4FU0 A;  3WO1 A;  2BR0 A;  4NXM H;  3RIZ A;  4ED0 A;  4M9U A;  5A38 A;  4XX0 B;  1DGS A;  4YR0 A;  4A3K G;  4HR7 A;  3TQ1 A;  1EUV A;  1TWG A;  2O03 A;  2VPS A;  2E5L H;  2UXC H;  3VMM A;  2SCU B;  4GKJ H;  5JVL A;  2V4Q A;  4O3S A;  3I6X A;  4JV0 A;  3TIG A;  4C2M A;  4YB8 B;  4GLX A;  1FKA H;  4RU9 A;  4RB0 A;  5HV6 A;  5F9L A;  3OSP A;  4JV1 A;  3MWE A;  3JAK M;  3FDS A;  2XGQ A;  2JV9 A;  2R7Z A;  5C3E G;  1T3N A;  4RUA A;  1CS0 A;  3GV7 B;  3V6J A;  5L1K A;  2IA6 A;  3PR4 A;  3QZ8 A;  4F4Z A;  3V6H A;  2NVY A;  3LP8 A;  3N8D A;  3Q8S B;  3E5N A;  3OHA A;  4RZQ A;  2UVU A;  4YY3 H;  3PO3 G;  1N48 A;  5KG7 A;  3T5H A;  3HBL A;  4Q45 A;  3M4I A;  4IR9 A;  5KG3 A;  5J2T F;  2DPI A;  5KFJ A;  4DUY H;  2ALZ A;  2D88 A;  3HOP A;  3OUZ A;  5FMT A;  3EAY A;  4QJF A;  2GLT A;  3BA9 A;  3BQ0 A;  2W6Q A;  4UCO A;  3Q8P B;  4X66 H;  2ZJT A;  4JI3 H;  2WFN A;  5KFS A;  1AN7 A;  4MV9 A;  3NGD A;  2VPQ A;  2E2I A;  4ME6 A;  2VZI B;  5LXT F;  4O3P A;  2R7L A;  5KT4 A;  2FK2 A;  5FPR A;  3RUP A;  1C30 A;  2YRW A;  3L4J A;  2HL9 A;  1BHD A;  1EYZ A;  2DZD A;  5K2M A;  4MTD A;  4E4T A;  3Q8R B;  1I50 A;  4F4X A;  1S0O A;  2WE6 A;  4IHJ F;  5FPO A;  5J2U F;  5KFU A;  5KFL A;  3RB3 A;  3MWM A;  4BWS C;  1C3O A;  5A2Q W;  2EQO A;  5KT2 A;  4IRC A;  2C00 A;  2W9A A;  1WCM G;  3GTK A;  2UUB H;  3BJY A;  4LF9 H;  2WAQ E;  5IYD G;  1RJQ A;  4YR2 A;  3GTP A;  1VS0 A;  2OLS A;  1Z2P X;  4O2A F;  3J81 W;  1Y1W G;  4OX9 H;  4ZI7 F;  5D8D A;  4NLG A;  5C5J A;  3PW2 A;  2DIK A;  2VZC A;  3GII A;  4A3C G;  1WIX A;  1CQI B;  2FK3 A;  4LSA A;  1Z2O X;  4Q0Y A;  4ED3 A;  3HKZ E;  1KJ9 A;  4EBC A;  2P0A A;  2VE7 A;  5KFW A;  2D87 A;  2KSW A;  3GIP A;  5KT6 A;  1GGO A;  1VKA A;  2D86 A;  4LVP A;  3C0F B;  4A2B A;  5JQW A;  5DG7 A;  3PW7 A;  3LWB A;  1XDN A;  4A3E G;  4JI8 H;  3EPI A;  3GID A;  1K1Q A;  2HVQ A;  3RBD A;  2YZM A;  5BMV F;  5IWA H;  4RNO A;  3MJF A;  4Q57 B;  3RAQ A;  2VQE H;  1KC7 