2WEKA

Crystal structure of the human mgc45594 gene product in complex with diclofenac
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
341
structure length
341
Chain Sequence
SMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Mgc45594 Gene Product in Complex with Diclofenac
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ZINC-BINDING ALCOHOL DEHYDROGENASE DOMAIN-CONTAINING PROTEIN
total genus 118
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2wekA01
3S55A 3VVCA 2D5CA 3N58A 3PXXA 4KTVE 4BMSA 1AHIA 4DREA 1YKFA 1A9YA 3BMNA 1B8PA 4GX1A 5KTKA 4BKOA 1OMOA 1T26A 1QR6A 4IMRA 2O3JA 1HLDA 3ROPA 4BNGA 1PJSA 1DFGA 1ZK4A 5HA5A 5T67A 3KEQA 3DOCA 4D3SA 1LRLA 1YOVA 1ZFNA 3MEQA 1HDRA 3DBLB 1DXYA 1KIFA 1YJ8A 3WJ7A 2XXBA 1KERA 3ORFA 4LVUA 1QV6A 3DAPA 3MZ0A 3VPSA 1NWCA 3DZGA 3AW9A 1ONNA 3GMDA 4RCVA 4XB2A 1K2WA 1X7HA 1Z74A 3D4PA 3FNHA 4HNHA 4H16A 1LDNA 1HSOA 2DT5A 2GRAA 2X0JA 3GHHA 2LDXA 4FFRA 4OQYA 5C5IA 3BZUA 4CLRA 2DC1A 1EUCA 1IHYA 3F4LA 2GZ2A 1CERA 4J91A 5TQVA 3TPCA 2IDZA 2VWQA 4MIEA 5JCJD 3E48A 3LLSA 4WCFC 5TC4A 4GAEA 3S1LA 1U4OA 2R00C 3JQAA 3TZKA 1EVJA 1GQQA 2Y67A 4CUZA 5I7SA 3WB9A 3KHUA 4YAEA 4Y6PA 1RYDA 5IDQA 2BF7A 1OOEA 4R51A 1Z7BA 1ID1A 5TT0A 4XQGA 4E5YA 5K1SA 1BVRA 3GR6A 3BTSA 3ZH2A 3Q11A 4CM3A 1H5QA 4MKRA 5KKAA 3ST7A 4FDAA 4W6ZA 1X7DA 3O9ZA 5KNLA 3K5PA 2C5EA 2TMGA 4XQ9A 4IXTA 1NYTA 1ONPA 3WQSB 1U2DA 5A9SB 1IOLA 4OYRA 3V8BA 5LDGA 4WCFA 3GNQA 1MX3A 1Q2XA 3INRA 4P38A 4NZ9A 3CIFA 2FR1A 3ANLA 3ULKA 3RJ5A 6ADHA 3GC6A 1WXDA 3OQ6A 3F5SA 1XKQA 3GVXA 4ID9A 4E3ZA 2J5QA 3KEOA 4PLPA 3ZW8A 4CLXA 1YONA 4DPMA 1SEPA 1R4NB 2JL1A 2X8LA 2BFOA 2WYUA 3CH6A 3OJOA 1E5QA 3OJFA 2V6GA 1NPDA 2FR8A 4DXHA 1XR3A 3PFWO 3E5RA 2JAHA 4CLRB 2ILTA 2YZ7A 3HB4X 2ZK7A 3BMOB 3A28A 3M2TA 3OEWA 2BGKA 5C7OO 1TEHA 5K0ZA 5L4NA 2BFAA 5JCJA 3DWFA 1B3RA 1B2LA 3QVTA 3PWZA 