2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/protein binding
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
3JRXA 2E2HA 4EDMA 1N34H 3G6XA 4UCTA 3PW7A 4AYBE 5C1OA 3QZ8A 1DV1A 4C5CA 3ETHA 1HNWH 1FJGH 3VMMA 5KFOA 1XMQH 1QAGA 3VP7A 2FJZA 3KTMA 4O3SA 3VPCA 1I7NA 5J2UF 1UJOA 4IZOA 1TJTA 4J9NA 4ED3A 4QIWE 4DL3A 2W9CB 4NXMH 5KG7A 1UC9A 4XX0B 3RAQA 5KFUA 4FBUA 3MWMA 1E4FT 4QWDA 1DIKA 2R8KA 3CQZA 3QZ7A 2R86A 1N56A 3J80W 1UC8A 4LMYA 2BQ3A 3MFHA 2R7ZG 3L2PA 2C28A 2PN1A 4A2BA 3KHLA 4Q8EA 4RB3C 3HORA 5BVRA 4GKJH 1DGSA 5D1PA 3KXYT 4DL5A 2EYNA 5IYZF 3N42B 3JZIA 2XCLA 5KT2A 1S03G 4TV8F 2XIGA 1EUVA 4U7CA 2AGQA 2F4VH 2NVYA 1RJRA 5LL6b 5KFKA 1K1SA 2JEJA 2VA2A 1TWFA 1BXRA 5L9XA 4JV2A 3RFCA 3R23A 2I8CA 2VQDA 3RJ0A 5CA1F 1V51A 2V59A 2W71A 3PO3G 4Y8VB 3RGXA 1TA8A 3FKIG 1P2XA 3IN5A 4DL4A 1E4GT 4RNOA 3GTMA 2YZMA 4LH7A 5KFVA 1B6SA 4R7RA 4Q43A 4LFCH 4LF7H 1GLVA 1C30A 1GO3E 4HR7A 4UCRA 5EDWA 3KHGA 5LMUH 2J6TA 1VKZA 4GLXA 1R9TA 5D8DA 2RGRA 3PW4A 3CVZA 2DIKA 3N41B 1T3NA 4RZRA 4O2BF 5EWEA 4EYHB 3HOYG 4B3TH 4RUAA 1H67A 2O03A 2R84A 4RB2C 4TQRA 3NGDA 1JXLA 4BBSG 4ZI7F 1HR0H 1GSAA 1HNXH 4DL7A 4RB1A 4J9RA 4F4XA 4ME6A 5KX5F 3U9TA 4YJ2F 3TIIA 3HOPA 3K3VA 2R8IA 1WH2A 5KFIA 5HV6A 5KT6A 3I4NG 4Q0YA 1SEIA 2W6OA 3GILA 4A3BG 2VOBA 2PMZE 2E5LH 4A3KG 2C35B 3GIQA 5JVLA 3OTOH 2K3SA 2D85A 2W9BB 1PA7A 2VPQA 1M0TA 4DR1H 1KJ9A 2DPJA 3MFIA 2VUMG 4O2AF 4QWCA 3GLKA 1VAJA 5IYCG 3HOWG 4C5AA 5DG8A 2YS6A 2WDTA 3V4ZA 1WCMG 3L4JA 3SI8A 2HVQA 2GPSA 5JH7F 1S0OA 3BABA 3Q8PB 2UXCH 5JVDF 4IRCA 5KFGA 3AYHB 1Y1VA 2HKPA 2IGPA 4O4LF 3EYYA 4TUYF 4EBDA 4TXIA 2FPGB 2ZDGA 1TWCA 5DLFA 2UXDH 3BA8A 1I3QA 5EWGA 2YRNA 3TINA 1M7JA 4O4IF 3EAYA 3PR4A 4DV2H 1S9FA 3RB4A 3U9SA 4BWSC 1SCUB 3KHHA 4QWAA 4B7LA 4MV7A 3RB3A 3GTQA 4B3RH 2VZDA 2W7OA 2J9GA 3JRWA 3REPB 4YBZB 3GTLA 5H80A 2R82A 1M6VA 3LWBA 4RNMA 2V4QA 4A3EG 2UVVA 5C44G 3EPGA 2JEFA 5KFLA 4EBEA 2FLLA 2WB1A 1AOAA 2VZCA 2YRXA 5BPHA 4LF9H 2R93G 4BY1G 4Q58A 4ECSA 2YL2A 5DG7A 4MA5A 4CC5A 4KHPH 5KFFA 3HOZG 2WA5A 5DQGA 1N32H 3C0FB 3N6XA 3HOVG 2R7KA 2D86A 3T5KA 1EHIA 2NU6B 2OLSA 4M9UA 5CB4F 1C3OA 1I6UA 1UEGA 1XMOH 5KFHA 1AUVA 4JI6H 4O3OA 5A4BA 1EYZA 4QJFA 2WA7A 5IYBG 4X66H 2VQFH 4DV3H 1S0NA 4GKKH 2RF4A 4LFAH 2CZGA 4EFBA 2W9AA 3OHBA 2W9CA 4O3RA 1WYMA 5I47A 2FB9A 4YB8B 4RU9A 4TXKA 1VBHA 4JV0A 4EGQA 4A3LG 2W57A 4EDLA 4IWYA 1WYQA 3K5HA 4HNUA 4EFEA 4ECQA 2ASLA 5C5JA 2CW8A 4EEQA 5JQWA 2B63A 2I80A 4ED8A 1N48A 2UUBH 3HOUG 3E5NA 2XC9A 3BQ0A 2D87A 1ZHQA 2PVPA 4Q57B 4YY3H 5C3EG 2GLTA 4AYBA 4LH6A 2W8KA 3MWEA 3V4SA 4APMA 2FK2A 4FM9A 1AUXA 4GC6A 2Y0SE 3Q8SB 4F4ZA 4Q8FA 1JLLB 1RJPA 3M9NB 1K83A 1X9NA 3RV4A 3WO0A 4DR4H 3H0GA 3HBLA 3K3PA 5KG4A 4ECZA 2MCTA 2R7MA 