2WE6A

Crystal structure of plasmodium falciparum ubiquitin carboxyl- terminal hydrolase 3 (uchl3)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
Knots found
sequence length
224
structure length
208
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVKENFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPNDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
total genus 62
structure length 208
sequence length 224
chains with identical sequence B
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2we6A01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2we6A02
2WE6A 2WDTA
chains in the Genus database with same CATH superfamily
3VMMA 3Q1KA 5F9LA 2C22A 1BJTA 3RB0A 5KFOA 2L3GA 2SCUB 3E5NA 4XYMB 1T3NA 3GTMA 1VBHA 3G6YA 2B63G 1WR2A 5KG0A 2DIKA 1V9PA 3TINA 2HVSA 2VUMG 2OH2A 3BQ2A 1XNRH 3T5JA 4LH7A 3PW7A 1GYFA 4IRCA 3KMUB 5KG1A 4X62H 1VBGA 5KFEA 1HNXH 5L1KA 2W6MA 4F4ZA 3WO1A 4A3FG 5FD6A 3IG0A 5EWEA 1TWCA 1WYOA 1B04A 2W6OA 1PX2A 2J9GA 3CQZA 3RAXA 2HKPA 2B63A 4DL5A 2AU0A 4O3NA 1BNCA 2ZJTA 4AYBE 1B6RA 3GV7B 2UUAH 2V59A 1E4GT 3I12A 1MB8A 2KSWA 1SH5A 1CE8A 2I87A 5IYZF 3FERA 3GTQA 2IGPA 4ED0A 4GLXA 2NU6B 1RJQA 2YZGA 4MTEA 1EUCB 2YS7A 3RIZA 4JUZA 4DUZH 4ECRA 1N36H 2E2HA 4ZQIA 3MWEA 3GIJA 1Y1WA 2VZCA 2NVYA 2CQYA 1S9FA 1PA7A 3GTOA 2HL8A 5C1PA 1GSHA 5A38A 2YYAA 4ED3A 4A2AA 4AQYH 2OWOA 3OTOH 3J7AK 2W7OA 4UCSA 1KEEA 2NU8B 3JAMW 1M0WA 1VKAA 5KFHA 4QWAA 4HNUA 4MA5A 2C2RA 4YR3A 1K1QA 4LFBH 4DLKA 1KJIA 5LYJF 2R84A 5J2UF 2QJXA 2YRXA 1KJQA 2W6QA 2Y0SA 2V5AA 4QW8A 4A2BA 1TWGA 4MV4A 4RZRA 1T36A 1JLLB 2FJZA 3H20A 3BQ1A 2XC9A 3H4DA 3VP7A 1UJOA 3SI8A 2ASJA 3KXYT 4ECYA 1SFOA 4KHPH 2XGQA 4RNMA 2EYNA 4RZQA 4X64H 4DV0H 1V4YA 4LVPA 5LMUH 2R7ZA 1UNNC 4B7LA 4YHHH 2VQFH 3RGZA 1S0MA 3HOVG 5CA1F 1SEIA 4CC6A 3RBDA 4YQWA 1J5EH 1BGWA 3G8CA 1CQJB 4XZ3B 5KG3A 2W70A 1GSOA 1V5KA 2R86A 1X9NA 4HNVA 3N40P 3GV5B 4FU0A 5KFLA 4MV3A 2D87A 1ZQ7A 4J9SA 3ORQA 5KFUA 2FB9A 5IYDG 4MAMA 5IWAH 3RB3A 4DR4H 1TWFA 5C3EG 1KJJA 3N44B 4Y8VB 1ZHSA 3GIPA 2ZDQA 2PBZA 1M0TA 3KAKA 4QIWE 4J9OA 4DV3H 3PVXA 3GTKA 5BR8H 1GO3E 3GIIA 4X66H 4TQSA 4LSAA 5DGBA 5KT2A 3Q8QB 3KHRA 2XIGA 3I4NG 3T1HH 2VPQA 2VQEH 2MCTA 5FPRA 3RTXA 4C5BA 3GTLA 4YR2A 3N43B 4BXXG 1RJPA 3KY9A 2R92G 1SCUB 1M7JA 4FBUA 2RR8A 2VE7C 5L9XA 2R8KA 1HNWH 2VZGB 5KX5F 4DR3H 4JI4H 4Q43A 3LP8A 3GTGA 2J6SA 3RV3A 2CW7A 1WKUA 4NXNH 2HVQA 2W6NA 3OUZA 4MV6A 4U7CA 5D1OA 4DV6H 4ECVA 2V58A 5D1OB 2WAQA 3CO1A 4DV5H 2ASDA 4EYHB 4IZOA 1UC8A 2ZM6H 2JEFA 4O3OA 2XGPA 1I3QA 2C35B 4IWXA 5A37A 1WCMA 2NVXA 4DL6A 4LH6A 2ATLA 1Y1VA 3GIMA 1GSAA 3JARM 4BBRG 4DR1H 4J9KA 2YU9A 2D89A 4LF4H 4WD3A 1WJOA 2VZIB 2JA6G 3V4SA 2O03A 4NLGA 4X65H 4YBZB 3PW5A 1EYZA 2FK2A 1JXLA 4JV1A 1N33H 1P8LA 1EHIA 4UCRA 4Q8EA 4IWYA 4QJFA 3U9TA 3HOXG 