2WDVB

E. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Structure of Escherichia Coli Succinate:Quinone Oxidoreductase with an Occupied and Empty Quinone- Binding Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdvB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdvB01
1V97A 1QOFA 3NVWA 2PVGC 1J7BA 3SFEB 1J7CA 4ZHPA 3EUB2 3AE8B 2WS3B 3AE9B 1FXAA 2FBWB 5H92C 3PO0A 2WP9B 1JWAD 1OQRA 3LB8C 2PIAA 1WYGA 1QLBB 2KAJA 3P4RB 2QIEB 5EE0A 5GXGB 3P4SB 1XLQA 1TKYA 1IUEA 1GAQB 2AX5A 1FIQA 1YQ4B 3HVZA 3AEEB 3LXFA 2W55A 2Y5CA 3NVVA 1JROA 1L6UA 3RPFC 3AB5A 1ZOYB 4WQMA 2WU5B 1GTHA 1XLNA 3P4PB 4US9A 1PDXA 1L6VA 4FXCA 1N5XA 5AUKA 5C2TB 5EE1A 2H89B 1JW9D 1RFKA 3SR6A 4C7YA 1A70A 2H88B 1CZPA 1ROEA 1WGKA 2MJ3A 3AM9A 1JRPA 3SFDB 4YTMB 2JX5A 4HRSA 2WDQB 4C7ZA 1AWDA 1L0VB 1YJJA 1E0ZA 1KF6B 1ZXIA 2CU3A 4USAA 1FFUA 4KX6B 2WDVB 1DOYA 2K22A 1E6EB 2L83A 1SIJA 2K5PA 2M19A 1TKEA 4JX1C 4A9AA 3B9JA 3AMZA 1FMAD 2BS3B 1F0ZA 1FFVA 1YJIA 3AECB 2PVOD 2WLBA 3HRDD 5H8YE 1V8CA 4ITKA 3AE5B 1E9MA 1WXQA 2M56B 1E7PB 2BS4B 3AE1B 1DOIA 2PKOA 2W54A 3W5UB 2MH7A 3HUIA 3CF4A 1N61A 2JQRB 1VDVA 1XO3A 4YSZB 1KFYB 3CIRB 1H7XA 1N5WA 1RWSA 1UWMA 5G5GA 1ZP0B 1JQ4A 3CWIA 1H7WA 1NYQA 4N58A 2WDRB 1NVID 3DWMA 3DWGC 3VR9B 1RM6C 5MPOA 3W9CB 3ZYYX 1L5PA 1J7AA 1EWYC 5EE9A 2CJOA 2LEKA 4JWSC 2QJLA 1PFDA 3FC4A 5AUIA 1N63A 3FAHA 4YSYB 1N60A 3AEFB 4N59A 3AV8A 3AE6B 1QOAA 1QT9A 1WRIA 2E3TA 3P1MA 3AE3B 1FRRA 1OQQA 3AEDB 2OHFA 1FO4A 5C3JB 1OFFA 2MJEA 2WQYB 3NVZA 4P6VF 1I7HA 1B9RA 1FRDA 3NS1A 1GPXA 4YTNB 2DWQA 2W3SA 2WU2B 1NI3A 3VRBB 1SB3C 3KWLA 1VLBA 1DOXA 2BT6A 2N0SB 3B2FA 1PUTA 3W5VB 1CJEA 1XLOA 1GTEA 5G5HA 1QOBA 2B76B 4ZHOA 1GT8A 1ZUD2 4YT0B 3AE2B 3NVYA 1YQ3B 2K9XA 4WWMA 2BS2B 1DGJA 3BIID 3AE4B 3L4PA 4JWUC 3B2GA 2G1EA 1QOGA 4US8A 5EE3A 1E10A 1AYFA 2DBYA 1SF0A 1XLPA 1R7SA 2L52A 3AH7A 3VRAB 1KRHA 3P4QB 4YTPB 1VJKA 1TKGA 4N6EB 4ZOHC 3ABVB 2EKIA 3P63A 1WWTA 3AE7B 1JWBD 1RYJA 2Q5WD 1TJEA 3AEBB 2KMMA 1FM0D 1JALA 3AEAB 4HROA 3AEGB 1T3QA 2MJDA 1QF6A 4LTUA 3VR8B 1NENB 1NEKB 1NYRA 2W3RA 3AN1A 2ACZB 4IDIA 2CJNA 1TYGB 3WCQA 4YXDB 1N62A 3NRZA 4YSXB 1FXIA 2HTME 4C80A 3ETRA
chains in the Genus database with same CATH superfamily
3TBLD 5IP4D 5IN7A 3QX1A 3NG0A 1TY0A 1OQRA 2Z8LA 2ZPNA 2FUG1 3GZNB 2GMIC 2VH2A 1R4MI 4LDTD 3BZDB 2Y5CA 3RPFC 3J9CA 4X57B 4WQMA 2VZKB 2FE8A 2INCC 3ZDMC 3UGBB 2HD5B 3SFDB 1P7EA 4AQ7A 3IVFA 3BVMA 2M0AA 4N9F4 4RM8A 2MW5A 4GDLA 4JGHB 3A9JB 1FFVA 4FLHA 3ZJTA 2WXRA 3QARA 1SGHA 2NBWB 1GC6A 1UH6A 3H1UA 3CIRB 2PTLA 2K1FA 4G50A 2J7QB 3IAM1 2N7JA 3DHGC 4EUTA 4NQKE 1V80A 2ONQA 4IUMB 4AP4C 4RF1A 2FAZA 2KN4A 2Y5PA 3MP9A 1ZUD2 2LZ6A 2MRPA 4JLCA 4MGKE 4WWPA 2NCNA 2MBEA 5LLIA 5KHOA 4YTPB 3BYTB 2K25A 3AE7B 2Q5WD 2KMMA 1QF6A 2HJ1A 1BT0A 1NYRA 3QA8A 1WX7A 2CJNA 3ZJUA 3MFGA 1N62A 3GZNI 5BYSA 3AU5A 1TS4A 3SFEB 1YX5B 2I1KA 4L23A 1GB4A 2MQJA 4W9JA 4LCDE 4QAYA 2RDHA 2BYVE 3BWUD 4RGNA 2KX0A 3EA6A 1GTHA 4US9A 1GG3A 3R2IA 4DQOC 2QSDA 2PW9A 3PSEB 3P2BA 3W1SA 4I6PA 2BF8B 1WR1A 1P98A 2LWPA 1AWDA 1WGGA 1E0ZA 2HE7A 3ECIA 4GIVA 2M19A 1E8ZA 3V60A 2WLBA 2JYEA 1UD7A 2M56B 1WXQA 4W9LA 4DDID 2MH7A 3DBLB 1XO3A 4EEWA 2IY1B 2OEDA 2M4NA 1SE2A 4A55A 1WF9A 4S17A 3FC4A 4FHKA 1I42A 1EU4A 2LVOA 1WJ6A 2KMCA 4FJVB 3NVZA 1PGAA 1C4AA 3LDZE 3M95A 1SB3C 3QK0A 1IPGA 1C77A 5LNK1 4JIOU 2KFKB 5IAAC 3WAOA 3BYYB 4KGTA 2G9HD 4GDKB 4II2B 3Q8AA 3BVZA 4FULA 2JWZA 2YVCA 3Q14C 1T3QA 1WH3A 4DDGD 3NRZA 4W9GA 3TEXA 2BQQA 4RF0A 3Q3OC 3PO0A 2GBKA 4GB9A 2KQ7A 2RPVA 3WIMA 4PS3A 1GAQB 3I63C 1WMHB 2WXOA 4KDIC 3U30A 2KKCA 2QEJC 2MCNB 1IBXA 1V81A 4M00A 2KJHB 4EZKA 1BUIC 4KIKA 4C7YA 5C23A 2H88B 1WXSA 1JRPA 4K7WA 4IOIE 3BK1A 2KJ6A 1E90A 3W2DA 4KGRA 3DBLI 3IT6B 1EF5A 4PT5A 1WGDA 3JVZX 3P42A 3U4EG 1SJED 1TZOA 1L2NA 4M02A 1EO6A 4HPPA 1JMLA 4YSZB 1K50A 2KWDA 1UWMA 2BB5A 3APFA 1NYQA 3ZNZB 2K8BA 4EFOA 2KD0A 3SDLC 5FKAC 2HJ8A 2PEAA 2NS5A 2UYZB 1B1ZA 2O2VA 4A20A 5AUIA 3FAHA 4YSYB 1N60A 4MJSA 2JZZA 2IGDA 3P1MA 1Z5SB 2OHFA 2MA9B 3MHSD 4P6VF 1L0YB 1WYWB 3APDA 2GBRA 2N0SB 1RLFA 1PUTA 1CJEA 5G5HA 2IZVB 3BY4B 2AQ3B 1UUPA 3BIID 3V6CB 3KWVA 2YLMA 4ANXA 4K81A 5FR3A 1T0QC 1LFDA 3X23A 4OVZA 1JRUA 4MH8A 2KTRA 1MG8A 3AEBB 1V1PB 1GOZA 2ZW1A 1V1OA 3H7SA 3V3XA 4EZJA 3NZ3A 2C7MB 4XGAB 1UBQA 4WJNA 3RD2A 1J7BA 1TTNA 4C00A 2JXXA 2WS3B 3BVGA 3ZLZA 1I4PA 2KNBA 4DWFA 1MG4A 3KQ4A 3ML9A 4M0WA 3P4PB 5HKHA 4W9CA 2KOXA 4E74A 4MH0E 4AWJA 2NBUA 5DPRA 4ZRPA 3IAS1 1SEBD 4RMAA 1V5TA 1Q1OA 4HCPB 4YL8A 2KDEB 4S0RA 3UQBA 1WE6A 1YJIA 1V8CA 2ZVNA 4ITKA 1ZE3D 1DOIA 4RGOS 4WWNA 1GJZA 2LASA 1WGHA 1K51A 1ZXHA 1OTRB 3JSVA 2LD9A 1RM6C 5MPOA 2TSSA 3SD5A 1EWYC 2SAKA 4P1CC 4NJ7A 5D2MB 2PE6B 2CJOA 2IJ0A 1TY2A 3FILA 3ZNGC 2GLSA 3PT2B 1IYFA 1OQQA 4OZAA 3BINA 1VCBA 4OVUA 2KDFB 1DOXA 2ZCCA 2KK8A 3R7RA 3E56A 5CHFA 4KSKC 3Q8BA 4WURA 1C3TA 1AYFA 1WE7A 3Q3FA 3A1QB 2RSUA 4REZA 1F9JA 4AJYB 2HTME 3RNAC 1KH0A 4FBJB 4ZHPA 1C76A 4PYUA 3HK0A 1D5MC 1JWAD 2PIAA 1WYGA 1BMLC 2B3AA 5BO4B 1WM2A 2PJHA 1UNSA 3VXWA 3NVVA 2M0XA 1SJHD 3UIOB 2WU5B 2IO0B 3IT4B 1SIFA 4H2AA 4KDLB 4DHZE 1RFKA 2BBCA 1YMHE 2JT4B 1VRAB 1CZPA 3PRZA 2MJ3A 3Q69A 3E9SA 3LYYA 1RRBA 3TEWA 1TS3A 4GMVA 3ZDTA 1FFUA 2K22A 3TEYA 2K8CA 3CF6E 4Q2JA 3D32A 2IDYA 2WXMA 1FMAD 2PVOD 3DBSA 3ZIMA 3PPAA 5FR6A 3JYUA 1AW7A 2I1JA 2RPQA 4N58A 3DWGC 2NMQA 4B6WA 1XF5L 2G3QB 5GMVA 1OGWA 5DCNA 5AZGA 3AXCA 3N9YC 4EZLA 3AEFB 2FCNA 4N59A 4FA6A 1UWXA 1FRDA 2J0MA 4NQLB 4HXDA 3B2FA 4XWWA 1SXTA 1K52A 4JWUC 2REXA 2L52A 3NZSA 4KKJA 3P63A 2VRRB 4RH6A 3X0WA 1YD8U 2L7RA 2JRHA 2ACZB 4IDIA 4R3DA 3H7PA 4YSXB 3ZUNA 2AQ2B 5D94A 2LHDA 1HE8A 4NJCA 3VUWA 1UF0A 2M8SA 2FIDA 2KAJA 2CHWA 3PLVA 3UQAA 