2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
b'DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
source organism Plasmodium falciparum
molecule tags Hydrolase/protein binding
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
2RF4A 4IHJF 4HNVA 2B63G 3R5XA 3JAKM 2HL9A 5H80A 2R8JA 3MWEA 4F4ZA 2EYIA 4EDLA 3VP7A 3BG5A 1I7NA 2BR0A 2QJZA 1WSCA 2CKZB 3BQ1A 1MZBA 2WAQE 3RBDA 4B3TH 3PN1A 3G8CA 2VZIB 5C1OA 1KC7A 1I3QA 4A3FG 4LF8H 4A3DG 4MTEA 5A36A 4DR7H 1GSAA 4O4HF 1Y1VG 3JSLA 4R8UA 4EFBA 4Q43A 4QWCA 5IYZF 3UQ8A 5KFDA 4ME6A 5DGBA 3GIDA 5KG4A 1GSHA 5KFVA 3RB3A 2V4RA 4F4XA 5KFYA 2WFNA 1HNXH 5DG7A 2HVQA 3BAAA 4C5BA 5KFEA 2ASJA 1FKAH 5KG6A 3Q8SB 4DV5H 1N32H 2Y0SE 4DR5H 2W6OA 4RZQA 1SFOA 3PO2G 1XMOH 3HOPA 4YQWA 3MJFA 2IMWP 2FMAA 2WA6A 2YZMA 4U6PA 5C8YF 2W57A 3PW4A 3I6XA 4LVPA 2XIGA 4ED7A 3V4ZA 3K3PA 4Q0YA 4GC7A 2E2IA 2ZDQA 2RGRA 2O03A 4QWEA 3T1YH 3TINA 4J9QA 2NUAB 2VA3A 2FPIB 1QAGA 1RK6A 4X64H 2WE6A 2ZJTA 2WTFA 3EPGA 1BKRA 1RJRA 2JEIA 4LH7A 5BPHA 1RT8A 3T5HA 4LF9H 2AGQA 3HXLA 2AGOA 4IRCA 5BVRA 1DV1A 2W6PA 1GLVA 1ULZA 3I12A 3MWMA 3RF2A 5KFGA 4TQSA 4ED2A 3PZPA 3U9SA 4J9SA 1N48A 3R23A 2D88A 2WA7A 2DZDA 4O3QA 4FU0A 4DR3H 3RUPA 4U7CA 2FKLA 5DG9A 2W9BA 3EPIA 3Q1KA 3OTOH 4EDNA 2HVSA 4O3PA 2UU9H 3HB9A 3Q2OA 3GIIA 1P8LA 2QYZA 3PR5B 3NGDA 3V6HA 4GC6A 3L4KA 3L4JA 5KFPA 5A38A 5D1OA 1WH2A 5C44G 3FDSA 4DL4A 2R85A 5I47A 1WCMG 2UVUA 4YBZB 3M4IA 3QZ7A 4MAMA 3JRWA 4DL2A 1W93A 3J80W 2AQ4A 2DPIA 2XCPA 4Q59A 5KT6A 4Q44A 5EWEA 4DV6H 1DV2A 2JA5G 1AUVA 2PBZA 4BXXG 5DGAA 3ORRA 2WAQA 4I4TF 4ECWA 3OSNA 4JI7H 3HOZG 2R0OA 5LYJF 4X65H 3GTJA 2NVXA 4TXIA 5BPFA 4RUAA 1I6UA 3PW0A 4YR0A 2VQFH 4EG0A 4DR6H 4ECTA 2R7KA 4XYMB 4MV4A 1VKZA 1AOAA 4UCUA 3ORQA 2J6SA 5KFOA 2PN1A 5FLMG 1WIXA 3RGXA 2UVRA 4A3JG 2BQRA 4DR4H 2FJZA 2Y0SA 3Q8QB 2CW7A 4CC6A 4WBNF 5DG8A 3N41B 3J7AK 5KFQA 5KG5A 1VAJA 4JYAH 4QJFA 2JEGA 4LFAH 3N40P 2J9GA 2W7OA 4F4YA 2L3GA 4MA0A 4MV9A 4E4TA 4LSAA 5KT4A 2FK3A 3WO1A 4B3MH 4LFBH 1P2XA 1A0IA 1C3OA 1RJQA 1VBGA 4BY1G 5DQGA 2W9CB 3K3VA 4A3BG 4ECSA 4UCSA 5EDWA 3KMWB 3ETJA 5IP9G 1SH6A 3HKZE 4RB0A 1SH5A 5C1PA 2FK2A 1JDEA 3KALA 3H3VH 5FLXW 1E4EB 1Y1WA 2R8IA 2VE7C 4ZOLF 2VUMA 2CZGA 4CC5A 3PR4A 1KJJA 2WDTA 2XCLA 4PWQA 1SEIA 2VPSA 3GIQA 1WYQA 4FBTA 1Y14B 3KAKA 5IYCG 4A3LG 2W6QA 2V9WA 4GKKH 2UVWA 2YS7A 4ED8A 2ATLA 1N33H 3G6YA 5KFUA 2GPWA 3RB6A 4DV4H 2FPPB 4RNNA 1K1SA 5EOYA 4LF5H 3KHLA 2D85A 4HR7A 3RV3A 4QW9A 5FD6A 2ZM6H 2R92A 4DR2H 4LVRA 1R9TA 3JAMW 5IT9W 1M0WA 5LXTF 4M7EA 4A3EG 1GO3E 3BQ2A 1JDBB 1I7LA 1H67A 3GQCA 3JALM 3MR5A 5LP6F 4Y8VB 4K0KH 5C4XG 4ETSA 2W7PA 1UEGA 2SCUB 2YCHA 4EFEA 3RGZA 1L2ZA 2IGPA 4IR1A 1S0MA 2C22A 3G6XA 4TXKA 2Q2UA 2VZDA 1ZHSA 3H0GA 5IP7G 4A3CG 1WYLA 