1PXYA 4OX9H 2VE7A 3RF2A 2EQOA 2UUBH 1AOAA 4QWBA 1AN7A 2GPWA 2W7PA 4A93G 1FKAH 4RAZA 1JIHA 4MV9A 3PO2G 1WYNA 4F50A 4YR0A 2YRWA 5DG8A 5JH7F 2RDIA 1P2XA 4U6PA 3N41B 1K83A 3FDSA 4JI7H 5JUMA 5KT3A 2RF4A 3R23A 3RB4A 1VKZA 4R8UA 3HXLA 3OSNA 1V51A 1FVIA 1Y14B 5BMVF 4ED8A 5JQWA 2WYOA 3MWDA 3QZ8A 4J9LA 5IT9W 2WE6A 1JDEA 4R7RA 1ZETA 2NU7B 1WIXA 2UXDH 4XX0B 4A3JG 1N34H 5KFPA 4JI8H 1ULZA 4RNNA 5KFWA 5L1JA 2AGPA 4A3DG 4DR6H 2YW2A 4EFBA 4EGJA 4JYAH 5H80A 3GLKA 2FPGB 3K5IA 4MV7A 5JVLA 3GTPA 1TWAA 4A3IG 4WBNF 1RJRA 2YCHA 2R7ZG 4YB8B 3TQ1A 5DQIA 5KT5A 1XMQH 5KFAA 4HYKA 5A2QW 1TJTA 4GC7A 4Q58A 3GIDA 3REPB 1T94A 2JV9A 2R7LA 3FKIG 1WYLA 5KG5A 2HHHH 5LOVF 4MTDA 4LF9H 4BBSG 3FKIA 2W9AA 1UEGA 3PR5B 3H3VH 4YAJB 2UU9H 5KFNA 4LFCH 3GV8B 1N32H 5LA6F 2FPIB 2WB1E 2IP4A 1RT8A 4ECQA 2FLNA 1PK8A 2UUCH 2VA2A 4A3LG 3HORA 4J9QA 2F4VH 5FLXW 1BKRA 3QZ7A 1AA2A 1BXRA 2VPSA 5KFFA 3Q2OA 4O2AF 3Q8RB 1N56A 4HR7A 5L1IA 4JI2H 3AYHB 3G6XA 1Y1WG 2R93G 2R82A 5KFSA 1Z2OX 3DF7A 1M6VA 1S97A 5BPHA 2J6TA 2JEJA 2W6PA 4RU9A 4EBEA 3T5HA 1O75A 2VR1A 2DK9A 2UVWA 3HBLA 2R93A 1IOWA 1TAEA 3C0FB 1RYSA 2VA3A 4IR9A 4TV9F 3H4BA 1JKJB 4FM9A 4APMA 1JDBB 4DDPA 1AUXA 3ETHA 5GONF 1WYPA 4UCTA 3J81W 2R6FA 5FD5A 2W8LA 3PR4A 3HKZE 2R8IA 4Q8FA 1A9XA 2R8UA 2EYIA 4EFEA 2FLPA 2D88A 4E4TA 2W9CB 5KFRA 3L2PA 5LXTF 4EBCA 4LFAH 4O3PA 3HOUG 2HGSA 5KFKA 1GGOA 5DLGA 5KFGA 3G6VA 1S0NA 2RGVA 3BA8A 4DL3A 3GIQA 2K3SA 4YY3H 4EYIB 4ECSA 2C00A 3BABA 3T5KA 1S10A 2E2IA 2K2RA 1EUVA 1A0IA 2W71A 4EEQA 2I8CA 5A36A 2PVPA 2C2DA 2JA7A 1JX4A 4ECWA 5DG7A 3F7PA 1CS0A 2WB1A 3MR2A 3T1YH 1WCMG 3H0GG 4JV0A 3RAQA 2GPSA 4O4LF 4ECUA 1DV1A 3RV4A 3BA9A 4PDBA 5KFYA 2JEIA 1B33N 3LWBA 4B3SH 1E4EB 2JA6A 2XD4A 2QJZA 4ECZA 4J0MA 1S03G 3KALA 1HNZH 2BQ3A 5I47A 4YJ2F 4I4TF 4RB3C 1TA8A 3MR6A 4DV7H 2W6ZA 4J9RA 1KJ8A 4MV8A 5KFVA 2IA6A 4G3IA 5KFJA 2RGRA 3EPIA 4A3BG 2JA5G 3NGDA 5L0OA 4TXKA 5HV6A 2R0OA 2JA8G 1UC9A 2FKLA 3HB9A 4LF6H 5D8DA 5C44G 2VUMA 3U9SA 2QYZA 2FK3A 4EGQA 4Q57B 2BQUA 3HKZA 1L2ZA 3JZIA 4JV2A 1ZHQA 5C8YF 3RUPA 2WFNA 2GLTA 3V6JA 4MA0A 2VUGA 5DGAA 3N6XA 3UFXB 3RBEA 2AQ4A 4A3GG 1IOVA 3M9MB 4I55F 5EWGA 4RB1A 4JV5H 3EAYA 5DQHA 4ETSA 4EDMA 1B6SA 4QWCA 2W8KA 3PW2A 1RK5A 2UVRA 4ED2A 2ZDGA 4UCOA 2D85A 4A3MG 3RGXA 5FLMG 4O2BF 3RB6A 4Q59A 2W57A 2Y0SE 4TUYF 3IN5A 1RK6A 3MR5A 3M9OB 5J2TF 5IYCG 5KFBA 3PZPA 5KFCA 5BPFA 4FS1A 5KT6A 4RNOA 3R5HA 3PO3G 4UFZA 4RB2C 4EDNA 2FK1A 2ASLA 5J8EA 2R7KA 2CW8A 4RAYA 1VS0A 1E4FT 2W9CA 5KFZA 4IHJF 2R7MA 3GTJA 1I7NA 5DQGA 3JRXA 4C5CA 2W9BB 4MV1A 4K0KH 4Q44A 2HVRA 2W9BA 2WAQE 4ZOLF 4GC6A 5LL6b 3BG5A 4LF8H 4B3MH 2UVUA 5KFMA 2J6UA 5LMNH 4XYLB 1C30A 4JI3H 5K2MA 2UVVA 3ETJA 5FMTA 2FE3A 3QFFA 5KT4A 4J9NA 5KG2A 2NUAB 2DLNA 3LMLA 5KFTA 3MFIA 1XMOH 1DXXA 4O4IF 3EPGA 5KFIA 4BY7G 5IYBG 4C5AA 3L4JA 