2WE6A

Crystal structure of plasmodium falciparum ubiquitin carboxyl- terminal hydrolase 3 (uchl3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
224
structure length
208
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVKENFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPNDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
total genus 62
structure length 208
sequence length 224
chains with identical sequence B
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2we6A01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2we6A02
2WDTA 2WE6A
chains in the Genus database with same CATH superfamily
1AOAA 4LSAA 3MJFA 4ME6A 4HNVA 5LOVF 2M05A 1VBGA 4UFZA 2CQYA 2PBZA 1BKRA 4JI7H 1BJTA 4DV2H 1S97A 1BXRA 4ECQA 4FBUA 5A38A 4F4YA 4RNMA 1I94H 4ED0A 2JA6G 4QW8A 5BPHA 1HR0H 2K2RA 3T5LA 3GTGA 2ASDA 3GLKA 5FJ8G 5KFQA 3NGDA 2W9AA 3HORA 4A3JG 2B63G 5KFMA 4APMA 4X65H 5KFEA 1IBLH 5JVDF 3KHLA 2QJZA 3GILA 3WNZA 2CKZB 1KJ8A 2MCTA 4J9KA 2J6TA 1Y1WA 4DR4H 3BABA 1IBMH 2PN1A 2W6ZA 1Y1VG 2YL2A 2HGSA 5DG7A 4K0KH 2IA6A 4JI6H 2JA5A 3GIKA 5C44G 2JA7A 1Y1WG 2VQEH 4EBDA 1AA2A 5KFCA 2FK3A 1V4YA 5BMVF 1WYLA 3RBEA 4TV9F 3QZ7A 1N36H 1RT8A 2DLNA 4MV9A 5LL6b 4LSXA 1EZ1A 2W6PA 4JV2A 1C30A 2ZDQA 4RB0A 4UCUA 5KT6A 2VE7C 2WDTA 2R8JA 1BNCA 3RJ0A 3G6XA 4DV0H 4DV5H 1JLLB 5FMTA 5KFFA 2C35B 1X9NA 2UXDH 3LMLA 5KFXA 4DL4A 1PA7A 4A3MG 1HNWH 5L0OA 3RUPA 1JXLA 4DV4H 1RJRA 1WKUA 2E9KA 1KJJA 2UUAH 3EPIA 2YRXA 3PZPA 4O3PA 1SCUB 5BVRA 4TV8F 2W57A 4PDBA 2JA6A 2R92A 5CB4F 2D88A 2DZDA 4A3IG 3EYYA 2Q2TA 1K1SA 2OH2A 2AGPA 4IRCA 4JI3H 3VPBA 2I87A 5J8EA 1TWCA 2L3GA 3PR5B 4Q57B 1AN7A 3N40P 4UCOA 4J9MA 4ED7A 2PVPA 3H3VH 4NLGA 2J9GA 4O4HF 5KT7A 3HOWG 1WYNA 5I47A 5L1KA 4Y8VB 5IYCG 1R9TA 2JV9A 1JDBB 4JI2H 2W9CB 1VKAA 1WYMA 2VPSA 3T1HH 5DQGA 1Z2PX 4O3RA 2JEJA 2HVQA 1V5KA 5KX5F 4YQWA 1WYPA 2V5AA 3U9TA 1Y1VA 4CC5A 4F4XA 2RDJA 4ED3A 3PW0A 4TXIA 5C8YF 3PW5A 2JA8G 4B3RH 1FKAH 1WYQA 2VZIB 3OTOH 2HL8A 4MV4A 4RAYA 2C2DA 4OX9H 2CW7A 3GIIA 5DQIA 1TAEA 3K3VA 3JALM 4FU0A 4MA0A 4MTDA 4QIWA 4IZOA 4PWQA 3PO3G 2PMZA 2RGRA 3HKZE 4JYAH 1J5EH 3J80W 2YZMA 3R5HA 4JI4H 1O75A 2FPGB 3G6YA 4IRKA 3GTJA 3RAXA 4IR1A 1UJOA 4J0MA 4X64H 4A2BA 5JH7F 3RTXA 5KG6A 1M7JA 4X66H 3OSNA 1I7LA 4Q58A 1EUCB 2ATLA 1A9XA 5KT3A 4J9PA 1XMOH 3TQTA 2UVVA 3RB4A 3PO2G 3Q8SB 3IG0A 2NU8B 3BA8A 5KFIA 2D86A 5DG8A 2F4VH 3REPB 1C3OA 5KT4A 2YCHA 3JAKM 2NU7B 1Y14B 4YJ2F 4FM9A 2VE7A 3PW7A 2YU9A 1M0TA 4TUYF 2E2HA 3RV3A 5LYJF 4DL7A 4M9UA 2VZGB 1OWTA 2YZNA 4LF9H 5D1OA 2FMAA 3IN5A 2FB9A 4B3SH 2B63A 3V6HA 3I12A 3T5KA 1EYZA 2SCUB 2C22A 2PMZE 5KFNA 4DUZH 4ECRA 1IBKH 1KJ9A 2V58A 4Q0YA 2XCLA 1AUVA 2R7MA 3Q8QB 1SH6A 2EE7A 3KXYT 2VUMA 3OUZA 5FPOA 4TXKA 2JA7G 4BY1G 5IYBG 2FLPA 2UXCH 4YBZB 2RR8A 5KFGA 4EBCA 4EFBA 