2PMZE 1S03G 5L1KA 2D86A 1BNCA 2NU8B 3RBEA 5KFHA 1SCUB 2JA6A 4APMA 2EYNA 3N43B 5EWGA 2R7LA 2W8KA 4EYHB 1AA2A 4RNMA 3BABA 2DPJA 2XC9A 4ZHQF 5IWAH 2RDJA 4DUZH 3GIJA 2B63A 4YJ3F 1CQJB 2DLNA 3GV5B 3MR6A 4LMYA 4GLXA 5HV6A 1MB8A 3C0FB 2FLLA 2XD4A 2VQEH 2ASLA 1WYMA 1V51A 4DL5A 4ECZA 4A3IG 4ED0A 2QK4A 4FBUA 3Q8RB 3T5LA 1JKJB 3AYHB 4EGQA 2FLPA 1FJGH 2E5LH 5JH7F 2VR1A 2W6MA 5JVDF 3HKZA 2NU6B 1FVIA 4FS2A 4IRKA 5KFAA 3J81W 4RAYA 1I94H 4FS1A 3N6XA 3LWBA 3V6KA 4O3SA 2YZGA 5HBRB 3VMMA 2VPQA 4HQ6A 3RFCA 4EBCA 3PW7A 4L1KA 2V58A 3PO3G 3E5NA 2X0SA 4DL7A 4YY3H 2R7MA 4J9OA 4LF7H 5FMTA 4QW8A 4B7LA 2E9KA 3GIPA 4AQYH 4YR3A 5DQIA 1KJ9A 4R8UB 4LFCH 4DDPA 3TIGA 1T36A 3BA8A 3I4NG 3T5JA 2ZDGA 1WKUA 2AU0A 1IBMH 1AUXA 2NVYA 2V4QA 1CE8A 3GV7B 4BY7G 2W71A 4JV0A 3F7PA 2NU7B 1DXXA 4IWYA 5C5JA 4MV1A 5K2MA 4FM9A 2YZNA 4DL3A 1RYSA 1B6SA 3EYYA 3GLKA 4RB1A 4ECRA 3RB0A 2UVVA 2FE3A 4J9NA 1JXLA 4QWBA 3MR2A 3HOYG 4R7RA 1X9NA 5KT2A 4YP3A 2OLSA 1M7JA 3G6VA 5BR8H 2AGPA 1Z2PX 4JI8H 2R8HA 3KHGA 2W9CA 4M9UA 1E4FT 2PMZA 2HJWA 2UXCH 4O4IF 2MCTA 2R87A 5F9LA 3MFIA 4UCOA 4RNOA 2R7ZA 1V4YA 4XZ3B 2W6NA 3FKIG 3RAXA 1KJ8A 1TA8A 4Q8FA 4EBEA 2UUCH 1WCMA 1S68A 4EEYA 3KHRA 1WYNA 4J9MA 1I50A 1M6VA 3HBLA 4ZQIA 1DGSA 4BBRG 2W9BB 2W70A 1Z2NX 4JI1H 2CW8A 2R93A 3CQZA 1TWAA 2UUAH 4IR9A 4IAJA 3WNZA 4F4WA 5KFFA 4JV2A 3REPB 1AN7A 4C5CA 2YRWA 5KFBA 1V5KA 4TUYF 5KFZA 3OHBA 1HNZH 1Z2OX 3N44B 5D8DA 2VUMG 3GTKA 4UCTA 4JI3H 4TQRA 3PW5A 5D1OB 3TQ1A 3GILA 5CAEB 3EAYA 4X66H 3L2PA 1VS0A 2R7NA 4BWSC 3IN5A 5CA0F 4RU9A 4DV2H 3KXYT 2V5AA 5KFSA 3M9OB 3T5KA 1S97A 3JRXA 3UFXB 3RAQA 5T14A 5LMNH 3GTPA 2ZDHA 3RIZA 1DIKA 4DL6A 4JV5H 2EE7A 3KY9A 1S10A 4GKJH 4J9PA 2K2RA 2YL2A 4DV3H 2C2EA 1UJOA 4A2BA 3OSPA 3K5IA 4ZI7F 4I7HA 1JIHA 3FMAA 4HYKA 4ECXA 1BHDA 2R92G 1BGWA 3WO0A 1B04A 1C30A 1T94A 3PVXA 4O4LF 4O3NA 1WYPA 3H40A 1UC9A 3HOWG 3TIIA 3N42B 4ED3A 5L1IA 2R8GA 5A4BA 4O2AF 2RDIA 3VPBA 1UC8A 5KT3A 4QWAA 4O3OA 4LH6A 1TWGA 3LMLA 2BQ3A 1A9XA 3T1HH 3H0GG 2HVRA 4EGJA 4XX0B 1VKAA 1HR0H 1O75A 5LOVF 3GTLA 1BJTA 4A2AA 5KG1A 5KG3A 5JUMA 3MR3A 3HOUG 2JA6G 5JQWA 4DR1H 1K83A 4MV7A 5DQHA 5FPRA 2FP4B 4RZRA 4NLGA 4I55F 3DF7A 4O2BF 1IBLH 2IBKA 2JA8G 4KHPH 1WR2A 3TQTA 3JZIA 1ZETA 1GSOA 2JA7A 1WYRA 3V6JA 1GYFA 3MWDA 1EYZA 3VPCA 3QZ8A 4DV1H 1RYRA 4AYBE 1KEEA 2VZGB 3HOCA 2ASDA 2XGQA 5L1JA 2FPGB 2HL8A 4YB8B 2DIKA 1IOWA 3LP8A 4RAZA 5GONF 3R5HA 1WJOA 5CB4F 3GTOA 4A3MG 3KMUB 4WD3A 4XYLB 4EYIB 3BQ0A 1J5EH 4A3KG 4ED6A 1TWCA 2IP4A 1TJTA 2EQOA 4UCVA 3JSNA 3SE7A 1KBLA 2BQUA 1KJIA 1N56A 4QIWE 5J2TF 1XDNA 5EWFA 4ECYA 4NXMH 1Y1VA 1K1QA 1OWTA 2I80A 2YRXA 4IWXA 2UXDH 4MV8A 3HOVG 3GIMA 4YAJB 2XCAA 1E4GT 4EEQA 3IG0A 4ECQA 1N34H 1UNNC 4J9KA 4Q58A 1VBHA 4JUZA 2V59A 2C35B 