2AEHA 2AX5A 4C4VA 2K0PA 3NZUA 1JROA 2K6DB 3R66C 3M3JA 5EE1A 2WXIA 3SR6A 1HEZE 2JX5A 2KJRA 1VR9A 1WXVA 1SE4A 2LRWA 4USAA 3WANA 2V0GA 1VZ8A 2PMVA 3ZNHB 3L17A 4TMAB 1WI0A 1HA5A 1TKEA 4TV3A 5JZEB 5TSSA 1I4HA 1SSNA 3SU8X 1E7PB 1ZW7A 3MJWA 3TMPB 2KDBA 4DXFA 1N6ZA 3GE8C 3CF4A 3UIPB 1N5WA 3NY5A 5G5GA 3I9V1 2LJIA 2IO2B 4BBNF 3UI3A 4B9KA 1L5PA 4WJOA 2QC8A 5JH5C 1QQRA 1WZ0A 2QJLA 4KSLC 4KGSA 4ZRIA 4YTNB 1UELA 3ZNID 2WU2B 4LNFA 3VRBB 3VAWA 4C56C 4KZ0A 5HFYA 4GN1A 4L1BA 4WWMA 5E6OA 3TL5A 2BWES 3Q3NC 2G1EA 1CK1A 4NPNA 2D3GA 2DX5B 3BK2A 3ABVB 3U7ZA 1WJUA 2NTSA 1KM7A 3ZTDA 3QC8B 4ANVA 3EHVA 2KMAA 1WZ3A 1FNWA 2OJRA 3EGRA 3DVNV 3RZWC 2LGSA 1QOFA 2J53A 1KLUD 3JW0X 1LXDA 3RULA 1ET9A 3RNCC 3A33B 1XXGA 3P4RB 3EECA 3L16A 1XLQA 1I4XA 1TKYA 3DBRB 4URKA 1YQ4B 3A9KA 1XLNA 2BGFA 2CU1A 4FXCA 1N5XA 5IKCM 2WXPA 3PGEA 1SE9A 1L7YA 2IO1B 4K3BA 1WJ4A 1E7VA 4C7ZA 1JWMD 5BYQA 2J42A 1HZ6A 4A3PA 2BKRB 3VFKA 4NJ6A 2NPTB 2BS3B 4K1RB 1WFYA 2BWFA 4HEA1 3OWEB 3WAPA 1VDVA 2JZ3B 2XK5A 4RGMA 3ZRFA 3DWMA 2G4SA 1NDDA 4HJKA 1ZPSA 2KVZA 5FK9C 4K7SA 2LEKA 4TSSA 1QT9A 1GB1A 3AE3B 2LVPA 4RFBA 1ESFA 3T3OA 1OEYA 3L13A 3IFWB 3ZVVA 1FNUA 3N3KB 3URYA 4MT5A 3AULA 2KWCA 2LRUA 1P7FA 4DHJD 1EF1A 4US8A 2GBJA 2DBYA 3PRMB 1VJKA 1KOTA 4NNJB 1V49A 3KVFB 2GI9A 4PYZA 1XCTL 3AEAB 4F8CB 2MJDA 5T8IA 3AN1A 4L2YA 5JHBA 3RZFA 4XDCA 3WCQA 2JF5A 4IWPA 1WX9A 1SBBB 3TIXA 3DBRI 2W9NA 2ZW0A 2WXKA 4HLEA 5EE0A 5E6PA 3N20C 2JVCA 3HVZA 4O1NA 4JL9A 4UDUC 3T8MA 2FNJB 5AEKB 2JSVX 4BKGA 3L08A 4ANWA 2XBBC 1A70A 3QJZA 3IHPC 1LGRA 4XYCA 2ZNVB 3C8YA 1F2RI 4IG7B 4KX6B 1DOYA 3V62A 2DZIA 2R2QA 4JX1C 4TUUA 4EKUA 2WGSA 3GB1A 3AECB 1WR6E 1F77A 3R8BA 4GDLB 2QDFA 5DPSA 4LNOA 4XX5A 3QQ8B 1RWSA 3R2TA 4P16A 1JQ4A 1A5RA 4PK1A 3KUDB 1NVID 1WY8A 2X38A 3WALA 1HTOA 3LJ3A 4MM3A 4B95A 1YOVB 2V3SA 1UBIA 3AV8A 1Q10A 4BZAA 3CMMB 2FCQA 1WIAA 3HIZA 2NVUI 1NI3A 4LJOB 2O6VD 4WJQA 3Q3JA 4YT0B 3AE2B 3ZRCA 1YQ3B 1VZ6A 3VTVA 1XLPA 3L0WB 3P4QB 2MP2A 4A90A 3GOEA 3RUIB 2DHZA 2MSED 2DLBA 4TQ0A 2RMMA 4HDOA 1LM8B 3AEGB 4HROA 1C9FA 4MELA 4I6LB 2DYMA 3V6EB 2PVGC 3EFUA 5IO9A 1DYQA 2KWVB 4W9KA 2YEPF 1XCQL 3RNGC 5L95C 5GXGB 3MC9A 3KLSX 2WXHA 4F1SA 5D7GA 4OZBA 3PV1A 3AB5A 4ARIA 2GBMA 2BYTA 4CYEA 4W9DA 2LHEA 2KLGA 1IP9A 2QILA 3B1LX 2LXAA 2JZPA 1ROEA 2BVCA 5C1ZA 1MHHE 4FHJA 1KLGD 1P9DU 2AL6A 2WX0A 2INPE 4FADA 5BMHA 2IBIB 1TBEA 3PZ8A 2L05A 4TKNA 4IC7B 1ZKHA 4WIPA 1LQBA 2PKOA 4DHJB 4GLSC 2KQ4X 1F52A 4KVGB 1J8CA 2IYDB 2LUEA 2XN9C 2CS4A 2D2QA 1YN3A 2J0JA 1C79A 4GXBA 2JPHA 1GC7A 4OVVA 3QAQA 2HDEA 4MGIE 2BKFA 2ZEQA 3PVLA 4G3XB 5D3IB 3NS8A 4W9EA 4W9IA 2QCZA 5C3JB 1B9RA 2CHZA 1GPXA 2DWQA 1TIFA 2C7NB 4ANUA 3PZDA 5JHAA 3DOWA 3U7DA 1QOBA 3L54A 3VUYA 4ZHOA 1DGJA 1Q5WB 2GRIA 2N4FA 3HM3A 3L4PA 1QOGA 2D3CA 2LGIA 2A4ZA 2D5GA 3AH7A 2C60A 4LK0M 4N6EB 3PHWB 3KUZA 4FN2A 3PLUA 4WAAA 2BYEA 4NAWA 2DYOA 4PS7A 2MBHA 2D07B 1PGBA 3RI7C 4BKSA 2LGDA 4YXDB 2C9WB 2R61A 4DBGA 2KXJA 4AS1A 3QWZB 4XE0A 3VVWB 2ZVOA 1P0RA 3ZQ4A 2ZNVC 4NAMA 3IG3A 5G2NA 1D5XC 1PDXA 1ZDXA 5AUKA 1V9JA 5C2TB 2A5UA 2WHIA 2KDMA 1IBXB 3RN9C 1YQBA 3N1ZC 1IGCA 5AZHA 4KIKB 1L0VB 2ZZPB 3A9JA 1K53A 4K7UA 2L83A 2O6VB 1FD6A 3TSSA 1FPYA 3DDCB 3AE1B 3KW5B 4MGYE 3APCA 1E8YA 1H7WA 1V6EA 2WXJA 2KFJA 1EM7A 2KX3A 3DQVA 2DZJA 5E6NA 2KACA 1QOAA 1FRRA 2O2VB 4CQNA 2INNE 2MWSB 4MJSB 2NTTA 2W3SA 3NJTA 1Y56A 1EU3A 3CSFA 4MDKE 3B2GA 4DXAB 1E10A 1ISNA 3TCAA 2N7DA 1MHXA 3ZO5B 1F1HA 3Q6BA 1I4GA 2V3NA 3QCAA 4AOFA 1Q0WB 4OHJA 2KTRB 4FJZA 1NEKB 2QMTA 4BKTA 4ICUA 4IWOA 3U8ZA 1PQSA 4C80A 3ETRA 1V97A 4EOYA 2KHWB 1J7CA 2FCMA 3AE8B 4G11A 5H92C 2EMSA 2WP9B 1WJNA 2NPTA 3LB8C 2PPHA 2LI5A 2ZJDA 1LO5D 3W1SC 1VD2A 1FIQA 3M62B 4HCNB 3RCZA 2HTHA 3HHMA 4HJGE 4GSWA 3N30A 3ZTCA 1YX6B 1JW9D 3QIJA 1HZ5A 3ZGZA 4M0WB 1S1QB 1V5OA 4MSQB 5IA7A 3UINB 1WGKA 2ASQA 2K39A 5D6JB 3WAMA 4W9FA 1ZXIA 2Y3AA 3MC0B 2WDVB 1E6EB 2N9KA 2AL3A 3Q3MC 4XZ4A 3OAWA 2LMCA 1MVKA 2IPKD 3ALBA 4FJYA 1RFAA 2FUHB 4B0MA 2MX2A 1H7XA 3VTUA 3KH0A 2D10A 2J52A 4DXGA 2KWUB 2LFIA 3O65B 3H9DA 1OEYJ 1J7AA 2QHOA 1P3QU 3JSVB 5KHQA 4PS8A 1CQVA 2WXLA 3AE6B 2E3TA 3DBHI 2IGHA 1FO4A 1OFFA 4AUQC 4M01A 3FILB 4M8NA 1I7HA 4WWOA 1MJDA 1YNTE 1JCKB 2BT6A 2KFKA 3RYTA 1H8CA 3W5VB 3H6NA 2B76B 1WM3A 5CTRC 4GDKA 1C4PA 3DCGA 1J19A 1SF0A 1MPEA 3OJ3A 1STEA 1U4AA 1XQQA 3KYCD 2XNAC 1FM0D 5E6JA 4OZCA 2MBQA 1TS2A 2Z0EB 1L4ZB 3N1YC 1FXIA 4W9HA 2Z0DB 4A8XC 3N1XC 3ZW3A 2I2YA 1FCCC 1C1YB 2Y5BB 4LLGM 1RAXA 2WXFA 1WMHA 5CHWA 1AARA 2JYTA 3IXSA 3S2AA 3DVNU 2H89B 5CHVC 2SEBD 3MJ5A 2GOWA 2KDIA 2BW2A 1V2YA 2CU3A 4P7IA 5I4DA 2CHXA 1SIJA 2LGYA 2LXCA 1D3ZA 3PHXB 4LNKA 5J18A 4XWTA 5IOIA 1F0ZA 3AMZA 3FKYA 2MEKA 5D3DA 2N7EA 3PRPB 3AE5B 4ICVA 4HKZE 2LJ5A 3VDZA 4BOSC 3MHZA 2I38A 3UF8A 3R7QA 2RD0A 3Q8CA 1BXTA 4IKGA 2J4XA 1WXAA 2N1VA 3C0RB 5AZFA 2N9EB 4GGQA 1WRIA 4KKIA 5BMIA 2L0FA 2WQYB 1E8WA 3CSTA 4RCOA 3N32A 2DZMA 1GTEA 2RDBC 3I3TB 2WXGA 3NVYA 4CHKA 4DHZB 3AE4B 4CO7A 1YJ1A 4KV2A 1V1PA 1KRHA 2N1WA 3T9LA 4ZRKA 2KVRA 1RYJA 1TJEA 4JPSA 2UWQA 2LUMA 4ZYSA 3OJ4B 2W3RA 2OOBB 1YIWA 2G4DB 4BOZB 1J0GA 3EUB2 3H7PB 5BMGA 2L32A 4F7ZA 4E3CA 1L4DB 3RNBC 3SEBA 3KYDD 3ONSA 1FEHA 2W55A 1ZOYB 1TZ1A 4HWIB 4OW0A 4C4VB 1UGJA 3A4SC 5HI1A 3OG5A 2KC2A 2JWUA 2JUOA 3DHHC 2FIFA 1TGZB 2BYFA 3RNEC 1UZXB 3Q8EA 4A9AA 1MI0A 3HRDD 3V05A 3W5UB 2BS4B 4TQ1A 1YN5A 1XEEA 4HVBA 4ZRQA 4NZLB 4ZRJA 1K8RB 4LDTB 5LXIB 3GE3C 2JY6A 3C19A 2D11A 1WX8A 3ZYYX 3PZ7A 3L10B 4IWQA 3AU4A 2CKHB 2L0TA 2KN5A 2V1YA 5J17A 4K3CA 2MJEA 3NUHB 5BYRA 2DENB 4G0NB 2L76A 1UGMA 3H8HA 1GT8A 2IO3B 2IGGA 3A1QA 4HK2A 4ZOHC 3RNFC 3A4RA 1WXMA 1JWBD 3QHTA 2G45B 3OLMD 4E71A 2DNFA 3DPDA 3B08A 4DK5A 3PTFC 1T5XD 4HPMB 1EWCA 