2WE4A

Carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
309
structure length
309
Chain Sequence
b'GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBAMATE KINASE 1
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site-Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 105
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we4A00
4A7XA 4F6TB 4I49A 2X2WA 3D2PA 3L86A 1B7BA 2BMUA 2AKOA 3QVFA 3ZZGA 2J5TA 4NDOA 2V4YA 2BNEA 3K56A 3K4OA 3C1MA 4JZ9A 4JZ8A 2JI5A 2BNDA 2J0WA 3K4YA 3D40A 3D41A 2OGXB 2BUFA 3ZZHA 3AB2A 2BTYA 3KZFA 3ZZFA 3T7BA 4AB7A 1OHAA 2JJ4A 4JZ7A 3QURA 4NDPB 3WWMA 3LL9A 2CDQA 4OLCA 4A7WA 4NDOB 2E9YA 3NWYA 3B8GA 3U6UA 2BRXA 3D2MA 1Z9DA 2V5HA 4AXSA 1OHBA 2A1FA 2IJ9A 3K52A 3S6HA 4NDQB 2J4JA 1GS5A 3EK5A 3WWNA 1OH9A 3LL5A 1E19A 2BRIA 4NDRA 3QUOA 2VA1A 2J5VA 2R98A 1GSJA 2AP9A 2WE4A 3C20A 2OGXA 1YBDA 4F6TA 3ZZIA 2J0XA 4KZTA 4Q1TA 3LKKA 3S6GA 2BNFA 3QUNA 2J4KA 4USJA 4NDPA 2RD5A 3AAWA 2WXBA 3L76A 3TVIA 2J4LA 3C1NA 2WE5A 2JJXA 2W21A 2HMFA 2R8VA 4NDRB 3EK6A 3QVHA 3S6KA 3AB4A 4NDQA
chains in the Genus database with same CATH superfamily
4A7XA 4F6TB 4I49A 2X2WA 3D2PA 3L86A 1B7BA 2BMUA 2AKOA 3QVFA 3ZZGA 2J5TA 4NDOA 2V4YA 2BNEA 3K56A 3K4OA 3C1MA 4JZ9A 4JZ8A 2JI5A 2BNDA 2J0WA 3K4YA 3D40A 3D41A 2OGXB 2BUFA 3ZZHA 3AB2A 2BTYA 3KZFA 3ZZFA 3T7BA 4AB7A 1OHAA 2JJ4A 4JZ7A 3QURA 4NDPB 3WWMA 3LL9A 2CDQA 4OLCA 4A7WA 4NDOB 2E9YA 3NWYA 3B8GA 3U6UA 2BRXA 3D2MA 1Z9DA 2V5HA 4AXSA 1OHBA 2A1FA 2IJ9A 3K52A 3S6HA 4NDQB 2J4JA 1GS5A 3EK5A 3WWNA 1OH9A 3LL5A 1E19A 2BRIA 4NDRA 3QUOA 2VA1A 2J5VA 2R98A 1GSJA 2AP9A 2WE4A 3C20A 2OGXA 1YBDA 4F6TA 3ZZIA 2J0XA 4KZTA 4Q1TA 3LKKA 3S6GA 2BNFA 3QUNA 2J4KA 4USJA 4NDPA 2RD5A 3AAWA 2WXBA 3L76A 3TVIA 2J4LA 3C1NA 2WE5A 2JJXA 2W21A 2HMFA 2R8VA 4NDRB 3EK6A 3QVHA 3S6KA 3AB4A 4NDQA
chains in the Genus database with same CATH topology
4A7XA 4F6TB 4I49A 2X2WA 3D2PA 3L86A 1B7BA 2BMUA 2AKOA 3QVFA 3ZZGA 2J5TA 4NDOA 2V4YA 2BNEA 3K56A 3K4OA 3C1MA 4JZ9A 4JZ8A 2JI5A 2BNDA 2J0WA 3K4YA 3D40A 3D41A 2OGXB 2BUFA 3ZZHA 3AB2A 2BTYA 3KZFA 3ZZFA 3T7BA 4AB7A 1OHAA 2JJ4A 4JZ7A 3QURA 4NDPB 3WWMA 3LL9A 2CDQA 4OLCA 4A7WA 4NDOB 2E9YA 3NWYA 3B8GA 3U6UA 2BRXA 3D2MA 1Z9DA 2V5HA 4AXSA 1OHBA 2A1FA 2IJ9A 3K52A 3S6HA 4NDQB 2J4JA 1GS5A 3EK5A 3WWNA 1OH9A 3LL5A 1E19A 2BRIA 4NDRA 3QUOA 2VA1A 2J5VA 2R98A 1GSJA 2AP9A 2WE4A 3C20A 2OGXA 1YBDA 4F6TA 3ZZIA 2J0XA 4KZTA 4Q1TA 3LKKA 3S6GA 2BNFA 3QUNA 2J4KA 4USJA 4NDPA 2RD5A 3AAWA 2WXBA 3L76A 3TVIA 2J4LA 3C1NA 2WE5A 2JJXA 2W21A 2HMFA 2R8VA 4NDRB 3EK6A 3QVHA 3S6KA 3AB4A 4NDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7X A;  4F6T B;  4I49 A;  2X2W A;  3D2P A;  3L86 A;  1B7B A;  2BMU A;  2AKO A;  3QVF A;  3ZZG A;  2J5T A;  4NDO A;  2V4Y A;  2BNE A;  3K56 A;  3K4O A;  3C1M A;  4JZ9 A;  4JZ8 A;  2JI5 A;  2BND A;  2J0W A;  3K4Y A;  3D40 A;  3D41 A;  2OGX B;  2BUF A;  3ZZH A;  3AB2 A;  2BTY A;  3KZF A;  3ZZF A;  3T7B A;  4AB7 A;  1OHA