2WDVB

E. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Succinate:Quinone Oxidoreductase with an Occupied and Empty Quinone- Binding Site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wdvB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wdvB01
2BS3B 1J7CA 1OFFA 1RYJA 1XLQA 2L52A 3DWGC 2JQRB 3LB8C 1FRDA 4ZHOA 5G5HA 4C7ZA 1WGKA 5H92C 1E9MA 2BS4B 2LEKA 2W55A 4YSXB 3AEDB 4US9A 3P4RB 2Q5WD 3VR8B 3AE1B 1ZUD2 4FXCA 3AH7A 2FBWB 3AEAB 1PFDA 1T3QA 1SIJA 1JQ4A 1OQQA 4LTUA 1ROEA 1GTHA 1E6EB 1A70A 2H88B 1E0ZA 3P1MA 2KMMA 3AE2B 1KRHA 1QLBB 2PIAA 3FC4A 1E10A 5EE1A 1DGJA 1YJIA 1RWSA 2MJEA 4P6VF 1NEKB 2WS3B 3AEGB 1FIQA 4YTNB 3EUB2 2E3TA 1NYQA 3W5UB 2ACZB 1QOGA 4ZHPA 3PO0A 2Y5CA 2WQYB 1JWAD 2PKOA 2CJNA 3AEEB 3CIRB 1FMAD 5AUIA 4YT0B 1N5XA 1QOFA 2KAJA 1JALA 5EE9A 3AE4B 1E7PB 2CJOA 1RM6C 2K9XA 1SB3C 3CWIA 1L6VA 1PUTA 3SR6A 1PDXA 1J7BA 1UWMA 2MH7A 1GPXA 3LXFA 4ITKA 2M19A 3NS1A 1ZXIA 1DOYA 2QIEB 3P4QB 1DOIA 3AE5B 1N62A 1NYRA 4YTPB 1V8CA 1NENB 2BT6A 2OHFA 2WLBA 3VR9B 2MJ3A 3ABVB 3ZYYX 2H89B 1KF6B 1QOAA 1SF0A 2DBYA 3WCQA 4YTMB 2W54A 1YJJA 3AM9A 1TKGA 1FXIA 2WDRB 1N60A 1TKEA 2K5PA 2M56B 3AEBB 2G1EA 4A9AA 1XLNA 1H7XA 1FRRA 4JWUC 3BIID 1B9RA 1AWDA 4YSZB 3AE8B 1F0ZA 2WU5B 1QT9A 1JWBD 3W5VB 2WDVB 2WP9B 3ETRA 3AE6B 1CZPA 2PVOD 3VRAB 2AX5A 1N63A 3NVWA 3AE7B 1JW9D 1VJKA 3AEFB 1KFYB 3AMZA 3KWLA 1N61A 3P63A 3HVZA 4N59A 4ZOHC 2K22A 1XLOA 3B2FA 4KX6B 3VRBB 1ZP0B 1ZOYB 2W3SA 3HRDD 1AYFA 3AE9B 3NRZA 3W9CB 3B9JA 4WQMA 4C80A 3P4PB 1GAQB 1N5WA 1FFUA 2JX5A 5AUKA 4JX1C 5EE0A 3AE3B 1FXAA 1TJEA 3SFDB 1L6UA 1YQ3B 3AECB 5C2TB 1OQRA 1WYGA 2DWQA 3B2GA 1R7SA 1CJEA 1XLPA 3L4PA 4JWSC 5G5GA 1L0VB 4US8A 1FM0D 1WRIA 1V97A 2L83A 1XO3A 3SFEB 2QJLA 3FAHA 5MPOA 1IUEA 1L5PA 1DOXA 4N6EB 1FFVA 3NVYA 1H7WA 1GTEA 4YXDB 1I7HA 2HTME 3DWMA 3RPFC 5EE3A 1GT8A 3CF4A 2PVGC 3HUIA 3NVZA 1QF6A 5H8YE 1WXQA 1TKYA 2MJDA 1J7AA 1VLBA 2BS2B 1QOBA 1WWTA 3AN1A 1VDVA 4C7YA 3NVVA 2W3RA 2WU2B 3AV8A 4HRSA 1NI3A 5GXGB 1JRPA 4USAA 3P4SB 1RFKA 1TYGB 5C3JB 3AB5A 4WWMA 1JROA 2WDQB 1YQ4B 4N58A 1FO4A 2N0SB 4IDIA 2EKIA 4YSYB 4HROA 1NVID 1EWYC 2B76B 2CU3A
chains in the Genus database with same CATH superfamily
2BS3B 2NPTB 2JF5A 2JQRB 1GJZA 3LB8C 4C7ZA 3MTNB 2KFKA 4M0WB 2J42A 3BK1A 1A70A 1XD3B 3P1MA 4TMAB 1E10A 3UIPB 3UQBA 1RWSA 2K6QA 5TSSA 3ZXRA 2NS5A 3BVMA 1MG4A 3A9KA 4FULA 1KJTA 3NZSA 4HKQA 2O2VA 1NI2A 2RDBC 2INDC 2Y3AA 2EMSA 1DOYA 3QX1A 1DOIA 1KTKA 3GB1A 3ZYYX 3DBSA 4NQKE 1UGMA 3A4RA 5AZFA 4FADA 3BIID 4RM9A 4HWIB 5J17A 3M63B 3Q69A 1E7UA 3M3JA 2L0FA 5BMIA 4KDIC 3L13A 1ENFA 3MJWA 3HRDD 1E7VA 2LMCA 3M95A 1WMHA 5HG2A 1TJEA 4A20A 1WMHB 2K8BA 1S1QB 2ZW0A 3AULA 1P3QU 3ZGZA 2DZIA 2J0KA 4XGAB 3BZDB 3GP7A 4MSQB 4W9KA 3H8HA 1H7WA 4MT5A 4FN2A 4ANUA 2MCNB 1J7AA 5T8IA 4C7YA 4II3B 2JXXA 2LRWA 4HRSA 5GXGB 1TYGB 1K8RB 2WXMA 1JROA 4W9HA 1F9JA 1WXAA 1YQ4B 4GDLA 3JVZX 4DQOC 3W1SA 5IOIA 4DXGA 1TZ1A 4MDKE 3R7QA 1UNSA 4OVUA 2ZEQA 3N1XC 2D3BA 5H92C 5IP4D 4GOCA 4FXCA 4AQ7A 2N9LA 2WXHA 1PFDA 2KC2A 3VH3B 2H88B 3I5JC 4MSMB 2ZVNA 3RI7C 4K7SA 3PZ8A 1FNUA 5DPRA 2VZKD 2C7NB 1PGAA 2DLBA 2E3TA 4A8XC 1VR9A 2KANA 3AU5A 2WQYB 3IT6B 4JLCA 1YN4A 1TS3A 2DYMA 4W9CA 4AS1A 3KUDB 5C23A 3E56A 1YX5B 2HD5B 1I4GA 4NAWB 4B9KA 2BW2A 4NAWA 2FCMA 4R3DA 3ZRFA 5J18A 3NS1A 1YJ1A 3Q8EA 2KVRA 3V6EB 3EGRA 2RPQA 1MI0A 1N60A 1RAXA 3KH0A 3QWZB 3HK0A 4B0MA 4ANWA 4S0RA 1WX8A 5J2RA 3J9CA 5JH5C 2OJWA 3JSVA 1N63A 4CHKA 3RN9C 3C0RB 5BMHA 3KWLA 4TQ1A 4UDUC 1SE9A 3P63A 1L7YA 3RYTA 5DPWA 2L7RA 2DAFA 3AE9B 4C80A 2N7DA 2LRUA 2JZPA 2KDIA 3TUOA 4TQ0A 4MGIE 3FAHA 2FE8A 2G3QB 2N1VA 2O2VB 1GC7A 4HK2A 4IOIE 4LNKA 2WYQA 1SE4A 2CHZA 4G3XB 1SSNA 2QILA 4G11A 1MG8A 2WXKA 4M00A 3BVZA 2CKHB 1R4NB 1SIFA 4XDDA 3DVGX 2MP2B 2XN9C 2KQ7A 3PSEB 3R8BA 1V86A 1ACCA 3DVGY 2V1YA 2FCNA 3P42A 4P7IA 4OZAA 2NTSA 2XK5B 3DOWA 4IM2A 3X0WA 4E3CA 1JQ4A 4DHJB 3ZDTA 4BVUC 1C3TA 1MFWA 1GC6A 2ASQA 2K1FA 4JGHB 1WR6E 2IO2B 4YTNB 3EUB2 1EUVB 1QOGA 2C7MB 4QAYA 2AYOB 3ALBA 4ZYNA 3ZTDA 4MJSB 4KGRA 3ZNHB 1PDXA 3DBLI 4BOZB 1Q1OA 1N62A 1NYRA 2BT6A 1NENB 3PT2B 2MJ3A 3WCQA 2GI9A 2YEPB 2J0JA 2DENB 1ESFA 4LLGM 2JU6X 3OLMD 1H7XA 1FRRA 1WXVA 2A5UA 2LASA 2BKRB 4LCDE 1XXGA 3RD2A 4KZ0A 2WWZA 2RPVA 2Z8LA 4LDTD 1JWSD 4CQNA 5G2NA 2WGSA 1KFYB 3TMPB 3KUCB 3N3KB 3OG5A 3MP9A 3P4PB 4MGZE 2REXA 2LZ6A 4DHJD 2WHIA 5BMGA 2WXRA 2HTME 1MPEA 3U4EG 5HI1A 2Y5PA 4GLSC 2W3RA 3RT3B 4W9GA 1IBXA 4KSLC 3EHVA 2BYEA 2BTEA 4LNFA 4NQLB 1D4BA 2A4ZA 3R7RA 4ZHOA 5G5HA 2C9WB 2BS4B 1P1AA 2JYTA 2M0XA 5KHOA 1SIJA 1OGWA 1WJUA 2BQQA 3E9SA 2ZNVB 3DDCB 1YJIA 2IZVB 3ZJTA 4W9FA 1D5ZC 4BAXA 1KLVA 2AQ2B 2N7EA 2RR9A 4B0EA 1M94A 1TS2A 3PO0A 5C1ZA 1ET6A 3NOBA 1JMLA 4BKGA 2BKFA 2X8XX 3PVLA 3A1QA 3CWIA 3SR6A 2GRIA 1C4CA 2GBNA 3AE5B 4JQWC 2PJHA 3HM3A 3BINA 2JZ3B 3AM9A 4MACA 1WGGA 1TKEA 3Q3JA 1J0GA 3AU4A 2MEKA 3K9PB 1V1PB 2C60A 4HJKA 1SBBB 3C8YA 3JW0X 4PS7A 4ZRPA 2PE9A 3ZNZB 4BBNF 3UINB 3R2IA 1JW9D 3AMZA 4DXAB 3RNEC 3BYTB 1P0RA 1R4MB 3DBRI 2LD9A 2OJRA 1WZ0A 1GAQB 1UBQA 2MLBA 4HDQA 3V60A 3W1YA 2LGSA 4HJGE 1IPGA 2ZVOA 4KSKC 1SE3A 2J52A 4LNNA 3PLUA 1P7EA 4MH0E 2LVQA 1YX6B 3IVFA 5H8YE 5BYQA 1WX7A 2VH2A 2IGGA 3MC9A 1RFKA 3P4SB 3PS6A 2L1AA 4CYEA 1STEA 2N0SB 2BWFA 1XLQA 5DPTA 4HPMB 1E9MA 1H4RA 3X23A 3OJ4B 3VR8B 3OAWA 4TSSA 2FBWB 2QHOA 4RCOA 4K1RB 2KX0A 3W2DA 1YD8U 3PRZA 3IAS1 3DVNU 2NR2A 3FC4A 3DBLB 2QSDA 4ICUA 5EE1A 1WI0A 1NEKB 2D3GA 1E8WA 2WXNA 3ZVVA 2CU1A 1ZXHA 1QQRA 2K8HA 3AEEB 3CIRB 1TS5A 2L0TA 3Q8BA 1WSPA 2CR5A 3NG0A 4ITKA 3RNFC 3L10B 2KWUB 1SGHA 5AEKB 2RDGA 1WJ6A 2BF8B 3O65B 3DCGA 4EKUA 2KQ4X 3A4SC 2M1MA 4YWGG 1F1HA 2LXAA 3BYYB 1SJED 2I2YA 1JWBD 5IKCM 2KVZA 2KT7A 