5EZYF 3BA9A 4WBNF 1B04A 3V6HA 4MAMA 3TQ1A 1Y1VG 1I94H 4LF6H 1J5EH 2DPIA 5L1KA 3IG0A 4JV5H 3T5JA 3V6KA 5EWFA 2R85A 4ECXA 1HNZH 1WJOA 4IR1A 4ECRA 1EUDB 4O4HF 4IHJF 1KJIA 3ETJA 1B33N 3RGZA 4TQSA 5L0OA 1RK5A 2K2RA 4O3PA 1PXYA 3EPIA 5DGAA 4MV9A 2J6UA 1TAEA 2NVXA 4J9LA 2QJXA 1IOWA 1PX2A 2R8HA 2DLNA 5A2QW 4DUYH 4G3IA 4UCOA 4LF5H 2JA6A 2WE6A 3F8NA 3OSPA 2NUAB 1M0WA 4QIWA 1EUCB 4I7HA 2VE7A 4K0KH 2C22A 2VUGA 4E4TA 2RDJA 2HHHH 1ZHSA 4MA0A 3JSLA 4HNVA 1GSHA 5KFMA 3N40P 5L1JA 4IRDA 3HKZE 3I4MG 4QWEA 1IBMH 2IP4A 2JA7A 2EQOA 3OUZA 3PR5B 3GIMA 5KKNB 3T1HH 2V4RA 1CQJB 2BQUA 2R0OA 3QFFA 5KT4A 1IBLH 2JA8G 2OWOA 3M4IA 5CA0F 4MTDA 2WAQE 4U6PA 4A3IG 4UCUA 2W6MA 5FD5A 1I7LA 1BHDA 3T5HA 5J2TF 1GGOA 4LSAA 5FMUA 3KMUB 4UFZA 5KG5A 4XZ3B 3WO1A 5IWAH 1RYRA 2Q2UA 2WTFA 4YQWA 3H4DA 1KJQA 5L1IA 3K5IA 4L1KA 4YAKB 5KG2A 4DV6H 2C2RA 2FK1A 4NXNH 3HB9A 1T94A 5KFDA 3T5LA 4GC7A 3Q2OA 2UVUA 5KFCA 2VZIB 4ZOLF 1S97A 1O75A 5DG9A 3HXLA 4A3GG 4IAJA 3H40A 2W9BA 2DK9A 4DUZH 4YR3A 4JV1A 1Z2PX 3BQ1A 4LSXA 4J9OA 5KT7A 4UCVA 2WA6A 2R87A 4IRKA 4JUZA 4DLKA 4RAZA 2HGSA 1W96A 1MB8A 2JV9A 2HL8A 1V4YA 1SH5A 4XYLB 4MV8A 3J81W 3PVXA 5C4XG 2R7NA 3PN1A 4R8UA 1N36H 2R6FA 3Q1KA 4ZQIA 3MR3A 2C00A 2W6NA 1KC7A 1A0IA 3MR5A 1KEEA 4MV1A 3RBEA 5DQIA 2YS7A 1KBLA 4ECTA 2FLNA 1FKAH 2SCUB 4X64H 3PZPA 3KHRA 1W93A 4LFBH 2NU7B 2E9KA 4ED7A 4J9PA 1RYSA 4A93G 3LMLA 1ZQ7A 5FJ8G 4F4YA 5LOVF 5F9NA 5KFWA 4YR0A 2AQ4A 2VE7C 4DDPA 3FDSA 2IA6A 4RAYA 3N44B 3RBDA 4JI7H 2VQEH 4JI8H 4FS2A 3H3VH 2W6ZA 5F9LA 3JARM 1P5SA 2PMZA 4ETSA 3DF7A 4HNTA 3KMWB 5C1PA 3GIKA 4MV4A 3N8DA 4JI5H 3KAJA 5K2MA 2YCHA 2V58A 3R5FA 3UFXB 5KT5A 3PW2A 2IMWP 1XNQH 5IP9G 4EBCA 2D88A 1TWHA 2L3GA 4EDNA 4DR5H 1DXXA 5J8EA 1BJTA 1V5KA 3RB0A 2C2EA 3GTJA 3RV3A 2AGOA 2RGVA 3GIIA 3JAKM 4C2MA 4XYMB 2KSWA 4MV3A 4J9QA 1MZBA 4BY7G 2BR0A 4O3NA 4NLGA 4ED2A 2JEGA 4LF8H 3CO1A 1AN7A 1B6RA 4HYKA 2J6SA 1Y14B 2JEIA 2EE7A 2ZM6H 5KFAA 3HKZA 2WB1E 5BMVF 2VA3A 1WYOA 2VZGB 4DV1H 4JI1H 5FPRA 2JA5G 4JI2H 4JI0H 3ORRA 3N43B 2R7ZA 4AQYH 3WNZA 4QW9A 4ECWA 1Y1WA 2YU9A 1WYRA 4J9MA 3MWDA 2W70A 2FLPA 4EEYA 3KAKA 2ASDA 2WAQA 5LA6F 4JI4H 5D1OB 5CAEB 1WYLA 2NU8B 4ED1A 5DGBA 2RR8A 4ECUA 3J7AK 3PO2G 3G8CA 5T14A 5A37A 2UUCH 3HOCA 1PK8A 2W6QA 4I50F 3SE7A 1T36A 5FLMG 4X62H 3Q8RB 4J9KA 3GIPA 2JA6G 3OUUA 2M05A 2VPSA 5BPFA 3GIJA 2V9WA 2FPPB 5KFYA 5KFTA 3M9OB 3OHAA 1AA2A 4FS1A 2ATLA 4IWXA 3HOXG 3TIGA 1S10A 4J0MA 3GQCA 1K1QA 3R5XA 3H4BA 2UVRA 4JI3H 4DV4H 1BNCA 5LP6F 3H20A 5KG6A 3UQ8A 5DLGA 4PDBA 3PW5A 2ZDQA 5JUMA 2W8LA 2HVSA 2X0SA 2CQYA 4J9SA 4TV9F 2ZDHA 3JAMW 1V9PA 1VKAA 1WYPA 4RB0A 4ED0A 3Q8QB 5LXTF 4EGJA 4DV5H 2PBZA 1Y1WG 2HJWA 2W7PA 3GV5B 2UVWA 1Z2OX 4LVPA 1L2ZA 1WSCA 4LVRA 4DV7H 1CQIB 