4ZQBA 2Q45A 2H5LA 4NJOA 3PI7A 4ZVVA 3F5QA 3DZIA 4L9RA 1VLLA 5IDXA 1CWUA 3HFSA 3AUSA 2HK8A 1LUAA 3HUDA 1T25A 2EJWA 3L9WA 4XKJA 1DAOA 5C37A 1E3WA 3PWKA 4XJTA 2PZJA 3IQDB 4AJLA 1AHHA 3VVBA 3ZV3A 1A27A 4PN3A 4BNIA 3IOYA 2NADA 1BVUA 1NPYA 2ZQYA 1YBAA 4WGGA 2YHIB 5KVSA 1EQ2A 3DZBA 1K5HA 1MGOA 4XWYA 1ONOA 3HJAA 3RQSA 3GNTA 2O3TA 2OO5A 4EZBA 2EKLA 3I4FA 1LSSA 2XPCA 5J23A 3HFGA 1P77A 3UHAA 4YB8A 2PH3A 5I9MA 3DMYA 4E31A 3AWDA 3FTNA 3FD8A 4UUNA 5IAAA 1YH3A 3CMCO 4FIZA 4YJHB 1N1EA 3MJVA 3ZCXA 4QO7A 1PL8A 4GKVA 5BNTA 3WTCA 4ZRNA 3KTDA 3OIDA 4C7KA 1L7EA 4IQGA 4UVIA 1H94A 3C24A 3DHYA 3QA9A 4MVJI 3ITKA 4GWKA 1WMAA 4ONEA 2Q4EA 1KOLA 5HS4A 3AOEA 2JFFA 4XIJA 3WFJA 3VDRA 1I5RA 3AOEC 5EIOA 2GGSA 4H3VA 5TLSA 4A2CA 4F6LA 4XDZA 2O2SA 3RU9A 2WE8A 1HXHA 4NR0A 3IUSA 5ER6A 3QWFA 4BKRA 1NAHA 1WNTA 1WW8A 4PIVA 1VKNA 3EZYA 4FOOA 3ENNA 3JQBC 2FSVA 5F1KA 3P19A 1ENZA 3NEPX 5TRTA 4BO1A 2PZKA 5L51A 4ITUA 4U5QA 5JAIA 3B20A 5FFFA 1JW9B 4E21A 3ZU5A 3ONFA 2GN9A 2O50A 1YS4A 5DP1A 5ITVA 2CD9A 3BIOA 4XB1A 3U4CA 1GPJA 3CINA 4JBHA 2HRZA 3PLRA 2EWMA 5JAQA 3ZWMA 4AJNA 1Y9AA 4BO0A 4AL4A 4UEOA 1LSOA 1OAAA 1U3VA 4YPOA 1LDEA 1NBOA 1E92A 1ZSVA 1PZHA 4E5NA 2ZCUA 1UXHA 2CVZA 4HWKA 1HETA 4W9NC 5GY7A 1P1KA 3E9MA 4E2WA 5KKCA 2IODA 1H6AA 1B15A 4IMPA 4M87A 2YFHA 2E82A 1DIGA 2Y05A 1JKFA 1LDBA 1SB9A 1ZNQO 4PZEA 1OZAA 3UN1A 1ULSA 2J5RA 3IUPA 3ZHYA 2C0CA 1B16A 1Y9EA 2WSBA 4KQXA 4BGIA 4TZTA 5A9TA 4WJZA 5F1OA 1DSSG 2JHFA 3GY0A 4R9RA 4XR9A 3L6OO 4Y67A 4CODB 1BWSA 4QO8A 2FY8A 5JDCC 4FB5A 4TROA 1KVSA 2O3QA 4HADA 5EQDA 1YE3A 3TQHA 5TT1A 1YDWA 3WYEA 1NAIA 5U1PA 1J4AA 2W2KB 3GN2A 3EK2A 1XU7A 2P9EA 4WEOA 1D1TA 4Z3DA 1JDJA 2YDXA 2X5JO 3OIFA 4E13A 1T4DA 1UDAA 1ISMA 1WWKA 2AE2A 2OBYA 3KO8A 1DLJA 5B1YA 2FRDA 3T7CA 4BNVA 3EHEA 4GI2A 3R3SA 2PKRA 4FS3A 4JJIA 3W4JA 3BHJA 1I0ZA 3Q6IA 4O6VA 4R9SA 4JK3A 3W8EA 4CV0A 2NU9A 