3BVGA 2YLMA 3ZNID 2KMAA 3PLVA 3HVZA 1FPYA 2W3SA 3W9CB 4MEMA 2KLGA 4L1BA 1WXSA 4G0NB 5FR3A 3AECB 4L2YA 2KMCA 1XT9B 1D6EC 1XQQA 1FM0D 1WRIA 2N4FA 4HXDA 4KKIA 3PHXB 4DHZB 4KVGB 4YXDB 2FNJB 3N32A 2MJDA 3PPAA 2NPTA 1BUIC 2INNE 3BK2A 2CS4A 2V4IB 4KDLB 4M02A 5AZHA 4IUMB 2KTRA 2L76A 2BYFA 2D3CA 4I6NB 4XYCA 2KK8A 3A9JB 4B6WA 2NVUI 4JPSA 2JWUA 1QLBB 1FNWA 4BKSD 1DGJA 5HKHA 2ACZB 2V3PA 3UIOB 2LJIA 2ZPYA 4Q2JA 1Q10A 2UU7A 1CMXB 1QOFA 4EFOA 2AL6A 3IFWB 3WANA 4AP4C 3R3MA 1FCCC 1UZXB 5L95C 3VAWA 1RLFA 2MBEA 4IG7B 1TKGA 2VH1A 1XLNA 4EEWA 4PYZA 1AWDA 1VZ8A 4YSZB 1T0YA 5KHQA 2KD0A 4MELA 3RMKC 3VRAB 5IO9A 2RSUA 1EF1A 3DVNV 4K7UA 3TCAA 2HJ1A 3N20C 2LHEA 2YVCA 1CJEA 1Z5SB 1KLGD 3QHTA 3QAQA 2L83A 4D2KA 2N7JA 2JYEA 3RZWC 5D3DA 3DWMA 3KWVA 4RGMA 4X57B 2JUOA 1VLBA 3UGBB 3AV8A 1JRPA 4USAA 4I6LB 3U52E 1EU3A 4P1CC 1QILA 1HEZE 5TR5A 4IDIA 2ZNVC 1E8YA 1YN5A 3AEFB 2MHJA 3HIZA 2JSVX 2MBBB 1F77A 3AEDB 1OTRB 4US9A 1E8XA 3L17A 5JZEB 3AH7A 3PRPB 3AEAB 3VFKA 1E6EB 2VZKB 3VHTC 3UI3A 5LLIA 1FIQA 2WXFA 2ZZPB 3WAPA 1C4AA 3CF6E 4ICVA 5D6JB 4JL9A 4FA6A 1FMAD 4HDOA 2GBJA 2MSED 2JRHA 3AE4B 1EWCA 2BBCA 1RM6C 2DYBA 2L32A 3JYUA 1FD6A 2HJ8A 4LDTB 1ZXIA 3WALA 1V8CA 3ZO5B 3TEXA 3VUYA 1LFDA 2M56B 2QCZA 4W9IA 4TV3A 1P7FA 1ZW7A 3W5VB 2JRIB 4K7WA 3RZFA 4NY0A 3ECIA 2IYDB 2DHZA 1ZP0B 2LI5A 1VZ7A 5CHFA 2KYWA 1KM7A 2KLCA 3GE3C 1JRUA 1NDDA 1YQ3B 4RF0A 1WYGA 1OQRA 1P9DU 2G4DB 1HE8A 4JWSC 4P1BC 2ICIA 3RUIB 4KV2A 4C00A 1IUEA 2JPHA 1L5PA 1BT0A 4N6EB 1RFAA 1TS4A 3TBLD 1Q0WB 4DDID 3CF4A 2L00B 2Z59B 1WXQA 1WWTA 3TIXA 1WE7A 4XDCA 1ZE3D 5C3JB 3U2SC 2FAZA 3WAOA 4N58A 4J6IA 4RGNA 4OVZA 4YSYB 1EWYC 2B76B 3DHGC 2L52A 4RGTA 1I35A 2KFJA 3TL5A 3U8ZA 3P2BA 4GSWA 1WRDB 4DDGD 3FKYA 1WGYA 3KVFB 2V0GA 3IT4B 2ZJDA 2LXCA 2M4NA 3KQ4A 4EZLA 3I63C 1J8CA 2RGFA 3AEGB 3Q8AA 1FXTB 1WH3A 4HPLB 3OWEB 2NTTA 1GB4A 4BBNC 2WXPA 2CJNA 1MVKA 1WM3A 2CJOA 1I4RA 2IPKD 1I42A 1UWMA 2MH7A 3LXFA 1HZ5A 4WJNA 2WNMA 4M8NA 1E8ZA 2W54A 2TSSA 1F0ZA 3V62A 2D07B 2PMVA 2WDVB 3QA8A 2WP9B 3U30A 3Q3OC 3H1UA 1FNVA 1XCQL 4XWTA 3SEBA 3PZDA 3QCAA 3AE7B 2LUEA 2DAJA 5FR6A 4K81A 1EM7A 3VRBB 1SXTA 1I4HA 3VXWA 5HHDG 1GNUA 3B9JA 4JX1C 1Y8RC 4M8MA 3A9KB 3CMMB 1L6UA 5C2TB 2HDEA 3NVVA 5CX3A 4F7ZA 4US8A 1V97A 3ZJUA 4G50A 1U4AA 1IBXB 2KX3A 1IGDA 5EE3A 2W9NA 2OEDA 4WJOA 1LO5D 1TKYA 2KOXA 3T9LA 2WU2B 4WWOA 4IM0A 3AI5A 4K3CA 3JSVB 1G6JA 3QARA 2KDMA 2MA9B 1CK1A 4LK0M 1AARA 3PZ7A 4L23A 2IBIB 3M62B 1LQBA 2MBOA 2D11A 4EOYA 2N1WA 2XNAC 1J19A 1C77A 3L16A 3C19A 3I3TB 4YL8A 2BWES 2LHDA 1TGZB 2ZCCA 4IW0A 5FKAC 1YIWA 5AUIA 1UH6A 3VDZA 1CQVA 2NCNA 2H89B 3V61A 3Q3FA 2LFIA 2K5PA 2G1EA 4P16A 4RNAA 2LGXA 3DBHB 2LUMA 1V1OA 4GGQA 3MC0B 2AL3A 5LXIB 2B3AA 2KZRA 1N61A 4ZDVA 1OEYJ 3W1SC 4ZOHC 2K22A 1ZOYB 4NJCA 1FFUA 5E6JA 1HTOA 2RMMA 1BMLC 3B2GA 3L4PA 2INCC 3EFUA 2J7QB 4J3OD 1LM8B 2AQ3B 1WY8A 4ANVA 1UWXA 1DOXA 1GTEA 3N1YC 2AEHA 2XBBC 5CHWA 3VTVA 4EUTA 4BOSC 5DCNA 3R66C 4FJZA 2GLSA 3B08A 1KLUD 4N9F4 5JHBA 4OZCA 3Q3MC 4GMVA 5JXVA 2YEPF 4HEA1 3DWGC 1FRDA 5D7GA 3NHEB 2D3AA 2W55A 4IM3A 2KO3A 1T3QA 2G45B 1OEYA 1KOTA 1T0QC 2PEAA 4ACFA 4I6PA 1V6EA 2KN5A 2KKCA 2V3NA 1Y56A 4E74A 1FCLA 4JE3B 2FIFA 1B1ZA 3QJZA 1JALA 1I4QA 1E7PB 2K9XA 1K50A 1SB3C 5GMVA 2N9XA 2LGYA 1C9FA 3UF8A 2NBWB 1KH0A 2N9EB 1I4PA 3CSFA 4NPNA 1KF6B 3QK0A 4A3PA 2WXQA 3H7PB 1V5OA 3PGEA 1WGDA 2UWQA 3Q6BA 2JVCA 2BB5A 4NZLB 4RH6A 2KACA 3NZUA 1L0XB 3PTFC 2AX5A 1VJKA 1TT5B 2JZZA 4KZCA 3NRZA 1HA5A 2M0AA 5CTRC 2K8CA 5EE0A 1RRBA 2GBMA 1R7SA 2LWPA 4EE2A 3APDA 1XF5L 3T8MA 1ZKHA 3FILA 2NBVB 5EDSA 3Q8CA 2KXJA 2N9KA 3AXCA 3EA6A 3EFCA 1I7HA 2K0PA 2DZKA 4GDKA 3GZNI 4LNOA 2BS2B 2PPHA 3MHSD 4AJYB 1WGHA 1FEHA 3AB5A 1C1YB 4A55A 2WDQB 5G55A 3RNAC 3K9OB 4KIKB 4HROA 2DZMA 3GZNB 2D10A 3ML9A 3RNCC 1K51A 1L0YB 4PK1A 2VRRB 2E6XA 4M0WA 3RNBC 4IKGA 2EMTA 2KDEB 2KMMA 1UD7A 4MGYE 1LXDA 3ZIMA 4EZJA 1SEBD 3A9JA 3ZDMC 1PYWD 1NYQA 2LGDA 2LVPA 3PRMB 2V4LA 2W82A 2PKOA 4OVVA 4HKZE 4W9JA 4A3OA 2FCQA 2ONQA 5JHAA 2GB1A 4MM3A 3ZXVA 1PUTA 4IWOA 4OZBA 1J7BA 1MHHE 4RMAA 3R2TA 3KUZA 1QOAA 1WR1A 3UQAA 2WDRB 2WU5B 4BKSA 3URYA 1CZPA 1UF0A 2KWVB 2J4XA 4AOFA 2WXOA 1D5MC 1L2NA 1D5XC 2C5LC 3SFDB 1WJ4A 2K6DB 5E6NA 3RULA 4MGKE 5D3IB 5G5GA 3ZNGC 1TY2A 4FLHA 3DHHC 4REZA 3RPFC 1GT8A 3CSTA 4HLEA 3HUIA 2L3ZA 1R4MI 3DBRB 1VDVA 2FUG1 5BYRA 2ZPNA 4HCPB 4RF1A 3VH4B 3ZTCA 5D94A 4DBGA 3OJ3A 1PGBA 1GUAB 4O1NA 5LNK1 3IG3A 3ZJVA 4DK5A 4FBJB 2QEJC 3HM6X 5IA7A 3N9YC 2Q5WD 1ZUD2 2KHWB 2O6VD 2N9PC 2KDBA 2KC1A 4FHKA 3ENEA 3TEWA 2WXIA 2ZW1A 3RFZB 3APCA 3ZUNA 4NAMA 5BYSA 1E90A 3L0WB 4GDKB 3N1ZC 1WX9A 5EE9A 2ON8A 1TZOA 4WJPA 2QIEB 2PTLA 2OHFA 3GE8C 3ABVB 2IY1B 3VUXA 2MX2A 4AUQC 4F1SA 2CHXA 1V5TA 3AEBB 4JWUC 1B9RA 1QT9A 3GS2A 4ZRKA 3LJ3A 2GOWA 2PVOD 3RNGC 2KQSA 5LXHA 2LVOA 2RD0A 3ZKJC 1QKZA 1XLOA 4KX6B 3V3XA 2O6VB 2XK5A 3TEZA 2INPE 4F8CB 2KN4A 3LYYA 1FXAA 1JWUD 4WH4A 3BWUD 5HFYA 1MJDA 1GG3A 3MJ5A 4DWFA 4AJWA 1YNTE 1K52A 2Z0DB 4MH8A 4WJQA 2BGFA 2PLPA 1ZPSA 3BY4B 3NVYA 4PYUA 4XZ4A 3A1QB 1QOBA 3H7SA 2MW5A 4WWMA 4B95A 3VUWA 4FJYA 1FFVA 4PS3A 2I1JA 5L83A 4DHZE 1XCTL 1IYFA 2IY0B 1WGKA 4WAFA 1S3SG 4GDLB 1SE2A 3RCZA 3SD5A 2AQ1B 2WXLA 1UBIA 4LJPB 2MRPA 1EO6A 3WIMA 3AE2B 1KRHA 1YQBA 2J53A 1HQRD 2QC8A 3MC8A 2I1KA 2MJEA 1C4PA 1OQYA 2K39A 1A5RA 4LNIA 3T3NA 2EELA 3SDLC 4YT0B 1N5XA 1L4DB 4NNJB 4GU2A 3A33B 2KJRA 1GPXA 1V80A 2IGDA 3P4QB 1WFYA 5BO4B 4CO7A 2DBYA 1YMHE 4GN1A 2D5GA 1YJJA 1H8CA 2FCSA 4WWPA 4IWPA 4KGTA 3IXSA 3AE8B 3ML8A 1XEEA 3EC8A 1GOZA 4AWJA 1C79A 4GXBA 3DHIC 4GB9A 4DXFA 4WWNA 2JY6A 2NBUA 3NS8A 2JX5A 1TY0A 5AUKA 1DYQA 4PS8A 1D3ZA 2DWQA 1JCKB 2BVCA 1XO3A 3MFGA 2KWDA 1VZ6A 4BZAA 4KGSA 4FHJA 2Y5BB 