2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/protein binding
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
2J6UA 2V5AA 4IRCA 1GYFA 4L1KA 2ASLA 4JI2H 3K3PA 1B6RA 4ZQIA 5BR8H 2ZM6H 3RBDA 1DGSA 4A3CG 2JV9A 2I87A 4NLGA 2W9AA 2PMZA 1IOWA 1SFOA 2L3GA 2FK2A 4DV5H 3R5XA 1JXLA 5HBRB 3VP7A 3IN5A 1K1QA 2C35B 3R5FA 3T5LA 2RF4A 4JI1H 3MR3A 2FK1A 2YS6A 3Q8RB 4JV2A 4EFEA 3K3VA 1A0IA 5EZYF 4RB0A 2HVSA 4HR7A 3GV5B 5KG2A 1V5KA 4LMYA 4UFZA 2IBKA 1ZHSA 3JAKM 3PR5B 4JI0H 3K5HA 5KFOA 4MV7A 1EZ1A 3RV3A 4PDBA 5IP7G 3T5KA 2R92G 4C5BA 3PO3G 2VQFH 4ECQA 4DR6H 3MWMA 5KFJA 1I3QA 2V59A 4LFCH 4DR3H 4MV4A 5IYZF 3MR5A 2ZDHA 3GIQA 4DL7A 3U9TA 4BY1G 1CQIB 2JA8G 4C2MA 2QJZA 3MR6A 2W7PA 3KAKA 3N42B 2I80A 3KHHA 2C28A 3H3VH 4EYHB 3N44B 5DGAA 1R9TA 4Q0YA 4EG0A 5KT5A 1PX2A 3QFFA 2UVUA 4MV9A 2EE7A 2WE6A 4ED2A 5DGBA 5FD5A 2VPSA 2QK4A 1C3OA 1WJOA 2R85A 3LWBA 4LSXA 2VQEH 4RNOA 4J0MA 3H0GG 1Y1WA 3RGZA 1VKAA 5KG0A 5KFBA 4U7CA 2FP4B 3HB9A 4TQSA 2HJWA 2JA6A 3I4NG 5A4BA 2JEFA 5L1JA 2R8UA 3RB6A 2YZGA 2XD4A 2YS7A 3SE7A 2GPSA 5T14A 5IYDG 3V6KA 1RYRA 2GPWA 4DR7H 2R7ZA 3RV4A 2C00A 2YRXA 4MV1A 4KHPH 3BQ2A 5D1OA 5J2UF 3HORA 1N56A 3G6XA 4A3FG 4IR1A 3HOWG 4YR3A 5KT7A 1PA7A 3TINA 1AUXA 5IYBG 2J6TA 4IRKA 1M7JA 4BBRG 5KFQA 4EEYA 4EBEA 1IOVA 3C0FB 3E5NA 4TXIA 5L1IA 2JA5A 5KG4A 1SCUB 3GTGA 1TA8A 5KFRA 4GLXA 4EDNA 2WA5A 1TWAA 1WYOA 4MTEA 2XCLA 5LYJF 5KFNA 3V6JA 1XMQH 4XX0B 1N34H 2HGSA 4XYMB 4FBTA 2JA7A 4A3KG 1KJ9A 1GSOA 5EWFA 2C2RA 4HYKA 2FPIB 4IAJA 1RJRA 4RB2C 4RB1A 4HNTA 5K2MA 1UNNC 2FPPB 4ECXA 1PXYA 1UC9A 3HKZA 4O4HF 3RJ0A 5I47A 3GV8B 2VZIB 3KALA 3OHBA 2HL8A 5FMUA 1V4YA 3GTQA 3OTOH 3PW0A 3BABA 3BAAA 4YR2A 2BQ3A 2VUMA 4J9NA 4DL6A 1Z2PX 3FDSA 4DL4A 1GLVA 2W9CB 1S03G 5D1PA 1RK6A 3MWDA 4UCTA 5KFEA 1C30A 3G8CA 2W57A 2FE3A 3GIMA 3RB3A 2CW7A 5LMUH 2VZCA 4C5CA 2K3SA 4ETSA 4LF7H 1P8LA 3GIKA 3UFXB 1OWTA 1I7LA 3N6XA 4UCOA 5KT4A 2W8KA 3GQCA 3H4BA 2FB9A 4DR2H 3PW7A 3N8DA 2D86A 5LP6F 4WBNF 2B63G 1I50A 3HKZE 3G6VA 1WYLA 2PVPA 2E2HA 1TJTA 3BG5A 4EYIB 2OH2A 4A3EG 1AN7A 3T5HA 3OHAA 3N41B 4YR0A 2BQUA 2DPJA 4A3DG 1EYZA 4EGJA 4JI4H 2R7ZG 5KFCA 4I7HA 3PO2G 2E9KA 1WCMG 2EYNA 1WYQA 1WYPA 2UVRA 2VE7A 5GONF 4ZHQF 4EGQA 3FKIA 4A3GG 2UU9H 3HXLA 5EDWA 2JEIA 4DR1H 2VUGA 3GIDA 3BJYA 4HNVA 2W6QA 1TWGA 1EUVA 2WAQA 4U6PA 4RB3C 2Y0SA 4DV3H 5F9NA 5DLFA 4QWDA 2W9BB 3HOVG 1I6UA 4A2AA 2NU9B 3I12A 2W9CA 5C5JA 2NU7B 3J80W 3T1YH 5KFVA 1SEIA 3VPBA 3RB4A 4QWEA 4LF6H 1S10A 3M9MB 4X65H 3ETHA 1S0OA 5BPHA 1PK8A 4JI8H 2UXBH 2CQYA 3EAYA 4DUYH 2WA7A 1M0WA 2W6MA 2R8HA 3RGXA 2UVVA 4AYBA 4ED7A 1TWCA 4JV1A 1GSAA 4RU9A 2W6NA 2R8IA 3BQ1A 1KEEA 4ED6A 4OX9H 1S0NA 5J8EA 2W7OA 3L4JA 2F4VH 2J9GA 2V4RA 1CS0A 4J9RA 4DL5A 3PW2A 