4PLTA 4O0LA 3SEFA 3VKVA 4E5KA 3PHGA 4ZHSA 4UEKA 1QRRA 2NLOA 4FCCA 3S2EA 3JD3A 3QW2A 3UXYA 1PZFA 3VH3A 2QW8A 3TSCA 1E3EA 3ZV5A 1YVEI 5IZCA 3ICPA 5LDHA 2P4HX 2FOIA 1HEUA 2AE1A 1BMDA 2CMDA 3L6DA 4WLNA 4CMCA 1ZK3A 3PJEA 4WLOA 2G5CA 3GOHA 3V2GA 3NTQA 5KOIA 3O03A 1BRMA 3AUUA 1ZH8A 5JO0A 2NNLD 4YAJA 2NTJA 2Y99A 1UR5A 1ZK2A 3RC1A 3I4CA 1IY8A 1SZJG 1VSUA 4FQ8A 4ALIA 1AN9A 1RM3A 3U3XA 1VJ0A 1XHLA 1DIAA 5GMOA 3DL2A 4ALJA 1GZ6A 1ENOA 3KYBA 1CYDA 1JWBB 4PVDA 7MDHA 1CDOA 4MP3A 1R12A 4O5OA 3A1NA 4W9NA 3KM0A 1GADO 4ZQHA 3SJUA 4LSMA 4I5GA 4XEHA 2PZLA 3RKUA 5K6AA 1DO8A 2B37A 2R00A 2QIOA 3WICA 4KDFA 3PYXA 1LC3A 1N8KA 3H9QA 1E6UA 1JWAB 4RPKA 2I76A 5L40A 2A9FA 4YA6A 4J9VA 5IN5A 4NBVA 3RUIA 3NT4A 5DCUA 1W0CA 3JQ9A 3LC2O 3FNGA 4F6CA 1GV1A 3TRIA 3TFQA 3L0DA 3WGOA 1B26A 2VWGA 5COBA 2NU8A 3F47A 1JU9A 3QVOA 1JVSA 1A5ZA 3QHAA 4OSOA 1H93A 3GVPA 3BAZA 3C8MA 3PHLA 5CFZA 4XYBA 5ES3A 1KEVA 5B4UA 3OQ1A 3VTFA 3G1TA 1IUKA 3K30A 4JGBA 1XWFA 4DPLA 4CQLB 5IXSA 2GN4A 1O5IA 3IDSA 1GQYA 4FGSA 3UAGA 3JQDA 1UUFA 4J2OA 4R1TA 2DTDA 3GFGA 5JMWA 4PFJA 3JQ8A 2VHZA 3WBFA 3A4VA 1GEGA 2OBNA 2EGGA 4DL9A 3Q2KA 4WOKA 1VSVA 1F0YA 3WWYA 3JD0A 5BSHA 4L8VA 3ICCA 3LQFA 2VRCD 1ORRA 1ADBA 1DDOA 2BD0A 3EVNA 3BTOA 4NBRA 2ZTUA 1QG6A 2J6IA 1X0XA 3QVSA 5JE8A 3DO5A 4DLLA 3DQPA 3GEGA 3RC7A 5JS6A 4B8ZA 5L53A 1LLDA 1TT5A 1MC4A 4PZDA 1BDMA 4P4GA 4TMFA 3GUYA 4CM9A 2IYOA 9LDBA 4LW8A 4N5NA 1HYHA 3UOGA 1VL6A 4A5OA 5IJZA 3OETA 4BNKA 4CM8A 1PL6A 5CG1A 5LCXA 2EF1A 2P4QA 4YAIA 1YXMA 3WXBA 3IP1A 3GG2A 1FDTA 4M86A 2A4KA 4I9NA 2JCXA 4D42A 4UVGA 1DB3A 2SCUA 1Y8QB 1M67A 3U9LA 4CM9D 5JPIA 3GT0A 4E33A 2CNBA 2BGLA 4IDAA 5BSEA 3BMNB 3V2HA 1ZO8A 2CDAA 4A03A 1CETA 1VL8A 3SX2A 2UUPA 4IDBA 1KS9A 1Q7BA 4GMFA 1DJQA 3PHHA 5JYEA 2X5OA 2YHUA 3HN7A 2JHGA 1U28A 3ZWXA 1AXEA 3EGOA 3AFNA 3RFTA 1GV0A 3S2IA 3TZHA 1WDMA 2X1HA 4B4UA 3GUCA 