2WE6A

Crystal structure of plasmodium falciparum ubiquitin carboxyl- terminal hydrolase 3 (uchl3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
224
structure length
208
Chain Sequence
b'DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVKENFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPNDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
molecule tags Hydrolase
source organism Plasmodium falciparum
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
total genus 62
structure length 208
sequence length 224
chains with identical sequence B
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2we6A01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2we6A02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
2R85A 4I55F 2V59A 2WB1E 3N43B 4RB3C 4LVRA 3U9TA 4IWXA 4DR4H 1UEGA 4J0MA 3J80W 4ED8A 2JA8G 1S0NA 1SFOA 3KMWB 2XD4A 2JA7G 4DV0H 3KMUB 2WYOA 1RT8A 5KG7A 5KFRA 5L1JA 4A3MG 1T3NA 3FERA 2WAQE 3K5IA 2HL9A 2NU9B 3TQTA 4EG0A 4QW9A 4EEYA 1ZETA 1M6VA 4OX9H 4JV2A 3V4ZA 1AUXA 5J2UF 3LMLA 5C1OA 3OHAA 3GTJA 2VQFH 4RB1A 3BA9A 4CC6A 2HHHH 2VQEH 2PVPA 4IWYA 4M9UA 4DR1H 2D86A 2L3GA 4R7RA 3GTOA 4Q0YA 4HR7A 4RB0A 2UVRA 1AUVA 4IRDA 1SYXB 2VUMG 1SH6A 5C8YF 2XCAA 4MAMA 3R23A 3N40P 2B63G 2UUBH 4EDMA 4JUZA 1M7JA 3R5FA 1MZBA 1FJGH 1WCMA 1R9TA 4FM9A 4ZOLF 2W6NA 1TAEA 2WAQA 4JYAH 1V51A 2RR8A 1OWTA 3GV5B 4EBDA 3RB4A 2CKZB 4EYIB 1JXLA 3HB9A 4ZQIA 3PVXA 2DK9A 4DR2H 4X62H 2X0SA 5KFBA 4EBCA 5KFPA 4LF9H 2JA5A 2C2DA 2VZCA 2RGRA 3G8CA 4RNNA 2W9BB 1WYOA 4AQYH 5D1PA 5D8DA 4EDNA 4DV3H 1JLLB 3PZPA 1K83A 4K0KH 4EYHB 4DR5H 4KHPH 1WSCA 2FKLA 5GONF 2YRNA 2R86A 2BR0A 4QWBA 1JIHA 4MV8A 4MV1A 1PK8A 2W8KA 2GPSA 2R7LA 4TQRA 4O3NA 1BGWA 4ETSA 3QZ7A 4B3SH 2YYAA 1E4GT 4MV4A 1XMOH 5DLGA 1FVIA 4M7EA 3H4BA 4ZHQF 4FBTA 4GLXA 2W9AA 1KC7A 1V9PA 4LF4H 4A3CG 4IHJF 2W9CB 3BJYA 1GYFA 4A3BG 2VPQA 4ECWA 5KFMA 3VPDA 5KG2A 5KT4A 5IYCG 3V6HA 5K2MA 3BAAA 4F4XA 1B04A 4ZI7F 1BXRA 4BBSG 2M05A 4C5BA 5JUMA 3GV8B 5DG7A 2FJZA 4G3IA 2XC9A 3GQCA 4MV7A 4YQWA 3F8NA 3QZ8A 4A3FG 4LVPA 3VP7A 1N36H 3VMMA 3R5XA 5KT5A 4J9PA 2IMWP 2O03A 1JKJB 1V4YA 1W93A 1GGOA 2B63A 1I94H 2KSWA 2JA7A 4XYMB 1WJOA 2JA5G 1MB8A 3C0FB 5JVLA 3KHLA 5C4XG 4YP3A 3GIMA 4YHHH 3JSNA 4DV4H 4MV3A 1GSAA 2I87A 4O3PA 1AA2A 3HKZE 5A2QW 4YR2A 1M0WA 3WNZA 3MFIA 1GSHA 3F7PA 3L2PA 4I7HA 3HORA 1WH2A 4EEQA 4IRCA 1RJRA 2UXDH 2Y0SE 3RAXA 4Q44A 1TWCA 2HVQA 2NVXA 5KG3A 4AYBA 4WD3A 2JEIA 5KFEA 4HNTA 4DR3H 4Q58A 5DG8A 1CE8A 5A4BA 4TV8F 3GIJA 3JSLA 4YB8B 1TWGA 4FS1A 2JA6A 2VZGB 2V4QA 4J9LA 3RAQA 1WYQA 4UCVA 1O75A 3HKZA 4EFEA 1WYNA 2R7KA 4L1KA 4DUZH 3H0GA 3KTMA 1WYRA 2C28A 2QK4A 2R87A 3GIKA 1Y1WG 1E4FT 2OLSA 2Q2UA 5C5JA 4B7LA 2VE7A 4FBUA 4R8UA 5IT9W 3HOPA 1EUDB 3RUPA 4ME6A 3QFFA 1Y14B 1KEEA 3IG0A 1CS0A 