2R6FA 2SCUB 1JKJB 3CO1A 1RK5A 4ECRA 2AGOA 3U9SA 5KFSA 2YW2A 5DQIA 5CA0F 2VZDA 5DQHA 4A93G 2WAQE 1T94A 2W70A 2WTFA 3PN1A 3J81W 3F7PA 4CC5A 1E4FT 2C2EA 2YU9A 4TV9F 4JI5H 2PMZE 2YYAA 2ZDGA 4A3BG 4J9PA 1EUDB 3H20A 2OWOA 5KT3A 5C1PA 1BKRA 1ULZA 3HOCA 1BNCA 1Y14B 2W9BA 2NVYA 1S97A 5J2TF 4AYBE 4CC6A 4JUZA 4LH7A 1GGOA 2RGRA 2CZGA 5FD6A 2XGQA 4FBUA 4MV6A 4MAMA 5JVLA 4XZ3B 3JSNA 4MA5A 2HHHH 3HOUG 1P2XA 2NU8B 1S9FA 4NXMH 4F50A 1N33H 2R93G 2R7NA 3WO0A 1IBLH 2R8JA 5DLGA 3JRXA 2W6PA 2WB1A 4EEQA 1KJQA 4E4TA 1UJOA 4DV2H 4FU0A 5KFMA 2EYIA 4DDPA 4IWXA 3V4SA 2FLPA 2R7KA 4Q45A 4LSAA 2HVRA 1AOAA 4ECWA 1ZETA 1EHIA 5BVRA 4F4YA 2C22A 1K83A 4M9UA 2GLTA 2Q2TA 1UC8A 3TQ1A 4TQRA 5KFGA 4RUCA 2UUBH 2YCHA 4RAZA 3FERA 4QW8A 1W96A 2RR8A 4YBZB 3KHGA 4O4IF 1IBKH 5L0OA 1A9XA 2M05A 4DV1H 3RBEA 2WA6A 4DL3A 5KG6A 1WKUA 4RAYA 2W8LA 5BPFA 1M0TA 3RB0A 2MCTA 3Q2OA 3KMWB 1B33N 2W6ZA 1I7NA 1BGWA 2WB1E 4B3TH 4Q8EA 4ED3A 4O3OA 2J6SA 4ZI7F 1CQJB 5KX5F 2HVQA 4A3JG 1Y1VA 2YL2A 5EWGA 1WYRA 5KG5A 3EPIA 4X62H 2V4QA 2UVWA 4R7RA 3REPB 4ECZA 2FMAA 3VPCA 4YQWA 1N36H 1L2ZA 5H80A 4ED1A 2R7MA 3QZ8A 4Q8FA 4BBSG 4O2AF 2R0OA 3JSLA 1QAGA 3WNZA 5LL6b 4R8UB 2D88A 4BXXG 1JDEA 3Q8PB 3PVXA 3JARM 2VZGB 5EWEA 4A3MG 4DL2A 4BWSC 4DR5H 3N43B 4LF9H 4X64H 5FLXW 1Y1WG 2R84A 4YAJB 3GIPA 2IMWP 4RZRA 1MB8A 2C2DA 3V4ZA 2JA6G 5KFXA 1WR2A 2R82A 4I55F 4QIWA 5KFTA 2XC9A 1DV1A 4ME6A 3KXYT 2R92A 4J9QA 2WFNA 5L1LA 4G3IA 2QJXA 2ATLA 5BMVF 3AYHB 4J9SA 3J7AK 4UCSA 4ECUA 3GTLA 3G6YA 5A36A 5FLMG 1JX4A 1DXXA 2CW8A 4RNMA 3BA9A 1H67A 3HOXG 4XYLB 4ECYA 3CQZA 1GO3E 4NXNH 1ZQ7A 3I6XA 2R8KA 4O3RA 1XNRH 2JA5G 2I8CA 4IRDA 4LVRA 1S0MA 2D87A 2NVXA 5KFUA 3RAQA 2PN1A 2HL9A 2XCPA 4J9KA 5FJ8G 4MV3A 3ORQA 1FKAH 3N40P 3TQTA 4B3SH 1UEGA 2JA7G 1AUVA 4Q43A 1CE8A 2QYZA 4A3IG 4Q57B 4DLKA 3H0GA 2PBZA 4R8UA 5KFFA 2IA6A 1BHDA 2K2RA 4Y8VB 5KFIA 1XMOH 4MV8A 2R8GA 3I4MG 4QIWE 5D8DA 3JRWA 1E4GT 3GIIA 4O2BF 5KFPA 1Z2NX 2DIKA 3K5IA 4ECVA 4O3PA 4GKKH 4YHHH 4LFAH 1VS0A 1ZHQA 2ZDQA 1BJTA 1KJ8A 5KG7A 4FS1A 1WYMA 3EPGA 4F4ZA 3M4IA 4Q44A 3PZPA 1HNXH 1WSCA 1TWHA 5C3EG 4YAKB 4UCUA 3VPDA 3MFIA 4JI3H 3OUUA 2VUMG 2UXDH 4QW9A 4YY3H 2FJZA 2ASJA 5CB4F 4EFBA 1SH5A 3MWEA 4X66H 1KJIA 4FS2A 2Y0SE 2FLLA 4MA0A 1IBMH 3KY9A 4EBDA 3H4DA 2AQ4A 1HR0H 4JI6H 3DF7A 2UUAH 2XIGA 4AQYH 5FPOA 5IT9W 2VR1A 2NUAB 3Q8SB 2AGQA 1HNZH 2FLNA 5F9LA 1VAJA 2VE7C 4F4XA 4QWCA 5LOVF 4DV0H 5KFDA 4J9LA 4UCRA 5D1OB 2ZJTA 3UQ8A 2FKLA 2DWCA 4Q59A 1V51A 3T5JA 4EDLA 2VA3A 4GKJH 3MJFA 3PW5A 4TV8F 5LA6F 3BA8A 3SI8A 4LVPA 5KG1A 5DQGA 1SYXB 4RZQA 1KJJA 1WYNA 3KHRA 3WO1A 3GLKA 5C8YF 2E2IA 1FJGH 1P5SA 2OLSA 2DK9A 3FKIG 3T1HH 3MFHA 2Q2UA 3Q1KA 4LF5H 4ZOLF 3RUPA 3KAJA 5KT2A 4ECTA 2EQOA 2IP4A 4YJ2F 1RT8A 