5IP7G 4NXMH 5KFDA 4DL2A 4DL4A 3PN1A 4GKKH 3HOPA 5EZYF 4JI1H 4R8UB 1CQIB 4IR1A 2EE7A 4F4XA 3Q8PB 4J9PA 5IP9G 2PMZA 3KTMA 4YJ3F 3OHAA 1I94H 3N42B 5KKNB 4YP3A 3VPBA 2R92A 5C4XG 2FPPB 4ME6A 3KHLA 3RJ0A 1OWTA 4UCVA 2CZGA 3JSLA 4JI5H 3CVZA 2WA6A 4ECTA 4TQRA 1W96A 5T14A 2V9WA 3HOCA 3UQ8A 2Q2UA 2QK4A 2R8GA 2R85A 5F9NA 1KC7A 1KBLA 3J80W 4J9MA 2Q2TA 4BWSC 1WYMA 2R87A 2P0AA 4LMYA 2IBKA 4JI0H 3MJFA 1AUVA 5KG4A 2VQDA 1WH2A 3M4IA 3VPDA 4LF7H 3HOWG 2JA7G 1C3OA 4RB0A 5KT7A 5KFXA 2OLSA 5FPOA 2D86A 3BAAA 2YL2A 1P5SA 4HNTA 5FJ8G 3V6HA 5DG9A 2C28A 2ZDHA 3VPCA 4QWEA 4LF5H 3GIKA 3OSPA 1W93A 3L4KA 2XCAA 1GLVA 3KMWB 2FMAA 3PW4A 1IBMH 1Z2PX 3PW0A 4GKJH 1SH6A 2DWCA 5EOYA 2DPIA 2DZDA 3H40A 1EZ1A 1WYRA 4DV4H 2BR0A 2XCLA 4DV2H 1E4EA 5BVRA 3OHBA 3M9NB 2R8JA 4ECXA 4B3RH 3JAKM 2VZDA 3KAJA 2UXCH 3MFHA 3GQCA 3K5HA 5C5JA 1TWHA 2I80A 4A3KG 3EYYA 4ED1A 3KHHA 1I50A 4ZI7F 2R7NA 1EUDB 1Y1VG 3V6KA 2E5LH 1VAJA 2HL9A 4O3SA 2XCPA 2WA7A 1QAGA 4DUYH 3KHGA 5FMUA 4EEYA 4IAJA 4DR7H 2RDJA 4A3CG 1XDNA 1BHDA 3JSNA 4TXIA 1MZBA 5KFQA 3V4ZA 3MR3A 3JALM 2YS6A 5CAEB 4AYBA 3BQ0A 5L1LA 4DV1H 2AGQA 3R5FA 1R9TA 2WTFA 1I6UA 4FS2A 3JRWA 2E9KA 2FP4B 4CC5A 3I4MG 2WA5A 4C2MA 4QW9A 2VOBA 4LSXA 2HJWA 2AGOA 1KJ9A 1WSCA 5LP6F 4ED7A 4I50F 4DL7A 4LVRA 3RFCA 2V4QA 4O3QA 5D1PA 2R8HA 1DGSA 5CA0F 1IBLH 5EDWA 2CKZB 3R5XA 1HR0H 4B3TH 4IRDA 3MWMA 3N8DA 2YZNA 3BJYA 3OUUA 3GILA 1N48A 3Q8SB 3HOZG 1I7LA 4DR2H 3HOYG 4O3RA 2M05A 4EDLA 4FBTA 2FLLA 5EWFA 5KG7A 4QWDA 1FJGH 4M9UA 2JEGA 4PWQA 4L1KA 2BQRA 5C1OA 1IBKH 4Q45A 4IRKA 4O4HF 4ZHQF 1K1SA 4JI6H 2UXBH 5KG6A 3SE7A 3TIGA 4M7EA 4BY1G 2V4RA 3WO0A 2ALZA 3T5LA 4QIWA 5A4BA 4YAKB 1WYQA 1H67A 4RUAA 2PN1A 3ORRA 4TV8F 1S68A 1DV2A 4RUCA 1SYXB 4F4YA 4EBDA 4UCUA 3I6XA 3F8NA 2YRNA 4HQ6A 4I7HA 4DR5H 1S0OA 2JA5A 3K3PA 1RYRA 2IMWP 1Z2NX 2C2EA 3TIIA 5JVDF 2PMZE 1XNQH 2X0SA 2YZMA 3TQTA 5DLFA 2WDTA 4F4WA 3FMAA 3H0GA 1DIKA 2NU9B 3WNZA 4ED6A 2DPJA 4A3EG 4Q0YA 3K3VA 4EG0A 5HBRB 5CB4F
chains in the Genus database with same CATH topology
2RGVA 4NXNH 3BA8A 2HVQA 1BJTA 4YY3H 3UQ8A 2Q2UA 5D1OA 4DV6H 3BABA 1A0IA 1EUVA 3J80W 5D1OB 4EEQA 2Q2TA 4BWSC 4DV5H 2HVSA 1V9PA 2ZM6H 4LMYA 4JI0H 3T1YH 1XNRH 4LH7A 1GYFA 1WH2A 3BA9A 3M4IA 4LF7H 4PDBA 4JV5H 4LH6A 4RB0A 4X62H 1HNXH 4B3SH 5FPOA 3BAAA 1S03G 4J0MA 4DR1H 3KALA 5FD6A 3IG0A 1HNZH 4LF4H 1B04A 2O03A 4X65H 4LF5H 4RB3C 1TA8A 2HKPA 3L4KA 4DV7H 1N33H 2RGRA 1P8LA 4UCRA 1IBMH 4GKJH 1Z2PX 2UUAH 2ZJTA 4OX9H 5EOYA 2VE7A 3RF2A 4LF6H 2EQOA 1E4GT 4DV4H 2UUBH 2KSWA 1AN7A 4DV2H 1FKAH 4RAZA 4MV9A 4B3RH 2IGPA 1L2ZA 4GLXA 3RIZA 3KAJA 2UXCH 4MTEA 4DUZH 3N41B 1ZHQA 1N36H 2VUGA 4JI7H 3N6XA 3EYYA 2E5LH 3HXLA 2HL8A 2HL9A 1FVIA 3EAYA 4RB1A 4ETSA 2OWOA 4A2AA 4DUYH 4AQYH 3OTOH 3J7AK 5FMUA 4UCSA 2WYOA 4IAJA 3JAMW 1M0WA 4DR7H 2WE6A 5IT9W 1XDNA 