2WEFA

Human 3'(2'), 5'-bisphosphate nucleotidase 1 (bpnt1) in complex with amp, po4 and magnesium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
303
structure length
303
Chain Sequence
TVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'(2')\, 5'-BISPHOSPHATE NUCLEOTIDASE 1
publication title Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) in Complex with AMP, Po4 and Magnesium
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 95
structure length 303
sequence length 303
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2009-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2wefA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wefA02
1NI9A 1FPIA 1EYKA 4GX6A 1NUWA 1KZ8A 2FHYA 1FSAA 1IMFA 4QXDA 5ET7A 3LV0A 2DDKA 5EYHA 1DBZA 2R8TA 2P3VA 1NV6A 2P3NA 1NUYA 4IR8A 5DW8A 4HXVA 1IMDA 1XI6A 3T0JA 1VDWA 4GWSA 2FIEA 2OX3A 1DK4A 4AS5A 1INPA 1FPLA 1LBVA 4GBVA 1K9YA 2F3BA 1NV7A 3BIHA 1IMCA 4GBWA 2QFLA 4O7IA 1NV4A 5A5LA 1NV5A 2Q74A 2CZHA 4I40A 1YXIA 5EQ8A 1FBHA 1YZ0A 4I3YA 2BJIA 4GWXA 2WEFA 5I3SA 1LBYA 2FIXA 5EQ9A 1RDZA 4FBPA 1BK4A 2QVRA 2OWZA 3IFAA 3RYDA 1NUZA 1NV0A 2Y5LA 2GQ1A 5IZ1A 1FPDA 2Q8MA 2VT5A 1K9ZA 4GX3A 3FBPA 1RDXA 1SPIA 3KC1A 4HE0A 5ET8A 1NV2A 2F3DA 3ROJA 1QGXA 2HHMA 1IMBA 1NV3A 1FPJA 2PCRA 2QVVA 4AS4A 1RDYA 1FJ6A 1LBZA 1NV1A 1AWBA 4GX4A 4GWWA 5J16A 1CNQA 3RPLA 5ESYA 4I3EA 4PTKA 3LUZA 1FRPA 1DCUA 2QVUA 5F24A 1FBEA 1Q9DA 1D9QA 1FPGA 1FPBA 3KBZA 3A29A 1FTAA 3BIGA 3QMFA 1EYJA 2WBDA 2CZIA 1LBWA 3IFCA 4GWUA 5IZ3A 1FPEA 1FBDA 4N81A 5ET5A 5EYGA 1FBCA 3B8BA 1NUXA 1FBGA 2FVZA 3D1RA 4KXPA 1JP4A 5ET6A 2Y5KA 3KC0A 3RPLB 2WBBA 1LBXA 1FBFA 1FPFA 4H45A 1FBPA 4H46A 5EQ7A 1G0HA 2JJKA 5LDZA 4HE1A 5FBPA 1IMEA 1FPKA 2CZKA 5IZ3B 1IMAA 2FBPA 4GWZA 5EQAA 1EYIA 4GWYA 4MJOA 1KA0A 1G0IA 1KA1A 4G61A 1YYZA 1LEVA 1FJ9A 5T3JA 4HE2A
chains in the Genus database with same CATH superfamily
3MWBA 3MVXA 2UYEA 1NNKA 2Z8EA 1TFDA 4Q30B 4GL0A 2UVGA 1BIYA 4QHQA 4OESA 3O97A 3IB0A 4R74A 3K00A 4ZE8A 2Q2AA 3MZBA 2REGA 2CZHA 2ONKE 4DDDA 2H25A 5AA4B 1Y1MA 5A5XA 2H9BA 4I62A 5EQ9A 5CM6A 2AIXA 1PEBA 3KN8A 4N6DA 1EH3A 1FPDA 3KC1A 3KJ7A 3VLVA 3O29A 2DVZA 5HBCA 1B4ZA 4ELRA 1MY4A 3LBSA 1SW4A 2I0CA 4DI3D 4PTKA 5F24A 1B5JA 4F1VA 3IL1B 2HQ0A 3T1BA 1I6AA 4R6YA 3K2DA 3FV1A 2H98A 5I57B 5H8SA 4PE3A 5ITOA 4YB5A 1A7LA 5I58B 2DXYA 2XX8A 1LBXA 1FTKA 2V3UA 5I59B 1JETA 2ZYNA 3UGWA 1MXVA 4IGRA 1IXGA 3OO7A 4HE1A 3IO6A 1IMEA 3Q25A 1P1NA 3EHTA 1B40A 4FIMA 4GWYA 3OSQA 4GLIA 3K01A 5M2VA 2QL3A 5L8DA 3G3FA 5I2NA 4FEBA 1B7HA 3T9HB 4P56A 1FSAA 2A5TB 3OD7A 2QMXA 1Z7NE 1AIVA 5KDTA 1ANFA 1VR5A 1LBVA 5H8FA 1NV4A 4HS7A 2QS2A 3FVNA 5EQ8A 5AA1A 4L17A 1B1HA 1YCJA 4NF4A 3ZKKA 1O63A 4RK9A 1UIUA 2CMOA 2HPGA 5TPAA 3MYUA 3THIA 3FVKA 4LZ8A 5ET8A 1NV2A 1TXFA 2QVVA 3CR9A 1UQWA 4DXUA 4KYSA 1SD3A 1XHYA 2DOJA 4JDFA 1UTBA 1FPBA 3A29A 4LZ5A 3U93A 2DS9A 4R9FA 2O1MA 1FQCA 3JYRA 2XWOA 3TPAA 1B2HA 1JVXA 2Y7PA 3M3FA 3KOSA 4EXKA 4POWA 4U4XA 1SW5A 4KCDA 3A3CA 4O3CA 3SEVA 4P0GA 1B3GA 4KI0E 3EN3A 1NI9A 1EYKA 1JVYA 4QXDA 4Q0CA 2F5XA 4G8HA 1IMDA 4OVQA 4AS5A 1LAHE 3G7WA 4XFEA 3MC2A 1DMBA 4NF6A 4ZDMA 4NEDA 4EQ7A 1N7XA 4PF8A 3MAMA 3G3JA 4ESXA 5IKBA 2HFBA 1RKMA 4ZZEA 1II5A 1GR2A 3H03A 4ZS9A 4OWDA 2XXVA 2O68A 4GX3A 4HE0A 3JZJA 1QGXA 1HSJA 2RINA 4EXLA 2UVHA 4ZEIA 4O7MA 1FJ6A 4GFRA 3TQWA 2DWJA 4ZZAA 4I3EA 1FQAA 1D9QA 4KYEA 5B7DA 2ONSA 3MVWA 2CEYA 4N13A 2RKMA 4HCYA 4N6KA 1BLFA 3H6UA 1FQBA 1NUXA 5JTYB 5L9SA 1XOCA 3RPLB 2XXIA 5I5PA 4GQOA 1I6BA 1ZMGA 3S9MC 2WYPA 1P99A 2CZKA 4P1LA 4XKQA 1WDNA 4G61A 5TU0A 4NAPA 2KR0A 2Z22A 4RA1A 4PGPA 5AA2D 1NUWA 1Y3PA 5DEXB 1IITA 3PPRA 4N8GA 4DCYA 4EQBA 3FVGA 2XA5A 1PB9A 4DXCA 1VDWA 4ZE9A 2NWJA 4DCXA 4F1UA 2ESNA 3MW0A 5A5LA 5K2XA 2Q74A 3W15C 1OIBA 3MVZA 3VE1B 4KHZE 2HEUA 1FQDA 2REJA 4LA9A 2UVIA 1MRPA 3H6WA 5DVFA 1SVXB 4YKJA 1RDXA 4F29A 1MXUA 2CZLA 4RYAA 1NFTA 2PCRA 1ATGA 1B7ZA 1DPEA 4LONB 4F22A 1SW1A 4TLLB 3BKIB 3EKIA 2XX9A 2F78A 1MQGA 2GHAA 3H06B 5HPQA 1B9JA 2PT2A 4U21A 1FBDA 4FECA 1GV8A 3B8BA 2ZYOA 3IX1A 3T9UA 4QF9A 3D1RA 3T9XB 4BDMA 4MX6A 3L6GA 3MP6A 2O7UA 4Z7EA 3RGYA 1FBFA 4H65A 4LQ2A 3OXNA 2JJKA 3ILTB 1NL5A 4F3PA 1TWYA 4ISUA 3QIMA 3N6TA 4R2BA 2VOZA 1Q1KA 2XHDA 4R75A 5EQAA 3O6GA 3K1PA 2DVCA 1B5IA 5TP9B 3ONMA 4JVDA 4PAFA 2HAUA 4MJOA 3HCQA 