2MWSB 4URKA 1T0RC 4K3BA 1TIFA 2R2QA 2SEBD 1N6ZA 4TUUA 2DX5B 2EKIA 1X1MA 1OFFA 1V2YA 3PHWB 1F52A 1WYWB 2LEKA 3PREA 3P4RB 4HVBA 2IDYA 2MP2A 3ONSA 1ROEA 1GTHA 3B1LX 2MBHA 2FIDA 3ZW3A 2K3UA 4ZRQA 3W5UB 4MJSA 3H9DA 3U7DA 5IN7A 4C56C 2KJHB 1UUPA 3N30A 2Y5CA 1JWAD 3IBEA 2WX0A 2KAJA 1ZDVA 2C7HA 5IAAC 1C76A 2AWTA 2GMIC 2IO3B 1L6VA 4TKNA 4GIVA 3TJPA 2JWZA 1LGRA 1T0SC 1HXYD 3FILB 2PE6B 1MHXA 4WAAA 3IHPC 1AW7A 3B0AA 3I9V1 3ZQ4A 1SF0A 1IP9A 1WGRA 3Q3NC 2KTRB 4XC2A 2V9HA 3ETRA 3AE6B 1L4ZB 4OHJA 3NVWA 5DPSA 2MQJA 2JXTA 4HPPA 3NJTA 3V05A 2BYVE 3V6CB 3ZLZA 1I4XA 4ARIA 1Q5WB 2HTHA 2HE7A 4RM8A 4OW0A 3Q14C 2KWCA 2QJLA 4C4VB 3KYDD 5D2MB 5MPOA 1TTNA 2G9HD 4C4VA 2L05A 3QIJA 2KNBA 1F2RI 2IO0B 4BKTA 2BB6A 1QF6A 2GBRA 1V9JA 1Z2MA 3I57A 3GOEA 1WIAA 3T3OA 2QDFA 3WA0A 4HCNB 3LDZE 4ZYSA 3O13A 1IGCA 1M4VA 2KTFA 1HZ6A 1JWMD 3SU8X 3APFA 1FO4A 4MM3B 1ZGUB 1NVID 2J0MA 1J7CA 3EECA 4S17A 1YN3A 1F2RC 5I4DA 1WXMA 4YSXB 2M8SA 2L8JA 4LTUA 3VTWA 1WJNA 2PIAA 3VVWB 4A6QA 4II2B 1P98A 2DYOA 3KYCD 2KDFB 3HVDA 2IJ0A 3MHZA 2KJ6A 4ZHPA 2LJ5A 4ANXA 1EU4A 5CHVC 3IAM1 4NJ6A 2WX1A 3Q2AC 1T5XD 2LGIA 2K25A 1V49A 3H7PA 4A90A 1EF5A 4ASWC 4YTMB 4FJVB 1BXTA 1WZ3A 4IC7B 4A9AA 3HHMA 2Z0EB 2KFKB 1VRAB 1PQSA 2IGHA 4WIPA 3VQIA 1V1PA 2X38A 4XE0A 1AYFA 4WQMA 1N5WA 1UGJA 2WXGA 4XWWA 3AE3B 3PV1A 3D32A 2R61A 5FK9C 5E6PA 2BYTA 1XLPA 2RDHA 4LJOB 3SFEB 2G4SA 2M17A 2PVGC 3NVZA 3WAMA 2GBKA 4E71A 3AN1A 1K53A 3KLSX 4M01A 5E6OA 1NBFC 3Q8FA 4W9DA 1HTQA 3L54A 4JIOU 3U7ZA 2JT4B 3NZ3A 2NMQA 1C78A 1RYJA 2OOBB 3NUHB 3L08A 1ISNA 2WDTB 4KIKA 4W9LA 3AE1B 5AZGA 1VCBA 1OQQA 2DNFA 4NJ7A 1PGXA 3VTUA 1E0ZA 2CHWA 1AN8A 4H2AA 3TSSA 2QMTA 2EKEC 4P6VF 2WS3B 3S2AA 1V81A 2O6VA 4WQOB 3ZRCA 2XEWA 1ZDXA 1R4NI 2DZJA 1TBEA 2I38A 3QQ8B 2FUHB 4BFRA 2M19A 3H6NA 1QZEA 4YTPB 4ZRIA 2WLBA 3VR9B 3TEYA 2ZCBA 1UELA 1FXIA 1WE6A 4XX5A 4RFBA 4EZKA 1ET9A 1E5WA 2SAKA 3SHQA 2D2QA 2R2OA 3KW5B 1T6BX 1VD2A 2UYZB 4ZRJA 3NY5A 4RGOS 1SJHD 2BPSA 3QC8B 4N59A 3B2FA 1YOVB 3DPDA 2WXJA 4KKJA 4IWQA 4ARCA 1L0VB 2PW9A 3DBHI 3DQVA 2MBQA 4PT5A 2IO1B 1GB1A 1WM2A 4WURA 1NI3A 1WF9A 4W9EA 2V3SA 2CU3A
chains in the Genus database with same CATH topology
2BS3B 1XLQA 2KDMA 1XCTL 2JQRB 3LB8C 1CK1A 4LK0M 4C7ZA 1WGKA 4WAFA 4GDLB 1E9MA 3PZ7A 1SE2A 4L23A 3VR8B 2AQ1B 2J42A 3BK1A 4TSSA 2WXLA 2FBWB 4RCOA 3W2DA 1A70A 3P1MA 3IAS1 3AE2B 1KRHA 2XNAC 2J53A 3FC4A 4TMAB 1C77A 2QSDA 1E10A 5EE1A 1HQRD 1RWSA 2MJEA 5TSSA 1NEKB 1C4PA 3BVMA 2LHDA 2WXNA 4HKQA 1ZXHA 1QQRA 5FKAC 3T3NA 2EELA 3AEEB 3CIRB 5AUIA 4YT0B 1N5XA 1TS5A 1L4DB 3Q8BA 1WSPA 2Y3AA 1GPXA 2IGDA 4ITKA 1DOYA 3P4QB 1CQVA 1DOIA 1KTKA 2RDGA 3GB1A 3ZYYX 2H89B 2DBYA 1YMHE 2D5GA 2KQ4X 1YJJA 2LFIA 2K5PA 4YWGG 2G1EA 4P16A 3BIID 4RNAA 4KGTA 3IXSA 3AE8B 3BYYB 1SJED 3Q69A 1XEEA 2I2YA 1JWBD 2LUMA 1GOZA 1V1OA 3MC0B 3BVGA 1C79A 5BMIA 4DXFA 1N61A 1ENFA 3HVZA 4ZOHC 2K22A 2W3SA 1ZOYB 3HRDD 4NJCA 3W9CB 4L1BA 2JX5A 1FFUA 1TY0A 2LMCA 1DYQA 5E6JA 5AUKA 5HG2A 2RMMA 1TJEA 1BMLC 5FR3A 3AECB 2DWQA 2ZW0A 3B2GA 3L4PA 4L2YA 1JCKB 1D6EC 4KKIA 1FM0D 1WRIA 4J3OD 3ZGZA 1XO3A 3MFGA 3BZDB 2AQ3B 1UWXA 2KWDA 3GP7A 1DOXA 1VZ6A 3H8HA 1H7WA 1GTEA 4YXDB 4MT5A 4KGSA 2MJDA 1J7AA 5T8IA 4C7YA 1KLUD 4HRSA 1BUIC 5GXGB 1TYGB 2WXMA 1JROA 2SEBD 2INNE 1YQ4B 3BK2A 4OZCA 4DQOC 3W1SA 2V4IB 4DXGA 5JXVA 2EKIA 2YEPF 4HEA1 1OFFA 3U4EG 1UNSA 3DWGC 1FRDA 5D7GA 5H92C 2LEKA 2W55A 3P4RB 4FXCA 2IDYA 4AQ7A 2N9LA 2WXHA 1PFDA 1T3QA 4JPSA 1ROEA 1GTHA 2H88B 2JWUA 3PZ8A 1FNUA 1QLBB 2VZKD 2K3UA 1FNWA 1DGJA 4ZRQA 1PGAA 2DLBA 2E3TA 3W5UB 2ACZB 2V3PA 4A8XC 2V3NA 1Y56A 1VR9A 4C56C 1FCLA 4JE3B 2LJIA 1UUPA 4Q2JA 2Y5CA 2WQYB 1B1ZA 1JWAD 1Q10A 3IT6B 1YN4A 1TS3A 1QOFA 2KAJA 1JALA 1ZDVA 2DYMA 1I4QA 1E7PB 4AS1A 1C76A 3E56A 2K9XA 1K50A 1I4GA 1L6VA 1SB3C 4NAWB 2BW2A 4R3DA 1HXYD 1C9FA 3NS1A 3FILB 1FCCC 1MHXA 3Q8EA 1AW7A 1KH0A 1I4PA 3EGRA 1KF6B 3I9V1 1SF0A 3ZQ4A 1MI0A 1TKGA 1N60A 2WXQA 1XLNA 4B0MA 1AWDA 1VZ8A 4YSZB 2BB5A 3J9CA 4NZLB 4RH6A 2KACA 3ETRA 1L0XB 3AE6B 3VRAB 1L4ZB 2AX5A 1N63A 4OHJA 3NVWA 5BMHA 1VJKA 3KWLA 4TQ1A 4UDUC 3P63A 2JXTA 3AE9B 3NRZA 4C80A 1HA5A 2M0AA 3V05A 2JZPA 5EE0A 1I4XA 4ARIA 2LHEA 1R7SA 1CJEA 4EE2A 4OW0A 1KLGD 3TUOA 4TQ0A 1XF5L 2L83A 2QJLA 4D2KA 2N7JA 2FE8A 2JYEA 3FILA 3FAHA 2G9HD 5MPOA 3Q8CA 5D3DA 2N9KA 3EA6A 4IOIE 1F2RI 1I7HA 2K0PA 3DWMA 3KWVA 4RGMA 2BB6A 1QF6A 1SE4A 1VLBA 2BS2B 3I57A 3T3OA 3AV8A 4ZYSA 1JRPA 1SSNA 2QILA 3O13A 4USAA 1EU3A 1FEHA 1IGCA 2WXKA 3AB5A 3U52E 1M4VA 4A55A 1QILA 2WDQB 1HEZE 1HZ6A 1JWMD 3BVZA 1FO4A 4IDIA 4MM3B 1YN5A 4XDDA 3AEFB 4HROA 1NVID 1J7CA 2XN9C 3R8BA 2JSVX 1ACCA 1YN3A 1F2RC 1K51A 3P42A 4OZAA 1L0YB 2NTSA 5I4DA 1F77A 4YSXB 3AEDB 4US9A 2E6XA 4M0WA 3AH7A 3AEAB 1JQ4A 4LTUA 4IKGA 1E6EB 2VZKB 2KMMA 2PIAA 3UI3A 1SEBD 1PYWD 4A6QA 1FIQA 4YTNB 2DYOA 3EUB2 2WXFA 1NYQA 3HVDA 1QOGA 2IJ0A 3MHZA 4ZHPA 1C4AA 2W82A 1EU4A 2PKOA 4HKZE 3IAM1 1FMAD 2ONQA 3AE4B 1EWCA 2BBCA 2GB1A 1RM6C 1T5XD 4KGRA 1PUTA 2L32A 4OZBA 1PDXA 1J7BA 1FD6A 2LGIA 1MHHE 1ZXIA 3R2TA 1V8CA 1N62A 1NYRA 2BT6A 1NENB 4A90A 2MJ3A 3TEXA 1QOAA 3WCQA 4YTMB 2GI9A 2YEPB 1BXTA 2M56B 2WDRB 1ESFA 4LLGM 4A9AA 2JU6X 1H7XA 1FRRA 1P7FA 1XXGA 2WU5B 3W5VB 1VRAB 3URYA 2IGHA 2RPVA 1CZPA 2Z8LA 1JWSD 2J4XA 4CQNA 4WIPA 1KFYB 2WXOA 3VQIA 1D5MC 1V1PA 2X38A 4XE0A 1ZP0B 1AYFA 1D5XC 1VZ7A 4WQMA 3MP9A 3P4PB 1N5WA 1UGJA 2WXGA 4XWWA 3AE3B 3SFDB 1YQ3B 2R61A 1WYGA 1OQRA 4RF0A 5FK9C 2BYTA 1XLPA 4JWSC 2ICIA 2RDHA 5D3IB 5G5GA 3SFEB 1TY2A 5BMGA 1IUEA 1L5PA 4N6EB 2WXRA 4REZA 1TS4A 3RPFC 2HTME 1GT8A 3CF4A 2PVGC 3HUIA 3NVZA 1MPEA 1WXQA 1WWTA 1K53A 1VDVA 2FUG1 2Y5PA 3AN1A 3KLSX 2W3RA 4GLSC 5HI1A 5BYRA 4XDCA 1IBXA 3Q8FA 1ZE3D 4RF1A 