1IOVA 2VUGA 3KAJA 3RJ0A 3RB4A 4EDMA 2R8UA 5FD5A 4Q45A 2VZCA 4HNUA 4YJ2F 3GTQA 4Q8EA 2W9AA 2W6ZA 2FK1A 2WB1E 4JI2H 5KT5A 4EBDA 1IBKH 2VQDA 4QWDA 2PVPA 5FJ8G 5L1LA 2VE7A 4OX9H 2UXBH 3KTMA 2ALZA 4A3GG 3Q8PB 4F50A 2DWCA 1EUVA 3H20A 5KFWA 5LL6b 4LF6H 3CVZA 1PX2A 2F4VH 4J9LA 4RB2C 5KFKA 1T3NA 4I50F 3N8DA 4BBSG 3JARM 5C3EG 1JLLB 5L0OA 5KFJA 2OH2A 5D1PA 4JI6H 3K5HA 2R7ZG 2HGSA 3M9MB 2JEFA 5A37A 2YRNA 4B3RH 5DLGA 2I87A 1SYXB 2R84A 4UFZA 2C28A 5FPOA 5EZYF 4MTDA 1V9PA 1RK5A 1E4EA 1ZQ7A 1P5SA 3OHAA 2R93G 1S9FA 2K3SA 2D87A 1RJPA 2HKPA 2RR8A 4IZOA 3V4SA 3SI8A 4IRDA 4JV1A 4O3RA 5KFXA 2R86A 3GTMA 2E2HA 2P0AA 5F9NA 2WYOA 4AYBA 1ZHQA 2J6TA 3H4DA 2IA6A 2D89A 4G3IA 4A93G 4ECVA 4J9RA 2VOBA 4DLKA 1CS0A 5A2QW 4DV7H 4YHHH 4NXNH 1PK8A 2RGVA 5KFLA 2JA5A 4C2MA 1Y1WG 5BMVF 3HORA 4RUCA 3U9TA 5KFNA 1PXYA 1GGOA 4DUYH 3M9NB 5DLFA 1PA7A 2R6FA 4JI5H 5J8EA 4TV9F 2KSWA 4RB3C 5LMUH 1TWFA 5KFMA 4YAKB 2YW2A 4QIWA 4YR2A 1HNWH 1TWHA 2C2RA 5CA1F 4MA5A 2QJXA 2WA5A 3FERA 5FMUA 4JI0H 1EUDB 5KG0A 2I8CA 2R82A 3RTXA 3HOXG 2GLTA 2XGPA 5KG2A 2JV9A 3FKIA 2CQYA 4MV6A 5JVLA 1TAEA 3OUZA 2JEJA 5KKNB 1CQIB 4HNTA 2W8LA 3RV4A 4B3SH 2Q2TA 1XNRH 3I4MG 1S0OA 4C5AA 1BXRA 1W96A 2M05A 3ETHA 2C00A 2GPSA 2WB1A 5KX5F 5IYBG 4DV0H 3H4BA 1S0NA 1XMQH 2J6UA 2VA2A 3QFFA 4TV8F 2UUBH 5KFIA 4JI4H 2YU9A 2NU9B 1B6RA 3VPDA 3CO1A 1XNQH 4MV3A 2YYAA 4J0MA 4ECUA 3R5FA 4LSXA 3BA9A 5KT7A 1EUCB 1N36H 4PDBA 2FB9A 3OUUA 5KFRA 5KG7A 1JX4A 3GTGA 1WYOA 2FLNA 1EZ1A 3MFHA 5L9XA 4Q57B 1KJQA 5KFCA 4LF4H 3PW2A 3F8NA 5KFTA 2R8KA 2OWOA 1B33N 1M0TA 3BJYA 3KHHA 4X62H 1EHIA 5J2UF 2HHHH 2C2DA 2JA7G 2DK9A 5LA6F 5IYDG 3GV8B 2YS6A 3GIKA 4UCRA 4ED1A
chains in the Genus database with same CATH topology
4LFBH 1E4GT 4RB1A 1A0IA 4EEQA 2FE3A 3IG0A 2HL9A 1N34H 3K3VA 4R7RA 1X9NA 3RJ0A 2VUGA 3KAJA 4UCSA 5BR8H 4JI8H 1Z2PX 3VP7A 4RB0A 5FD5A 1E4FT 3KALA 2UXCH 5FLXW 1MZBA 2MCTA 4B3TH 2VE7C 3PN1A 4JI2H 4UCOA 1IBKH 4LF8H 4CC5A 4MTEA 2WDTA 4DR7H 1TA8A 2VE7A 3JSLA 1SEIA 2VPSA 4EFBA 4OX9H 2UXBH 3UQ8A 3KAKA 2UUCH 1S68A 4GKKH 1EUVA 3H20A 1N33H 5LL6b 1DGSA 3CVZA 1HNXH 4JI1H 1Z2NX 2HVQA 2CW8A 4LF6H 3BAAA 4DV4H 2UUAH 2F4VH 4RB2C 1FKAH 4DV5H 4IAJA 5EOYA 4LF5H 1N32H 1AN7A 2ZM6H 4RZQA 4DR5H 5FD6A 1HNZH 1Z2OX 5D1PA 4LVRA 3N44B 3JAMW 4DR2H 1M0WA 4M7EA 2HGSA 4UCTA 1XMOH 4JI3H 4JI6H 5D1OB 3EAYA 4X66H 3L2PA 1VS0A 4BWSC 2W57A 4LVPA 2XIGA 4DV2H 4B3RH 1SYXB 3KXYT 4UFZA 4ETSA 4Q0YA 5FPOA 4K0KH 2RGRA 2O03A 2YCHA 4EFEA 4MTDA 1V9PA 3RGZA 3T1YH 2IGPA 1L2ZA 5LMNH 4X64H 3RIZA 2WE6A 2ZJTA 2Q2UA 1ZHSA 4JV5H 4GKJH 2HKPA 4LH7A 4DV3H 4A2BA 4LF9H 4I7HA 3FMAA 3HXLA 1S03G 2WYOA 1BGWA 3RF2A 1ZHQA 3MWMA 1B04A 2VOBA 4APMA 4DV7H 3N43B 5A2QW 4DR3H 4YHHH 4NXNH 2RGVA 3N42B 3BABA 3OTOH 4DUZH 