4HPLB 1FNVA 2CR5A 2PLPA 2D3BA 2O6VA 2RGFA 2X8XX 4JE3B 3NOBA 2VH1A 1IUEA 2KLCA 3AEEB 3LXFA 1L6UA 1ENFA 3T3NA 1WGYA 4RM9A 3U52E 2DAFA 4J6IA 2N9PC 3A9KB 4LJPB 2JRIB 2W82A 2L1AA 3ML8A 3TUOA 1T0RC 2KQSA 3DVGX 2GB1A 2JU6X 1T0SC 4YTMB 4J3OD 1YJJA 1ZGUB 5HHDG 1E7UA 4ACFA 1T6BX 3SHQA 3K9OB 3I57A 4IW0A 4II3B 2W54A 1AN8A 2KANA 1I4RA 2IY0B 2PE9A 3HUIA 1N61A 2JQRB 1F2RC 1KFYB 1C4CA 2MLBA 2RR9A 1ZP0B 3CWIA 4IM2A 4MSMB 3GS2A 5TR5A 2WDRB 3VHTC 4MACA 3MC8A 2INDC 2XK5B 1QILA 2WXQA 1N63A 2EKEC 1I4QA 1M4VA 5G55A 1T0YA 4EE2A 5JXVA 4IM0A 5EDSA 2V3PA 4LNNA 4RNAA 2K3UA 2V4IB 2LVQA 3O13A 2XEWA 1FCLA 2ICIA 3KUCB 3Q8FA 2WYQA 1X1MA 1Y8RC 2MHJA 2WX1A 4XDDA 2BB6A 2L3ZA 2D3AA 1JWSD 3NHEB 4XC2A 3VR8B 2N9LA 2R2OA 1S3SG 3ZXVA 3NVWA 4IM3A 2GBNA 2K6QA 4BAXA 1R4NB 3HVDA 3RMKC 4I6NB 3ENEA 2QIEB 4BBNC 3IBEA 1EUVB 2AYOB 2K8HA 2J0KA 1TS5A 4KZCA 2LGXA 2N9XA 1L6VA 3R3MA 1C78A 1JWUD 3VH3B 3B0AA 2UU7A 3AM9A 2AQ1B 1KJTA 2L8JA 4HRSA 4WQOB 1KF6B 1V86A 4BKSD 1KTKA 1Z2MA 1E9MA 4HKQA 3ZXRA 3ZJVA 2MBBB 1XT9B 1NI2A 1PYWD 3V61A 3DVGY 3VR9B 2VZKD 1E5WA 3W9CB 1WRDB 4JWSC 1PFDA 3VTWA 3W1YA 4MM3B 3DHIC 2WWZA 2DYBA 4AJWA 3NS1A 3PS6A 3KWLA 4MGZE 1XLOA 3EFCA 1QKZA 4ZDVA 2K9XA 2BS2B 1D6EC 4A3OA 5LXHA 2M17A 1KLVA 1R7SA 2YEPB 3RFZB 1ACCA 2EELA 1TKGA 2NR2A 1WWTA 1D4BA 4ZYNA 1JALA 1HXYD 3WA0A 2EMTA 2ON8A 2MP2B 1IGDA 1R4NI 1NENB 2V4LA 3VUXA 2KYWA 2KC1A 4D2KA 2WDTB 1WSPA 2KT7A 3DBHB 4ARCA 3AE9B 1FXAA 2FBWB 3I5JC 5HG2A 4B0EA 2C5LC 1QLBB 1NBFC 3P4SB 1PGXA 2C7HA 3Q2AC 1YN4A 4GOCA 4JQWC 4BVUC 5DPWA 4YWGG 2E6XA 1VZ7A 3RT3B 4M8MA 2NBVB 3M63B 1ET6A 3AI5A 1R4MB 4P1BC 3MTNB 5L83A 1H4RA 1P1AA 4ASWC 4WAFA 5J2RA 2WDQB 1G6JA 2L00B 5CX3A 2KO3A 2K5PA 3B9JA 3PREA 2MBOA 5H8YE 1ZDVA 2BPSA 3K9PB 1CMXB 4MEMA 4BFRA 4LNIA 2ZPYA 3ZKJC 1L0XB 3VQIA 1WGRA 2WNMA 4HDQA 1M94A 2KTFA 3TEZA 2AWTA 5EE9A 2JXTA 2WXNA 2BTEA 1GNUA 4GU2A 2Z59B 2FCSA 1I35A 2V9HA 3AEDB 1HQRD 2RDGA 4NY0A 1VLBA 4A6QA 3GP7A 2KZRA 1XD3B 3TJPA 1MFWA 3U2SC 2OJWA 1QZEA 2DZKA 4WJPA 4RGTA 5EE3A 5DPTA 3VRAB 1D5ZC 2EKIA 2DAJA 1SE3A 1HTQA 2ZCBA 3EC8A 3HM6X 4LTUA 1E8XA 1FXTB 2M1MA 1GUAB 1TYGB 1TT5B 1OQYA 3VH4B 4WH4A 4NAWB
chains in the Genus database with same CATH topology
2PVGC 1KH0A 4ZHPA 1C76A 3EUB2 5BMGA 2L32A 1TY0A 1DYQA 1D5MC 1JWAD 1OQRA 2YEPF 2Z8LA 1L4DB 1XCQL 2PIAA 1WYGA 1BMLC 2FUG1 5GXGB 3SEBA 3KLSX 2WXHA 1UNSA 1FEHA 5D7GA 3BZDB 4OZBA 3NVVA 2W55A 2Y5CA 3RPFC 1SJHD 3J9CA 3AB5A 1ZOYB 4WQMA 2WU5B 3IT4B 4ARIA 4OW0A 2BYTA 1UGJA 2VZKB 4H2AA 2LHEA 2FE8A 1RFKA 2QILA 2BBCA 5HI1A 1YMHE 2JWUA 1VRAB 1CZPA 2JZPA 1ROEA 2MJ3A 3Q69A 1MHHE 3E9SA 3SFDB 1P7EA 3LYYA 4AQ7A 3BVMA 1KLGD 3TEWA 1TS3A 2INPE 2M0AA 5BMHA 1FFUA 3PZ8A 2K22A 3Q8EA 3TEYA 4Q2JA 2IDYA 2WXMA 4A9AA 1FMAD 1FFVA 1MI0A 2PVOD 4WIPA 3HRDD 3V05A 3ZJTA 3W5UB 2WXRA 2PKOA 2BS4B 4GLSC 2KQ4X 4TQ1A 1YN5A 1XEEA 1AW7A 2XN9C 4ZRQA 4NZLB 3CIRB 2PTLA 1YN3A 4N58A 3DWGC 2NMQA 1C79A 1XF5L 3ZYYX 3IAM1 2N7JA 3PZ7A 2HDEA 3N9YC 5D3IB 3AEFB 4N59A 2ONQA 5C3JB 2MJEA 4RF1A 1B9RA 1UWXA 1GPXA 3NUHB 1FRDA 2DWQA 2KN4A 5BYRA 3B2FA 4XWWA 1SXTA 2Y5PA 1QOBA 4ZHOA 3H8HA 1GT8A 1ZUD2 3MP9A 1DGJA 2GRIA 1K52A 2IGGA 3L4PA 4JWUC 1QOGA 2LGIA 2L52A 2D5GA 3AH7A 4LK0M 4N6EB 4YTPB 3BYTB 4ZOHC 4KKJA 3P63A 3AE7B 1JWBD 2Q5WD 4RH6A 2KMMA 1QF6A 2DYOA 1NYRA 1PGBA 1T5XD 4R3DA 2ACZB 4IDIA 2CJNA 3ZJUA 3MFGA 4YXDB 1EWCA 1N62A 4YSXB 2AQ2B 5BYSA 1FNVA 2PLPA 1TS4A 2LHDA 3SFEB 4NJCA 2R61A 4L23A 1GB4A 4AS1A 4JE3B 4XE0A 2KAJA 3ZQ4A 2RDHA 1IUEA 2AX5A 4NAMA 2K0PA 3AEEB 3BWUD 3LXFA 4RGNA 1JROA 1L6UA 3EA6A 1D5XC 1GTHA 1ENFA 4US9A 3T3NA 1PDXA 1ZDXA 3R2IA 3U52E 5AUKA 5C2TB 5EE1A 4DQOC 2QSDA 2PW9A 3W1SA 2WXIA 2KDMA 2L1AA 2W82A 3SR6A 1HEZE 3TUOA 1IBXB 2GB1A 2JU6X 4YTMB 1IGCA 2JX5A 1VR9A 1AWDA 1L0VB 1SE4A 1YJJA 4J3OD 1E0ZA 1K53A 4USAA 2V0GA 1VZ8A 5HHDG 2PMVA 4TMAB 2L83A 1HA5A 2M19A 1FD6A 1TKEA 3TSSA 1T6BX 2WLBA 2JYEA 3I57A 5TSSA 1I4HA 1SSNA 2M56B 1WXQA 1E7PB 3AE1B 4DXFA 2W54A 1AN8A 1I4RA 2MH7A 3HUIA 3CF4A 1N61A 2JQRB 1F2RC 1XO3A 1KFYB 1N5WA 1C4CA 5G5GA 1ZP0B 3CWIA 3I9V1 1H7WA 2LJIA 2WXJA 2OEDA 3GS2A 3UI3A 2WDRB 1EM7A 4MACA 1L5PA 1QILA 1SE2A 4A55A 1QQRA 2QJLA 2WXQA 3FC4A 1N63A 2KACA 1I4QA 1M4VA 1EU4A 4KGSA 1QOAA 4EE2A 5JXVA 1FRRA 2V3PA 4CQNA 2INNE 3NVZA 1PGAA 1C4AA 2NTTA 4YTNB 2W3SA 2WU2B 1SB3C 3VRBB 4RNAA 2K3UA 4C56C 2V4IB 3O13A 1Y56A 5HFYA 1EU3A 1FCLA 2ICIA 1C77A 4L1BA 4WWMA 5LNK1 3B2GA 2G1EA 1E10A 3BYYB 1CK1A 4KGTA 3Q8FA 2G9HD 3BK2A 1MHXA 4GDKB 3ABVB 1I4GA 3Q8AA 2V3NA 3BVZA 3U7ZA 2NTSA 4XDDA 2BB6A 4OHJA 1T3QA 1JWSD 3VR8B 2N9LA 1NEKB 2QMTA 1FNWA 3NRZA 3EGRA 4C80A 3ETRA 1V97A 1QOFA 3TEXA 2J53A 3NVWA 1J7CA 1KLUD 3AE8B 4RF0A 3HVDA 5H92C 3PO0A 1ET9A 2WP9B 3LB8C 1XXGA 1LO5D 3P4RB 2QIEB 1XLQA 1I4XA 1TKYA 2RPVA 1TS5A 1GAQB 1FIQA 1YQ4B 2WXOA 4HJGE 2QEJC 1XLNA 1IBXA 1L6VA 4FXCA 1N5XA 1C78A 1JWUD 1JW9D 1HZ5A 2WXPA 1BUIC 3ZGZA 4C7YA 1WGKA 2H88B 3AM9A 1JRPA 2AQ1B 4IOIE 3BK1A 4HRSA 4C7ZA 1JWMD 5BYQA 1KF6B 1ZXIA 2J42A 1HZ6A 2Y3AA 3MC0B 3W2DA 2WDVB 1E6EB 4KGRA 3IT6B 2N9KA 4PT5A 2BS3B 2LMCA 1KTKA 1MVKA 2IPKD 1E9MA 3P42A 3U4EG 1SJED 1TZOA 4HKQA 4HEA1 4B0MA 3OWEB 3ZJVA 1VDVA 1PYWD 1JMLA 4YSZB 1K50A 1H7XA 2KWDA 1UWMA 2BB5A 4RGMA 1NYQA 2J52A 4DXGA 3DWMA 3VR9B 2LFIA 1ZPSA 2VZKD 3W9CB 5FKAC 1J7AA 5FK9C 2LEKA 1B1ZA 4JWSC 1PFDA 5AUIA 3FAHA 4YSYB 4MM3B 1CQVA 1N60A 4TSSA 2WXLA 3AE6B 2IGDA 1QT9A 2E3TA 3P1MA 1GB1A 3AE3B 2OHFA 4RFBA 1ESFA 2IGHA 1FO4A 3T3OA 1OFFA 4P6VF 1L0YB 3FILB 1I7HA 3NS1A 1YNTE 1JCKB 3KWLA 2BT6A 2N0SB 1PUTA 3W5VB 1CJEA 1XLOA 5G5HA 1FNUA 2B76B 1QKZA 3URYA 4MT5A 2AQ3B 1UUPA 2K9XA 2BS2B 3BIID 1D6EC 3KWVA 1P7FA 4US8A 1C4PA 2DBYA 5FR3A 1SF0A 1MPEA 1R7SA 2YEPB 1VJKA 3RFZB 1ACCA 2EELA 