3MWDA 1XMQH 4C5CA 2XGQA 3TIGA 4EGJA 1Y1VG 4ECVA 4U7CA 3K3PA 5LMUH 1AN7A 1L2ZA 1KJJA 4LSAA 3N6XA 3EPIA 5FLMG 2PN1A 4DV7H 4F4ZA 4ECRA 2I80A 2MCTA 2YL2A 1RYSA 5DQIA 4UCSA 2P0AA 3H0GG 4O4LF 1S9FA 3TIIA 4MA5A 3JRWA 4NXMH 3BQ0A 1I7LA 5F9NA 2E5LH 2UVUA 5KG0A 2R7ZA 3OSPA 2DLNA 4ECTA 3SE7A 4RAYA 5KFKA 5IYZF 3L4JA 4DR7H 2NVYA 1ULZA 5CAEB 5LOVF 3HOXG 2D89A 1P5SA 2QYZA 4DL7A 4J9OA 3MR6A 1XNQH 3RBDA 4LF7H 2IBKA 1S0MA 1UC9A 4DLKA 4LFAH 4MA0A 3K5HA 5BMVF 3WO0A 5BR8H 3JARM 4A3JG 4BY1G 3PW5A 3RIZA 2E9KA 3E5NA 3Q1KA 3NGDA 2XCLA 2XCPA 5L1IA 1RYRA 4IR1A 3IN5A 3I4MG 2J9GA 1Y1WA 4DL3A 5CB4F 5FD6A 3H3VH 2VQDA 1VBGA 4JV5H 2GLTA 5KT6A 2OWOA 4EBEA 3PW4A 4J9QA 3SI8A 5J8EA 1EHIA 4TQSA 3N41B 1CQJB 3ORQA 4UFZA 5J2TF 4Q43A 2ZDQA 2C2RA 3GLKA 4RU9A 4YJ2F 3RV4A 4FU0A 3T5HA 2W6MA 5LP6F 2VA3A 2VUGA 1EUCB 1A0IA 2FLNA 1EUVA 2CQYA 3KHHA 5KFIA 1Z2OX 2UUAH 3KAKA 4TXIA 1EZ1A 5D1OB 1N32H 3RGXA 1N34H 2NU6B 2R7ZG 1M0TA 5JVDF 5BPFA 2W9BA 5C1PA 2JEGA 3PN1A 3HOYG 2FK3A 3RB6A 4O2AF 1T36A 2NU7B 3OUUA 2HVRA 2W7OA 2V5AA 4GC6A 2HVSA 2FPPB 1HNWH 1TWAA 2W6OA 3FDSA 4I50F 2AQ4A 5KG4A 2WA7A 5KFVA 1H67A 3MJFA 4E4TA 1N33H 4QJFA 5KT2A 1QAGA 2VE7C 5FLXW 5KFUA 5KG1A 1VKAA 1VS0A 4LSXA 4DL5A 4JI8H 5KFXA 2J6SA 5T14A 4LF8H 2NUAB 4O3OA 3REPB 4X65H 4JI5H 5IYBG 2EYNA 5JQWA 1KJ9A 4RB2C 2UU9H 2C35B 1SH5A 2JV9A 4ECXA 3WO1A 4IAJA 1P8LA 5KT3A 3HXLA 5CA0F 3UQ8A 3JALM 1EYZA 3RGZA 5KFFA 4QWEA 4CC5A 3PO2G 3HOUG 4RUCA 2R93A 3Q2OA 4QIWA 4TXKA 4O3QA 3H20A 3VPCA 2YZGA 1ZHQA 3RTXA 4O3SA 3RJ0A 4DV6H 4F4WA 4DUYH 2VA2A 5BPHA 5KFQA 4X66H 1K1SA 1S68A 5KFLA 1DXXA 2QJZA 2R82A 5H80A 4BWSC 2PMZE 2AGQA 2R7MA 2YZNA 4A2BA 4APMA 1IOVA 4JV0A 2W6ZA 4GKKH 2V58A 4GKJH 4YR0A 2Y0SA 5L1LA 2VR1A 4A2AA 4Y8VB 5LMNH 5KFHA 3ETJA 1IOWA 2R8GA 3GTKA 2WE6A 3FKIA 4UCTA 1VKZA 2VZDA 2AGOA 4A3IG 2I8CA 1DV2A 2WB1A 1JDBB 5KX5F 2D88A 4JI1H 4PDBA 4MTEA 2SCUB 1GSOA 4LH6A 2BQ3A 3JZIA 4B3TH 1WYLA 4XYLB 5EZYF 5KFYA 1S03G 4IR9A 1I6UA 3PR5B 3MWEA 3GTGA 3GILA 3H4DA 3H40A 4ECZA 4ED3A 4TV9F 5KG6A 4J9RA 2FB9A 4RUAA 4JI2H 5FD5A 2CW7A 2VPSA 4RZRA 3RV3A 3KALA 5EWEA 1N48A 2YZMA 1WR2A 2WFNA 1BNCA 2W7PA 4QWCA 3ETHA 1CQIB 2XIGA 4UCUA 3MR2A 1TWHA 2ASDA 4A3EG 4A3KG 4YAJB 1E4EA 3M4IA 4GC7A 4RNMA 2E2HA 3TQ1A 1VAJA 2CW8A 1Y1VA 1HR0H 2Q2TA 2FE3A 3U9SA 1IBLH 2R6FA 3I4NG 4ED1A 5FMTA 2OH2A 3PR4A 5KFJA 3V6KA 4I4TF 2K2RA 2W57A 3BQ1A 2YRXA 3DF7A 4TUYF 2ZDHA 1JDEA 2WA6A 5L9XA 4DV5H 2R8UA 3G6VA 3BABA 2ASJA 2BQRA 4Q45A 2FLPA 3M9NB 3R5HA 2W9CA 2DZDA 4C2MA 2FPIB 4LFCH 4O4HF 3Q8RB 5F9LA 4X64H 2HKPA 4EFBA 2V9WA 3MR3A 2UVWA 2ZJTA 4Q8EA 2C00A 4ED0A 5DLFA 4JI6H 3CVZA 5DG9A 3GV7B 1X9NA 2BQUA 2UXCH 2ZDGA 3RB3A 1N56A 1UNNC 3LP8A 5KFTA 1XDNA 2J6TA 2EQOA 4EDLA 2F4VH 4JI7H 3HOVG 1SEIA 2FMAA 3HBLA 5EWFA 5FMUA 4RNOA 4DL2A 4XZ3B 2W70A 5HBRB 3VPBA 1C3OA 2YCHA 5EOYA 