2Q2TA 2RDIA 2UUAH 3GTGA 2FP4B 5L1LA 4B3SH 1VBGA 1FVIA 3BJYA 5KG0A 3I12A 4Q59A 5GONF 2XCPA 1KJ8A 3JSNA 3JALM 5KFJA 2XGQA 5KFNA 2HL9A 1JDEA 1UNNC 4A2AA 4RUCA 2IBKA 5D1OA 2UXBH 1E4EB 4MTEA 2E2IA 5A38A 4ECVA 5EOYA 5KG3A 1JX4A 3RTXA 5KFBA 2P0AA 2YRWA 4PWQA 2AGPA 4DR6H 2R8UA 1S68A 3VPBA 1A9XA 1ZETA 2R8JA 2UU9H 4LF4H 2JA7G 1XDNA 4UCSA 1TWAA 4JYAH 2DZDA 4I4TF 5IP7G 5LMNH 5C8YF 1SYXB 2DWCA 2NU9B 4YP3A 2QJZA 1JDBB 4QWBA 5DQHA 4A3JG 1TWGA 3I6XA 1WKUA 2R7LA 5KFRA 3G6VA 4DL6A 4A3CG 4A3MG 4R8UB 1VS0A 4WD3A 5HBRB 4I55F 5KFPA 1Z2NX 4A3DG 4CC6A 1WCMA 1DV2A 3MJFA 3F7PA 1EZ1A 4O3QA 2GPWA 1BGWA 3RF2A 5A36A 1P8LA 4B3MH 2AU0A 1OWTA 4MV6A 5KG1A 4RNNA 4EYIB 4FBTA 1XNRH 5IT9W 1IBKH 2B63G 2CW7A 4YHHH 3GIDA 3T1YH 2FE3A 4BBRG 3BAAA 5KFZA 3GV8B 2OH2A 2YYAA 3GV7B 3MR2A 2VUMA 4IR9A 4DR7H 5KFQA 2YW2A 3OSNA 5FPOA 2ASJA 4FU0A 3FMAA 3G6YA 2R8GA 4DR3H 1SH6A 1WIXA 3R5HA 1ULZA 2CKZB 5FLXW 4Q45A 3H0GG 2WYOA 2EYIA 3LP8A 3ORQA 4YJ3F 2BQRA 4ED6A 2HVRA 5FD6A 5IYDG 2YZNA 4F4WA 1BKRA 2R92G 1E4EA 4QW8A 1JKJB 4EG0A 4ZHQF 4Q44A 2Y0SA 4DV0H 2XCAA 2XGPA 4BXXG 2WFNA 5KT3A 1S0MA 2W6PA 4M7EA 3GTPA 1KJJA 3FKIA 3V6JA 3GTKA 5KFXA 4DR2H 3PW0A 1RJQA 2QYZA 3M9MB 2QK4A 5KFEA 4C5BA 4F50A 5LYJF 1RK6A 1CE8A 4YAJB 2XD4A 1IOVA 2ALZA 3RUPA 3TQTA 5BR8H 3BQ2A 4ECYA 4A3FG 4DL2A 2R93A 3FERA 2ZJTA 1RT8A 4OX9H 1GSOA 2V5AA 3RB6A 2VR1A 1WYNA 3RIZA 4YR2A 2YZGA 5FMTA 1N33H 1I50A 4RZQA 1GYFA 1WR2A 5KFSA 3KY9A 3VPDA 1JIHA 2FPIB 3KALA 2R92A 3MR6A 3RAXA 2I87A 1SFOA 3BG5A 3L4KA 2C2DA 1CS0A 2FMAA 2JA5A 2FK3A 2D89A 4X65H 3GTOA 4HQ6A 2FKLA
chains in the Genus database with same CATH topology
2HVSA 4DV6H 1N34H 4UCTA 4NXNH 1FJGH 1HNWH 3JAMW 1V9PA 4RB0A 4DV5H 1XMQH 4LF9H 3VP7A 4LVPA 1Z2OX 1O75A 4CC5A 4KHPH 3HXLA 1N32H 1L2ZA 4IAJA 4LVRA 3C0FB 4DUZH 4DV7H 3N6XA 2Q2TA 2UUAH 4B3SH 1FVIA 1Z2PX 4NXMH 4LSXA 1I6UA 4UCVA 1XMOH 3JSNA 3MWMA 1E4FT 4RAZA 2HGSA 2HL9A 4A2AA 5D1OA 2HL8A 4MTEA 3J81W 3J80W 4JI6H 2UXBH 5EOYA 4LMYA 4X66H 2VQFH 4DV3H 4GKKH 3PN1A 3RTXA 3L2PA 1N36H 4LFAH 4EFBA 4DR6H 1S68A 4A2BA 4JYAH 4LF4H 2UU9H 4RB3C 1A0IA 1XDNA 4UCSA 5LMNH 4GKJH 1DGSA 5D1PA 3KXYT 1SYXB 2W57A 3N42B 1FKAH 4EFEA 1S03G 4X64H 2XIGA 1EUVA 4LFBH 2F4VH 2CW8A 4EEQA 5LL6b 3LMLA 1VS0A 2UUBH 1Z2NX 1ZHQA 4CC6A 4YY3H 3RJ0A 2VE7C 4DDPA 1BGWA 3RF2A 4RAYA 1P8LA 3N44B 4LH6A 3RGXA 1TA8A 4JI7H 2VQEH 4B3MH 4JI8H 4APMA 4FM9A 1XNRH 1E4GT 5IT9W 4LH7A 1IBKH 4ETSA 3DF7A 4JI5H 2CW7A 4R7RA 4DR4H 1X9NA 4LFCH 3KAJA 4UCRA 4LF7H 4YHHH 2YCHA 5LMUH 3T1YH 2FE3A 4GLXA 1XNQH 3BAAA 2MCTA 2RGRA 3BA9A 3CVZA 4DR5H 3N41B 4DR7H 1B04A 4B3TH 1I94H 2O03A 1BJTA 5FPOA 4RB2C 3IG0A 1J5EH 4LF6H 4JV5H 3FMAA 4DR3H 1HR0H 1HNXH 1HNZH 5FLXW 2RGVA 2WYOA 4RB1A 3K3VA 5FD6A 3RGZA 2KSWA 