5C3JB 3U2SC 3U7ZA 4N58A 4RGNA 2BTEA 1PGBA 4O1NA 4OVZA 5LNK1 4YSYB 3NZ3A 1EWYC 2B76B 2NMQA 1C78A 1RYJA 2L52A 4RGTA 1D4BA 3NUHB 3ZJVA 4ZHOA 5G5HA 2QEJC 2BS4B 2JYTA 3N9YC 2Q5WD 3AE1B 1ZUD2 1SIJA 2V0GA 3IT4B 1OQQA 1PGXA 1E0ZA 3KQ4A 1AN8A 3E9SA 4H2AA 1YJIA 3TSSA 2QMTA 3ZJTA 1D5ZC 3TEWA 4P6VF 2WS3B 3AEGB 2AQ2B 2WXIA 3Q8AA 4B0EA 2ZW1A 3RFZB 1TS2A 3PO0A 4NAMA 3OWEB 2NTTA 5BYSA 1GB4A 1ET6A 2WXPA 1JMLA 2CJNA 4GDKB 1MVKA 5EE9A 2CJOA 1I4RA 1ZDXA 2ON8A 2I38A 1TZOA 2IPKD 3CWIA 3SR6A 2GRIA 1UWMA 2MH7A 3LXFA 1C4CA 2M19A 1HZ5A 2QIEB 2PTLA 3AE5B 4YTPB 2OHFA 2WNMA 2WLBA 3VR9B 3ABVB 3TEYA 2W54A 2TSSA 3AM9A 4MACA 1FXIA 1TKEA 3AEBB 4RFBA 1ET9A 2MEKA 4JWUC 1B9RA 1V1PB 2SAKA 1SBBB 3C8YA 1F0ZA 1QT9A 3GS2A 2PMVA 2WDVB 2WP9B 4ZRPA 1T6BX 1FNVA 1XCQL 2PVOD 4XWTA 3SEBA 3R2IA 3AE7B 1JW9D 3AMZA 4RGOS 1SJHD 3BYTB 4N59A 1EM7A 1QKZA 1XLOA 3B2FA 4KX6B 3VRBB 1SXTA 1I4HA 3V3XA 5HHDG 3B9JA 3TEZA 1GAQB 2INPE 4JX1C 2KN4A 1FXAA 2WXJA 1JWUD 3LYYA 4HJGE 3BWUD 4KKJA 1L6UA 4WH4A 5C2TB 2HDEA 3NVVA 5HFYA 4ARCA 1SE3A 2J52A 1L0VB 3MJ5A 1V97A 4US8A 3ZJUA 1YNTE 1K52A 2PW9A 4MH8A 1IBXB 2PLPA 1ZPSA 3NVYA 1P7EA 1IGDA 5EE3A 4PT5A 2OEDA 1GB1A 5H8YE 1LO5D 1TKYA 5BYQA 1QOBA 2WU2B 4WURA 1NI3A 2IGGA 3P4SB 1RFKA 4WWMA 2L1AA 1STEA 2N0SB 1FFVA 2CU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  1J7C A;  1OFF A;  1RYJ A;  1XLQ A;  2L52 A;  3DWG C;  2JQR B;  3LB8 C;  1FRD A;  4ZHO A;  5G5H A;  4C7Z A;  1WGK A;  5H92 C;  1E9M A;  2BS4 B;  2LEK A;  2W55 A;  4YSX B;  3AED B;  4US9 A;  3P4R B;  2Q5W D;  3VR8 B;  3AE1 B;  1ZUD 2;  4FXC A;  3AH7 A;  2FBW B;  3AEA B;  1PFD A;  1T3Q A;  1SIJ A;  1JQ4 A;  1OQQ A;  4LTU A;  1ROE A;  1GTH A;  1E6E B;  1A70 A;  2H88 B;  1E0Z A;  3P1M A;  2KMM A;  3AE2 B;  1KRH A;  1QLB B;  2PIA A;  3FC4 A;  1E10 A;  5EE1 A;  1DGJ A;  1YJI A;  1RWS A;  2MJE A;  4P6V F;  1NEK B;  2WS3 B;  3AEG B;  1FIQ A;  4YTN B;  3EUB 2;  2E3T A;  1NYQ A;  3W5U B;  2ACZ B;  1QOG A;  4ZHP A;  3PO0 A;  2Y5C A;  2WQY B;  1JWA D;  2PKO A;  2CJN A;  3AEE B;  3CIR B;  1FMA D;  5AUI A;  4YT0 B;  1N5X A;  1QOF A;  2KAJ A;  1JAL A;  5EE9 A;  3AE4 B;  1E7P B;  2CJO A;  1RM6 C;  2K9X A;  1SB3 C;  3CWI A;  1L6V A;  1PUT A;  3SR6 A;  1PDX A;  1J7B A;  1UWM A;  2MH7 A;  1GPX A;  3LXF A;  4ITK A;  2M19 A;  3NS1 A;  1ZXI A;  1DOY A;  2QIE B;  3P4Q B;  1DOI A;  3AE5 B;  1N62 A;  1NYR A;  4YTP B;  1V8C A;  1NEN B;  2BT6 A;  2OHF A;  2WLB A;  3VR9 B;  2MJ3 A;  3ABV B;  3ZYY X;  2H89 B;  1KF6 B;  1QOA A;  1SF0 A;  2DBY A;  3WCQ A;  4YTM B;  2W54 A;  1YJJ A;  3AM9 A;  1TKG A;  1FXI A;  2WDR B;  1N60 A;  1TKE A;  2K5P A;  2M56 B;  3AEB B;  2G1E A;  4A9A A;  1XLN A;  1H7X A;  1FRR A;  4JWU C;  3BII D;  1B9R A;  1AWD A;  4YSZ B;  3AE8 B;  1F0Z A;  2WU5 B;  1QT9 A;  1JWB D;  3W5V B;  2WDV B;  2WP9 B;  3ETR A;  3AE6 B;  1CZP A;  2PVO D;  3VRA B;  2AX5 A;  1N63 A;  3NVW A;  3AE7 B;  1JW9 D;  1VJK A;  3AEF B;  1KFY B;  3AMZ A;  3KWL A;  1N61 A;  3P63 A;  3HVZ A;  4N59 A;  4ZOH C;  2K22 A;  1XLO A;  3B2F A;  4KX6 B;  3VRB B;  1ZP0 B;  1ZOY B;  2W3S A;  3HRD D;  1AYF A;  3AE9 B;  3NRZ A;  3W9C B;  3B9J A;  4WQM A;  4C80 A;  3P4P B;  1GAQ B;  1N5W A;  1FFU A;  2JX5 A;  5AUK A;  4JX1 C;  5EE0 A;  3AE3 B;  1FXA A;  1TJE A;  3SFD B;  1L6U A;  1YQ3 B;  3AEC B;  5C2T B;  1OQR A;  1WYG A;  2DWQ A;  3B2G A;  1R7S A;  1CJE A;  1XLP A;  3L4P A;  4JWS C;  5G5G A;  1L0V B;  4US8 A;  1FM0 D;  1WRI A;  1V97 A;  2L83 A;  1XO3 A;  3SFE B;  2QJL A;  3FAH A;  5MPO A;  1IUE A;  1L5P A;  1DOX A;  4N6E B;  1FFV A;  3NVY A;  1H7W A;  1GTE A;  4YXD B;  1I7H A;  2HTM E;  3DWM A;  3RPF C;  5EE3 A;  1GT8 A;  3CF4 A;  2PVG C;  3HUI A;  3NVZ A;  1QF6 A;  5H8Y E;  1WXQ A;  1TKY A;  2MJD A;  1J7A A;  1VLB A;  2BS2 B;  1QOB A;  1WWT A;  3AN1 A;  1VDV A;  4C7Y A;  3NVV A;  2W3R A;  2WU2 B;  3AV8 A;  4HRS A;  1NI3 A;  5GXG B;  1JRP A;  4USA A;  3P4S B;  1RFK A;  1TYG B;  5C3J B;  3AB5 A;  4WWM A;  1JRO A;  2WDQ B;  1YQ4 B;  4N58 A;  1FO4 A;  2N0S B;  4IDI A;  2EKI A;  4YSY B;  4HRO A;  1NVI D;  1EWY C;  2B76 B;  2CU3 A; 
#chains in the Genus database with same CATH topology
 2BS3 B;  2NPT B;  2JF5 A;  2JQR B;  1GJZ A;  3LB8 C;  4C7Z A;  3MTN B;  2KFK A;  4M0W B;  2J42 A;  3BK1 A;  1A70 A;  1XD3 B;  3P1M A;  4TMA B;  1E10 A;  3UIP B;  3UQB A;  1RWS A;  2K6Q A;  5TSS A;  3ZXR A;  2NS5 A;  3BVM A;  1MG4 A;  3A9K A;  4FUL A;  1KJT A;  3NZS A;  4HKQ A;  2O2V A;  1NI2 A;  2RDB C;  2IND C;  2Y3A A;  2EMS A;  1DOY A;  3QX1 A;  1DOI A;  1KTK A;  3GB1 A;  3ZYY X;  3DBS A;  4NQK E;  1UGM A;  3A4R A;  5AZF A;  4FAD A;  3BII D;  4RM9 A;  4HWI B;  5J17 A;  3M63 B;  3Q69 A;  1E7U A;  3M3J A;  2L0F A;  5BMI A;  4KDI C;  3L13 A;  1ENF A;  3MJW A;  3HRD D;  1E7V A;  2LMC A;  3M95 A;  1WMH A;  5HG2 A;  1TJE A;  4A20 A;  1WMH B;  2K8B A;  1S1Q B;  2ZW0 A;  3AUL A;  1P3Q U;  3ZGZ A;  2DZI A;  2J0K A;  4XGA B;  3BZD B;  3GP7 A;  4MSQ B;  4W9K A;  3H8H A;  1H7W A;  4MT5 A;  4FN2 A;  4ANU A;  2MCN B;  1J7A A;  5T8I A;  4C7Y A;  4II3 B;  2JXX A;  2LRW A;  4HRS A;  5GXG B;  1TYG B;  1K8R B;  2WXM A;  1JRO A;  4W9H A;  1F9J A;  1WXA A;  1YQ4 B;  4GDL A;  3JVZ X;  4DQO C;  3W1S A;  5IOI A;  4DXG A;  1TZ1 A;  4MDK E;  3R7Q A;  1UNS A;  4OVU A;  2ZEQ A;  3N1X C;  2D3B A;  5H92 C;  5IP4 D;  4GOC A;  4FXC A;  4AQ7 A;  2N9L A;  2WXH A;  1PFD A;  2KC2 A;  3VH3 B;  2H88 B;  3I5J C;  4MSM B;  2ZVN A;  3RI7 C;  4K7S A;  3PZ8 A;  1FNU A;  5DPR A;  2VZK D;  2C7N B;  1PGA A;  2DLB A;  2E3T A;  4A8X C;  1VR9 A;  2KAN A;  3AU5 A;  2WQY B;  3IT6 B;  4JLC A;  1YN4 A;  1TS3 A;  