A;  4EBD A;  1KJ8 A;  4RAY A;  1RT8 A;  3OHB A;  4DR7 H;  2XCA A;  1H67 A;  5LYJ F;  3H0G A;  2JEG A;  2R82 A;  5IYB G;  2W7O A;  2C22 A;  4ECQ A;  2FJZ A;  2OH2 A;  2WA7 A;  1AOA A;  2VZD A;  1BGW A;  5KG6 A;  4QIW A;  4X62 H;  2YW2 A;  4LMY A;  3J7A K;  2B63 G;  3PO2 G;  2J6T A;  4C5C A;  4RNM A;  3I12 A;  3JAM W;  4HNV A;  4QWB A;  1XMO H;  4BY7 G;  4O2B F;  5IP7 G;  4DR3 H;  4J9K A;  2HVR A;  2PVP A;  3KAL A;  5KX5 F;  2RDJ A;  4DL2 A;  5KG0 A;  2UXB H;  1PXY A;  3JZI A;  2WAQ A;  3PZP A;  4YHH H;  3T5J A;  1TWC A;  3N42 B;  4CC5 A;  3DF7 A;  5FLM G;  5LMN H;  1XNR H;  2RR8 A;  2DPJ A;  1DXX A;  2FMA A;  4R8U B;  4ECZ A;  4O4L F;  3VPC A;  5DQG A;  3GV5 B;  3K5I A;  2VA3 A;  5HBR B;  1I7N A;  1O75 A;  3WNZ A;  5KFE A;  5KT5 A;  3I4M G;  4J9M A;  5KFA A;  2W6M A;  2W9C B;  2AGO A;  5LA6 F;  4C5A A;  5A37 A;  4DR2 H;  3K3P A;  5H80 A;  4DV0 H;  4A3J G;  3LML A;  5DQI A;  4JYA H;  2I8C A;  2NU6 B;  4MAM A;  5FD5 A;  5KFQ A;  2RDI A;  3WO0 A;  4QWC A;  4Q8E A;  3H4B A;  3UQ8 A;  3HB9 A;  3H40 A;  1FJG H;  4BBR G;  4DDP A;  1I7L A;  3MFH A;  4QWA A;  3PVX A;  1DV1 A;  1XNQ H;  2NVX A;  5CB4 F;  3AYH B;  3BG5 A;  5KFO A;  5DLF A;  1TA8 A;  4ECV A;  2FLL A;  3JAR M;  1K83 A;  1KJJ A;  4ED7 A;  1HR0 H;  4YAJ B;  1S9F A;  2B63 A;  4WD3 A;  1N36 H;  1WYL A;  5KFC A;  4DL3 A;  4PWQ A;  5FJ8 G;  2C2R A;  2YS7 A;  1KBL A;  3MR5 A;  2X0S A;  2VZG B;  4J9Q A;  4JI6 H;  4JI7 H;  4ED2 A;  2UXD H;  3V4Z A;  1W93 A;  4Q58 A;  4A3M G;  5DGB A;  4J9O A;  2FLN A;  4B3S H;  1HNW H;  2JA8 G;  1S10 A;  2VQD A;  4MV8 A;  1WR2 A;  2NU8 B;  4JI2 H;  1ZET A;  4FS2 A;  2BQR A;  2R8K A;  1EUC B;  2HKP A;  1B6R A;  4XYL B;  4LVR A;  5C1P A;  3N6X A;  2ZM6 H;  2UVV A;  2R7K A;  5EWF A;  2F4V H;  4IR1 A;  1DV2 A;  2R85 A;  3RFC A;  1UC8 A;  3KHH A;  4DV7 H;  2YRN A;  4A3F G;  2JA6 A;  4EDL A;  5DGA A;  3H20 A;  4TQS A;  3KHG A;  3GIJ A;  2RGR A;  4JV2 A;  2WB1 E;  4O4I F;  3CO1 A;  2J9G A;  