1MUUA 1ML3A 1UXKA 1BXKA 4FOSA 4JBGA 1P1RA 3DBVO 4FJ1A 3DBRB 2TMDA 4BKQA 3NDJA 4ZU3A 2OMEA 1LLCA 4OL9A 4GX0A 4MP6A 4IBOA 1UP7A 3H6KA 2C7GA 4XD2A 2UV8A 3A14A 3LT0A 4IS3A 3K8ZA 4K9DA 2YY7A 4WPGA 2P9CA 3SJ7A 2HK7A 3DZFA 5L3ZA 1N5DA 3R0IA 3QWBA 3D5QA 1K6XA 2EV9A 1YL6A 3RASA 4XGNA 1NVMB 4RDIA 2NTNA 5KCZA 3ZNOA 4KUGA 1TB4A 3WNQA 4F45A 2ET6A 2QRLA 4FFPA 1I8TA 1B0AA 3KLMX 2HKIA 5FI3A 4HFMA 3P2OA 3OA2A 4RGBA 3I9KA 3F46A 5HM8A 2V7PA 4AJ1A 3E9QA 4K1LA 4EUHA 5A5FA 1U9JA 4J1QA 3O38A 3WWZA 5FI5A 4B7CA 4J49A 3PQFA 1PX0A 1HKUA 1AGNA 2A94A 2Q1TA 3COSA 3GG9A 4M54A 4DQUA 3GH3A 2CFCA 3WS7A 2PR2A 4LCEA 1YBMA 4BNFA 4LSWA 1NQOA 3Q3CA 3QP9A 3GVIA 4UVHA 1YL5A 1YBVA 4DC0A 5I8WA 3VZQA 5AXCA 5U4QA 1EBUA 4I5FA 3PGXA 1NQAO 3I1JA 1CJCA 5CDUA 1J0XO 3GMSA 3MJ4A 4RVGA 3U0BA 3QIVA 2HDHA 1GFSA 1K3TA 4FN4A 4UVEA 2Q2WA 5AXAA 3I52A 5DCWA 1DIBA 4EUFA 4BB6A 3I83A 1FJHA 4KWHA 1F8GA 1NHGA 4PLCA 4BV8A 1LTHR 1PJBA 2Y0EA 3PJDA 2B4QA 5DOVA 2Y1OA 3DDNA 3AM5A 1TI7A 1CQJA 2HMVA 4NFHA 3DBLA 3NJ4A 4MIYA 4R1NA 4XIYA 4CMKA 3JQGA 1JQBA 1I36A 2O2YA 2X4GA 3MJSA 3GDOA 1GZ3A 5T57A 4MP8A 4DQVA 2H9IA 1U5CA 2O23A 4D3FA 1I3KA 3OBBA 4BMNA 2FZWA 2YUTA 3RKRA 3ZHZA 3ZWNA 3BYZA 2IEDA 1LX6A 4N7RA 2YV1A 4Y9DA 5B12A 3NT2A 4G81A 4ND3A 1DOHA 4GGOA 4H15A 4EGFA 3M1AA 1MB4A 2DUUA 4RQUA 2AQIA 1C0KA 3DHNA 1WZIA 2G1UA 3EY4A 3KVOA 2X7HA 4Y6RA 3ENKA 3FRJA 2VWHA 3WYBA 4BOYA 4BNJA 2EKPA 1U8FO 2PFGA 5CHEA 1WP4A 5AVOA 5DF1A 1BHSA 2VT3A 1Q0QA 3Q0EA 2P9GA 3LT4A 1SB8A 4FFMA 3L4BA 5F1PA 2WEKA 2BELA 1GL3A 1FXSA 2FSSA 4D3DA 3GRPA 3VHRA 3C1OA 1I2ZA 1ZUD1 3C1TA 5JY1A 3JYLA 2XAAA 1I10A 3Q9NA 2IZ0A 2FP4A 4RLHA 5DNAA 1E77A 3ZW9A 4JXKA 3OA0A 1P1HA 4JBIA 4PRLA 3H3FA 3ROQA 3WOHA 4B3HA 3H2ZA 2DFVA 1VRWA 1I24A 3B6ZA 1ZW1A 4KZPA 5KJFA 3ETDA 1M66A 3D1LA 3HDQA 3GQVA 1ZXBA 1BDBA 4YDRA 4CMHA 1HYGA 3P5SA 4XYEA 3PEFA 4TRMA 4NJMB 4FFOA 5T8KA 5ILOA 