2VUMG 5C3EG 3N8DA 2UXBH 4UCVA 1KBLA 3H20A 4QWAA 2AGOA 4EDLA 1M6VA 2J6UA 2VPQA 4EGJA 2JEIA 1ZETA 1CQJB 2NUAB 5LMNH 2VZCA 1TWGA 1ZHQA 4RZQA 4YAJB 3H4BA 4DL2A 2W7PA 5DGBA 4XX0B 2R85A 4U7CA 5FPRA 5KT5A 3PN1A 4J9SA 3FMAA 1KC7A 4ECYA 4O2AF 5KKNB 3GIDA 4A3DG 2FPPB 3HOVG 1KJIA 4F4ZA 1B33N 2CW8A 4A3CG 5KG3A 2RF4A 2WAQE 3GQCA 3GV5B 5IYZF 4ED6A 2AQ4A 5EWGA 4HR7A 4ED8A 4AYBE 4ETSA 3G8CA 4ECUA 4NXNH 2WYOA 3AYHB 3MFHA 2YRNA 3MWEA 3RAQA 1PK8A 3PW4A 4J9QA 2R87A 4JV5H 3RFCA 4JI1H 2DIKA 1TWAA 4GC6A 1EHIA 4A2AA 3VPCA 5F9LA 4J9OA 1BHDA 1I3QA 3CVZA 1W96A 2X0SA 2FLLA 4DV7H 2WFNA 3VMMA 1FVIA 2C2EA 4ECVA 4LFBH 3N41B 3KHHA 5KG7A 1RJQA 4UCRA 1V51A 5KFHA 3HBLA 2C00A 4YR2A 2XCAA 2UVRA 1XNRH 3BAAA 2YYAA 4I50F 3VPDA 3G6VA 4XZ3B 2BQ3A 4IR9A 5FLMG 5JVLA 5IYDG 1WIXA 4JI8H 4G3IA 4RB1A 3HOCA 3Q2OA 2W70A 3RGZA 1MZBA 4QW9A 3FKIA 3MR5A 2ASJA 2AU0A 4A93G 1VS0A 1DIKA 2GLTA 3RB0A 3JRWA 4RU9A 4EG0A 4LF8H 3M9NB 2AGQA 4IWXA 2UVWA 1N48A 2XC9A 1S0OA 4GKKH 4MA5A 4U6PA 5K2MA 2OWOA 4FBTA 3K5HA 1A0IA 3GTKA 1T3NA 5GONF 3ORRA 3N43B 4YHHH 3MR2A 3TIIA 3BJYA 2W71A 2ALZA 2R6FA 2GPSA 2W9CA 3GTPA 1W93A 1N33H 5EZYF 1K83A 4Q43A 3KAJA 4RNOA 4UCTA 5LP6F 5KFPA 2R7KA 4JUZA 2W8KA 2R93A 4LF5H 4DR5H 2R8GA 1IOWA 1UC9A 3Q8PB 2UVUA 3V6KA 2WB1A 2R93G 2R8KA 1T94A 2I8CA 5HV6A 1UEGA 4F50A 3GTQA 4A3LG 4BWSC 4YP3A 2Y0SE 3RBDA 2EQOA 4C5CA 3HOPA 2ZJTA 1TWFA 4EYHB 1E4EA 3MWDA 4JV0A 3BQ2A 3JSLA 4EFEA 4I55F 3I4MG 2QYZA 4MV3A 1GO3E 4RZRA 1S0MA 3PW2A 5KFLA 4J9NA 4DV3H 3F7PA 3U9SA 2DPIA 2R7LA 4MTEA 2FP4B 3FDSA 2HVRA 4O3SA 1JDEA 3Q1KA 3I6XA 4ZQIA 4AQYH 4JV1A 2CZGA 3GTLA 4ECZA 2VUGA 5FLXW 4QWCA 3BQ0A 2W6MA 3FERA 3PR4A 3MR3A 1CE8A 4O3NA 4DR6H 2NVXA 5A37A 3N44B 3QZ8A 2QK4A 3K5IA 3R5FA 4TQSA 2VA2A 2UUBH 2O03A 4EYIB 5DG9A 4HYKA 2BR0A 1XMQH 3V4SA 4B3MH 2FLNA 2Q2UA 2RGVA 4Q45A 1I7NA 1GGOA 4UCSA 2UUCH 1VAJA 4IHJF 5KG2A 2XGQA 3EPGA 1UNNC 4MV8A 1HNXH 4ECWA 4NXMH 2FE3A 4LF6H 1Z2NX 4Q44A 3T1YH 4O4IF 1CQIB 1N56A 4BY7G 4RAZA 1L2ZA 3JAMW 2YRWA 1XDNA 5KFVA 4GLXA 2W7OA 3VP7A 2UU9H 3MWMA 3C0FB 2XD4A 5KFBA 4XYMB 5HBRB 5T14A 2OLSA 4L1KA 3J7AK 2VR1A 1DV1A 3CO1A 1E4FT 1WR2A 2R86A 5C5JA 5LXTF 5L1IA 2W6OA 1ZQ7A 1S10A 1DV2A 4B7LA 3H40A 4DR3H 1UC8A 2YS7A 2NU9B 3GTOA 4O3QA 4J9LA 4FS1A 2DK9A 1CS0A 5KFDA 5LMUH 1WCMA 2R0OA 1WJOA 3BQ1A 1RJPA 1GSAA 4EGQA 2R7ZG 3Q8RB 4Q59A 4HQ6A 1PX2A 1WCMG 5DLFA 2W9BA 3SI8A 1S0NA 1AUXA 3OHAA 4ED1A 1TJTA 1GSOA 2E5LH 1N34H 3T5HA 5A36A 4IAJA 5KFUA 4C2MA 3KMUB 4Q8EA 1P5SA 2FK1A 5EWEA 2HKPA 1VKZA 4RUCA 4DLKA 3LWBA 4ZHQF 2VQDA 3N6XA 4YR3A 4ECXA 3OSPA 5IT9W 1H67A 1S68A 4ZOLF 3CQZA 2R8IA 2IP4A 3HKZA 3FKIG 4YJ3F 4KHPH 1WYOA 1S03G 1S9FA 3QFFA 3GIJA 3GV8B 1TA8A 1T36A 4LMYA 4MV7A 4FS2A 1XNQH 4DV6H 5KFJA 2V59A 3LP8A 3M9OB 4LF4H 5CA1F 1B04A 4JI5H 4EDNA 2D87A 2K3SA 1RK5A 3H0GA 1DGSA 5KFAA 