5IWAH 4DUYH 2HVSA 2UU9H 4JI5H 1P8LA 2KSWA 4LH6A 3LMLA 4LMYA 4RB3C 5LMUH 4GLXA 3L4KA 3T1HH 3C0FB 3L4JA 2VQEH 2HVRA 5D1OA 1WH2A 1HNWH 1HR0H 1O75A 5IT9W 5FMUA 4JI0H 1BJTA 4A2AA 3M4IA 3RTXA 3J80W 1FJGH 2E5LH 4DR1H 1TAEA 4DV6H 4MV7A 1FVIA 1XNRH 5FPRA 3J81W 2Q2TA 4B3SH 4RAYA 1I94H 3DF7A 3N6XA 1IBLH 4JI7H 4DV0H 4KHPH 1XMQH 4X65H 2UUBH 4JI4H 1GYFA 1I6UA 4YY3H 2VQFH 1XNQH 4DV1H 4J0MA 4PDBA 4LF7H 5FMTA 4LSXA 3BA9A 1N36H 4DR6H 4AQYH 4LFCH 2HL8A 4UCUA 4DDPA 3BA8A 3RGXA 4RAZA 4LF4H 4DR4H 4B3MH 2CW7A 1IBMH 3F8NA 4CC6A 1J5EH 2OWOA 1M0TA 3N41B 3J7AK 2EQOA 4UCVA 3JSNA 4X62H 4JYAH 2HHHH 4LFAH 4NXMH 1XDNA 3N40P 4FM9A 4MV9A 2UXDH 4LSAA 4UCRA 3EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 2RF4 A;  4IHJ F;  4HNV A;  2B63 G;  3R5X A;  3JAK M;  2HL9 A;  5H80 A;  2R8J A;  3MWE A;  4F4Z A;  2EYI A;  4EDL A;  3VP7 A;  3BG5 A;  1I7N A;  2BR0 A;  2QJZ A;  1WSC A;  2CKZ B;  3BQ1 A;  1MZB A;  2WAQ E;  3RBD A;  4B3T H;  3PN1 A;  3G8C A;  2VZI B;  5C1O A;  1KC7 A;  1I3Q A;  4A3F G;  4LF8 H;  4A3D G;  4MTE A;  5A36 A;  4DR7 H;  1GSA A;  4O4H F;  1Y1V G;  3JSL A;  4R8U A;  4EFB A;  4Q43 A;  4QWC A;  5IYZ F;  3UQ8 A;  5KFD A;  4ME6 A;  5DGB A;  3GID A;  5KG4 A;  1GSH A;  5KFV A;  3RB3 A;  2V4R A;  4F4X A;  5KFY A;  2WFN A;  1HNX H;  5DG7 A;  2HVQ A;  3BAA A;  4C5B A;  5KFE A;  2ASJ A;  1FKA H;  5KG6 A;  3Q8S B;  4DV5 H;  1N32 H;  2Y0S E;  4DR5 H;  2W6O A;  4RZQ A;  1SFO A;  3PO2 G;  1XMO H;  3HOP A;  4YQW A;  3MJF A;  2IMW P;  2FMA A;  2WA6 A;  2YZM A;  4U6P A;  5C8Y F;  2W57 A;  3PW4 A;  3I6X A;  4LVP A;  2XIG A;  4ED7 A;  3V4Z A;  3K3P A;  4Q0Y A;  4GC7 A;  2E2I A;  2ZDQ A;  2RGR A;  2O03 A;  4QWE A;  3T1Y H;  3TIN A;  4J9Q A;  2NUA B;  2VA3 A;  2FPI B;  1QAG A;  1RK6 A;  4X64 H;  2WE6 A;  2ZJT A;  2WTF A;  3EPG A;  1BKR A;  1RJR A;  2JEI A;  4LH7 A;  5BPH A;  1RT8 A;  3T5H A;  4LF9 H;  2AGQ A;  3HXL A;  2AGO A;  4IRC A;  5BVR A;  1DV1 A;  2W6P A;  1GLV A;  1ULZ A;  3I12 A;  3MWM A;  3RF2 A;  5KFG A;  4TQS A;  4ED2 A;  3PZP A;  3U9S A;  4J9S A;  1N48 A;  3R23 A;  2D88 A;  2WA7 A;  2DZD A;  4O3Q A;  4FU0 A;  4DR3 H;  3RUP A;  4U7C A;  2FKL A;  5DG9 A;  2W9B A;  3EPI A;  3Q1K A;  3OTO H;  4EDN A;  2HVS A;  4O3P A;  2UU9 H;  3HB9 A;  3Q2O A;  3GII A;  1P8L A;  2QYZ A;  3PR5 B;  3NGD A;  3V6H A;  4GC6 A;  3L4K A;  3L4J A;  5KFP A;  5A38 A;  5D1O A;  1WH2 A;  5C44 G;  3FDS A;  4DL4 A;  2R85 A;  5I47 A;  1WCM G;  2UVU A;  4YBZ B;  3M4I A;  3QZ7 A;  4MAM A;  3JRW A;  4DL2 A;  1W93 A;  3J80 W;  2AQ4 A;  2DPI A;  2XCP A;  4Q59 A;  5KT6 A;  4Q44 A;  5EWE A;  4DV6 H;  1DV2 A;  2JA5 G;  1AUV A;  2PBZ A;  4BXX G;  5DGA A;  3ORR A;  2WAQ A;  4I4T F;  4ECW A;  3OSN A;  4JI7 H;  