4R7RA 2UXDH 4UCOA 3JSNA 1N34H 4JI8H 1MZBA 4LFBH 3RGXA 4DV1H 2W57A 4DR6H 4A2BA 4EFBA 1I6UA 4JYAH 4CC5A 3H20A 3VP7A 4MV7A 2VOBA 3KXYT 4LSXA 4KHPH 2YCHA 4RZQA 4LVRA 4X64H 1XMQH 5D1PA 4DV0H 4UFZA 4LVPA 5A2QW 4RB2C 5LMUH 1DGSA 1IBLH 4RAYA 2CW8A 4YHHH 1VS0A 1E4FT 2VQFH 3RGZA 1HR0H 4B3TH 2HHHH 3MWMA 1SEIA 4CC6A 4MTDA 4LF9H 1J5EH 4K0KH 1BGWA 2UU9H 4LFCH 2HVRA 1N32H 4DR2H 1X9NA 5LL6b 4LF8H 3N40P 2UUCH 4B3MH 1FJGH 5LMNH 2F4VH 4JI3H 5FLXW 5FMTA 2FE3A 2VPSA 5IWAH 1IBKH 4DR4H 4JI6H 4JI2H 1XMOH 3LMLA 2UXBH 1Z2OX 3N44B 3DF7A 4M7EA 1ZHSA 1O75A 3L4JA 4DV3H 4NXMH 1M0TA 3KAKA 1TAEA 3C0FB 5BR8H 3PN1A 4GKKH 1S68A 4X66H 4JI1H 4LSAA 1SYXB 4FM9A 4APMA 2XIGA 4UCUA 3T1HH 4DDPA 3F8NA 4I7HA 2MCTA 5FPRA 2VQEH 4DR5H 3RTXA 4UCTA 3J81W 1Z2NX 3N43B 5FD5A 1I94H 1XNQH 3N42B 2WDTA 2VE7C 3FMAA 1HNWH 4EFEA 4DR3H 3RJ0A 4JI4H 3L2PA 4UCVA 4Q0YA 3JSLA 3K3VA 4LFAH 4JI5H 2HGSA 3CVZA 2CW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE6 A;  2WDT A; 
#chains in the Genus database with same CATH topology
 3VMM A;  3Q1K A;  5F9L A;  2C22 A;  1BJT A;  3RB0 A;  5KFO A;  2L3G A;  2SCU B;  3E5N A;  4XYM B;  1T3N A;  3GTM A;  1VBH A;  3G6Y A;  2B63 G;  1WR2 A;  5KG0 A;  2DIK A;  1V9P A;  3TIN A;  2HVS A;  2VUM G;  2OH2 A;  3BQ2 A;  1XNR H;  3T5J A;  4LH7 A;  3PW7 A;  1GYF A;  4IRC A;  3KMU B;  5KG1 A;  4X62 H;  1VBG A;  5KFE A;  1HNX H;  5L1K A;  2W6M A;  4F4Z A;  3WO1 A;  4A3F G;  5FD6 A;  3IG0 A;  5EWE A;  1TWC A;  1WYO A;  1B04 A;  2W6O A;  1PX2 A;  2J9G A;  3CQZ A;  3RAX A;  2HKP A;  2B63 A;  4DL5 A;  2AU0 A;  4O3N A;  1BNC A;  2ZJT A;  4AYB E;  1B6R A;  3GV7 B;  2UUA H;  2V59 A;  1E4G T;  3I12 A;  1MB8 A;  2KSW A;  1SH5 A;  1CE8 A;  2I87 A;  5IYZ F;  3FER A;  3GTQ A;  2IGP A;  4ED0 A;  4GLX A;  2NU6 B;  1RJQ A;  2YZG A;  4MTE A;  1EUC B;  2YS7 A;  3RIZ A;  4JUZ A;  4DUZ H;  4ECR A;  1N36 H;  2E2H A;  4ZQI A;  3MWE A;  3GIJ A;  1Y1W A;  2VZC A;  2NVY A;  2CQY A;  1S9F A;  1PA7 A;  3GTO A;  2HL8 A;  5C1P A;  1GSH A;  5A38 A;  2YYA A;  4ED3 A;  4A2A A;  4AQY H;  2OWO A;  3OTO H;  3J7A K;  2W7O A;  4UCS A;  1KEE A;  2NU8 B;  3JAM W;  1M0W A;  1VKA A;  5KFH A;  4QWA A;  4HNU A;  4MA5 A;  2C2R A;  4YR3 A;  1K1Q A;  4LFB H;  4DLK A;  1KJI A;  5LYJ F;  2R84 A;  5J2U F;  2QJX A;  2YRX A;  1KJQ A;  2W6Q A;  2Y0S A;  2V5A A;  4QW8 A;  4A2B A;  1TWG A;  4MV4 A;  4RZR A;  1T36 A;  1JLL B;  2FJZ A;  3H20 A;  3BQ1 A;  2XC9 A;  3H4D A;  3VP7 A;  1UJO A;  3SI8 A;  2ASJ A;  3KXY T;  4ECY A;  1SFO A;  4KHP H;  2XGQ A;  4RNM A;  2EYN A;  4RZQ A;  4X64 H;  4DV0 H;  1V4Y A;  4LVP A;  5LMU H;  2R7Z A;  1UNN C;  4B7L A;  4YHH H;  2VQF H;  3RGZ A;  1S0M A;  3HOV G;  5CA1 F;  1SEI A;  4CC6 A;  3RBD A;  4YQW A;  1J5E H;  1BGW A;  3G8C A;  1CQJ B;  4XZ3 B;  5KG3 