2WDVB

E. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Succinate:Quinone Oxidoreductase with an Occupied and Empty Quinone- Binding Site.
pubmed doi rcsb
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdvB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdvB01
2G1EA 1AWDA 1GAQB 3AN1A 3SFEB 1OQQA 3P4RB 1N61A 4US9A 2WDVB 2CJOA 1WYGA 1JALA 2LEKA 3SR6A 1E9MA 1RYJA 5EE1A 3AEDB 2KAJA 2MJ3A 3NVZA 1L5PA 2CJNA 2W3SA 3VRBB 5EE3A 4KX6B 1ROEA 2H89B 1QOAA 1A70A 1DOXA 2BS3B 2K9XA 1JW9D 1QT9A 5G5GA 2N0SB 1ZUD2 4YSYB 3HVZA 4YTPB 2PKOA 1B9RA 2BS4B 4WWMA 1JRPA 1N5XA 1KF6B 1TKEA 1TYGB 2W3RA 3DWMA 4USAA 2PVGC 1FRDA 1JWBD 2QIEB 1L6UA 5C2TB 3W5VB 2L52A 4YTNB 1V97A 1KRHA 4HROA 1H7XA 3CF4A 3VR8B 3P4QB 2B76B 2Q5WD 1R7SA 2BT6A 1JQ4A 2DBYA 3AEBB 1J7CA 2WU5B 3B2FA 3CWIA 1WGKA 3AV8A 2JX5A 5GXGB 3AE8B 1YQ3B 4N59A 1GPXA 1WXQA 3FAHA 1FFVA 1UWMA 1N62A 3FC4A 2WS3B 1FFUA 5AUIA 2FBWB 4YSZB 1E0ZA 1I7HA 1SIJA 2M19A 1VDVA 1FRRA 1QOGA 1TKGA 3AEAB 1DGJA 2MJEA 3HUIA 4HRSA 4ZHPA 1ZXIA 3ABVB 1NYQA 1JROA 2K5PA 2L83A 3AE1B 3AM9A 2WDRB 2WLBA 1H7WA 1XLQA 3NRZA 3BIID 4ITKA 3AE9B 1NENB 4C7YA 3W5UB 4C80A 5AUKA 1KFYB 2W54A 3AH7A 1NVID 1TKYA 4ZOHC 1FO4A 3AEFB 1NEKB 3AE4B 5C3JB 2WQYB 1OQRA 5H8YE 3P4PB 4ZHOA 1QF6A 2H88B 1XLPA 2EKIA 3LB8C 1ZOYB 2HTME 1F0ZA 3AE7B 1NI3A 1GTEA 1FXIA 1IUEA 5MPOA 1GTHA 2WDQB 1ZP0B 3ETRA 4WQMA 3NS1A 5EE0A 1J7BA 2PIAA 2Y5CA 4N6EB 3AMZA 1L6VA 4US8A 4P6VF 1EWYC 1DOIA 1N63A 3KWLA 1E6EB 2MJDA 1J7AA 1WRIA 2W55A 1AYFA 3P63A 3HRDD 3VRAB 3EUB2 1VLBA 3WCQA 1E10A 1VJKA 1YQ4B 4A9AA 4JWUC 4YSXB 3AB5A 1TJEA 1XO3A 1FXAA 4YTMB 4C7ZA 2WP9B 3B2GA 3RPFC 3CIRB 3AE2B 3AEGB 1RM6C 1FIQA 2K22A 2ACZB 1SF0A 1SB3C 1JWAD 1XLOA 1XLNA 2JQRB 2E3TA 2WU2B 3NVWA 4YXDB 1CJEA 4LTUA 5EE9A 5G5HA 1GT8A 2BS2B 3VR9B 3ZYYX 3P4SB 3P1MA 1PUTA 2KMMA 1QOBA 3B9JA 2M56B 3SFDB 4N58A 2DWQA 2OHFA 1L0VB 3AEEB 4JWSC 4JX1C 3NVYA 1WWTA 1RWSA 2QJLA 1OFFA 1PDXA 1N60A 1YJJA 1V8CA 3L4PA 2MH7A 1T3QA 2AX5A 4FXCA 1NYRA 1E7PB 3W9CB 2PVOD 1DOYA 2CU3A 3DWGC 3AE6B 3AE5B 1N5WA 1QOFA 3LXFA 1CZPA 1PFDA 1RFKA 4YT0B 3PO0A 1FM0D 4IDIA 3AE3B 3NVVA 1YJIA 1FMAD 1QLBB 3AECB 5H92C
chains in the Genus database with same CATH superfamily
4MGZE 2J0JA 3DBSA 1D5MC 2C7MB 1ENFA 4JL9A 3M95A 5T8IA 3J9CA 1WJUA 1QT9A 1B9RA 4M0WA 4WWMA 2BKFA 2ASQA 2BYVE 2SEBD 2LJ5A 4HROA 2D3BA 2WU5B 2AWTA 4A3OA 2NS5A 1VDVA 3AEAB 3N3KB 2HTHA 3DBRB 1TIFA 4GMVA 1S1QB 2WHIA 4C4VB 1NENB 2K3UA 3KH0A 4ANXA 3B0AA 1IGDA 3U4EG 3TEWA 2KQ7A 2NPTB 2QDFA 2LFIA 5D7GA 3R2TA 1DOIA 1KM7A 1FD6A 1UNSA 1AYFA 1T0QC 3P63A 4G3XB 2M4NA 3DBHB 5JXVA 3LDZE 4K3BA 5KHOA 3RI7C 1PGBA 4TV3A 1XLOA 2ZZPB 3ONSA 3P4SB 2K8BA 4W9DA 4WJOA 3B9JA 4ICUA 4P1BC 2JT4B 4YWGG 2KWVB 3D32A 2DZJA 1N60A 1TGZB 3M63B 3EECA 2WXJA 1TBEA 2DYBA 3DVGX 2J52A 1WGRA 1FM0D 4GDLB 2KMAA 2KVRA 2ZEQA 2Y5BB 1V9JA 3SFEB 1GJZA 2QILA 1LXDA 5D3DA 1TS3A 1PGXA 3I3TB 1MG4A 4NAMA 2JPHA 2EMTA 1WXVA 4HPPA 2G4SA 4YSYB 4B95A 2FUG1 2W3RA 3JSVB 3KUCB 1I42A 1SBBB 1V97A 3QHTA 1JQ4A 2DAJA 2KWDA 2KFKB 1WFYA 3VVWB 1FFUA 2TSSA 4F8CB 3Q8AA 2ZVOA 1SEBD 2NBUA 4DXAB 2J53A 2GBNA 2MBBB 3AE1B 1OGWA 4HK2A 2AYOB 4HDOA 1YOVB 3NY5A 1TS5A 4HDQA 5FK9C 4WQOB 2DHZA 3NS8A 4M0WB 4KVGB 2IBIB 1ZP0B 5CTRC 1YMHE 1WJ4A 1EF1A 4US8A 4HXDA 1J7AA 3RT3B 2PJHA 3H7SA 4EE2A 3EUB2 1VLBA 3TUOA 3ZDMC 2JWZA 2KO3A 3UI3A 2LASA 2HE7A 2V4IB 3DQVA 3RPFC 1R4MI 3V3XA 3R7RA 3JW0X 3TBLD 3RNCC 4GDKA 4M02A 4PT5A 1GT8A 4NNJB 4KGRA 4AS1A 2AX5A 4MH0E 1YNTE 4MGIE 4ZRKA 2BYFA 1R4NI 2N1VA 4GU2A 3PO0A 4K3CA 5IAAC 2G1EA 3U7ZA 2L05A 1V49A 2CJOA 4E71A 2J42A 3SR6A 3TEXA 3URYA 2LVPA 2IJ0A 2W3SA 2X8XX 2WXGA 2K8HA 3IAM1 4HCNB 2N9LA 1UH6A 3N20C 2BPSA 3L13A 3T9LA 3HM3A 4IG7B 4XGAB 3DVGY 2DLBA 4YTNB 1EUVB 1EF5A 2IY1B 3DCGA 2G45B 3NUHB 2KYWA 3PLVA 3OG5A 5L83A 2BYTA 2O6VD 5AUIA 1E0ZA 2FBWB 4XZ4A 3ABVB 3C8YA 3B1LX 2INDC 2N7DA 2WXRA 1LFDA 2FE8A 3WIMA 1XCTL 1NEKB 3UIPB 1L7YA 2X38A 3WAPA 1WGYA 4XC2A 1J7BA 1GB4A 5I4DA 2N7JA 2MBQA 1C4PA 3A1QA 1E10A 3HRDD 1D5XC 2MRPA 5CHFA 4JWUC 3QAQA 1XO3A 3FKYA 3R66C 1Q0WB 1R4MB 1A5RA 2XK5A 4GIVA 2WU2B 1WX9A 2KC2A 4TUUA 3DHGC 1QOBA 2K0PA 2OHFA 4C56C 1WWTA 1RWSA 2QJLA 5FR6A 2V0GA 5HI1A 5FR3A 1UBQA 3PRMB 2MW5A 5G2NA 1R4NB 3GE8C 4IM2A 2KMCA 1HEZE 1AWDA 1P9DU 3APFA 4I6NB 3S2AA 2N9XA 4KIKB 1LM8B 3AEDB 2KAJA 3Q14C 3IVFA 4XDDA 1HQRD 4IKGA 2WX1A 4EZLA 2IYDB 3PHWB 3PT2B 3VR8B 2Q5WD 2B76B 3VHTC 1YN3A 5GXGB 5BYSA 3Q8BA 4OVZA 3ECIA 2KZRA 4J6IA 1TKGA 4G11A 1OEYJ 2K6QA 4PYZA 2MBHA 5E6NA 4QAYA 4E74A 2CHWA 2RD0A 5AUKA 2W54A 4C00A 1P7FA 2KFJA 3A4RA 2LZ6A 3AULA 1F9JA 1GTHA 1C78A 2IPKD 5TSSA 2XN9C 3ZTDA 1E8ZA 3NS1A 4ANUA 2GBRA 4KDIC 4HLEA 1T6BX 3NG0A 1E8XA 1SE2A 3ZDTA 2PPHA 1XT9B 1FXAA 2OOBB 4XWWA 3NJTA 2K8CA 1RRBA 2C9WB 3ZVVA 4PS7A 3HIZA 3QA8A 1VD2A 2PE9A 1P98A 4FA6A 2GB1A 3PZDA 1V8CA 4RF1A 3L4PA 3UQBA 1EWCA 3HVDA 2CU3A 2FCMA 1WX8A 3PVLA 2QC8A 3GB1A 2LXAA 3A1QB 2Y3AA 3RCZA 3ZTCA 1WYGA 4WWOA 1E9MA 4AWJA 1MPEA 3VRBB 2D10A 1MI0A 3Q3OC 2BS3B 2XK5B 4W9LA 2RPQA 4LJPB 3BK2A 3ZXVA 1HTOA 2FIFA 1ZPSA 2RSUA 2C5LC 3DHHC 3C19A 4ICVA 3TEYA 5AZGA 1J8CA 2NTTA 3TL5A 1FRRA 4AOFA 4DHZE 4LNNA 1V5OA 4NQKE 2BB5A 1GC7A 2NPTA 2DZMA 3AH7A 1D5ZC 4CHKA 2RDHA 4WJNA 4K7WA 3LB8C 3M62B 1XD3B 2FNJB 4DDGD 3VFKA 4K81A 5JHAA 3GOEA 2NBVB 1L6VA 3AMZA 4P6VF 4ZYSA 1VR9A 4ARCA 4H2AA 2LHEA 4GXBA 1M4VA 4JPSA 2KDBA 4GB9A 4AUQC 3P42A 4C7ZA 1VZ6A 2KNBA 1VRAB 1SB3C 4BVUC 1E8WA 2KANA 5DPTA 2PTLA 1F52A 2CU1A 4JX1C 2L00B 4P7IA 2DYOA 3IAS1 2W9NA 3N1ZC 4RGOS 3W2DA 4K1RB 5IP4D 3RNAC 2JY6A 3ZO5B 3GZNI 5JH5C 3VTWA 1I4XA 4MEMA 4AP4C 1WJNA 4WJQA 3SHQA 4E3CA 1N61A 4A3PA 1JALA 2BQQA 3JSVA 2MJ3A 1L5PA 2CJNA 2L76A 4K7UA 2BW2A 3PREA 