1RYRA 4Q8FA 5KG5A 4ED2A 2D85A 2WE6A 5CAEB 4WBNF 2E2IA 4RUAA 5FMUA 4IWYA 5L9XA 1RYSA 2R84A 5BPFA 3V6JA 5BR8H 5EWFA 4DR1H 5DGAA 2FJZA 4EBEA 5DQHA 4O3OA 1ZHSA 4EEQA 2EYIA 4YB8B 5EOYA 5D1OB 5L1JA 3TINA 2JEFA 4A3KG 4RB2C 1EUDB 2IBKA 4AYBA 4X62H 4GKJH 2VA3A 2HVSA 1GLVA 3JSNA 4LVRA 2R7NA 3BA9A 1E4EB 5LA6F 3J81W 3KHGA 4HNUA 2ZM6H 2R8HA 3I4NG 3JRXA 3KMWB 5IWAH 2HL9A 5JQWA 3GTMA 2NVYA 3V4ZA 4QWBA 3UFXB 1KEEA 2IGPA 3BG5A 3RIZA 2P0AA 5KFOA 3KHRA 4A3GG 3TIGA 4BXXG 2EYNA 3RF2A 3K3PA 3OHBA 2XGPA 2NU6B 2W9BB 2VQFH 4B3TH 3H4DA 2VOBA 2BQRA 4QJFA 2YS6A 3HOUG 3R23A 4DL5A 4RNNA 2DWCA 3GIQA 5CA0F 2RDIA 2FK2A 5A2QW 4CC6A 4YR0A 3HB9A 5KFSA 2XCPA 4LF7H 4MV6A 1SEIA 4RB3C 3SE7A 3WO0A 5IP9G 2C2RA 3R5XA 2BQUA 1P2XA 2VZDA 1RK6A 1I6UA 3L2PA 2WTFA 2FPIB 3MFIA 4O4LF 3TQ1A 4YAKB 4QIWE 4A3EG 2R82A 5H80A 2C28A 1TWHA 2ZDHA 3JZIA 3HOXG 2JA5G 3HOZG 1DXXA 1M0WA 1P8LA 5KFWA 4DL3A 1SYXB 4F4WA 2I80A 3KY9A 1Z2OX 4LH7A 2FKLA 1MB8A 3JARM 1KJQA 3MR6A 3ETJA 3RB6A 4HNTA 4EDMA 1HNZH 3T5JA 3L4KA 4JI0H 5IP7G 3KAKA 4M7EA 4YY3H 3EAYA 4ECSA 1ULZA 3GIMA 3HOYG 4DR7H 2WAQA 4I7HA 3DF7A 4LH6A 4LFAH 3GV7B 3N42B 1IOVA 4J9RA 4QWEA 3WO1A 2ZDGA 5KG0A 2W6QA 4DL6A 3KALA 5C4XG 4R8UB 1B6SA 1V9PA 2R92G 4LVPA 4EEYA 3RGXA 5J2UF 2ASLA 3GIPA 2HJWA 2KSWA 4WD3A 2D89A 1WH2A 2R7ZA 4DV1H 5L1LA 2WA6A 1QAGA 4GC7A 4DUYH 5KFRA 4R7RA 1EUVA 3F8NA 1JX4A 5FD5A 2XIGA 1WYRA 3HXLA 1BGWA 1SFOA 4A3FG 4BBRG 2V4RA 2Y0SA 5KG1A 3M9MB 2W8LA 5KT2A 1SH5A 2WB1E 5J2TF 2DPJA 3ETHA 4TQRA 2JEGA 4XYLB 3OUUA 5KFZA 2YW2A 4ECTA 3ORQA 5KG4A 5KFTA 4E4TA 4QWDA 5A4BA 4A3BG 5FD6A 5D8DA 1VBHA 2WA7A 3KTMA 4DDPA 5D1PA 2QJXA 5KFYA 4BBSG 2V9WA 3PVXA 3RB3A 5DLGA 2IMWP 1PXYA 5C1OA 2R8UA 1FJGH 1B6RA 1E4GT 2WA5A 3UQ8A 5KFKA 3M4IA 2GPWA 2V4QA 2W6NA 5F9NA 5EDWA 4LFCH 1JKJB 4I4TF 3H0GG 4IRDA 1I50A 4C5AA 4DR2H 1N32H 1WSCA 4ZI7F 4O2BF 2YZGA 3L4JA 2J6SA 4MV1A 3RV4A 3E5NA 5JUMA 1JIHA 4R8UA 1K1QA 2HHHH 5C1PA 4MAMA 4C5BA 1GSHA 1GYFA
chains in the Genus database with same CATH topology
5D1OB 4LSAA 1N33H 2F4VH 4RB2C 1X9NA 3KAJA 4UCTA 4UFZA 4X62H 4LF5H 4GKJH 2YCHA 4DR5H 2HVSA 3JSNA 4JI7H 1BJTA 4LVRA 4DV2H 3BA9A 4FM9A 2VE7A 3J81W 2ZM6H 1I94H 5IWAH 2HL9A 1M0TA 4BWSC 2EQOA 4LF9H 1HR0H 2IGPA 3RIZA 5D1OA 2ZJTA 3RF2A 4B3SH 2VQFH 4EEQA 4B3TH 3JSLA 4EFEA 2VOBA 4DUZH 1IBKH 4APMA 4X65H 1IBLH 4DV3H 4Q0YA 3BA8A 4MTEA 4CC6A 5A2QW 4LF7H 2HVRA 1SEIA 4RB3C 3KXYT 4AQYH 2MCTA 5FPOA 2VUGA 5FLXW 3BABA 1IBMH 4DR4H 2UXCH 1I6UA 3L2PA 2HGSA 4K0KH 4JI6H 4EFBA 2UXBH 4UCVA 4DR6H 3H20A 2VQEH 3N44B 1M0WA 1P8LA 1N36H 2UUBH 2O03A 4MV9A 1XMQH 5LL6b 4LSXA 1SYXB 5LMNH 4B3MH 2Q2UA 2RGVA 4LH7A 1Z2OX 1ZHQA 4RB0A 4RZQA 4UCSA 4UCUA 2VE7C 2WDTA 2UUCH 4NXMH 3RJ0A 4DV0H 5FPRA 4DV5H 3PN1A 5FMTA 2FE3A 3FMAA 3L4KA 1Z2NX 3T1YH 3KAKA 3LMLA 1HNZH 4JI0H 4LF6H 2UXDH 