3H0G G;  3N40 P;  1WKU A;  1ULZ A;  1WCM A;  3N44 B;  4IWY A;  4XYM B;  4ZOL F;  5KKN B;  4DL5 A;  2W57 A;  4I55 F;  3GQC A;  5L1L A;  1RYR A;  3MFI A;  2HVS A;  1RJP A;  3UFX B;  1Y1V A;  3M9N B;  1RJR A;  4ECY A;  1Y1V G;  2WB1 A;  4L1K A;  4KHP H;  1VBH A;  2VUM G;  2C35 B;  4O4H F;  4DUZ H;  2I87 A;  3ETH A;  4DV3 H;  3MR6 A;  4LF7 H;  3F7P A;  5EWE A;  1JLL B;  4IRD A;  2GPS A;  4MV3 A;  1KJQ A;  1SCU B;  2R92 A;  3R23 A;  2VR1 A;  1B04 A;  4BXX G;  3GTQ A;  2R93 G;  4M7E A;  2R92 G;  4Y8V B;  4LH6 A;  5KFN A;  4LFC H;  1WYN A;  3J80 W;  4BBS G;  1UNN C;  3QZ7 A;  1BXR A;  1ZHQ A;  1P8L A;  3G6X A;  1RK6 A;  1WYO A;  2RF4 A;  2FPG B;  4IAJ A;  1S0N A;  2JEF A;  2UUC H;  2JA5 G;  4LF4 H;  2I80 A;  2ASJ A;  4HYK A;  4ECT A;  4RB2 C;  1VKZ A;  5KFH A;  2Q2T A;  4CC6 A;  5BPH A;  4UCV A;  4LF5 H;  2ASD A;  3VPB A;  5DG8 A;  2HJW A;  3PW0 A;  1P2X A;  4IWX A;  1V51 A;  5T14 A;  1N32 H;  2E2H A;  5JVD F;  1WSC A;  3KY9 A;  3JSL A;  4UCT A;  2AGQ A;  3RB6 A;  5D1O A;  4EYI B;  5KFG A;  2AGP A;  2QYZ A;  2R8J A;  5KFY A;  3BAB A;  2W9B B;  3OUU A;  1XMQ H;  5IYZ F;  2V58 A;  2WYO A;  2WA6 A;  4UCU A;  3T1Y H;  4A3I G;  5FMU A;  3RB4 A;  2JA6 G;  1RK5 A;  1N56 A;  3N43 B;  4DLK A;  2AQ4 A;  3HOV G;  2ZDH A;  3Q2O A;  5C44 G;  1WYM A;  4TV9 F;  2IMW P;  2VE7 C;  5FLX W;  1JDB B; 
#chains in the Genus database with same CATH homology
 2VPS A;  2Q2U A;  4DV6 H;  4GKJ H;  1O75 A;  3JSN A;  2HHH H;  5EOY A;  4PDB A;  3L4K A;  2RGV A;  4I7H A;  4DV4 H;  4GLX A;  4MTE A;  3KAK A;  1FKA H;  4RB0 A;  4DR2 H;  3HXL A;  1N33 H;  4UCR A;  4DV0 H;  3LML A;  4JYA H;  1HNX H;  5FD5 A;  5IT9 W;  1S03 G;  3UQ8 A;  1L2Z A;  4RZQ A;  4YY3 H;  1FJG H;  3RGZ A;  4DDP A;  1E4F T;  1XNQ H;  4LH7 A;  1J5E H;  4AQY H;  4LFB H;  4JI0 H;  3M4I A;  4DV5 H;  1TA8 A;  4DV1 H;  1HR0 H;  1BJT A;  1A0I A;  2FE3 A;  4DUY H;  3VP7 A;  5FMT A;  3EAY A;  1N36 H;  4A2A A;  4JI5 H;  4LFA H;  3F8N A;  