2WE4A

Carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
309
structure length
309
Chain Sequence
GKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVGNLLLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDPADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTLIKNDIITISCGGGGIPVVGQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCINYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSLENLGSMSGDEIVGTVVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Binding and Catalysis in Carbamate Kinase Ascertained by Crystallographic and Site-Directed Mutagenesis Studies. Movements and Significance of a Unique Globular Subdomain of This Key Enzyme for Fermentative ATP Production in Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
molecule keywords CARBAMATE KINASE 1
total genus 105
structure length 309
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.2: Carbamate kinase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2we4A00
3S6HA 2W21A 4A7WA 3WWNA 2CDQA 3LL5A 2BTYA 3LKKA 4A7XA 3LL9A 1B7BA 3ZZFA 3TVIA 3D2PA 3C1NA 3S6KA 2X2WA 2AKOA 3ZZHA 4NDPA 3U6UA 3B8GA 2V4YA 3ZZGA 2J5VA 2WE4A 3C1MA 2J4KA 2J4JA 2R98A 3D2MA 4Q1TA 4AXSA 1GSJA 4NDPB 4KZTA 2AP9A 1OH9A 3QVHA 2J5TA 2J4LA 3WWMA 1OHBA 3S6GA 4USJA 3ZZIA 2VA1A 3D41A 2R8VA 2JJXA 3KZFA 2BUFA 2BNFA 4NDQB 4JZ8A 2BMUA 4OLCA 4NDOA 3QUOA 3K4YA 3K56A 3L86A 2BNEA 3D40A 2IJ9A 2BRIA 3T7BA 3EK5A 2HMFA 2E9YA 4NDRB 1Z9DA 4NDOB 2BRXA 2WXBA 3AB4A 2JI5A 2OGXB 2RD5A 3L76A 3QURA 3K4OA 2A1FA 2OGXA 4AB7A 1E19A 2BNDA 3C20A 4F6TB 1OHAA 4NDRA 2V5HA 3NWYA 2JJ4A 4NDQA 4F6TA 2J0WA 2WE5A 1YBDA 3K52A 2J0XA 3EK6A 3AAWA 3QVFA 1GS5A 4JZ9A 4I49A 3QUNA 3AB2A 4JZ7A
chains in the Genus database with same CATH superfamily
3S6HA 2W21A 4A7WA 3WWNA 2CDQA 3LL5A 2BTYA 3LKKA 4A7XA 3LL9A 1B7BA 3ZZFA 3TVIA 3D2PA 3C1NA 3S6KA 2X2WA 2AKOA 3ZZHA 4NDPA 3U6UA 3B8GA 2V4YA 3ZZGA 2J5VA 2WE4A 3C1MA 2J4KA 2J4JA 2R98A 3D2MA 4Q1TA 4AXSA 1GSJA 4NDPB 4KZTA 2AP9A 1OH9A 3QVHA 2J5TA 2J4LA 3WWMA 1OHBA 3S6GA 4USJA 3ZZIA 2VA1A 3D41A 2R8VA 2JJXA 3KZFA 2BUFA 2BNFA 4NDQB 4JZ8A 2BMUA 4OLCA 4NDOA 3QUOA 3K4YA 3K56A 3L86A 2BNEA 3D40A 2IJ9A 2BRIA 3T7BA 3EK5A 2HMFA 2E9YA 4NDRB 1Z9DA 4NDOB 2BRXA 2WXBA 3AB4A 2JI5A 2OGXB 2RD5A 3L76A 3QURA 3K4OA 2A1FA 2OGXA 4AB7A 1E19A 2BNDA 3C20A 4F6TB 1OHAA 4NDRA 2V5HA 3NWYA 2JJ4A 4NDQA 4F6TA 2J0WA 2WE5A 1YBDA 3K52A 2J0XA 3EK6A 3AAWA 3QVFA 1GS5A 4JZ9A 4I49A 3QUNA 3AB2A 4JZ7A