1ROEA 2H89B 4WH4A 2QCZA 5E6PA 1N5XA 3ZNGC 2REXA 4MM3A 1RLFA 5TR5A 1TS2A 2ZW1A 4HPLB 2L7RA 1J7CA 1V1OA 3Q6BA 3QCAA 5BYRA 2MWSB 1GPXA 1N62A 4F7ZA 5C23A 1Q1OA 1L4DB 3OAWA 5DPWA 1IGCA 3MC8A 2HJ1A 1FCLA 1P0RA 5IOIA 1WXMA 1OQRA 3EGRA 4ZHOA 1WM2A 2WXNA 3ZKJC 2OJWA 1UELA 1F0ZA 3PHXB 1C1YB 2WXMA 3ZRCA 2WDQB 3N9YC 3ETRA 4KZCA 1ESFA 2L32A 3V6EB 5BMHA 1ISNA 5HKHA 1WYWB 2W55A 4W9EA 1XCQL 1VJKA 3KLSX 4PS3A 4G0NB 1TJEA 4BBNC 4YTMB 1YIWA 3WANA 3OLMD 4EKUA 2K22A 1LQBA 2BGFA 2JQRB 3TIXA 4KSKC 4UDUC 3SD5A 3PV1A 3PGEA 1NBFC 3DVNV 1PDXA 3ALBA 2J4XA 5BYQA 4WAAA 2KDEB 4MELA 3DDCB 3ZLZA 1RFKA 2JSVX 2EKEC 5LNK1 1S3SG 1QOAA 2AQ2B 3HHMA 1H8CA 3IHPC 2NVUI 1OQQA 3U52E 2BKRB 3AI5A 4IM0A 1KLGD 3VAWA 2YLMA 3H9DA 1WI0A 2IGHA 4DXFA 1ZDXA 1AN8A 2GOWA 4A20A 1WGHA 3P4QB 5LXHA 1J0GA 2IZVB 3H6NA 1KLUD 2UWQA 3AV8A 3Q8EA 5HHDG 4JGHB 1YQ3B 2WXOA 3R3MA 4ARIA 2Y5PA 3QWZB 4C7YA 4CO7A 1TKYA 5JZEB 1KTKA 4N9F4 2WQYB 5IA7A 2M1MA 3C0RB 3BK1A 3UIOB 2G9HD 5E6OA 4MM3B 2MX2A 1KLVA 4ANVA 1VCBA 3VUWA 2J0KA 2LUEA 5J18A 1GOZA 1YX5B 3VRAB 3NZ3A 4WURA 2KD0A 2MLBA 1FNUA 2ZPYA 3BY4B 2ACZB 2ZNVC 1XLNA 3ZNZB 4L2YA 3ZQ4A 2M56B 4AJWA 1QZEA 1TS4A 1WZ0A 4W9HA 1YJJA 1PQSA 4FXCA 2LUMA 1Z5SB 3AE5B 4LNFA 2ICIA 4KIKA 4ZRPA 3KWVA 4RNAA 1F1HA 1WF9A 1IPGA 3VDZA 2KQSA 2WXIA 3BYTB 4US9A 1ZXHA 4LLGM 2DX5B 3ZXRA 3PLUA 4BZAA 2MP2A 1KH0A 1ZUD2 4XE0A 2GRIA 1B1ZA 1JRPA 1TTNA 4W9FA 2KWUB 1JWBD 1FNVA 3CMMB 1H7XA 5DPRA 3SDLC 2V3NA 2KX3A 1CK1A 3IG3A 4DWFA 4NQLB 1UGJA 3DOWA 3T3NA 4WIPA 3AM9A 5AZFA 3O13A 4B9KA 2WLBA 1I4QA 4OW0A 2BTEA 3AE4B 5C3JB 2FAZA 1XLPA 1D3ZA 4TQ0A 1C4AA 4OZBA 3BINA 4EUTA 3ENEA 1UD7A 1ZE3D 2PIAA 2Y5CA 2KDFB 2N9KA 1E90A 3WAOA 4Q2JA 1UWXA 3WALA 4B0MA 3R8BA 4LTUA 2BB6A 3CSFA 1WGDA 5G5HA 3Q2AC 4J3OD 3DPDA 2KACA 3A33B 4OHJA 4ZRIA 1VZ8A 2NTSA 3IFWB 3BVZA 2MH7A 2JZ3B 1T0RC 1V80A 2KN5A 3CSTA 1SJHD 3NOBA 2QEJC 3E9SA 3MP9A 3PTFC 4OZAA 3DWMA 3TMPB 1P7EA 4MACA 1JWUD 1FCCC 3TJPA 1WE7A 1I4HA 1YN4A 3ZJUA 1UF0A 1P3QU 3DBLI 3FILB 4LNKA 5EE1A 3B08A 1SIFA 1JW9D 2ZW0A 5J17A 2CS4A 2VH2A 2B3AA 1FEHA 5G55A 1TKEA 1RFAA 1ZDVA 4RCOA 2RGFA 3WA0A 1DYQA 3ZIMA 3V05A 2JXTA 2DBYA 2EELA 3CWIA 3A9KB 1WGKA 3ML9A 2LGXA 3JVZX 1GUAB 4HJKA 4URKA 4BKTA 2WXKA 3HUIA 1NYQA 2MSED 1SE3A 1EM7A 1H7WA 1L4ZB 1SSNA 2IGDA 1KFYB 4HJGE 4DBGA 5LLIA 2MQJA 4EFOA 3P4PB 2H88B 4GOCA 2MP2B 1NI3A 1PYWD 4HWIB 4OZCA 4G50A 4II3B 3HM6X 4X57B 3MC0B 3VUYA 4FN2A 1N63A 3KWLA 2K1FA 1GC6A 4S17A 3Q8CA 4RGMA 4NPNA 1BT0A 1YQ4B 3R7QA 4A9AA 2N4FA 1KJTA 2JYEA 3X0WA 4KZ0A 1K52A 4JLCA 4RMAA 3CIRB 3AE2B 1XQQA 3L16A 1FIQA 1JWAD 2E3TA 2VRRB 3APCA 1E8YA 4RM8A 2ZPNA 3RUIB 4IOIE 3UINB 2UU7A 1Y56A 1X1MA 5IN7A 2DENB 1M94A 2ZVNA 2CKHB 3T3OA 4XYCA 2OJRA 1MFWA 3K9PB 2BT6A 4NZLB 4ZRQA 3AN1A 2A4ZA 4REZA 2LWPA 2LEKA 1WM3A 4IWPA 3NVZA 3H7PA 2KJ6A 4WJPA 1NI2A 1FXTB 4KX6B 3VTUA 1ET6A 1RAXA 2LD9A 4FHJA 1KF6B 2LHDA 4A8XC 2KOXA 2YEPB 1KRHA 3KUDB 2AL3A 4ACFA 3R2IA 3B2FA 1JWMD 4IUMB 2L3ZA 2M8SA 2RPVA 4N59A 2KXJA 2K39A 1UWMA 4CQNA 3APDA 1I7HA 1EO6A 2K5PA 4HCPB 4ITKA 3AE9B 3QARA 4KDLB 5CHVC 2KX0A 3AEFB 3AU5A 1MHHE 2IO2B 3T8MA 4DHZB 3AE7B 1FXIA 2RDBC 1HZ6A 3RMKC 4M01A 3GE3C 4PYUA 1WR1A 1FNWA 2HJ8A 2MJDA 1WIAA 2K6DB 5D6JB 3L54A 4NJ7A 4MGYE 3B2GA 3PZ8A 4KGSA 2JVCA 3A9JB 2IY0B 3PSEB 3AXCA 1WSPA 3N1YC 4MH8A 4W9KA 5D94A 3L10B 3IT6B 4XWTA 4M8NA 1WZ3A 1BXTA 2KWCA 2PLPA 3GP7A 3W9CB 3X23A 1NYRA 2MBOA 2DZKA 3DWGC 2R2OA 3MC9A 2V9HA 1CZPA 2V4LA 1XF5L 3Q69A 3AE3B 2L1AA 1AW7A 1QLBB 5H92C 2VZKB 4BBNF 1C3TA 1L0XB 1E7VA 4IW0A 2BBCA 2IO0B 2WNMA 1RYJA 4B0EA 5EE3A 4FULA 2BWFA 1JCKB 1T5XD 4AJYB 4ZDVA 1Z2MA 2PKOA 1C77A 1QILA 2O2VA 1FRDA 3MHSD 2V1YA 4GGQA 3W5VB 2D3AA 4BOZB 1I35A 2A5UA 2RDGA 1OEYA 1WJ6A 3AE8B 3FAHA 1WX7A 2K25A 1JROA 4LDTB 3NZSA 3DBHI 4CYEA 1K8RB 1FO4A 3ML8A 2V3PA 3BVGA 3H7PB 1HTQA 1K53A 2C60A 3SEBA 1GTEA 4I6LB 3MJWA 1IUEA 4NAWA 2AQ3B 3W1SC 4N6EB 3QK0A 4MGKE 3ZNHB 2QMTA 4AQ7A 5JHBA 1EU3A 3VTVA 4BFRA 2LRUA 3QX1A 1BUIC 4LCDE 3AEGB 1SF0A 2JRHA 3V6CB 2LGYA 2PW9A 3RD2A 2BYEA 1WMHB 2IDYA 2DWQA 3A4SC 2GBJA 1Q10A 1XEEA 4MDKE 4FHKA 2YVCA 2Z0DB 2D11A 3OJ4B 1MHXA 3CF6E 2WXPA 3EC8A 1DOYA 1N5WA 3Q3MC 2SAKA 3VXWA 3N32A 4KKJA 1LGRA 1FMAD 4FJZA 4IWOA 3QJZA 2VH1A 1SXTA 1WRDB 2BVCA 2RMMA 1YN5A 2ZNVB 2WWZA 1HE8A 1DOXA 3M3JA 1MG8A 2K9XA 2FCNA 2GBMA 3V62A 5AZHA 4YTPB 4USAA 1TYGB 4FBJB 1OTRB 2WYQA 3BWUD 3GZNB 3ZRFA 2L8JA 1C76A 2HDEA 4DDID 1WXQA 2O6VA 1I4PA 3ZW3A 2R61A 4MSQB 2L83A 5BMIA 1E5WA 4GN1A 3NRZA 1YJ1A 3W5UB 5C1ZA 1NVID 3V61A 1TY0A 2GI9A 4TQ1A 4XX5A 1ZGUB 1UZXB 4DQOC 3I57A 2O2VB 2CR5A 4II2B 4XDCA 5EE0A 2WXLA 4R3DA 2KDIA 3U7DA 1SE9A 1K51A 3KW5B 3HK0A 3L0WB 3P2BA 2JYTA 1V5TA 4HVBA 3AB5A 2KJHB 1GG3A 4KGTA 3KYDD 4ASWC 1AARA 5IKCM 2KT7A 1OQYA 2JXXA 3MHZA 3NVWA 2BS2B 3VR9B 1WR6E 1PUTA 2KMMA 3SFDB 1L0VB 2M17A 4L1BA 2DYMA 2INNE 3EA6A 1D6EC 2PVOD 5DPSA 4L23A 3RN9C 4NAWB 1TY2A 3FILA 1YJIA 3AECB 4KV2A 1SGHA 4B6WA 3V60A 1IP9A 3I63C 3RULA 2MHJA 1ZW7A 3UF8A 2G4DB 3IBEA 2PMVA 2Z0EB 4WWNA 3A9KA 2ONQA 5HG2A 1UUPA 3N30A 2WXHA 2L52A 1ZKHA 1T0SC 4FJYA 3JYUA 2MEKA 4F1SA 4HKZE 2D07B 4EOYA 3L17A 1YQBA 4LJOB 3TSSA 3FC4A 4EEWA 2WS3B 2LGSA 2IO3B 3TCAA 5MPOA 4OVVA 2KDMA 4ANWA 3I5JC 4RGNA 1KOTA 2WDRB 3BIID 4C80A 1CMXB 4ZOHC 5CX3A 1Y8RC 4FADA 2DAFA 3L08A 2EKIA 4BKGA 2BF8B 2HTME 1GB1A 2GBKA 3OWEB 4OVUA 4MJSA 1F77A 4W9CA 2BWES 2GLSA 1EWYC 1IYFA 3WAMA 2LMCA 3ZJTA 2EMSA 3WCQA 3QIJA 2LVQA 4W9GA 4DHJB 2LI5A 2O6VB 4IC7B 2WP9B 3PZ7A 2WXFA 2LVOA 3ZYYX 1V86A 2FUHB 4JWSC 3QC8B 3NVYA 2ZCBA 3EFCA 3OJ3A 1YD8U 4P16A 5L95C 4KSLC 1YX6B 1CQVA 4IDIA 4DHJD 2NR2A 5E6JA 3H1UA 2I38A 3NZUA 4A6QA 3ZGZA 1TT5B 2NMQA 2N9EB 5G5GA 2AEHA 3UGBB 2N0SB 2KC1A 2BS4B 3N1XC 