A;  2W70 A;  1GSO A;  1V5K A;  2R86 A;  1X9N A;  4HNV A;  3N40 P;  3GV5 B;  4FU0 A;  5KFL A;  4MV3 A;  2D87 A;  1ZQ7 A;  4J9S A;  3ORQ A;  5KFU A;  2FB9 A;  5IYD G;  4MAM A;  5IWA H;  3RB3 A;  4DR4 H;  1TWF A;  5C3E G;  1KJJ A;  3N44 B;  4Y8V B;  1ZHS A;  3GIP A;  2ZDQ A;  2PBZ A;  1M0T A;  3KAK A;  4QIW E;  4J9O A;  4DV3 H;  3PVX A;  3GTK A;  5BR8 H;  1GO3 E;  3GII A;  4X66 H;  4TQS A;  4LSA A;  5DGB A;  5KT2 A;  3Q8Q B;  3KHR A;  2XIG A;  3I4N G;  3T1H H;  2VPQ A;  2VQE H;  2MCT A;  5FPR A;  3RTX A;  4C5B A;  3GTL A;  4YR2 A;  3N43 B;  4BXX G;  1RJP A;  3KY9 A;  2R92 G;  1SCU B;  1M7J A;  4FBU A;  2RR8 A;  2VE7 C;  5L9X A;  2R8K A;  1HNW H;  2VZG B;  5KX5 F;  4DR3 H;  4JI4 H;  4Q43 A;  3LP8 A;  3GTG A;  2J6S A;  3RV3 A;  2CW7 A;  1WKU A;  4NXN H;  2HVQ A;  2W6N A;  3OUZ A;  4MV6 A;  4U7C A;  5D1O A;  4DV6 H;  4ECV A;  2V58 A;  5D1O B;  2WAQ A;  3CO1 A;  4DV5 H;  2ASD A;  4EYH B;  4IZO A;  1UC8 A;  2ZM6 H;  2JEF A;  4O3O A;  2XGP A;  1I3Q A;  2C35 B;  4IWX A;  5A37 A;  1WCM A;  2NVX A;  4DL6 A;  4LH6 A;  2ATL A;  1Y1V A;  3GIM A;  1GSA A;  3JAR M;  4BBR G;  4DR1 H;  4J9K A;  2YU9 A;  2D89 A;  4LF4 H;  4WD3 A;  1WJO A;  2VZI B;  2JA6 G;  3V4S A;  2O03 A;  4NLG A;  4X65 H;  4YBZ B;  3PW5 A;  1EYZ A;  2FK2 A;  1JXL A;  4JV1 A;  1N33 H;  1P8L A;  1EHI A;  4UCR A;  4Q8E A;  4IWY A;  4QJF A;  3U9T A;  3HOX G;  1PXY A;  4OX9 H;  2VE7 A;  3RF2 A;  2EQO A;  2UUB H;  1AOA A;  4QWB A;  1AN7 A;  2GPW A;  2W7P A;  4A93 G;  1FKA H;  4RAZ A;  1JIH A;  4MV9 A;  3PO2 G;  1WYN A;  4F50 A;  4YR0 A;  2YRW A;  5DG8 A;  5JH7 F;  2RDI A;  1P2X A;  4U6P A;  3N41 B;  1K83 A;  3FDS A;  4JI7 H;  5JUM A;  5KT3 A;  2RF4 A;  3R23 A;  3RB4 A;  1VKZ A;  4R8U A;  3HXL A;  3OSN A;  1V51 A;  1FVI A;  1Y14 B;  5BMV F;  4ED8 A;  5JQW A;  2WYO A;  3MWD A;  3QZ8 A;  4J9L A;  5IT9 W;  2WE6 A;  1JDE A;  4R7R A;  1ZET A;  2NU7 B;  1WIX A;  2UXD H;  4XX0 B;  4A3J G;  1N34 H;  5KFP A;  4JI8 H;  1ULZ A;  4RNN A;  5KFW A;  5L1J A;  2AGP A;  4A3D G;  4DR6 H;  2YW2 A;  4EFB A;  4EGJ A;  4JYA H;  5H80 A;  3GLK A;  2FPG B;  3K5I A;  4MV7 A;  5JVL A;  3GTP A;  1TWA A;  4A3I G;  4WBN F;  1RJR A;  2YCH A;  2R7Z G;  4YB8 B;  3TQ1 A;  5DQI A;  5KT5 A;  1XMQ H;  5KFA A;  4HYK A;  5A2Q W;  1TJT A;  4GC7 A;  4Q58 A;  3GID A;  3REP B;  1T94 A;  2JV9 A;  2R7L A;  3FKI G;  1WYL A;  5KG5 A;  2HHH H;  5LOV F;  4MTD A;  4LF9 H;  4BBS G;  3FKI A;  2W9A A;  1UEG A;  3PR5 B;  3H3V H;  4YAJ B;  2UU9 H;  5KFN A;  4LFC H;  3GV8 B;  1N32 H;  5LA6 F;  2FPI B;  2WB1 E;  2IP4 A;  1RT8 A;  4ECQ A;  2FLN A;  1PK8 A;  2UUC H;  2VA2 A;  4A3L G;  3HOR A;  4J9Q A;  2F4V H;  5FLX W;  1BKR A;  3QZ7 A;  1AA2 A;  1BXR A;  2VPS A;  5KFF A;  3Q2O A;  4O2A F;  3Q8R B;  1N56 A;  