4YB6A 2GRVA 3CI8A 1NNPA 4GX6A 2Q9TA 3BBRA 4R6KA 3IR1A 2VPNA 1A55A 1IUDA 2A5SA 1PDAA 4YMAA 4QBAA 1LFGA 2XXXA 1IMCA 1H43A 4R2FA 1USYE 3SEWA 5L9MA 1M5CA 5ITPA 3FV2A 3H6VA 4PFIA 2OZZA 4H1XA 3RT6B 3OELA 3HPIA 4NWCA 3SEUA 4JSDA 3RPWA 3TCGA 4JWYA 3G3KA 2I6EA 2V3TA 4WXJA 2H4IA 4U1OA 4XKPA 2O84X 3CVGA 2QS3A 1B46A 4PFYA 4F19A 4OEUA 1S7YA 1FTJA 4GD5A 3EQ1A 1MPBA 3K4UA 5H8NB 4U1ZA 1CNQA 4ELPA 2Q89A 1B51A 4XKRA 1P1QA 1Q9DA 5FHOA 2Y7IA 4NMYA 4X04A 1R6ZA 1YTVA 3TKDA 1NNFA 4R9GA 3M3LA 5F1QA 4GXAA 5I2KA 3TUSA 4F3BA 3Q29A 5AA2B 3L6HA 4N07A 2QS4A 4E0XA 3LSFB 4BDNA 2XXPA 4POXA 1N3XA 4LP2B 1N3WA 4H67A 4AB5A 2Z8FA 1USYH 1FTOA 1QKBA 1P1UA 1LEVA 3HV1A 2X7PA 3FXQA 1H44A 1NH8A 3QUFA 3ZS6A 4OZ9A 3MSTA 1B52A 1VSOA 1NV6A 1D3KA 4XIGQ 1K9YA 1H45A 4JVCA 1PBPA 4IO5A 1Y4TA 1US5A 2BJIA 2V84A 4I8CA 1LAGE 2ZZXA 1QVSA 3IOUA 1B58A 3TAJA 4WEPA 3V8XB 2WX9A 3VLUA 4C0RA 3E79A 3FJGA 4N17A 4P9KA 3U1OA 2IEEA 3RTWB 2VT5A 3PTYA 4OA4A 2D21A 3TTLA 3PUYE 1B3HA 4O3BA 1NV3A 1FPJA 4PAIA 5CMMA 3OMBA 4FATA 3U65A 5DYHA 3O66A 1FTMA 2DWIA 4IO3A 3TTRA 4THIA 4ELQA 2GH9A 2DE3A 3BFTA 2RC8A 3K0VA 3KBZA 3BIGA 1AMFA 2XXQA 4F2QA 2QRYA 4GRKA 5ICQA 5ET5A 5H8HB 2CEXA 2OJTA 4KFQA 3O9PA 2F6PA 2XXUA 3BFUA 2GFEA 1B1XA 3MUQA 5AA3A 3MPKA 3IOVA 3TCHA 5J1DA 4NN3A 4G2ZA 3B6TA 4ESWA 2F35A 1CB6A 4ZECA 2HZLA 3E13X 4G4PA 5EYFA 4OYVA 4NF8B 2I4CA 1JEVA 3IJOB 2HZKA 2FYIA 4R72A 3N94A 4OTEA 4KQPA 2P3NA 3LUYA 4RJZA 4PETA 4O94A 4WEDA 5I56B 1JW5A 3DP4A 2THIA 5H8QB 3PPNA 1LLSA 2YJPA 2HAVA 2UYFA 4TOZA 4BDQA 3PPPA 1B7UA 4LUBA 5K2YA 4FORA 4OVJA 1A54A 4G77A 2AL5A 2Y5LA 3E4RA 2B4MA 4JBZA 3FBPA 1FTLA 2FA7A 4NF5A 2OPDA 1B5HA 3VV5A 1DTGA 4H8IA 1QUJA 3H3GA 2ZMBA 5IZZA 1LBZA 3R6UA 4GX4A 2G29A 1AH5A 1IXCA 5ESYA 4H5FA 2F97A 5DVIA 1Z7ME 3HFUA 4RK2A 3S9EA 1FPGA 4JB7A 4DLDA 5KCJB 5LOMA 3MZ1A 5L9OA 3HO7A 3C9HA 2Y5KA 2YLNA 5HM4B 4BDLA 5JEIA 3TODA 5FBPA 1UTHB 2QPQA 1EU8A 4DZ1A 4GWOA 3OSRA 2Y7KA 1YPNA 2VGQA 5CC2A 4HE2A 1LBCA 2DWAA 2XWKA 3QYTA 2LAOA 3G3GA 5ET7A 1GGGA 4Z0IA 5AA4A 2P3VA 5B70A 1MH3A 5DW8A 3QSLA 3QAXA 2X7QA 3BIHA 4QFLA 2QFLA 1MY0A 2FNCA 4XEQA 3O2AA 4F31B 4PGNA 3PMWA 2NVUB 4U2RA 1URGA 3PU5A 4MHFA 2MKZA 3R7XA 1OVTA 1LB9A 4QFNA 4F39A 3IOWA 2I4BA 3FASA 4TLMB 2XXKA 4G68B 1SPIA 3DLNA 1KWHA 3SEXA 5I57A 2ZXTA 2PX1A 4KR5A 3UN6A 1JW4A 3LR1A 4UA8A 5I58A 1ZIUA 5IAIA 1MXXA 3IK6B 5I59A 1TT1A 4U4SA 3C31A 2Y84A 1OLAA 2AYSA 1NMUA 3V89B 2CZIA 2UVJA 3LSXA 3IFCA 1QUIA 3EHSA 1FBCA 4GOTA 4ECFA 1FBGA 4PBQA 1N04A 4NGUA 1LBBA 4ND9A 5LTCA 3A09A 2ZYMA 2PMSA 5EQ7A 1XVYA 2A5TA 2KLFA 1BTJA 4G8NA 5IZ3B 1B3FA 4G68C 4IO4A 3H7MA 1FJ9A 1B3EA 2VPOA 2HXRA 3TZAA 2XWIA 2XXTA 4PE5B 4X9TA 3IAZA 3T0JA 4IY5A 1ELJA 2FIEA 3MPLA 3QUJA 4OETA 2H5YA 4RXLA 3N26A 4NTLA 5DTBA 1IXHA 4FJPA 4YKPA 3KGCA 1MQDA 5I3SA 5BWJA 1B4HA 3DP8A 1B6HA 4N15A 1B0LA 2XXYA 2OWZA 3O6IA 1IQ7A 1NV0A 1Q35A 4PDHA 4Q8RA 1EZ9A 3GBAA 2I48A 3P7IA 3R26A 1SI0A 4GWWA 1S50A 1JQFA 3LUZA 4IGTA 4H0WA 3TMGA 2XXWA 3QK6A 3QMFA 2WBDA 2RCBA 3PUWE 4RNSA 2FVZA 3FATA 4H5GA 2Q88A 3M3KA 2G93A 1SBPA 3E9XA 4OFJA 2F36A 3PPQA 4MH5A 1XVXA 4UABA 1EYIA 5CI5A 3KEIA 3FIRA 1BP5A 4OVTA 3OEMA 4KXPA 4UACA 4OQOA 3KN7A 4RPOA 2DDKA 1N84A 4XXUA 4U23A 3PUZE 4NHBA 2F6GA 3PUVE 4G8MA 3PMVA 2F34A 3H4ZA 3K6UA 4P11A 1I6QA 2Y7WA 2OWTA 1FBHA 2ANJA 3FJ7A 1VFDA 2XD3A 4BLAA 1FW0A 4PF6A 4JWOA 3M8UA 3EPEA 3FGSA 2O69A 4OFOA 2Q8MA 4F1YA 4QFOA 2F3DA 5A5XB 1QULA 4TQUQ 4OEVA 5JTYA 3IJXB 3U92A 4LVQA 3OEKA 3RPLA 3FXRA 2GHBA 1FRPA 3ZSFA 3LSLA 1PB7A 1XC1A 2PT1A 4YMBA 1A40A 5CMBA 4JWXA 1LBWA 3CFXA 1Y3QA 3FJMA 2F8DA 3MJNA 1P1WA 5FHNA 1D9VA 3VXBA 3T96B 4MCOA 3IOTA 1XS5A 4NG7A 1ZJLA 3MP1A 3MBPA 3TTMA 1T0KA 3KN3A 1QJMA 4KPTA 1LAFE 1FPFA 4H46A 3HSTA 3PD9A 5DEXA 3TCFA 4FAJA 1FQFA 3F11A 5LDZA 3DM0A 1FPKA 2PYYA 1O64A 5DVJA 4MNPA 3MP8A 3RT8A 3K1NA 3WAEA 1VE4A 4MNCA 4YICA 1OQGA 2V93A 3TFLA 3LV0A 3KSXA 3K1MA 1DBZA 2HXWA 2B4LA 1M5DA 3K6VA 2KQZA 1IEJA 3GLBA 1XI6A 1GVCA 4DXBA 1SYHA 1R1NA 2RF1A 5ICTA 4GBWA 2Q8JA 4PFUA 2UXAA 1ZTYA 5I2NB 3T9VA 1MH4A 2YPNA 4F3GA 3PV0E 3SKPA 1QW0A 3NOHA 1MXYA 3MVYA 5KDTB 3C36A 1JEUA 4LZ7A 5H8FB 3AXFA 2XX7A 1MY1A 4PDDA 3VDFA 3VVDA 1K9ZA 1XT8A 1H76A 2I3WA 3PMXA 1ZBMA 3C4MA 1YAEA 4NF4B 4MMPA 4WKMA 1AWBA 4PFBA 4H8JA 1DCUA 3OO8A 5TPAB 1N0TA 4N91A 4QRZA 3SEYA 2ZNUA 4C1UA 2ZNTA 2R71A 4GWUA 3VVFA 4N81A 3QXMA 