2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/protein binding
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
5CB4F 2YYAA 4YJ3F 4C5AA 4Q45A 2NU8B 1BXRA 3GIJA 1GGOA 3ETJA 3HOYG 2HVQA 2HL9A 2J6UA 4YBZB 3OSNA 3BQ0A 4IRDA 5I47A 1I7NA 4A3IG 5EWFA 4DL2A 3H0GA 2B63G 2VUMA 4EBEA 3R5FA 1FKAH 4JI6H 2FPIB 2JEFA 1ULZA 5LYJF 3R23A 3RB0A 4HR7A 3RB3A 1N36H 1EUDB 4F4WA 1X9NA 3GLKA 4MV3A 2NUAB 5FLMG 4IR9A 2XGPA 2UXCH 2FK2A 3IG0A 1PK8A 3JRWA 1P2XA 4IRKA 5JUMA 2R7KA 2V59A 4M7EA 2XGQA 1T94A 1Y1VA 1KJ8A 1WR2A 4RB2C 2XC9A 3GV5B 3K3VA 5T14A 2HVSA 4Q59A 1VKZA 2PMZE 3FKIA 1B04A 3UQ8A 1CQJB 3RIZA 4LSXA 2W6NA 4Q58A 2W9BA 4J9RA 4ECTA 3V6KA 4I55F 3HOPA 1KJIA 4LH7A 5DG9A 3Q1KA 2JA6G 5BPHA 1SEIA 2E2HA 2D88A 2GPWA 4JI8H 2WB1E 1O75A 5KG3A 4LFAH 4MV7A 2NU9B 2R7ZA 4DR2H 1AUXA 4MTDA 2XD4A 3N41B 1KEEA 4JV1A 4JV2A 3OHAA 4A3LG 2NU6B 3OTOH 4AQYH 4JI0H 3RAQA 4LF8H 1SFOA 3CQZA 1R9TA 1V9PA 3JARM 4J9QA 5IYBG 2VPSA 5F9LA 4GLXA 4ED2A 2I8CA 3OHBA 4BBRG 2RGRA 3LP8A 4ECSA 4F4YA 4IWXA 4JI7H 3MR5A 2DIKA 5CA1F 4IHJF 2EYNA 5KG6A 4YQWA 4R8UB 5KFQA 2JA7A 2DZDA 2R8GA 4YAKB 4DR1H 2E9KA 4ZQIA 4UCSA 2WE6A 2W9AA 2CKZB 4WBNF 3L2PA 5L1LA 2J6TA 5LMNH 1E4GT 5KFMA 1W93A 2PVPA 5FD6A 3OUZA 2W57A 1XDNA 3VPBA 4F4ZA 3V4SA 5DQHA 2YZMA 4YY3H 2IMWP 4IR1A 1KJQA 5CAEB 5DQGA 2YCHA 3BAAA 1GLVA 3I6XA 3K3PA 4ZHQF 1WKUA 4FBUA 5JVLA 1CQIB 5BMVF 4DR4H 3ORQA 3JZIA 2R86A 4TQSA 4ECYA 4BY7G 3M4IA 4QWBA 4DV2H 5DGAA 5L1JA 4Q0YA 3TIIA 1MB8A 3WNZA 2D87A 2FPPB 4X66H 4RNNA 3SI8A 2NU7B 2AGQA 4UFZA 3T1YH 1M0TA 2V5AA 2YL2A 3R5HA 4B3RH 1IOVA 4TV9F 4F50A 4FS1A 4UCVA 5KG7A 2Q2UA 3T5KA 4YR3A 1EHIA 2UUAH 2DK9A 1V51A 4IAJA 3AYHB 5KFBA 4Q57B 4M9UA 1TJTA 1BHDA 5FMTA 1N33H 3ETHA 1B33N 1KJJA 1S0MA 2JEIA 4J0MA 5F9NA 4EEYA 2OWOA 1XNRH 5IWAH 1S0NA 2Y0SE 1DGSA 2Q2TA 2VE7C 2UVVA 3HKZE 3R5XA 3N43B 4GC7A 2W70A 5JQWA 2YZNA 3MWEA 4RAYA 3HB9A 4MV8A 4QW8A 3GV7B 2BQ3A 4HNVA 1JX4A 1MZBA 4A3FG 3HORA 5KFPA 1PXYA 3L4JA 2AU0A 2J9GA 3KXYT 5DGBA 1Y14B 1EUVA 4ED0A 2RR8A 1S03G 3Q8SB 2VUMG 2AGOA 4ECQA 2ALZA 4F4XA 3GIKA 5KFCA 4YHHH 1BNCA 1K1SA 1IOWA 4EEQA 3QFFA 4EDMA 4UCUA 1FJGH 2W6QA 3GIPA 4YB8B 1JIHA 3RUPA 5KG1A 4A2BA 4XYLB 5A38A 4LF5H 4B3TH 3GTKA 4ED7A 2RDJA 2VOBA 1GSAA 3N40P 4EFBA 2VUGA 4Q44A 1S10A 2YS6A 4IWYA 4UCRA 5KFUA 1TWCA 1Y1VG 1DXXA 1ZQ7A 4YP3A 3OUUA 3G6YA 4XX0B 3C0FB 4J9PA 4KHPH 3FKIG 3REPB 1SH6A 2VA2A 3FMAA 3RAXA 5FMUA 4EGJA 5KFWA 1RJQA 5KFIA 1E4FT 3MWDA 2R7NA 1Z2NX 2CQYA 4DUYH 4ED6A 5DG7A 1WYOA 2R7ZG 5KT2A 3N6XA 2R8HA 3KHRA 2HL8A 4R8UA 1I7LA 1RJRA 5KFOA 5KFEA 4JUZA 3TINA 2FP4B 4X64H 4MV9A 2FLPA 1T36A 2DLNA 5C3EG 2FLLA 3H4DA 2R84A 1IBLH 1AN7A 5JVDF 1K83A 1VBGA 3HOUG 3G6XA 4MV4A 3BABA 2RGVA 3HOWG 3PW2A 3V6JA 2BQRA 2K3SA 2C35B 4ED1A 3J7AK 3N8DA 4NXNH 4J9KA 4UCTA 4WD3A 1GYFA 5KT6A 2DWCA 4YAJB 3EPGA 3H3VH 3TQTA 5KFXA 4QWAA 2JA7G 1WJOA 5KG4A 2EYIA 1S68A 3RBEA 3MR3A 1M7JA 4QWCA 4TUYF 4GC6A 1IBMH 1C30A 2PBZA 4O3OA 3V4ZA 4X65H 1SYXB 4O3PA 4J9OA 1T3NA 2HVRA 1I6UA 2UXDH 4EYIB 1IBKH 4DL3A 4MA0A 1UEGA 2VZDA 4LVPA 2WAQA 4ECXA 2C28A 5LXTF 3PO2G 2XIGA 1ZHSA 2P0AA 2I80A 4RU9A 2VA3A 2CW8A 4ECUA 2JA8G 2I87A 3I4NG 2YRWA 4G3IA 1V5KA 5BPFA 1KBLA 5EDWA 3T5JA 2F4VH 4FS2A 1VAJA 1CS0A 4RNMA 1FVIA 3RV4A 4B7LA 2L3GA 5KG5A 4EFEA 4O3RA 4U6PA 4O3NA 4QWEA 4A3JG 2FKLA 4EBDA 4DL7A 3UFXB 3PR5B 2M05A 5KFYA 4O4LF 4QIWE 1A0IA 2CW7A 5KFSA 4ZI7F 1VS0A 4A3MG 2C2DA 2UVRA 2R8JA 5A4BA 1AUVA 5D1OB 3EPIA 3RGXA 1WCMG 2WYOA 2R93G 1RK6A 3GTJA 2QK4A 4O2BF 5KKNB 5J2UF 1HR0H 2UUBH 4Q8EA 5KT3A 4QJFA 2YS7A 3HOZG 4TXKA 3GTLA 2ZDHA 5A36A 1SH5A 3GIIA 2J6SA 3EAYA 5KFDA 4DLKA 2FK1A 3BA8A 3H20A 3M9OB 1HNXH 2YU9A 3JAMW 2MCTA 3OSPA 3GTQA 4A3KG 4A3BG 5D8DA 4MTEA 3I4MG 2V4QA 2W9CB 4EDLA 1B6SA 3GQCA 4C5BA 1N34H 2UU9H 5KG0A 2W6OA 4MV6A 3WO1A 4J9MA 5HBRB 1HNZH 3GTGA 3I12A 4ETSA 4XZ3B 3BQ2A 5IT9W 5C44G 3MR2A 3KMWB 4DV1H 1L2ZA 2FLNA 2DPJA 1RK5A 5IYCG 3HXLA 1WYPA 1CE8A 3Q2OA 3M9MB 5A2QW 1XMQH 5LA6F 1I50A 5DLGA 4BBSG 5KFRA 1WCMA 3JALM 2YRXA 1S97A 2R93A 1VKAA 2IP4A 2QJXA 5FJ8G 2W71A 4FM9A 3J80W 2ASDA 4RB0A 4ED3A 2W6PA 5LL6b 4J9SA 4ECWA 3IN5A 2R6FA 1GO3E 3FDSA 2JEGA 1TWAA 2QJZA 4R7RA 2FB9A 4FU0A 5KFLA 4HNUA 1ZHQA 4RZRA 2IGPA 2ZDGA 4C5CA 2JV9A 4K0KH 4DL4A 5KFGA 4A93G 2HKPA 3K5HA 2WA7A 2PMZA 3WO0A 2R87A 5CA0F 1BKRA 1W96A 3ORRA 5EWGA 1ZETA 4J9LA 1BJTA 3KHGA 1PX2A 5KT7A 4ZOLF 3Q8QB 2OLSA 4I4TF 4JYAH 4HQ6A 3KY9A 2NVYA 3GIMA 2C00A 3HBLA 3KTMA 1GSHA 3H40A 3BG5A 4LF6H 2D85A 2VZIB 3KAKA 1K1QA 4JV0A 3MR6A 1C3OA 3NGDA 3KHLA 2HHHH 4FBTA 2R85A 3MJFA 1WYNA 4O4IF 5KFJA 2FPGB 5DLFA 3F8NA 4DL6A 2K2RA 4RB1A 4BXXG 2HGSA 2ZJTA 3BJYA 1OWTA 5DG8A 4RUCA 5L1IA 3PO3G 5KX5F 1B6RA 3U9SA 4YR2A 3K5IA 4U7CA 5LMUH 3RBDA 3EYYA 2WTFA 3JSNA 1KC7A 1N56A 2VZCA 4HNTA 1Y1WA 5K2MA 1WYMA 2ZM6H 5EWEA 3G8CA 2AQ4A 5J8EA 2PN1A 3LWBA 4AYBA 5GONF 1UC8A 1E4EB 3MFIA 3G6VA 1J5EH 4IRCA 1TWFA 3L4KA 5D1OA 2JA5G 4PWQA 2VQDA 5LOVF 3VPCA 4DV3H 1TA8A 4JI2H 3N44B 1RT8A 5DQIA 3HOCA 4RB3C 5A37A 1M0WA 4QW9A 2W8KA 4EBCA 4JI3H 2VE7A 2W6ZA 3PW4A 5D1PA 4OX9H 2ASJA 2UUCH 4LF9H 4BWSC 1P8LA 4Q8FA 5KFNA 1Z2PX 3JAKM 5HV6A 3CO1A 3PZPA 1TAEA 2W7OA 3MWMA 4RAZA 4YJ2F 2W9CA 3HOXG 1WYRA 3QZ8A 3T5LA 1WYLA 2RF4A 3BQ1A 3Q8RB 4Y8VB 2GPSA 2IA6A 4JV5H 3VPDA 4DV6H 5KFTA 1H67A 2FMAA 4NLGA 1TWGA 2R82A 4TQRA 2EQOA 4RUAA 3M9NB 2VQFH 2D89A 3KMUB 4L1KA 3PR4A 4J9NA 1S9FA 2JA5A 1XMOH 3MFHA 2Y0SA 4LMYA 3JRXA 3HKZA 5IP9G 2BR0A 1EUCB 3N42B 4YR0A 1HNWH 3RF2A 3PN1A 5KFVA 3TIGA 1P5SA 3PW0A 2FJZA 2R0OA 