4HR7 A;  5L1I A;  4JI2 H;  3AYH B;  3G6X A;  1Y1W G;  2R93 G;  2R82 A;  5KFS A;  1Z2O X;  3DF7 A;  1M6V A;  1S97 A;  5BPH A;  2J6T A;  2JEJ A;  2W6P A;  4RU9 A;  4EBE A;  3T5H A;  1O75 A;  2VR1 A;  2DK9 A;  2UVW A;  3HBL A;  2R93 A;  1IOW A;  1TAE A;  3C0F B;  1RYS A;  2VA3 A;  4IR9 A;  4TV9 F;  3H4B A;  1JKJ B;  4FM9 A;  4APM A;  1JDB B;  4DDP A;  1AUX A;  3ETH A;  5GON F;  1WYP A;  4UCT A;  3J81 W;  2R6F A;  5FD5 A;  2W8L A;  3PR4 A;  3HKZ E;  2R8I A;  4Q8F A;  1A9X A;  2R8U A;  2EYI A;  4EFE A;  2FLP A;  2D88 A;  4E4T A;  2W9C B;  5KFR A;  3L2P A;  5LXT F;  4EBC A;  4LFA H;  4O3P A;  3HOU G;  2HGS A;  5KFK A;  1GGO A;  5DLG A;  5KFG A;  3G6V A;  1S0N A;  2RGV A;  3BA8 A;  4DL3 A;  3GIQ A;  2K3S A;  4YY3 H;  4EYI B;  4ECS A;  2C00 A;  3BAB A;  3T5K A;  1S10 A;  2E2I A;  2K2R A;  1EUV A;  1A0I A;  2W71 A;  4EEQ A;  2I8C A;  5A36 A;  2PVP A;  2C2D A;  2JA7 A;  1JX4 A;  4ECW A;  5DG7 A;  3F7P A;  1CS0 A;  2WB1 A;  3MR2 A;  3T1Y H;  1WCM G;  3H0G G;  4JV0 A;  3RAQ A;  2GPS A;  4O4L F;  4ECU A;  1DV1 A;  3RV4 A;  3BA9 A;  4PDB A;  5KFY A;  2JEI A;  1B33 N;  3LWB A;  4B3S H;  1E4E B;  2JA6 A;  2XD4 A;  2QJZ A;  4ECZ A;  4J0M A;  1S03 G;  3KAL A;  1HNZ H;  2BQ3 A;  5I47 A;  4YJ2 F;  4I4T F;  4RB3 C;  1TA8 A;  3MR6 A;  4DV7 H;  2W6Z A;  4J9R A;  1KJ8 A;  4MV8 A;  5KFV A;  2IA6 A;  4G3I A;  5KFJ A;  2RGR A;  3EPI A;  4A3B G;  2JA5 G;  3NGD A;  5L0O A;  4TXK A;  5HV6 A;  2R0O A;  2JA8 G;  1UC9 A;  2FKL A;  3HB9 A;  4LF6 H;  5D8D A;  5C44 G;  2VUM A;  3U9S A;  2QYZ A;  2FK3 A;  4EGQ A;  4Q57 B;  2BQU A;  3HKZ A;  1L2Z A;  3JZI A;  4JV2 A;  1ZHQ A;  5C8Y F;  3RUP A;  2WFN A;  2GLT A;  3V6J A;  4MA0 A;  2VUG A;  5DGA A;  3N6X A;  3UFX B;  3RBE A;  2AQ4 A;  4A3G G;  1IOV A;  3M9M B;  4I55 F;  5EWG A;  4RB1 A;  4JV5 H;  3EAY A;  5DQH A;  4ETS A;  4EDM A;  1B6S A;  4QWC A;  2W8K A;  3PW2 A;  1RK5 A;  2UVR A;  4ED2 A;  2ZDG A;  4UCO A;  2D85 A;  4A3M G;  3RGX A;  5FLM G;  4O2B F;  3RB6 A;  4Q59 A;  2W57 A;  2Y0S E;  4TUY F;  3IN5 A;  1RK6 A;  3MR5 A;  3M9O B;  5J2T F;  5IYC G;  5KFB A;  3PZP A;  5KFC A;  5BPF A;  4FS1 A;  5KT6 A;  4RNO A;  3R5H A;  3PO3 G;  4UFZ A;  4RB2 C;  4EDN A;  2FK1 A;  2ASL A;  5J8E A;  2R7K A;  2CW8 A;  4RAY A;  1VS0 A;  1E4F T;  2W9C A;  5KFZ A;  4IHJ F;  2R7M A;  3GTJ A;  1I7N A;  5DQG A;  3JRX A;  4C5C A;  2W9B B;  4MV1 A;  4K0K H;  4Q44 A;  2HVR A;  2W9B A;  2WAQ E;  4ZOL F;  4GC6 A;  5LL6 b;  3BG5 A;  4LF8 H;  4B3M H;  2UVU A;  5KFM A;  2J6U A;  5LMN H;  4XYL B;  1C30 A;  4JI3 H;  5K2M A;  2UVV A;  3ETJ A;  5FMT A;  2FE3 A;  3QFF A;  5KT4 A;  4J9N A;  5KG2 A;  2NUA B;  2DLN A;  3LML A;  5KFT A;  3MFI A;  1XMO H;  1DXX A;  4O4I F;  3EPG A;  5KFI A;  4BY7 G;  5IYB G;  4C5A A;  3L4J