3HOZ G;  2R0O A;  5LYJ F;  4X65 H;  3GTJ A;  2NVX A;  4TXI A;  5BPF A;  4RUA A;  1I6U A;  3PW0 A;  4YR0 A;  2VQF H;  4EG0 A;  4DR6 H;  4ECT A;  2R7K A;  4XYM B;  4MV4 A;  1VKZ A;  1AOA A;  4UCU A;  3ORQ A;  2J6S A;  5KFO A;  2PN1 A;  5FLM G;  1WIX A;  3RGX A;  2UVR A;  4A3J G;  2BQR A;  4DR4 H;  2FJZ A;  2Y0S A;  3Q8Q B;  2CW7 A;  4CC6 A;  4WBN F;  5DG8 A;  3N41 B;  3J7A K;  5KFQ A;  5KG5 A;  1VAJ A;  4JYA H;  4QJF A;  2JEG A;  4LFA H;  3N40 P;  2J9G A;  2W7O A;  4F4Y A;  2L3G A;  4MA0 A;  4MV9 A;  4E4T A;  4LSA A;  5KT4 A;  2FK3 A;  3WO1 A;  4B3M H;  4LFB H;  1P2X A;  1A0I A;  1C3O A;  1RJQ A;  1VBG A;  4BY1 G;  5DQG A;  2W9C B;  3K3V A;  4A3B G;  4ECS A;  4UCS A;  5EDW A;  3KMW B;  3ETJ A;  5IP9 G;  1SH6 A;  3HKZ E;  4RB0 A;  1SH5 A;  5C1P A;  2FK2 A;  1JDE A;  3KAL A;  3H3V H;  5FLX W;  1E4E B;  1Y1W A;  2R8I A;  2VE7 C;  4ZOL F;  2VUM A;  2CZG A;  4CC5 A;  3PR4 A;  1KJJ A;  2WDT A;  2XCL A;  4PWQ A;  1SEI A;  2VPS A;  3GIQ A;  1WYQ A;  4FBT A;  1Y14 B;  3KAK A;  5IYC G;  4A3L G;  2W6Q A;  2V9W A;  4GKK H;  2UVW A;  2YS7 A;  4ED8 A;  2ATL A;  1N33 H;  3G6Y A;  5KFU A;  2GPW A;  3RB6 A;  4DV4 H;  2FPP B;  4RNN A;  1K1S A;  5EOY A;  4LF5 H;  3KHL A;  2D85 A;  4HR7 A;  3RV3 A;  4QW9 A;  5FD6 A;  2ZM6 H;  2R92 A;  4DR2 H;  4LVR A;  1R9T A;  3JAM W;  5IT9 W;  1M0W A;  5LXT F;  4M7E A;  4A3E G;  1GO3 E;  3BQ2 A;  1JDB B;  1I7L A;  1H67 A;  3GQC A;  3JAL M;  3MR5 A;  5LP6 F;  4Y8V B;  4K0K H;  5C4X G;  4ETS A;  2W7P A;  1UEG A;  2SCU B;  2YCH A;  4EFE A;  3RGZ A;  1L2Z A;  2IGP A;  4IR1 A;  1S0M A;  2C22 A;  3G6X A;  4TXK A;  2Q2U A;  2VZD A;  1ZHS A;  3H0G A;  5IP7 G;  4A3C G;  1WYL A;  2PMZ E;  1S03 G;  5L1K A;  2D86 A;  1BNC A;  2NU8 B;  3RBE A;  5KFH A;  1SCU B;  2JA6 A;  4APM A;  2EYN A;  3N43 B;  5EWG A;  2R7L A;  2W8K A;  4EYH B;  1AA2 A;  4RNM A;  3BAB A;  2DPJ A;  2XC9 A;  4ZHQ F;  5IWA H;  2RDJ A;  4DUZ H;  3GIJ A;  2B63 A;  4YJ3 F;  1CQJ B;  2DLN A;  3GV5 B;  3MR6 A;  4LMY A;  4GLX A;  5HV6 A;  1MB8 A;  3C0F B;  2FLL A;  2XD4 A;  2VQE H;  2ASL A;  1WYM A;  1V51 A;  4DL5 A;  4ECZ A;  4A3I G;  4ED0 A;  2QK4 A;  4FBU A;  3Q8R B;  3T5L A;  1JKJ B;  3AYH B;  4EGQ A;  2FLP A;  1FJG H;  2E5L H;  5JH7 F;  2VR1 A;  2W6M A;  5JVD F;  3HKZ A;  2NU6 B;  1FVI A;  4FS2 A;  4IRK A;  5KFA A;  3J81 W;  4RAY A;  1I94 H;  4FS1 A;  3N6X A;  3LWB A;  3V6K A;  4O3S A;  2YZG A;  5HBR B;  3VMM A;  2VPQ A;  4HQ6 A;  3RFC A;  4EBC A;  3PW7 A;  4L1K A;  2V58 A;  3PO3 G;  3E5N A;  2X0S A;  4DL7 A;  4YY3 H;  2R7M A;  4J9O A;  4LF7 H;  5FMT A;  4QW8 A;  4B7L A;  2E9K A;  3GIP A;  4AQY H;  4YR3 A;  5DQI A;  1KJ9 A;  4R8U B;  4LFC H;  4DDP A;  3TIG A;  1T36 A;  