4RNOA 2CZGA 2YW2A 4EG0A 4HYKA 4DUZH 5J2TF 4EDNA 2W8LA 2B63A 2V9WA 1DIKA 4O2AF 4LVRA 5FPRA 5IYDG 2C2EA 4LFBH 3HOVG 4I50F 2UVWA 3KAJA 4DV5H 1EYZA 5KG2A 5KT4A 3VP7A 2BQUA 4O3QA 1DV1A 1UJOA 3BA9A 5L1KA 2R8UA 4JI5H 3RFCA 5C1PA 2W6MA 3GV8B 2IBKA 2O03A 2VZGB 2SCUB 4ECRA 2V58A 3PVXA 2YRNA 2C22A 4A2AA 3JSLA 5BR8H 2E2IA 4IZOA 1JDEA 4ECZA 2RDIA 3KALA 4Q43A 4RZQA 5KFHA 2KSWA 2ATLA 3RV3A 1TWHA 2YZGA 2VQEH 1AA2A 1A9XA 3H4BA 2XCLA 4TXIA 5IP7G 2XCAA 2W7PA 5H80A 4AYBE 4ECVA 2QYZA 4LF7H 2JA6A 1S0OA 2OH2A 2ZDQA 2EE7A 3RJ0A 4QWDA 4BY1G 3SE7A 2JEJA 4APMA 2VPQA 4E4TA 1WSCA 3V6HA 1V4YA 3TQ1A 5C4XG 1RYSA 4LF4H 2R92G 3T1HH 3LMLA 4UCOA 2FK3A 2W9BB 5FPOA 2R8IA 1WIXA 4ED8A 3T5HA 2ASLA 5C8YF 1E4EA 3F7PA 3GIDA 4A3CG 1AOAA 1XNQH 5EOYA 2D86A 3FERA 2R7LA 2XCPA 4MA5A 4LSAA 2AGPA 4O3SA 1SCUB 1UNNC 4JI4H 4X62H 2UVUA 5FLXW 1JKJB 1PA7A 2WAQE 1Y1WG 5L0OA 1N48A 3DF7A 1DV2A 4PDBA 5C1OA 4NXMH 4B3SH 1GSOA 1JDBB 4A3GG 1JLLB 5KFAA 4B3MH 2FE3A 4I7HA 3KHHA 3RB4A 2WB1A 1JXLA 2E5LH 3GTOA 1N32H 1M6VA 1BGWA 2VR1A 4CC5A 5KFFA 4A3DG 1KJ9A 1EZ1A 5JH7F 3Q8PB 3RGZA 4EYHB 4LFCH 4DR6H 2R92A 1Z2OX 2HJWA 3RB6A 1UC9A 4C2MA 4DV0H 4TV8F 4CC6A 5BVRA 1QAGA 5IYZF 5KFKA 1WYQA 1RJPA 3U9TA 3VMMA 3GTMA 4DR5H 1I3QA 4DL5A 3PW7A 2X0SA 2WFNA 1RYRA 3H0GG 2WA5A 3GIQA 4A3EG 4EGQA 3J81W 5LP6F 5C5JA 2R8KA 5L9XA 4GKJH 4MV1A 3GTPA 4DDPA 2WA6A 1VBHA 4O4HF 4MAMA 4JI1H 5EZYF 4DV7H 4LH6A 4XYMB 2V4RA 4DR3H 3PW5A 4QIWA 4DV4H 2DPIA 5KT5A 5KFZA 3QZ7A 2GLTA 3CVZA 3GILA 3RTXA 2UXBH 2NVXA 2R7MA 1I94H 4ME6A 4DR7H 5FD5A 1WH2A 2C2RA 4GKKH 3E5NA 2WDTA
chains in the Genus database with same CATH topology
3H20A 3BA8A 1MZBA 3N42B 1HNXH 3JAMW 2MCTA 3RF2A 3PN1A 1HNWH 4MTEA 3L4JA 3KXYT 1N34H 2UU9H 1EUVA 2HVQA 2HL9A 1S03G 4DUZH 1HNZH 4ETSA 1FKAH 4JI6H 5IT9W 4LVRA 5FPRA 4DV1H 4LFBH 1L2ZA 4YHHH 4EEQA 3HXLA 1FJGH 3KAJA 4UCUA 4DV5H 1N36H 3VP7A 5A2QW 1XMQH 4LF5H 4A2BA 3BA9A 1X9NA 4B3TH 2VOBA 3N40P 4EFBA 4JI5H 2VUGA 4FM9A 3IG0A 3J80W 4RB0A 2UXCH 2O03A 5LL6b 4UCRA 4A2AA 4M7EA 3JSLA 5BR8H 4RB2C 3C0FB 3K3VA 4KHPH 3KALA 2HVSA 4RZQA 4R7RA 3UQ8A 2KSWA 1B04A 3RIZA 4LSXA 3FMAA 2VQEH 5FMUA 1ZHQA 2IGPA 4LH7A 4K0KH 2HKPA 4LF7H 1SEIA 1E4FT 4DUYH 1Z2NX 4JI8H 1O75A 4LFAH 3N6XA 4MV7A 3RJ0A 4DR2H 2HL8A 4MTDA 3N41B 4APMA 4X64H 4MV9A 1BJTA 3OTOH 4AQYH 4JI0H 1IBLH 4LF8H 4JYAH 4LF4H 1AN7A 4GKKH 3T1HH 3LMLA 1V9PA 4UCOA 4LF6H 5FPOA 2VPSA 4GLXA 3KAKA 3BABA 2RGVA 2HHHH 2RGRA 3J7AK 1XNQH 4NXNH 5EOYA 3F8NA 4UCTA 4JI7H 4RB1A 1GYFA 2HGSA 2ZJTA 4LSAA 4JI4H 4X62H 1S68A 4DR1H 4UCSA 2WE6A 5FLXW 5LMUH 3EYYA 3L2PA 3JSNA 3DF7A 1IBMH 5LMNH 4PDBA 4X65H 1E4GT 2ZM6H 1SYXB 5FD6A 4NXMH 2HVRA 1I6UA 2UXDH 2W57A 1XDNA 1IBKH 4B3SH 4YY3H 4LVPA 1J5EH 4B3MH 2FE3A 4I7HA 2YCHA 