1HNWH 4RAZA 2CW8A 4M7EA 1L2ZA 4YY3H 3EAYA 3JAMW 4DV4H 1XDNA 2UUAH 4GLXA 3VP7A 4DR7H 2UU9H 3MWMA 3C0FB 3DF7A 4I7HA 4LH6A 4LFAH 2W57A 3N42B 3J7AK 4PDBA 4ETSA 1E4FT 3EYYA 2Q2TA 3KALA 4NXNH 4JI3H 2WYOA 1V9PA 4LVPA 3RGXA 4DR3H 3N40P 1AN7A 4UCOA 2KSWA 5LMUH 1WH2A 4DV1H 4JI1H 4DUYH 4R7RA 1EUVA 3F8NA 4JI2H 5FD5A 4A2AA 2XIGA 2VPSA 3T1HH 1Z2PX 3HXLA 1BGWA 2HVQA 3CVZA 2E5LH 4DV7H 4CC5A 1N34H 4IAJA 1FVIA 4B3RH 3N41B 2HKPA 4LFBH 1FKAH 3OTOH 4UCRA 2HL8A 3N6XA 4RAYA 4OX9H 1S68A 2CW7A 1XNRH 5IT9W 3BAAA 1TAEA 3K3VA 4MTDA 4KHPH 5FD6A 4JI8H 1S03G 4DDPA 5D1PA 4RB1A 1J5EH 2RGRA 1TA8A 3RGZA 1MZBA 4LMYA 1O75A 4MV7A 3J80W 4JI4H 1XNQH 4DV6H 1VS0A 4J0MA 4LF4H 4X64H 1B04A 4JI5H 1FJGH 4A2BA 1E4GT 3UQ8A 4LFCH 1DGSA 3M4IA 3RTXA 4LF8H 2WE6A 4X66H 4GKKH 5FMUA 2OWOA 4DR2H 1HNXH 1A0IA 1N32H 4JV5H 3L4JA 1XMOH 4JYAH 3N43B 5BR8H 4YHHH 4DR1H 2HHHH 3IG0A 1ZHSA 1GYFA 5EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDT A;  2WE6 A; 
#chains in the Genus database with same CATH topology
 1AOA A;  4LSA A;  3MJF A;  4ME6 A;  4HNV A;  5LOV F;  2M05 A;  1VBG A;  4UFZ A;  2CQY A;  2PBZ A;  1BKR A;  4JI7 H;  1BJT A;  4DV2 H;  1S97 A;  1BXR A;  4ECQ A;  4FBU A;  5A38 A;  4F4Y A;  4RNM A;  1I94 H;  4ED0 A;  2JA6 G;  4QW8 A;  5BPH A;  1HR0 H;  2K2R A;  3T5L A;  3GTG A;  2ASD A;  3GLK A;  5FJ8 G;  5KFQ A;  3NGD A;  2W9A A;  3HOR A;  4A3J G;  2B63 G;  5KFM A;  4APM A;  4X65 H;  5KFE A;  1IBL H;  5JVD F;  3KHL A;  2QJZ A;  3GIL A;  3WNZ A;  2CKZ B;  1KJ8 A;  2MCT A;  4J9K A;  2J6T A;  1Y1W A;  4DR4 H;  3BAB A;  1IBM H;  2PN1 A;  2W6Z A;  1Y1V G;  2YL2 A;  2HGS A;  5DG7 A;  4K0K H;  2IA6 A;  4JI6 H;  2JA5 A;  3GIK A;  5C44 G;  2JA7 A;  1Y1W G;  2VQE H;  4EBD A;  1AA2 A;  5KFC A;  2FK3 A;  1V4Y A;  5BMV F;  1WYL A;  3RBE A;  4TV9 F;  3QZ7 A;  1N36 H;  1RT8 A;  2DLN A;  4MV9 A;  5LL6 b;  4LSX A;  1EZ1 A;  2W6P A;  4JV2 A;  1C30 A;  2ZDQ A;  4RB0 A;  4UCU A;  5KT6 A;  2VE7 C;  2WDT A;  2R8J A;  1BNC A;  3RJ0 A;  3G6X A;  4DV0 H;  4DV5 H;  1JLL B;  5FMT A;  5KFF A;  2C35 B;  1X9N A;  2UXD H;  3LML A;  5KFX A;  4DL4 A;  1PA7 A;  4A3M G;  1HNW H;  5L0O A;  3RUP A;  1JXL A;  4DV4 H;  1RJR A;  1WKU A;  2E9K A;  1KJJ A;  2UUA H;  3EPI A;  2YRX A;  3PZP A;  4O3P A;  1SCU B;  5BVR A;  4TV8 F;  2W57 A;  4PDB A;  2JA6 A;  2R92 A;  5CB4 F;  2D88 A;  2DZD A;  4A3I G;  3EYY A;  2Q2T A;  1K1S A;  2OH2 A;  2AGP A;  4IRC A;  4JI3 H;  3VPB A;  2I87 A;  5J8E A;  1TWC A;  2L3G A;  3PR5 B;  4Q57 B;  1AN7 A;  3N40 P;  4UCO A;  4J9M A;  4ED7 A;  2PVP A;  3H3V H;  4NLG A;  2J9G A;  4O4H F;  5KT7 A;  3HOW G;  1WYN A;  5I47 A;  5L1K A;  4Y8V B;  5IYC G;  1R9T A;  2JV9 A;  1JDB B;  4JI2 H;  2W9C B;  1VKA A;  1WYM A;  2VPS A;  3T1H H;  5DQG A;  1Z2P X;  4O3R A;  2JEJ A;  