2HVRA 1WH2A 1MZBA 4MV9A 4LF8H 1TAEA 1AN7A 1SEIA 4Q0YA 2VOBA 2ZM6H 2E5LH 5A2QW 4DUYH 4DV0H 4UCOA 4LF5H 3OTOH 4DV1H 4JI1H 2WE6A 5FPRA 4JI2H 4JI0H 3N43B 3F8NA 1M0TA 4M7EA 4DR1H 4AQYH 4DR2H 1M0WA 4I7HA 2VE7A 4K0KH 3KAKA 2HHHH 2VUGA 5D1OB 4JI4H 3J7AK 1ZHSA 3JSLA 3N40P 2WDTA 3L4JA 5BR8H 2HVQA 1IBMH 2UUCH 2EQOA 3BABA 2ZJTA 3T1HH 2UXCH 4OX9H 4X62H 2IGPA 2HKPA 1IBLH 2VPSA 3EYYA 2OWOA 3RIZA 3M4IA 2UXDH 4MTDA 5FMTA 3BA8A 1N33H 4RZQA 4UCUA 1GYFA 5FD5A 4J0MA 3KALA 4LSAA 3EAYA 5FMUA 4DV2H 4BWSC 4UFZA 5IWAH 4JI3H 3L4KA 4DV4H 4PDBA 3UQ8A 3H20A 4MV7A 2Q2UA 4B3RH 4X65H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 3JRX A;  2E2H A;  4EDM A;  1N34 H;  3G6X A;  4UCT A;  3PW7 A;  4AYB E;  5C1O A;  3QZ8 A;  1DV1 A;  4C5C A;  3ETH A;  1HNW H;  1FJG H;  3VMM A;  5KFO A;  1XMQ H;  1QAG A;  3VP7 A;  2FJZ A;  3KTM A;  4O3S A;  3VPC A;  1I7N A;  5J2U F;  1UJO A;  4IZO A;  1TJT A;  4J9N A;  4ED3 A;  4QIW E;  4DL3 A;  2W9C B;  4NXM H;  5KG7 A;  1UC9 A;  4XX0 B;  3RAQ A;  5KFU A;  4FBU A;  3MWM A;  1E4F T;  4QWD A;  1DIK A;  2R8K A;  3CQZ A;  3QZ7 A;  2R86 A;  1N56 A;  3J80 W;  1UC8 A;  4LMY A;  2BQ3 A;  3MFH A;  2R7Z G;  3L2P A;  2C28 A;  2PN1 A;  4A2B A;  3KHL A;  4Q8E A;  4RB3 C;  3HOR A;  5BVR A;  4GKJ H;  1DGS A;  5D1P A;  3KXY T;  4DL5 A;  2EYN A;  5IYZ F;  3N42 B;  3JZI A;  2XCL A;  5KT2 A;  1S03 G;  4TV8 F;  2XIG A;  1EUV A;  4U7C A;  2AGQ A;  2F4V H;  2NVY A;  1RJR A;  5LL6 b;  5KFK A;  1K1S A;  2JEJ A;  2VA2 A;  1TWF A;  1BXR A;  5L9X A;  4JV2 A;  3RFC A;  3R23 A;  2I8C A;  2VQD A;  3RJ0 A;  5CA1 F;  1V51 A;  2V59 A;  2W71 A;  3PO3 G;  4Y8V B;  3RGX A;  1TA8 A;  3FKI G;  1P2X A;  3IN5 A;  4DL4 A;  1E4G T;  4RNO A;  3GTM A;  2YZM A;  4LH7 A;  5KFV A;  1B6S A;  4R7R A;  4Q43 A;  4LFC H;  4LF7 H;  1GLV A;  1C30 A;  1GO3 E;  4HR7 A;  4UCR A;  5EDW A;  3KHG A;  5LMU H;  2J6T A;  1VKZ A;  4GLX A;  1R9T A;  5D8D A;  2RGR A;  3PW4 A;  3CVZ A;  2DIK A;  3N41 B;  1T3N A;  4RZR A;  4O2B F;  5EWE A;  4EYH B;  3HOY G;  4B3T H;  4RUA A;  1H67 A;  2O03 A;  2R84 A;  4RB2 C;  4TQR A;  3NGD A;  1JXL A;  4BBS G;  4ZI7 F;  1HR0 H;  1GSA A;  1HNX H;  4DL7 A;  4RB1 A;  4J9R A;  4F4X A;  4ME6 A;  5KX5 F;  3U9T A;  4YJ2 F;  3TII A;  3HOP A;  3K3V A;  2R8I A;  1WH2 A;  5KFI A;  5HV6 A;  5KT6 A;  3I4N G;  4Q0Y A;  1SEI A;  2W6O A;  3GIL A;  4A3B G;  2VOB A;  2PMZ E;  2E5L H;  4A3K G;  2C35 B;  3GIQ A;  5JVL A;  3OTO H;  2K3S A;  2D85 A;  2W9B B;  1PA7 A;  2VPQ A;  1M0T A;  4DR1 H;  1KJ9 A;  2DPJ A;  3MFI A;  2VUM G;  4O2A F;  4QWC A;  3GLK A;  1VAJ A;  5IYC G;  3HOW G;  4C5A A;  5DG8 A;  2YS6 A;  2WDT A;  3V4Z A;  1WCM G;  3L4J A;  3SI8 A;  2HVQ A;  2GPS A;  5JH7 