3BAAA 2XIGA 3L4KA 1ZHSA 5D1OA 2E5LH 1N32H 1BGWA 4CC5A 4DR4H 2CW8A 4LFCH 3RGZA 4DR6H 4DV3H 1TA8A 1Z2OX 3M4IA 3N44B 4JI2H 4RB3C 4DV2H 1M0WA 4DV0H 4CC6A 4Q0YA 2F4VH 4X66H 4JI3H 2VE7A 1FVIA 4UFZA 3T1YH 1M0TA 5D1PA 4DR5H 4EFEA 4OX9H 4B3RH 2UUCH 4LF9H 4BWSC 1P8LA 1Z2PX 4UCVA 3J81W 2Q2UA 4GKJH 1TAEA 2UUAH 1A0IA 2CW7A 3MWMA 4DDPA 1VS0A 4RAZA 4IAJA 5D1OB 4JI1H 5FMTA 3RGXA 1N33H 4DV7H 2WYOA 4J0MA 4LH6A 1XNRH 4DR3H 2OWOA 4JV5H 5IWAH 4DV4H 4DV6H 1HR0H 2UUBH 1DGSA 2Q2TA 2VE7C 3CVZA 2UXBH 3N43B 2EQOA 3RTXA 4RAYA 1I94H 2VQFH 4DR7H 5FD5A 1WH2A 1XMOH 3EAYA 4LMYA 2WDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 5CB4 F;  2YYA A;  4YJ3 F;  4C5A A;  4Q45 A;  2NU8 B;  1BXR A;  3GIJ A;  1GGO A;  3ETJ A;  3HOY G;  2HVQ A;  2HL9 A;  2J6U A;  4YBZ B;  3OSN A;  3BQ0 A;  4IRD A;  5I47 A;  1I7N A;  4A3I G;  5EWF A;  4DL2 A;  3H0G A;  2B63 G;  2VUM A;  4EBE A;  3R5F A;  1FKA H;  4JI6 H;  2FPI B;  2JEF A;  1ULZ A;  5LYJ F;  3R23 A;  3RB0 A;  4HR7 A;  3RB3 A;  1N36 H;  1EUD B;  4F4W A;  1X9N A;  3GLK A;  4MV3 A;  2NUA B;  5FLM G;  4IR9 A;  2XGP A;  2UXC H;  2FK2 A;  3IG0 A;  1PK8 A;  3JRW A;  1P2X A;  4IRK A;  5JUM A;  2R7K A;  2V59 A;  4M7E A;  2XGQ A;  1T94 A;  1Y1V A;  1KJ8 A;  1WR2 A;  4RB2 C;  2XC9 A;  3GV5 B;  3K3V A;  5T14 A;  2HVS A;  4Q59 A;  1VKZ A;  2PMZ E;  3FKI A;  1B04 A;  3UQ8 A;  1CQJ B;  3RIZ A;  4LSX A;  2W6N A;  4Q58 A;  2W9B A;  4J9R A;  4ECT A;  3V6K A;  4I55 F;  3HOP A;  1KJI A;  4LH7 A;  5DG9 A;  3Q1K A;  2JA6 G;  5BPH A;  1SEI A;  2E2H A;  2D88 A;  2GPW A;  4JI8 H;  2WB1 E;  1O75 A;  5KG3 A;  4LFA H;  4MV7 A;  2NU9 B;  2R7Z A;  4DR2 H;  1AUX A;  4MTD A;  2XD4 A;  3N41 B;  1KEE A;  4JV1 A;  4JV2 A;  3OHA A;  4A3L G;  2NU6 B;  3OTO H;  4AQY H;  4JI0 H;  3RAQ A;  4LF8 H;  1SFO A;  3CQZ A;  1R9T A;  1V9P A;  3JAR M;  4J9Q A;  5IYB G;  2VPS A;  5F9L A;  4GLX A;  4ED2 A;  2I8C A;  3OHB A;  4BBR G;  2RGR A;  3LP8 A;  4ECS A;  4F4Y A;  4IWX A;  4JI7 H;  3MR5 A;  2DIK A;  5CA1 F;  4IHJ F;  2EYN A;  5KG6 A;  4YQW A;  4R8U B;  5KFQ A;  2JA7 A;  2DZD A;  2R8G A;  4YAK B;  4DR1 H;  2E9K A;  4ZQI A;  4UCS A;  2WE6 A;  2W9A A;  2CKZ B;  4WBN F;  3L2P A;  5L1L A;  2J6T A;  5LMN H;  1E4G T;  5KFM A;  1W93 A;  2PVP A;  5FD6 A;  3OUZ A;  2W57 A;  1XDN A;  3VPB A;  4F4Z A;  3V4S A;  5DQH A;  2YZM A;  4YY3 H;  2IMW P;  4IR1 A;  1KJQ A;  5CAE B;  5DQG A;  2YCH A;  3BAA A;  1GLV A;  3I6X A;  3K3P A;  4ZHQ F;  1WKU A;  4FBU A;  5JVL A;  1CQI B;  5BMV F;  4DR4 H;  3ORQ A;  3JZI A;  2R86 A;  4TQS A;  4ECY A;  4BY7 G;  3M4I A;  4QWB A;  4DV2 H;  5DGA A;  5L1J A;  4Q0Y A;  3TII A;  1MB8 A;  3WNZ A;  2D87 A;  2FPP B;  4X66 H;  4RNN A;  3SI8 A;  2NU7 