chains in the Genus database with same CATH topology
3S6HA 2W21A 4A7WA 3WWNA 2CDQA 3LL5A 2BTYA 3LKKA 4A7XA 3LL9A 1B7BA 3ZZFA 3TVIA 3D2PA 3C1NA 3S6KA 2X2WA 2AKOA 3ZZHA 4NDPA 3U6UA 3B8GA 2V4YA 3ZZGA 2J5VA 2WE4A 3C1MA 2J4KA 2J4JA 2R98A 3D2MA 4Q1TA 4AXSA 1GSJA 4NDPB 4KZTA 2AP9A 1OH9A 3QVHA 2J5TA 2J4LA 3WWMA 1OHBA 3S6GA 4USJA 3ZZIA 2VA1A 3D41A 2R8VA 2JJXA 3KZFA 2BUFA 2BNFA 4NDQB 4JZ8A 2BMUA 4OLCA 4NDOA 3QUOA 3K4YA 3K56A 3L86A 2BNEA 3D40A 2IJ9A 2BRIA 3T7BA 3EK5A 2HMFA 2E9YA 4NDRB 1Z9DA 4NDOB 2BRXA 2WXBA 3AB4A 2JI5A 2OGXB 2RD5A 3L76A 3QURA 3K4OA 2A1FA 2OGXA 4AB7A 1E19A 2BNDA 3C20A 4F6TB 1OHAA 4NDRA 2V5HA 3NWYA 2JJ4A 4NDQA 4F6TA 2J0WA 2WE5A 1YBDA 3K52A 2J0XA 3EK6A 3AAWA 3QVFA 1GS5A 4JZ9A 4I49A 3QUNA 3AB2A 4JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  2W21 A;  4A7W A;  3WWN A;  2CDQ A;  3LL5 A;  2BTY A;  3LKK A;  4A7X A;  3LL9 A;  1B7B A;  3ZZF A;  3TVI A;  3D2P A;  3C1N A;  3S6K A;  2X2W A;  2AKO A;  3ZZH A;  4NDP A;  3U6U A;  3B8G A;  2V4Y A;  3ZZG A;  2J5V A;  2WE4 A;  3C1M A;  2J4K A;  2J4J A;  2R98 A;  3D2M A;  4Q1T A;  4AXS A;  1GSJ A;  4NDP B;  4KZT A;  2AP9 A;  1OH9 A;  3QVH A;  2J5T A;  2J4L A;  3WWM A;  1OHB A;  3S6G A;  4USJ A;  3ZZI A;  2VA1 A;  3D41 A;  2R8V A;  2JJX A;  3KZF A;  2BUF A;  2BNF A;  4NDQ B;  4JZ8 A;  2BMU A;  4OLC A;  4NDO A;  3QUO A;  3K4Y A;  3K56 A;  3L86 A;  2BNE A;  3D40 A;  2IJ9 A;  2BRI A;  3T7B A;  3EK5 A;  2HMF A;  2E9Y A;  4NDR B;  1Z9D A;  4NDO B;  2BRX A;  2WXB A;  3AB4 A;  2JI5 A;  2OGX B;  2RD5 A;  3L76 A;  3QUR A;  3K4O A;  2A1F A;  2OGX A;  4AB7 A;  1E19 A;  2BND A;  3C20 A;  4F6T B;  1OHA A;  4NDR A;  2V5H A;  3NWY A;  2JJ4 A;  4NDQ A;  4F6T A;  2J0W A;  2WE5 A;  1YBD A;  3K52 A;  2J0X A;  3EK6 A;  3AAW A;  3QVF A;  1GS5 A;  4JZ9 A;  4I49 A;  3QUN A;  3AB2 A;  4JZ7 A; 
#chains in the Genus database with same CATH topology