3U30A 5C2TB 5IO9A 5HFYA 3VH4B 1G6JA 3MJ5A 3QQ8B 1PGAA 2IO1B 2JX5A 1WH3A 1FFVA 4MSMB 4YSZB 4W9IA 2M19A 4KKIA 4ZHPA 1C9FA 1ZXIA 3BYYB 5GMVA 2KN4A 1XLQA 2GMIC 1WGGA 2DZIA 1C4CA 3AU4A 4BKSA 3W1SA 4K7SA 4TSSA 5H8YE 1QF6A 1IBXA 4EZJA 2N9PC 5AEKB 4YL8A 4HKQA 3BVMA 4D2KA 1JWSD 5D2MB 4WQMA 3PRPB 2KQ4X 1E6EB 3KYCD 1SE4A 3A9JA 2I1KA 5LXIB 2KLGA 2CHXA 5DCNA 2WDTB 2WXQA 4DK5A 3KVFB 4YSXB 2L0TA 2J0MA 4RFBA 4EZKA 5EE9A 4TMAB 1CJEA 1V1PA 3SU8X 1WE6A 1STEA 3GS2A 4FJVB 4N58A 4S0RA 2MBEA 1NDDA 4FLHA 4GDKB 1E7PB 2JWUA 3DHIC 1QQRA 1F2RI 3VUXA 1ET9A 2IGGA 3DVNU 4MJSB 1EU4A 2JU6X 1P1AA 2QSDA 2DNFA 3NHEB 2HD5B 3P4RB 2Z8LA 2WDVB 4RH6A 1MVKA 4W9JA 3I9V1 2LRWA 1HZ5A 2AL6A 3RNFC 1H4RA 2I1JA 2CHZA 4O1NA 4P1CC 2QIEB 1L6UA 5D3IB 3RNEC 1ACCA 2N7EA 1GNUA 2D2QA 2WGSA 3RYTA 1R7SA 4A55A 1I4GA 1WY8A 3ZNID 1SJED 4MT5A 1C79A 4I6PA 1QOGA 3DBLB 1DGJA 2MJEA 4HRSA 1V6EA 2XEWA 2RR9A 4NY0A 2KTRA 2KJRA 3IXSA 1I4RA 3W1YA 2JUOA 2LGDA 5EDSA 2KK8A 4A90A 1N6ZA 2ZCCA 3Q3JA 3EFUA 2L0FA 4IWQA 2ZJDA 3UQAA 2YEPF 1L2NA 2LXCA 2D3GA 1V2YA 3O65B 1HXYD 5CHWA 2MCNB 1WMHA 4NJ6A 1K50A 2LJIA 4RF0A 1T0YA 2NBWB 3RFZB 1JRUA 3LJ3A 4YXDB 2KVZA 1E7UA 3VQIA 2FCSA 1WXSA 3AEEB 2M0AA 3KQ4A 4WWPA 3MFGA 4LK0M 1UGMA 1IBXB 4M8MA 1T3QA 2FCQA 1TZOA 3AE6B 3LXFA 1PFDA 2OEDA 4YT0B 5KHQA 3Q8FA 3PPAA 2KHWB 3NVVA 2C7NB 2J7QB 3H8HA 1Q5WB 2LGIA 1GAQB 1V81A 1XXGA 2WX0A 4C4VA 2Z59B 2XBBC 2JZZA 4LNIA 3KUZA 2ON8A 1A70A 4ZRJA 4JIOU 3HVZA 3VH3B 1V1PB 4RM9A 4BKSD 2PVGC 3MTNB 2C7HA 1U4AA 3IT4B 2INPE 2I2YA 3CF4A 1FPYA 4M00A 1UBIA 3AEBB 1VZ7A 4ZYNA 2KLCA 5FKAC 3RNBC 3ZJVA 1SIJA 2JRIB 2KKCA 3DBRI 4HEA1 3Q3FA 3RNGC 2AQ1B 3U2SC 3TEZA 3ZUNA 2JF5A 4NJCA 1J19A 4DXGA 2W82A 1BMLC 3LYYA 3EHVA 1ZOYB 2JZPA 2PE6B 2R2QA 4RGTA 2PEAA 4GLSC 3U8ZA 4GDLA 5J2RA 4JQWC 3K9OB 1JMLA 1TZ1A 2VZKD 2NCNA 1WRIA 4PS8A 4WAFA 4LNOA 1WXAA 4JE3B 3PRZA 4HPMB 2N1WA 3E56A 1RM6C 4IM3A 1L0YB 5BO4B 2QHOA 2D3CA 1D4BA 2KTRB 3PS6A 3P1MA 2KTFA 2XNAC 2M0XA 3RZFA 4BOSC 1LO5D 3RZWC 2INCC 1OFFA 2V3SA 5BMGA 1MJDA 1F2RC 4TKNA 2MA9B 3BZDB 2KFKA 2FIDA 1QOFA 2UYZB 4BAXA 4PK1A 2G3QB 4GSWA 1HA5A 1QKZA 2D5GA 4LDTD 3Q3NC 2E6XA
chains in the Genus database with same CATH topology
4MACA 1JWUD 2Y3AA 1FCCC 1D5MC 1ENFA 1I4HA 1YN4A 5T8IA 1WYGA 3ZJUA 3FILB 3J9CA 1E9MA 5EE1A 1MPEA 3VRBB 2PMVA 1MI0A 2BS3B 1JW9D 1QT9A 2ZW0A 2ONQA 1B9RA 4M0WA 5HG2A 1FEHA 1UUPA 4WWMA 3BK2A 1TKEA 1ZDVA 4RCOA 1ZPSA 2WXHA 2SEBD 2L52A 1DYQA 4HROA 3V05A 2JXTA 2MEKA 2DBYA 2EELA 2WU5B 3CWIA 1WGKA 3TEYA 4HKZE 3TSSA 3FC4A 2WS3B 2NTTA 1VDVA 1FRRA 5MPOA 3AEAB 2WXKA 3HUIA 2KDMA 1NYQA 1SE3A 4RGNA 2BB5A 2WDRB 1EM7A 1H7WA 3BIID 1L4ZB 1SSNA 1NENB 2IGDA 2K3UA 4C80A 1KFYB 4HJGE 3AH7A 4ZOHC 1D5ZC 2RDHA 3P4PB 2H88B 2EKIA 1IGDA 3LB8C 3U4EG 2HTME 1GB1A 1NI3A 1PYWD 3TEWA 4OZCA 2LFIA 5D7GA 3OWEB 1F77A 1L6VA 3AMZA 3MC0B 3R2TA 4P6VF 1EWYC 1VR9A 4ZYSA 1DOIA 1N63A 3KWLA 4ARCA 1FD6A 4H2AA 2LMCA 2LHEA 1UNSA 3ZJTA 1AYFA 1M4VA 3P63A 3Q8CA 4JPSA 3WCQA 4RGMA 1YQ4B 4A9AA 5JXVA 2JYEA 3P42A 4C7ZA 1K52A 2WP9B 1VZ6A 3CIRB 3AE2B 3PZ7A 1FIQA 1PGBA 1VRAB 1SB3C 2WXFA 1JWAD 1XLOA 2E3TA 3ZYYX 3P4SB 2PTLA 3B9JA 4JX1C 4JWSC 3NVYA 4YWGG 4IOIE 1N60A 1Y56A 2DYOA 4P16A 3IAS1 2WXJA 4RGOS 3W2DA 3T3OA 2J52A 1CQVA 1FM0D 4IDIA 2E6XA 4GDLB 2BT6A 4NZLB 1I4XA 4ZRQA 5E6JA 3AN1A 4REZA 2I38A 3SFEB 4A6QA 1N61A 2QILA 2LEKA 1JALA 5D3DA 3ZGZA 1TS3A 1PGXA 2MJ3A 2NMQA 3NVZA 1L5PA 2CJNA 2BW2A 4KX6B 1ROEA 2H89B 4NAMA 4WH4A 1ET6A 5G5GA 2N0SB 4YSYB 2FUG1 2BS4B 1N5XA 1KF6B 2W3RA 2LHDA 4A8XC 5C2TB 2YEPB 5HFYA 1SBBB 1V97A 1KRHA 1TS2A 1JQ4A 2ZW1A 3R2IA 1J7CA 3MJ5A 1PGAA 3B2FA 1V1OA 1JWMD 5BYRA 2JX5A 2KWDA 4N59A 2RPVA 1GPXA 1FFVA 1UWMA 1N62A 1FFUA 4CQNA 4YSZB 2TSSA 1I7HA 2M19A 4KKIA 4ZHPA 3Q8AA 1C9FA 1SEBD 1ZXIA 1L4DB 3BYYB 2J53A 2K5PA 1IGCA 2KN4A 3AE1B 1XLQA 4ITKA 3AE9B 1FCLA 1TS5A 1C4CA 3AEFB 3W1SA 1OQRA 3EGRA 4TSSA 5FK9C 5H8YE 4ZHOA 1QF6A 1IBXA 2WXNA 1MHHE 1F0ZA 3AE7B 1FXIA 2WXMA 3BVMA 4HKQA 4D2KA 1HZ6A 2WDQB 1JWSD 1ZP0B 3ETRA 3N9YC 4WQMA 1ESFA 1YMHE 4US8A 2L32A 1FNWA 2KQ4X 5BMHA 1E6EB 2MJDA 1J7AA 1SE4A 2W55A 4EE2A 1XCQL 1VLBA 3EUB2 3TUOA 1VJKA 3KLSX 2WXQA 3UI3A 4YSXB 2V4IB 1TJEA 4YTMB 3B2GA 3PZ8A 3RPFC 4KGSA 3V3XA 4RFBA 2K22A 2JQRB 5EE9A 4TMAB 1CJEA 4UDUC 4PT5A 1GT8A 1V1PA 1STEA 1WSPA 3GS2A 4MH8A 4N58A 3IT6B 4XWTA 1BXTA 1PDXA 4KGRA 2J4XA 2PLPA 3GP7A 4AS1A 3W9CB 2AX5A 4GDKB 1NYRA 1E7PB 5BYQA 2JWUA 1YNTE 1QQRA 1F2RI 3DWGC 1ET9A 1CZPA 1RFKA 2JSVX 1XF5L 3PO0A 3Q69A 2IGGA 1EU4A 2JU6X 3AE3B 2L1AA 5LNK1 1AW7A 1QOAA 1QLBB 2AQ2B 2QSDA 2G1EA 5H92C 3U7ZA 2VZKB 1L0XB 1OQQA 3P4RB 2BBCA 2WNMA 2WDVB 2CJOA 2Z8LA 3U52E 4RH6A 2J42A 3SR6A 3TEXA 3URYA 1RYJA 1MVKA 2IJ0A 3I9V1 4B0EA 5EE3A 2W3SA 2WXGA 1HZ5A 1JCKB 1KLGD 1T5XD 3IAM1 2N9LA 2PKOA 1C77A 1QILA 4O1NA 1FRDA 2QIEB 2IGHA 1L6UA 5D3IB 4DXFA 2DLBA 1ACCA 1ZDXA 1AN8A 3W5VB 4YTNB 3P4QB 1R7SA 4A55A 1I4GA 2RDGA 3NUHB 1SJED 1KLUD 3AV8A 3Q8EA 5HHDG 3AE8B 1YQ3B 4MT5A 1C79A 2BYTA 2WXOA 3FAHA 5AUIA 1E0ZA 2FBWB 1QOGA 1DGJA 2MJEA 4HRSA 4ARIA 3ABVB 3C8YA 1JROA 2Y5PA 3IXSA 4C7YA 1I4RA 2WXRA 1TKYA 2FE8A 1FO4A 1KTKA 2V3PA 1XCTL 1NEKB 3BVGA 2WQYB 4A90A 2X38A 1K53A 3SEBA 1GTEA 2YEPF 3BK1A 1IUEA 2G9HD 2AQ3B 1J7BA 1GB4A 4N6EB 4MM3B 5I4DA 2N7JA 1C4PA 2QMTA 4AQ7A 1GOZA 1EU3A 1E10A 3HRDD 3VRAB 1HXYD 3NZ3A 4WURA 1D5XC 4JWUC 1FNUA 1K50A 2LJIA 1XO3A 4RF0A 1BUIC 3RFZB 3AEGB 2ACZB 1SF0A 1XLNA 2WU2B 4YXDB 3VQIA 2PW9A 4L2YA 1QOBA 2K0PA 3ZQ4A 2M56B 2IDYA 2DWQA 2OHFA 3AEEB 1Q10A 1TS4A 1XEEA 2M0AA 1WWTA 3KQ4A 4C56C 1RWSA 3MFGA 2QJLA 4LK0M 1IBXB 1YJJA 1MHXA 4FXCA 1T3QA 2V0GA 1TZOA 5HI1A 2LUMA 2WXPA 5FR3A 1DOYA 3AE6B 3AE5B 1N5WA 3LXFA 2ICIA 1PFDA 2OEDA 4YT0B 3Q8FA 3KWVA 