B;  2AGQ A;  4UFZ A;  3T1Y H;  1M0T A;  2V5A A;  2YL2 A;  3R5H A;  4B3R H;  1IOV A;  4TV9 F;  4F50 A;  4FS1 A;  4UCV A;  5KG7 A;  2Q2U A;  3T5K A;  4YR3 A;  1EHI A;  2UUA H;  2DK9 A;  1V51 A;  4IAJ A;  3AYH B;  5KFB A;  4Q57 B;  4M9U A;  1TJT A;  1BHD A;  5FMT A;  1N33 H;  3ETH A;  1B33 N;  1KJJ A;  1S0M A;  2JEI A;  4J0M A;  5F9N A;  4EEY A;  2OWO A;  1XNR H;  5IWA H;  1S0N A;  2Y0S E;  1DGS A;  2Q2T A;  2VE7 C;  2UVV A;  3HKZ E;  3R5X A;  3N43 B;  4GC7 A;  2W70 A;  5JQW A;  2YZN A;  3MWE A;  4RAY A;  3HB9 A;  4MV8 A;  4QW8 A;  3GV7 B;  2BQ3 A;  4HNV A;  1JX4 A;  1MZB A;  4A3F G;  3HOR A;  5KFP A;  1PXY A;  3L4J A;  2AU0 A;  2J9G A;  3KXY T;  5DGB A;  1Y14 B;  1EUV A;  4ED0 A;  2RR8 A;  1S03 G;  3Q8S B;  2VUM G;  2AGO A;  4ECQ A;  2ALZ A;  4F4X A;  3GIK A;  5KFC A;  4YHH H;  1BNC A;  1K1S A;  1IOW A;  4EEQ A;  3QFF A;  4EDM A;  4UCU A;  1FJG H;  2W6Q A;  3GIP A;  4YB8 B;  1JIH A;  3RUP A;  5KG1 A;  4A2B A;  4XYL B;  5A38 A;  4LF5 H;  4B3T H;  3GTK A;  4ED7 A;  2RDJ A;  2VOB A;  1GSA A;  3N40 P;  4EFB A;  2VUG A;  4Q44 A;  1S10 A;  2YS6 A;  4IWY A;  4UCR A;  5KFU A;  1TWC A;  1Y1V G;  1DXX A;  1ZQ7 A;  4YP3 A;  3OUU A;  3G6Y A;  4XX0 B;  3C0F B;  4J9P A;  4KHP H;  3FKI G;  3REP B;  1SH6 A;  2VA2 A;  3FMA A;  3RAX A;  5FMU A;  4EGJ A;  5KFW A;  1RJQ A;  5KFI A;  1E4F T;  3MWD A;  2R7N A;  1Z2N X;  2CQY A;  4DUY H;  4ED6 A;  5DG7 A;  1WYO A;  2R7Z G;  5KT2 A;  3N6X A;  2R8H A;  3KHR A;  2HL8 A;  4R8U A;  1I7L A;  1RJR A;  5KFO A;  5KFE A;  4JUZ A;  3TIN A;  2FP4 B;  4X64 H;  4MV9 A;  2FLP A;  1T36 A;  2DLN A;  5C3E G;  2FLL A;  3H4D A;  2R84 A;  1IBL H;  1AN7 A;  5JVD F;  1K83 A;  1VBG A;  3HOU G;  3G6X A;  4MV4 A;  3BAB A;  2RGV A;  3HOW G;  3PW2 A;  3V6J A;  2BQR A;  2K3S A;  2C35 B;  4ED1 A;  3J7A K;  3N8D A;  4NXN H;  4J9K A;  4UCT A;  4WD3 A;  1GYF A;  5KT6 A;  2DWC A;  4YAJ B;  3EPG A;  3H3V H;  3TQT A;  5KFX A;  4QWA A;  2JA7 G;  1WJO A;  5KG4 A;  2EYI A;  1S68 A;  3RBE A;  3MR3 A;  1M7J A;  4QWC A;  4TUY F;  4GC6 A;  1IBM H;  1C30 A;  2PBZ A;  4O3O A;  3V4Z A;  4X65 H;  1SYX B;  4O3P A;  4J9O A;  1T3N A;  2HVR A;  1I6U A;  2UXD H;  4EYI B;  1IBK H;  4DL3 A;  4MA0 A;  1UEG A;  2VZD A;  4LVP A;  2WAQ A;  4ECX A;  2C28 A;  5LXT F;  3PO2 G;  2XIG A;  1ZHS A;  2P0A A;  2I80 A;  4RU9 A;  2VA3 A;  2CW8 A;  4ECU A;  2JA8 G;  2I87 A;  3I4N G;  2YRW A;  4G3I A;  1V5K A;  5BPF A;  1KBL A;  5EDW A;  3T5J A;  2F4V H;  4FS2 A;  1VAJ A;  1CS0 A;  4RNM A;  1FVI A;  3RV4 A;  4B7L A;  2L3G A;  5KG5 A;  4EFE A;  4O3R A;  4U6P A;  4O3N A;  4QWE A;  4A3J G;  2FKL A;  4EBD A;  4DL7 A;  3UFX B;  3PR5 B;  2M05 A;  5KFY A;  4O4L F;  4QIW E;  