5TP9A 4EDPA 2VP1A 4YZZA 1H3DA 1EZPA 5ET6A 3IO4A 4OVPA 1UTBB 1PBQA 4IO6A 3W9VA 3VLWA 2QJEA 3UP9A 5FTHA 4MF3A 1G0IA 1JNFA 2F7AA 4KD5A 4NF0A 2OCUA 3SETA 1B0HA 4P8BA 4PC9A 3W9WA 4I1DA 4PFRA 4F2OA 3KJTA 4PBHA 2PVUA 4IB2A 4RPNA 1DK4A 3MZ9A 4GBVA 3S4UA 1PC3A 1MM6A 1MQIA 3E78A 1LCFA 1NNTA 1YXIA 3DELB 2B65A 1TFAA 1RDZA 3S2VA 5H8NA 1UIVA 3IFAA 2O6AA 4NF6B 5IZ1A 3VXCA 4OXVA 1A8FA 3ROJA 3OENA 4P47A 5BUUA 1IMBA 4P3LA 2OK2A 3Q26A 4MFIA 5IGAA 1NV1A 5EHSA 3FZVA 2ZZWA 5AA2A 3U72A 2QMWA 2PFZA 4N8YA 3TELA 3TTNA 3VVEA 4MIJA 3HHGA 1FTAA 2ALUA 5EYGA 3EF7A 3S9NC 3FXUA 3DP6A 1MY3A 2Q2CA 3I6VA 3RTFB 1SYIA 3K02A 4H45A 3K6XA 3TEPA 1SDXA 4X1BA 1L5TA 1G0HA 1ZLQA 4PQJA 2FBPA 3PD8A 3TYHA 1QKAA 3FXBA 4BDOA 3Q28A 1LFHA 1Y1ZA 4PFWA 2I49A 1R9LA 1FPIA 3C35A 1MPDA 3K6WA 2NUVA 5EYHA 2F7CA 2R8TA 3ISPA 1IIWA 1MM7A 3V83A 1NV7A 2PBWA 4GIZA 3RY3A 2NOOA 1NV5A 3KZGA 4IO2A 1S9TA 1MXWA 3O6HA 4GWXA 5I84A 2WEFA 1D9YA 3FVOA 4X48A 3T66A 2R9JA 1D4NA 4DIGA 4EQ9A 4KYDA 1HSEA 5FTIA 3IB1A 1IZ1A 2GQ1A 1LFIA 1B32A 3C33A 5EHMA 5ELVA 3SZPA 4O3AA 1SW2A 4JSOA 2I3VA 3D4CA 2XXHA 2X26A 3FUZA 5H8HA 4AS4A 2O1LA 1AL3A 3N6UA 2DYXA 3O28A 4GXSB 5I7IA 2ABHA 3SERA 3U8QA 3UIFA 1WODA 1FPEA 3D4GA 3N5LA 3B6QA 4JVIA 4OHNA 5DT6A 3G3IA 4NF8A 3CFZA 3PUXE 4KCCA 4OERA 4YU0A 4R73A 4HCWA 5I56A 2DQVA 1BKAA 5H8QA 3ILUB 1KA1A 3G3HA 1YYZA 4MEVA 1OMPA 1MDP1 1LCTA 2D3IA 1MS7A 4ELOA 3ECRA 3WAFA 4GVOA 4IR8A 2P1SA 4HXVA 4XTCQ 4IO7A 3ODBA 1FPLA 2O7IA 3CFLA 3GYYA 1M5FA 3TQLA 4O7IA 1GTKA 4OFLA 2E1SA 1NH7A 3OO9A 2Z23A 3CSGA 4I3YA 4GF8A 2FIXA 2XXRA 3SDFA 4FBPA 4DI4B 1BK4A 1RYXA 3CG1A 1QUKA 3T93B 3KFMA 3E3KA 1NUZA 3TDJA 3LC8A 3I3VA 2M8CA 1EZOA 3CG3A 5KCJA 1HSLA 4PAKA 2D5WA 4AQ4A 2HHMA 1J1NA 4HTGA 3OO6A 4NE4A 3CIJA 2Z8DA 2WYKA 5J16A 3HN0A 3IB2A 4N6PA 3B7DA 5CRYA 4OMBA 1LB8A 4MAGA 1A8EA 4PFTA 5CMCA 1UTHA 2RCAA 3RQTA 1LAXA 1OVBA 3KSJA 3HHFA 1DTZA 5CBSA 1JW1A 3MQ9A 1FCKA 2WBBA 1MQHA 2ZYKA 1FQEA 3GXAA 2ONRA 1OQHA 1F9BA 1MQJA 3TTKA 4EF2A 2NXOA 5I2KB 4MLVA 1MY2A 1PB8A 5T3JA 1POY1 5KZTA 2V4CA 1KZ8A 1O7TA 1MPCA 3U94A 4LATA 4FE8A 2H99A 3UA8A 1OLCA 4X1DA 4GWSA 4M4GA 2OX3A 1R9QA 5IM2A 2DE2A 4ZEDA 4YKKA 4ONYA 3PGFA 4PCDA 4P0IA 1URSA 4QFPA 4G68A 2XD2A 1Y3NA 1YZ0A 1ZKBA 3ZKLA 4QSEA 2BJJX 4IY6A 3UK4A 1DPPA 2W7YA 4OANA 3I5OA 3USDA 5F7VA 1CE2A 4HW8A 4XF5A 3GZGA 1N76A 4ZEBA 3RUMA 4LN5A 2VHAA 3RNNA 5AE4A 1NKXA 3CRBA 4H6DA 4QFKA 3PPOA 3H6TA 4NQ8A 3B6WA 2IA4A 2DXRA 1M5EA 4U22A 2OLBA 2I0BA 3C32A 1EYJA 1Y20A 4YB7A 5IZ3A 2E0SA 2ZZVA 4ZEFA 4F18A 2P2AA 5ISUA 1SQYA 1LSTA 1JP4A 3KC0A 2DSFA 2V25A 4QSCA 2DE4A 4NWDA 1I69A 1B05A 2OBGA 3RN8A 3KOTA 2VD3A 1A99A 2OWSA 4GWZA 2HCAA 2F7BA 1WVJA 4MBPA 1MG1A 2RC7A 2V3QA 2FHYA 4QSDA 1IMFA 2R6GE 2WKYA 1DOTA 1NUYA 4E0WA 3CHGA 1Y9UA 1INPA 3SESA 3KBRA 2F3BA 5JK4A 4AB6A 3Q27A 4NX1A 4EF1A 4I40A 2DWHA 1MDQA 2I58A 4R6HA 3KG2A 2PFYA 3B50A 1LBYA 1AOVA 3VFJA 4YKIA 2QVRA 4F3SA 4YAHX 2B3FA 5CMKA 1DSNA 3RYDA 2DP8A 3CSBA 4GL8A 4MLQA 3IORA 3OOAA 3FD3A 4O8MA 3RLFE 4OENA 2P0SA 4N4UA 2VD2A 5CBRA 4JXIA 4RY1A 3JV9A 2QSXA 4PP0A 1MXZA 1RDYA 3V5AA 1P1OA 1Y4CA 4C1TA 4ZEKA 4XKNA 2QVUA 4DE8A 4Q5TA 1FBEA 1RYOA 4K3FA 4I9DA 4NF5B 4OVRA 1VFEA 2O51A 2RC9A 2Y7RA 1M5BA 1N7WA 4M1VA 3GBBA 2OPEA 1LGBC 4BDRA 4OVSA 4X8RA 2QS1A 4EUOA 1US4A 4LQ5A 3T22A 2B3BA 1FBPA 3EHUA 3C34A 1URDA 1IXIA 5FHMA 3LSWA 4P1EA 3S9LC 4MNIA 2AL4A 3A3UA 1POTA 1B3LA 1ZU0A 1SI1A 4FEDA 2XWVA 1KA0A 2L5VA 3UORA 1IMAA 2ZNSA
chains in the Genus database with same CATH topology
1FPIA 2VPOA 4GX6A 2Q9TA 2HXRA 2XWIA 2VPNA 4X9TA 5EYHA 2R8TA 3ISPA 3T0JA 2FIEA 4QBAA 1NV7A 1IMCA 1NV5A 2CZHA 4PFIA 4GWXA 2WEFA 5I3SA 5EQ9A 5CM6A 4N15A 2OWZA 4N6DA 1NV0A 2GQ1A 1FPDA 4PDHA 3SZPA 4F19A 3KC1A 2DVZA 4AS4A 4GWWA 1CNQA 4DI3D 4PTKA 3LUZA 5F24A 1Q9DA 4F1VA 4X04A 3QMFA 3T1BA 5I7IA 2WBDA 1FPEA 4PE3A 2FVZA 4JVIA 1LBXA 4HE1A 1IMEA 4HCWA 4UABA 1EYIA 4GWYA 1KA1A 4OVTA 1YYZA 1LEVA 4KXPA 4MEVA 1FSAA 4P56A 2DDKA 3MSTA 1NV6A 4NHBA 4IR8A 4HXVA 1FPLA 1LBVA 1K9YA 3GYYA 4O7IA 1NV4A 4JVCA 5EQ8A 1FBHA 4I3YA 2BJIA 2FIXA 2ZZXA 4PF6A 4FBPA 4DI4B 1BK4A 2WX9A 3E79A 2HPGA 4N17A 1NUZA 4P9KA 2Q8MA 3MYUA 2VT5A 3PTYA 4PAKA 5ET8A 4OA4A 1NV2A 2F3DA 2HHMA 1NV3A 1FPJA 4PAIA 2QVVA 3U65A 2WYKA 5J16A 3RPLA 1FRPA 2DE3A 4MAGA 1FPBA 3KBZA 3A29A 3BIGA 1LBWA 5ET5A 2XWOA 2CEXA 4MCOA 4NG7A 2WBBA 1FPFA 