3BA9 A;  1N34 H;  4JI6 H;  4UCO A;  4JI7 H;  4LF8 H;  3RJ0 A;  4X65 H;  2UUA H;  4X66 H;  2UXD H;  2ZJT A;  2VQF H;  4JI3 H;  4B3S H;  1HNW H;  1AN7 A;  1S68 A;  1TAE A;  3BAA A;  2E5L H;  4MV9 A;  4JI2 H;  1IBM H;  1V9P A;  1I94 H;  4EFE A;  2HKP A;  5FPR A;  4DR4 H;  4LVR A;  1M0T A;  3N6X A;  2ZM6 H;  3L4J A;  2F4V H;  2HL9 A;  2MCT A;  2CW7 A;  3K3V A;  4MTD A;  4DV7 H;  3IG0 A;  4DV2 H;  4EFB A;  3H20 A;  2WE6 A;  1SEI A;  1WH2 A;  4UCS A;  2RGR A;  5FPO A;  2UU9 H;  3N40 P;  4B3M H;  1FVI A;  3N44 B;  4RB1 A;  3MWM A;  4BWS C;  5A2Q W;  2VUG A;  2EQO A;  1MZB A;  2W57 A;  1IBK H;  2HVS A;  2WDT A;  4UFZ A;  2UUB H;  4K0K H;  4LF9 H;  3T1H H;  2CW8 A;  5LL6 b;  3RF2 A;  3KAJ A;  1VS0 A;  1Z2P X;  3J81 W;  4KHP H;  4OX9 H;  4RAZ A;  4DUZ H;  4MV7 A;  4DV3 H;  4B3R H;  2OWO A;  4LF7 H;  4JV5 H;  3PN1 A;  3N41 B;  2YCH A;  1Z2O X;  4Q0Y A;  4LSA A;  4B3T H;  3FMA A;  2VE7 A;  1GYF A;  3L2P A;  4R7R A;  2KSW A;  4DR1 H;  4LF6 H;  1B04 A;  4M7E A;  4LVP A;  4LH6 A;  3C0F B;  2HL8 A;  4A2B A;  3RGX A;  3J80 W;  4LFC H;  1XDN A;  4JI8 H;  4APM A;  1ZHQ A;  2HGS A;  1ZHS A;  1P8L A;  5D1O B;  2HVQ A;  5IWA H;  4IAJ A;  3CVZ A;  2UUC H;  4JI1 H;  4LF4 H;  4JI4 H;  2VQE H;  4EEQ A;  4RB2 C;  1SYX B;  4RAY A;  4ETS A;  4DR7 H;  3OTO H;  2Q2T A;  4CC6 A;  4DR6 H;  4FM9 A;  4UCV A;  4LF5 H;  1IBL H;  3RTX A;  4LSX A;  1N32 H;  1E4G T;  1Z2N X;  5D1P A;  1I6U A;  1BGW A;  3EYY A;  4X62 H;  4LMY A;  3JSL A;  2XIG A;  4UCT A;  5LMU H;  5D1O A;  4DR5 H;  3J7A K;  3KXY T;  4X64 H;  5BR8 H;  3BA8 A;  3JAM W;  3BAB A;  1XMO H;  1M0W A;  4NXN H;  1HNZ H;  4J0M A;  1X9N A;  4DR3 H;  1XMQ H;  2WYO A;  2HVR A;  2IGP A;  2UXC H;  4UCU A;  3KAL A;  3T1Y H;  5FMU A;  5FD6 A;  2UXB H;  3N43 B;  2VOB A;  4RB3 C;  4YHH H;  4GKK H;  3N42 B;  4CC5 A;  3DF7 A;  3RIZ A;  4NXM H;  5LMN H;  1XNR H;  1DGS A;  2VE7 C;  5FLX W;  1EUV A;  2O03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...