3JAMW 3FMAA 3GTKA 5A38A 4I4TF 4I50F 4J9OA 4LF8H 3M9OB 4Q58A 1M6VA 4TUYF 3HOYG 2VPQA 5KFAA 1K1SA 4WD3A 3TIIA 2B63A 4EBCA 5KFZA 4FM9A 5KFLA 4O3NA 1DV2A 5JQWA 5C44G 5A2QW 5DG8A 4UCVA 3GIJA 3L4KA 4ED8A 4YJ3F 1E4EB 3PR4A 3EYYA 3MR2A 2DPIA 2YZMA 1T36A 4LH6A 3RTXA 3IG0A 4O3QA 1WCMA 4IHJF 3BQ0A 5FMTA 1B6SA 1V9PA 2FPGB 2WYOA 4IWYA 1VBHA 1FVIA 2XGPA 3LMLA 3H40A 4IR9A 5KFKA 4APMA 5LMNH 2NU6B 1I94H 3F8NA 3RFCA 1S68A 2DLNA 4A2BA 2UUCH 4MTDA 2JEJA 1Z2OX 2P0AA 3NGDA 3M9NB 3KHLA 4B3RH 2DZDA 3Q8QB 2CKZB 2V9WA 1N48A 4HQ6A 1X9NA 5JUMA 4ED0A 4ECSA 3HOZG 1VBGA 2VQDA 4DV6H 2YRNA 5CAEB 5LXTF 2RGVA 5JVDF 2R86A 3GTMA 1B04A 2KSWA 3JZIA 4LFBH 3KMUB 1HNWH 5A37A 1RYSA 3GTPA 1JIHA 4PWQA 1MZBA 5IP9G 4J9MA 5KG3A 3OSPA 5KFYA 4JI7H 1W93A 3ETJA 5L1KA 3ORRA 3GTOA 2BQRA 1DIKA 4O4LF 3OUZA 4LF4H 2VOBA 3LP8A 2VA2A 5IWAH 1EUCB 4TXKA 5KT6A 2E5LH 4JV0A 4K0KH 2ALZA 5KKNB 2R87A 2RDIA 2R7LA 1TWFA 2IGPA 4BY7G 4RUAA 1N32H 4QJFA 4DR4H 3JALM 1GSHA 3RF2A 5L9XA 3GTJA 5JH7F 1E4EA 2RDJA 4GC7A 3RAXA 2W6OA 2O03A 3QZ7A 3HBLA 2AU0A 1VKZA 2V58A 5FPRA 3RIZA 4O3SA 3KTMA 2FK3A 4M7EA 4HNUA 4F4WA 4DV7H 1WH2A 4GC6A 2AGPA 3L2PA 2W71A 1O75A 2YRWA 3GILA 1BXRA 1AA2A 4B7LA 3V6HA 4QWBA 4JV5H 2D89A 2ASDA 2YZNA 5C1OA 2BR0A 1T3NA 5DG7A 1KC7A 2XCAA 4QWAA 3R23A 2WDTA 5HV6A 5DG9A 1XNQH 1TAEA 4RNNA 4JYAH 3VMMA 5KFWA 3OSNA 1J5EH 4A3LG 1JLLB 3GV7B 2R93A 5CA1F 5IYCG 3PW4A 1KBLA 5C4XG 3HOPA 2X0SA 4B3MH 3R5HA 4IZOA 4YP3A 2UXCH 4EDMA 1JDBB 4C5AA 5KFHA 1RJPA 4DV4H 1SH6A 2D85A 2HKPA 1Y1VG 1RJQA 4YB8B 4DUZH 2JEGA 1WIXA 5EOYA 1XDNA 3TIGA 3CVZA
chains in the Genus database with same CATH topology
4LF7H 1SYXB 4RZQA 1P8LA 1GYFA 1BGWA 3N6XA 4UCOA 4JI2H 5BR8H 2ZM6H 4DR2H 4B3TH 1DGSA 1FJGH 3T1HH 2Q2UA 4LF5H 2HVQA 4DV5H 3KAJA 3VP7A 1AN7A 4JI1H 3N41B 4X62H 2EQOA 4R7RA 4JI4H 4EFEA 3K3VA 3JAMW 1A0IA 3FMAA 4I7HA 1N36H 4RB0A 2HVSA 1L2ZA 4LF8H 2VE7A 4LMYA 4UFZA 1ZHSA 4FM9A 2UU9H 3HXLA 3JSLA 5A2QW 5LL6b 4DR1H 4MV7A 2VUGA 4UCVA 3L4KA 4JI0H 4PDBA 4ETSA 2VQFH 3EYYA 4RB3C 1EUVA 4DR6H 4DV3H 3MWMA 4LH6A 3RTXA 4BWSC 3IG0A 3N43B 4DR5H 4DR3H 4LF9H 4X64H 5FMTA 2WYOA 1V9PA 4A2AA 5FLXW 1I6UA 1FVIA 3LMLA 3J80W 5LMNH 4APMA 3T1YH 1I94H 1SEIA 3F8NA 1S68A 4A2BA 2UUCH 3KAKA 3N42B 4MTDA 4LF6H 1Z2OX 4X65H 4B3RH 3N44B 4JI8H 2UXBH 3KXYT 4Q0YA 3EAYA 4DUYH 1X9NA 1M0WA 4MV9A 3RGXA 4DV6H 4OX9H 2WE6A 5FD5A 3J7AK 4UCSA 2VPSA 2RGVA 3L4JA 4LSXA 2VQEH 2F4VH 1B04A 2CW8A 4J0MA 3BA9A 2KSWA 3RGZA 4LFBH 1HNWH 1XNRH 1MZBA 4JI7H 4NXNH 4LVRA 4LF4H 2HL9A 4DR7H 2VOBA 5IWAH 1FKAH 3N40P 3PN1A 4B3SH 2E5LH 3J81W 4KHPH 4K0KH 5D1OA 4CC5A 1E4FT 2IGPA 4JI5H 1N32H 4DR4H 3RF2A 3H20A 1XMOH 2OWOA 1E4GT 3C0FB 1Z2NX 2O03A 1TA8A 4GKKH 4YHHH 4GLXA 4LFAH 1VS0A 1ZHQA 5FPRA 1BJTA 