4H46A 5J1DA 5LDZA 4NN3A 1FPKA 4MNPA 2HZLA 5T3JA 1NI9A 1EYKA 4MNCA 2V4CA 4YICA 1KZ8A 4QXDA 2HZKA 3LV0A 2F5XA 1DBZA 2B4LA 2P3NA 4PETA 4O94A 2KQZA 1IMDA 1XI6A 4GWSA 4OVQA 2OX3A 4AS5A 5IM2A 4XFEA 2DE2A 4GBWA 4PCDA 4PF8A 1YZ0A 3NOHA 4OANA 4XF5A 2Y5LA 4PDDA 2B4MA 1K9ZA 4GX3A 3FBPA 4LN5A 4HE0A 1QGXA 4NQ8A 4O7MA 5IZZA 1FJ6A 1LBZA 4MMPA 1AWBA 4GX4A 4PFBA 5ESYA 4I3EA 1DCUA 3HFUA 4N91A 1D9QA 1FPGA 2CEYA 1EYJA 4HCYA 4N6KA 4GWUA 5IZ3A 2ZZVA 4N81A 1NUXA 4F18A 4YZZA 1JP4A 5ET6A 2Y5KA 3KC0A 3RPLB 4OVPA 2DE4A 5I5PA 3W9VA 5FBPA 2QPQA 2WYPA 2CZKA 4P1LA 4GWZA 1G0IA 4G61A 2V3QA 4NAPA 4HE2A 2KR0A 4NF0A 2XWKA 4PGPA 1NUWA 2FHYA 1IMFA 4P8BA 4PC9A 5ET7A 3W9WA 4PFRA 4N8GA 2P3VA 1NUYA 2XA5A 5DW8A 4PBHA 3CHGA 1VDWA 1DK4A 1INPA 4GBVA 2F3BA 4F1UA 3BIHA 2QFLA 5JK4A 5A5LA 3E78A 2Q74A 4NX1A 4XEQA 4I40A 1YXIA 4PGNA 2PFYA 3B50A 1LBYA 4MHFA 1RDZA 2MKZA 2QVRA 3IFAA 3RYDA 5IZ1A 4O8MA 2XXKA 1RDXA 1SPIA 4N4UA 3ROJA 4P47A 1IMBA 4P3LA 2PCRA 1RDYA 5IGAA 1NV1A 2ZZWA 2PFZA 2QVUA 4N8YA 3EKIA 1FBEA 4MIJA 1FTAA 4OVRA 2CZIA 3IFCA 1FBDA 5EYGA 4M1VA 1FBCA 3B8BA 1FBGA 4PBQA 3D1RA 4OVSA 4MX6A 4X8RA 4NGUA 5LTCA 1FBFA 4H45A 1FBPA 5EQ7A 1G0HA 2JJKA 4P1EA 4MNIA 5IZ3B 2FBPA 5EQAA 4JVDA 4PAFA 3FXBA 2XWVA 4MJOA 1KA0A 2L5VA 1IMAA 1FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI9 A;  1FPI A;  1EYK A;  4GX6 A;  1NUW A;  1KZ8 A;  2FHY A;  1FSA A;  1IMF A;  4QXD A;  5ET7 A;  3LV0 A;  2DDK A;  5EYH A;  1DBZ A;  2R8T A;  2P3V A;  1NV6 A;  2P3N A;  1NUY A;  4IR8 A;  5DW8 A;  4HXV A;  1IMD A;  1XI6 A;  3T0J A;  1VDW A;  4GWS A;  2FIE A;  2OX3 A;  1DK4 A;  4AS5 A;  1INP A;  1FPL A;  1LBV A;  4GBV A;  1K9Y A;  2F3B A;  1NV7 A;  3BIH A;  1IMC A;  4GBW A;  2QFL A;  4O7I A;  1NV4 A;  5A5L A;  1NV5 A;  2Q74 A;  2CZH A;  4I40 A;  1YXI A;  5EQ8 A;  1FBH A;  1YZ0 A;  4I3Y A;  2BJI A;  4GWX A;  2WEF A;  5I3S A;  1LBY A;  2FIX A;  5EQ9 A;  1RDZ A;  4FBP A;  1BK4 A;  2QVR A;  2OWZ A;  3IFA A;  3RYD A;  1NUZ A;  1NV0 A;  2Y5L A;  2GQ1 A;  5IZ1 A;  1FPD A;  2Q8M A;  2VT5 A;  1K9Z A;  4GX3 A;  3FBP A;  1RDX A;  1SPI A;  3KC1 A;  4HE0 A;  5ET8 A;  1NV2 A;  2F3D A;  3ROJ A;  1QGX A;  2HHM A;  1IMB A;  1NV3 A;  1FPJ A;  2PCR A;  2QVV A;  4AS4 A;  1RDY A;  1FJ6 A;  1LBZ A;  1NV1 A;  1AWB A;  4GX4 A;  4GWW A;  5J16 A;  1CNQ A;  3RPL A;  5ESY A;  4I3E A;  4PTK A;  3LUZ A;  1FRP A;  1DCU A;  2QVU A;  5F24 A;  1FBE A;  1Q9D A;  1D9Q A;  1FPG A;  1FPB A;  3KBZ A;  3A29 A;  1FTA A;  3BIG A;  3QMF A;  1EYJ A;  2WBD A;  2CZI A;  1LBW A;  3IFC A;  4GWU A;  5IZ3 A;  1FPE A;  1FBD A;  4N81 A;  5ET5 A;  5EYG A;  1FBC A;  3B8B A;  1NUX A;  1FBG A;  2FVZ A;  3D1R A;  4KXP A;  1JP4 A;  5ET6 A;  2Y5K A;  3KC0 A;  3RPL B;  2WBB A;  1LBX A;  1FBF A;  1FPF A;  4H45 A;  1FBP A;  4H46 A;  5EQ7 A;  1G0H A;  2JJK A;  5LDZ A;  4HE1 A;  5FBP A;  1IME A;  1FPK A;  2CZK A;  5IZ3 B;  1IMA A;  2FBP A;  4GWZ A;  5EQA A;  1EYI A;  4GWY A;  4MJO A;  1KA0 A;  1G0I A;  1KA1 A;  4G61 A;  1YYZ A;  1LEV A;  1FJ9 A;  5T3J A;  4HE2 A; 
#chains in the Genus database with same CATH topology
 3MWB A;  3MVX A;  2UYE A;  1NNK A;  2Z8E A;  1TFD A;  4Q30 B;  4GL0 A;  2UVG A;  1BIY A;  4QHQ A;  4OES A;  3O97 A;  3IB0 A;  4R74 A;  3K00 A;  4ZE8 A;  2Q2A A;  3MZB A;  2REG A;  2CZH A;  2ONK E;  4DDD A;  2H25 A;  5AA4 B;  1Y1M A;  5A5X A;  2H9B A;  4I62 A;  5EQ9 A;  5CM6 A;  2AIX A;  1PEB A;  3KN8 A;  4N6D A;  1EH3 A;  1FPD A;  3KC1 A;  3KJ7 A;  3VLV A;  3O29 A;  2DVZ A;  5HBC A;  1B4Z A;  4ELR A;  1MY4 A;  3LBS A;  1SW4 A;  2I0C A;  4DI3 D;  4PTK A;  5F24 A;  1B5J A;  4F1V A;  3IL1 B;  2HQ0 A;  3T1B A;  1I6A A;  4R6Y A;  3K2D A;  3FV1 A;  2H98 A;  5I57 B;  5H8S A;  4PE3 A;  5ITO A;  4YB5 A;  1A7L A;  5I58 B;  2DXY A;  2XX8 A;  1LBX A;  1FTK A;  2V3U A;  5I59 B;  1JET A;  2ZYN A;  3UGW A;  1MXV A;  4IGR A;  1IXG A;  3OO7 A;  4HE1 A;  3IO6 A;  1IME A;  3Q25 A;  1P1N A;  3EHT A;  1B40 A;  4FIM A;  4GWY A;  3OSQ A;  4GLI A;  3K01 A;  5M2V A;  2QL3 A;  5L8D A;  3G3F A;  5I2N A;  4FEB A;  1B7H A;  3T9H B;  4P56 A;  1FSA A;  2A5T B;  3OD7 A;  2QMX A;  1Z7N E;  1AIV A;  5KDT A;  1ANF A;  1VR5 A;  1LBV A;  5H8F A;  1NV4 A;  4HS7 A;  2QS2 A;  3FVN A;  5EQ8 A;  5AA1 A;  4L17 A;  1B1H A;  1YCJ A;  4NF4 A;  3ZKK A;  