3CQZA 4F4YA 5KFNA 3EAYA 3GTQA 3M9MB 4QWAA 1FKAH 3KXYT 2VZIB 1V5KA 2YS6A 1P2XA 1XNRH 3JAKM 3BA8A 1GO3E 4ED2A 4MV9A 2FP4B 4MV6A 5IWAH 2EE7A 2W8LA 2UXBH 3GIDA 4HNVA 3FKIG 1AOAA 2RDIA 3RF2A 3L4KA 1I7NA 1K1QA 4HNUA 4ECSA 4NXNH 1S10A 2YW2A 2C2EA 1Z2NX 2ZM6H 3GTPA 4A3DG 2V4RA 4J9KA 2RGVA 3Q8PB 2AU0A 4O3RA 2R92G 3PO3G 5LYJF 5KFOA 3PW2A 1WKUA 2WTFA 1J5EH 1Z2PX 5LXTF 3M9OB 2JEFA 2R84A 3G6XA 2JA6G 5CA1F 4DV1H 3N8DA 4RZQA 4UCOA 1GLVA 1UC8A 2PBZA 3RFCA 2FK1A 2ATLA 3KY9A 4B3MH 3GIQA 3MWMA 3G6YA 5BVRA 1UJOA 4DDPA 4J9MA 4U6PA 1W96A 4XX0B 1DIKA 3HOZG 5L0OA 1DV1A 2IP4A 2YU9A 4AYBE 2VOBA 4BXXG 2AGPA 1ZQ7A 3CO1A 3T5LA 3RB0A 3GTLA 3KAJA 2UVVA 2ALZA 1C30A 4O4IF 4QIWE 4RAZA 3JAMW 3KHGA 2DIKA 3T5JA 3GTMA 1T94A 2RF4A 4FS2A 2R8JA 2DPIA 3HOWG 1WIXA 2R7NA 4JI0H 5EWGA 5EDWA 5C3EG 5L1KA 2XGPA 4DV2H 2UUCH 4LF5H 5FPOA 5KFCA 4B3RH 4YAKB 5A36A 4O2BF 4YJ3F 3GIIA 3JRXA 1KBLA 4BY7G 5KFAA 5HV6A 5KFSA 2FPGB 4Q57B 4PWQA 1JX4A 5LA6F 5KFGA 5KT7A 1HNXH 2D85A 3EPGA 2HGSA 3T1HH 4LF6H 1WYMA 2D87A 2GPWA 4QW8A 5KFWA 2VUMA 3OHBA 2J6UA 5JH7F 3N44B 1VBHA 5A38A 2IA6A 5KFDA 2HJWA 4JI3H 4J9SA 1BHDA 4IZOA 1B33N 4Q59A 4JI4H 4ECQA 4JV1A 5FPRA 3UFXB 2EYIA 1S97A 2R0OA 3LWBA 3PW7A 3BG5A 5DQHA 1E4EB 4ED6A 3MR5A 4YBZB 3V6JA 4LFBH 3T5KA 3AYHB 5KFZA 4ECUA 1RJQA 1TWFA 4ECYA 2IGPA 3EYYA 5DQGA 4QWDA 4EGQA 4F50A 1TJTA 2DWCA 3FMAA 5D1OA 1DGSA 2YS7A 5DGBA 2JEJA 5I47A 3N42B 2FLLA 2W6QA 3OTOH 5IP7G 1IBMH 1KJQA 4A3GG 5A37A 1BJTA 3GIPA 4UCRA 1BKRA 4J9NA 5FJ8G 3MFHA 2YRWA 2ASLA 1B6SA 4IRKA 1S0OA 3HOCA 1RJPA 4YY3H 1RK5A 4ED7A 2C22A 1I3QA 2RDJA 4R8UB 5C44G 3J7AK 2FK2A 2E2IA 4BBRG 2HL8A 3PW0A 3K3VA 3J81W 2R92A 4HYKA 1KJIA 4A3LG 3ORRA 2R8IA 1SCUB 3I12A 2PMZA 1A9XA 3RBEA 1WCMG 5LL6b 3T1YH 3TINA 2WA5A 4C5AA 5KKNB 2DPJA 2W71A 5IYDG 4YR3A 1IBKH 4NLGA 4A93G 5IP9G 1B6RA 1PXYA 4Q8FA 1ZHSA 2R8KA 3I6XA 1TA8A 3V4SA 2WDTA 1PX2A 2CZGA 3BQ2A 3OUZA 4DL4A 4DR6H 5KG5A 3KHRA 2R93G 4MTDA 3Q8SB 2W6PA 4HQ6A 1I50A 2QJXA 1PA7A 4LH7A 2NU8B 4WBNF 3OSNA 1KJ8A 1WYPA 2K3SA 5DGAA 1RK6A 3Q8QB 1HNZH 4LMYA 2R8HA 4DL6A
chains in the Genus database with same CATH topology
2RGVA 3H20A 4UCVA 1O75A 1ZHQA 3N43B 3RTXA 4LVRA 4EFEA 3RJ0A 4RB3C 4DV6H 4J0MA 3J80W 4DR4H 4DUZH 1J5EH 1Z2PX 4DUYH 4DV0H 2WYOA 4X66H 1S68A 1E4FT 2Q2UA 4BWSC 2HL9A 4DV1H 4OX9H 4RZQA 2VE7A 4UCOA 5IT9W 3LMLA 4A2BA 4APMA 4GKKH 3IG0A 2VQFH 4RB1A 3BA9A 4CC6A 1XMQH 2VQEH 2HHHH 4DR1H 3MWMA 4B3MH 4R7RA 4GKJH 4Q0YA 4DDPA 5LMUH 1AN7A 4RB0A 1L2ZA 1SYXB 4A2AA 3N6XA 4LSAA 4DV7H 5LMNH 2MCTA 3N40P 4UCSA 2VOBA 2UUBH 1FJGH 1MZBA 2WE6A 4FM9A 3KAJA 1TAEA 4RAZA 3JAMW 4JYAH 4UCTA 2E5LH 4JI1H 4PDBA 4MTEA 4JI0H 4RAYA 4DR2H 4X62H 2UXDH 4LH6A 3L4JA 4DV2H 2UUCH 4DR7H 4LF5H 5FPOA 4LF9H 4B3RH 4B3TH 2RGRA 4AQYH 1S03G 1XNQH 4LF7H 1I6UA 4LFAH 5D1PA 5BR8H 4DV3H 1HNXH 4K0KH 