4MTEA 4CC6A 4M7EA 4LH7A 3RIZA 4DV7H 1WH2A 5FD6A 1XMQH 2HGSA 3L2PA 1N34H 2HHHH 1O75A 3JSNA 3M4IA 1HNXH 4UCUA 4IAJA 4NXMH 1N33H 4JI3H 1IBLH 4RB1A 4RB2C 4JV5H 2UXDH 4YY3H 4EEQA 4EFBA 4X66H 4LFCH 4DV2H 3RJ0A 4DDPA 1IBMH 4LSAA 2WDTA 2HVRA 3KALA 1HR0H 3DF7A 2UUAH 2RGRA 2XIGA 4AQYH 2Q2TA 1TAEA 4JI6H 5FPOA 2HL8A 5FMUA 1J5EH 1XNQH 3OTOH 4JYAH 3BABA 3BAAA 5IT9W 1HNZH 1Z2PX 2VE7C 2UUBH 2YCHA 4RAZA 4DV0H 4B3MH 4UCRA 5D1OB 2ZJTA 5D1PA 3UQ8A 4UCTA 4DV4H 1IBKH 1S03G 2UXCH 2HKPA 2FE3A 2W57A 4DV1H 4GKJH 4DUZH 2CW7A 5LMUH 5EOYA 1XDNA 3CVZA 4RAYA 3BA8A 4LVPA 1M0TA 2MCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 2J6U A;  2V5A A;  4IRC A;  1GYF A;  4L1K A;  2ASL A;  4JI2 H;  3K3P A;  1B6R A;  4ZQI A;  5BR8 H;  2ZM6 H;  3RBD A;  1DGS A;  4A3C G;  2JV9 A;  2I87 A;  4NLG A;  2W9A A;  2PMZ A;  1IOW A;  1SFO A;  2L3G A;  2FK2 A;  4DV5 H;  3R5X A;  1JXL A;  5HBR B;  3VP7 A;  3IN5 A;  1K1Q A;  2C35 B;  3R5F A;  3T5L A;  2RF4 A;  4JI1 H;  3MR3 A;  2FK1 A;  2YS6 A;  3Q8R B;  4JV2 A;  4EFE A;  3K3V A;  1A0I A;  5EZY F;  4RB0 A;  2HVS A;  4HR7 A;  3GV5 B;  5KG2 A;  1V5K A;  4LMY A;  4UFZ A;  2IBK A;  1ZHS A;  3JAK M;  3PR5 B;  4JI0 H;  3K5H A;  5KFO A;  4MV7 A;  1EZ1 A;  3RV3 A;  4PDB A;  5IP7 G;  3T5K A;  2R92 G;  4C5B A;  3PO3 G;  2VQF H;  4ECQ A;  4DR6 H;  3MWM A;  5KFJ A;  1I3Q A;  2V59 A;  4LFC H;  4DR3 H;  4MV4 A;  5IYZ F;  3MR5 A;  2ZDH A;  3GIQ A;  4DL7 A;  3U9T A;  4BY1 G;  1CQI B;  2JA8 G;  4C2M A;  2QJZ A;  3MR6 A;  2W7P A;  3KAK A;  3N42 B;  2I80 A;  3KHH A;  2C28 A;  3H3V H;  4EYH B;  3N44 B;  5DGA A;  1R9T A;  4Q0Y A;  4EG0 A;  5KT5 A;  1PX2 A;  3QFF A;  2UVU A;  4MV9 A;  2EE7 A;  2WE6 A;  4ED2 A;  5DGB A;  5FD5 A;  2VPS A;  2QK4 A;  1C3O A;  1WJO A;  2R85 A;  3LWB A;  4LSX A;  2VQE H;  4RNO A;  4J0M A;  3H0G G;  1Y1W A;  3RGZ A;  1VKA A;  5KG0 A;  5KFB A;  4U7C A;  2FP4 B;  3HB9 A;  4TQS A;  2HJW A;  2JA6 A;  3I4N G;  5A4B A;  2JEF A;  5L1J A;  2R8U A;  3RB6 A;  2YZG A;  2XD4 A;  2YS7 A;  3SE7 A;  2GPS A;  5T14 A;  5IYD G;  3V6K A;  1RYR A;  2GPW A;  4DR7 H;  2R7Z A;  3RV4 A;  2C00 A;  2YRX A;  4MV1 A;  4KHP H;  3BQ2 A;  5D1O A;  5J2U F;  3HOR A;  1N56 A;  3G6X A;  4A3F G;  4IR1 A;  3HOW G;  4YR3 A;  5KT7 A;  1PA7 A;  3TIN A;  1AUX A;  5IYB G;  2J6T A;  4IRK A;  1M7J A;  4BBR G;  5KFQ A;  4EEY A;  4EBE A;  1IOV A;  3C0F B;  3E5N A;  4TXI A;  5L1I A;  2JA5 A;  5KG4 A;  1SCU B;  3GTG A;  1TA8 A;  5KFR A;  4GLX A;  4EDN A;  2WA5 A;  1TWA A;  1WYO A;  4MTE A;  2XCL A;  5LYJ F;  5KFN A;  3V6J A;  1XMQ H;  4XX0 B;  1N34 H;  2HGS A;  4XYM B;  4FBT A;  2JA7 A;  4A3K G;  1KJ9 A;  1GSO A;  5EWF A;  2C2R A;  4HYK A;  2FPI B;  4IAJ A;  1RJR