1O63 A;  4RK9 A;  1UIU A;  2CMO A;  2HPG A;  5TPA A;  3MYU A;  3THI A;  3FVK A;  4LZ8 A;  5ET8 A;  1NV2 A;  1TXF A;  2QVV A;  3CR9 A;  1UQW A;  4DXU A;  4KYS A;  1SD3 A;  1XHY A;  2DOJ A;  4JDF A;  1UTB A;  1FPB A;  3A29 A;  4LZ5 A;  3U93 A;  2DS9 A;  4R9F A;  2O1M A;  1FQC A;  3JYR A;  2XWO A;  3TPA A;  1B2H A;  1JVX A;  2Y7P A;  3M3F A;  3KOS A;  4EXK A;  4POW A;  4U4X A;  1SW5 A;  4KCD A;  3A3C A;  4O3C A;  3SEV A;  4P0G A;  1B3G A;  4KI0 E;  3EN3 A;  1NI9 A;  1EYK A;  1JVY A;  4QXD A;  4Q0C A;  2F5X A;  4G8H A;  1IMD A;  4OVQ A;  4AS5 A;  1LAH E;  3G7W A;  4XFE A;  3MC2 A;  1DMB A;  4NF6 A;  4ZDM A;  4NED A;  4EQ7 A;  1N7X A;  4PF8 A;  3MAM A;  3G3J A;  4ESX A;  5IKB A;  2HFB A;  1RKM A;  4ZZE A;  1II5 A;  1GR2 A;  3H03 A;  4ZS9 A;  4OWD A;  2XXV A;  2O68 A;  4GX3 A;  4HE0 A;  3JZJ A;  1QGX A;  1HSJ A;  2RIN A;  4EXL A;  2UVH A;  4ZEI A;  4O7M A;  1FJ6 A;  4GFR A;  3TQW A;  2DWJ A;  4ZZA A;  4I3E A;  1FQA A;  1D9Q A;  4KYE A;  5B7D A;  2ONS A;  3MVW A;  2CEY A;  4N13 A;  2RKM A;  4HCY A;  4N6K A;  1BLF A;  3H6U A;  1FQB A;  1NUX A;  5JTY B;  5L9S A;  1XOC A;  3RPL B;  2XXI A;  5I5P A;  4GQO A;  1I6B A;  1ZMG A;  3S9M C;  2WYP A;  1P99 A;  2CZK A;  4P1L A;  4XKQ A;  1WDN A;  4G61 A;  5TU0 A;  4NAP A;  2KR0 A;  2Z22 A;  4RA1 A;  4PGP A;  5AA2 D;  1NUW A;  1Y3P A;  5DEX B;  1IIT A;  3PPR A;  4N8G A;  4DCY A;  4EQB A;  3FVG A;  2XA5 A;  1PB9 A;  4DXC A;  1VDW A;  4ZE9 A;  2NWJ A;  4DCX A;  4F1U A;  2ESN A;  3MW0 A;  5A5L A;  5K2X A;  2Q74 A;  3W15 C;  1OIB A;  3MVZ A;  3VE1 B;  4KHZ E;  2HEU A;  1FQD A;  2REJ A;  4LA9 A;  2UVI A;  1MRP A;  3H6W A;  5DVF A;  1SVX B;  4YKJ A;  1RDX A;  4F29 A;  1MXU A;  2CZL A;  4RYA A;  1NFT A;  2PCR A;  1ATG A;  1B7Z A;  1DPE A;  4LON B;  4F22 A;  1SW1 A;  4TLL B;  3BKI B;  3EKI A;  2XX9 A;  2F78 A;  1MQG A;  2GHA A;  3H06 B;  5HPQ A;  1B9J A;  2PT2 A;  4U21 A;  1FBD A;  4FEC A;  1GV8 A;  3B8B A;  2ZYO A;  3IX1 A;  3T9U A;  4QF9 A;  3D1R A;  3T9X B;  4BDM A;  4MX6 A;  3L6G A;  3MP6 A;  2O7U A;  4Z7E A;  3RGY A;  1FBF A;  4H65 A;  4LQ2 A;  3OXN A;  2JJK A;  3ILT B;  1NL5 A;  4F3P A;  1TWY A;  4ISU A;  3QIM A;  3N6T A;  4R2B A;  2VOZ A;  1Q1K A;  2XHD A;  4R75 A;  5EQA A;  3O6G A;  3K1P A;  2DVC A;  1B5I A;  5TP9 B;  3ONM A;  4JVD A;  4PAF A;  2HAU A;  4MJO A;  3HCQ A;  4YB6 A;  2GRV A;  3CI8 A;  1NNP A;  4GX6 A;  2Q9T A;  3BBR A;  4R6K A;  3IR1 A;  2VPN A;  1A55 A;  1IUD A;  2A5S A;  1PDA A;  4YMA A;  4QBA A;  1LFG A;  2XXX A;  1IMC A;  1H43 A;  4R2F A;  1USY E;  3SEW A;  5L9M A;  1M5C A;  5ITP A;  3FV2 A;  3H6V A;  4PFI A;  2OZZ A;  4H1X A;  3RT6 B;  3OEL A;  3HPI A;  4NWC A;  3SEU A;  4JSD A;  3RPW A;  3TCG A;  4JWY A;  3G3K A;  2I6E A;  2V3T A;  4WXJ A;  2H4I A;  4U1O A;  4XKP A;  2O84 X;  3CVG A;  2QS3 A;  1B46 A;  4PFY A;  4F19 A;  4OEU A;  1S7Y A;  1FTJ A;  4GD5 A;  3EQ1 A;  1MPB A;  3K4U A;  5H8N B;  4U1Z A;  1CNQ A;  4ELP A;  2Q89 A;  1B51 A;  4XKR A;  1P1Q A;  1Q9D A;  5FHO A;  2Y7I A;  4NMY A;  4X04 A;  1R6Z A;  1YTV A;  3TKD A;  1NNF A;  4R9G A;  3M3L A;  5F1Q A;  4GXA A;  5I2K A;  3TUS A;  4F3B A;  3Q29 A;  5AA2 B;  3L6H A;  4N07 A;  2QS4 A;  4E0X A;  3LSF B;  4BDN A;  2XXP A;  4POX A;  1N3X A;  4LP2 B;  1N3W A;  4H67 A;  4AB5 A;  2Z8F A;  1USY H;  1FTO A;  1QKB A;  1P1U A;  1LEV A;  3HV1 A;  2X7P A;  3FXQ A;  1H44 A;  1NH8 A;  3QUF A;  3ZS6 A;  4OZ9 A;  3MST A;  1B52 A;  1VSO A;  1NV6 A;  1D3K A;  4XIG Q;  1K9Y A;  1H45 A;  4JVC A;  1PBP A;  4IO5 A;  1Y4T A;  1US5 A;  2BJI A;  2V84 A;  4I8C A;  1LAG E;  2ZZX A;  1QVS A;  3IOU A;  1B58 A;  3TAJ A;  4WEP A;  3V8X B;  2WX9 A;  3VLU A;  4C0R A;  3E79 A;  3FJG A;  4N17 A;  4P9K A;  3U1O A;  2IEE A;  3RTW B;  2VT5 A;  3PTY A;  4OA4 A;  2D21 A;  3TTL A;  3PUY E;  1B3H A;  4O3B A;  1NV3 A;  1FPJ A;  4PAI A;  5CMM A;  3OMB A;  4FAT A;  3U65 A;  5DYH A;  3O66 A;  1FTM A;  2DWI A;  4IO3 A;  3TTR A;  4THI A;  4ELQ A;  2GH9 A;  2DE3 A;  3BFT A;  2RC8 A;  3K0V A;  3KBZ A;  3BIG A;  1AMF A;  2XXQ A;  4F2Q A;  2QRY A;  4GRK A;  5ICQ A;  5ET5 A;  5H8H B;  2CEX A;  2OJT A;  4KFQ A;  3O9P A;  2F6P A;  2XXU A;  3BFU A;  2GFE A;  1B1X A;  3MUQ A;  5AA3 A;  3MPK A;  3IOV A;  3TCH A;  5J1D A;  4NN3 A;  4G2Z A;  