4DR5H 4KHPH 3RIZA 2HGSA 3T1HH 4LF6H 4JI2H 5FD5A 2CW7A 2VPSA 3N44B 3KALA 5FD6A 4JI3H 4JV5H 2OWOA 2XIGA 1BGWA 4UCUA 4ETSA 4B3SH 4JI4H 1E4GT 3M4IA 5FPRA 2CW8A 3N41B 4UFZA 1XMOH 1HR0H 2Q2TA 1FVIA 4M7EA 2FE3A 4LFBH 4GLXA 1IBLH 5FMTA 1V9PA 4LF4H 2IGPA 2VUGA 2W57A 3DF7A 3EYYA 4DV5H 1A0IA 1N36H 4NXMH 5D1OA 3FMAA 1EUVA 1DGSA 3BABA 1Z2OX 3BAAA 3N42B 2UUAH 1B04A 3KAKA 3OTOH 1IBMH 1N32H 5D1OB 4LMYA 4LFCH 3RGXA 1N34H 4X64H 2HKPA 1BJTA 1M0TA 4UCRA 4EFBA 2ZJTA 4MV7A 3PN1A 3F8NA 4LVPA 3VP7A 3CVZA 4JI6H 1X9NA 2UXCH 4YY3H 2O03A 1GYFA 2HVRA 1I94H 1XDNA 2KSWA 2HVSA 2EQOA 3J7AK 1HNWH 2HL8A 2F4VH 3C0FB 4JI7H 1SEIA 3K3VA 5FMUA 3J81W 4YHHH 3JSNA 4DV4H 1N33H 2YCHA 5EOYA 5A2QW 3EAYA 5LL6b 2VE7C 3T1YH 1M0WA 5FLXW 1FKAH 3KXYT 4I7HA 1VS0A 1WH2A 4EEQA 4LSXA 3L2PA 1IBKH 4JI8H 4LF8H 1XNRH 3BA8A 2UXBH 4MV9A 4X65H 1ZHSA 5IWAH 4JI5H 1TA8A 2HVQA 2WDTA 4DR6H 4RB2C 2UU9H 3L4KA 3RF2A 4MTDA 4DR3H 4IAJA 1P8LA 4LH7A 3HXLA 4NXNH 3UQ8A 3JSLA 3RGZA 4CC5A 1HNZH 1Z2NX 2ZM6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 2R85 A;  4I55 F;  2V59 A;  2WB1 E;  3N43 B;  4RB3 C;  4LVR A;  3U9T A;  4IWX A;  4DR4 H;  1UEG A;  4J0M A;  3J80 W;  4ED8 A;  2JA8 G;  1S0N A;  1SFO A;  3KMW B;  2XD4 A;  2JA7 G;  4DV0 H;  3KMU B;  2WYO A;  1RT8 A;  5KG7 A;  5KFR A;  5L1J A;  4A3M G;  1T3N A;  3FER A;  2WAQ E;  3K5I A;  2HL9 A;  2NU9 B;  3TQT A;  4EG0 A;  4QW9 A;  4EEY A;  1ZET A;  1M6V A;  4OX9 H;  4JV2 A;  3V4Z A;  1AUX A;  5J2U F;  3LML A;  5C1O A;  3OHA A;  3GTJ A;  2VQF H;  4RB1 A;  3BA9 A;  4CC6 A;  2HHH H;  2VQE H;  2PVP A;  4IWY A;  4M9U A;  4DR1 H;  2D86 A;  2L3G A;  4R7R A;  3GTO A;  4Q0Y A;  4HR7 A;  4RB0 A;  2UVR A;  1AUV A;  4IRD A;  1SYX B;  2VUM G;  1SH6 A;  5C8Y F;  2XCA A;  4MAM A;  3R23 A;  3N40 P;  2B63 G;  2UUB H;  4EDM A;  4JUZ A;  1M7J A;  3R5F A;  1MZB A;  1FJG H;  1WCM A;  1R9T A;  4FM9 A;  4ZOL F;  2W6N A;  1TAE A;  2WAQ A;  4JYA H;  1V51 A;  2RR8 A;  1OWT A;  3GV5 B;  4EBD A;  3RB4 A;  2CKZ B;  4EYI B;  1JXL A;  3HB9 A;  4ZQI A;  3PVX A;  2DK9 A;  4DR2 H;  4X62 H;  2X0S A;  5KFB A;  4EBC A;  5KFP A;  4LF9 H;  2JA5 A;  2C2D A;  2VZC A;  2RGR A;  3G8C A;  4RNN A;  2W9B B;  1WYO A;  4AQY H;  5D1P A;  5D8D A;  4EDN A;  4DV3 H;  1JLL B;  3PZP A;  1K83 A;  4K0K H;  4EYH B;  4DR5 H;  4KHP H;  1WSC A;  2FKL A;  5GON F;  2YRN A;  2R86 A;  2BR0 A;  4QWB A;  1JIH A;  4MV8 A;  4MV1 A;  1PK8 A;  2W8K A;  2GPS A;  2R7L A;  4TQR A;  4O3N A;  1BGW A;  4ETS A;  3QZ7 A;  4B3S H;  2YYA A;  1E4G T;  4MV4 A;  1XMO H;  5DLG A;  1FVI A;  4M7E A;  3H4B A;  4ZHQ F;  4FBT A;  4GLX A;  2W9A A;  1KC7 A;  1V9P A;  4LF4 H;  4A3C G;  4IHJ F;  2W9C B;  3BJY A;  1GYF A;  4A3B G;  2VPQ A;  4ECW A;  5KFM A;  3VPD A;  5KG2 A;  5KT4 A;  5IYC G;  3V6H A;  5K2M A;  3BAA