3BA8 A;  3I4N G;  3T5J A;  2ZDG A;  1WKU A;  2AU0 A;  1IBM H;  1AUX A;  2NVY A;  2V4Q A;  1CE8 A;  3GV7 B;  4BY7 G;  2W71 A;  4JV0 A;  3F7P A;  2NU7 B;  1DXX A;  4IWY A;  5C5J A;  4MV1 A;  5K2M A;  4FM9 A;  2YZN A;  4DL3 A;  1RYS A;  1B6S A;  3EYY A;  3GLK A;  4RB1 A;  4ECR A;  3RB0 A;  2UVV A;  2FE3 A;  4J9N A;  1JXL A;  4QWB A;  3MR2 A;  3HOY G;  4R7R A;  1X9N A;  5KT2 A;  4YP3 A;  2OLS A;  1M7J A;  3G6V A;  5BR8 H;  2AGP A;  1Z2P X;  4JI8 H;  2R8H A;  3KHG A;  2W9C A;  4M9U A;  1E4F T;  2PMZ A;  2HJW A;  2UXC H;  4O4I F;  2MCT A;  2R87 A;  5F9L A;  3MFI A;  4UCO A;  4RNO A;  2R7Z A;  1V4Y A;  4XZ3 B;  2W6N A;  3FKI G;  3RAX A;  1KJ8 A;  1TA8 A;  4Q8F A;  4EBE A;  2UUC H;  1WCM A;  1S68 A;  4EEY A;  3KHR A;  1WYN A;  4J9M A;  1I50 A;  1M6V A;  3HBL A;  4ZQI A;  1DGS A;  4BBR G;  2W9B B;  2W70 A;  1Z2N X;  4JI1 H;  2CW8 A;  2R93 A;  3CQZ A;  1TWA A;  2UUA H;  4IR9 A;  4IAJ A;  3WNZ A;  4F4W A;  5KFF A;  4JV2 A;  3REP B;  1AN7 A;  4C5C A;  2YRW A;  5KFB A;  1V5K A;  4TUY F;  5KFZ A;  3OHB A;  1HNZ H;  1Z2O X;  3N44 B;  5D8D A;  2VUM G;  3GTK A;  4UCT A;  4JI3 H;  4TQR A;  3PW5 A;  5D1O B;  3TQ1 A;  3GIL A;  5CAE B;  3EAY A;  4X66 H;  3L2P A;  1VS0 A;  2R7N A;  4BWS C;  3IN5 A;  5CA0 F;  4RU9 A;  4DV2 H;  3KXY T;  2V5A A;  5KFS A;  3M9O B;  3T5K A;  1S97 A;  3JRX A;  3UFX B;  3RAQ A;  5T14 A;  5LMN H;  3GTP A;  2ZDH A;  3RIZ A;  1DIK A;  4DL6 A;  4JV5 H;  2EE7 A;  3KY9 A;  1S10 A;  4GKJ H;  4J9P A;  2K2R A;  2YL2 A;  4DV3 H;  2C2E A;  1UJO A;  4A2B A;  3OSP A;  3K5I A;  4ZI7 F;  4I7H A;  1JIH A;  3FMA A;  4HYK A;  4ECX A;  1BHD A;  2R92 G;  1BGW A;  3WO0 A;  1B04 A;  1C30 A;  1T94 A;  3PVX A;  4O4L F;  4O3N A;  1WYP A;  3H40 A;  1UC9 A;  3HOW G;  3TII A;  3N42 B;  4ED3 A;  5L1I A;  2R8G A;  5A4B A;  4O2A F;  2RDI A;  3VPB A;  1UC8 A;  5KT3 A;  4QWA A;  4O3O A;  4LH6 A;  1TWG A;  3LML A;  2BQ3 A;  1A9X A;  3T1H H;  3H0G G;  2HVR A;  4EGJ A;  4XX0 B;  1VKA A;  1HR0 H;  1O75 A;  5LOV F;  3GTL A;  1BJT A;  4A2A A;  5KG1 A;  5KG3 A;  5JUM A;  3MR3 A;  3HOU G;  2JA6 G;  5JQW A;  4DR1 H;  1K83 A;  4MV7 A;  5DQH A;  5FPR A;  2FP4 B;  4RZR A;  4NLG A;  4I55 F;  3DF7 A;  4O2B F;  1IBL H;  2IBK A;  2JA8 G;  4KHP H;  1WR2 A;  3TQT A;  3JZI A;  1ZET A;  1GSO A;  2JA7 A;  1WYR A;  3V6J A;  1GYF A;  3MWD A;  1EYZ A;  3VPC A;  3QZ8 A;  4DV1 H;  1RYR A;  4AYB E;  1KEE A;  2VZG B;  3HOC A;  2ASD A;  2XGQ A;  5L1J A;  2FPG B;  2HL8 A;  4YB8 B;  2DIK A;  1IOW A;  3LP8 A;  4RAZ A;  5GON F;  3R5H A;  1WJO A;  5CB4 F;  3GTO A;  4A3M G;  3KMU B;  4WD3 A;  4XYL B;  4EYI B;  3BQ0 A;  1J5E H;  4A3K G;  4ED6 A;  1TWC A;  2IP4 A;  1TJT A;  2EQO A;  4UCV A;  3JSN