A;  4RB2 C;  4RB1 A;  4HNT A;  5K2M A;  1UNN C;  2FPP B;  4ECX A;  1PXY A;  1UC9 A;  3HKZ A;  4O4H F;  3RJ0 A;  5I47 A;  3GV8 B;  2VZI B;  3KAL A;  3OHB A;  2HL8 A;  5FMU A;  1V4Y A;  3GTQ A;  3OTO H;  3PW0 A;  3BAB A;  3BAA A;  4YR2 A;  2BQ3 A;  2VUM A;  4J9N A;  4DL6 A;  1Z2P X;  3FDS A;  4DL4 A;  1GLV A;  2W9C B;  1S03 G;  5D1P A;  1RK6 A;  3MWD A;  4UCT A;  5KFE A;  1C30 A;  3G8C A;  2W57 A;  2FE3 A;  3GIM A;  3RB3 A;  2CW7 A;  5LMU H;  2VZC A;  4C5C A;  2K3S A;  4ETS A;  4LF7 H;  1P8L A;  3GIK A;  3UFX B;  1OWT A;  1I7L A;  3N6X A;  4UCO A;  5KT4 A;  2W8K A;  3GQC A;  3H4B A;  2FB9 A;  4DR2 H;  3PW7 A;  3N8D A;  2D86 A;  5LP6 F;  4WBN F;  2B63 G;  1I50 A;  3HKZ E;  3G6V A;  1WYL A;  2PVP A;  2E2H A;  1TJT A;  3BG5 A;  4EYI B;  2OH2 A;  4A3E G;  1AN7 A;  3T5H A;  3OHA A;  3N41 B;  4YR0 A;  2BQU A;  2DPJ A;  4A3D G;  1EYZ A;  4EGJ A;  4JI4 H;  2R7Z G;  5KFC A;  4I7H A;  3PO2 G;  2E9K A;  1WCM G;  2EYN A;  1WYQ A;  1WYP A;  2UVR A;  2VE7 A;  5GON F;  4ZHQ F;  4EGQ A;  3FKI A;  4A3G G;  2UU9 H;  3HXL A;  5EDW A;  2JEI A;  4DR1 H;  2VUG A;  3GID A;  3BJY A;  4HNV A;  2W6Q A;  1TWG A;  1EUV A;  2WAQ A;  4U6P A;  4RB3 C;  2Y0S A;  4DV3 H;  5F9N A;  5DLF A;  4QWD A;  2W9B B;  3HOV G;  1I6U A;  4A2A A;  2NU9 B;  3I12 A;  2W9C A;  5C5J A;  2NU7 B;  3J80 W;  3T1Y H;  5KFV A;  1SEI A;  3VPB A;  3RB4 A;  4QWE A;  4LF6 H;  1S10 A;  3M9M B;  4X65 H;  3ETH A;  1S0O A;  5BPH A;  1PK8 A;  4JI8 H;  2UXB H;  2CQY A;  3EAY A;  4DUY H;  2WA7 A;  1M0W A;  2W6M A;  2R8H A;  3RGX A;  2UVV A;  4AYB A;  4ED7 A;  1TWC A;  4JV1 A;  1GSA A;  4RU9 A;  2W6N A;  2R8I A;  3BQ1 A;  1KEE A;  4ED6 A;  4OX9 H;  1S0N A;  5J8E A;  2W7O A;  3L4J A;  2F4V H;  2J9G A;  2V4R A;  1CS0 A;  4J9R A;  4DL5 A;  3PW2 A;  2R6F A;  2SCU B;  1JKJ B;  3CO1 A;  1RK5 A;  4ECR A;  2AGO A;  3U9S A;  5KFS A;  2YW2 A;  5DQI A;  5CA0 F;  2VZD A;  5DQH A;  4A93 G;  2WAQ E;  1T94 A;  2W70 A;  2WTF A;  3PN1 A;  3J81 W;  3F7P A;  4CC5 A;  1E4F T;  2C2E A;  2YU9 A;  4TV9 F;  4JI5 H;  2PMZ E;  2YYA A;  2ZDG A;  4A3B G;  4J9P A;  1EUD B;  3H20 A;  2OWO A;  5KT3 A;  5C1P A;  1BKR A;  1ULZ A;  3HOC A;  1BNC A;  1Y14 B;  2W9B A;  2NVY A;  1S97 A;  5J2T F;  4AYB E;  4CC6 A;  4JUZ A;  4LH7 A;  1GGO A;  2RGR A;  2CZG A;  5FD6 A;  2XGQ A;  4FBU A;  4MV6 A;  4MAM A;  5JVL A;  4XZ3 B;  3JSN A;  4MA5 A;  2HHH H;  3HOU G;  1P2X A;  2NU8 B;  1S9F A;  4NXM H;  4F50 A;  1N33 H;  2R93 G;  2R7N A;  3WO0 A;  1IBL H;  2R8J A;  5DLG A;  3JRX A;  2W6P A;  2WB1 A;  4EEQ A;  1KJQ A;  4E4T A;  1UJO A;  4DV2 H;  4FU0 A;  5KFM A;  2EYI A;  4DDP A;  4IWX A;  3V4S A;  2FLP A;  2R7K A;  4Q45 A;  4LSA A;  2HVR A;  