2SAKA 4ZRPA 4RNAA 4KKJA 3NVVA 1HEZE 1FMAD 3H8HA 1SXTA 2LGIA 1AWDA 2RMMA 1GAQB 1YN5A 1XXGA 2WXIA 3BYTB 4US9A 1ZXHA 4LLGM 3AEDB 2KAJA 2ON8A 1DOXA 1A70A 4XDDA 2K9XA 1HQRD 1KH0A 1ZUD2 3HVZA 4YTPB 4XE0A 4IKGA 2GRIA 1V1PB 1B1ZA 1JRPA 4USAA 1TYGB 2PVGC 1JWBD 1FNVA 3IT4B 3BWUD 2INPE 2I2YA 1H7XA 3CF4A 3VR8B 2Q5WD 2B76B 1YN3A 3AEBB 1VZ7A 5GXGB 2V3NA 1CK1A 1C76A 2HDEA 5FKAC 5BYSA 3ZJVA 1WXQA 3Q8BA 4OVZA 1SIJA 1I4PA 1TKGA 2R61A 1UGJA 3T3NA 4HEA1 2L83A 5BMIA 2AQ1B 3AM9A 4WIPA 3O13A 3U2SC 2WLBA 3NRZA 1I4QA 3TEZA 4NJCA 3W5UB 5AUKA 2W54A 1NVID 4OW0A 1P7FA 4DXGA 2BTEA 2W82A 3AE4B 1TY0A 5C3JB 1BMLC 1XLPA 2GI9A 3LYYA 4TQ1A 1ZOYB 2JZPA 4TQ0A 1C4AA 4OZBA 4DQOC 3I57A 1GTHA 1C78A 2IPKD 5TSSA 2XN9C 4RGTA 4XDCA 3NS1A 1ZE3D 5EE0A 2PIAA 2Y5CA 4GLSC 2N9KA 2WXLA 4R3DA 1JMLA 1T6BX 2VZKD 1WRIA 1K51A 4Q2JA 1SE2A 4WAFA 2JYTA 4JE3B 3AB5A 1FXAA 1UWXA 4B0MA 4XWWA 4KGTA 3R8BA 3E56A 1RM6C 1L0YB 4LTUA 3MHZA 2BB6A 3NVWA 5G5HA 1D4BA 2BS2B 3VR9B 4J3OD 3P1MA 1PUTA 2KACA 2KMMA 3SFDB 2XNAC 4OHJA 1L0VB 4L1BA 1LO5D 1VZ8A 2DYMA 1OFFA 2NTSA 2GB1A 5BMGA 1V8CA 4RF1A 3L4PA 2MH7A 3BVZA 1EWCA 2INNE 3EA6A 3HVDA 1D6EC 2PVOD 1F2RC 1SJHD 3BZDB 2CU3A 1QOFA 2QEJC 4L23A 4NAWB 1TY2A 3FILA 3E9SA 1HA5A 1QKZA 3MP9A 2D5GA 3GB1A 4OZAA 1YJIA 3DWMA 3AECB 1P7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1E A;  1AWD A;  1GAQ B;  3AN1 A;  3SFE B;  1OQQ A;  3P4R B;  1N61 A;  4US9 A;  2WDV B;  2CJO A;  1WYG A;  1JAL A;  2LEK A;  3SR6 A;  1E9M A;  1RYJ A;  5EE1 A;  3AED B;  2KAJ A;  2MJ3 A;  3NVZ A;  1L5P A;  2CJN A;  2W3S A;  3VRB B;  5EE3 A;  4KX6 B;  1ROE A;  2H89 B;  1QOA A;  1A70 A;  1DOX A;  2BS3 B;  2K9X A;  1JW9 D;  1QT9 A;  5G5G A;  2N0S B;  1ZUD 2;  4YSY B;  3HVZ A;  4YTP B;  2PKO A;  1B9R A;  2BS4 B;  4WWM A;  1JRP A;  1N5X A;  1KF6 B;  1TKE A;  1TYG B;  2W3R A;  3DWM A;  4USA A;  2PVG C;  1FRD A;  1JWB D;  2QIE B;  1L6U A;  5C2T B;  3W5V B;  2L52 A;  4YTN B;  1V97 A;  1KRH A;  4HRO A;  1H7X A;  3CF4 A;  3VR8 B;  3P4Q B;  2B76 B;  2Q5W D;  1R7S A;  2BT6 A;  1JQ4 A;  2DBY A;  3AEB B;  1J7C A;  2WU5 B;  3B2F A;  3CWI A;  1WGK A;  3AV8 A;  2JX5 A;  5GXG B;  3AE8 B;  1YQ3 B;  4N59 A;  1GPX A;  1WXQ A;  3FAH A;  1FFV A;  1UWM A;  1N62 A;  3FC4 A;  2WS3 B;  1FFU A;  5AUI A;  2FBW B;  4YSZ B;  1E0Z A;  1I7H A;  1SIJ A;  2M19 A;  1VDV A;  1FRR A;  1QOG A;  1TKG A;  3AEA B;  1DGJ A;  2MJE A;  3HUI A;  4HRS A;  4ZHP A;  1ZXI A;  3ABV B;  1NYQ A;  1JRO A;  2K5P A;  2L83 A;  3AE1 B;  3AM9 A;  2WDR B;  2WLB A;  1H7W A;  1XLQ A;  3NRZ A;  3BII D;  4ITK A;  3AE9 B;  1NEN B;  4C7Y A;  3W5U B;  4C80 A;  5AUK A;  1KFY B;  2W54 A;  3AH7 A;  1NVI D;  1TKY A;  4ZOH C;  1FO4 A;  3AEF B;  1NEK B;  3AE4 B;  5C3J B;  2WQY B;  1OQR A;  5H8Y E;  3P4P B;  4ZHO A;  1QF6 A;  2H88 B;  1XLP A;  2EKI A;  3LB8 C;  1ZOY B;  2HTM E;  1F0Z A;  3AE7 B;  1NI3 A;  1GTE A;  1FXI A;  1IUE A;  5MPO A;  1GTH A;  2WDQ B;  1ZP0 B;  3ETR A;  4WQM A;  3NS1 A;  5EE0 A;  1J7B A;  2PIA A;  2Y5C A;  4N6E B;  3AMZ A;  1L6V A;  4US8 A;  4P6V F;  1EWY C;  1DOI A;  1N63 A;  3KWL A;  1E6E B;  2MJD A;  1J7A A;  1WRI A;  2W55 A;  1AYF A;  3P63 A;  3HRD D;  3VRA B;  3EUB 2;  1VLB A;  3WCQ A;  1E10 A;  1VJK A;  1YQ4 B;  4A9A A;  4JWU C;  4YSX B;  3AB5 A;  1TJE A;  1XO3 A;  1FXA A;  4YTM B;  4C7Z A;  2WP9 B;  3B2G A;  3RPF C;  3CIR B;  3AE2 B;  3AEG B;  1RM6 C;  1FIQ A;  2K22 A;  2ACZ B;  1SF0 A;  1SB3 C;  1JWA D;  1XLO A;  1XLN A;  2JQR B;  2E3T A;  2WU2 B;  3NVW A;  4YXD B;  1CJE A;  4LTU A;  5EE9 A;  5G5H A;  1GT8 A;  2BS2 B;  3VR9 B;  3ZYY X;  3P4S B;  3P1M A;  1PUT A;  2KMM A;  1QOB A;  3B9J A;  2M56 B;  3SFD B;  4N58 A;  2DWQ A;  2OHF A;  1L0V B;  3AEE B;  4JWS C;  4JX1 C;  3NVY A;  1WWT A;  1RWS A;  2QJL A;  1OFF A;  1PDX A;  1N60 A;  1YJJ A;  1V8C A;  3L4P A;  2MH7 A;  1T3Q A;  2AX5 A;  4FXC A;  1NYR A;  1E7P B;  3W9C B;  2PVO D;  1DOY A;  2CU3 A;  3DWG C;  3AE6 B;  3AE5 B;  1N5W A;  1QOF A;  3LXF A;  1CZP A;  1PFD A;  1RFK A;  4YT0 B;  3PO0 A;  1FM0 D;  4IDI A;  3AE3 B;  3NVV A;  1YJI A;  1FMA D;  1QLB B;  3AEC B;  5H92 C; 
#chains in the Genus database with same CATH topology
 4MGZ E;  2J0J A;  3DBS A;  1D5M C;  2C7M B;  1ENF A;  4JL9 A;  3M95 A;  5T8I A;  3J9C A;  1WJU A;  1QT9 A;  1B9R A;  4M0W A;  4WWM A;  2BKF A;  2ASQ A;  2BYV E;  2SEB D;  2LJ5 A;  4HRO A;  2D3B A;  2WU5 B;  2AWT A;  4A3O A;  2NS5 A;  1VDV A;  3AEA B;  3N3K B;  2HTH A;  3DBR B;  1TIF A;  4GMV A;  1S1Q B;  2WHI A;  4C4V B;  1NEN B;  2K3U A;  3KH0 A;  4ANX A;  3B0A A;  1IGD A;  3U4E G;  3TEW A;  2KQ7 A;  2NPT B;  2QDF A;  2LFI A;  5D7G A;  3R2T A;  1DOI A;  1KM7 A;  1FD6 A;  1UNS A;  1AYF A;  1T0Q C;  3P63 A;  4G3X B;  2M4N A;  3DBH B;  5JXV A;  3LDZ E;  4K3B A;  5KHO A;  3RI7 C;  1PGB A;  4TV3 A;  1XLO A;  2ZZP B;  3ONS A;  3P4S B;  2K8B A;  4W9D A;  4WJO A;  3B9J A;  4ICU A;  4P1B C;  2JT4 B;  4YWG G;  2KWV B;  3D32 A;  2DZJ A;  1N60 A;  1TGZ B;  3M63 B;  3EEC A;  2WXJ A;  1TBE A;  2DYB A;  3DVG X;  2J52 A;  1WGR A;  1FM0 D;  4GDL B;  2KMA A;  2KVR A;  2ZEQ A;  2Y5B B;  1V9J A;  3SFE B;  1GJZ A;  2QIL A;  1LXD A;  5D3D A;  1TS3 A;  1PGX A;  3I3T B;  1MG4 A;  4NAM A;  2JPH A;  2EMT A;  1WXV A;  4HPP A;  2G4S A;  4YSY B;  4B95 A;  2FUG 1;  2W3R A;  3JSV B;  3KUC B;  1I42 A;  1SBB B;  1V97 A;  3QHT A;  1JQ4 A;  2DAJ A;  2KWD A;  2KFK B;  1WFY A;  3VVW B;  1FFU A;  2TSS A;  4F8C B;  3Q8A A;  2ZVO A;  1SEB D;  2NBU A;  4DXA B;  2J53 A;  2GBN A;  2MBB B;  3AE1 B;  1OGW A;  4HK2 A;  2AYO B;  4HDO A;  1YOV B;  3NY5 A;  1TS5 A;  4HDQ A;  5FK9 C;  4WQO B;  2DHZ A;  3NS8 A;  4M0W B;  4KVG B;  2IBI B;  1ZP0 B;  5CTR C;  1YMH E;  1WJ4 A;  1EF1 A;  4US8 A;  4HXD A;  1J7A A;  3RT3 B;  2PJH A;  3H7S A;  4EE2 A;  3EUB 2;  1VLB A;  3TUO A;  3ZDM C;  2JWZ A;  2KO3 A;  3UI3 A;  2LAS A;  2HE7 A;  2V4I B;  3DQV A;  3RPF C;  1R4M I;  3V3X A;  3R7R A;  3JW0 X;  3TBL D;  3RNC C;  4GDK A;  4M02 A;  4PT5 A;  1GT8 A;  4NNJ B;  4KGR A;  4AS1 A;  2AX5 A;  4MH0 E;  1YNT E;  4MGI E;  4ZRK A;  2BYF A;  1R4N I;  2N1V A;  4GU2 A;  3PO0 A;  4K3C A;  5IAA C;  2G1E A;  3U7Z A;  2L05 A;  1V49 A;  2CJO A;  4E71 A;  2J42 A;  3SR6 A;  3TEX A;  3URY A;  2LVP A;  2IJ0 A;  2W3S A;  2X8X X;  2WXG A;  2K8H A;  3IAM 1;  4HCN B;  2N9L A;  1UH6 A;  3N20 C;  2BPS A;  3L13 A;  3T9L A;  3HM3 A;  4IG7 B;  4XGA B;  3DVG Y;  2DLB A;  4YTN B;  1EUV B;  1EF5 A;  2IY1 B;  3DCG A;  2G45 B;  3NUH B;  2KYW A;  3PLV A;  3OG5 A;  5L83 A;  2BYT A;  2O6V D;  5AUI A;  1E0Z A;  2FBW B;  4XZ4 A;  3ABV B;  3C8Y A;  3B1L X;  2IND C;  2N7D A;  2WXR A;  1LFD A;  2FE8 A;  3WIM A;  1XCT L;  1NEK B;  3UIP B;  1L7Y A;  2X38 A;  3WAP A;  1WGY A;  4XC2 A;  1J7B A;  1GB4 A;  5I4D A;  2N7J A;  2MBQ A;  1C4P A;  3A1Q A;  1E10 A;  3HRD D;  1D5X C;  2MRP A;  5CHF A;  4JWU C;  3QAQ A;  1XO3 A;  3FKY A;  3R66 C;  1Q0W B;  1R4M B;  1A5R A;  2XK5 A;  4GIV A;  2WU2 B;  1WX9 A;  2KC2 A;  4TUU A;  3DHG C;  1QOB A;  2K0P A;  2OHF A;  4C56 C;  1WWT A;  1RWS A;  2QJL A;  5FR6 A;  2V0G A;  5HI1 A;  5FR3 A;  1UBQ A;  3PRM B;  2MW5 A;  5G2N A;  1R4N B;  3GE8 C;  4IM2 A;  2KMC A;  1HEZ E;  1AWD A;  1P9D U;  3APF A;  4I6N B;  3S2A A;  2N9X A;  4KIK B;  1LM8 B;  3AED B;  2KAJ A;  3Q14 C;  3IVF A;  4XDD A;  1HQR D;  4IKG A;  2WX1 A;  4EZL A;  2IYD B;  3PHW B;  3PT2 B;  3VR8 B;  2Q5W D;  2B76 B;  3VHT C;  1YN3 A;  5GXG B;  5BYS A;  3Q8B A;  4OVZ A;  3ECI A;  2KZR A;  4J6I A;  1TKG A;  4G11 A;  1OEY J;  2K6Q A;  4PYZ A;  2MBH A;  5E6N A;  4QAY A;  4E74 A;  2CHW A;  2RD0 A;  5AUK A;  2W54 A;  4C00 A;  1P7F A;  2KFJ A;  3A4R A;  2LZ6 A;  3AUL A;  1F9J A;  1GTH A;  1C78 A;  2IPK D;  5TSS A;  2XN9 C;  3ZTD A;  1E8Z A;  3NS1 A;  4ANU A;  2GBR A;  4KDI C;  4HLE A;  1T6B X;  3NG0 A;  1E8X A;  1SE2 A;  3ZDT A;  2PPH A;  1XT9 B;  1FXA A;  2OOB B;  4XWW A;  3NJT A;  2K8C A;  1RRB A;  2C9W B;  3ZVV A;  4PS7 A;  3HIZ A;  3QA8 A;  1VD2 A;  2PE9 A;  1P98 A;  4FA6 A;  2GB1 A;  3PZD A;  1V8C A;  4RF1 A;  3L4P A;  3UQB A;  1EWC A;  3HVD A;  2CU3 A;  2FCM A;  1WX8 A;  3PVL A;  2QC8 A;  3GB1 A;  2LXA A;  3A1Q B;  2Y3A A;  3RCZ A;  3ZTC A;  1WYG A;  4WWO A;  1E9M A;  4AWJ A;  1MPE A;  3VRB B;  2D10 A;  1MI0 A;  3Q3O C;  2BS3 B;  2XK5 B;  4W9L A;  2RPQ A;  4LJP B;  3BK2 A;  3ZXV A;  1HTO A;  2FIF A;  1ZPS A;  2RSU A;  2C5L C;  3DHH C;  3C19 A;  4ICV A;  3TEY A;  5AZG A;  1J8C A;  2NTT A;  3TL5 A;  1FRR A;  4AOF A;  4DHZ E;  4LNN A;  1V5O A;  4NQK E;  2BB5 A;  1GC7 A;  2NPT A;  2DZM A;  3AH7 A;  1D5Z C;  4CHK A;  2RDH A;  4WJN A;  4K7W A;  3LB8 C;  3M62 B;  1XD3 B;  2FNJ B;  4DDG D;  3VFK A;  4K81 A;  5JHA A;  3GOE A;  2NBV B;  1L6V A;  3AMZ A;  4P6V F;  4ZYS A;  1VR9 A;  4ARC A;  4H2A A;  2LHE A;  4GXB A;  1M4V A;  4JPS A;  2KDB A;  4GB9 A;  4AUQ C;  3P42 A;  4C7Z A;  1VZ6 A;  2KNB A;  1VRA B;  1SB3 C;  4BVU C;  1E8W A;  2KAN A;  5DPT A;  2PTL A;  1F52 A;  2CU1 A;  4JX1 C;  2L00 B;  4P7I A;  2DYO A;  3IAS 1;  2W9N A;  3N1Z C;  4RGO S;  3W2D A;  4K1R B;  5IP4 D;  3RNA C;  2JY6 A;  3ZO5 B;  3GZN I;  5JH5 C;  3VTW A;  1I4X A;  4MEM A;  4AP4 C;  1WJN A;  4WJQ A;  3SHQ A;  4E3C A;  1N61 A;  4A3P A;  1JAL A;  2BQQ A;  3JSV A;  2MJ3 A;  1L5P A;  2CJN A;  2L76 A;  4K7U A;  2BW2 A;  3PRE A;  1ROE A;  2H89 B;  4WH4 A;  2QCZ A;  5E6P A;  1N5X A;  3ZNG C;  2REX A;  4MM3 A;  1RLF A;  5TR5 A;  1TS2 A;  2ZW1 A;  4HPL B;  2L7R A;  1J7C A;  1V1O A;  3Q6B A;  3QCA A;  5BYR A;  2MWS B;  1GPX A;  1N62 A;  4F7Z A;  5C23 A;  1Q1O A;  1L4D B;  3OAW A;  5DPW A;  1IGC A;  3MC8 A;  2HJ1 A;  1FCL A;  1P0R A;  5IOI A;  1WXM A;  1OQR A;  3EGR A;  4ZHO A;  1WM2 A;  2WXN A;  3ZKJ C;  2OJW A;  1UEL A;  1F0Z A;  3PHX B;  1C1Y B;  2WXM A;  3ZRC A;  2WDQ B;  3N9Y C;  3ETR A;  4KZC A;  1ESF A;  2L32 A;  3V6E B;  5BMH A;  1ISN A;  5HKH A;  1WYW B;  2W55 A;  4W9E A;  1XCQ L;  1VJK A;  3KLS X;  4PS3 A;  4G0N B;  1TJE A;  4BBN C;  4YTM B;  1YIW A;  3WAN A;  3OLM D;  4EKU A;  2K22 A;  1LQB A;  2BGF A;  2JQR B;  3TIX A;  4KSK C;  4UDU C;  3SD5 A;  3PV1 A;  3PGE A;  1NBF C;  3DVN V;  1PDX A;  3ALB A;  2J4X A;  5BYQ A;  4WAA A;  2KDE B;  4MEL A;  3DDC B;  3ZLZ A;  1RFK A;  2JSV X;  2EKE C;  5LNK 1;  1S3S G;  1QOA A;  2AQ2 B;  3HHM A;  1H8C A;  3IHP C;  2NVU I;  1OQQ A;  3U52 E;  2BKR B;  3AI5 A;  4IM0 A;  1KLG D;  3VAW A;  2YLM A;  3H9D A;  1WI0 A;  2IGH A;  4DXF A;  1ZDX A;  1AN8 A;  2GOW A;  4A20 A;  1WGH A;  3P4Q B;  5LXH A;  1J0G A;  2IZV B;  3H6N A;  1KLU D;  2UWQ A;  3AV8 A;  3Q8E A;  5HHD G;  4JGH B;  1YQ3 B;  2WXO A;  3R3M A;  4ARI A;  2Y5P A;  3QWZ B;  4C7Y A;  4CO7 A;  1TKY A;  5JZE B;  1KTK A;  4N9F 4;  2WQY B;  5IA7 A;  2M1M A;  3C0R B;  3BK1 A;  3UIO B;  2G9H D;  5E6O A;  4MM3 B;  2MX2 A;  1KLV A;  4ANV A;  1VCB A;  3VUW A;  2J0K A;  2LUE A;  5J18 A;  1GOZ A;  1YX5 B;  3VRA B;  3NZ3 A;  4WUR A;  2KD0 A;  2MLB A;  1FNU A;  2ZPY A;  3BY4 B;  2ACZ B;  2ZNV C;  1XLN A;  3ZNZ B;  4L2Y A;  3ZQ4 A;  2M56 B;  4AJW A;  1QZE A;  1TS4 A;  1WZ0 A;  4W9H A;  1YJJ A;  1PQS A;  4FXC A;  2LUM A;  1Z5S B;  3AE5 B;  4LNF A;  2ICI A;  4KIK A;  4ZRP A;  3KWV A;  4RNA A;  1F1H A;  1WF9 A;  1IPG A;  3VDZ A;  2KQS A;  2WXI A;  3BYT B;  4US9 