2DYM A;  4W9C A;  4AS1 A;  3KUD B;  5C23 A;  3E56 A;  1YX5 B;  2HD5 B;  1I4G A;  4NAW B;  4B9K A;  2BW2 A;  4NAW A;  2FCM A;  4R3D A;  3ZRF A;  5J18 A;  3NS1 A;  1YJ1 A;  3Q8E A;  2KVR A;  3V6E B;  3EGR A;  2RPQ A;  1MI0 A;  1N60 A;  1RAX A;  3KH0 A;  3QWZ B;  3HK0 A;  4B0M A;  4ANW A;  4S0R A;  1WX8 A;  5J2R A;  3J9C A;  5JH5 C;  2OJW A;  3JSV A;  1N63 A;  4CHK A;  3RN9 C;  3C0R B;  5BMH A;  3KWL A;  4TQ1 A;  4UDU C;  1SE9 A;  3P63 A;  1L7Y A;  3RYT A;  5DPW A;  2L7R A;  2DAF A;  3AE9 B;  4C80 A;  2N7D A;  2LRU A;  2JZP A;  2KDI A;  3TUO A;  4TQ0 A;  4MGI E;  3FAH A;  2FE8 A;  2G3Q B;  2N1V A;  2O2V B;  1GC7 A;  4HK2 A;  4IOI E;  4LNK A;  2WYQ A;  1SE4 A;  2CHZ A;  4G3X B;  1SSN A;  2QIL A;  4G11 A;  1MG8 A;  2WXK A;  4M00 A;  3BVZ A;  2CKH B;  1R4N B;  1SIF A;  4XDD A;  3DVG X;  2MP2 B;  2XN9 C;  2KQ7 A;  3PSE B;  3R8B A;  1V86 A;  1ACC A;  3DVG Y;  2V1Y A;  2FCN A;  3P42 A;  4P7I A;  4OZA A;  2NTS A;  2XK5 B;  3DOW A;  4IM2 A;  3X0W A;  4E3C A;  1JQ4 A;  4DHJ B;  3ZDT A;  4BVU C;  1C3T A;  1MFW A;  1GC6 A;  2ASQ A;  2K1F A;  4JGH B;  1WR6 E;  2IO2 B;  4YTN B;  3EUB 2;  1EUV B;  1QOG A;  2C7M B;  4QAY A;  2AYO B;  3ALB A;  4ZYN A;  3ZTD A;  4MJS B;  4KGR A;  3ZNH B;  1PDX A;  3DBL I;  4BOZ B;  1Q1O A;  1N62 A;  1NYR A;  2BT6 A;  1NEN B;  3PT2 B;  2MJ3 A;  3WCQ A;  2GI9 A;  2YEP B;  2J0J A;  2DEN B;  1ESF A;  4LLG M;  2JU6 X;  3OLM D;  1H7X A;  1FRR A;  1WXV A;  2A5U A;  2LAS A;  2BKR B;  4LCD E;  1XXG A;  3RD2 A;  4KZ0 A;  2WWZ A;  2RPV A;  2Z8L A;  4LDT D;  1JWS D;  4CQN A;  5G2N A;  2WGS A;  1KFY B;  3TMP B;  3KUC B;  3N3K B;  3OG5 A;  3MP9 A;  3P4P B;  4MGZ E;  2REX A;  2LZ6 A;  4DHJ D;  2WHI A;  5BMG A;  2WXR A;  2HTM E;  1MPE A;  3U4E G;  5HI1 A;  2Y5P A;  4GLS C;  2W3R A;  3RT3 B;  4W9G A;  1IBX A;  4KSL C;  3EHV A;  2BYE A;  2BTE A;  4LNF A;  4NQL B;  1D4B A;  2A4Z A;  3R7R A;  4ZHO A;  5G5H A;  2C9W B;  2BS4 B;  1P1A A;  2JYT A;  2M0X A;  5KHO A;  1SIJ A;  1OGW A;  1WJU A;  2BQQ A;  3E9S A;  2ZNV B;  3DDC B;  1YJI A;  2IZV B;  3ZJT A;  4W9F A;  1D5Z C;  4BAX A;  1KLV A;  2AQ2 B;  2N7E A;  2RR9 A;  4B0E A;  1M94 A;  1TS2 A;  3PO0 A;  5C1Z A;  1ET6 A;  3NOB A;  1JML A;  4BKG A;  2BKF A;  2X8X X;  3PVL A;  3A1Q A;  3CWI A;  3SR6 A;  2GRI A;  1C4C A;  2GBN A;  3AE5 B;  4JQW C;  2PJH A;  3HM3 A;  3BIN A;  2JZ3 B;  3AM9 A;  4MAC A;  1WGG A;  1TKE A;  3Q3J A;  1J0G A;  3AU4 A;  2MEK A;  3K9P B;  1V1P B;  2C60 A;  4HJK A;  1SBB B;  3C8Y A;  3JW0 X;  4PS7 A;  4ZRP A;  2PE9 A;  3ZNZ B;  4BBN F;  3UIN B;  3R2I A;  1JW9 D;  3AMZ A;  4DXA B;  3RNE C;  3BYT B;  1P0R A;  1R4M B;  3DBR I;  2LD9 A;  2OJR A;  1WZ0 A;  1GAQ B;  1UBQ A;  2MLB A;  4HDQ A;  3V60 A;  3W1Y A;  2LGS A;  4HJG E;  1IPG A;  2ZVO A;  4KSK C;  1SE3 A;  2J52 A;  4LNN A;  3PLU A;  1P7E A;  4MH0 E;  2LVQ A;  1YX6 B;  3IVF A;  5H8Y E;  5BYQ A;  1WX7 A;  2VH2 A;  2IGG A;  3MC9 A;  1RFK A;  3P4S B;  3PS6 A;  2L1A A;  4CYE A;  1STE A;  2N0S B;  2BWF A;  1XLQ A;  5DPT A;  4HPM B;  1E9M A;  1H4R A;  3X23 A;  3OJ4 B;  3VR8 B;  3OAW A;  4TSS A;  2FBW B;  2QHO A;  4RCO A;  4K1R B;  2KX0 A;  3W2D A;  1YD8 U;  3PRZ A;  3IAS 1;  3DVN U;  2NR2 A;  3FC4 A;  3DBL B;  2QSD A;  4ICU A;  5EE1 A;  1WI0 A;  1NEK B;  2D3G A;  1E8W A;  2WXN A;  3ZVV A;  2CU1 A;  1ZXH A;  1QQR A;  2K8H A;  3AEE B;  3CIR B;  1TS5 A;  2L0T A;  3Q8B A;  1WSP A;  2CR5 A;  3NG0 A;  4ITK A;  3RNF C;  3L10 B;  2KWU B;  1SGH A;  5AEK B;  2RDG A;  1WJ6 A;  2BF8 B;  3O65 B;  3DCG A;  4EKU A;  2KQ4 X;  3A4S C;  2M1M A;  4YWG G;  1F1H A;  2LXA A;  3BYY B;  1SJE D;  2I2Y A;  1JWB D;  5IKC M;  2KVZ A;  2KT7 A;  3BVG A;  2YLM A;  3ZNI D;  2KMA A;  3PLV A;  3HVZ A;  1FPY A;  2W3S A;  3W9C B;  4MEM A;  2KLG A;  4L1B A;  1WXS A;  4G0N B;  5FR3 A;  3AEC B;  4L2Y A;  2KMC A;  1XT9 B;  1D6E C;  1XQQ A;  1FM0 D;  1WRI A;  2N4F A;  4HXD A;  4KKI A;  3PHX B;  4DHZ B;  4KVG B;  4YXD B;  2FNJ B;  3N32 A;  2MJD A;  3PPA A;  2NPT A;  1BUI C;  2INN E;  3BK2 A;  2CS4 A;  2V4I B;  4KDL B;  4M02 A;  5AZH A;  4IUM B;  2KTR A;  2L76 A;  2BYF A;  2D3C A;  4I6N B;  4XYC A;  2KK8 A;  3A9J B;  4B6W A;  2NVU I;  4JPS A;  2JWU A;  1QLB B;  1FNW A;  4BKS D;  1DGJ A;  5HKH A;  2ACZ B;  2V3P A;  3UIO B;  2LJI A;  2ZPY A;  4Q2J A;  1Q10 A;  2UU7 A;  1CMX B;  1QOF A;  4EFO A;  2AL6 A;  3IFW B;  3WAN A;  4AP4 C;  3R3M A;  1FCC C;  1UZX B;  5L95 C;  3VAW A;  1RLF A;  2MBE A;  4IG7 B;  1TKG A;  2VH1 A;  1XLN A;  4EEW A;  4PYZ A;  1AWD A;  1VZ8 A;  4YSZ B;  1T0Y A;  5KHQ A;  2KD0 A;  4MEL A;  3RMK C;  3VRA B;  5IO9 A;  2RSU A;  1EF1 A;  3DVN V;  4K7U A;  3TCA A;  2HJ1 A;  3N20 C;  2LHE A;  2YVC A;  1CJE A;  1Z5S B;  1KLG D;  3QHT A;  3QAQ A;  2L83 A;  4D2K A;  2N7J A;  2JYE A;  3RZW C;  5D3D A;  3DWM A;  3KWV A;  4RGM A;  4X57 B;  2JUO A;  1VLB A;  3UGB B;  3AV8 A;  1JRP A;  4USA A;  4I6L B;  3U52 E;  1EU3 A;  4P1C C;  1QIL A;  1HEZ E;  5TR5 A;  4IDI A;  2ZNV C;  1E8Y A;  1YN5 A;  3AEF B;  2MHJ A;  3HIZ A;  2JSV X;  2MBB B;  1F77 A;  3AED B;  1OTR B;  4US9 A;  1E8X A;  3L17 A;  5JZE B;  3AH7 A;  3PRP B;  3AEA B;  3VFK A;  1E6E B;  2VZK B;  3VHT C;  3UI3 A;  5LLI A;  1FIQ A;  2WXF A;  2ZZP B;  3WAP A;  1C4A A;  3CF6 E;  4ICV A;  5D6J B;  4JL9 A;  4FA6 A;  1FMA D;  4HDO A;  2GBJ A;  2MSE D;  2JRH A;  3AE4 B;  1EWC A;  2BBC A;  1RM6 C;  2DYB A;  2L32 A;  3JYU A;  1FD6 A;  2HJ8 A;  4LDT B;  1ZXI A;  3WAL A;  1V8C A;  3ZO5 B;  3TEX A;  3VUY A;  1LFD A;  2M56 B;  2QCZ A;  4W9I A;  4TV3 A;  1P7F A;  1ZW7 A;  3W5V B;  2JRI B;  4K7W A;  3RZF A;  4NY0 