A;  5IP7 G;  4NXM H;  5KFD A;  4DL2 A;  4DL4 A;  3PN1 A;  4GKK H;  3HOP A;  5EZY F;  4JI1 H;  4R8U B;  1CQI B;  4IR1 A;  2EE7 A;  4F4X A;  3Q8P B;  4J9P A;  5IP9 G;  2PMZ A;  3KTM A;  4YJ3 F;  3OHA A;  1I94 H;  3N42 B;  5KKN B;  4YP3 A;  3VPB A;  2R92 A;  5C4X G;  2FPP B;  4ME6 A;  3KHL A;  3RJ0 A;  1OWT A;  4UCV A;  2CZG A;  3JSL A;  4JI5 H;  3CVZ A;  2WA6 A;  4ECT A;  4TQR A;  1W96 A;  5T14 A;  2V9W A;  3HOC A;  3UQ8 A;  2Q2U A;  2QK4 A;  2R8G A;  2R85 A;  5F9N A;  1KC7 A;  1KBL A;  3J80 W;  4J9M A;  2Q2T A;  4BWS C;  1WYM A;  2R87 A;  2P0A A;  4LMY A;  2IBK A;  4JI0 H;  3MJF A;  1AUV A;  5KG4 A;  2VQD A;  1WH2 A;  3M4I A;  3VPD A;  4LF7 H;  3HOW G;  2JA7 G;  1C3O A;  4RB0 A;  5KT7 A;  5KFX A;  2OLS A;  5FPO A;  2D86 A;  3BAA A;  2YL2 A;  1P5S A;  4HNT A;  5FJ8 G;  3V6H A;  5DG9 A;  2C28 A;  2ZDH A;  3VPC A;  4QWE A;  4LF5 H;  3GIK A;  3OSP A;  1W93 A;  3L4K A;  2XCA A;  1GLV A;  3KMW B;  2FMA A;  3PW4 A;  1IBM H;  1Z2P X;  3PW0 A;  4GKJ H;  1SH6 A;  2DWC A;  5EOY A;  2DPI A;  2DZD A;  3H40 A;  1EZ1 A;  1WYR A;  4DV4 H;  2BR0 A;  2XCL A;  4DV2 H;  1E4E A;  5BVR A;  3OHB A;  3M9N B;  2R8J A;  4ECX A;  4B3R H;  3JAK M;  2VZD A;  3KAJ A;  2UXC H;  3MFH A;  3GQC A;  3K5H A;  5C5J A;  1TWH A;  2I80 A;  4A3K G;  3EYY A;  4ED1 A;  3KHH A;  1I50 A;  4ZI7 F;  2R7N A;  1EUD B;  1Y1V G;  3V6K A;  2E5L H;  1VAJ A;  2HL9 A;  4O3S A;  2XCP A;  2WA7 A;  1QAG A;  4DUY H;  3KHG A;  5FMU A;  4EEY A;  4IAJ A;  4DR7 H;  2RDJ A;  4A3C G;  1XDN A;  1BHD A;  3JSN A;  4TXI A;  1MZB A;  5KFQ A;  3V4Z A;  3MR3 A;  3JAL M;  2YS6 A;  5CAE B;  4AYB A;  3BQ0 A;  5L1L A;  4DV1 H;  2AGQ A;  3R5F A;  1R9T A;  2WTF A;  1I6U A;  4FS2 A;  3JRW A;  2E9K A;  2FP4 B;  4CC5 A;  3I4M G;  2WA5 A;  4C2M A;  4QW9 A;  2VOB A;  4LSX A;  2HJW A;  2AGO A;  1KJ9 A;  1WSC A;  5LP6 F;  4ED7 A;  4I50 F;  4DL7 A;  4LVR A;  3RFC A;  2V4Q A;  4O3Q A;  5D1P A;  2R8H A;  1DGS A;  5CA0 F;  1IBL H;  5EDW A;  2CKZ B;  3R5X A;  1HR0 H;  4B3T H;  4IRD A;  3MWM A;  3N8D A;  2YZN A;  3BJY A;  3OUU A;  3GIL A;  1N48 A;  3Q8S B;  3HOZ G;  1I7L A;  4DR2 H;  3HOY G;  4O3R A;  2M05 A;  4EDL A;  4FBT A;  2FLL A;  5EWF A;  5KG7 A;  4QWD A;  1FJG H;  4M9U A;  2JEG A;  4PWQ A;  4L1K A;  2BQR A;  5C1O A;  1IBK H;  4Q45 A;  4IRK A;  4O4H F;  4ZHQ F;  1K1S A;  4JI6 H;  2UXB H;  5KG6 A;  3SE7 A;  3TIG A;  4M7E A;  4BY1 G;  2V4R A;  3WO0 A;  2ALZ A;  3T5L A;  4QIW A;  5A4B A;  4YAK B;  1WYQ A;  1H67 A;  4RUA A;  2PN1 A;  3ORR A;  4TV8 F;  1S68 A;  1DV2 A;  4RUC A;  1SYX B;  4F4Y A;  4EBD A;  4UCU A;  3I6X A;  3F8N A;  2YRN A;  4HQ6 A;  4I7H A;  4DR5 H;  1S0O A;  2JA5 A;  3K3P A;  1RYR A;  2IMW P;  1Z2N X;  2C2E A;  3TII A;  5JVD F;  2PMZ E;  1XNQ H;  2X0S A;  2YZM A;  3TQT A;  5DLF A;  2WDT A;  4F4W A;  3FMA A;  3H0G A;  1DIK A;  2NU9 B;  3WNZ A;  4ED6 A;  2DPJ A;  4A3E G;  4Q0Y A;  3K3V A;  4EG0 A;  5HBR B;  5CB4 F; 