2HVQ A;  1V5K A;  5KX5 F;  4YQW A;  1WYP A;  2V5A A;  3U9T A;  1Y1V A;  4CC5 A;  4F4X A;  2RDJ A;  4ED3 A;  3PW0 A;  4TXI A;  5C8Y F;  3PW5 A;  2JA8 G;  4B3R H;  1FKA H;  1WYQ A;  2VZI B;  3OTO H;  2HL8 A;  4MV4 A;  4RAY A;  2C2D A;  4OX9 H;  2CW7 A;  3GII A;  5DQI A;  1TAE A;  3K3V A;  3JAL M;  4FU0 A;  4MA0 A;  4MTD A;  4QIW A;  4IZO A;  4PWQ A;  3PO3 G;  2PMZ A;  2RGR A;  3HKZ E;  4JYA H;  1J5E H;  3J80 W;  2YZM A;  3R5H A;  4JI4 H;  1O75 A;  2FPG B;  3G6Y A;  4IRK A;  3GTJ A;  3RAX A;  4IR1 A;  1UJO A;  4J0M A;  4X64 H;  4A2B A;  5JH7 F;  3RTX A;  5KG6 A;  1M7J A;  4X66 H;  3OSN A;  1I7L A;  4Q58 A;  1EUC B;  2ATL A;  1A9X A;  5KT3 A;  4J9P A;  1XMO H;  3TQT A;  2UVV A;  3RB4 A;  3PO2 G;  3Q8S B;  3IG0 A;  2NU8 B;  3BA8 A;  5KFI A;  2D86 A;  5DG8 A;  2F4V H;  3REP B;  1C3O A;  5KT4 A;  2YCH A;  3JAK M;  2NU7 B;  1Y14 B;  4YJ2 F;  4FM9 A;  2VE7 A;  3PW7 A;  2YU9 A;  1M0T A;  4TUY F;  2E2H A;  3RV3 A;  5LYJ F;  4DL7 A;  4M9U A;  2VZG B;  1OWT A;  2YZN A;  4LF9 H;  5D1O A;  2FMA A;  3IN5 A;  2FB9 A;  4B3S H;  2B63 A;  3V6H A;  3I12 A;  3T5K A;  1EYZ A;  2SCU B;  2C22 A;  2PMZ E;  5KFN A;  4DUZ H;  4ECR A;  1IBK H;  1KJ9 A;  2V58 A;  4Q0Y A;  2XCL A;  1AUV A;  2R7M A;  3Q8Q B;  1SH6 A;  2EE7 A;  3KXY T;  2VUM A;  3OUZ A;  5FPO A;  4TXK A;  2JA7 G;  4BY1 G;  5IYB G;  2FLP A;  2UXC H;  4YBZ B;  2RR8 A;  5KFG A;  4EBC A;  4EFB A;  2VUM G;  5C3E G;  3N8D A;  2UXB H;  4UCV A;  1KBL A;  3H20 A;  4QWA A;  2AGO A;  4EDL A;  1M6V A;  2J6U A;  2VPQ A;  4EGJ A;  2JEI A;  1ZET A;  1CQJ B;  2NUA B;  5LMN H;  2VZC A;  1TWG A;  1ZHQ A;  4RZQ A;  4YAJ B;  3H4B A;  4DL2 A;  2W7P A;  5DGB A;  4XX0 B;  2R85 A;  4U7C A;  5FPR A;  5KT5 A;  3PN1 A;  4J9S A;  3FMA A;  1KC7 A;  4ECY A;  4O2A F;  5KKN B;  3GID A;  4A3D G;  2FPP B;  3HOV G;  1KJI A;  4F4Z A;  1B33 N;  2CW8 A;  4A3C G;  5KG3 A;  2RF4 A;  2WAQ E;  3GQC A;  3GV5 B;  5IYZ F;  4ED6 A;  2AQ4 A;  5EWG A;  4HR7 A;  4ED8 A;  4AYB E;  4ETS A;  3G8C A;  4ECU A;  4NXN H;  2WYO A;  3AYH B;  3MFH A;  2YRN A;  3MWE A;  3RAQ A;  1PK8 A;  3PW4 A;  4J9Q A;  2R87 A;  4JV5 H;  3RFC A;  4JI1 H;  2DIK A;  1TWA A;  4GC6 A;  1EHI A;  4A2A A;  3VPC A;  5F9L A;  4J9O A;  1BHD A;  1I3Q A;  3CVZ A;  1W96 A;  2X0S A;  2FLL A;  4DV7 H;  2WFN A;  3VMM A;  1FVI A;  2C2E A;  4ECV A;  4LFB H;  3N41 B;  3KHH A;  5KG7 A;  1RJQ A;  4UCR A;  1V51 A;  5KFH A;  3HBL A;  2C00 A;  4YR2 A;  2XCA A;  2UVR A;  1XNR H;  3BAA A;  2YYA A;  4I50 F;  3VPD A;  3G6V A;  4XZ3 B;  2BQ3 A;  4IR9 A;  5FLM G;  5JVL A;  5IYD G;  1WIX A;  4JI8 H;  4G3I A;  4RB1 A;  3HOC A;  3Q2O A;  2W70 A;  3RGZ A;  1MZB A;  4QW9 A;  3FKI A;  3MR5 A;  2ASJ A;  2AU0 A;  4A93 G;  1VS0 A;  1DIK A;  2GLT A;  3RB0 A;  3JRW A;  