1TKGA 4OVZA 1STEA 2GI9A 1WWTA 4MH8A 3AEBB 1V1PB 2XNAC 1GOZA 1D4BA 1FM0D 1JALA 3AEAB 1HXYD 1V1OA 1XCTL 2ON8A 2MJDA 2ZW1A 4OZCA 5E6JA 1IGDA 1NENB 5T8IA 3V3XA 3AN1A 1TS2A 3NZ3A 4L2YA 4D2KA 4XDCA 3WCQA 1L4ZB 1FXIA 1WSPA 1SBBB 4ARCA 1J7BA 4A8XC 2I2YA 1FCCC 2WS3B 2ZW0A 3AE9B 1FXAA 2FBWB 5HG2A 4LLGM 2WXKA 4B0EA 3BVGA 2WXFA 1QLBB 1I4PA 5EE0A 3P4SB 1PGXA 1YN4A 2JYTA 3IXSA 3KQ4A 3HVZA 4O1NA 4YWGG 4M0WA 2E6XA 3P4PB 4UDUC 1VZ7A 2H89B 1ET6A 2SEBD 2JSVX 3MJ5A 1A70A 4ZRPA 3IAS1 4WAFA 1SEBD 2WDQB 2BW2A 3C8YA 1F2RI 2CU3A 4KX6B 5I4DA 1DOYA 1SIJA 2K5PA 4XWTA 4JX1C 3B9JA 3AMZA 1F0ZA 1YJIA 3GB1A 3AECB 2MEKA 5H8YE 1F77A 1ZDVA 1V8CA 4ITKA 5D3DA 3AE5B 1ZE3D 4GDLB 4NAWB 3R8BA 1DOIA 4RGOS 4HKZE 1RWSA 3R2TA 4P16A 1JQ4A 3MHZA 1K51A 2I38A 1NVID 1ZXHA 2X38A 1L0XB 1RM6C 3VQIA 5MPOA 2WNMA 2TSSA 3Q8CA 1BXTA 1EWYC 2SAKA 4IKGA 3TEZA 5EE9A 2JXTA 2CJOA 2WXNA 2IJ0A 2J4XA 2BTEA 1TY2A 3FILA 3AV8A 1Q10A 1WRIA 4KKIA 1OQQA 3AEDB 1HQRD 2RDGA 4OZAA 5BMIA 2WQYB 1NI3A 1DOXA 1VLBA 4RCOA 4A6QA 3GP7A 1GTEA 4YT0B 3AE2B 3U2SC 2WXGA 1YQ3B 3NVYA 3E56A 3AE4B 3Q8BA 4WURA 4RGTA 1VZ6A 5EE3A 1AYFA 1XLPA 1V1PA 3VRAB 1KRHA 3P4QB 1D5ZC 2EKIA 4A90A 1RYJA 4TQ0A 1TJEA 2DLBA 1SE3A 2RMMA 4JPSA 4HROA 3AEGB 1C9FA 2LUMA 4ZYSA 4LTUA 4REZA 2W3RA 1TYGB 4WH4A 2DYMA 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  1QOF A;  3NVW A;  2PVG C;  1J7B A;  3SFE B;  1J7C A;  4ZHP A;  3EUB 2;  3AE8 B;  2WS3 B;  3AE9 B;  1FXA A;  2FBW B;  5H92 C;  3PO0 A;  2WP9 B;  1JWA D;  1OQR A;  3LB8 C;  2PIA A;  1WYG A;  1QLB B;  2KAJ A;  3P4R B;  2QIE B;  5EE0 A;  5GXG B;  3P4S B;  1XLQ A;  1TKY A;  1IUE A;  1GAQ B;  2AX5 A;  1FIQ A;  1YQ4 B;  3HVZ A;  3AEE B;  3LXF A;  2W55 A;  2Y5C A;  3NVV A;  1JRO A;  1L6U A;  3RPF C;  3AB5 A;  1ZOY B;  4WQM A;  2WU5 B;  1GTH A;  1XLN A;  3P4P B;  4US9 A;  1PDX A;  1L6V A;  4FXC A;  1N5X A;  5AUK A;  5C2T B;  5EE1 A;  2H89 B;  1JW9 D;  1RFK A;  3SR6 A;  4C7Y A;  1A70 A;  2H88 B;  1CZP A;  1ROE A;  1WGK A;  2MJ3 A;  3AM9 A;  1JRP A;  3SFD B;  4YTM B;  2JX5 A;  4HRS A;  2WDQ B;  4C7Z A;  1AWD A;  1L0V B;  1YJJ A;  1E0Z A;  1KF6 B;  1ZXI A;  2CU3 A;  4USA A;  1FFU A;  4KX6 B;  2WDV B;  1DOY A;  2K22 A;  1E6E B;  2L83 A;  1SIJ A;  2K5P A;  2M19 A;  1TKE A;  4JX1 C;  4A9A A;  3B9J A;  3AMZ A;  1FMA D;  2BS3 B;  1F0Z A;  1FFV A;  1YJI A;  3AEC B;  2PVO D;  2WLB A;  3HRD D;  5H8Y E;  1V8C A;  4ITK A;  3AE5 B;  1E9M A;  1WXQ A;  2M56 B;  1E7P B;  2BS4 B;  3AE1 B;  1DOI A;  2PKO A;  2W54 A;  3W5U B;  2MH7 A;  3HUI A;  3CF4 A;  1N61 A;  2JQR B;  1VDV A;  1XO3 A;  4YSZ B;  1KFY B;  3CIR B;  1H7X A;  1N5W A;  1RWS A;  1UWM A;  5G5G A;  1ZP0 B;  1JQ4 A;  3CWI A;  1H7W A;  1NYQ A;  4N58 A;  2WDR B;  1NVI D;  3DWM A;  3DWG C;  3VR9 B;  1RM6 C;  5MPO A;  3W9C B;  3ZYY X;  1L5P A;  1J7A A;  1EWY C;  5EE9 A;  2CJO A;  2LEK A;  4JWS C;  2QJL A;  1PFD A;  3FC4 A;  5AUI A;  1N63 A;  3FAH A;  4YSY B;  1N60 A;  3AEF B;  4N59 A;  3AV8 A;  3AE6 B;  1QOA A;  1QT9 A;  1WRI A;  2E3T A;  3P1M A;  3AE3 B;  1FRR A;  1OQQ A;  3AED B;  2OHF A;  1FO4 A;  5C3J B;  1OFF A;  2MJE A;  2WQY B;  3NVZ A;  4P6V F;  1I7H A;  1B9R A;  1FRD A;  3NS1 A;  1GPX A;  4YTN B;  2DWQ A;  2W3S A;  2WU2 B;  1NI3 A;  3VRB B;  1SB3 C;  3KWL A;  1VLB A;  1DOX A;  2BT6 A;  2N0S B;  3B2F A;  1PUT A;  3W5V B;  1CJE A;  1XLO A;  1GTE A;  5G5H A;  1QOB A;  2B76 B;  4ZHO A;  1GT8 A;  1ZUD 2;  4YT0 B;  3AE2 B;  3NVY A;  1YQ3 B;  2K9X A;  4WWM A;  2BS2 B;  1DGJ A;  3BII D;  3AE4 B;  3L4P A;  4JWU C;  3B2G A;  2G1E A;  1QOG A;  4US8 A;  5EE3 A;  1E10 A;  1AYF A;  2DBY A;  1SF0 A;  1XLP A;  1R7S A;  2L52 A;  3AH7 A;  3VRA B;  1KRH A;  3P4Q B;  4YTP B;  1VJK A;  1TKG A;  4N6E B;  4ZOH C;  3ABV B;  2EKI A;  3P63 A;  1WWT A;  3AE7 B;  1JWB D;  1RYJ A;  2Q5W D;  1TJE A;  3AEB B;  2KMM A;  1FM0 D;  1JAL A;  3AEA B;  4HRO A;  3AEG B;  1T3Q A;  2MJD A;  1QF6 A;  4LTU A;  3VR8 B;  1NEN B;  1NEK B;  1NYR A;  2W3R A;  3AN1 A;  2ACZ B;  4IDI A;  2CJN A;  1TYG B;  3WCQ A;  4YXD B;  1N62 A;  3NRZ A;  4YSX B;  1FXI A;  2HTM E;  4C80 A;  3ETR A; 
#chains in the Genus database with same CATH topology
 3TBL D;  5IP4 D;  5IN7 A;  3QX1 A;  3NG0 A;  1TY0 A;  1OQR A;  2Z8L A;  2ZPN A;  2FUG 1;  3GZN B;  2GMI C;  2VH2 A;  1R4M I;  4LDT D;  3BZD B;  2Y5C A;  3RPF C;  3J9C A;  4X57 B;  4WQM A;  2VZK B;  2FE8 A;  2INC C;  3ZDM C;  3UGB B;  2HD5 B;  3SFD B;  1P7E A;  4AQ7 A;  3IVF A;  3BVM A;  2M0A A;  4N9F 4;  4RM8 A;  2MW5 A;  4GDL A;  4JGH B;  3A9J B;  1FFV A;  4FLH A;  3ZJT A;  2WXR A;  3QAR A;  1SGH A;  2NBW B;  1GC6 A;  1UH6 A;  3H1U A;  3CIR B;  2PTL A;  2K1F A;  4G50 A;  2J7Q B;  3IAM 1;  2N7J A;  3DHG C;  4EUT A;  4NQK E;  1V80 A;  2ONQ A;  4IUM B;  4AP4 C;  4RF1 A;  2FAZ A;  2KN4 A;  2Y5P A;  3MP9 A;  1ZUD 2;  2LZ6 A;  2MRP A;  4JLC A;  4MGK E;  4WWP A;  2NCN A;  2MBE A;  5LLI A;  5KHO A;  4YTP B;  3BYT B;  2K25 A;  3AE7 B;  2Q5W D;  2KMM A;  1QF6 A;  2HJ1 A;  1BT0 A;  1NYR A;  3QA8 A;  1WX7 A;  2CJN A;  3ZJU A;  3MFG A;  1N62 A;  3GZN I;  5BYS A;  3AU5 A;  1TS4 A;  3SFE B;  1YX5 B;  2I1K A;  4L23 A;  1GB4 A;  2MQJ A;  4W9J A;  4LCD E;  4QAY A;  2RDH A;  2BYV E;  3BWU D;  4RGN A;  2KX0 A;  3EA6 A;  1GTH A;  4US9 A;  1GG3 A;  3R2I A;  4DQO C;  2QSD A;  2PW9 A;  3PSE B;  3P2B A;  3W1S A;  4I6P A;  2BF8 B;  1WR1 A;  1P98 A;  2LWP A;  1AWD A;  1WGG A;  1E0Z A;  2HE7 A;  3ECI A;  4GIV A;  2M19 A;  1E8Z A;  3V60 A;  2WLB A;  2JYE A;  1UD7 A;  2M56 B;  1WXQ A;  4W9L A;  4DDI D;  2MH7 A;  3DBL B;  1XO3 A;  4EEW A;  2IY1 B;  2OED A;  2M4N A;  1SE2 A;  4A55 