1A0I A;  2CW7 A;  5KFS A;  4ZI7 F;  1VS0 A;  4A3M G;  2C2D A;  2UVR A;  2R8J A;  5A4B A;  1AUV A;  5D1O B;  3EPI A;  3RGX A;  1WCM G;  2WYO A;  2R93 G;  1RK6 A;  3GTJ A;  2QK4 A;  4O2B F;  5KKN B;  5J2U F;  1HR0 H;  2UUB H;  4Q8E A;  5KT3 A;  4QJF A;  2YS7 A;  3HOZ G;  4TXK A;  3GTL A;  2ZDH A;  5A36 A;  1SH5 A;  3GII A;  2J6S A;  3EAY A;  5KFD A;  4DLK A;  2FK1 A;  3BA8 A;  3H20 A;  3M9O B;  1HNX H;  2YU9 A;  3JAM W;  2MCT A;  3OSP A;  3GTQ A;  4A3K G;  4A3B G;  5D8D A;  4MTE A;  3I4M G;  2V4Q A;  2W9C B;  4EDL A;  1B6S A;  3GQC A;  4C5B A;  1N34 H;  2UU9 H;  5KG0 A;  2W6O A;  4MV6 A;  3WO1 A;  4J9M A;  5HBR B;  1HNZ H;  3GTG A;  3I12 A;  4ETS A;  4XZ3 B;  3BQ2 A;  5IT9 W;  5C44 G;  3MR2 A;  3KMW B;  4DV1 H;  1L2Z A;  2FLN A;  2DPJ A;  1RK5 A;  5IYC G;  3HXL A;  1WYP A;  1CE8 A;  3Q2O A;  3M9M B;  5A2Q W;  1XMQ H;  5LA6 F;  1I50 A;  5DLG A;  4BBS G;  5KFR A;  1WCM A;  3JAL M;  2YRX A;  1S97 A;  2R93 A;  1VKA A;  2IP4 A;  2QJX A;  5FJ8 G;  2W71 A;  4FM9 A;  3J80 W;  2ASD A;  4RB0 A;  4ED3 A;  2W6P A;  5LL6 b;  4J9S A;  4ECW A;  3IN5 A;  2R6F A;  1GO3 E;  3FDS A;  2JEG A;  1TWA A;  2QJZ A;  4R7R A;  2FB9 A;  4FU0 A;  5KFL A;  4HNU A;  1ZHQ A;  4RZR A;  2IGP A;  2ZDG A;  4C5C A;  2JV9 A;  4K0K H;  4DL4 A;  5KFG A;  4A93 G;  2HKP A;  3K5H A;  2WA7 A;  2PMZ A;  3WO0 A;  2R87 A;  5CA0 F;  1BKR A;  1W96 A;  3ORR A;  5EWG A;  1ZET A;  4J9L A;  1BJT A;  3KHG A;  1PX2 A;  5KT7 A;  4ZOL F;  3Q8Q B;  2OLS A;  4I4T F;  4JYA H;  4HQ6 A;  3KY9 A;  2NVY A;  3GIM A;  2C00 A;  3HBL A;  3KTM A;  1GSH A;  3H40 A;  3BG5 A;  4LF6 H;  2D85 A;  2VZI B;  3KAK A;  1K1Q A;  4JV0 A;  3MR6 A;  1C3O A;  3NGD A;  3KHL A;  2HHH H;  4FBT A;  2R85 A;  3MJF A;  1WYN A;  4O4I F;  5KFJ A;  2FPG B;  5DLF A;  3F8N A;  4DL6 A;  2K2R A;  4RB1 A;  4BXX G;  2HGS A;  2ZJT A;  3BJY A;  1OWT A;  5DG8 A;  4RUC A;  5L1I A;  3PO3 G;  5KX5 F;  1B6R A;  3U9S A;  4YR2 A;  3K5I A;  4U7C A;  5LMU H;  3RBD A;  3EYY A;  2WTF A;  3JSN A;  1KC7 A;  1N56 A;  2VZC A;  4HNT A;  1Y1W A;  5K2M A;  1WYM A;  2ZM6 H;  5EWE A;  3G8C A;  2AQ4 A;  5J8E A;  2PN1 A;  3LWB A;  4AYB A;  5GON F;  1UC8 A;  1E4E B;  3MFI A;  3G6V A;  1J5E H;  4IRC A;  1TWF A;  3L4K A;  5D1O A;  2JA5 G;  4PWQ A;  2VQD A;  5LOV F;  3VPC A;  4DV3 H;  1TA8 A;  4JI2 H;  3N44 B;  1RT8 A;  5DQI A;  3HOC A;  4RB3 C;  5A37 A;  1M0W A;  4QW9 A;  2W8K A;  4EBC A;  4JI3 H;  2VE7 A;  2W6Z A;  3PW4 A;  5D1P A;  4OX9 H;  2ASJ A;  2UUC H;  4LF9 H;  4BWS C;  1P8L A;  4Q8F A;  5KFN A;  1Z2P X;  3JAK M;  5HV6 A;  3CO1 A;  3PZP A;  1TAE A;  2W7O A;  3MWM A;  4RAZ A;  4YJ2 F;  2W9C A;  3HOX G;  1WYR A;  3QZ8 A;  3T5L A;  1WYL A;  