A;  1ZXH A;  4LLG M;  2DX5 B;  3ZXR A;  3PLU A;  4BZA A;  2MP2 A;  1KH0 A;  1ZUD 2;  4XE0 A;  2GRI A;  1B1Z A;  1JRP A;  1TTN A;  4W9F A;  2KWU B;  1JWB D;  1FNV A;  3CMM B;  1H7X A;  5DPR A;  3SDL C;  2V3N A;  2KX3 A;  1CK1 A;  3IG3 A;  4DWF A;  4NQL B;  1UGJ A;  3DOW A;  3T3N A;  4WIP A;  3AM9 A;  5AZF A;  3O13 A;  4B9K A;  2WLB A;  1I4Q A;  4OW0 A;  2BTE A;  3AE4 B;  5C3J B;  2FAZ A;  1XLP A;  1D3Z A;  4TQ0 A;  1C4A A;  4OZB A;  3BIN A;  4EUT A;  3ENE A;  1UD7 A;  1ZE3 D;  2PIA A;  2Y5C A;  2KDF B;  2N9K A;  1E90 A;  3WAO A;  4Q2J A;  1UWX A;  3WAL A;  4B0M A;  3R8B A;  4LTU A;  2BB6 A;  3CSF A;  1WGD A;  5G5H A;  3Q2A C;  4J3O D;  3DPD A;  2KAC A;  3A33 B;  4OHJ A;  4ZRI A;  1VZ8 A;  2NTS A;  3IFW B;  3BVZ A;  2MH7 A;  2JZ3 B;  1T0R C;  1V80 A;  2KN5 A;  3CST A;  1SJH D;  3NOB A;  2QEJ C;  3E9S A;  3MP9 A;  3PTF C;  4OZA A;  3DWM A;  3TMP B;  1P7E A;  4MAC A;  1JWU D;  1FCC C;  3TJP A;  1WE7 A;  1I4H A;  1YN4 A;  3ZJU A;  1UF0 A;  1P3Q U;  3DBL I;  3FIL B;  4LNK A;  5EE1 A;  3B08 A;  1SIF A;  1JW9 D;  2ZW0 A;  5J17 A;  2CS4 A;  2VH2 A;  2B3A A;  1FEH A;  5G55 A;  1TKE A;  1RFA A;  1ZDV A;  4RCO A;  2RGF A;  3WA0 A;  1DYQ A;  3ZIM A;  3V05 A;  2JXT A;  2DBY A;  2EEL A;  3CWI A;  3A9K B;  1WGK A;  3ML9 A;  2LGX A;  3JVZ X;  1GUA B;  4HJK A;  4URK A;  4BKT A;  2WXK A;  3HUI A;  1NYQ A;  2MSE D;  1SE3 A;  1EM7 A;  1H7W A;  1L4Z B;  1SSN A;  2IGD A;  1KFY B;  4HJG E;  4DBG A;  5LLI A;  2MQJ A;  4EFO A;  3P4P B;  2H88 B;  4GOC A;  2MP2 B;  1NI3 A;  1PYW D;  4HWI B;  4OZC A;  4G50 A;  4II3 B;  3HM6 X;  4X57 B;  3MC0 B;  3VUY A;  4FN2 A;  1N63 A;  3KWL A;  2K1F A;  1GC6 A;  4S17 A;  3Q8C A;  4RGM A;  4NPN A;  1BT0 A;  1YQ4 B;  3R7Q A;  4A9A A;  2N4F A;  1KJT A;  2JYE A;  3X0W A;  4KZ0 A;  1K52 A;  4JLC A;  4RMA A;  3CIR B;  3AE2 B;  1XQQ A;  3L16 A;  1FIQ A;  1JWA D;  2E3T A;  2VRR B;  3APC A;  1E8Y A;  4RM8 A;  2ZPN A;  3RUI B;  4IOI E;  3UIN B;  2UU7 A;  1Y56 A;  1X1M A;  5IN7 A;  2DEN B;  1M94 A;  2ZVN A;  2CKH B;  3T3O A;  4XYC A;  2OJR A;  1MFW A;  3K9P B;  2BT6 A;  4NZL B;  4ZRQ A;  3AN1 A;  2A4Z A;  4REZ A;  2LWP A;  2LEK A;  1WM3 A;  4IWP A;  3NVZ A;  3H7P A;  2KJ6 A;  4WJP A;  1NI2 A;  1FXT B;  4KX6 B;  3VTU A;  1ET6 A;  1RAX A;  2LD9 A;  4FHJ A;  1KF6 B;  2LHD A;  4A8X C;  2KOX A;  2YEP B;  1KRH A;  3KUD B;  2AL3 A;  4ACF A;  3R2I A;  3B2F A;  1JWM D;  4IUM B;  2L3Z A;  2M8S A;  2RPV A;  4N59 A;  2KXJ A;  2K39 A;  1UWM A;  4CQN A;  3APD A;  1I7H A;  1EO6 A;  2K5P A;  4HCP B;  4ITK A;  3AE9 B;  3QAR A;  4KDL B;  5CHV C;  2KX0 A;  3AEF B;  3AU5 A;  1MHH E;  2IO2 B;  3T8M A;  4DHZ B;  3AE7 B;  1FXI A;  2RDB C;  1HZ6 A;  3RMK C;  4M01 A;  3GE3 C;  4PYU A;  1WR1 A;  1FNW A;  2HJ8 A;  2MJD A;  1WIA A;  2K6D B;  5D6J B;  3L54 A;  4NJ7 A;  4MGY E;  3B2G A;  3PZ8 A;  4KGS A;  2JVC A;  3A9J B;  2IY0 B;  3PSE B;  3AXC A;  1WSP A;  3N1Y C;  4MH8 A;  4W9K A;  5D94 A;  3L10 B;  3IT6 B;  4XWT A;  4M8N A;  1WZ3 A;  1BXT A;  2KWC A;  2PLP A;  3GP7 A;  3W9C B;  3X23 A;  1NYR A;  2MBO A;  2DZK A;  3DWG C;  2R2O A;  3MC9 A;  2V9H A;  1CZP A;  2V4L A;  1XF5 L;  3Q69 A;  3AE3 B;  2L1A A;  1AW7 A;  1QLB B;  5H92 C;  2VZK B;  4BBN F;  1C3T A;  1L0X B;  1E7V A;  4IW0 A;  2BBC A;  2IO0 B;  2WNM A;  1RYJ A;  4B0E A;  5EE3 A;  4FUL A;  2BWF A;  1JCK B;  1T5X D;  4AJY B;  4ZDV A;  1Z2M A;  2PKO A;  1C77 A;  1QIL A;  2O2V A;  1FRD A;  3MHS D;  2V1Y A;  4GGQ A;  3W5V B;  2D3A A;  4BOZ B;  1I35 A;  2A5U A;  2RDG A;  1OEY A;  1WJ6 A;  3AE8 B;  3FAH A;  1WX7 A;  2K25 A;  1JRO A;  4LDT B;  3NZS A;  3DBH I;  4CYE A;  1K8R B;  1FO4 A;  3ML8 A;  2V3P A;  3BVG A;  3H7P B;  1HTQ A;  1K53 A;  2C60 A;  3SEB A;  1GTE A;  4I6L B;  3MJW A;  1IUE A;  4NAW A;  2AQ3 B;  3W1S C;  4N6E B;  3QK0 A;  4MGK E;  3ZNH B;  2QMT A;  4AQ7 A;  5JHB A;  1EU3 A;  3VTV A;  4BFR A;  2LRU A;  3QX1 A;  1BUI C;  4LCD E;  3AEG B;  1SF0 A;  2JRH A;  3V6C B;  2LGY A;  2PW9 A;  3RD2 A;  2BYE A;  1WMH B;  2IDY A;  2DWQ A;  3A4S C;  2GBJ A;  1Q10 A;  1XEE A;  4MDK E;  4FHK A;  2YVC A;  2Z0D B;  2D11 A;  3OJ4 B;  1MHX A;  3CF6 E;  2WXP A;  3EC8 A;  1DOY A;  1N5W A;  3Q3M C;  2SAK A;  3VXW A;  3N32 A;  4KKJ A;  1LGR A;  1FMA D;  4FJZ A;  4IWO A;  3QJZ A;  2VH1 A;  1SXT A;  1WRD B;  2BVC A;  2RMM A;  1YN5 A;  2ZNV B;  2WWZ A;  1HE8 A;  1DOX A;  3M3J A;  1MG8 A;  2K9X A;  2FCN A;  2GBM A;  3V62 A;  5AZH A;  4YTP B;  4USA A;  1TYG B;  4FBJ B;  1OTR B;  2WYQ A;  3BWU D;  3GZN B;  3ZRF A;  2L8J A;  1C76 A;  2HDE A;  4DDI D;  1WXQ A;  2O6V A;  1I4P A;  3ZW3 A;  2R61 A;  4MSQ B;  2L83 A;  5BMI A;  1E5W A;  4GN1 A;  3NRZ A;  1YJ1 A;  3W5U B;  5C1Z A;  1NVI D;  3V61 A;  1TY0 A;  2GI9 A;  4TQ1 A;  4XX5 A;  1ZGU B;  1UZX B;  4DQO C;  3I57 A;  2O2V B;  2CR5 A;  4II2 B;  4XDC A;  5EE0 A;  2WXL A;  4R3D A;  2KDI A;  3U7D A;  1SE9 A;  1K51 A;  3KW5 B;  3HK0 A;  3L0W B;  3P2B A;  2JYT A;  1V5T A;  4HVB A;  3AB5 A;  2KJH B;  1GG3 A;  4KGT A;  3KYD D;  4ASW C;  1AAR A;  5IKC M;  2KT7 A;  1OQY A;  2JXX A;  3MHZ A;  3NVW A;  2BS2 B;  3VR9 B;  1WR6 E;  1PUT A;  2KMM A;  3SFD B;  1L0V B;  2M17 A;  4L1B A;  2DYM A;  2INN E;  3EA6 A;  1D6E C;  2PVO D;  5DPS A;  4L23 A;  3RN9 C;  4NAW B;  1TY2 A;  3FIL A;  1YJI A;  3AEC B;  4KV2 A;  1SGH A;  4B6W A;  3V60 A;  1IP9 A;  3I63 C;  3RUL A;  2MHJ A;  1ZW7 A;  3UF8 A;  2G4D B;  3IBE A;  2PMV A;  2Z0E B;  4WWN A;  3A9K A;  2ONQ A;  5HG2 A;  1UUP A;  3N30 A;  2WXH A;  2L52 A;  1ZKH A;  1T0S C;  4FJY A;  3JYU A;  2MEK A;  4F1S A;  4HKZ E;  2D07 B;  4EOY A;  3L17 A;  