A;  1WF9 A;  4S17 A;  3FC4 A;  4FHK A;  1I42 A;  1EU4 A;  2LVO A;  1WJ6 A;  2KMC A;  4FJV B;  3NVZ A;  1PGA A;  1C4A A;  3LDZ E;  3M95 A;  1SB3 C;  3QK0 A;  1IPG A;  1C77 A;  5LNK 1;  4JIO U;  2KFK B;  5IAA C;  3WAO A;  3BYY B;  4KGT A;  2G9H D;  4GDK B;  4II2 B;  3Q8A A;  3BVZ A;  4FUL A;  2JWZ A;  2YVC A;  3Q14 C;  1T3Q A;  1WH3 A;  4DDG D;  3NRZ A;  4W9G A;  3TEX A;  2BQQ A;  4RF0 A;  3Q3O C;  3PO0 A;  2GBK A;  4GB9 A;  2KQ7 A;  2RPV A;  3WIM A;  4PS3 A;  1GAQ B;  3I63 C;  1WMH B;  2WXO A;  4KDI C;  3U30 A;  2KKC A;  2QEJ C;  2MCN B;  1IBX A;  1V81 A;  4M00 A;  2KJH B;  4EZK A;  1BUI C;  4KIK A;  4C7Y A;  5C23 A;  2H88 B;  1WXS A;  1JRP A;  4K7W A;  4IOI E;  3BK1 A;  2KJ6 A;  1E90 A;  3W2D A;  4KGR A;  3DBL I;  3IT6 B;  1EF5 A;  4PT5 A;  1WGD A;  3JVZ X;  3P42 A;  3U4E G;  1SJE D;  1TZO A;  1L2N A;  4M02 A;  1EO6 A;  4HPP A;  1JML A;  4YSZ B;  1K50 A;  2KWD A;  1UWM A;  2BB5 A;  3APF A;  1NYQ A;  3ZNZ B;  2K8B A;  4EFO A;  2KD0 A;  3SDL C;  5FKA C;  2HJ8 A;  2PEA A;  2NS5 A;  2UYZ B;  1B1Z A;  2O2V A;  4A20 A;  5AUI A;  3FAH A;  4YSY B;  1N60 A;  4MJS A;  2JZZ A;  2IGD A;  3P1M A;  1Z5S B;  2OHF A;  2MA9 B;  3MHS D;  4P6V F;  1L0Y B;  1WYW B;  3APD A;  2GBR A;  2N0S B;  1RLF A;  1PUT A;  1CJE A;  5G5H A;  2IZV B;  3BY4 B;  2AQ3 B;  1UUP A;  3BII D;  3V6C B;  3KWV A;  2YLM A;  4ANX A;  4K81 A;  5FR3 A;  1T0Q C;  1LFD A;  3X23 A;  4OVZ A;  1JRU A;  4MH8 A;  2KTR A;  1MG8 A;  3AEB B;  1V1P B;  1GOZ A;  2ZW1 A;  1V1O A;  3H7S A;  3V3X A;  4EZJ A;  3NZ3 A;  2C7M B;  4XGA B;  1UBQ A;  4WJN A;  3RD2 A;  1J7B A;  1TTN A;  4C00 A;  2JXX A;  2WS3 B;  3BVG A;  3ZLZ A;  1I4P A;  2KNB A;  4DWF A;  1MG4 A;  3KQ4 A;  3ML9 A;  4M0W A;  3P4P B;  5HKH A;  4W9C A;  2KOX A;  4E74 A;  4MH0 E;  4AWJ A;  2NBU A;  5DPR A;  4ZRP A;  3IAS 1;  1SEB D;  4RMA A;  1V5T A;  1Q1O A;  4HCP B;  4YL8 A;  2KDE B;  4S0R A;  3UQB A;  1WE6 A;  1YJI A;  1V8C A;  2ZVN A;  4ITK A;  1ZE3 D;  1DOI A;  4RGO S;  4WWN A;  1GJZ A;  2LAS A;  1WGH A;  1K51 A;  1ZXH A;  1OTR B;  3JSV A;  2LD9 A;  1RM6 C;  5MPO A;  2TSS A;  3SD5 A;  1EWY C;  2SAK A;  4P1C C;  4NJ7 A;  5D2M B;  2PE6 B;  2CJO A;  2IJ0 A;  1TY2 A;  3FIL A;  3ZNG C;  2GLS A;  3PT2 B;  1IYF A;  1OQQ A;  4OZA A;  3BIN A;  1VCB A;  4OVU A;  2KDF B;  1DOX A;  2ZCC A;  2KK8 A;  3R7R A;  3E56 A;  5CHF A;  4KSK C;  3Q8B A;  4WUR A;  1C3T A;  1AYF A;  1WE7 A;  3Q3F A;  3A1Q B;  2RSU A;  4REZ A;  1F9J A;  4AJY B;  2HTM E;  3RNA C;  1KH0 A;  4FBJ B;  4ZHP A;  1C76 A;  4PYU A;  3HK0 A;  1D5M C;  1JWA D;  2PIA A;  1WYG A;  1BML C;  2B3A A;  5BO4 B;  1WM2 A;  2PJH A;  1UNS A;  3VXW A;  3NVV A;  2M0X A;  1SJH D;  3UIO B;  2WU5 B;  2IO0 B;  3IT4 B;  1SIF A;  4H2A A;  4KDL B;  4DHZ E;  1RFK A;  2BBC A;  1YMH E;  2JT4 B;  1VRA B;  1CZP A;  3PRZ A;  2MJ3 A;  3Q69 A;  3E9S A;  3LYY A;  1RRB A;  3TEW A;  1TS3 A;  4GMV A;  3ZDT A;  1FFU A;  2K22 A;  3TEY A;  2K8C A;  3CF6 E;  4Q2J A;  3D32 A;  2IDY A;  2WXM A;  1FMA D;  2PVO D;  3DBS A;  3ZIM A;  3PPA A;  5FR6 A;  3JYU A;  1AW7 A;  2I1J A;  2RPQ A;  4N58 A;  3DWG C;  2NMQ A;  4B6W A;  1XF5 L;  2G3Q B;  5GMV A;  1OGW A;  5DCN A;  5AZG A;  3AXC A;  3N9Y C;  4EZL A;  3AEF B;  2FCN A;  4N59 A;  4FA6 A;  1UWX A;  1FRD A;  2J0M A;  4NQL B;  4HXD A;  3B2F A;  4XWW A;  1SXT A;  1K52 A;  4JWU C;  2REX A;  2L52 A;  3NZS A;  4KKJ A;  3P63 A;  2VRR B;  4RH6 A;  3X0W A;  1YD8 U;  2L7R A;  2JRH A;  2ACZ B;  4IDI A;  4R3D A;  3H7P A;  4YSX B;  3ZUN A;  2AQ2 B;  5D94 A;  2LHD A;  1HE8 A;  4NJC A;  3VUW A;  1UF0 A;  2M8S A;  2FID A;  2KAJ A;  2CHW A;  3PLV A;  3UQA A;  2AEH A;  2AX5 A;  4C4V A;  2K0P A;  3NZU A;  1JRO A;  2K6D B;  3R66 C;  3M3J A;  5EE1 A;  2WXI A;  3SR6 A;  1HEZ E;  2JX5 A;  2KJR A;  1VR9 A;  1WXV A;  1SE4 A;  2LRW A;  4USA A;  3WAN A;  2V0G A;  1VZ8 A;  2PMV A;  3ZNH B;  3L17 A;  4TMA B;  1WI0 A;  1HA5 A;  1TKE A;  4TV3 A;  5JZE B;  5TSS A;  1I4H A;  1SSN A;  3SU8 X;  1E7P B;  1ZW7 A;  3MJW A;  3TMP B;  2KDB A;  4DXF A;  1N6Z A;  3GE8 C;  3CF4 A;  3UIP B;  1N5W A;  3NY5 A;  5G5G A;  3I9V 1;  2LJI A;  2IO2 B;  4BBN F;  3UI3 A;  4B9K A;  1L5P A;  4WJO A;  2QC8 A;  5JH5 C;  1QQR A;  1WZ0 A;  2QJL A;  4KSL C;  4KGS A;  4ZRI A;  4YTN B;  1UEL A;  3ZNI D;  2WU2 B;  4LNF A;  3VRB B;  3VAW A;  4C56 C;  4KZ0 A;  5HFY A;  4GN1 A;  4L1B A;  4WWM A;  5E6O A;  3TL5 A;  2BWE S;  3Q3N C;  2G1E A;  1CK1 A;  4NPN A;  2D3G A;  2DX5 B;  3BK2 A;  3ABV B;  3U7Z A;  1WJU A;  2NTS A;  1KM7 A;  3ZTD A;  3QC8 B;  4ANV A;  3EHV A;  2KMA A;  1WZ3 A;  1FNW A;  2OJR A;  3EGR A;  3DVN V;  3RZW C;  2LGS A;  1QOF A;  2J53 A;  1KLU D;  3JW0 X;  1LXD A;  3RUL A;  1ET9 A;  3RNC C;  3A33 B;  1XXG A;  3P4R B;  3EEC A;  3L16 A;  1XLQ A;  1I4X A;  1TKY A;  3DBR B;  4URK A;  1YQ4 B;  3A9K A;  1XLN A;  2BGF A;  2CU1 A;  4FXC A;  1N5X A;  5IKC M;  2WXP A;  3PGE A;  1SE9 A;  1L7Y A;  2IO1 B;  4K3B A;  1WJ4 A;  1E7V A;  4C7Z A;  1JWM D;  5BYQ A;  2J42 A;  1HZ6 A;  4A3P A;  2BKR B;  3VFK A;  4NJ6 A;  2NPT B;  2BS3 B;  4K1R B;  1WFY A;  2BWF A;  4HEA 1;  3OWE B;  3WAP A;  1VDV A;  2JZ3 B;  2XK5 A;  4RGM A;  3ZRF A;  3DWM A;  2G4S A;  1NDD A;  4HJK A;  1ZPS A;  2KVZ A;  5FK9 C;  4K7S A;  2LEK A;  4TSS A;  1QT9 A;  1GB1 A;  3AE3 B;  2LVP A;  4RFB A;  1ESF A;  3T3O A;  1OEY A;  3L13 A;  3IFW B;  3ZVV A;  1FNU A;  3N3K B;  3URY A;  4MT5 A;  3AUL A;  2KWC A;  2LRU A;  1P7F A;  4DHJ D;  1EF1 A;  4US8 A;  2GBJ A;  2DBY A;  3PRM B;  1VJK A;  1KOT A;  4NNJ B;  1V49 A;  3KVF B;  2GI9 A;  4PYZ A;  1XCT L;  3AEA B;  4F8C B;  