2RF4 A;  3BQ1 A;  3Q8R B;  4Y8V B;  2GPS A;  2IA6 A;  4JV5 H;  3VPD A;  4DV6 H;  5KFT A;  1H67 A;  2FMA A;  4NLG A;  1TWG A;  2R82 A;  4TQR A;  2EQO A;  4RUA A;  3M9N B;  2VQF H;  2D89 A;  3KMU B;  4L1K A;  3PR4 A;  4J9N A;  1S9F A;  2JA5 A;  1XMO H;  3MFH A;  2Y0S A;  4LMY A;  3JRX A;  3HKZ A;  5IP9 G;  2BR0 A;  1EUC B;  3N42 B;  4YR0 A;  1HNW H;  3RF2 A;  3PN1 A;  5KFV A;  3TIG A;  1P5S A;  3PW0 A;  2FJZ A;  2R0O A;  4RNO A;  2CZG A;  2YW2 A;  4EG0 A;  4HYK A;  4DUZ H;  5J2T F;  4EDN A;  2W8L A;  2B63 A;  2V9W A;  1DIK A;  4O2A F;  4LVR A;  5FPR A;  5IYD G;  2C2E A;  4LFB H;  3HOV G;  4I50 F;  2UVW A;  3KAJ A;  4DV5 H;  1EYZ A;  5KG2 A;  5KT4 A;  3VP7 A;  2BQU A;  4O3Q A;  1DV1 A;  1UJO A;  3BA9 A;  5L1K A;  2R8U A;  4JI5 H;  3RFC A;  5C1P A;  2W6M A;  3GV8 B;  2IBK A;  2O03 A;  2VZG B;  2SCU B;  4ECR A;  2V58 A;  3PVX A;  2YRN A;  2C22 A;  4A2A A;  3JSL A;  5BR8 H;  2E2I A;  4IZO A;  1JDE A;  4ECZ A;  2RDI A;  3KAL A;  4Q43 A;  4RZQ A;  5KFH A;  2KSW A;  2ATL A;  3RV3 A;  1TWH A;  2YZG A;  2VQE H;  1AA2 A;  1A9X A;  3H4B A;  2XCL A;  4TXI A;  5IP7 G;  2XCA A;  2W7P A;  5H80 A;  4AYB E;  4ECV A;  2QYZ A;  4LF7 H;  2JA6 A;  1S0O A;  2OH2 A;  2ZDQ A;  2EE7 A;  3RJ0 A;  4QWD A;  4BY1 G;  3SE7 A;  2JEJ A;  4APM A;  2VPQ A;  4E4T A;  1WSC A;  3V6H A;  1V4Y A;  3TQ1 A;  5C4X G;  1RYS A;  4LF4 H;  2R92 G;  3T1H H;  3LML A;  4UCO A;  2FK3 A;  2W9B B;  5FPO A;  2R8I A;  1WIX A;  4ED8 A;  3T5H A;  2ASL A;  5C8Y F;  1E4E A;  3F7P A;  3GID A;  4A3C G;  1AOA A;  1XNQ H;  5EOY A;  2D86 A;  3FER A;  2R7L A;  2XCP A;  4MA5 A;  4LSA A;  2AGP A;  4O3S A;  1SCU B;  1UNN C;  4JI4 H;  4X62 H;  2UVU A;  5FLX W;  1JKJ B;  1PA7 A;  2WAQ E;  1Y1W G;  5L0O A;  1N48 A;  3DF7 A;  1DV2 A;  4PDB A;  5C1O A;  4NXM H;  4B3S H;  1GSO A;  1JDB B;  4A3G G;  1JLL B;  5KFA A;  4B3M H;  2FE3 A;  4I7H A;  3KHH A;  3RB4 A;  2WB1 A;  1JXL A;  2E5L H;  3GTO A;  1N32 H;  1M6V A;  1BGW A;  2VR1 A;  4CC5 A;  5KFF A;  4A3D G;  1KJ9 A;  1EZ1 A;  5JH7 F;  3Q8P B;  3RGZ A;  4EYH B;  4LFC H;  4DR6 H;  2R92 A;  1Z2O X;  2HJW A;  3RB6 A;  1UC9 A;  4C2M A;  4DV0 H;  4TV8 F;  4CC6 A;  5BVR A;  1QAG A;  5IYZ F;  5KFK A;  1WYQ A;  1RJP A;  3U9T A;  3VMM A;  3GTM A;  4DR5 H;  1I3Q A;  4DL5 A;  3PW7 A;  2X0S A;  2WFN A;  1RYR A;  3H0G G;  2WA5 A;  3GIQ A;  4A3E G;  4EGQ A;  3J81 W;  5LP6 F;  5C5J A;  2R8K A;  5L9X A;  4GKJ H;  4MV1 A;  3GTP A;  4DDP A;  2WA6 A;  1VBH A;  4O4H F;  4MAM A;  4JI1 H;  5EZY F;  4DV7 H;  4LH6 A;  4XYM B;  2V4R A;  4DR3 H;  3PW5 A;  4QIW A;  4DV4 H;  2DPI A;  5KT5 A;  5KFZ A;  3QZ7 A;  2GLT A;  3CVZ A;  3GIL A;  3RTX A;  2UXB H;  2NVX A;  2R7M A;  1I94 H;  4ME6 A;  4DR7 H;  5FD5 A;  1WH2 A;  2C2R A;  4GKK H;  3E5N A;  2WDT A; 