A;  4F4X A;  1B04 A;  4ZI7 F;  1BXR A;  4BBS G;  2M05 A;  4C5B A;  5JUM A;  3GV8 B;  5DG7 A;  2FJZ A;  4G3I A;  2XC9 A;  3GQC A;  4MV7 A;  4YQW A;  3F8N A;  3QZ8 A;  4A3F G;  4LVP A;  3VP7 A;  1N36 H;  3VMM A;  3R5X A;  5KT5 A;  4J9P A;  2IMW P;  2O03 A;  1JKJ B;  1V4Y A;  1W93 A;  1GGO A;  2B63 A;  1I94 H;  2KSW A;  2JA7 A;  4XYM B;  1WJO A;  2JA5 G;  1MB8 A;  3C0F B;  5JVL A;  3KHL A;  5C4X G;  4YP3 A;  3GIM A;  4YHH H;  3JSN A;  4DV4 H;  4MV3 A;  1GSA A;  2I87 A;  4O3P A;  1AA2 A;  3HKZ E;  5A2Q W;  4YR2 A;  1M0W A;  3WNZ A;  3MFI A;  1GSH A;  3F7P A;  3L2P A;  4I7H A;  3HOR A;  1WH2 A;  4EEQ A;  4IRC A;  1RJR A;  2UXD H;  2Y0S E;  3RAX A;  4Q44 A;  1TWC A;  2HVQ A;  2NVX A;  5KG3 A;  4AYB A;  4WD3 A;  2JEI A;  5KFE A;  4HNT A;  4DR3 H;  4Q58 A;  5DG8 A;  1CE8 A;  5A4B A;  4TV8 F;  3GIJ A;  3JSL A;  4YB8 B;  1TWG A;  4FS1 A;  2JA6 A;  2VZG B;  2V4Q A;  4J9L A;  3RAQ A;  1WYQ A;  4UCV A;  1O75 A;  3HKZ A;  4EFE A;  1WYN A;  2R7K A;  4L1K A;  4DUZ H;  3H0G A;  3KTM A;  1WYR A;  2C28 A;  2QK4 A;  2R87 A;  3GIK A;  1Y1W G;  1E4F T;  2OLS A;  2Q2U A;  5C5J A;  4B7L A;  2VE7 A;  4FBU A;  4R8U A;  5IT9 W;  3HOP A;  1EUD B;  3RUP A;  4ME6 A;  3QFF A;  1Y14 B;  1KEE A;  3IG0 A;  1CS0 A;  3MWD A;  1XMQ H;  4C5C A;  2XGQ A;  3TIG A;  4EGJ A;  1Y1V G;  4ECV A;  4U7C A;  3K3P A;  5LMU H;  1AN7 A;  1L2Z A;  1KJJ A;  4LSA A;  3N6X A;  3EPI A;  5FLM G;  2PN1 A;  4DV7 H;  4F4Z A;  4ECR A;  2I80 A;  2MCT A;  2YL2 A;  1RYS A;  5DQI A;  4UCS A;  2P0A A;  3H0G G;  4O4L F;  1S9F A;  3TII A;  4MA5 A;  3JRW A;  4NXM H;  3BQ0 A;  1I7L A;  5F9N A;  2E5L H;  2UVU A;  5KG0 A;  2R7Z A;  3OSP A;  2DLN A;  4ECT A;  3SE7 A;  4RAY A;  5KFK A;  5IYZ F;  3L4J A;  4DR7 H;  2NVY A;  1ULZ A;  5CAE B;  5LOV F;  3HOX G;  2D89 A;  1P5S A;  2QYZ A;  4DL7 A;  4J9O A;  3MR6 A;  1XNQ H;  3RBD A;  4LF7 H;  2IBK A;  1S0M A;  1UC9 A;  4DLK A;  4LFA H;  4MA0 A;  3K5H A;  5BMV F;  3WO0 A;  5BR8 H;  3JAR M;  4A3J G;  4BY1 G;  3PW5 A;  3RIZ A;  2E9K A;  3E5N A;  3Q1K A;  3NGD A;  2XCL A;  2XCP A;  5L1I A;  1RYR A;  4IR1 A;  3IN5 A;  3I4M G;  2J9G A;  1Y1W A;  4DL3 A;  5CB4 F;  5FD6 A;  3H3V H;  2VQD A;  1VBG A;  4JV5 H;  2GLT A;  5KT6 A;  2OWO A;  4EBE A;  3PW4 A;  4J9Q A;  3SI8 A;  5J8E A;  1EHI A;  4TQS A;  3N41 B;  1CQJ B;  3ORQ A;  4UFZ A;  5J2T F;  4Q43 A;  2ZDQ A;  2C2R A;  3GLK A;  4RU9 A;  4YJ2 F;  3RV4 A;  4FU0 A;  3T5H A;  2W6M A;  5LP6 F;  2VA3 A;  2VUG A;  1EUC B;  1A0I A;  2FLN A;  1EUV A;  2CQY A;  3KHH A;  5KFI A;  1Z2O X;  2UUA H;  3KAK A;  4TXI A;  1EZ1 A;  5D1O B;  1N32 H;  3RGX A;  1N34 H;  2NU6 B;  2R7Z G;  1M0T A;  5JVD F;  5BPF A;  2W9B A;  5C1P A;  2JEG A;  3PN1 A;  3HOY G;  2FK3 A;  3RB6 A;  4O2A F;  1T36 A;  2NU7 B;  