2WE4A

Carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site-Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords CARBAMATE KINASE 1
total genus 105
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we4A00
3AB4A 4AXSA 3AAWA 2J0WA 2BTYA 2OGXB 2AKOA 3D40A 3L86A 1OHAA 4AB7A 3LL9A 2WE5A 3NWYA 4A7WA 2IJ9A 4NDPB 2X2WA 1OH9A 3T7BA 3WWMA 2W21A 3K56A 3QVFA 2A1FA 3C1NA 3AB2A 3EK6A 3K4OA 3S6KA 4NDQB 2HMFA 3S6HA 3QUOA 1YBDA 4NDPA 3KZFA 2BRXA 2JJXA 2OGXA 4NDRA 4NDOB 4Q1TA 3QVHA 1GS5A 4I49A 4KZTA 3B8GA 2J4JA 4NDRB 2VA1A 2J5TA 1GSJA 3LL5A 3QURA 4NDOA 3K4YA 2BRIA 2JJ4A 2WXBA 2BUFA 3D41A 3D2PA 2R8VA 2J5VA 3WWNA 3ZZFA 2BMUA 1OHBA 2J0XA 3D2MA 2J4KA 4NDQA 4A7XA 3EK5A 4JZ8A 3K52A 2E9YA 3ZZGA 3ZZIA 2AP9A 2WE4A 2CDQA 2V5HA 4JZ9A 1E19A 3TVIA 1B7BA 2BNEA 4JZ7A 4USJA 2BNDA 3C1MA 3LKKA 2BNFA 2JI5A 3ZZHA 2J4LA 3C20A 2RD5A 4OLCA 2V4YA 4F6TA 3L76A 3QUNA 3S6GA 2R98A 1Z9DA 3U6UA 4F6TB
chains in the Genus database with same CATH superfamily
3AB4A 4AXSA 3AAWA 2J0WA 2BTYA 2OGXB 2AKOA 3D40A 3L86A 1OHAA 4AB7A 3LL9A 2WE5A 3NWYA 4A7WA 2IJ9A 4NDPB 2X2WA 1OH9A 3T7BA 3WWMA 2W21A 3K56A 3QVFA 2A1FA 3C1NA 3AB2A 3EK6A 3K4OA 3S6KA 4NDQB 2HMFA 3S6HA 3QUOA 1YBDA 4NDPA 3KZFA 2BRXA 2JJXA 2OGXA 4NDRA 4NDOB 4Q1TA 3QVHA 1GS5A 4I49A 4KZTA 3B8GA 2J4JA 4NDRB 2VA1A 2J5TA 1GSJA 3LL5A 3QURA 4NDOA 3K4YA 2BRIA 2JJ4A 2WXBA 2BUFA 3D41A 3D2PA 2R8VA 2J5VA 3WWNA 3ZZFA 2BMUA 1OHBA 2J0XA 3D2MA 2J4KA 4NDQA 4A7XA 3EK5A 4JZ8A 3K52A 2E9YA 3ZZGA 3ZZIA 2AP9A 2WE4A 2CDQA 2V5HA 4JZ9A 1E19A 3TVIA 1B7BA 2BNEA 4JZ7A 4USJA 2BNDA 3C1MA 3LKKA 2BNFA 2JI5A 3ZZHA 2J4LA 3C20A 2RD5A 4OLCA 2V4YA 4F6TA 3L76A 3QUNA 3S6GA 2R98A 1Z9DA 3U6UA 4F6TB
chains in the Genus database with same CATH topology
3AB4A 4AXSA 3AAWA 2J0WA 2BTYA 2OGXB 2AKOA 3D40A 3L86A 1OHAA 4AB7A 3LL9A 2WE5A 3NWYA 4A7WA 2IJ9A 4NDPB 2X2WA 1OH9A 3T7BA 3WWMA 2W21A 3K56A 3QVFA 2A1FA 3C1NA 3AB2A 3EK6A 3K4OA 3S6KA 4NDQB 2HMFA 3S6HA 3QUOA 1YBDA 4NDPA 3KZFA 2BRXA 2JJXA 2OGXA 4NDRA 4NDOB 4Q1TA 3QVHA 1GS5A 4I49A 4KZTA 3B8GA 2J4JA 4NDRB 2VA1A 2J5TA 1GSJA 3LL5A 3QURA 4NDOA 3K4YA 2BRIA 2JJ4A 2WXBA 2BUFA 3D41A 3D2PA 2R8VA 2J5VA 3WWNA 3ZZFA 2BMUA 1OHBA 2J0XA 3D2MA 2J4KA 4NDQA 4A7XA 3EK5A 4JZ8A 3K52A 2E9YA 3ZZGA 3ZZIA 2AP9A 2WE4A 2CDQA 2V5HA 4JZ9A 1E19A 3TVIA 1B7BA 2BNEA 4JZ7A 4USJA 2BNDA 3C1MA 3LKKA 2BNFA 2JI5A 3ZZHA 2J4LA 3C20A 2RD5A 4OLCA 2V4YA 4F6TA 3L76A 3QUNA 3S6GA 2R98A 1Z9DA 3U6UA 4F6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB4 A;  4AXS A;  3AAW A;  2J0W A;  2BTY A;  2OGX B;  2AKO A;  3D40 A;  3L86 A;  1OHA A;  4AB7 A;  3LL9 A;  2WE5 A;  3NWY A;  4A7W A;  2IJ9 A;  4NDP B;  2X2W A;  1OH9 A;  3T7B A;  3WWM A;  2W21 A;  3K56 A;  3QVF A;  2A1F A;  3C1N A;  3AB2 A;  3EK6 A;  3K4O A;  3S6K A;  4NDQ B;  2HMF A;  3S6H A;  3QUO A;  1YBD A;  4NDP A;  3KZF A;  2BRX A;  2JJX A;  2OGX A;  4NDR A;  4NDO B;  4Q1T A;  