3B6T A;  4ESW A;  2F35 A;  1CB6 A;  4ZEC A;  2HZL A;  3E13 X;  4G4P A;  5EYF A;  4OYV A;  4NF8 B;  2I4C A;  1JEV A;  3IJO B;  2HZK A;  2FYI A;  4R72 A;  3N94 A;  4OTE A;  4KQP A;  2P3N A;  3LUY A;  4RJZ A;  4PET A;  4O94 A;  4WED A;  5I56 B;  1JW5 A;  3DP4 A;  2THI A;  5H8Q B;  3PPN A;  1LLS A;  2YJP A;  2HAV A;  2UYF A;  4TOZ A;  4BDQ A;  3PPP A;  1B7U A;  4LUB A;  5K2Y A;  4FOR A;  4OVJ A;  1A54 A;  4G77 A;  2AL5 A;  2Y5L A;  3E4R A;  2B4M A;  4JBZ A;  3FBP A;  1FTL A;  2FA7 A;  4NF5 A;  2OPD A;  1B5H A;  3VV5 A;  1DTG A;  4H8I A;  1QUJ A;  3H3G A;  2ZMB A;  5IZZ A;  1LBZ A;  3R6U A;  4GX4 A;  2G29 A;  1AH5 A;  1IXC A;  5ESY A;  4H5F A;  2F97 A;  5DVI A;  1Z7M E;  3HFU A;  4RK2 A;  3S9E A;  1FPG A;  4JB7 A;  4DLD A;  5KCJ B;  5LOM A;  3MZ1 A;  5L9O A;  3HO7 A;  3C9H A;  2Y5K A;  2YLN A;  5HM4 B;  4BDL A;  5JEI A;  3TOD A;  5FBP A;  1UTH B;  2QPQ A;  1EU8 A;  4DZ1 A;  4GWO A;  3OSR A;  2Y7K A;  1YPN A;  2VGQ A;  5CC2 A;  4HE2 A;  1LBC A;  2DWA A;  2XWK A;  3QYT A;  2LAO A;  3G3G A;  5ET7 A;  1GGG A;  4Z0I A;  5AA4 A;  2P3V A;  5B70 A;  1MH3 A;  5DW8 A;  3QSL A;  3QAX A;  2X7Q A;  3BIH A;  4QFL A;  2QFL A;  1MY0 A;  2FNC A;  4XEQ A;  3O2A A;  4F31 B;  4PGN A;  3PMW A;  2NVU B;  4U2R A;  1URG A;  3PU5 A;  4MHF A;  2MKZ A;  3R7X A;  1OVT A;  1LB9 A;  4QFN A;  4F39 A;  3IOW A;  2I4B A;  3FAS A;  4TLM B;  2XXK A;  4G68 B;  1SPI A;  3DLN A;  1KWH A;  3SEX A;  5I57 A;  2ZXT A;  2PX1 A;  4KR5 A;  3UN6 A;  1JW4 A;  3LR1 A;  4UA8 A;  5I58 A;  1ZIU A;  5IAI A;  1MXX A;  3IK6 B;  5I59 A;  1TT1 A;  4U4S A;  3C31 A;  2Y84 A;  1OLA A;  2AYS A;  1NMU A;  3V89 B;  2CZI A;  2UVJ A;  3LSX A;  3IFC A;  1QUI A;  3EHS A;  1FBC A;  4GOT A;  4ECF A;  1FBG A;  4PBQ A;  1N04 A;  4NGU A;  1LBB A;  4ND9 A;  5LTC A;  3A09 A;  2ZYM A;  2PMS A;  5EQ7 A;  1XVY A;  2A5T A;  2KLF A;  1BTJ A;  4G8N A;  5IZ3 B;  1B3F A;  4G68 C;  4IO4 A;  3H7M A;  1FJ9 A;  1B3E A;  2VPO A;  2HXR A;  3TZA A;  2XWI A;  2XXT A;  4PE5 B;  4X9T A;  3IAZ A;  3T0J A;  4IY5 A;  1ELJ A;  2FIE A;  3MPL A;  3QUJ A;  4OET A;  2H5Y A;  4RXL A;  3N26 A;  4NTL A;  5DTB A;  1IXH A;  4FJP A;  4YKP A;  3KGC A;  1MQD A;  5I3S A;  5BWJ A;  1B4H A;  3DP8 A;  1B6H A;  4N15 A;  1B0L A;  2XXY A;  2OWZ A;  3O6I A;  1IQ7 A;  1NV0 A;  1Q35 A;  4PDH A;  4Q8R A;  1EZ9 A;  3GBA A;  2I48 A;  3P7I A;  3R26 A;  1SI0 A;  4GWW A;  1S50 A;  1JQF A;  3LUZ A;  4IGT A;  4H0W A;  3TMG A;  2XXW A;  3QK6 A;  3QMF A;  2WBD A;  2RCB A;  3PUW E;  4RNS A;  2FVZ A;  3FAT A;  4H5G A;  2Q88 A;  3M3K A;  2G93 A;  1SBP A;  3E9X A;  4OFJ A;  2F36 A;  3PPQ A;  4MH5 A;  1XVX A;  4UAB A;  1EYI A;  5CI5 A;  3KEI A;  3FIR A;  1BP5 A;  4OVT A;  3OEM A;  4KXP A;  4UAC A;  4OQO A;  3KN7 A;  4RPO A;  2DDK A;  1N84 A;  4XXU A;  4U23 A;  3PUZ E;  4NHB A;  2F6G A;  3PUV E;  4G8M A;  3PMV A;  2F34 A;  3H4Z A;  3K6U A;  4P11 A;  1I6Q A;  2Y7W A;  2OWT A;  1FBH A;  2ANJ A;  3FJ7 A;  1VFD A;  2XD3 A;  4BLA A;  1FW0 A;  4PF6 A;  4JWO A;  3M8U A;  3EPE A;  3FGS A;  2O69 A;  4OFO A;  2Q8M A;  4F1Y A;  4QFO A;  2F3D A;  5A5X B;  1QUL A;  4TQU Q;  4OEV A;  5JTY A;  3IJX B;  3U92 A;  4LVQ A;  3OEK A;  3RPL A;  3FXR A;  2GHB A;  1FRP A;  3ZSF A;  3LSL A;  1PB7 A;  1XC1 A;  2PT1 A;  4YMB A;  1A40 A;  5CMB A;  4JWX A;  1LBW A;  3CFX A;  1Y3Q A;  3FJM A;  2F8D A;  3MJN A;  1P1W A;  5FHN A;  1D9V A;  3VXB A;  3T96 B;  4MCO A;  3IOT A;  1XS5 A;  4NG7 A;  1ZJL A;  3MP1 A;  3MBP A;  3TTM A;  1T0K A;  3KN3 A;  1QJM A;  4KPT A;  1LAF E;  1FPF A;  4H46 A;  3HST A;  3PD9 A;  5DEX A;  3TCF A;  4FAJ A;  1FQF A;  3F11 A;  5LDZ A;  3DM0 A;  1FPK A;  2PYY A;  1O64 A;  5DVJ A;  4MNP A;  3MP8 A;  3RT8 A;  3K1N A;  3WAE A;  1VE4 A;  4MNC A;  4YIC A;  1OQG A;  2V93 A;  3TFL A;  3LV0 A;  3KSX A;  3K1M A;  1DBZ A;  2HXW A;  2B4L A;  1M5D A;  3K6V A;  2KQZ A;  1IEJ A;  3GLB A;  1XI6 A;  1GVC A;  4DXB A;  1SYH A;  1R1N A;  2RF1 A;  5ICT A;  4GBW A;  2Q8J A;  4PFU A;  2UXA A;  1ZTY A;  5I2N B;  3T9V A;  1MH4 A;  2YPN A;  4F3G A;  3PV0 E;  3SKP A;  1QW0 A;  3NOH A;  1MXY A;  3MVY A;  5KDT B;  3C36 A;  1JEU A;  4LZ7 A;  5H8F B;  3AXF A;  2XX7 A;  1MY1 A;  4PDD A;  3VDF A;  3VVD A;  1K9Z A;  1XT8 A;  1H76 A;  2I3W A;  3PMX A;  1ZBM