A;  3SE7 A;  1KBL A;  2BQU A;  1KJI A;  1N56 A;  4QIW E;  5J2T F;  1XDN A;  5EWF A;  4ECY A;  4NXM H;  1Y1V A;  1K1Q A;  1OWT A;  2I80 A;  2YRX A;  4IWX A;  2UXD H;  4MV8 A;  3HOV G;  3GIM A;  4YAJ B;  2XCA A;  1E4G T;  4EEQ A;  3IG0 A;  4ECQ A;  1N34 H;  1UNN C;  4J9K A;  4Q58 A;  1VBH A;  4JUZ A;  2V59 A;  2C35 B;  1IOV A;  2VUG A;  3KAJ A;  3RJ0 A;  3RB4 A;  4EDM A;  2R8U A;  5FD5 A;  4Q45 A;  2VZC A;  4HNU A;  4YJ2 F;  3GTQ A;  4Q8E A;  2W9A A;  2W6Z A;  2FK1 A;  2WB1 E;  4JI2 H;  5KT5 A;  4EBD A;  1IBK H;  2VQD A;  4QWD A;  2PVP A;  5FJ8 G;  5L1L A;  2VE7 A;  4OX9 H;  2UXB H;  3KTM A;  2ALZ A;  4A3G G;  3Q8P B;  4F50 A;  2DWC A;  1EUV A;  3H20 A;  5KFW A;  5LL6 b;  4LF6 H;  3CVZ A;  1PX2 A;  2F4V H;  4J9L A;  4RB2 C;  5KFK A;  1T3N A;  4I50 F;  3N8D A;  4BBS G;  3JAR M;  5C3E G;  1JLL B;  5L0O A;  5KFJ A;  2OH2 A;  5D1P A;  4JI6 H;  3K5H A;  2R7Z G;  2HGS A;  3M9M B;  2JEF A;  5A37 A;  2YRN A;  4B3R H;  5DLG A;  2I87 A;  1SYX B;  2R84 A;  4UFZ A;  2C28 A;  5FPO A;  5EZY F;  4MTD A;  1V9P A;  1RK5 A;  1E4E A;  1ZQ7 A;  1P5S A;  3OHA A;  2R93 G;  1S9F A;  2K3S A;  2D87 A;  1RJP A;  2HKP A;  2RR8 A;  4IZO A;  3V4S A;  3SI8 A;  4IRD A;  4JV1 A;  4O3R A;  5KFX A;  2R86 A;  3GTM A;  2E2H A;  2P0A A;  5F9N A;  2WYO A;  4AYB A;  1ZHQ A;  2J6T A;  3H4D A;  2IA6 A;  2D89 A;  4G3I A;  4A93 G;  4ECV A;  4J9R A;  2VOB A;  4DLK A;  1CS0 A;  5A2Q W;  4DV7 H;  4YHH H;  4NXN H;  1PK8 A;  2RGV A;  5KFL A;  2JA5 A;  4C2M A;  1Y1W G;  5BMV F;  3HOR A;  4RUC A;  3U9T A;  5KFN A;  1PXY A;  1GGO A;  4DUY H;  3M9N B;  5DLF A;  1PA7 A;  2R6F A;  4JI5 H;  5J8E A;  4TV9 F;  2KSW A;  4RB3 C;  5LMU H;  1TWF A;  5KFM A;  4YAK B;  2YW2 A;  4QIW A;  4YR2 A;  1HNW H;  1TWH A;  2C2R A;  5CA1 F;  4MA5 A;  2QJX A;  2WA5 A;  3FER A;  5FMU A;  4JI0 H;  1EUD B;  5KG0 A;  2I8C A;  2R82 A;  3RTX A;  3HOX G;  2GLT A;  2XGP A;  5KG2 A;  2JV9 A;  3FKI A;  2CQY A;  4MV6 A;  5JVL A;  1TAE A;  3OUZ A;  2JEJ A;  5KKN B;  1CQI B;  4HNT A;  2W8L A;  3RV4 A;  4B3S H;  2Q2T A;  1XNR H;  3I4M G;  1S0O A;  4C5A A;  1BXR A;  1W96 A;  2M05 A;  3ETH A;  2C00 A;  2GPS A;  2WB1 A;  5KX5 F;  5IYB G;  4DV0 H;  3H4B A;  1S0N A;  1XMQ H;  2J6U A;  2VA2 A;  3QFF A;  4TV8 F;  2UUB H;  5KFI A;  4JI4 H;  2YU9 A;  2NU9 B;  1B6R A;  3VPD A;  3CO1 A;  1XNQ H;  4MV3 A;  2YYA A;  4J0M A;  4ECU A;  3R5F A;  4LSX A;  3BA9 A;  5KT7 A;  1EUC B;  1N36 H;  4PDB A;  2FB9 A;  3OUU A;  5KFR A;  5KG7 A;  1JX4 A;  3GTG A;  1WYO A;  2FLN A;  1EZ1 A;  3MFH A;  5L9X A;  4Q57 B;  1KJQ A;  5KFC A;  4LF4 H;  3PW2 A;  3F8N A;  5KFT A;  2R8K A;  2OWO A;  1B33 N;  1M0T A;  3BJY A;  3KHH A;  4X62 H;  1EHI A;  5J2U F;  2HHH H;  2C2D A;  2JA7 G;  2DK9 A;  5LA6 F;  5IYD G;  3GV8 B;  2YS6 A;  3GIK A;  4UCR A;  4ED1 A; 