3QVH A;  1GS5 A;  4I49 A;  4KZT A;  3B8G A;  2J4J A;  4NDR B;  2VA1 A;  2J5T A;  1GSJ A;  3LL5 A;  3QUR A;  4NDO A;  3K4Y A;  2BRI A;  2JJ4 A;  2WXB A;  2BUF A;  3D41 A;  3D2P A;  2R8V A;  2J5V A;  3WWN A;  3ZZF A;  2BMU A;  1OHB A;  2J0X A;  3D2M A;  2J4K A;  4NDQ A;  4A7X A;  3EK5 A;  4JZ8 A;  3K52 A;  2E9Y A;  3ZZG A;  3ZZI A;  2AP9 A;  2WE4 A;  2CDQ A;  2V5H A;  4JZ9 A;  1E19 A;  3TVI A;  1B7B A;  2BNE A;  4JZ7 A;  4USJ A;  2BND A;  3C1M A;  3LKK A;  2BNF A;  2JI5 A;  3ZZH A;  2J4L A;  3C20 A;  2RD5 A;  4OLC A;  2V4Y A;  4F6T A;  3L76 A;  3QUN A;  3S6G A;  2R98 A;  1Z9D A;  3U6U A;  4F6T B; 
#chains in the Genus database with same CATH topology
 3AB4 A;  4AXS A;  3AAW A;  2J0W A;  2BTY A;  2OGX B;  2AKO A;  3D40 A;  3L86 A;  1OHA A;  4AB7 A;  3LL9 A;  2WE5 A;  3NWY A;  4A7W A;  2IJ9 A;  4NDP B;  2X2W A;  1OH9 A;  3T7B A;  3WWM A;  2W21 A;  3K56 A;  3QVF A;  2A1F A;  3C1N A;  3AB2 A;  3EK6 A;  3K4O A;  3S6K A;  4NDQ B;  2HMF A;  3S6H A;  3QUO A;  1YBD A;  4NDP A;  3KZF A;  2BRX A;  2JJX A;  2OGX A;  4NDR A;  4NDO B;  4Q1T A;  3QVH A;  1GS5 A;  4I49 A;  4KZT A;  3B8G A;  2J4J A;  4NDR B;  2VA1 A;  2J5T A;  1GSJ A;  3LL5 A;  3QUR A;  4NDO A;  3K4Y A;  2BRI A;  2JJ4 A;  2WXB A;  2BUF A;  3D41 A;  3D2P A;  2R8V A;  2J5V A;  3WWN A;  3ZZF A;  2BMU A;  1OHB A;  2J0X A;  3D2M A;  2J4K A;  4NDQ A;  4A7X A;  3EK5 A;  4JZ8 A;  3K52 A;  2E9Y A;  3ZZG A;  3ZZI A;  2AP9 A;  2WE4 A;  2CDQ A;  2V5H A;  4JZ9 A;  1E19 A;  3TVI A;  1B7B A;  2BNE A;  4JZ7 A;  4USJ A;  2BND A;  3C1M A;  3LKK A;  2BNF A;  2JI5 A;  3ZZH A;  2J4L A;  3C20 A;  2RD5 A;  4OLC A;  2V4Y A;  4F6T A;  3L76 A;  3QUN A;  3S6G A;  2R98 A;  1Z9D A;  3U6U A;  4F6T B; 
#chains in the Genus database with same CATH homology
 3AB4 A;  4AXS A;  3AAW A;  2J0W A;  2BTY A;  2OGX B;  2AKO A;  3D40 A;  3L86 A;  1OHA A;  4AB7 A;  3LL9 A;  2WE5 A;  3NWY A;  4A7W A;  2IJ9 A;  4NDP B;  2X2W A;  1OH9 A;  3T7B A;  3WWM A;  2W21 A;  3K56 A;  3QVF A;  2A1F A;  3C1N A;  3AB2 A;  3EK6 A;  3K4O A;  3S6K A;  4NDQ B;  2HMF A;  3S6H A;  3QUO A;  1YBD A;  4NDP A;  3KZF A;  2BRX A;  2JJX A;  2OGX A;  4NDR A;  4NDO B;  4Q1T A;  3QVH A;  1GS5 A;  4I49 A;  4KZT A;  3B8G A;  2J4J A;  4NDR B;  2VA1 A;  2J5T A;  1GSJ A;  3LL5 A;  3QUR A;  4NDO A;  3K4Y A;  2BRI A;  2JJ4 A;  2WXB A;  2BUF A;  3D41 A;  3D2P A;  2R8V A;  2J5V A;  3WWN A;  3ZZF A;  2BMU A;  1OHB A;  2J0X A;  3D2M A;  2J4K A;  4NDQ A;  4A7X A;  3EK5 A;  4JZ8 A;  3K52 A;  2E9Y A;  3ZZG A;  3ZZI A;  2AP9 A;  2WE4 A;  2CDQ A;  2V5H A;  4JZ9 A;  1E19 A;  3TVI A;  1B7B A;  2BNE A;  4JZ7 A;  4USJ A;  2BND A;  3C1M A;  3LKK A;  2BNF A;  2JI5 A;  3ZZH A;  2J4L A;  3C20 A;  2RD5 A;  4OLC A;  2V4Y A;  4F6T A;  3L76 A;  3QUN A;  3S6G A;  2R98 A;  1Z9D A;  3U6U A;  4F6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...