A;  3C4M A;  1YAE A;  4NF4 B;  4MMP A;  4WKM A;  1AWB A;  4PFB A;  4H8J A;  1DCU A;  3OO8 A;  5TPA B;  1N0T A;  4N91 A;  4QRZ A;  3SEY A;  2ZNU A;  4C1U A;  2ZNT A;  2R71 A;  4GWU A;  3VVF A;  4N81 A;  3QXM A;  5TP9 A;  4EDP A;  2VP1 A;  4YZZ A;  1H3D A;  1EZP A;  5ET6 A;  3IO4 A;  4OVP A;  1UTB B;  1PBQ A;  4IO6 A;  3W9V A;  3VLW A;  2QJE A;  3UP9 A;  5FTH A;  4MF3 A;  1G0I A;  1JNF A;  2F7A A;  4KD5 A;  4NF0 A;  2OCU A;  3SET A;  1B0H A;  4P8B A;  4PC9 A;  3W9W A;  4I1D A;  4PFR A;  4F2O A;  3KJT A;  4PBH A;  2PVU A;  4IB2 A;  4RPN A;  1DK4 A;  3MZ9 A;  4GBV A;  3S4U A;  1PC3 A;  1MM6 A;  1MQI A;  3E78 A;  1LCF A;  1NNT A;  1YXI A;  3DEL B;  2B65 A;  1TFA A;  1RDZ A;  3S2V A;  5H8N A;  1UIV A;  3IFA A;  2O6A A;  4NF6 B;  5IZ1 A;  3VXC A;  4OXV A;  1A8F A;  3ROJ A;  3OEN A;  4P47 A;  5BUU A;  1IMB A;  4P3L A;  2OK2 A;  3Q26 A;  4MFI A;  5IGA A;  1NV1 A;  5EHS A;  3FZV A;  2ZZW A;  5AA2 A;  3U72 A;  2QMW A;  2PFZ A;  4N8Y A;  3TEL A;  3TTN A;  3VVE A;  4MIJ A;  3HHG A;  1FTA A;  2ALU A;  5EYG A;  3EF7 A;  3S9N C;  3FXU A;  3DP6 A;  1MY3 A;  2Q2C A;  3I6V A;  3RTF B;  1SYI A;  3K02 A;  4H45 A;  3K6X A;  3TEP A;  1SDX A;  4X1B A;  1L5T A;  1G0H A;  1ZLQ A;  4PQJ A;  2FBP A;  3PD8 A;  3TYH A;  1QKA A;  3FXB A;  4BDO A;  3Q28 A;  1LFH A;  1Y1Z A;  4PFW A;  2I49 A;  1R9L A;  1FPI A;  3C35 A;  1MPD A;  3K6W A;  2NUV A;  5EYH A;  2F7C A;  2R8T A;  3ISP A;  1IIW A;  1MM7 A;  3V83 A;  1NV7 A;  2PBW A;  4GIZ A;  3RY3 A;  2NOO A;  1NV5 A;  3KZG A;  4IO2 A;  1S9T A;  1MXW A;  3O6H A;  4GWX A;  5I84 A;  2WEF A;  1D9Y A;  3FVO A;  4X48 A;  3T66 A;  2R9J A;  1D4N A;  4DIG A;  4EQ9 A;  4KYD A;  1HSE A;  5FTI A;  3IB1 A;  1IZ1 A;  2GQ1 A;  1LFI A;  1B32 A;  3C33 A;  5EHM A;  5ELV A;  3SZP A;  4O3A A;  1SW2 A;  4JSO A;  2I3V A;  3D4C A;  2XXH A;  2X26 A;  3FUZ A;  5H8H A;  4AS4 A;  2O1L A;  1AL3 A;  3N6U A;  2DYX A;  3O28 A;  4GXS B;  5I7I A;  2ABH A;  3SER A;  3U8Q A;  3UIF A;  1WOD A;  1FPE A;  3D4G A;  3N5L A;  3B6Q A;  4JVI A;  4OHN A;  5DT6 A;  3G3I A;  4NF8 A;  3CFZ A;  3PUX E;  4KCC A;  4OER A;  4YU0 A;  4R73 A;  4HCW A;  5I56 A;  2DQV A;  1BKA A;  5H8Q A;  3ILU B;  1KA1 A;  3G3H A;  1YYZ A;  4MEV A;  1OMP A;  1MDP 1;  1LCT A;  2D3I A;  1MS7 A;  4ELO A;  3ECR A;  3WAF A;  4GVO A;  4IR8 A;  2P1S A;  4HXV A;  4XTC Q;  4IO7 A;  3ODB A;  1FPL A;  2O7I A;  3CFL A;  3GYY A;  1M5F A;  3TQL A;  4O7I A;  1GTK A;  4OFL A;  2E1S A;  1NH7 A;  3OO9 A;  2Z23 A;  3CSG A;  4I3Y A;  4GF8 A;  2FIX A;  2XXR A;  3SDF A;  4FBP A;  4DI4 B;  1BK4 A;  1RYX A;  3CG1 A;  1QUK A;  3T93 B;  3KFM A;  3E3K A;  1NUZ A;  3TDJ A;  3LC8 A;  3I3V A;  2M8C A;  1EZO A;  3CG3 A;  5KCJ A;  1HSL A;  4PAK A;  2D5W A;  4AQ4 A;  2HHM A;  1J1N A;  4HTG A;  3OO6 A;  4NE4 A;  3CIJ A;  2Z8D A;  2WYK A;  5J16 A;  3HN0 A;  3IB2 A;  4N6P A;  3B7D A;  5CRY A;  4OMB A;  1LB8 A;  4MAG A;  1A8E A;  4PFT A;  5CMC A;  1UTH A;  2RCA A;  3RQT A;  1LAX A;  1OVB A;  3KSJ A;  3HHF A;  1DTZ A;  5CBS A;  1JW1 A;  3MQ9 A;  1FCK A;  2WBB A;  1MQH A;  2ZYK A;  1FQE A;  3GXA A;  2ONR A;  1OQH A;  1F9B A;  1MQJ A;  3TTK A;  4EF2 A;  2NXO A;  5I2K B;  4MLV A;  1MY2 A;  1PB8 A;  5T3J A;  1POY 1;  5KZT A;  2V4C A;  1KZ8 A;  1O7T A;  1MPC A;  3U94 A;  4LAT A;  4FE8 A;  2H99 A;  3UA8 A;  1OLC A;  4X1D A;  4GWS A;  4M4G A;  2OX3 A;  1R9Q A;  5IM2 A;  2DE2 A;  4ZED A;  4YKK A;  4ONY A;  3PGF A;  4PCD A;  4P0I A;  1URS A;  4QFP A;  4G68 A;  2XD2 A;  1Y3N A;  1YZ0 A;  1ZKB A;  3ZKL A;  4QSE A;  2BJJ X;  4IY6 A;  3UK4 A;  1DPP A;  2W7Y A;  4OAN A;  3I5O A;  3USD A;  5F7V A;  1CE2 A;  4HW8 A;  4XF5 A;  3GZG A;  1N76 A;  4ZEB A;  3RUM A;  4LN5 A;  2VHA A;  3RNN A;  5AE4 A;  1NKX A;  3CRB A;  4H6D A;  4QFK A;  3PPO A;  3H6T A;  4NQ8 A;  3B6W A;  2IA4 A;  2DXR A;  1M5E A;  4U22 A;  2OLB A;  2I0B A;  3C32 A;  1EYJ A;  1Y20 A;  4YB7 A;  5IZ3 A;  2E0S A;  2ZZV A;  4ZEF A;  4F18 A;  2P2A A;  5ISU A;  1SQY A;  1LST A;  1JP4 A;  3KC0 A;  2DSF A;  2V25 A;  4QSC A;  2DE4 A;  4NWD A;  1I69 A;  1B05 A;  2OBG A;  3RN8 A;  3KOT A;  2VD3 A;  1A99 A;  2OWS A;  4GWZ A;  2HCA A;  2F7B A;  1WVJ A;  4MBP A;  1MG1 A;  2RC7 A;  2V3Q A;  2FHY A;  4QSD A;  1IMF A;  2R6G E;  2WKY A;  1DOT A;  