1AOA A;  4ECW A;  1ZET A;  1EHI A;  5BVR A;  4F4Y A;  2C22 A;  1K83 A;  4M9U A;  2GLT A;  2Q2T A;  1UC8 A;  3TQ1 A;  4TQR A;  5KFG A;  4RUC A;  2UUB H;  2YCH A;  4RAZ A;  3FER A;  4QW8 A;  1W96 A;  2RR8 A;  4YBZ B;  3KHG A;  4O4I F;  1IBK H;  5L0O A;  1A9X A;  2M05 A;  4DV1 H;  3RBE A;  2WA6 A;  4DL3 A;  5KG6 A;  1WKU A;  4RAY A;  2W8L A;  5BPF A;  1M0T A;  3RB0 A;  2MCT A;  3Q2O A;  3KMW B;  1B33 N;  2W6Z A;  1I7N A;  1BGW A;  2WB1 E;  4B3T H;  4Q8E A;  4ED3 A;  4O3O A;  2J6S A;  4ZI7 F;  1CQJ B;  5KX5 F;  2HVQ A;  4A3J G;  1Y1V A;  2YL2 A;  5EWG A;  1WYR A;  5KG5 A;  3EPI A;  4X62 H;  2V4Q A;  2UVW A;  4R7R A;  3REP B;  4ECZ A;  2FMA A;  3VPC A;  4YQW A;  1N36 H;  1L2Z A;  5H80 A;  4ED1 A;  2R7M A;  3QZ8 A;  4Q8F A;  4BBS G;  4O2A F;  2R0O A;  3JSL A;  1QAG A;  3WNZ A;  5LL6 b;  4R8U B;  2D88 A;  4BXX G;  1JDE A;  3Q8P B;  3PVX A;  3JAR M;  2VZG B;  5EWE A;  4A3M G;  4DL2 A;  4BWS C;  4DR5 H;  3N43 B;  4LF9 H;  4X64 H;  5FLX W;  1Y1W G;  2R84 A;  4YAJ B;  3GIP A;  2IMW P;  4RZR A;  1MB8 A;  2C2D A;  3V4Z A;  2JA6 G;  5KFX A;  1WR2 A;  2R82 A;  4I55 F;  4QIW A;  5KFT A;  2XC9 A;  1DV1 A;  4ME6 A;  3KXY T;  2R92 A;  4J9Q A;  2WFN A;  5L1L A;  4G3I A;  2QJX A;  2ATL A;  5BMV F;  3AYH B;  4J9S A;  3J7A K;  4UCS A;  4ECU A;  3GTL A;  3G6Y A;  5A36 A;  5FLM G;  1JX4 A;  1DXX A;  2CW8 A;  4RNM A;  3BA9 A;  1H67 A;  3HOX G;  4XYL B;  4ECY A;  3CQZ A;  1GO3 E;  4NXN H;  1ZQ7 A;  3I6X A;  2R8K A;  4O3R A;  1XNR H;  2JA5 G;  2I8C A;  4IRD A;  4LVR A;  1S0M A;  2D87 A;  2NVX A;  5KFU A;  3RAQ A;  2PN1 A;  2HL9 A;  2XCP A;  4J9K A;  5FJ8 G;  4MV3 A;  3ORQ A;  1FKA H;  3N40 P;  3TQT A;  4B3S H;  1UEG A;  2JA7 G;  1AUV A;  4Q43 A;  1CE8 A;  2QYZ A;  4A3I G;  4Q57 B;  4DLK A;  3H0G A;  2PBZ A;  4R8U A;  5KFF A;  2IA6 A;  1BHD A;  2K2R A;  4Y8V B;  5KFI A;  1XMO H;  4MV8 A;  2R8G A;  3I4M G;  4QIW E;  5D8D A;  3JRW A;  1E4G T;  3GII A;  4O2B F;  5KFP A;  1Z2N X;  2DIK A;  3K5I A;  4ECV A;  4O3P A;  4GKK H;  4YHH H;  4LFA H;  1VS0 A;  1ZHQ A;  2ZDQ A;  1BJT A;  1KJ8 A;  5KG7 A;  4FS1 A;  1WYM A;  3EPG A;  4F4Z A;  3M4I A;  4Q44 A;  3PZP A;  1HNX H;  1WSC A;  1TWH A;  5C3E G;  4YAK B;  4UCU A;  3VPD A;  3MFI A;  4JI3 H;  3OUU A;  2VUM G;  2UXD H;  4QW9 A;  4YY3 H;  2FJZ A;  2ASJ A;  5CB4 F;  4EFB A;  1SH5 A;  3MWE A;  4X66 H;  1KJI A;  4FS2 A;  2Y0S E;  2FLL A;  4MA0 A;  1IBM H;  3KY9 A;  4EBD A;  3H4D A;  2AQ4 A;  1HR0 H;  4JI6 H;  3DF7 A;  2UUA H;  2XIG A;  4AQY H;  5FPO A;  5IT9 W;  2VR1 A;  2NUA B;  3Q8S B;  2AGQ A;  1HNZ H;  2FLN A;  5F9L A;  1VAJ A;  2VE7 C;  4F4X A;  4QWC A;  5LOV F;  4DV0 H;  5KFD A;  4J9L A;  4UCR A;  5D1O B;  