F;  1S0O A;  3BAB A;  3Q8P B;  2UXC H;  5JVD F;  4IRC A;  5KFG A;  3AYH B;  1Y1V A;  2HKP A;  2IGP A;  4O4L F;  3EYY A;  4TUY F;  4EBD A;  4TXI A;  2FPG B;  2ZDG A;  1TWC A;  5DLF A;  2UXD H;  3BA8 A;  1I3Q A;  5EWG A;  2YRN A;  3TIN A;  1M7J A;  4O4I F;  3EAY A;  3PR4 A;  4DV2 H;  1S9F A;  3RB4 A;  3U9S A;  4BWS C;  1SCU B;  3KHH A;  4QWA A;  4B7L A;  4MV7 A;  3RB3 A;  3GTQ A;  4B3R H;  2VZD A;  2W7O A;  2J9G A;  3JRW A;  3REP B;  4YBZ B;  3GTL A;  5H80 A;  2R82 A;  1M6V A;  3LWB A;  4RNM A;  2V4Q A;  4A3E G;  2UVV A;  5C44 G;  3EPG A;  2JEF A;  5KFL A;  4EBE A;  2FLL A;  2WB1 A;  1AOA A;  2VZC A;  2YRX A;  5BPH A;  4LF9 H;  2R93 G;  4BY1 G;  4Q58 A;  4ECS A;  2YL2 A;  5DG7 A;  4MA5 A;  4CC5 A;  4KHP H;  5KFF A;  3HOZ G;  2WA5 A;  5DQG A;  1N32 H;  3C0F B;  3N6X A;  3HOV G;  2R7K A;  2D86 A;  3T5K A;  1EHI A;  2NU6 B;  2OLS A;  4M9U A;  5CB4 F;  1C3O A;  1I6U A;  1UEG A;  1XMO H;  5KFH A;  1AUV A;  4JI6 H;  4O3O A;  5A4B A;  1EYZ A;  4QJF A;  2WA7 A;  5IYB G;  4X66 H;  2VQF H;  4DV3 H;  1S0N A;  4GKK H;  2RF4 A;  4LFA H;  2CZG A;  4EFB A;  2W9A A;  3OHB A;  2W9C A;  4O3R A;  1WYM A;  5I47 A;  2FB9 A;  4YB8 B;  4RU9 A;  4TXK A;  1VBH A;  4JV0 A;  4EGQ A;  4A3L G;  2W57 A;  4EDL A;  4IWY A;  1WYQ A;  3K5H A;  4HNU A;  4EFE A;  4ECQ A;  2ASL A;  5C5J A;  2CW8 A;  4EEQ A;  5JQW A;  2B63 A;  2I80 A;  4ED8 A;  1N48 A;  2UUB H;  3HOU G;  3E5N A;  2XC9 A;  3BQ0 A;  2D87 A;  1ZHQ A;  2PVP A;  4Q57 B;  4YY3 H;  5C3E G;  2GLT A;  4AYB A;  4LH6 A;  2W8K A;  3MWE A;  3V4S A;  4APM A;  2FK2 A;  4FM9 A;  1AUX A;  4GC6 A;  2Y0S E;  3Q8S B;  4F4Z A;  4Q8F A;  1JLL B;  1RJP A;  3M9N B;  1K83 A;  1X9N A;  3RV4 A;  3WO0 A;  4DR4 H;  3H0G A;  3HBL A;  3K3P A;  5KG4 A;  4ECZ A;  2MCT A;  2R7M A;  5EZY F;  3BA9 A;  4WBN F;  1B04 A;  3V6H A;  4MAM A;  3TQ1 A;  1Y1V G;  1I94 H;  4LF6 H;  1J5E H;  2DPI A;  5L1K A;  3IG0 A;  4JV5 H;  3T5J A;  3V6K A;  5EWF A;  2R85 A;  4ECX A;  1HNZ H;  1WJO A;  4IR1 A;  4ECR A;  1EUD B;  4O4H F;  4IHJ F;  1KJI A;  3ETJ A;  1B33 N;  3RGZ A;  4TQS A;  5L0O A;  1RK5 A;  2K2R A;  4O3P A;  1PXY A;  3EPI A;  5DGA A;  4MV9 A;  2J6U A;  1TAE A;  2NVX A;  4J9L A;  2QJX A;  1IOW A;  1PX2 A;  2R8H A;  2DLN A;  5A2Q W;  4DUY H;  4G3I A;  4UCO A;  4LF5 H;  2JA6 A;  2WE6 A;  3F8N A;  3OSP A;  2NUA B;  1M0W A;  4QIW A;  1EUC B;  4I7H A;  2VE7 A;  4K0K H;  2C22 A;  2VUG A;  4E4T A;  2RDJ A;  2HHH H;  1ZHS A;  4MA0 A;  3JSL A;  4HNV A;  1GSH A;  5KFM A;  3N40 P;  5L1J A;  4IRD A;  3HKZ E;  3I4M G;  4QWE A;  1IBM H;  2IP4 A;  2JA7 A;  2EQO A;  3OUZ A;  3PR5 B;  3GIM A;  5KKN B;  3T1H H;  2V4R A;  1CQJ B;  2BQU A;  2R0O A;  3QFF A;  