1YQB A;  4LJO B;  3TSS A;  3FC4 A;  4EEW A;  2WS3 B;  2LGS A;  2IO3 B;  3TCA A;  5MPO A;  4OVV A;  2KDM A;  4ANW A;  3I5J C;  4RGN A;  1KOT A;  2WDR B;  3BII D;  4C80 A;  1CMX B;  4ZOH C;  5CX3 A;  1Y8R C;  4FAD A;  2DAF A;  3L08 A;  2EKI A;  4BKG A;  2BF8 B;  2HTM E;  1GB1 A;  2GBK A;  3OWE B;  4OVU A;  4MJS A;  1F77 A;  4W9C A;  2BWE S;  2GLS A;  1EWY C;  1IYF A;  3WAM A;  2LMC A;  3ZJT A;  2EMS A;  3WCQ A;  3QIJ A;  2LVQ A;  4W9G A;  4DHJ B;  2LI5 A;  2O6V B;  4IC7 B;  2WP9 B;  3PZ7 A;  2WXF A;  2LVO A;  3ZYY X;  1V86 A;  2FUH B;  4JWS C;  3QC8 B;  3NVY A;  2ZCB A;  3EFC A;  3OJ3 A;  1YD8 U;  4P16 A;  5L95 C;  4KSL C;  1YX6 B;  1CQV A;  4IDI A;  4DHJ D;  2NR2 A;  5E6J A;  3H1U A;  2I38 A;  3NZU A;  4A6Q A;  3ZGZ A;  1TT5 B;  2NMQ A;  2N9E B;  5G5G A;  2AEH A;  3UGB B;  2N0S B;  2KC1 A;  2BS4 B;  3N1X C;  3U30 A;  5C2T B;  5IO9 A;  5HFY A;  3VH4 B;  1G6J A;  3MJ5 A;  3QQ8 B;  1PGA A;  2IO1 B;  2JX5 A;  1WH3 A;  1FFV A;  4MSM B;  4YSZ B;  4W9I A;  2M19 A;  4KKI A;  4ZHP A;  1C9F A;  1ZXI A;  3BYY B;  5GMV A;  2KN4 A;  1XLQ A;  2GMI C;  1WGG A;  2DZI A;  1C4C A;  3AU4 A;  4BKS A;  3W1S A;  4K7S A;  4TSS A;  5H8Y E;  1QF6 A;  1IBX A;  4EZJ A;  2N9P C;  5AEK B;  4YL8 A;  4HKQ A;  3BVM A;  4D2K A;  1JWS D;  5D2M B;  4WQM A;  3PRP B;  2KQ4 X;  1E6E B;  3KYC D;  1SE4 A;  3A9J A;  2I1K A;  5LXI B;  2KLG A;  2CHX A;  5DCN A;  2WDT B;  2WXQ A;  4DK5 A;  3KVF B;  4YSX B;  2L0T A;  2J0M A;  4RFB A;  4EZK A;  5EE9 A;  4TMA B;  1CJE A;  1V1P A;  3SU8 X;  1WE6 A;  1STE A;  3GS2 A;  4FJV B;  4N58 A;  4S0R A;  2MBE A;  1NDD A;  4FLH A;  4GDK B;  1E7P B;  2JWU A;  3DHI C;  1QQR A;  1F2R I;  3VUX A;  1ET9 A;  2IGG A;  3DVN U;  4MJS B;  1EU4 A;  2JU6 X;  1P1A A;  2QSD A;  2DNF A;  3NHE B;  2HD5 B;  3P4R B;  2Z8L A;  2WDV B;  4RH6 A;  1MVK A;  4W9J A;  3I9V 1;  2LRW A;  1HZ5 A;  2AL6 A;  3RNF C;  1H4R A;  2I1J A;  2CHZ A;  4O1N A;  4P1C C;  2QIE B;  1L6U A;  5D3I B;  3RNE C;  1ACC A;  2N7E A;  1GNU A;  2D2Q A;  2WGS A;  3RYT A;  1R7S A;  4A55 A;  1I4G A;  1WY8 A;  3ZNI D;  1SJE D;  4MT5 A;  1C79 A;  4I6P A;  1QOG A;  3DBL B;  1DGJ A;  2MJE A;  4HRS A;  1V6E A;  2XEW A;  2RR9 A;  4NY0 A;  2KTR A;  2KJR A;  3IXS A;  1I4R A;  3W1Y A;  2JUO A;  2LGD A;  5EDS A;  2KK8 A;  4A90 A;  1N6Z A;  2ZCC A;  3Q3J A;  3EFU A;  2L0F A;  4IWQ A;  2ZJD A;  3UQA A;  2YEP F;  1L2N A;  2LXC A;  2D3G A;  1V2Y A;  3O65 B;  1HXY D;  5CHW A;  2MCN B;  1WMH A;  4NJ6 A;  1K50 A;  2LJI A;  4RF0 A;  1T0Y A;  2NBW B;  3RFZ B;  1JRU A;  3LJ3 A;  4YXD B;  2KVZ A;  1E7U A;  3VQI A;  2FCS A;  1WXS A;  3AEE B;  2M0A A;  3KQ4 A;  4WWP A;  3MFG A;  4LK0 M;  1UGM A;  1IBX B;  4M8M A;  1T3Q A;  2FCQ A;  1TZO A;  3AE6 B;  3LXF A;  1PFD A;  2OED A;  4YT0 B;  5KHQ A;  3Q8F A;  3PPA A;  2KHW B;  3NVV A;  2C7N B;  2J7Q B;  3H8H A;  1Q5W B;  2LGI A;  1GAQ B;  1V81 A;  1XXG A;  2WX0 A;  4C4V A;  2Z59 B;  2XBB C;  2JZZ A;  4LNI A;  3KUZ A;  2ON8 A;  1A70 A;  4ZRJ A;  4JIO U;  3HVZ A;  3VH3 B;  1V1P B;  4RM9 A;  4BKS D;  2PVG C;  3MTN B;  2C7H A;  1U4A A;  3IT4 B;  2INP E;  2I2Y A;  3CF4 A;  1FPY A;  4M00 A;  1UBI A;  3AEB B;  1VZ7 A;  4ZYN A;  2KLC A;  5FKA C;  3RNB C;  3ZJV A;  1SIJ A;  2JRI B;  2KKC A;  3DBR I;  4HEA 1;  3Q3F A;  3RNG C;  2AQ1 B;  3U2S C;  3TEZ A;  3ZUN A;  2JF5 A;  4NJC A;  1J19 A;  4DXG A;  2W82 A;  1BML C;  3LYY A;  3EHV A;  1ZOY B;  2JZP A;  2PE6 B;  2R2Q A;  4RGT A;  2PEA A;  4GLS C;  3U8Z A;  4GDL A;  5J2R A;  4JQW C;  3K9O B;  1JML A;  1TZ1 A;  2VZK D;  2NCN A;  1WRI A;  4PS8 A;  4WAF A;  4LNO A;  1WXA A;  4JE3 B;  3PRZ A;  4HPM B;  2N1W A;  3E56 A;  1RM6 C;  4IM3 A;  1L0Y B;  5BO4 B;  2QHO A;  2D3C A;  1D4B A;  2KTR B;  3PS6 A;  3P1M A;  2KTF A;  2XNA C;  2M0X A;  3RZF A;  4BOS C;  1LO5 D;  3RZW C;  2INC C;  1OFF A;  2V3S A;  5BMG A;  1MJD A;  1F2R C;  4TKN A;  2MA9 B;  3BZD B;  2KFK A;  2FID A;  1QOF A;  2UYZ B;  4BAX A;  4PK1 A;  2G3Q B;  4GSW A;  1HA5 A;  1QKZ A;  2D5G A;  4LDT D;  3Q3N C;  2E6X A; 
#chains in the Genus database with same CATH homology
 4MAC A;  1JWU D;  2Y3A A;  1FCC C;  1D5M C;  1ENF A;  1I4H A;  1YN4 A;  5T8I A;  1WYG A;  3ZJU A;  3FIL B;  3J9C A;  1E9M A;  5EE1 A;  1MPE A;  3VRB B;  2PMV A;  1MI0 A;  2BS3 B;  1JW9 D;  1QT9 A;  2ZW0 A;  2ONQ A;  1B9R A;  4M0W A;  5HG2 A;  1FEH A;  1UUP A;  4WWM A;  3BK2 A;  1TKE A;  1ZDV A;  4RCO A;  1ZPS A;  2WXH A;  2SEB D;  2L52 A;  1DYQ A;  4HRO A;  3V05 A;  2JXT A;  2MEK A;  2DBY A;  2EEL A;  2WU5 B;  3CWI A;  1WGK A;  3TEY A;  4HKZ E;  3TSS A;  3FC4 A;  2WS3 B;  2NTT A;  1VDV A;  1FRR A;  5MPO A;  3AEA B;  2WXK A;  3HUI A;  2KDM A;  1NYQ A;  1SE3 A;  4RGN A;  2BB5 A;  2WDR B;  1EM7 A;  1H7W A;  3BII D;  1L4Z B;  1SSN A;  1NEN B;  2IGD A;  2K3U A;  4C80 A;  1KFY B;  4HJG E;  3AH7 A;  4ZOH C;  1D5Z C;  2RDH A;  3P4P B;  2H88 B;  2EKI A;  1IGD A;  3LB8 C;  3U4E G;  2HTM E;  1GB1 A;  1NI3 A;  1PYW D;  3TEW A;  4OZC A;  2LFI A;  5D7G A;  3OWE B;  1F77 A;  1L6V A;  3AMZ A;  3MC0 B;  3R2T A;  4P6V F;  1EWY C;  1VR9 A;  4ZYS A;  1DOI A;  1N63 A;  3KWL A;  4ARC A;  1FD6 A;  4H2A A;  2LMC A;  2LHE A;  1UNS A;  3ZJT A;  1AYF A;  1M4V A;  3P63 A;  3Q8C A;  4JPS A;  3WCQ A;  4RGM A;  1YQ4 B;  4A9A A;  5JXV A;  2JYE A;  3P42 A;  4C7Z A;  1K52 A;  2WP9 B;  1VZ6 A;  3CIR B;  3AE2 B;  3PZ7 A;  1FIQ A;  1PGB A;  1VRA B;  1SB3 C;  2WXF A;  1JWA D;  1XLO A;  2E3T A;  3ZYY X;  3P4S B;  2PTL A;  3B9J A;  4JX1 C;  4JWS C;  3NVY A;  4YWG G;  4IOI E;  1N60 A;  1Y56 A;  2DYO A;  4P16 A;  3IAS 1;  2WXJ A;  4RGO S;  3W2D A;  