#chains in the Genus database with same CATH homology
 3H20 A;  3BA8 A;  1MZB A;  3N42 B;  1HNX H;  3JAM W;  2MCT A;  3RF2 A;  3PN1 A;  1HNW H;  4MTE A;  3L4J A;  3KXY T;  1N34 H;  2UU9 H;  1EUV A;  2HVQ A;  2HL9 A;  1S03 G;  4DUZ H;  1HNZ H;  4ETS A;  1FKA H;  4JI6 H;  5IT9 W;  4LVR A;  5FPR A;  4DV1 H;  4LFB H;  1L2Z A;  4YHH H;  4EEQ A;  3HXL A;  1FJG H;  3KAJ A;  4UCU A;  4DV5 H;  1N36 H;  3VP7 A;  5A2Q W;  1XMQ H;  4LF5 H;  4A2B A;  3BA9 A;  1X9N A;  4B3T H;  2VOB A;  3N40 P;  4EFB A;  4JI5 H;  2VUG A;  4FM9 A;  3IG0 A;  3J80 W;  4RB0 A;  2UXC H;  2O03 A;  5LL6 b;  4UCR A;  4A2A A;  4M7E A;  3JSL A;  5BR8 H;  4RB2 C;  3C0F B;  3K3V A;  4KHP H;  3KAL A;  2HVS A;  4RZQ A;  4R7R A;  3UQ8 A;  2KSW A;  1B04 A;  3RIZ A;  4LSX A;  3FMA A;  2VQE H;  5FMU A;  1ZHQ A;  2IGP A;  4LH7 A;  4K0K H;  2HKP A;  4LF7 H;  1SEI A;  1E4F T;  4DUY H;  1Z2N X;  4JI8 H;  1O75 A;  4LFA H;  3N6X A;  4MV7 A;  3RJ0 A;  4DR2 H;  2HL8 A;  4MTD A;  3N41 B;  4APM A;  4X64 H;  4MV9 A;  1BJT A;  3OTO H;  4AQY H;  4JI0 H;  1IBL H;  4LF8 H;  4JYA H;  4LF4 H;  1AN7 A;  4GKK H;  3T1H H;  3LML A;  1V9P A;  4UCO A;  4LF6 H;  5FPO A;  2VPS A;  4GLX A;  3KAK A;  3BAB A;  2RGV A;  2HHH H;  2RGR A;  3J7A K;  1XNQ H;  4NXN H;  5EOY A;  3F8N A;  4UCT A;  4JI7 H;  4RB1 A;  1GYF A;  2HGS A;  2ZJT A;  4LSA A;  4JI4 H;  4X62 H;  1S68 A;  4DR1 H;  4UCS A;  2WE6 A;  5FLX W;  5LMU H;  3EYY A;  3L2P A;  3JSN A;  3DF7 A;  1IBM H;  5LMN H;  4PDB A;  4X65 H;  1E4G T;  2ZM6 H;  1SYX B;  5FD6 A;  4NXM H;  2HVR A;  1I6U A;  2UXD H;  2W57 A;  1XDN A;  1IBK H;  4B3S H;  4YY3 H;  4LVP A;  1J5E H;  4B3M H;  2FE3 A;  4I7H A;  2YCH A;  3BAA A;  2XIG A;  3L4K A;  1ZHS A;  5D1O A;  2E5L H;  1N32 H;  1BGW A;  4CC5 A;  4DR4 H;  2CW8 A;  4LFC H;  3RGZ A;  4DR6 H;  4DV3 H;  1TA8 A;  1Z2O X;  3M4I A;  3N44 B;  4JI2 H;  4RB3 C;  4DV2 H;  1M0W A;  4DV0 H;  4CC6 A;  4Q0Y A;  2F4V H;  4X66 H;  4JI3 H;  2VE7 A;  1FVI A;  4UFZ A;  3T1Y H;  1M0T A;  5D1P A;  4DR5 H;  4EFE A;  4OX9 H;  4B3R H;  2UUC H;  4LF9 H;  4BWS C;  1P8L A;  1Z2P X;  4UCV A;  3J81 W;  2Q2U A;  4GKJ H;  1TAE A;  2UUA H;  1A0I A;  2CW7 A;  3MWM A;  4DDP A;  1VS0 A;  4RAZ A;  4IAJ A;  5D1O B;  4JI1 H;  5FMT A;  3RGX A;  1N33 H;  4DV7 H;  2WYO A;  4J0M A;  4LH6 A;  1XNR H;  4DR3 H;  2OWO A;  4JV5 H;  5IWA H;  4DV4 H;  4DV6 H;  1HR0 H;  2UUB H;  1DGS A;  2Q2T A;  2VE7 C;  3CVZ A;  2UXB H;  3N43 B;  2EQO A;  3RTX A;  4RAY A;  1I94 H;  2VQF H;  4DR7 H;  5FD5 A;  1WH2 A;  1XMO H;  3EAY A;  4LMY A;  2WDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...