4RU9 A;  4EG0 A;  4LF8 H;  3M9N B;  2AGQ A;  4IWX A;  2UVW A;  1N48 A;  2XC9 A;  1S0O A;  4GKK H;  4MA5 A;  4U6P A;  5K2M A;  2OWO A;  4FBT A;  3K5H A;  1A0I A;  3GTK A;  1T3N A;  5GON F;  3ORR A;  3N43 B;  4YHH H;  3MR2 A;  3TII A;  3BJY A;  2W71 A;  2ALZ A;  2R6F A;  2GPS A;  2W9C A;  3GTP A;  1W93 A;  1N33 H;  5EZY F;  1K83 A;  4Q43 A;  3KAJ A;  4RNO A;  4UCT A;  5LP6 F;  5KFP A;  2R7K A;  4JUZ A;  2W8K A;  2R93 A;  4LF5 H;  4DR5 H;  2R8G A;  1IOW A;  1UC9 A;  3Q8P B;  2UVU A;  3V6K A;  2WB1 A;  2R93 G;  2R8K A;  1T94 A;  2I8C A;  5HV6 A;  1UEG A;  4F50 A;  3GTQ A;  4A3L G;  4BWS C;  4YP3 A;  2Y0S E;  3RBD A;  2EQO A;  4C5C A;  3HOP A;  2ZJT A;  1TWF A;  4EYH B;  1E4E A;  3MWD A;  4JV0 A;  3BQ2 A;  3JSL A;  4EFE A;  4I55 F;  3I4M G;  2QYZ A;  4MV3 A;  1GO3 E;  4RZR A;  1S0M A;  3PW2 A;  5KFL A;  4J9N A;  4DV3 H;  3F7P A;  3U9S A;  2DPI A;  2R7L A;  4MTE A;  2FP4 B;  3FDS A;  2HVR A;  4O3S A;  1JDE A;  3Q1K A;  3I6X A;  4ZQI A;  4AQY H;  4JV1 A;  2CZG A;  3GTL A;  4ECZ A;  2VUG A;  5FLX W;  4QWC A;  3BQ0 A;  2W6M A;  3FER A;  3PR4 A;  3MR3 A;  1CE8 A;  4O3N A;  4DR6 H;  2NVX A;  5A37 A;  3N44 B;  3QZ8 A;  2QK4 A;  3K5I A;  3R5F A;  4TQS A;  2VA2 A;  2UUB H;  2O03 A;  4EYI B;  5DG9 A;  4HYK A;  2BR0 A;  1XMQ H;  3V4S A;  4B3M H;  2FLN A;  2Q2U A;  2RGV A;  4Q45 A;  1I7N A;  1GGO A;  4UCS A;  2UUC H;  1VAJ A;  4IHJ F;  5KG2 A;  2XGQ A;  3EPG A;  1UNN C;  4MV8 A;  1HNX H;  4ECW A;  4NXM H;  2FE3 A;  4LF6 H;  1Z2N X;  4Q44 A;  3T1Y H;  4O4I F;  1CQI B;  1N56 A;  4BY7 G;  4RAZ A;  1L2Z A;  3JAM W;  2YRW A;  1XDN A;  5KFV A;  4GLX A;  2W7O A;  3VP7 A;  2UU9 H;  3MWM A;  3C0F B;  2XD4 A;  5KFB A;  4XYM B;  5HBR B;  5T14 A;  2OLS A;  4L1K A;  3J7A K;  2VR1 A;  1DV1 A;  3CO1 A;  1E4F T;  1WR2 A;  2R86 A;  5C5J A;  5LXT F;  5L1I A;  2W6O A;  1ZQ7 A;  1S10 A;  1DV2 A;  4B7L A;  3H40 A;  4DR3 H;  1UC8 A;  2YS7 A;  2NU9 B;  3GTO A;  4O3Q A;  4J9L A;  4FS1 A;  2DK9 A;  1CS0 A;  5KFD A;  5LMU H;  1WCM A;  2R0O A;  1WJO A;  3BQ1 A;  1RJP A;  1GSA A;  4EGQ A;  2R7Z G;  3Q8R B;  4Q59 A;  4HQ6 A;  1PX2 A;  1WCM G;  5DLF A;  2W9B A;  3SI8 A;  1S0N A;  1AUX A;  3OHA A;  4ED1 A;  1TJT A;  1GSO A;  2E5L H;  1N34 H;  3T5H A;  5A36 A;  4IAJ A;  5KFU A;  4C2M A;  3KMU B;  4Q8E A;  1P5S A;  2FK1 A;  5EWE A;  2HKP A;  1VKZ A;  4RUC A;  4DLK A;  3LWB A;  4ZHQ F;  2VQD A;  3N6X A;  4YR3 A;  4ECX A;  3OSP A;  5IT9 W;  1H67 A;  1S68 A;  4ZOL F;  3CQZ A;  2R8I A;  2IP4 A;  3HKZ A;  3FKI G;  4YJ3 F;  4KHP H;  1WYO A;  1S03 G;  1S9F A;  3QFF A;  3GIJ A;  3GV8 B;  1TA8 A;  1T36 A;  4LMY A;  4MV7 A;  4FS2 A;  1XNQ H;  4DV6 H;  5KFJ A;  2V59 A;  3LP8 A;  3M9O B;  4LF4 H;  5CA1 F;  1B04 A;  4JI5 H;  4EDN A;  2D87 A;  2K3S A;  1RK5 