5KT4 A;  1IBL H;  2JA8 G;  2OWO A;  3M4I A;  5CA0 F;  4MTD A;  2WAQ E;  4U6P A;  4A3I G;  4UCU A;  2W6M A;  5FD5 A;  1I7L A;  1BHD A;  3T5H A;  5J2T F;  1GGO A;  4LSA A;  5FMU A;  3KMU B;  4UFZ A;  5KG5 A;  4XZ3 B;  3WO1 A;  5IWA H;  1RYR A;  2Q2U A;  2WTF A;  4YQW A;  3H4D A;  1KJQ A;  5L1I A;  3K5I A;  4L1K A;  4YAK B;  5KG2 A;  4DV6 H;  2C2R A;  2FK1 A;  4NXN H;  3HB9 A;  1T94 A;  5KFD A;  3T5L A;  4GC7 A;  3Q2O A;  2UVU A;  5KFC A;  2VZI B;  4ZOL F;  1S97 A;  1O75 A;  5DG9 A;  3HXL A;  4A3G G;  4IAJ A;  3H40 A;  2W9B A;  2DK9 A;  4DUZ H;  4YR3 A;  4JV1 A;  1Z2P X;  3BQ1 A;  4LSX A;  4J9O A;  5KT7 A;  4UCV A;  2WA6 A;  2R87 A;  4IRK A;  4JUZ A;  4DLK A;  4RAZ A;  2HGS A;  1W96 A;  1MB8 A;  2JV9 A;  2HL8 A;  1V4Y A;  1SH5 A;  4XYL B;  4MV8 A;  3J81 W;  3PVX A;  5C4X G;  2R7N A;  3PN1 A;  4R8U A;  1N36 H;  2R6F A;  3Q1K A;  4ZQI A;  3MR3 A;  2C00 A;  2W6N A;  1KC7 A;  1A0I A;  3MR5 A;  1KEE A;  4MV1 A;  3RBE A;  5DQI A;  2YS7 A;  1KBL A;  4ECT A;  2FLN A;  1FKA H;  2SCU B;  4X64 H;  3PZP A;  3KHR A;  1W93 A;  4LFB H;  2NU7 B;  2E9K A;  4ED7 A;  4J9P A;  1RYS A;  4A93 G;  3LML A;  1ZQ7 A;  5FJ8 G;  4F4Y A;  5LOV F;  5F9N A;  5KFW A;  4YR0 A;  2AQ4 A;  2VE7 C;  4DDP A;  3FDS A;  2IA6 A;  4RAY A;  3N44 B;  3RBD A;  4JI7 H;  2VQE H;  4JI8 H;  4FS2 A;  3H3V H;  2W6Z A;  5F9L A;  3JAR M;  1P5S A;  2PMZ A;  4ETS A;  3DF7 A;  4HNT A;  3KMW B;  5C1P A;  3GIK A;  4MV4 A;  3N8D A;  4JI5 H;  3KAJ A;  5K2M A;  2YCH A;  2V58 A;  3R5F A;  3UFX B;  5KT5 A;  3PW2 A;  2IMW P;  1XNQ H;  5IP9 G;  4EBC A;  2D88 A;  1TWH A;  2L3G A;  4EDN A;  4DR5 H;  1DXX A;  5J8E A;  1BJT A;  1V5K A;  3RB0 A;  2C2E A;  3GTJ A;  3RV3 A;  2AGO A;  2RGV A;  3GII A;  3JAK M;  4C2M A;  4XYM B;  2KSW A;  4MV3 A;  4J9Q A;  1MZB A;  4BY7 G;  2BR0 A;  4O3N A;  4NLG A;  4ED2 A;  2JEG A;  4LF8 H;  3CO1 A;  1AN7 A;  1B6R A;  4HYK A;  2J6S A;  1Y14 B;  2JEI A;  2EE7 A;  2ZM6 H;  5KFA A;  3HKZ A;  2WB1 E;  5BMV F;  2VA3 A;  1WYO A;  2VZG B;  4DV1 H;  4JI1 H;  5FPR A;  2JA5 G;  4JI2 H;  4JI0 H;  3ORR A;  3N43 B;  2R7Z A;  4AQY H;  3WNZ A;  4QW9 A;  4ECW A;  1Y1W A;  2YU9 A;  1WYR A;  4J9M A;  3MWD A;  2W70 A;  2FLP A;  4EEY A;  3KAK A;  2ASD A;  2WAQ A;  5LA6 F;  4JI4 H;  5D1O B;  5CAE B;  1WYL A;  2NU8 B;  4ED1 A;  5DGB A;  2RR8 A;  4ECU A;  3J7A K;  3PO2 G;  3G8C A;  5T14 A;  5A37 A;  2UUC H;  3HOC A;  1PK8 A;  2W6Q A;  4I50 F;  3SE7 A;  1T36 A;  5FLM G;  4X62 H;  3Q8R B;  4J9K A;  3GIP A;  2JA6 G;  3OUU A;  2M05 A;  2VPS A;  5BPF A;  3GIJ A;  2V9W A;  2FPP B;  5KFY A;  5KFT A;  3M9O B;  3OHA A;  1AA2 A;  4FS1 A;  2ATL A;  4IWX A;  3HOX G;  3TIG A;  1S10 A;  4J0M A;  