A;  3ECI A;  2IYD B;  2DHZ A;  1ZP0 B;  2LI5 A;  1VZ7 A;  5CHF A;  2KYW A;  1KM7 A;  2KLC A;  3GE3 C;  1JRU A;  1NDD A;  1YQ3 B;  4RF0 A;  1WYG A;  1OQR A;  1P9D U;  2G4D B;  1HE8 A;  4JWS C;  4P1B C;  2ICI A;  3RUI B;  4KV2 A;  4C00 A;  1IUE A;  2JPH A;  1L5P A;  1BT0 A;  4N6E B;  1RFA A;  1TS4 A;  3TBL D;  1Q0W B;  4DDI D;  3CF4 A;  2L00 B;  2Z59 B;  1WXQ A;  1WWT A;  3TIX A;  1WE7 A;  4XDC A;  1ZE3 D;  5C3J B;  3U2S C;  2FAZ A;  3WAO A;  4N58 A;  4J6I A;  4RGN A;  4OVZ A;  4YSY B;  1EWY C;  2B76 B;  3DHG C;  2L52 A;  4RGT A;  1I35 A;  2KFJ A;  3TL5 A;  3U8Z A;  3P2B A;  4GSW A;  1WRD B;  4DDG D;  3FKY A;  1WGY A;  3KVF B;  2V0G A;  3IT4 B;  2ZJD A;  2LXC A;  2M4N A;  3KQ4 A;  4EZL A;  3I63 C;  1J8C A;  2RGF A;  3AEG B;  3Q8A A;  1FXT B;  1WH3 A;  4HPL B;  3OWE B;  2NTT A;  1GB4 A;  4BBN C;  2WXP A;  2CJN A;  1MVK A;  1WM3 A;  2CJO A;  1I4R A;  2IPK D;  1I42 A;  1UWM A;  2MH7 A;  3LXF A;  1HZ5 A;  4WJN A;  2WNM A;  4M8N A;  1E8Z A;  2W54 A;  2TSS A;  1F0Z A;  3V62 A;  2D07 B;  2PMV A;  2WDV B;  3QA8 A;  2WP9 B;  3U30 A;  3Q3O C;  3H1U A;  1FNV A;  1XCQ L;  4XWT A;  3SEB A;  3PZD A;  3QCA A;  3AE7 B;  2LUE A;  2DAJ A;  5FR6 A;  4K81 A;  1EM7 A;  3VRB B;  1SXT A;  1I4H A;  3VXW A;  5HHD G;  1GNU A;  3B9J A;  4JX1 C;  1Y8R C;  4M8M A;  3A9K B;  3CMM B;  1L6U A;  5C2T B;  2HDE A;  3NVV A;  5CX3 A;  4F7Z A;  4US8 A;  1V97 A;  3ZJU A;  4G50 A;  1U4A A;  1IBX B;  2KX3 A;  1IGD A;  5EE3 A;  2W9N A;  2OED A;  4WJO A;  1LO5 D;  1TKY A;  2KOX A;  3T9L A;  2WU2 B;  4WWO A;  4IM0 A;  3AI5 A;  4K3C A;  3JSV B;  1G6J A;  3QAR A;  2KDM A;  2MA9 B;  1CK1 A;  4LK0 M;  1AAR A;  3PZ7 A;  4L23 A;  2IBI B;  3M62 B;  1LQB A;  2MBO A;  2D11 A;  4EOY A;  2N1W A;  2XNA C;  1J19 A;  1C77 A;  3L16 A;  3C19 A;  3I3T B;  4YL8 A;  2BWE S;  2LHD A;  1TGZ B;  2ZCC A;  4IW0 A;  5FKA C;  1YIW A;  5AUI A;  1UH6 A;  3VDZ A;  1CQV A;  2NCN A;  2H89 B;  3V61 A;  3Q3F A;  2LFI A;  2K5P A;  2G1E A;  4P16 A;  4RNA A;  2LGX A;  3DBH B;  2LUM A;  1V1O A;  4GGQ A;  3MC0 B;  2AL3 A;  5LXI B;  2B3A A;  2KZR A;  1N61 A;  4ZDV A;  1OEY J;  3W1S C;  4ZOH C;  2K22 A;  1ZOY B;  4NJC A;  1FFU A;  5E6J A;  1HTO A;  2RMM A;  1BML C;  3B2G A;  3L4P A;  2INC C;  3EFU A;  2J7Q B;  4J3O D;  1LM8 B;  2AQ3 B;  1WY8 A;  4ANV A;  1UWX A;  1DOX A;  1GTE A;  3N1Y C;  2AEH A;  2XBB C;  5CHW A;  3VTV A;  4EUT A;  4BOS C;  5DCN A;  3R66 C;  4FJZ A;  2GLS A;  3B08 A;  1KLU D;  4N9F 4;  5JHB A;  4OZC A;  3Q3M C;  4GMV A;  5JXV A;  2YEP F;  4HEA 1;  3DWG C;  1FRD A;  5D7G A;  3NHE B;  2D3A A;  2W55 A;  4IM3 A;  2KO3 A;  1T3Q A;  2G45 B;  1OEY A;  1KOT A;  1T0Q C;  2PEA A;  4ACF A;  4I6P A;  1V6E A;  2KN5 A;  2KKC A;  2V3N A;  1Y56 A;  4E74 A;  1FCL A;  4JE3 B;  2FIF A;  1B1Z A;  3QJZ A;  1JAL A;  1I4Q A;  1E7P B;  2K9X A;  1K50 A;  1SB3 C;  5GMV A;  2N9X A;  2LGY A;  1C9F A;  3UF8 A;  2NBW B;  1KH0 A;  2N9E B;  1I4P A;  3CSF A;  4NPN A;  1KF6 B;  3QK0 A;  4A3P A;  2WXQ A;  3H7P B;  1V5O A;  3PGE A;  1WGD A;  2UWQ A;  3Q6B A;  2JVC A;  2BB5 A;  4NZL B;  4RH6 A;  2KAC A;  3NZU A;  1L0X B;  3PTF C;  2AX5 A;  1VJK A;  1TT5 B;  2JZZ A;  4KZC A;  3NRZ A;  1HA5 A;  2M0A A;  5CTR C;  2K8C A;  5EE0 A;  1RRB A;  2GBM A;  1R7S A;  2LWP A;  4EE2 A;  3APD A;  1XF5 L;  3T8M A;  1ZKH A;  3FIL A;  2NBV B;  5EDS A;  3Q8C A;  2KXJ A;  2N9K A;  3AXC A;  3EA6 A;  3EFC A;  1I7H A;  2K0P A;  2DZK A;  4GDK A;  3GZN I;  4LNO A;  2BS2 B;  2PPH A;  3MHS D;  4AJY B;  1WGH A;  1FEH A;  3AB5 A;  1C1Y B;  4A55 A;  2WDQ B;  5G55 A;  3RNA C;  3K9O B;  4KIK B;  4HRO A;  2DZM A;  3GZN B;  2D10 A;  3ML9 A;  3RNC C;  1K51 A;  1L0Y B;  4PK1 A;  2VRR B;  2E6X A;  4M0W A;  3RNB C;  4IKG A;  2EMT A;  2KDE B;  2KMM A;  1UD7 A;  4MGY E;  1LXD A;  3ZIM A;  4EZJ A;  1SEB D;  3A9J A;  3ZDM C;  1PYW D;  1NYQ A;  2LGD A;  2LVP A;  3PRM B;  2V4L A;  2W82 A;  2PKO A;  4OVV A;  4HKZ E;  4W9J A;  4A3O A;  2FCQ A;  2ONQ A;  5JHA A;  2GB1 A;  4MM3 A;  3ZXV A;  1PUT A;  4IWO A;  4OZB A;  1J7B A;  1MHH E;  4RMA A;  3R2T A;  3KUZ A;  1QOA A;  1WR1 A;  3UQA A;  2WDR B;  2WU5 B;  4BKS A;  3URY A;  1CZP A;  1UF0 A;  2KWV B;  2J4X A;  4AOF A;  2WXO A;  1D5M C;  1L2N A;  1D5X C;  2C5L C;  3SFD B;  1WJ4 A;  2K6D B;  5E6N A;  3RUL A;  4MGK E;  5D3I B;  5G5G A;  3ZNG C;  1TY2 A;  4FLH A;  3DHH C;  4REZ A;  3RPF C;  1GT8 A;  3CST A;  4HLE A;  3HUI A;  2L3Z A;  1R4M I;  3DBR B;  1VDV A;  2FUG 1;  5BYR A;  2ZPN A;  4HCP B;  4RF1 A;  3VH4 B;  3ZTC A;  5D94 A;  4DBG A;  3OJ3 A;  1PGB A;  1GUA B;  4O1N A;  5LNK 1;  3IG3 A;  3ZJV A;  4DK5 A;  4FBJ B;  2QEJ C;  3HM6 X;  5IA7 A;  3N9Y C;  2Q5W D;  1ZUD 2;  2KHW B;  2O6V D;  2N9P C;  2KDB A;  2KC1 A;  4FHK A;  3ENE A;  3TEW A;  2WXI A;  2ZW1 A;  3RFZ B;  3APC A;  3ZUN A;  4NAM A;  5BYS A;  1E90 A;  3L0W B;  4GDK B;  3N1Z C;  1WX9 A;  5EE9 A;  2ON8 A;  1TZO A;  4WJP A;  2QIE B;  2PTL A;  2OHF A;  3GE8 C;  3ABV B;  2IY1 B;  3VUX A;  2MX2 A;  4AUQ C;  4F1S A;  2CHX A;  1V5T A;  3AEB B;  4JWU C;  1B9R A;  1QT9 A;  3GS2 A;  4ZRK A;  3LJ3 A;  2GOW A;  2PVO D;  3RNG C;  2KQS A;  5LXH A;  2LVO A;  2RD0 A;  3ZKJ C;  1QKZ A;  1XLO A;  4KX6 B;  3V3X A;  2O6V B;  2XK5 A;  3TEZ A;  2INP E;  4F8C B;  2KN4 A;  3LYY A;  1FXA A;  1JWU D;  4WH4 A;  3BWU D;  5HFY A;  1MJD A;  1GG3 A;  3MJ5 A;  4DWF A;  4AJW A;  1YNT E;  1K52 A;  2Z0D B;  4MH8 A;  4WJQ A;  2BGF A;  2PLP A;  1ZPS A;  3BY4 B;  3NVY A;  4PYU A;  4XZ4 A;  3A1Q B;  1QOB A;  3H7S A;  2MW5 A;  4WWM A;  4B95 A;  3VUW A;  4FJY A;  1FFV A;  4PS3 A;  2I1J A;  5L83 