A;  3H0G A;  1DGS A;  5KFA A;  1RYR A;  4Q8F A;  5KG5 A;  4ED2 A;  2D85 A;  2WE6 A;  5CAE B;  4WBN F;  2E2I A;  4RUA A;  5FMU A;  4IWY A;  5L9X A;  1RYS A;  2R84 A;  5BPF A;  3V6J A;  5BR8 H;  5EWF A;  4DR1 H;  5DGA A;  2FJZ A;  4EBE A;  5DQH A;  4O3O A;  1ZHS A;  4EEQ A;  2EYI A;  4YB8 B;  5EOY A;  5D1O B;  5L1J A;  3TIN A;  2JEF A;  4A3K G;  4RB2 C;  1EUD B;  2IBK A;  4AYB A;  4X62 H;  4GKJ H;  2VA3 A;  2HVS A;  1GLV A;  3JSN A;  4LVR A;  2R7N A;  3BA9 A;  1E4E B;  5LA6 F;  3J81 W;  3KHG A;  4HNU A;  2ZM6 H;  2R8H A;  3I4N G;  3JRX A;  3KMW B;  5IWA H;  2HL9 A;  5JQW A;  3GTM A;  2NVY A;  3V4Z A;  4QWB A;  3UFX B;  1KEE A;  2IGP A;  3BG5 A;  3RIZ A;  2P0A A;  5KFO A;  3KHR A;  4A3G G;  3TIG A;  4BXX G;  2EYN A;  3RF2 A;  3K3P A;  3OHB A;  2XGP A;  2NU6 B;  2W9B B;  2VQF H;  4B3T H;  3H4D A;  2VOB A;  2BQR A;  4QJF A;  2YS6 A;  3HOU G;  3R23 A;  4DL5 A;  4RNN A;  2DWC A;  3GIQ A;  5CA0 F;  2RDI A;  2FK2 A;  5A2Q W;  4CC6 A;  4YR0 A;  3HB9 A;  5KFS A;  2XCP A;  4LF7 H;  4MV6 A;  1SEI A;  4RB3 C;  3SE7 A;  3WO0 A;  5IP9 G;  2C2R A;  3R5X A;  2BQU A;  1P2X A;  2VZD A;  1RK6 A;  1I6U A;  3L2P A;  2WTF A;  2FPI B;  3MFI A;  4O4L F;  3TQ1 A;  4YAK B;  4QIW E;  4A3E G;  2R82 A;  5H80 A;  2C28 A;  1TWH A;  2ZDH A;  3JZI A;  3HOX G;  2JA5 G;  3HOZ G;  1DXX A;  1M0W A;  1P8L A;  5KFW A;  4DL3 A;  1SYX B;  4F4W A;  2I80 A;  3KY9 A;  1Z2O X;  4LH7 A;  2FKL A;  1MB8 A;  3JAR M;  1KJQ A;  3MR6 A;  3ETJ A;  3RB6 A;  4HNT A;  4EDM A;  1HNZ H;  3T5J A;  3L4K A;  4JI0 H;  5IP7 G;  3KAK A;  4M7E A;  4YY3 H;  3EAY A;  4ECS A;  1ULZ A;  3GIM A;  3HOY G;  4DR7 H;  2WAQ A;  4I7H A;  3DF7 A;  4LH6 A;  4LFA H;  3GV7 B;  3N42 B;  1IOV A;  4J9R A;  4QWE A;  3WO1 A;  2ZDG A;  5KG0 A;  2W6Q A;  4DL6 A;  3KAL A;  5C4X G;  4R8U B;  1B6S A;  1V9P A;  2R92 G;  4LVP A;  4EEY A;  3RGX A;  5J2U F;  2ASL A;  3GIP A;  2HJW A;  2KSW A;  4WD3 A;  2D89 A;  1WH2 A;  2R7Z A;  4DV1 H;  5L1L A;  2WA6 A;  1QAG A;  4GC7 A;  4DUY H;  5KFR A;  4R7R A;  1EUV A;  3F8N A;  1JX4 A;  5FD5 A;  2XIG A;  1WYR A;  3HXL A;  1BGW A;  1SFO A;  4A3F G;  4BBR G;  2V4R A;  2Y0S A;  5KG1 A;  3M9M B;  2W8L A;  5KT2 A;  1SH5 A;  2WB1 E;  5J2T F;  2DPJ A;  3ETH A;  4TQR A;  2JEG A;  4XYL B;  3OUU A;  5KFZ A;  2YW2 A;  4ECT A;  3ORQ A;  5KG4 A;  5KFT A;  4E4T A;  4QWD A;  5A4B A;  4A3B G;  5FD6 A;  5D8D A;  1VBH A;  2WA7 A;  3KTM A;  4DDP A;  5D1P A;  2QJX A;  5KFY A;  4BBS G;  2V9W A;  3PVX A;  3RB3 A;  5DLG A;  2IMW P;  1PXY A;  5C1O A;  2R8U A;  1FJG H;  1B6R A;  1E4G T;  2WA5 A;  3UQ8 A;  5KFK A;  3M4I A;  2GPW A;  2V4Q A;  2W6N A;  5F9N A;  5EDW A;  4LFC H;  1JKJ B;  4I4T F;  3H0G G;  4IRD A;  1I50 A;  4C5A A;  4DR2 H;  1N32 H;  1WSC A;  4ZI7 F;  4O2B F;  2YZG A;  3L4J A;  2J6S A;  4MV1 A;  3RV4 A;  3E5N A;  5JUM A;  1JIH A;  4R8U A;  1K1Q A;  2HHH H;  5C1P A;  4MAM A;  4C5B A;  1GSH A;  1GYF A; 