1NUY A;  4E0W A;  3CHG A;  1Y9U A;  1INP A;  3SES A;  3KBR A;  2F3B A;  5JK4 A;  4AB6 A;  3Q27 A;  4NX1 A;  4EF1 A;  4I40 A;  2DWH A;  1MDQ A;  2I58 A;  4R6H A;  3KG2 A;  2PFY A;  3B50 A;  1LBY A;  1AOV A;  3VFJ A;  4YKI A;  2QVR A;  4F3S A;  4YAH X;  2B3F A;  5CMK A;  1DSN A;  3RYD A;  2DP8 A;  3CSB A;  4GL8 A;  4MLQ A;  3IOR A;  3OOA A;  3FD3 A;  4O8M A;  3RLF E;  4OEN A;  2P0S A;  4N4U A;  2VD2 A;  5CBR A;  4JXI A;  4RY1 A;  3JV9 A;  2QSX A;  4PP0 A;  1MXZ A;  1RDY A;  3V5A A;  1P1O A;  1Y4C A;  4C1T A;  4ZEK A;  4XKN A;  2QVU A;  4DE8 A;  4Q5T A;  1FBE A;  1RYO A;  4K3F A;  4I9D A;  4NF5 B;  4OVR A;  1VFE A;  2O51 A;  2RC9 A;  2Y7R A;  1M5B A;  1N7W A;  4M1V A;  3GBB A;  2OPE A;  1LGB C;  4BDR A;  4OVS A;  4X8R A;  2QS1 A;  4EUO A;  1US4 A;  4LQ5 A;  3T22 A;  2B3B A;  1FBP A;  3EHU A;  3C34 A;  1URD A;  1IXI A;  5FHM A;  3LSW A;  4P1E A;  3S9L C;  4MNI A;  2AL4 A;  3A3U A;  1POT A;  1B3L A;  1ZU0 A;  1SI1 A;  4FED A;  2XWV A;  1KA0 A;  2L5V A;  3UOR A;  1IMA A;  2ZNS A; 
#chains in the Genus database with same CATH homology
 1FPI A;  2VPO A;  4GX6 A;  2Q9T A;  2HXR A;  2XWI A;  2VPN A;  4X9T A;  5EYH A;  2R8T A;  3ISP A;  3T0J A;  2FIE A;  4QBA A;  1NV7 A;  1IMC A;  1NV5 A;  2CZH A;  4PFI A;  4GWX A;  2WEF A;  5I3S A;  5EQ9 A;  5CM6 A;  4N15 A;  2OWZ A;  4N6D A;  1NV0 A;  2GQ1 A;  1FPD A;  4PDH A;  3SZP A;  4F19 A;  3KC1 A;  2DVZ A;  4AS4 A;  4GWW A;  1CNQ A;  4DI3 D;  4PTK A;  3LUZ A;  5F24 A;  1Q9D A;  4F1V A;  4X04 A;  3QMF A;  3T1B A;  5I7I A;  2WBD A;  1FPE A;  4PE3 A;  2FVZ A;  4JVI A;  1LBX A;  4HE1 A;  1IME A;  4HCW A;  4UAB A;  1EYI A;  4GWY A;  1KA1 A;  4OVT A;  1YYZ A;  1LEV A;  4KXP A;  4MEV A;  1FSA A;  4P56 A;  2DDK A;  3MST A;  1NV6 A;  4NHB A;  4IR8 A;  4HXV A;  1FPL A;  1LBV A;  1K9Y A;  3GYY A;  4O7I A;  1NV4 A;  4JVC A;  5EQ8 A;  1FBH A;  4I3Y A;  2BJI A;  2FIX A;  2ZZX A;  4PF6 A;  4FBP A;  4DI4 B;  1BK4 A;  2WX9 A;  3E79 A;  2HPG A;  4N17 A;  1NUZ A;  4P9K A;  2Q8M A;  3MYU A;  2VT5 A;  3PTY A;  4PAK A;  5ET8 A;  4OA4 A;  1NV2 A;  2F3D A;  2HHM A;  1NV3 A;  1FPJ A;  4PAI A;  2QVV A;  3U65 A;  2WYK A;  5J16 A;  3RPL A;  1FRP A;  2DE3 A;  4MAG A;  1FPB A;  3KBZ A;  3A29 A;  3BIG A;  1LBW A;  5ET5 A;  2XWO A;  2CEX A;  4MCO A;  4NG7 A;  2WBB A;  1FPF A;  4H46 A;  5J1D A;  5LDZ A;  4NN3 A;  1FPK A;  4MNP A;  2HZL A;  5T3J A;  1NI9 A;  1EYK A;  4MNC A;  2V4C A;  4YIC A;  1KZ8 A;  4QXD A;  2HZK A;  3LV0 A;  2F5X A;  1DBZ A;  2B4L A;  2P3N A;  4PET A;  4O94 A;  2KQZ A;  1IMD A;  1XI6 A;  4GWS A;  4OVQ A;  2OX3 A;  4AS5 A;  5IM2 A;  4XFE A;  2DE2 A;  4GBW A;  4PCD A;  4PF8 A;  1YZ0 A;  3NOH A;  4OAN A;  4XF5 A;  2Y5L A;  4PDD A;  2B4M A;  1K9Z A;  4GX3 A;  3FBP A;  4LN5 A;  4HE0 A;  1QGX A;  4NQ8 A;  4O7M A;  5IZZ A;  1FJ6 A;  1LBZ A;  4MMP A;  1AWB A;  4GX4 A;  4PFB A;  5ESY A;  4I3E A;  1DCU A;  3HFU A;  4N91 A;  1D9Q A;  1FPG A;  2CEY A;  1EYJ A;  4HCY A;  4N6K A;  4GWU A;  5IZ3 A;  2ZZV A;  4N81 A;  1NUX A;  4F18 A;  4YZZ A;  1JP4 A;  5ET6 A;  2Y5K A;  3KC0 A;  3RPL B;  4OVP A;  2DE4 A;  5I5P A;  3W9V A;  5FBP A;  2QPQ A;  2WYP A;  2CZK A;  4P1L A;  4GWZ A;  1G0I A;  4G61 A;  2V3Q A;  4NAP A;  4HE2 A;  2KR0 A;  4NF0 A;  2XWK A;  4PGP A;  1NUW A;  2FHY A;  1IMF A;  4P8B A;  4PC9 A;  5ET7 A;  3W9W A;  4PFR A;  4N8G A;  2P3V A;  1NUY A;  2XA5 A;  5DW8 A;  4PBH A;  3CHG A;  1VDW A;  1DK4 A;  1INP A;  4GBV A;  2F3B A;  4F1U A;  3BIH A;  2QFL A;  5JK4 A;  5A5L A;  3E78 A;  2Q74 A;  4NX1 A;  4XEQ A;  4I40 A;  1YXI A;  4PGN A;  2PFY A;  3B50 A;  1LBY A;  4MHF A;  1RDZ A;  2MKZ A;  2QVR A;  3IFA A;  3RYD A;  5IZ1 A;  4O8M A;  2XXK A;  1RDX A;  1SPI A;  4N4U A;  3ROJ A;  4P47 A;  1IMB A;  4P3L A;  2PCR A;  1RDY A;  5IGA A;  1NV1 A;  2ZZW A;  2PFZ A;  2QVU A;  4N8Y A;  3EKI A;  1FBE A;  4MIJ A;  1FTA A;  4OVR A;  2CZI A;  3IFC A;  1FBD A;  5EYG A;  4M1V A;  1FBC A;  3B8B A;  1FBG A;  4PBQ A;  3D1R A;  4OVS A;  4MX6 A;  4X8R A;  4NGU A;  5LTC A;  1FBF A;  4H45 A;  1FBP A;  5EQ7 A;  1G0H A;  2JJK A;  4P1E A;  4MNI A;  5IZ3 B;  2FBP A;  5EQA A;  4JVD A;  4PAF A;  3FXB A;  2XWV A;  4MJO A;  1KA0 A;  2L5V A;  1IMA A;  1FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...