2ZJT A;  3UQ8 A;  2FKL A;  2DWC A;  4Q59 A;  1V51 A;  3T5J A;  4EDL A;  2VA3 A;  4GKJ H;  3MJF A;  3PW5 A;  4TV8 F;  5LA6 F;  3BA8 A;  3SI8 A;  4LVP A;  5KG1 A;  5DQG A;  1SYX B;  4RZQ A;  1KJJ A;  1WYN A;  3KHR A;  3WO1 A;  3GLK A;  5C8Y F;  2E2I A;  1FJG H;  1P5S A;  2OLS A;  2DK9 A;  3FKI G;  3T1H H;  3MFH A;  2Q2U A;  3Q1K A;  4LF5 H;  4ZOL F;  3RUP A;  3KAJ A;  5KT2 A;  4ECT A;  2EQO A;  2IP4 A;  4YJ2 F;  1RT8 A;  3JAM W;  3FMA A;  3GTK A;  5A38 A;  4I4T F;  4I50 F;  4J9O A;  4LF8 H;  3M9O B;  4Q58 A;  1M6V A;  4TUY F;  3HOY G;  2VPQ A;  5KFA A;  1K1S A;  4WD3 A;  3TII A;  2B63 A;  4EBC A;  5KFZ A;  4FM9 A;  5KFL A;  4O3N A;  1DV2 A;  5JQW A;  5C44 G;  5A2Q W;  5DG8 A;  4UCV A;  3GIJ A;  3L4K A;  4ED8 A;  4YJ3 F;  1E4E B;  3PR4 A;  3EYY A;  3MR2 A;  2DPI A;  2YZM A;  1T36 A;  4LH6 A;  3RTX A;  3IG0 A;  4O3Q A;  1WCM A;  4IHJ F;  3BQ0 A;  5FMT A;  1B6S A;  1V9P A;  2FPG B;  2WYO A;  4IWY A;  1VBH A;  1FVI A;  2XGP A;  3LML A;  3H40 A;  4IR9 A;  5KFK A;  4APM A;  5LMN H;  2NU6 B;  1I94 H;  3F8N A;  3RFC A;  1S68 A;  2DLN A;  4A2B A;  2UUC H;  4MTD A;  2JEJ A;  1Z2O X;  2P0A A;  3NGD A;  3M9N B;  3KHL A;  4B3R H;  2DZD A;  3Q8Q B;  2CKZ B;  2V9W A;  1N48 A;  4HQ6 A;  1X9N A;  5JUM A;  4ED0 A;  4ECS A;  3HOZ G;  1VBG A;  2VQD A;  4DV6 H;  2YRN A;  5CAE B;  5LXT F;  2RGV A;  5JVD F;  2R86 A;  3GTM A;  1B04 A;  2KSW A;  3JZI A;  4LFB H;  3KMU B;  1HNW H;  5A37 A;  1RYS A;  3GTP A;  1JIH A;  4PWQ A;  1MZB A;  5IP9 G;  4J9M A;  5KG3 A;  3OSP A;  5KFY A;  4JI7 H;  1W93 A;  3ETJ A;  5L1K A;  3ORR A;  3GTO A;  2BQR A;  1DIK A;  4O4L F;  3OUZ A;  4LF4 H;  2VOB A;  3LP8 A;  2VA2 A;  5IWA H;  1EUC B;  4TXK A;  5KT6 A;  2E5L H;  4JV0 A;  4K0K H;  2ALZ A;  5KKN B;  2R87 A;  2RDI A;  2R7L A;  1TWF A;  2IGP A;  4BY7 G;  4RUA A;  1N32 H;  4QJF A;  4DR4 H;  3JAL M;  1GSH A;  3RF2 A;  5L9X A;  3GTJ A;  5JH7 F;  1E4E A;  2RDJ A;  4GC7 A;  3RAX A;  2W6O A;  2O03 A;  3QZ7 A;  3HBL A;  2AU0 A;  1VKZ A;  2V58 A;  5FPR A;  3RIZ A;  4O3S A;  3KTM A;  2FK3 A;  4M7E A;  4HNU A;  4F4W A;  4DV7 H;  1WH2 A;  4GC6 A;  2AGP A;  3L2P A;  2W71 A;  1O75 A;  2YRW A;  3GIL A;  1BXR A;  1AA2 A;  4B7L A;  3V6H A;  4QWB A;  4JV5 H;  2D89 A;  2ASD A;  2YZN A;  5C1O A;  2BR0 A;  1T3N A;  5DG7 A;  1KC7 A;  2XCA A;  4QWA A;  3R23 A;  2WDT A;  5HV6 A;  5DG9 A;  1XNQ H;  1TAE A;  4RNN A;  4JYA H;  3VMM A;  5KFW A;  3OSN A;  1J5E H;  4A3L G;  1JLL B;  3GV7 B;  2R93 A;  5CA1 F;  5IYC G;  3PW4 A;  1KBL A;  5C4X G;  3HOP A;  2X0S A;  4B3M H;  3R5H A;  4IZO A;  4YP3 A;  2UXC H;  4EDM A;  1JDB B;  4C5A A;  5KFH A;  1RJP A;  4DV4 H;  1SH6 A;  2D85 A;  2HKP A;  1Y1V G;  1RJQ A;  4YB8 B;  4DUZ H;  2JEG A;  1WIX A;  5EOY A;  1XDN A;  3TIG A;  3CVZ A; 