#chains in the Genus database with same CATH homology
 4LFB H;  1E4G T;  4RB1 A;  1A0I A;  4EEQ A;  2FE3 A;  3IG0 A;  2HL9 A;  1N34 H;  3K3V A;  4R7R A;  1X9N A;  3RJ0 A;  2VUG A;  3KAJ A;  4UCS A;  5BR8 H;  4JI8 H;  1Z2P X;  3VP7 A;  4RB0 A;  5FD5 A;  1E4F T;  3KAL A;  2UXC H;  5FLX W;  1MZB A;  2MCT A;  4B3T H;  2VE7 C;  3PN1 A;  4JI2 H;  4UCO A;  1IBK H;  4LF8 H;  4CC5 A;  4MTE A;  2WDT A;  4DR7 H;  1TA8 A;  2VE7 A;  3JSL A;  1SEI A;  2VPS A;  4EFB A;  4OX9 H;  2UXB H;  3UQ8 A;  3KAK A;  2UUC H;  1S68 A;  4GKK H;  1EUV A;  3H20 A;  1N33 H;  5LL6 b;  1DGS A;  3CVZ A;  1HNX H;  4JI1 H;  1Z2N X;  2HVQ A;  2CW8 A;  4LF6 H;  3BAA A;  4DV4 H;  2UUA H;  2F4V H;  4RB2 C;  1FKA H;  4DV5 H;  4IAJ A;  5EOY A;  4LF5 H;  1N32 H;  1AN7 A;  2ZM6 H;  4RZQ A;  4DR5 H;  5FD6 A;  1HNZ H;  1Z2O X;  5D1P A;  4LVR A;  3N44 B;  3JAM W;  4DR2 H;  1M0W A;  4M7E A;  2HGS A;  4UCT A;  1XMO H;  4JI3 H;  4JI6 H;  5D1O B;  3EAY A;  4X66 H;  3L2P A;  1VS0 A;  4BWS C;  2W57 A;  4LVP A;  2XIG A;  4DV2 H;  4B3R H;  1SYX B;  3KXY T;  4UFZ A;  4ETS A;  4Q0Y A;  5FPO A;  4K0K H;  2RGR A;  2O03 A;  2YCH A;  4EFE A;  4MTD A;  1V9P A;  3RGZ A;  3T1Y H;  2IGP A;  1L2Z A;  5LMN H;  4X64 H;  3RIZ A;  2WE6 A;  2ZJT A;  2Q2U A;  1ZHS A;  4JV5 H;  4GKJ H;  2HKP A;  4LH7 A;  4DV3 H;  4A2B A;  4LF9 H;  4I7H A;  3FMA A;  3HXL A;  1S03 G;  2WYO A;  1BGW A;  3RF2 A;  1ZHQ A;  3MWM A;  1B04 A;  2VOB A;  4APM A;  4DV7 H;  3N43 B;  5A2Q W;  4DR3 H;  4YHH H;  4NXN H;  2RGV A;  3N42 B;  3BAB A;  3OTO H;  4DUZ H;  5IWA H;  4DUY H;  2HVS A;  2UU9 H;  4JI5 H;  1P8L A;  2KSW A;  4LH6 A;  3LML A;  4LMY A;  4RB3 C;  5LMU H;  4GLX A;  3L4K A;  3T1H H;  3C0F B;  3L4J A;  2VQE H;  2HVR A;  5D1O A;  1WH2 A;  1HNW H;  1HR0 H;  1O75 A;  5IT9 W;  5FMU A;  4JI0 H;  1BJT A;  4A2A A;  3M4I A;  3RTX A;  3J80 W;  1FJG H;  2E5L H;  4DR1 H;  1TAE A;  4DV6 H;  4MV7 A;  1FVI A;  1XNR H;  5FPR A;  3J81 W;  2Q2T A;  4B3S H;  4RAY A;  1I94 H;  3DF7 A;  3N6X A;  1IBL H;  4JI7 H;  4DV0 H;  4KHP H;  1XMQ H;  4X65 H;  2UUB H;  4JI4 H;  1GYF A;  1I6U A;  4YY3 H;  2VQF H;  1XNQ H;  4DV1 H;  4J0M A;  4PDB A;  4LF7 H;  5FMT A;  4LSX A;  3BA9 A;  1N36 H;  4DR6 H;  4AQY H;  4LFC H;  2HL8 A;  4UCU A;  4DDP A;  3BA8 A;  3RGX A;  4RAZ A;  4LF4 H;  4DR4 H;  4B3M H;  2CW7 A;  1IBM H;  3F8N A;  4CC6 A;  1J5E H;  2OWO A;  1M0T A;  3N41 B;  3J7A K;  2EQO A;  4UCV A;  3JSN A;  4X62 H;  4JYA H;  2HHH H;  4LFA H;  4NXM H;  1XDN A;  3N40 P;  4FM9 A;  4MV9 A;  2UXD H;  4LSA A;  4UCR A;  3EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...