 3S6H A;  2W21 A;  4A7W A;  3WWN A;  2CDQ A;  3LL5 A;  2BTY A;  3LKK A;  4A7X A;  3LL9 A;  1B7B A;  3ZZF A;  3TVI A;  3D2P A;  3C1N A;  3S6K A;  2X2W A;  2AKO A;  3ZZH A;  4NDP A;  3U6U A;  3B8G A;  2V4Y A;  3ZZG A;  2J5V A;  2WE4 A;  3C1M A;  2J4K A;  2J4J A;  2R98 A;  3D2M A;  4Q1T A;  4AXS A;  1GSJ A;  4NDP B;  4KZT A;  2AP9 A;  1OH9 A;  3QVH A;  2J5T A;  2J4L A;  3WWM A;  1OHB A;  3S6G A;  4USJ A;  3ZZI A;  2VA1 A;  3D41 A;  2R8V A;  2JJX A;  3KZF A;  2BUF A;  2BNF A;  4NDQ B;  4JZ8 A;  2BMU A;  4OLC A;  4NDO A;  3QUO A;  3K4Y A;  3K56 A;  3L86 A;  2BNE A;  3D40 A;  2IJ9 A;  2BRI A;  3T7B A;  3EK5 A;  2HMF A;  2E9Y A;  4NDR B;  1Z9D A;  4NDO B;  2BRX A;  2WXB A;  3AB4 A;  2JI5 A;  2OGX B;  2RD5 A;  3L76 A;  3QUR A;  3K4O A;  2A1F A;  2OGX A;  4AB7 A;  1E19 A;  2BND A;  3C20 A;  4F6T B;  1OHA A;  4NDR A;  2V5H A;  3NWY A;  2JJ4 A;  4NDQ A;  4F6T A;  2J0W A;  2WE5 A;  1YBD A;  3K52 A;  2J0X A;  3EK6 A;  3AAW A;  3QVF A;  1GS5 A;  4JZ9 A;  4I49 A;  3QUN A;  3AB2 A;  4JZ7 A; 
#chains in the Genus database with same CATH homology
 3S6H A;  2W21 A;  4A7W A;  3WWN A;  2CDQ A;  3LL5 A;  2BTY A;  3LKK A;  4A7X A;  3LL9 A;  1B7B A;  3ZZF A;  3TVI A;  3D2P A;  3C1N A;  3S6K A;  2X2W A;  2AKO A;  3ZZH A;  4NDP A;  3U6U A;  3B8G A;  2V4Y A;  3ZZG A;  2J5V A;  2WE4 A;  3C1M A;  2J4K A;  2J4J A;  2R98 A;  3D2M A;  4Q1T A;  4AXS A;  1GSJ A;  4NDP B;  4KZT A;  2AP9 A;  1OH9 A;  3QVH A;  2J5T A;  2J4L A;  3WWM A;  1OHB A;  3S6G A;  4USJ A;  3ZZI A;  2VA1 A;  3D41 A;  2R8V A;  2JJX A;  3KZF A;  2BUF A;  2BNF A;  4NDQ B;  4JZ8 A;  2BMU A;  4OLC A;  4NDO A;  3QUO A;  3K4Y A;  3K56 A;  3L86 A;  2BNE A;  3D40 A;  2IJ9 A;  2BRI A;  3T7B A;  3EK5 A;  2HMF A;  2E9Y A;  4NDR B;  1Z9D A;  4NDO B;  2BRX A;  2WXB A;  3AB4 A;  2JI5 A;  2OGX B;  2RD5 A;  3L76 A;  3QUR A;  3K4O A;  2A1F A;  2OGX A;  4AB7 A;  1E19 A;  2BND A;  3C20 A;  4F6T B;  1OHA A;  4NDR A;  2V5H A;  3NWY A;  2JJ4 A;  4NDQ A;  4F6T A;  2J0W A;  2WE5 A;  1YBD A;  3K52 A;  2J0X A;  3EK6 A;  3AAW A;  3QVF A;  1GS5 A;  4JZ9 A;  4I49 A;  3QUN A;  3AB2 A;  4JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...