#chains in the Genus database with same CATH homology
 2RGV A;  4NXN H;  3BA8 A;  2HVQ A;  1BJT A;  4YY3 H;  3UQ8 A;  2Q2U A;  5D1O A;  4DV6 H;  3BAB A;  1A0I A;  1EUV A;  3J80 W;  5D1O B;  4EEQ A;  2Q2T A;  4BWS C;  4DV5 H;  2HVS A;  1V9P A;  2ZM6 H;  4LMY A;  4JI0 H;  3T1Y H;  1XNR H;  4LH7 A;  1GYF A;  1WH2 A;  3BA9 A;  3M4I A;  4LF7 H;  4PDB A;  4JV5 H;  4LH6 A;  4RB0 A;  4X62 H;  1HNX H;  4B3S H;  5FPO A;  3BAA A;  1S03 G;  4J0M A;  4DR1 H;  3KAL A;  5FD6 A;  3IG0 A;  1HNZ H;  4LF4 H;  1B04 A;  2O03 A;  4X65 H;  4LF5 H;  4RB3 C;  1TA8 A;  2HKP A;  3L4K A;  4DV7 H;  1N33 H;  2RGR A;  1P8L A;  4UCR A;  1IBM H;  4GKJ H;  1Z2P X;  2UUA H;  2ZJT A;  4OX9 H;  5EOY A;  2VE7 A;  3RF2 A;  4LF6 H;  2EQO A;  1E4G T;  4DV4 H;  2UUB H;  2KSW A;  1AN7 A;  4DV2 H;  1FKA H;  4RAZ A;  4MV9 A;  4B3R H;  2IGP A;  1L2Z A;  4GLX A;  3RIZ A;  3KAJ A;  2UXC H;  4MTE A;  4DUZ H;  3N41 B;  1ZHQ A;  1N36 H;  2VUG A;  4JI7 H;  3N6X A;  3EYY A;  2E5L H;  3HXL A;  2HL8 A;  2HL9 A;  1FVI A;  3EAY A;  4RB1 A;  4ETS A;  2OWO A;  4A2A A;  4DUY H;  4AQY H;  3OTO H;  3J7A K;  5FMU A;  4UCS A;  2WYO A;  4IAJ A;  3JAM W;  1M0W A;  4DR7 H;  2WE6 A;  5IT9 W;  1XDN A;  4R7R A;  2UXD H;  4UCO A;  3JSN A;  1N34 H;  4JI8 H;  1MZB A;  4LFB H;  3RGX A;  4DV1 H;  2W57 A;  4DR6 H;  4A2B A;  4EFB A;  1I6U A;  4JYA H;  4CC5 A;  3H20 A;  3VP7 A;  4MV7 A;  2VOB A;  3KXY T;  4LSX A;  4KHP H;  2YCH A;  4RZQ A;  4LVR A;  4X64 H;  1XMQ H;  5D1P A;  4DV0 H;  4UFZ A;  4LVP A;  5A2Q W;  4RB2 C;  5LMU H;  1DGS A;  1IBL H;  4RAY A;  2CW8 A;  4YHH H;  1VS0 A;  1E4F T;  2VQF H;  3RGZ A;  1HR0 H;  4B3T H;  2HHH H;  3MWM A;  1SEI A;  4CC6 A;  4MTD A;  4LF9 H;  1J5E H;  4K0K H;  1BGW A;  2UU9 H;  4LFC H;  2HVR A;  1N32 H;  4DR2 H;  1X9N A;  5LL6 b;  4LF8 H;  3N40 P;  2UUC H;  4B3M H;  1FJG H;  5LMN H;  2F4V H;  4JI3 H;  5FLX W;  5FMT A;  2FE3 A;  2VPS A;  5IWA H;  1IBK H;  4DR4 H;  4JI6 H;  4JI2 H;  1XMO H;  3LML A;  2UXB H;  1Z2O X;  3N44 B;  3DF7 A;  4M7E A;  1ZHS A;  1O75 A;  3L4J A;  4DV3 H;  4NXM H;  1M0T A;  3KAK A;  1TAE A;  3C0F B;  5BR8 H;  3PN1 A;  4GKK H;  1S68 A;  4X66 H;  4JI1 H;  4LSA A;  1SYX B;  4FM9 A;  4APM A;  2XIG A;  4UCU A;  3T1H H;  4DDP A;  3F8N A;  4I7H A;  2MCT A;  5FPR A;  2VQE H;  4DR5 H;  3RTX A;  4UCT A;  3J81 W;  1Z2N X;  3N43 B;  5FD5 A;  1I94 H;  1XNQ H;  3N42 B;  2WDT A;  2VE7 C;  3FMA A;  1HNW H;  4EFE A;  4DR3 H;  3RJ0 A;  4JI4 H;  3L2P A;  4UCV A;  4Q0Y A;  3JSL A;  3K3V A;  4LFA H;  4JI5 H;  2HGS A;  3CVZ A;  2CW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...