3OUU A;  2HVR A;  2W7O A;  2V5A A;  4GC6 A;  2HVS A;  2FPP B;  1HNW H;  1TWA A;  2W6O A;  3FDS A;  4I50 F;  2AQ4 A;  5KG4 A;  2WA7 A;  5KFV A;  1H67 A;  3MJF A;  4E4T A;  1N33 H;  4QJF A;  5KT2 A;  1QAG A;  2VE7 C;  5FLX W;  5KFU A;  5KG1 A;  1VKA A;  1VS0 A;  4LSX A;  4DL5 A;  4JI8 H;  5KFX A;  2J6S A;  5T14 A;  4LF8 H;  2NUA B;  4O3O A;  3REP B;  4X65 H;  4JI5 H;  5IYB G;  2EYN A;  5JQW A;  1KJ9 A;  4RB2 C;  2UU9 H;  2C35 B;  1SH5 A;  2JV9 A;  4ECX A;  3WO1 A;  4IAJ A;  1P8L A;  5KT3 A;  3HXL A;  5CA0 F;  3UQ8 A;  3JAL M;  1EYZ A;  3RGZ A;  5KFF A;  4QWE A;  4CC5 A;  3PO2 G;  3HOU G;  4RUC A;  2R93 A;  3Q2O A;  4QIW A;  4TXK A;  4O3Q A;  3H20 A;  3VPC A;  2YZG A;  1ZHQ A;  3RTX A;  4O3S A;  3RJ0 A;  4DV6 H;  4F4W A;  4DUY H;  2VA2 A;  5BPH A;  5KFQ A;  4X66 H;  1K1S A;  1S68 A;  5KFL A;  1DXX A;  2QJZ A;  2R82 A;  5H80 A;  4BWS C;  2PMZ E;  2AGQ A;  2R7M A;  2YZN A;  4A2B A;  4APM A;  1IOV A;  4JV0 A;  2W6Z A;  4GKK H;  2V58 A;  4GKJ H;  4YR0 A;  2Y0S A;  5L1L A;  2VR1 A;  4A2A A;  4Y8V B;  5LMN H;  5KFH A;  3ETJ A;  1IOW A;  2R8G A;  3GTK A;  2WE6 A;  3FKI A;  4UCT A;  1VKZ A;  2VZD A;  2AGO A;  4A3I G;  2I8C A;  1DV2 A;  2WB1 A;  1JDB B;  5KX5 F;  2D88 A;  4JI1 H;  4PDB A;  4MTE A;  2SCU B;  1GSO A;  4LH6 A;  2BQ3 A;  3JZI A;  4B3T H;  1WYL A;  4XYL B;  5EZY F;  5KFY A;  1S03 G;  4IR9 A;  1I6U A;  3PR5 B;  3MWE A;  3GTG A;  3GIL A;  3H4D A;  3H40 A;  4ECZ A;  4ED3 A;  4TV9 F;  5KG6 A;  4J9R A;  2FB9 A;  4RUA A;  4JI2 H;  5FD5 A;  2CW7 A;  2VPS A;  4RZR A;  3RV3 A;  3KAL A;  5EWE A;  1N48 A;  2YZM A;  1WR2 A;  2WFN A;  1BNC A;  2W7P A;  4QWC A;  3ETH A;  1CQI B;  2XIG A;  4UCU A;  3MR2 A;  1TWH A;  2ASD A;  4A3E G;  4A3K G;  4YAJ B;  1E4E A;  3M4I A;  4GC7 A;  4RNM A;  2E2H A;  3TQ1 A;  1VAJ A;  2CW8 A;  1Y1V A;  1HR0 H;  2Q2T A;  2FE3 A;  3U9S A;  1IBL H;  2R6F A;  3I4N G;  4ED1 A;  5FMT A;  2OH2 A;  3PR4 A;  5KFJ A;  3V6K A;  4I4T F;  2K2R A;  2W57 A;  3BQ1 A;  2YRX A;  3DF7 A;  4TUY F;  2ZDH A;  1JDE A;  2WA6 A;  5L9X A;  4DV5 H;  2R8U A;  3G6V A;  3BAB A;  2ASJ A;  2BQR A;  4Q45 A;  2FLP A;  3M9N B;  3R5H A;  2W9C A;  2DZD A;  4C2M A;  2FPI B;  4LFC H;  4O4H F;  3Q8R B;  5F9L A;  4X64 H;  2HKP A;  4EFB A;  2V9W A;  3MR3 A;  2UVW A;  2ZJT A;  4Q8E A;  2C00 A;  4ED0 A;  5DLF A;  4JI6 H;  3CVZ A;  5DG9 A;  3GV7 B;  1X9N A;  2BQU A;  2UXC H;  2ZDG A;  3RB3 A;  1N56 A;  1UNN C;  3LP8 A;  5KFT A;  1XDN A;  2J6T A;  2EQO A;  4EDL A;  2F4V H;  4JI7 H;  3HOV G;  1SEI A;  2FMA A;  3HBL A;  5EWF A;  5FMU A;  4RNO A;  4DL2 A;  4XZ3 B;  2W70 A;  5HBR B;  3VPB A;  1C3O A;  2YCH A;  5EOY A;  3CQZ A;  4F4Y A;  5KFN A;  3EAY A;  3GTQ A;  3M9M B;  4QWA A;  1FKA H;  3KXY T;  2VZI B;  1V5K A;  2YS6 A;  1P2X A;  1XNR H;  3JAK M;  3BA8 A;  1GO3 E;  4ED2 A;  4MV9 A;  2FP4 B;  4MV6 A;  5IWA H;  2EE7 A;  2W8L A;  2UXB H;  3GID A;  4HNV A;  3FKI G;  1AOA A;  2RDI A;  3RF2 A;  3L4K A;  1I7N A;  1K1Q A;  4HNU A;  4ECS A;  4NXN H;  1S10 A;  2YW2 A;  2C2E A;  1Z2N X;  2ZM6 H;  3GTP A;  4A3D G;  2V4R A;  4J9K A;  2RGV A;  3Q8P B;  2AU0 A;  4O3R A;  2R92 G;  3PO3 G;  5LYJ F;  5KFO A;  3PW2 A;  1WKU A;  2WTF A;  1J5E H;  1Z2P X;  5LXT F;  3M9O B;  2JEF A;  2R84 A;  3G6X A;  2JA6 G;  5CA1 F;  4DV1 H;  3N8D A;  4RZQ A;  4UCO A;  1GLV A;  1UC8 A;  2PBZ A;  3RFC A;  2FK1 A;  2ATL A;  3KY9 A;  4B3M H;  3GIQ A;  3MWM A;  3G6Y A;  5BVR A;  1UJO A;  4DDP A;  4J9M A;  4U6P A;  1W96 A;  4XX0 B;  1DIK A;  3HOZ G;  5L0O A;  1DV1 A;  2IP4 A;  2YU9 A;  4AYB E;  2VOB A;  4BXX G;  2AGP A;  1ZQ7 A;  3CO1 A;  3T5L A;  3RB0 A;  3GTL A;  3KAJ A;  2UVV A;  2ALZ A;  1C30 A;  4O4I F;  4QIW E;  4RAZ A;  3JAM W;  3KHG A;  2DIK A;  3T5J A;  3GTM A;  1T94 A;  2RF4 A;  4FS2 A;  2R8J A;  2DPI A;  3HOW G;  1WIX A;  2R7N A;  4JI0 H;  5EWG A;  5EDW A;  5C3E G;  5L1K A;  2XGP A;  4DV2 H;  2UUC H;  4LF5 H;  5FPO A;  5KFC A;  4B3R H;  4YAK B;  5A36 A;  4O2B F;  4YJ3 F;  3GII A;  3JRX A;  1KBL A;  4BY7 G;  5KFA A;  5HV6 A;  5KFS A;  2FPG B;  4Q57 B;  4PWQ A;  1JX4 A;  5LA6 F;  5KFG A;  5KT7 A;  1HNX H;  2D85 A;  3EPG A;  2HGS A;  3T1H H;  4LF6 H;  1WYM A;  2D87 A;  2GPW A;  4QW8 A;  5KFW A;  2VUM A;  3OHB A;  2J6U A;  5JH7 F;  3N44 B;  1VBH A;  5A38 A;  2IA6 A;  5KFD A;  2HJW A;  4JI3 H;  4J9S A;  1BHD A;  4IZO A;  1B33 N;  4Q59 A;  4JI4 H;  4ECQ A;  4JV1 A;  5FPR A;  3UFX B;  2EYI A;  1S97 A;  2R0O A;  3LWB A;  3PW7 A;  3BG5 A;  5DQH A;  1E4E B;  4ED6 A;  3MR5 A;  4YBZ B;  3V6J A;  4LFB H;  3T5K A;  3AYH B;  5KFZ A;  4ECU A;  1RJQ A;  1TWF A;  4ECY A;  2IGP A;  3EYY A;  5DQG A;  4QWD A;  4EGQ A;  4F50 A;  1TJT A;  2DWC A;  3FMA A;  5D1O A;  1DGS A;  2YS7 A;  5DGB A;  2JEJ A;  5I47 A;  3N42 B;  2FLL A;  2W6Q A;  3OTO H;  5IP7 G;  1IBM H;  1KJQ A;  4A3G G;  5A37 A;  1BJT A;  3GIP A;  4UCR A;  1BKR A;  4J9N A;  5FJ8 G;  3MFH A;  2YRW A;  2ASL A;  1B6S A;  4IRK A;  1S0O A;  3HOC A;  1RJP A;  4YY3 H;  1RK5 A;  4ED7 A;  2C22 A;  1I3Q A;  2RDJ A;  4R8U B;  5C44 G;  3J7A K;  2FK2 A;  2E2I A;  4BBR G;  2HL8 A;  3PW0 A;  3K3V A;  3J81 W;  2R92 A;  4HYK A;  1KJI A;  4A3L G;  3ORR A;  2R8I A;  1SCU B;  3I12 A;  2PMZ A;  1A9X A;  3RBE A;  1WCM G;  5LL6 b;  3T1Y H;  3TIN A;  2WA5 A;  4C5A A;  5KKN B;  2DPJ A;  2W71 A;  5IYD G;  4YR3 A;  1IBK H;  4NLG A;  4A93 G;  5IP9 G;  1B6R A;  1PXY A;  4Q8F A;  1ZHS A;  2R8K A;  3I6X A;  1TA8 A;  3V4S A;  2WDT A;  1PX2 A;  2CZG A;  3BQ2 A;  3OUZ A;  4DL4 A;  4DR6 H;  5KG5 A;  3KHR A;  2R93 G;  4MTD A;  3Q8S B;  2W6P A;  4HQ6 A;  1I50 A;  2QJX A;  1PA7 A;  4LH7 A;  2NU8 B;  4WBN F;  3OSN A;  1KJ8 A;  1WYP A;  2K3S A;  5DGA A;  1RK6 A;  3Q8Q B;  1HNZ H;  4LMY A;  2R8H A;  4DL6 A; 