2MJD A;  5T8I A;  3AN1 A;  4L2Y A;  5JHB A;  3RZF A;  4XDC A;  3WCQ A;  2JF5 A;  4IWP A;  1WX9 A;  1SBB B;  3TIX A;  3DBR I;  2W9N A;  2ZW0 A;  2WXK A;  4HLE A;  5EE0 A;  5E6P A;  3N20 C;  2JVC A;  3HVZ A;  4O1N A;  4JL9 A;  4UDU C;  3T8M A;  2FNJ B;  5AEK B;  2JSV X;  4BKG A;  3L08 A;  4ANW A;  2XBB C;  1A70 A;  3QJZ A;  3IHP C;  1LGR A;  4XYC A;  2ZNV B;  3C8Y A;  1F2R I;  4IG7 B;  4KX6 B;  1DOY A;  3V62 A;  2DZI A;  2R2Q A;  4JX1 C;  4TUU A;  4EKU A;  2WGS A;  3GB1 A;  3AEC B;  1WR6 E;  1F77 A;  3R8B A;  4GDL B;  2QDF A;  5DPS A;  4LNO A;  4XX5 A;  3QQ8 B;  1RWS A;  3R2T A;  4P16 A;  1JQ4 A;  1A5R A;  4PK1 A;  3KUD B;  1NVI D;  1WY8 A;  2X38 A;  3WAL A;  1HTO A;  3LJ3 A;  4MM3 A;  4B95 A;  1YOV B;  2V3S A;  1UBI A;  3AV8 A;  1Q10 A;  4BZA A;  3CMM B;  2FCQ A;  1WIA A;  3HIZ A;  2NVU I;  1NI3 A;  4LJO B;  2O6V D;  4WJQ A;  3Q3J A;  4YT0 B;  3AE2 B;  3ZRC A;  1YQ3 B;  1VZ6 A;  3VTV A;  1XLP A;  3L0W B;  3P4Q B;  2MP2 A;  4A90 A;  3GOE A;  3RUI B;  2DHZ A;  2MSE D;  2DLB A;  4TQ0 A;  2RMM A;  4HDO A;  1LM8 B;  3AEG B;  4HRO A;  1C9F A;  4MEL A;  4I6L B;  2DYM A;  3V6E B;  2PVG C;  3EFU A;  5IO9 A;  1DYQ A;  2KWV B;  4W9K A;  2YEP F;  1XCQ L;  3RNG C;  5L95 C;  5GXG B;  3MC9 A;  3KLS X;  2WXH A;  4F1S A;  5D7G A;  4OZB A;  3PV1 A;  3AB5 A;  4ARI A;  2GBM A;  2BYT A;  4CYE A;  4W9D A;  2LHE A;  2KLG A;  1IP9 A;  2QIL A;  3B1L X;  2LXA A;  2JZP A;  1ROE A;  2BVC A;  5C1Z A;  1MHH E;  4FHJ A;  1KLG D;  1P9D U;  2AL6 A;  2WX0 A;  2INP E;  4FAD A;  5BMH A;  2IBI B;  1TBE A;  3PZ8 A;  2L05 A;  4TKN A;  4IC7 B;  1ZKH A;  4WIP A;  1LQB A;  2PKO A;  4DHJ B;  4GLS C;  2KQ4 X;  1F52 A;  4KVG B;  1J8C A;  2IYD B;  2LUE A;  2XN9 C;  2CS4 A;  2D2Q A;  1YN3 A;  2J0J A;  1C79 A;  4GXB A;  2JPH A;  1GC7 A;  4OVV A;  3QAQ A;  2HDE A;  4MGI E;  2BKF A;  2ZEQ A;  3PVL A;  4G3X B;  5D3I B;  3NS8 A;  4W9E A;  4W9I A;  2QCZ A;  5C3J B;  1B9R A;  2CHZ A;  1GPX A;  2DWQ A;  1TIF A;  2C7N B;  4ANU A;  3PZD A;  5JHA A;  3DOW A;  3U7D A;  1QOB A;  3L54 A;  3VUY A;  4ZHO A;  1DGJ A;  1Q5W B;  2GRI A;  2N4F A;  3HM3 A;  3L4P A;  1QOG A;  2D3C A;  2LGI A;  2A4Z A;  2D5G A;  3AH7 A;  2C60 A;  4LK0 M;  4N6E B;  3PHW B;  3KUZ A;  4FN2 A;  3PLU A;  4WAA A;  2BYE A;  4NAW A;  2DYO A;  4PS7 A;  2MBH A;  2D07 B;  1PGB A;  3RI7 C;  4BKS A;  2LGD A;  4YXD B;  2C9W B;  2R61 A;  4DBG A;  2KXJ A;  4AS1 A;  3QWZ B;  4XE0 A;  3VVW B;  2ZVO A;  1P0R A;  3ZQ4 A;  2ZNV C;  4NAM A;  3IG3 A;  5G2N A;  1D5X C;  1PDX A;  1ZDX A;  5AUK A;  1V9J A;  5C2T B;  2A5U A;  2WHI A;  2KDM A;  1IBX B;  3RN9 C;  1YQB A;  3N1Z C;  1IGC A;  5AZH A;  4KIK B;  1L0V B;  2ZZP B;  3A9J A;  1K53 A;  4K7U A;  2L83 A;  2O6V B;  1FD6 A;  3TSS A;  1FPY A;  3DDC B;  3AE1 B;  3KW5 B;  4MGY E;  3APC A;  1E8Y A;  1H7W A;  1V6E A;  2WXJ A;  2KFJ A;  1EM7 A;  2KX3 A;  3DQV A;  2DZJ A;  5E6N A;  2KAC A;  1QOA A;  1FRR A;  2O2V B;  4CQN A;  2INN E;  2MWS B;  4MJS B;  2NTT A;  2W3S A;  3NJT A;  1Y56 A;  1EU3 A;  3CSF A;  4MDK E;  3B2G A;  4DXA B;  1E10 A;  1ISN A;  3TCA A;  2N7D A;  1MHX A;  3ZO5 B;  1F1H A;  3Q6B A;  1I4G A;  2V3N A;  3QCA A;  4AOF A;  1Q0W B;  4OHJ A;  2KTR B;  4FJZ A;  1NEK B;  2QMT A;  4BKT A;  4ICU A;  4IWO A;  3U8Z A;  1PQS A;  4C80 A;  3ETR A;  1V97 A;  4EOY A;  2KHW B;  1J7C A;  2FCM A;  3AE8 B;  4G11 A;  5H92 C;  2EMS A;  2WP9 B;  1WJN A;  2NPT A;  3LB8 C;  2PPH A;  2LI5 A;  2ZJD A;  1LO5 D;  3W1S C;  1VD2 A;  1FIQ A;  3M62 B;  4HCN B;  3RCZ A;  2HTH A;  3HHM A;  4HJG E;  4GSW A;  3N30 A;  3ZTC A;  1YX6 B;  1JW9 D;  3QIJ A;  1HZ5 A;  3ZGZ A;  4M0W B;  1S1Q B;  1V5O A;  4MSQ B;  5IA7 A;  3UIN B;  1WGK A;  2ASQ A;  2K39 A;  5D6J B;  3WAM A;  4W9F A;  1ZXI A;  2Y3A A;  3MC0 B;  2WDV B;  1E6E B;  2N9K A;  2AL3 A;  3Q3M C;  4XZ4 A;  3OAW A;  2LMC A;  1MVK A;  2IPK D;  3ALB A;  4FJY A;  1RFA A;  2FUH B;  4B0M A;  2MX2 A;  1H7X A;  3VTU A;  3KH0 A;  2D10 A;  2J52 A;  4DXG A;  2KWU B;  2LFI A;  3O65 B;  3H9D A;  1OEY J;  1J7A A;  2QHO A;  1P3Q U;  3JSV B;  5KHQ A;  4PS8 A;  1CQV A;  2WXL A;  3AE6 B;  2E3T A;  3DBH I;  2IGH A;  1FO4 A;  1OFF A;  4AUQ C;  4M01 A;  3FIL B;  4M8N A;  1I7H A;  4WWO A;  1MJD A;  1YNT E;  1JCK B;  2BT6 A;  2KFK A;  3RYT A;  1H8C A;  3W5V B;  3H6N A;  2B76 B;  1WM3 A;  5CTR C;  4GDK A;  1C4P A;  3DCG A;  1J19 A;  1SF0 A;  1MPE A;  3OJ3 A;  1STE A;  1U4A A;  1XQQ A;  3KYC D;  2XNA C;  1FM0 D;  5E6J A;  4OZC A;  2MBQ A;  1TS2 A;  2Z0E B;  1L4Z B;  3N1Y C;  1FXI A;  4W9H A;  2Z0D B;  4A8X C;  3N1X C;  3ZW3 A;  2I2Y A;  1FCC C;  1C1Y B;  2Y5B B;  4LLG M;  1RAX A;  2WXF A;  1WMH A;  5CHW A;  1AAR A;  2JYT A;  3IXS A;  3S2A A;  3DVN U;  2H89 B;  5CHV C;  2SEB D;  3MJ5 A;  2GOW A;  2KDI A;  2BW2 A;  1V2Y A;  2CU3 A;  4P7I A;  5I4D A;  2CHX A;  1SIJ A;  2LGY A;  2LXC A;  1D3Z A;  3PHX B;  4LNK A;  5J18 A;  4XWT A;  5IOI A;  1F0Z A;  3AMZ A;  3FKY A;  2MEK A;  5D3D A;  2N7E A;  3PRP B;  3AE5 B;  4ICV A;  4HKZ E;  2LJ5 A;  3VDZ A;  4BOS C;  3MHZ A;  2I38 A;  3UF8 A;  3R7Q A;  2RD0 A;  3Q8C A;  1BXT A;  4IKG A;  2J4X A;  1WXA A;  2N1V A;  3C0R B;  5AZF A;  2N9E B;  4GGQ A;  1WRI A;  4KKI A;  5BMI A;  2L0F A;  2WQY B;  1E8W A;  3CST A;  4RCO A;  3N32 A;  2DZM A;  1GTE A;  2RDB C;  3I3T B;  2WXG A;  3NVY A;  4CHK A;  4DHZ B;  3AE4 B;  4CO7 A;  1YJ1 A;  4KV2 A;  1V1P A;  1KRH A;  2N1W A;  3T9L A;  4ZRK A;  2KVR A;  1RYJ A;  1TJE A;  4JPS A;  2UWQ A;  2LUM A;  4ZYS A;  3OJ4 B;  2W3R A;  2OOB B;  1YIW A;  2G4D B;  4BOZ B;  1J0G A;  3EUB 2;  3H7P B;  5BMG A;  2L32 A;  4F7Z A;  