#chains in the Genus database with same CATH homology
 5D1O B;  4LSA A;  1N33 H;  2F4V H;  4RB2 C;  1X9N A;  3KAJ A;  4UCT A;  4UFZ A;  4X62 H;  4LF5 H;  4GKJ H;  2YCH A;  4DR5 H;  2HVS A;  3JSN A;  4JI7 H;  1BJT A;  4LVR A;  4DV2 H;  3BA9 A;  4FM9 A;  2VE7 A;  3J81 W;  2ZM6 H;  1I94 H;  5IWA H;  2HL9 A;  1M0T A;  4BWS C;  2EQO A;  4LF9 H;  1HR0 H;  2IGP A;  3RIZ A;  5D1O A;  2ZJT A;  3RF2 A;  4B3S H;  2VQF H;  4EEQ A;  4B3T H;  3JSL A;  4EFE A;  2VOB A;  4DUZ H;  1IBK H;  4APM A;  4X65 H;  1IBL H;  4DV3 H;  4Q0Y A;  3BA8 A;  4MTE A;  4CC6 A;  5A2Q W;  4LF7 H;  2HVR A;  1SEI A;  4RB3 C;  3KXY T;  4AQY H;  2MCT A;  5FPO A;  2VUG A;  5FLX W;  3BAB A;  1IBM H;  4DR4 H;  2UXC H;  1I6U A;  3L2P A;  2HGS A;  4K0K H;  4JI6 H;  4EFB A;  2UXB H;  4UCV A;  4DR6 H;  3H20 A;  2VQE H;  3N44 B;  1M0W A;  1P8L A;  1N36 H;  2UUB H;  2O03 A;  4MV9 A;  1XMQ H;  5LL6 b;  4LSX A;  1SYX B;  5LMN H;  4B3M H;  2Q2U A;  2RGV A;  4LH7 A;  1Z2O X;  1ZHQ A;  4RB0 A;  4RZQ A;  4UCS A;  4UCU A;  2VE7 C;  2WDT A;  2UUC H;  4NXM H;  3RJ0 A;  4DV0 H;  5FPR A;  4DV5 H;  3PN1 A;  5FMT A;  2FE3 A;  3FMA A;  3L4K A;  1Z2N X;  3T1Y H;  3KAK A;  3LML A;  1HNZ H;  4JI0 H;  4LF6 H;  2UXD H;  1HNW H;  4RAZ A;  2CW8 A;  4M7E A;  1L2Z A;  4YY3 H;  3EAY A;  3JAM W;  4DV4 H;  1XDN A;  2UUA H;  4GLX A;  3VP7 A;  4DR7 H;  2UU9 H;  3MWM A;  3C0F B;  3DF7 A;  4I7H A;  4LH6 A;  4LFA H;  2W57 A;  3N42 B;  3J7A K;  4PDB A;  4ETS A;  1E4F T;  3EYY A;  2Q2T A;  3KAL A;  4NXN H;  4JI3 H;  2WYO A;  1V9P A;  4LVP A;  3RGX A;  4DR3 H;  3N40 P;  1AN7 A;  4UCO A;  2KSW A;  5LMU H;  1WH2 A;  4DV1 H;  4JI1 H;  4DUY H;  4R7R A;  1EUV A;  3F8N A;  4JI2 H;  5FD5 A;  4A2A A;  2XIG A;  2VPS A;  3T1H H;  1Z2P X;  3HXL A;  1BGW A;  2HVQ A;  3CVZ A;  2E5L H;  4DV7 H;  4CC5 A;  1N34 H;  4IAJ A;  1FVI A;  4B3R H;  3N41 B;  2HKP A;  4LFB H;  1FKA H;  3OTO H;  4UCR A;  2HL8 A;  3N6X A;  4RAY A;  4OX9 H;  1S68 A;  2CW7 A;  1XNR H;  5IT9 W;  3BAA A;  1TAE A;  3K3V A;  4MTD A;  4KHP H;  5FD6 A;  4JI8 H;  1S03 G;  4DDP A;  5D1P A;  4RB1 A;  1J5E H;  2RGR A;  1TA8 A;  3RGZ A;  1MZB A;  4LMY A;  1O75 A;  4MV7 A;  3J80 W;  4JI4 H;  1XNQ H;  4DV6 H;  1VS0 A;  4J0M A;  4LF4 H;  4X64 H;  1B04 A;  4JI5 H;  1FJG H;  4A2B A;  1E4G T;  3UQ8 A;  4LFC H;  1DGS A;  3M4I A;  3RTX A;  4LF8 H;  2WE6 A;  4X66 H;  4GKK H;  5FMU A;  2OWO A;  4DR2 H;  1HNX H;  1A0I A;  1N32 H;  4JV5 H;  3L4J A;  1XMO H;  4JYA H;  3N43 B;  5BR8 H;  4YHH H;  4DR1 H;  2HHH H;  3IG0 A;  1ZHS A;  1GYF A;  5EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...