#chains in the Genus database with same CATH homology
 2RGV A;  3H20 A;  4UCV A;  1O75 A;  1ZHQ A;  3N43 B;  3RTX A;  4LVR A;  4EFE A;  3RJ0 A;  4RB3 C;  4DV6 H;  4J0M A;  3J80 W;  4DR4 H;  4DUZ H;  1J5E H;  1Z2P X;  4DUY H;  4DV0 H;  2WYO A;  4X66 H;  1S68 A;  1E4F T;  2Q2U A;  4BWS C;  2HL9 A;  4DV1 H;  4OX9 H;  4RZQ A;  2VE7 A;  4UCO A;  5IT9 W;  3LML A;  4A2B A;  4APM A;  4GKK H;  3IG0 A;  2VQF H;  4RB1 A;  3BA9 A;  4CC6 A;  1XMQ H;  2VQE H;  2HHH H;  4DR1 H;  3MWM A;  4B3M H;  4R7R A;  4GKJ H;  4Q0Y A;  4DDP A;  5LMU H;  1AN7 A;  4RB0 A;  1L2Z A;  1SYX B;  4A2A A;  3N6X A;  4LSA A;  4DV7 H;  5LMN H;  2MCT A;  3N40 P;  4UCS A;  2VOB A;  2UUB H;  1FJG H;  1MZB A;  2WE6 A;  4FM9 A;  3KAJ A;  1TAE A;  4RAZ A;  3JAM W;  4JYA H;  4UCT A;  2E5L H;  4JI1 H;  4PDB A;  4MTE A;  4JI0 H;  4RAY A;  4DR2 H;  4X62 H;  2UXD H;  4LH6 A;  3L4J A;  4DV2 H;  2UUC H;  4DR7 H;  4LF5 H;  5FPO A;  4LF9 H;  4B3R H;  4B3T H;  2RGR A;  4AQY H;  1S03 G;  1XNQ H;  4LF7 H;  1I6U A;  4LFA H;  5D1P A;  5BR8 H;  4DV3 H;  1HNX H;  4K0K H;  4DR5 H;  4KHP H;  3RIZ A;  2HGS A;  3T1H H;  4LF6 H;  4JI2 H;  5FD5 A;  2CW7 A;  2VPS A;  3N44 B;  3KAL A;  5FD6 A;  4JI3 H;  4JV5 H;  2OWO A;  2XIG A;  1BGW A;  4UCU A;  4ETS A;  4B3S H;  4JI4 H;  1E4G T;  3M4I A;  5FPR A;  2CW8 A;  3N41 B;  4UFZ A;  1XMO H;  1HR0 H;  2Q2T A;  1FVI A;  4M7E A;  2FE3 A;  4LFB H;  4GLX A;  1IBL H;  5FMT A;  1V9P A;  4LF4 H;  2IGP A;  2VUG A;  2W57 A;  3DF7 A;  3EYY A;  4DV5 H;  1A0I A;  1N36 H;  4NXM H;  5D1O A;  3FMA A;  1EUV A;  1DGS A;  3BAB A;  1Z2O X;  3BAA A;  3N42 B;  2UUA H;  1B04 A;  3KAK A;  3OTO H;  1IBM H;  1N32 H;  5D1O B;  4LMY A;  4LFC H;  3RGX A;  1N34 H;  4X64 H;  2HKP A;  1BJT A;  1M0T A;  4UCR A;  4EFB A;  2ZJT A;  4MV7 A;  3PN1 A;  3F8N A;  4LVP A;  3VP7 A;  3CVZ A;  4JI6 H;  1X9N A;  2UXC H;  4YY3 H;  2O03 A;  1GYF A;  2HVR A;  1I94 H;  1XDN A;  2KSW A;  2HVS A;  2EQO A;  3J7A K;  1HNW H;  2HL8 A;  2F4V H;  3C0F B;  4JI7 H;  1SEI A;  3K3V A;  5FMU A;  3J81 W;  4YHH H;  3JSN A;  4DV4 H;  1N33 H;  2YCH A;  5EOY A;  5A2Q W;  3EAY A;  5LL6 b;  2VE7 C;  3T1Y H;  1M0W A;  5FLX W;  1FKA H;  3KXY T;  4I7H A;  1VS0 A;  1WH2 A;  4EEQ A;  4LSX A;  3L2P A;  1IBK H;  4JI8 H;  4LF8 H;  1XNR H;  3BA8 A;  2UXB H;  4MV9 A;  4X65 H;  1ZHS A;  5IWA H;  4JI5 H;  1TA8 A;  2HVQ A;  2WDT A;  4DR6 H;  4RB2 C;  2UU9 H;  3L4K A;  3RF2 A;  4MTD A;  4DR3 H;  4IAJ A;  1P8L A;  4LH7 A;  3HXL A;  4NXN H;  3UQ8 A;  3JSL A;  3RGZ A;  4CC5 A;  1HNZ H;  1Z2N X;  2ZM6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...