#chains in the Genus database with same CATH homology
 4LF7 H;  1SYX B;  4RZQ A;  1P8L A;  1GYF A;  1BGW A;  3N6X A;  4UCO A;  4JI2 H;  5BR8 H;  2ZM6 H;  4DR2 H;  4B3T H;  1DGS A;  1FJG H;  3T1H H;  2Q2U A;  4LF5 H;  2HVQ A;  4DV5 H;  3KAJ A;  3VP7 A;  1AN7 A;  4JI1 H;  3N41 B;  4X62 H;  2EQO A;  4R7R A;  4JI4 H;  4EFE A;  3K3V A;  3JAM W;  1A0I A;  3FMA A;  4I7H A;  1N36 H;  4RB0 A;  2HVS A;  1L2Z A;  4LF8 H;  2VE7 A;  4LMY A;  4UFZ A;  1ZHS A;  4FM9 A;  2UU9 H;  3HXL A;  3JSL A;  5A2Q W;  5LL6 b;  4DR1 H;  4MV7 A;  2VUG A;  4UCV A;  3L4K A;  4JI0 H;  4PDB A;  4ETS A;  2VQF H;  3EYY A;  4RB3 C;  1EUV A;  4DR6 H;  4DV3 H;  3MWM A;  4LH6 A;  3RTX A;  4BWS C;  3IG0 A;  3N43 B;  4DR5 H;  4DR3 H;  4LF9 H;  4X64 H;  5FMT A;  2WYO A;  1V9P A;  4A2A A;  5FLX W;  1I6U A;  1FVI A;  3LML A;  3J80 W;  5LMN H;  4APM A;  3T1Y H;  1I94 H;  1SEI A;  3F8N A;  1S68 A;  4A2B A;  2UUC H;  3KAK A;  3N42 B;  4MTD A;  4LF6 H;  1Z2O X;  4X65 H;  4B3R H;  3N44 B;  4JI8 H;  2UXB H;  3KXY T;  4Q0Y A;  3EAY A;  4DUY H;  1X9N A;  1M0W A;  4MV9 A;  3RGX A;  4DV6 H;  4OX9 H;  2WE6 A;  5FD5 A;  3J7A K;  4UCS A;  2VPS A;  2RGV A;  3L4J A;  4LSX A;  2VQE H;  2F4V H;  1B04 A;  2CW8 A;  4J0M A;  3BA9 A;  2KSW A;  3RGZ A;  4LFB H;  1HNW H;  1XNR H;  1MZB A;  4JI7 H;  4NXN H;  4LVR A;  4LF4 H;  2HL9 A;  4DR7 H;  2VOB A;  5IWA H;  1FKA H;  3N40 P;  3PN1 A;  4B3S H;  2E5L H;  3J81 W;  4KHP H;  4K0K H;  5D1O A;  4CC5 A;  1E4F T;  2IGP A;  4JI5 H;  1N32 H;  4DR4 H;  3RF2 A;  3H20 A;  1XMO H;  2OWO A;  1E4G T;  3C0F B;  1Z2N X;  2O03 A;  1TA8 A;  4GKK H;  4YHH H;  4GLX A;  4LFA H;  1VS0 A;  1ZHQ A;  5FPR A;  1BJT A;  4MTE A;  4CC6 A;  4M7E A;  4LH7 A;  3RIZ A;  4DV7 H;  1WH2 A;  5FD6 A;  1XMQ H;  2HGS A;  3L2P A;  1N34 H;  2HHH H;  1O75 A;  3JSN A;  3M4I A;  1HNX H;  4UCU A;  4IAJ A;  4NXM H;  1N33 H;  4JI3 H;  1IBL H;  4RB1 A;  4RB2 C;  4JV5 H;  2UXD H;  4YY3 H;  4EEQ A;  4EFB A;  4X66 H;  4LFC H;  4DV2 H;  3RJ0 A;  4DDP A;  1IBM H;  4LSA A;  2WDT A;  2HVR A;  3KAL A;  1HR0 H;  3DF7 A;  2UUA H;  2RGR A;  2XIG A;  4AQY H;  2Q2T A;  1TAE A;  4JI6 H;  5FPO A;  2HL8 A;  5FMU A;  1J5E H;  1XNQ H;  3OTO H;  4JYA H;  3BAB A;  3BAA A;  5IT9 W;  1HNZ H;  1Z2P X;  2VE7 C;  2UUB H;  2YCH A;  4RAZ A;  4DV0 H;  4B3M H;  4UCR A;  5D1O B;  2ZJT A;  5D1P A;  3UQ8 A;  4UCT A;  4DV4 H;  1IBK H;  1S03 G;  2UXC H;  2HKP A;  2FE3 A;  2W57 A;  4DV1 H;  4GKJ H;  4DUZ H;  2CW7 A;  5LMU H;  5EOY A;  1XDN A;  3CVZ A;  4RAY A;  3BA8 A;  4LVP A;  1M0T A;  2MCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...