A;  4DHZ E;  1XCT L;  1IYF A;  2IY0 B;  1WGK A;  4WAF A;  1S3S G;  4GDL B;  1SE2 A;  3RCZ A;  3SD5 A;  2AQ1 B;  2WXL A;  1UBI A;  4LJP B;  2MRP A;  1EO6 A;  3WIM A;  3AE2 B;  1KRH A;  1YQB A;  2J53 A;  1HQR D;  2QC8 A;  3MC8 A;  2I1K A;  2MJE A;  1C4P A;  1OQY A;  2K39 A;  1A5R A;  4LNI A;  3T3N A;  2EEL A;  3SDL C;  4YT0 B;  1N5X A;  1L4D B;  4NNJ B;  4GU2 A;  3A33 B;  2KJR A;  1GPX A;  1V80 A;  2IGD A;  3P4Q B;  1WFY A;  5BO4 B;  4CO7 A;  2DBY A;  1YMH E;  4GN1 A;  2D5G A;  1YJJ A;  1H8C A;  2FCS A;  4WWP A;  4IWP A;  4KGT A;  3IXS A;  3AE8 B;  3ML8 A;  1XEE A;  3EC8 A;  1GOZ A;  4AWJ A;  1C79 A;  4GXB A;  3DHI C;  4GB9 A;  4DXF A;  4WWN A;  2JY6 A;  2NBU A;  3NS8 A;  2JX5 A;  1TY0 A;  5AUK A;  1DYQ A;  4PS8 A;  1D3Z A;  2DWQ A;  1JCK B;  2BVC A;  1XO3 A;  3MFG A;  2KWD A;  1VZ6 A;  4BZA A;  4KGS A;  4FHJ A;  2Y5B B;  2MWS B;  4URK A;  1T0R C;  4K3B A;  1TIF A;  2R2Q A;  2SEB D;  1N6Z A;  4TUU A;  2DX5 B;  2EKI A;  1X1M A;  1OFF A;  1V2Y A;  3PHW B;  1F52 A;  1WYW B;  2LEK A;  3PRE A;  3P4R B;  4HVB A;  2IDY A;  2MP2 A;  3ONS A;  1ROE A;  1GTH A;  3B1L X;  2MBH A;  2FID A;  3ZW3 A;  2K3U A;  4ZRQ A;  3W5U B;  4MJS A;  3H9D A;  3U7D A;  5IN7 A;  4C56 C;  2KJH B;  1UUP A;  3N30 A;  2Y5C A;  1JWA D;  3IBE A;  2WX0 A;  2KAJ A;  1ZDV A;  2C7H A;  5IAA C;  1C76 A;  2AWT A;  2GMI C;  2IO3 B;  1L6V A;  4TKN A;  4GIV A;  3TJP A;  2JWZ A;  1LGR A;  1T0S C;  1HXY D;  3FIL B;  2PE6 B;  1MHX A;  4WAA A;  3IHP C;  1AW7 A;  3B0A A;  3I9V 1;  3ZQ4 A;  1SF0 A;  1IP9 A;  1WGR A;  3Q3N C;  2KTR B;  4XC2 A;  2V9H A;  3ETR A;  3AE6 B;  1L4Z B;  4OHJ A;  3NVW A;  5DPS A;  2MQJ A;  2JXT A;  4HPP A;  3NJT A;  3V05 A;  2BYV E;  3V6C B;  3ZLZ A;  1I4X A;  4ARI A;  1Q5W B;  2HTH A;  2HE7 A;  4RM8 A;  4OW0 A;  3Q14 C;  2KWC A;  2QJL A;  4C4V B;  3KYD D;  5D2M B;  5MPO A;  1TTN A;  2G9H D;  4C4V A;  2L05 A;  3QIJ A;  2KNB A;  1F2R I;  2IO0 B;  4BKT A;  2BB6 A;  1QF6 A;  2GBR A;  1V9J A;  1Z2M A;  3I57 A;  3GOE A;  1WIA A;  3T3O A;  2QDF A;  3WA0 A;  4HCN B;  3LDZ E;  4ZYS A;  3O13 A;  1IGC A;  1M4V A;  2KTF A;  1HZ6 A;  1JWM D;  3SU8 X;  3APF A;  1FO4 A;  4MM3 B;  1ZGU B;  1NVI D;  2J0M A;  1J7C A;  3EEC A;  4S17 A;  1YN3 A;  1F2R C;  5I4D A;  1WXM A;  4YSX B;  2M8S A;  2L8J A;  4LTU A;  3VTW A;  1WJN A;  2PIA A;  3VVW B;  4A6Q A;  4II2 B;  1P98 A;  2DYO A;  3KYC D;  2KDF B;  3HVD A;  2IJ0 A;  3MHZ A;  2KJ6 A;  4ZHP A;  2LJ5 A;  4ANX A;  1EU4 A;  5CHV C;  3IAM 1;  4NJ6 A;  2WX1 A;  3Q2A C;  1T5X D;  2LGI A;  2K25 A;  1V49 A;  3H7P A;  4A90 A;  1EF5 A;  4ASW C;  4YTM B;  4FJV B;  1BXT A;  1WZ3 A;  4IC7 B;  4A9A A;  3HHM A;  2Z0E B;  2KFK B;  1VRA B;  1PQS A;  2IGH A;  4WIP A;  3VQI A;  1V1P A;  2X38 A;  4XE0 A;  1AYF A;  4WQM A;  1N5W A;  1UGJ A;  2WXG A;  4XWW A;  3AE3 B;  3PV1 A;  3D32 A;  2R61 A;  5FK9 C;  5E6P A;  2BYT A;  1XLP A;  2RDH A;  4LJO B;  3SFE B;  2G4S A;  2M17 A;  2PVG C;  3NVZ A;  3WAM A;  2GBK A;  4E71 A;  3AN1 A;  1K53 A;  3KLS X;  4M01 A;  5E6O A;  1NBF C;  3Q8F A;  4W9D A;  1HTQ A;  3L54 A;  4JIO U;  3U7Z A;  2JT4 B;  3NZ3 A;  2NMQ A;  1C78 A;  1RYJ A;  2OOB B;  3NUH B;  3L08 A;  1ISN A;  2WDT B;  4KIK A;  4W9L A;  3AE1 B;  5AZG A;  1VCB A;  1OQQ A;  2DNF A;  4NJ7 A;  1PGX A;  3VTU A;  1E0Z A;  2CHW A;  1AN8 A;  4H2A A;  3TSS A;  2QMT A;  2EKE C;  4P6V F;  2WS3 B;  3S2A A;  1V81 A;  2O6V A;  4WQO B;  3ZRC A;  2XEW A;  1ZDX A;  1R4N I;  2DZJ A;  1TBE A;  2I38 A;  3QQ8 B;  2FUH B;  4BFR A;  2M19 A;  3H6N A;  1QZE A;  4YTP B;  4ZRI A;  2WLB A;  3VR9 B;  3TEY A;  2ZCB A;  1UEL A;  1FXI A;  1WE6 A;  4XX5 A;  4RFB A;  4EZK A;  1ET9 A;  1E5W A;  2SAK A;  3SHQ A;  2D2Q A;  2R2O A;  3KW5 B;  1T6B X;  1VD2 A;  2UYZ B;  4ZRJ A;  3NY5 A;  4RGO S;  1SJH D;  2BPS A;  3QC8 B;  4N59 A;  3B2F A;  1YOV B;  3DPD A;  2WXJ A;  4KKJ A;  4IWQ A;  4ARC A;  1L0V B;  2PW9 A;  3DBH I;  3DQV A;  2MBQ A;  4PT5 A;  2IO1 B;  1GB1 A;  1WM2 A;  4WUR A;  1NI3 A;  1WF9 A;  4W9E A;  2V3S A;  2CU3 A; 
#chains in the Genus database with same CATH homology
 2BS3 B;  1XLQ A;  2KDM A;  1XCT L;  2JQR B;  3LB8 C;  1CK1 A;  4LK0 M;  4C7Z A;  1WGK A;  4WAF A;  4GDL B;  1E9M A;  3PZ7 A;  1SE2 A;  4L23 A;  3VR8 B;  2AQ1 B;  2J42 A;  3BK1 A;  4TSS A;  2WXL A;  2FBW B;  4RCO A;  3W2D A;  1A70 A;  3P1M A;  3IAS 1;  3AE2 B;  1KRH A;  2XNA C;  2J53 A;  3FC4 A;  4TMA B;  1C77 A;  2QSD A;  1E10 A;  5EE1 A;  1HQR D;  1RWS A;  2MJE A;  5TSS A;  1NEK B;  1C4P A;  3BVM A;  2LHD A;  2WXN A;  4HKQ A;  1ZXH A;  1QQR A;  5FKA C;  3T3N A;  2EEL A;  3AEE B;  3CIR B;  5AUI A;  4YT0 B;  1N5X A;  1TS5 A;  1L4D B;  3Q8B A;  1WSP A;  2Y3A A;  1GPX A;  2IGD A;  4ITK A;  1DOY A;  3P4Q B;  1CQV A;  1DOI A;  1KTK A;  2RDG A;  3GB1 A;  3ZYY X;  2H89 B;  2DBY A;  1YMH E;  2D5G A;  2KQ4 X;  1YJJ A;  2LFI A;  2K5P A;  4YWG G;  2G1E A;  4P16 A;  3BII D;  4RNA A;  4KGT A;  3IXS A;  3AE8 B;  3BYY B;  1SJE D;  3Q69 A;  1XEE A;  2I2Y A;  1JWB D;  2LUM A;  1GOZ A;  1V1O A;  3MC0 B;  3BVG A;  1C79 A;  5BMI A;  4DXF A;  1N61 A;  1ENF A;  3HVZ A;  4ZOH C;  2K22 A;  2W3S A;  1ZOY B;  3HRD D;  4NJC A;  3W9C B;  4L1B A;  2JX5 A;  1FFU A;  1TY0 A;  2LMC A;  1DYQ A;  5E6J A;  5AUK A;  5HG2 A;  2RMM A;  1TJE A;  1BML C;  5FR3 A;  3AEC B;  2DWQ A;  2ZW0 A;  3B2G A;  3L4P A;  4L2Y A;  1JCK B;  1D6E C;  4KKI A;  1FM0 D;  1WRI A;  4J3O D;  3ZGZ A;  1XO3 A;  3MFG A;  3BZD B;  2AQ3 B;  1UWX A;  2KWD A;  3GP7 A;  1DOX A;  1VZ6 A;  3H8H A;  1H7W A;  1GTE A;  4YXD B;  4MT5 A;  4KGS A;  2MJD A;  1J7A A;  5T8I A;  4C7Y A;  