4E3C A;  1L4D B;  3RNB C;  3SEB A;  3KYD D;  3ONS A;  1FEH A;  2W55 A;  1ZOY B;  1TZ1 A;  4HWI B;  4OW0 A;  4C4V B;  1UGJ A;  3A4S C;  5HI1 A;  3OG5 A;  2KC2 A;  2JWU A;  2JUO A;  3DHH C;  2FIF A;  1TGZ B;  2BYF A;  3RNE C;  1UZX B;  3Q8E A;  4A9A A;  1MI0 A;  3HRD D;  3V05 A;  3W5U B;  2BS4 B;  4TQ1 A;  1YN5 A;  1XEE A;  4HVB A;  4ZRQ A;  4NZL B;  4ZRJ A;  1K8R B;  4LDT B;  5LXI B;  3GE3 C;  2JY6 A;  3C19 A;  2D11 A;  1WX8 A;  3ZYY X;  3PZ7 A;  3L10 B;  4IWQ A;  3AU4 A;  2CKH B;  2L0T A;  2KN5 A;  2V1Y A;  5J17 A;  4K3C A;  2MJE A;  3NUH B;  5BYR A;  2DEN B;  4G0N B;  2L76 A;  1UGM A;  3H8H A;  1GT8 A;  2IO3 B;  2IGG A;  3A1Q A;  4HK2 A;  4ZOH C;  3RNF C;  3A4R A;  1WXM A;  1JWB D;  3QHT A;  2G45 B;  3OLM D;  4E71 A;  2DNF A;  3DPD A;  3B08 A;  4DK5 A;  3PTF C;  1T5X D;  4HPM B;  1EWC A;  4HPL B;  1FNV A;  2CR5 A;  2PLP A;  2D3B A;  2O6V A;  2RGF A;  2X8X X;  4JE3 B;  3NOB A;  2VH1 A;  1IUE A;  2KLC A;  3AEE B;  3LXF A;  1L6U A;  1ENF A;  3T3N A;  1WGY A;  4RM9 A;  3U52 E;  2DAF A;  4J6I A;  2N9P C;  3A9K B;  4LJP B;  2JRI B;  2W82 A;  2L1A A;  3ML8 A;  3TUO A;  1T0R C;  2KQS A;  3DVG X;  2GB1 A;  2JU6 X;  1T0S C;  4YTM B;  4J3O D;  1YJJ A;  1ZGU B;  5HHD G;  1E7U A;  4ACF A;  1T6B X;  3SHQ A;  3K9O B;  3I57 A;  4IW0 A;  4II3 B;  2W54 A;  1AN8 A;  2KAN A;  1I4R A;  2IY0 B;  2PE9 A;  3HUI A;  1N61 A;  2JQR B;  1F2R C;  1KFY B;  1C4C A;  2MLB A;  2RR9 A;  1ZP0 B;  3CWI A;  4IM2 A;  4MSM B;  3GS2 A;  5TR5 A;  2WDR B;  3VHT C;  4MAC A;  3MC8 A;  2IND C;  2XK5 B;  1QIL A;  2WXQ A;  1N63 A;  2EKE C;  1I4Q A;  1M4V A;  5G55 A;  1T0Y A;  4EE2 A;  5JXV A;  4IM0 A;  5EDS A;  2V3P A;  4LNN A;  4RNA A;  2K3U A;  2V4I B;  2LVQ A;  3O13 A;  2XEW A;  1FCL A;  2ICI A;  3KUC B;  3Q8F A;  2WYQ A;  1X1M A;  1Y8R C;  2MHJ A;  2WX1 A;  4XDD A;  2BB6 A;  2L3Z A;  2D3A A;  1JWS D;  3NHE B;  4XC2 A;  3VR8 B;  2N9L A;  2R2O A;  1S3S G;  3ZXV A;  3NVW A;  4IM3 A;  2GBN A;  2K6Q A;  4BAX A;  1R4N B;  3HVD A;  3RMK C;  4I6N B;  3ENE A;  2QIE B;  4BBN C;  3IBE A;  1EUV B;  2AYO B;  2K8H A;  2J0K A;  1TS5 A;  4KZC A;  2LGX A;  2N9X A;  1L6V A;  3R3M A;  1C78 A;  1JWU D;  3VH3 B;  3B0A A;  2UU7 A;  3AM9 A;  2AQ1 B;  1KJT A;  2L8J A;  4HRS A;  4WQO B;  1KF6 B;  1V86 A;  4BKS D;  1KTK A;  1Z2M A;  1E9M A;  4HKQ A;  3ZXR A;  3ZJV A;  2MBB B;  1XT9 B;  1NI2 A;  1PYW D;  3V61 A;  3DVG Y;  3VR9 B;  2VZK D;  1E5W A;  3W9C B;  1WRD B;  4JWS C;  1PFD A;  3VTW A;  3W1Y A;  4MM3 B;  3DHI C;  2WWZ A;  2DYB A;  4AJW A;  3NS1 A;  3PS6 A;  3KWL A;  4MGZ E;  1XLO A;  3EFC A;  1QKZ A;  4ZDV A;  2K9X A;  2BS2 B;  1D6E C;  4A3O A;  5LXH A;  2M17 A;  1KLV A;  1R7S A;  2YEP B;  3RFZ B;  1ACC A;  2EEL A;  1TKG A;  2NR2 A;  1WWT A;  1D4B A;  4ZYN A;  1JAL A;  1HXY D;  3WA0 A;  2EMT A;  2ON8 A;  2MP2 B;  1IGD A;  1R4N I;  1NEN B;  2V4L A;  3VUX A;  2KYW A;  2KC1 A;  4D2K A;  2WDT B;  1WSP A;  2KT7 A;  3DBH B;  4ARC A;  3AE9 B;  1FXA A;  2FBW B;  3I5J C;  5HG2 A;  4B0E A;  2C5L C;  1QLB B;  1NBF C;  3P4S B;  1PGX A;  2C7H A;  3Q2A C;  1YN4 A;  4GOC A;  4JQW C;  4BVU C;  5DPW A;  4YWG G;  2E6X A;  1VZ7 A;  3RT3 B;  4M8M A;  2NBV B;  3M63 B;  1ET6 A;  3AI5 A;  1R4M B;  4P1B C;  3MTN B;  5L83 A;  1H4R A;  1P1A A;  4ASW C;  4WAF A;  5J2R A;  2WDQ B;  1G6J A;  2L00 B;  5CX3 A;  2KO3 A;  2K5P A;  3B9J A;  3PRE A;  2MBO A;  5H8Y E;  1ZDV A;  2BPS A;  3K9P B;  1CMX B;  4MEM A;  4BFR A;  4LNI A;  2ZPY A;  3ZKJ C;  1L0X B;  3VQI A;  1WGR A;  2WNM A;  4HDQ A;  1M94 A;  2KTF A;  3TEZ A;  2AWT A;  5EE9 A;  2JXT A;  2WXN A;  2BTE A;  1GNU A;  4GU2 A;  2Z59 B;  2FCS A;  1I35 A;  2V9H A;  3AED B;  1HQR D;  2RDG A;  4NY0 A;  1VLB A;  4A6Q A;  3GP7 A;  2KZR A;  1XD3 B;  3TJP A;  1MFW A;  3U2S C;  2OJW A;  1QZE A;  2DZK A;  4WJP A;  4RGT A;  5EE3 A;  5DPT A;  3VRA B;  1D5Z C;  2EKI A;  2DAJ A;  1SE3 A;  1HTQ A;  2ZCB A;  3EC8 A;  3HM6 X;  4LTU A;  1E8X A;  1FXT B;  2M1M A;  1GUA B;  1TYG B;  1TT5 B;  1OQY A;  3VH4 B;  4WH4 A;  4NAW B; 
#chains in the Genus database with same CATH homology
 2PVG C;  1KH0 A;  4ZHP A;  1C76 A;  3EUB 2;  5BMG A;  2L32 A;  1TY0 A;  1DYQ A;  1D5M C;  1JWA D;  1OQR A;  2YEP F;  2Z8L A;  1L4D B;  1XCQ L;  2PIA A;  1WYG A;  1BML C;  2FUG 1;  5GXG B;  3SEB A;  3KLS X;  2WXH A;  1UNS A;  1FEH A;  5D7G A;  3BZD B;  4OZB A;  3NVV A;  2W55 A;  2Y5C A;  3RPF C;  1SJH D;  3J9C A;  3AB5 A;  1ZOY B;  4WQM A;  2WU5 B;  3IT4 B;  4ARI A;  4OW0 A;  2BYT A;  1UGJ A;  2VZK B;  4H2A A;  2LHE A;  2FE8 A;  1RFK A;  2QIL A;  2BBC A;  5HI1 A;  1YMH E;  2JWU A;  1VRA B;  1CZP A;  2JZP A;  1ROE A;  2MJ3 A;  3Q69 A;  1MHH E;  3E9S A;  3SFD B;  1P7E A;  3LYY A;  4AQ7 A;  3BVM A;  1KLG D;  3TEW A;  1TS3 A;  2INP E;  2M0A A;  5BMH A;  1FFU A;  3PZ8 A;  2K22 A;  3Q8E A;  3TEY A;  4Q2J A;  2IDY A;  2WXM A;  4A9A A;  1FMA D;  1FFV A;  1MI0 A;  2PVO D;  4WIP A;  3HRD D;  3V05 A;  3ZJT A;  3W5U B;  2WXR A;  2PKO A;  2BS4 B;  4GLS C;  2KQ4 X;  4TQ1 A;  1YN5 A;  1XEE A;  1AW7 A;  2XN9 C;  4ZRQ A;  4NZL B;  3CIR B;  2PTL A;  1YN3 A;  4N58 A;  3DWG C;  2NMQ A;  1C79 A;  1XF5 L;  3ZYY X;  3IAM 1;  2N7J A;  3PZ7 A;  2HDE A;  3N9Y C;  5D3I B;  3AEF B;  4N59 A;  2ONQ A;  5C3J B;  2MJE A;  4RF1 A;  1B9R A;  1UWX A;  1GPX A;  3NUH B;  1FRD A;  2DWQ A;  2KN4 A;  5BYR A;  3B2F A;  4XWW A;  1SXT A;  2Y5P A;  1QOB A;  4ZHO A;  3H8H A;  1GT8 A;  1ZUD 2;  3MP9 A;  1DGJ A;  2GRI A;  1K52 A;  2IGG A;  3L4P A;  4JWU C;  1QOG A;  2LGI A;  2L52 A;  2D5G A;  3AH7 A;  4LK0 M;  4N6E B;  4YTP B;  3BYT B;  4ZOH C;  4KKJ A;  3P63 A;  3AE7 B;  1JWB D;  2Q5W D;  4RH6 A;  2KMM A;  1QF6 A;  2DYO A;  1NYR A;  1PGB A;  1T5X D;  4R3D A;  2ACZ B;  4IDI A;  2CJN A;  3ZJU A;  3MFG A;  4YXD B;  1EWC A;  1N62 A;  4YSX B;  2AQ2 B;  5BYS A;  1FNV A;  2PLP A;  1TS4 A;  2LHD A;  3SFE B;  4NJC A;  2R61 A;  4L23 A;  1GB4 A;  4AS1 A;  4JE3 B;  4XE0 A;  2KAJ A;  3ZQ4 A;  2RDH A;  1IUE A;  2AX5 A;  4NAM A;  2K0P A;  3AEE B;  3BWU D;  3LXF A;  4RGN A;  1JRO A;  1L6U A;  3EA6 A;  1D5X C;  1GTH A;  1ENF A;  4US9 A;  3T3N A;  1PDX A;  1ZDX A;  3R2I A;  3U52 E;  5AUK A;  5C2T B;  5EE1 A;  4DQO C;  2QSD A;  2PW9 A;  3W1S A;  2WXI A;  2KDM A;  2L1A A;  2W82 A;  3SR6 A;  1HEZ E;  3TUO A;  1IBX B;  2GB1 A;  2JU6 X;  4YTM B;  1IGC A;  2JX5 A;  1VR9 A;  1AWD A;  1L0V B;  1SE4 A;  1YJJ A;  4J3O D;  1E0Z A;  1K53 A;  4USA A;  2V0G A;  1VZ8 A;  5HHD G;  2PMV A;  4TMA B;  2L83 A;  1HA5 A;  2M19 A;  1FD6 A;  1TKE A;  3TSS A;  1T6B X;  2WLB A;  2JYE A;  3I57 A;  5TSS A;  1I4H A;  1SSN A;  2M56 B;  1WXQ A;  1E7P B;  3AE1 B;  4DXF A;  2W54 A;  1AN8 A;  1I4R A;  2MH7 A;  3HUI A;  3CF4 A;  1N61 A;  2JQR B;  1F2R C;  1XO3 A;  1KFY B;  1N5W A;  1C4C A;  5G5G A;  1ZP0 B;  3CWI A;  3I9V 1;  1H7W A;  2LJI A;  2WXJ A;  2OED A;  3GS2 A;  3UI3 A;  2WDR B;  1EM7 A;  4MAC A;  1L5P A;  1QIL A;  1SE2 A;  4A55 A;  1QQR A;  2QJL A;  2WXQ A;  3FC4 A;  1N63 A;  2KAC A;  1I4Q A;  1M4V A;  1EU4 A;  4KGS A;  1QOA A;  4EE2 A;  5JXV A;  1FRR A;  2V3P A;  4CQN A;  2INN E;  3NVZ A;  1PGA A;  1C4A A;  2NTT A;  4YTN B;  2W3S A;  2WU2 B;  1SB3 C;  3VRB B;  4RNA A;  2K3U A;  4C56 C;  2V4I B;  3O13 A;  1Y56 A;  5HFY A;  1EU3 A;  1FCL A;  2ICI A;  1C77 A;  4L1B A;  4WWM A;  5LNK 1;  3B2G A;  2G1E A;  1E10 A;  3BYY B;  1CK1 A;  4KGT A;  3Q8F A;  2G9H D;  3BK2 A;  1MHX A;  4GDK B;  3ABV B;  1I4G A;  3Q8A A;  2V3N A;  3BVZ A;  3U7Z A;  2NTS A;  4XDD A;  2BB6 A;  4OHJ A;  1T3Q A;  1JWS D;  3VR8 B;  2N9L A;  1NEK B;  2QMT A;  1FNW A;  3NRZ A;  3EGR A;  4C80 A;  3ETR A;  1V97 A;  1QOF A;  3TEX A;  2J53 A;  3NVW A;  1J7C A;  1KLU D;  3AE8 B;  4RF0 A;  3HVD A;  5H92 C;  3PO0 A;  1ET9 A;  2WP9 B;  3LB8 C;  1XXG A;  1LO5 D;  3P4R B;  2QIE B;  1XLQ A;  1I4X A;  1TKY A;  2RPV A;  1TS5 A;  1GAQ B;  1FIQ A;  1YQ4 B;  2WXO A;  4HJG E;  2QEJ C;  1XLN A;  1IBX A;  1L6V A;  4FXC A;  1N5X A;  1C78 A;  1JWU D;  1JW9 D;  1HZ5 A;  2WXP A;  1BUI C;  3ZGZ A;  4C7Y A;  1WGK A;  2H88 B;  3AM9 A;  1JRP A;  2AQ1 B;  4IOI E;  3BK1 A;  4HRS A;  4C7Z A;  1JWM D;  5BYQ A;  1KF6 B;  1ZXI A;  2J42 A;  1HZ6 A;  2Y3A A;  3MC0 B;  3W2D A;  2WDV B;  1E6E B;  4KGR A;  3IT6 B;  2N9K A;  4PT5 A;  2BS3 B;  2LMC A;  1KTK A;  1MVK A;  2IPK D;  1E9M A;  3P42 A;  3U4E G;  1SJE D;  1TZO A;  4HKQ A;  4HEA 1;  4B0M A;  3OWE B;  3ZJV A;  1VDV A;  1PYW D;  1JML A;  4YSZ B;  1K50 A;  1H7X A;  2KWD A;  1UWM A;  2BB5 A;  4RGM A;  1NYQ A;  2J52 A;  4DXG A;  3DWM A;  3VR9 B;  2LFI A;  1ZPS A;  2VZK D;  3W9C B;  5FKA C;  1J7A A;  5FK9 C;  2LEK A;  1B1Z A;  4JWS C;  1PFD A;  5AUI A;  3FAH A;  4YSY B;  4MM3 B;  1CQV A;  1N60 A;  4TSS A;  2WXL A;  3AE6 B;  2IGD A;  1QT9 A;  2E3T A;  3P1M A;  1GB1 A;  3AE3 B;  2OHF A;  4RFB A;  1ESF A;  2IGH A;  1FO4 A;  3T3O A;  1OFF A;  4P6V F;  1L0Y B;  3FIL B;  1I7H A;  3NS1 A;  1YNT E;  1JCK B;  3KWL A;  2BT6 A;  2N0S B;  1PUT A;  3W5V B;  1CJE A;  1XLO A;  5G5H A;  1FNU A;  2B76 B;  1QKZ A;  3URY A;  4MT5 A;  2AQ3 B;  1UUP A;  2K9X A;  2BS2 B;  3BII D;  1D6E C;  3KWV A;  1P7F A;  4US8 A;  1C4P A;  2DBY A;  5FR3 A;  1SF0 A;  1MPE A;  1R7S A;  2YEP B;  1VJK A;  3RFZ B;  1ACC A;  2EEL A;  1TKG A;  4OVZ A;  1STE A;  2GI9 A;  1WWT A;  4MH8 A;  3AEB B;  1V1P B;  2XNA C;  1GOZ A;  1D4B A;  1FM0 D;  1JAL A;  3AEA B;  1HXY D;  1V1O A;  1XCT L;  2ON8 A;  2MJD A;  2ZW1 A;  4OZC A;  5E6J A;  1IGD A;  1NEN B;  5T8I A;  3V3X A;  3AN1 A;  1TS2 A;  3NZ3 A;  4L2Y A;  4D2K A;  4XDC A;  3WCQ A;  1L4Z B;  1FXI A;  1WSP A;  1SBB B;  4ARC A;  1J7B A;  4A8X C;  2I2Y A;  1FCC C;  2WS3 B;  2ZW0 A;  3AE9 B;  1FXA A;  2FBW B;  5HG2 A;  4LLG M;  2WXK A;  4B0E A;  3BVG A;  2WXF A;  1QLB B;  1I4P A;  5EE0 A;  3P4S B;  1PGX A;  1YN4 A;  2JYT A;  3IXS A;  3KQ4 A;  3HVZ A;  4O1N A;  4YWG G;  4M0W A;  2E6X A;  3P4P B;  4UDU C;  1VZ7 A;  2H89 B;  1ET6 A;  2SEB D;  2JSV X;  3MJ5 A;  1A70 A;  4ZRP A;  3IAS 1;  4WAF A;  1SEB D;  2WDQ B;  2BW2 A;  3C8Y A;  1F2R I;  2CU3 A;  4KX6 B;  5I4D A;  1DOY A;  1SIJ A;  2K5P A;  4XWT A;  4JX1 C;  3B9J A;  3AMZ A;  1F0Z A;  1YJI A;  3GB1 A;  3AEC B;  2MEK A;  5H8Y E;  1F77 A;  1ZDV A;  1V8C A;  4ITK A;  5D3D A;  3AE5 B;  1ZE3 D;  4GDL B;  4NAW B;  3R8B A;  1DOI A;  4RGO S;  4HKZ E;  1RWS A;  3R2T A;  4P16 A;  1JQ4 A;  3MHZ A;  1K51 A;  2I38 A;  1NVI D;  1ZXH A;  2X38 A;  1L0X B;  1RM6 C;  3VQI A;  5MPO A;  2WNM A;  2TSS A;  3Q8C A;  1BXT A;  1EWY C;  2SAK A;  4IKG A;  3TEZ A;  5EE9 A;  2JXT A;  2CJO A;  2WXN A;  2IJ0 A;  2J4X A;  2BTE A;  1TY2 A;  3FIL A;  3AV8 A;  1Q10 A;  1WRI A;  4KKI A;  1OQQ A;  3AED B;  1HQR D;  2RDG A;  4OZA A;  5BMI A;  2WQY B;  1NI3 A;  1DOX A;  1VLB A;  4RCO A;  4A6Q A;  3GP7 A;  1GTE A;  4YT0 B;  3AE2 B;  3U2S C;  2WXG A;  1YQ3 B;  3NVY A;  3E56 A;  3AE4 B;  3Q8B A;  4WUR A;  4RGT A;  1VZ6 A;  5EE3 A;  1AYF A;  1XLP A;  1V1P A;  3VRA B;  1KRH A;  3P4Q B;  1D5Z C;  2EKI A;  4A90 A;  1RYJ A;  4TQ0 A;  1TJE A;  2DLB A;  1SE3 A;  2RMM A;  4JPS A;  4HRO A;  3AEG B;  1C9F A;  2LUM A;  4ZYS A;  4LTU A;  4REZ A;  2W3R A;  1TYG B;  4WH4 A;  2DYM A;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...