3GQC A;  1K1Q A;  3R5X A;  3H4B A;  2UVR A;  4JI3 H;  4DV4 H;  1BNC A;  5LP6 F;  3H20 A;  5KG6 A;  3UQ8 A;  5DLG A;  4PDB A;  3PW5 A;  2ZDQ A;  5JUM A;  2W8L A;  2HVS A;  2X0S A;  2CQY A;  4J9S A;  4TV9 F;  2ZDH A;  3JAM W;  1V9P A;  1VKA A;  1WYP A;  4RB0 A;  4ED0 A;  3Q8Q B;  5LXT F;  4EGJ A;  4DV5 H;  2PBZ A;  1Y1W G;  2HJW A;  2W7P A;  3GV5 B;  2UVW A;  1Z2O X;  4LVP A;  1L2Z A;  1WSC A;  4LVR A;  4DV7 H;  1CQI B;  2Q2T A;  2RDI A;  2UUA H;  3GTG A;  2FP4 B;  5L1L A;  4B3S H;  1VBG A;  1FVI A;  3BJY A;  5KG0 A;  3I12 A;  4Q59 A;  5GON F;  2XCP A;  1KJ8 A;  3JSN A;  3JAL M;  5KFJ A;  2XGQ A;  5KFN A;  2HL9 A;  1JDE A;  1UNN C;  4A2A A;  4RUC A;  2IBK A;  5D1O A;  2UXB H;  1E4E B;  4MTE A;  2E2I A;  5A38 A;  4ECV A;  5EOY A;  5KG3 A;  1JX4 A;  3RTX A;  5KFB A;  2P0A A;  2YRW A;  4PWQ A;  2AGP A;  4DR6 H;  2R8U A;  1S68 A;  3VPB A;  1A9X A;  1ZET A;  2R8J A;  2UU9 H;  4LF4 H;  2JA7 G;  1XDN A;  4UCS A;  1TWA A;  4JYA H;  2DZD A;  4I4T F;  5IP7 G;  5LMN H;  5C8Y F;  1SYX B;  2DWC A;  2NU9 B;  4YP3 A;  2QJZ A;  1JDB B;  4QWB A;  5DQH A;  4A3J G;  1TWG A;  3I6X A;  1WKU A;  2R7L A;  5KFR A;  3G6V A;  4DL6 A;  4A3C G;  4A3M G;  4R8U B;  1VS0 A;  4WD3 A;  5HBR B;  4I55 F;  5KFP A;  1Z2N X;  4A3D G;  4CC6 A;  1WCM A;  1DV2 A;  3MJF A;  3F7P A;  1EZ1 A;  4O3Q A;  2GPW A;  1BGW A;  3RF2 A;  5A36 A;  1P8L A;  4B3M H;  2AU0 A;  1OWT A;  4MV6 A;  5KG1 A;  4RNN A;  4EYI B;  4FBT A;  1XNR H;  5IT9 W;  1IBK H;  2B63 G;  2CW7 A;  4YHH H;  3GID A;  3T1Y H;  2FE3 A;  4BBR G;  3BAA A;  5KFZ A;  3GV8 B;  2OH2 A;  2YYA A;  3GV7 B;  3MR2 A;  2VUM A;  4IR9 A;  4DR7 H;  5KFQ A;  2YW2 A;  3OSN A;  5FPO A;  2ASJ A;  4FU0 A;  3FMA A;  3G6Y A;  2R8G A;  4DR3 H;  1SH6 A;  1WIX A;  3R5H A;  1ULZ A;  2CKZ B;  5FLX W;  4Q45 A;  3H0G G;  2WYO A;  2EYI A;  3LP8 A;  3ORQ A;  4YJ3 F;  2BQR A;  4ED6 A;  2HVR A;  5FD6 A;  5IYD G;  2YZN A;  4F4W A;  1BKR A;  2R92 G;  1E4E A;  4QW8 A;  1JKJ B;  4EG0 A;  4ZHQ F;  4Q44 A;  2Y0S A;  4DV0 H;  2XCA A;  2XGP A;  4BXX G;  2WFN A;  5KT3 A;  1S0M A;  2W6P A;  4M7E A;  3GTP A;  1KJJ A;  3FKI A;  3V6J A;  3GTK A;  5KFX A;  4DR2 H;  3PW0 A;  1RJQ A;  2QYZ A;  3M9M B;  2QK4 A;  5KFE A;  4C5B A;  4F50 A;  5LYJ F;  1RK6 A;  1CE8 A;  4YAJ B;  2XD4 A;  1IOV A;  2ALZ A;  3RUP A;  3TQT A;  5BR8 H;  3BQ2 A;  4ECY A;  4A3F G;  4DL2 A;  2R93 A;  3FER A;  2ZJT A;  1RT8 A;  4OX9 H;  1GSO A;  2V5A A;  3RB6 A;  2VR1 A;  1WYN A;  3RIZ A;  4YR2 A;  2YZG A;  5FMT A;  1N33 H;  1I50 A;  4RZQ A;  1GYF A;  1WR2 A;  5KFS A;  3KY9 A;  3VPD A;  1JIH A;  2FPI B;  3KAL A;  2R92 A;  3MR6 A;  3RAX A;  2I87 A;  1SFO A;  3BG5 A;  3L4K A;  2C2D A;  1CS0 A;  2FMA A;  2JA5 A;  2FK3 A;  2D89 A;  4X65 H;  3GTO A;  4HQ6 A;  2FKL A; 