A;  2JJ4 A;  4JZ7 A;  3QUR A;  4NDP B;  3WWM A;  3LL9 A;  2CDQ A;  4OLC A;  4A7W A;  4NDO B;  2E9Y A;  3NWY A;  3B8G A;  3U6U A;  2BRX A;  3D2M A;  1Z9D A;  2V5H A;  4AXS A;  1OHB A;  2A1F A;  2IJ9 A;  3K52 A;  3S6H A;  4NDQ B;  2J4J A;  1GS5 A;  3EK5 A;  3WWN A;  1OH9 A;  3LL5 A;  1E19 A;  2BRI A;  4NDR A;  3QUO A;  2VA1 A;  2J5V A;  2R98 A;  1GSJ A;  2AP9 A;  2WE4 A;  3C20 A;  2OGX A;  1YBD A;  4F6T A;  3ZZI A;  2J0X A;  4KZT A;  4Q1T A;  3LKK A;  3S6G A;  2BNF A;  3QUN A;  2J4K A;  4USJ A;  4NDP A;  2RD5 A;  3AAW A;  2WXB A;  3L76 A;  3TVI A;  2J4L A;  3C1N A;  2WE5 A;  2JJX A;  2W21 A;  2HMF A;  2R8V A;  4NDR B;  3EK6 A;  3QVH A;  3S6K A;  3AB4 A;  4NDQ A; 
#chains in the Genus database with same CATH topology
 4A7X A;  4F6T B;  4I49 A;  2X2W A;  3D2P A;  3L86 A;  1B7B A;  2BMU A;  2AKO A;  3QVF A;  3ZZG A;  2J5T A;  4NDO A;  2V4Y A;  2BNE A;  3K56 A;  3K4O A;  3C1M A;  4JZ9 A;  4JZ8 A;  2JI5 A;  2BND A;  2J0W A;  3K4Y A;  3D40 A;  3D41 A;  2OGX B;  2BUF A;  3ZZH A;  3AB2 A;  2BTY A;  3KZF A;  3ZZF A;  3T7B A;  4AB7 A;  1OHA A;  2JJ4 A;  4JZ7 A;  3QUR A;  4NDP B;  3WWM A;  3LL9 A;  2CDQ A;  4OLC A;  4A7W A;  4NDO B;  2E9Y A;  3NWY A;  3B8G A;  3U6U A;  2BRX A;  3D2M A;  1Z9D A;  2V5H A;  4AXS A;  1OHB A;  2A1F A;  2IJ9 A;  3K52 A;  3S6H A;  4NDQ B;  2J4J A;  1GS5 A;  3EK5 A;  3WWN A;  1OH9 A;  3LL5 A;  1E19 A;  2BRI A;  4NDR A;  3QUO A;  2VA1 A;  2J5V A;  2R98 A;  1GSJ A;  2AP9 A;  2WE4 A;  3C20 A;  2OGX A;  1YBD A;  4F6T A;  3ZZI A;  2J0X A;  4KZT A;  4Q1T A;  3LKK A;  3S6G A;  2BNF A;  3QUN A;  2J4K A;  4USJ A;  4NDP A;  2RD5 A;  3AAW A;  2WXB A;  3L76 A;  3TVI A;  2J4L A;  3C1N A;  2WE5 A;  2JJX A;  2W21 A;  2HMF A;  2R8V A;  4NDR B;  3EK6 A;  3QVH A;  3S6K A;  3AB4 A;  4NDQ A; 
#chains in the Genus database with same CATH homology
 4A7X A;  4F6T B;  4I49 A;  2X2W A;  3D2P A;  3L86 A;  1B7B A;  2BMU A;  2AKO A;  3QVF A;  3ZZG A;  2J5T A;  4NDO A;  2V4Y A;  2BNE A;  3K56 A;  3K4O A;  3C1M A;  4JZ9 A;  4JZ8 A;  2JI5 A;  2BND A;  2J0W A;  3K4Y A;  3D40 A;  3D41 A;  2OGX B;  2BUF A;  3ZZH A;  3AB2 A;  2BTY A;  3KZF A;  3ZZF A;  3T7B A;  4AB7 A;  1OHA A;  2JJ4 A;  4JZ7 A;  3QUR A;  4NDP B;  3WWM A;  3LL9 A;  2CDQ A;  4OLC A;  4A7W A;  4NDO B;  2E9Y A;  3NWY A;  3B8G A;  3U6U A;  2BRX A;  3D2M A;  1Z9D A;  2V5H A;  4AXS A;  1OHB A;  2A1F A;  2IJ9 A;  3K52 A;  3S6H A;  4NDQ B;  2J4J A;  1GS5 A;  3EK5 A;  3WWN A;  1OH9 A;  3LL5 A;  1E19 A;  2BRI A;  4NDR A;  3QUO A;  2VA1 A;  2J5V A;  2R98 A;  1GSJ A;  2AP9 A;  2WE4 A;  3C20 A;  2OGX A;  1YBD A;  4F6T A;  3ZZI A;  2J0X A;  4KZT A;  4Q1T A;  3LKK A;  3S6G A;  2BNF A;  3QUN A;  2J4K A;  4USJ A;  4NDP A;  2RD5 A;  3AAW A;  2WXB A;  3L76 A;  3TVI A;  2J4L A;  3C1N A;  2WE5 A;  2JJX A;  2W21 A;  2HMF A;  2R8V A;  4NDR B;  3EK6 A;  3QVH A;  3S6K A;  3AB4 A;  4NDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...