3T3O A;  2J52 A;  1CQV A;  1FM0 D;  4IDI A;  2E6X A;  4GDL B;  2BT6 A;  4NZL B;  1I4X A;  4ZRQ A;  5E6J A;  3AN1 A;  4REZ A;  2I38 A;  3SFE B;  4A6Q A;  1N61 A;  2QIL A;  2LEK A;  1JAL A;  5D3D A;  3ZGZ A;  1TS3 A;  1PGX A;  2MJ3 A;  2NMQ A;  3NVZ A;  1L5P A;  2CJN A;  2BW2 A;  4KX6 B;  1ROE A;  2H89 B;  4NAM A;  4WH4 A;  1ET6 A;  5G5G A;  2N0S B;  4YSY B;  2FUG 1;  2BS4 B;  1N5X A;  1KF6 B;  2W3R A;  2LHD A;  4A8X C;  5C2T B;  2YEP B;  5HFY A;  1SBB B;  1V97 A;  1KRH A;  1TS2 A;  1JQ4 A;  2ZW1 A;  3R2I A;  1J7C A;  3MJ5 A;  1PGA A;  3B2F A;  1V1O A;  1JWM D;  5BYR A;  2JX5 A;  2KWD A;  4N59 A;  2RPV A;  1GPX A;  1FFV A;  1UWM A;  1N62 A;  1FFU A;  4CQN A;  4YSZ B;  2TSS A;  1I7H A;  2M19 A;  4KKI A;  4ZHP A;  3Q8A A;  1C9F A;  1SEB D;  1ZXI A;  1L4D B;  3BYY B;  2J53 A;  2K5P A;  1IGC A;  2KN4 A;  3AE1 B;  1XLQ A;  4ITK A;  3AE9 B;  1FCL A;  1TS5 A;  1C4C A;  3AEF B;  3W1S A;  1OQR A;  3EGR A;  4TSS A;  5FK9 C;  5H8Y E;  4ZHO A;  1QF6 A;  1IBX A;  2WXN A;  1MHH E;  1F0Z A;  3AE7 B;  1FXI A;  2WXM A;  3BVM A;  4HKQ A;  4D2K A;  1HZ6 A;  2WDQ B;  1JWS D;  1ZP0 B;  3ETR A;  3N9Y C;  4WQM A;  1ESF A;  1YMH E;  4US8 A;  2L32 A;  1FNW A;  2KQ4 X;  5BMH A;  1E6E B;  2MJD A;  1J7A A;  1SE4 A;  2W55 A;  4EE2 A;  1XCQ L;  1VLB A;  3EUB 2;  3TUO A;  1VJK A;  3KLS X;  2WXQ A;  3UI3 A;  4YSX B;  2V4I B;  1TJE A;  4YTM B;  3B2G A;  3PZ8 A;  3RPF C;  4KGS A;  3V3X A;  4RFB A;  2K22 A;  2JQR B;  5EE9 A;  4TMA B;  1CJE A;  4UDU C;  4PT5 A;  1GT8 A;  1V1P A;  1STE A;  1WSP A;  3GS2 A;  4MH8 A;  4N58 A;  3IT6 B;  4XWT A;  1BXT A;  1PDX A;  4KGR A;  2J4X A;  2PLP A;  3GP7 A;  4AS1 A;  3W9C B;  2AX5 A;  4GDK B;  1NYR A;  1E7P B;  5BYQ A;  2JWU A;  1YNT E;  1QQR A;  1F2R I;  3DWG C;  1ET9 A;  1CZP A;  1RFK A;  2JSV X;  1XF5 L;  3PO0 A;  3Q69 A;  2IGG A;  1EU4 A;  2JU6 X;  3AE3 B;  2L1A A;  5LNK 1;  1AW7 A;  1QOA A;  1QLB B;  2AQ2 B;  2QSD A;  2G1E A;  5H92 C;  3U7Z A;  2VZK B;  1L0X B;  1OQQ A;  3P4R B;  2BBC A;  2WNM A;  2WDV B;  2CJO A;  2Z8L A;  3U52 E;  4RH6 A;  2J42 A;  3SR6 A;  3TEX A;  3URY A;  1RYJ A;  1MVK A;  2IJ0 A;  3I9V 1;  4B0E A;  5EE3 A;  2W3S A;  2WXG A;  1HZ5 A;  1JCK B;  1KLG D;  1T5X D;  3IAM 1;  2N9L A;  2PKO A;  1C77 A;  1QIL A;  4O1N A;  1FRD A;  2QIE B;  2IGH A;  1L6U A;  5D3I B;  4DXF A;  2DLB A;  1ACC A;  1ZDX A;  1AN8 A;  3W5V B;  4YTN B;  3P4Q B;  1R7S A;  4A55 A;  1I4G A;  2RDG A;  3NUH B;  1SJE D;  1KLU D;  3AV8 A;  3Q8E A;  5HHD G;  3AE8 B;  1YQ3 B;  4MT5 A;  1C79 A;  2BYT A;  2WXO A;  3FAH A;  5AUI A;  1E0Z A;  2FBW B;  1QOG A;  1DGJ A;  2MJE A;  4HRS A;  4ARI A;  3ABV B;  3C8Y A;  1JRO A;  2Y5P A;  3IXS A;  4C7Y A;  1I4R A;  2WXR A;  1TKY A;  2FE8 A;  1FO4 A;  1KTK A;  2V3P A;  1XCT L;  1NEK B;  3BVG A;  2WQY B;  4A90 A;  2X38 A;  1K53 A;  3SEB A;  1GTE A;  2YEP F;  3BK1 A;  1IUE A;  2G9H D;  2AQ3 B;  1J7B A;  1GB4 A;  4N6E B;  4MM3 B;  5I4D A;  2N7J A;  1C4P A;  2QMT A;  4AQ7 A;  1GOZ A;  1EU3 A;  1E10 A;  3HRD D;  3VRA B;  1HXY D;  3NZ3 A;  4WUR A;  1D5X C;  4JWU C;  1FNU A;  1K50 A;  2LJI A;  1XO3 A;  4RF0 A;  1BUI C;  3RFZ B;  3AEG B;  2ACZ B;  1SF0 A;  1XLN A;  2WU2 B;  4YXD B;  3VQI A;  2PW9 A;  4L2Y A;  1QOB A;  2K0P A;  3ZQ4 A;  2M56 B;  2IDY A;  2DWQ A;  2OHF A;  3AEE B;  1Q10 A;  1TS4 A;  1XEE A;  2M0A A;  1WWT A;  3KQ4 A;  4C56 C;  1RWS A;  3MFG A;  2QJL A;  4LK0 M;  1IBX B;  1YJJ A;  1MHX A;  4FXC A;  1T3Q A;  2V0G A;  1TZO A;  5HI1 A;  2LUM A;  2WXP A;  5FR3 A;  1DOY A;  3AE6 B;  3AE5 B;  1N5W A;  3LXF A;  2ICI A;  1PFD A;  2OED A;  4YT0 B;  3Q8F A;  3KWV A;  2SAK A;  4ZRP A;  4RNA A;  4KKJ A;  3NVV A;  1HEZ E;  1FMA D;  3H8H A;  1SXT A;  2LGI A;  1AWD A;  2RMM A;  1GAQ B;  1YN5 A;  1XXG A;  2WXI A;  3BYT B;  4US9 A;  1ZXH A;  4LLG M;  3AED B;  2KAJ A;  2ON8 A;  1DOX A;  1A70 A;  4XDD A;  2K9X A;  1HQR D;  1KH0 A;  1ZUD 2;  3HVZ A;  4YTP B;  4XE0 A;  4IKG A;  2GRI A;  1V1P B;  1B1Z A;  1JRP A;  4USA A;  1TYG B;  2PVG C;  1JWB D;  1FNV A;  3IT4 B;  3BWU D;  2INP E;  2I2Y A;  1H7X A;  3CF4 A;  3VR8 B;  2Q5W D;  2B76 B;  1YN3 A;  3AEB B;  1VZ7 A;  5GXG B;  2V3N A;  1CK1 A;  1C76 A;  2HDE A;  5FKA C;  5BYS A;  3ZJV A;  1WXQ A;  3Q8B A;  4OVZ A;  1SIJ A;  1I4P A;  1TKG A;  2R61 A;  1UGJ A;  3T3N A;  4HEA 1;  2L83 A;  5BMI A;  2AQ1 B;  3AM9 A;  4WIP A;  3O13 A;  3U2S C;  2WLB A;  3NRZ A;  1I4Q A;  3TEZ A;  4NJC A;  3W5U B;  5AUK A;  2W54 A;  1NVI D;  4OW0 A;  1P7F A;  4DXG A;  2BTE A;  2W82 A;  3AE4 B;  1TY0 A;  5C3J B;  1BML C;  1XLP A;  2GI9 A;  3LYY A;  4TQ1 A;  1ZOY B;  2JZP A;  4TQ0 A;  1C4A A;  4OZB A;  4DQO C;  3I57 A;  1GTH A;  1C78 A;  2IPK D;  5TSS A;  2XN9 C;  4RGT A;  4XDC A;  3NS1 A;  1ZE3 D;  5EE0 A;  2PIA A;  2Y5C A;  4GLS C;  2N9K A;  2WXL A;  4R3D A;  1JML A;  1T6B X;  2VZK D;  1WRI A;  1K51 A;  4Q2J A;  1SE2 A;  4WAF A;  2JYT A;  4JE3 B;  3AB5 A;  1FXA A;  1UWX A;  4B0M A;  4XWW A;  4KGT A;  3R8B A;  3E56 A;  1RM6 C;  1L0Y B;  4LTU A;  3MHZ A;  2BB6 A;  3NVW A;  5G5H A;  1D4B A;  2BS2 B;  3VR9 B;  4J3O D;  3P1M A;  1PUT A;  2KAC A;  2KMM A;  3SFD B;  2XNA C;  4OHJ A;  1L0V B;  4L1B A;  1LO5 D;  1VZ8 A;  2DYM A;  1OFF A;  2NTS A;  2GB1 A;  5BMG A;  1V8C A;  4RF1 A;  3L4P A;  2MH7 A;  3BVZ A;  1EWC A;  2INN E;  3EA6 A;  3HVD A;  1D6E C;  2PVO D;  1F2R C;  1SJH D;  3BZD B;  2CU3 A;  1QOF A;  2QEJ C;  4L23 A;  4NAW B;  1TY2 A;  3FIL A;  3E9S A;  1HA5 A;  1QKZ A;  3MP9 A;  2D5G A;  3GB1 A;  4OZA A;  1YJI A;  3DWM A;  3AEC B;  1P7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...