1KLU D;  4HRS A;  1BUI C;  5GXG B;  1TYG B;  2WXM A;  1JRO A;  2SEB D;  2INN E;  1YQ4 B;  3BK2 A;  4OZC A;  4DQO C;  3W1S A;  2V4I B;  4DXG A;  5JXV A;  2EKI A;  2YEP F;  4HEA 1;  1OFF A;  3U4E G;  1UNS A;  3DWG C;  1FRD A;  5D7G A;  5H92 C;  2LEK A;  2W55 A;  3P4R B;  4FXC A;  2IDY A;  4AQ7 A;  2N9L A;  2WXH A;  1PFD A;  1T3Q A;  4JPS A;  1ROE A;  1GTH A;  2H88 B;  2JWU A;  3PZ8 A;  1FNU A;  1QLB B;  2VZK D;  2K3U A;  1FNW A;  1DGJ A;  4ZRQ A;  1PGA A;  2DLB A;  2E3T A;  3W5U B;  2ACZ B;  2V3P A;  4A8X C;  2V3N A;  1Y56 A;  1VR9 A;  4C56 C;  1FCL A;  4JE3 B;  2LJI A;  1UUP A;  4Q2J A;  2Y5C A;  2WQY B;  1B1Z A;  1JWA D;  1Q10 A;  3IT6 B;  1YN4 A;  1TS3 A;  1QOF A;  2KAJ A;  1JAL A;  1ZDV A;  2DYM A;  1I4Q A;  1E7P B;  4AS1 A;  1C76 A;  3E56 A;  2K9X A;  1K50 A;  1I4G A;  1L6V A;  1SB3 C;  4NAW B;  2BW2 A;  4R3D A;  1HXY D;  1C9F A;  3NS1 A;  3FIL B;  1FCC C;  1MHX A;  3Q8E A;  1AW7 A;  1KH0 A;  1I4P A;  3EGR A;  1KF6 B;  3I9V 1;  1SF0 A;  3ZQ4 A;  1MI0 A;  1TKG A;  1N60 A;  2WXQ A;  1XLN A;  4B0M A;  1AWD A;  1VZ8 A;  4YSZ B;  2BB5 A;  3J9C A;  4NZL B;  4RH6 A;  2KAC A;  3ETR A;  1L0X B;  3AE6 B;  3VRA B;  1L4Z B;  2AX5 A;  1N63 A;  4OHJ A;  3NVW A;  5BMH A;  1VJK A;  3KWL A;  4TQ1 A;  4UDU C;  3P63 A;  2JXT A;  3AE9 B;  3NRZ A;  4C80 A;  1HA5 A;  2M0A A;  3V05 A;  2JZP A;  5EE0 A;  1I4X A;  4ARI A;  2LHE A;  1R7S A;  1CJE A;  4EE2 A;  4OW0 A;  1KLG D;  3TUO A;  4TQ0 A;  1XF5 L;  2L83 A;  2QJL A;  4D2K A;  2N7J A;  2FE8 A;  2JYE A;  3FIL A;  3FAH A;  2G9H D;  5MPO A;  3Q8C A;  5D3D A;  2N9K A;  3EA6 A;  4IOI E;  1F2R I;  1I7H A;  2K0P A;  3DWM A;  3KWV A;  4RGM A;  2BB6 A;  1QF6 A;  1SE4 A;  1VLB A;  2BS2 B;  3I57 A;  3T3O A;  3AV8 A;  4ZYS A;  1JRP A;  1SSN A;  2QIL A;  3O13 A;  4USA A;  1EU3 A;  1FEH A;  1IGC A;  2WXK A;  3AB5 A;  3U52 E;  1M4V A;  4A55 A;  1QIL A;  2WDQ B;  1HEZ E;  1HZ6 A;  1JWM D;  3BVZ A;  1FO4 A;  4IDI A;  4MM3 B;  1YN5 A;  4XDD A;  3AEF B;  4HRO A;  1NVI D;  1J7C A;  2XN9 C;  3R8B A;  2JSV X;  1ACC A;  1YN3 A;  1F2R C;  1K51 A;  3P42 A;  4OZA A;  1L0Y B;  2NTS A;  5I4D A;  1F77 A;  4YSX B;  3AED B;  4US9 A;  2E6X A;  4M0W A;  3AH7 A;  3AEA B;  1JQ4 A;  4LTU A;  4IKG A;  1E6E B;  2VZK B;  2KMM A;  2PIA A;  3UI3 A;  1SEB D;  1PYW D;  4A6Q A;  1FIQ A;  4YTN B;  2DYO A;  3EUB 2;  2WXF A;  1NYQ A;  3HVD A;  1QOG A;  2IJ0 A;  3MHZ A;  4ZHP A;  1C4A A;  2W82 A;  1EU4 A;  2PKO A;  4HKZ E;  3IAM 1;  1FMA D;  2ONQ A;  3AE4 B;  1EWC A;  2BBC A;  2GB1 A;  1RM6 C;  1T5X D;  4KGR A;  1PUT A;  2L32 A;  4OZB A;  1PDX A;  1J7B A;  1FD6 A;  2LGI A;  1MHH E;  1ZXI A;  3R2T A;  1V8C A;  1N62 A;  1NYR A;  2BT6 A;  1NEN B;  4A90 A;  2MJ3 A;  3TEX A;  1QOA A;  3WCQ A;  4YTM B;  2GI9 A;  2YEP B;  1BXT A;  2M56 B;  2WDR B;  1ESF A;  4LLG M;  4A9A A;  2JU6 X;  1H7X A;  1FRR A;  1P7F A;  1XXG A;  2WU5 B;  3W5V B;  1VRA B;  3URY A;  2IGH A;  2RPV A;  1CZP A;  2Z8L A;  1JWS D;  2J4X A;  4CQN A;  4WIP A;  1KFY B;  2WXO A;  3VQI A;  1D5M C;  1V1P A;  2X38 A;  4XE0 A;  1ZP0 B;  1AYF A;  1D5X C;  1VZ7 A;  4WQM A;  3MP9 A;  3P4P B;  1N5W A;  1UGJ A;  2WXG A;  4XWW A;  3AE3 B;  3SFD B;  1YQ3 B;  2R61 A;  1WYG A;  1OQR A;  4RF0 A;  5FK9 C;  2BYT A;  1XLP A;  4JWS C;  2ICI A;  2RDH A;  5D3I B;  5G5G A;  3SFE B;  1TY2 A;  5BMG A;  1IUE A;  1L5P A;  4N6E B;  2WXR A;  4REZ A;  1TS4 A;  3RPF C;  2HTM E;  1GT8 A;  3CF4 A;  2PVG C;  3HUI A;  3NVZ A;  1MPE A;  1WXQ A;  1WWT A;  1K53 A;  1VDV A;  2FUG 1;  2Y5P A;  3AN1 A;  3KLS X;  2W3R A;  4GLS C;  5HI1 A;  5BYR A;  4XDC A;  1IBX A;  3Q8F A;  1ZE3 D;  4RF1 A;  5C3J B;  3U2S C;  3U7Z A;  4N58 A;  4RGN A;  2BTE A;  1PGB A;  4O1N A;  4OVZ A;  5LNK 1;  4YSY B;  3NZ3 A;  1EWY C;  2B76 B;  2NMQ A;  1C78 A;  1RYJ A;  2L52 A;  4RGT A;  1D4B A;  3NUH B;  3ZJV A;  4ZHO A;  5G5H A;  2QEJ C;  2BS4 B;  2JYT A;  3N9Y C;  2Q5W D;  3AE1 B;  1ZUD 2;  1SIJ A;  2V0G A;  3IT4 B;  1OQQ A;  1PGX A;  1E0Z A;  3KQ4 A;  1AN8 A;  3E9S A;  4H2A A;  1YJI A;  3TSS A;  2QMT A;  3ZJT A;  1D5Z C;  3TEW A;  4P6V F;  2WS3 B;  3AEG B;  2AQ2 B;  2WXI A;  3Q8A A;  4B0E A;  2ZW1 A;  3RFZ B;  1TS2 A;  3PO0 A;  4NAM A;  3OWE B;  2NTT A;  5BYS A;  1GB4 A;  1ET6 A;  2WXP A;  1JML A;  2CJN A;  4GDK B;  1MVK A;  5EE9 A;  2CJO A;  1I4R A;  1ZDX A;  2ON8 A;  2I38 A;  1TZO A;  2IPK D;  3CWI A;  3SR6 A;  2GRI A;  1UWM A;  2MH7 A;  3LXF A;  1C4C A;  2M19 A;  1HZ5 A;  2QIE B;  2PTL A;  3AE5 B;  4YTP B;  2OHF A;  2WNM A;  2WLB A;  3VR9 B;  3ABV B;  3TEY A;  2W54 A;  2TSS A;  3AM9 A;  4MAC A;  1FXI A;  1TKE A;  3AEB B;  4RFB A;  1ET9 A;  2MEK A;  4JWU C;  1B9R A;  1V1P B;  2SAK A;  1SBB B;  3C8Y A;  1F0Z A;  1QT9 A;  3GS2 A;  2PMV A;  2WDV B;  2WP9 B;  4ZRP A;  1T6B X;  1FNV A;  1XCQ L;  2PVO D;  4XWT A;  3SEB A;  3R2I A;  3AE7 B;  1JW9 D;  3AMZ A;  4RGO S;  1SJH D;  3BYT B;  4N59 A;  1EM7 A;  1QKZ A;  1XLO A;  3B2F A;  4KX6 B;  3VRB B;  1SXT A;  1I4H A;  3V3X A;  5HHD G;  3B9J A;  3TEZ A;  1GAQ B;  2INP E;  4JX1 C;  2KN4 A;  1FXA A;  2WXJ A;  1JWU D;  3LYY A;  4HJG E;  3BWU D;  4KKJ A;  1L6U A;  4WH4 A;  5C2T B;  2HDE A;  3NVV A;  5HFY A;  4ARC A;  1SE3 A;  2J52 A;  1L0V B;  3MJ5 A;  1V97 A;  4US8 A;  3ZJU A;  1YNT E;  1K52 A;  2PW9 A;  4MH8 A;  1IBX B;  2PLP A;  1ZPS A;  3NVY A;  1P7E A;  1IGD A;  5EE3 A;  4PT5 A;  2OED A;  1GB1 A;  5H8Y E;  1LO5 D;  1TKY A;  5BYQ A;  1QOB A;  2WU2 B;  4WUR A;  1NI3 A;  2IGG A;  3P4S B;  1RFK A;  4WWM A;  2L1A A;  1STE A;  2N0S B;  1FFV A;  2CU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...