#chains in the Genus database with same CATH homology
 2HVS A;  4DV6 H;  1N34 H;  4UCT A;  4NXN H;  1FJG H;  1HNW H;  3JAM W;  1V9P A;  4RB0 A;  4DV5 H;  1XMQ H;  4LF9 H;  3VP7 A;  4LVP A;  1Z2O X;  1O75 A;  4CC5 A;  4KHP H;  3HXL A;  1N32 H;  1L2Z A;  4IAJ A;  4LVR A;  3C0F B;  4DUZ H;  4DV7 H;  3N6X A;  2Q2T A;  2UUA H;  4B3S H;  1FVI A;  1Z2P X;  4NXM H;  4LSX A;  1I6U A;  4UCV A;  1XMO H;  3JSN A;  3MWM A;  1E4F T;  4RAZ A;  2HGS A;  2HL9 A;  4A2A A;  5D1O A;  2HL8 A;  4MTE A;  3J81 W;  3J80 W;  4JI6 H;  2UXB H;  5EOY A;  4LMY A;  4X66 H;  2VQF H;  4DV3 H;  4GKK H;  3PN1 A;  3RTX A;  3L2P A;  1N36 H;  4LFA H;  4EFB A;  4DR6 H;  1S68 A;  4A2B A;  4JYA H;  4LF4 H;  2UU9 H;  4RB3 C;  1A0I A;  1XDN A;  4UCS A;  5LMN H;  4GKJ H;  1DGS A;  5D1P A;  3KXY T;  1SYX B;  2W57 A;  3N42 B;  1FKA H;  4EFE A;  1S03 G;  4X64 H;  2XIG A;  1EUV A;  4LFB H;  2F4V H;  2CW8 A;  4EEQ A;  5LL6 b;  3LML A;  1VS0 A;  2UUB H;  1Z2N X;  1ZHQ A;  4CC6 A;  4YY3 H;  3RJ0 A;  2VE7 C;  4DDP A;  1BGW A;  3RF2 A;  4RAY A;  1P8L A;  3N44 B;  4LH6 A;  3RGX A;  1TA8 A;  4JI7 H;  2VQE H;  4B3M H;  4JI8 H;  4APM A;  4FM9 A;  1XNR H;  1E4G T;  5IT9 W;  4LH7 A;  1IBK H;  4ETS A;  3DF7 A;  4JI5 H;  2CW7 A;  4R7R A;  4DR4 H;  1X9N A;  4LFC H;  3KAJ A;  4UCR A;  4LF7 H;  4YHH H;  2YCH A;  5LMU H;  3T1Y H;  2FE3 A;  4GLX A;  1XNQ H;  3BAA A;  2MCT A;  2RGR A;  3BA9 A;  3CVZ A;  4DR5 H;  3N41 B;  4DR7 H;  1B04 A;  4B3T H;  1I94 H;  2O03 A;  1BJT A;  5FPO A;  4RB2 C;  3IG0 A;  1J5E H;  4LF6 H;  4JV5 H;  3FMA A;  4DR3 H;  1HR0 H;  1HNX H;  1HNZ H;  5FLX W;  2RGV A;  2WYO A;  4RB1 A;  3K3V A;  5FD6 A;  3RGZ A;  2KSW A;  2HVR A;  1WH2 A;  1MZB A;  4MV9 A;  4LF8 H;  1TAE A;  1AN7 A;  1SEI A;  4Q0Y A;  2VOB A;  2ZM6 H;  2E5L H;  5A2Q W;  4DUY H;  4DV0 H;  4UCO A;  4LF5 H;  3OTO H;  4DV1 H;  4JI1 H;  2WE6 A;  5FPR A;  4JI2 H;  4JI0 H;  3N43 B;  3F8N A;  1M0T A;  4M7E A;  4DR1 H;  4AQY H;  4DR2 H;  1M0W A;  4I7H A;  2VE7 A;  4K0K H;  3KAK A;  2HHH H;  2VUG A;  5D1O B;  4JI4 H;  3J7A K;  1ZHS A;  3JSL A;  3N40 P;  2WDT A;  3L4J A;  5BR8 H;  2HVQ A;  1IBM H;  2UUC H;  2EQO A;  3BAB A;  2ZJT A;  3T1H H;  2UXC H;  4OX9 H;  4X62 H;  2IGP A;  2HKP A;  1IBL H;  2VPS A;  3EYY A;  2OWO A;  3RIZ A;  3M4I A;  2UXD H;  4MTD A;  5FMT A;  3BA8 A;  1N33 H;  4RZQ A;  4UCU A;  1GYF A;  5FD5 A;  4J0M A;  3KAL A;  4LSA A;  3EAY A;  5FMU A;  4DV2 H;  4BWS C;  4UFZ A;  5IWA H;  4JI3 H;  3L4K A;  4DV4 H;  4PDB A;  3UQ8 A;  3H20 A;  4MV7 A;  2Q2U A;  4B3R H;  4X65 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...