4B3JA 4MVJH 3FPCA 2VUUA 4DIBA 4ZQGA 4PVCA 3JQAB 4PG5A 5G0UA 1P0CA 1L7DA 3BMOA 4CR7A 4GH5A 4XRGA 5BQFA 5KWEA 4S3MA 5GZ1A 1E6EA 4U7WA 4W7IA 4D45A 3CSDA 2NQ8A 3GDFA 4QEDA 5ER9A 3SC4A 4I5EA 2W8ZA 2C5AA 2VNAA 4HFRA 4YQYA 1E7WA 3DHEA 4ZD6A 2HK9A 4JP2A 2JD0A 4IUYA 1UXJA 4J0EA 2VTDA 3V1UA 4BNMA 5IZ4A 5CDSA 1HDGO 1KY4A 1E1LA 2ZIZA 1PS0A 2YFQA 3KYCB 3M6IA 2CSUA 4MVJG 2HMSA 4PRKA 4CM4A 3IMFA 3SLGA 3LK7A 3DZJA 2FPPA 4JROA 2W98A 3QWHA 1YQGA 2IRWA 5DBGA 3VOSA 1W73A 2FZEA 1YOVB 2AQKA 3ADPA 3D0OA 3H65A 3QSGA 1L1FA 4OAQA 1LRJA 4GX2A 2DKNA 3RROA 4M55A 4WLEA 3SVTA 3K2BA 4QTZA 4M49A 4PG7A 1ZXLA 3VH4A 4C4OA 4FFNA 1M6WA 2VUTA 3H5RA 5L45A 4OGWA 3I9JA 1YJQA 3PIIA 4OOEA 5COAA 3PJFA 2B5WA 3DC2A 4TRJA 2HMTA 2NUAA 3FBTA 5JC1A 4ALMA 1YB4A 1U1IA 1RKXA 4RPHA 3JQ9C 2YW9A 3EVTA 2DM6A 3JQFC 3ZDFA 3FR7A 4HFJA 5IZCC 1BXGA 4INAA 3TN7A 4F46A 2DBVO 1HL3A 1W6UA 2P5UA 5TJ9A 1I3NA 1I30A 1Y5MA 1U5AA 4R3NA 2D2IA 4Z9XA 1E3JA 3RC9A 1S7CA 3DZKA 4ALNA 3K92A 5HRUA 5L95A 2V6MA 2W2LA 3M2PA 2GN6A 1VJ1A 4URFA 2D4AA 3TWOA 3JQCA 4R1UA 5FF9A 2HUNA 4MVJM 1AE1A 4NU5A 3RUFA 1P9LA 1PSDA 4J2HA 5CPFA 3EAGA 1YB5A 3S2GA 4IY1A 1A72A 4TKMA 3AM3A 4PLFA 1UJMA 1V3UA 4D0SA 3WMWA 2UDPA 4OSPA 1UP6A 4PG4A 5F3RA 3F3SA 5DP2A 2W90A 4BKUA 4ILKA 4EJ0A 2HSDA 1UXGA 4ZJUA 4R41A 3W1VA 1HE5A 5THQA 2RCYA 2AEJA 2GUGA 1O94A 3FBGA 4Q3AA 2BFPA 2WD7B 1I2CA 4L4RA 4LISA 5DULA 4D41A 4PLVA 2Y68A 4GLOA 4ZRMA 3TJRA 4CV1A 3N74A 1PJQA 3U4IA 2WYVA 1KC3A 3H3JA 3RUDA 3AI1A 4Z3KA 1M75A 1X1TA 3W6UA 2PD4A 1T2DA 3V2UA 1Y7TA 3S8MA 3UVEA 1MV8A 1KBZA 1QMGA 1UP4A 1YQDA 3W4KA 5C3MA 3TL3A 4DLAA 2IZZA 2FMUA 1GDHA 3RVDA 2NU7A 3LT1A 3QQPA 2J3IA 4Z9YA 3U5TA 1CQIA 5TS3A 1IPEA 4A0SA 4FJ2A 4IIUA 4KDEA 4M1QA 1ZJZA 2PH5A 3D3WB 4DWVA 4A7PA 1I33A 2UYYA 3FR8A 4IDFA 4PCVA 1EEHA 2DPGA 3NRCA 4E12A 2I65A 4J4TA 3VAZA 4CQLA 4GL4A 2Y66A 2JCYA 2J3HA 3ZHBA 3ZV4A 1LQTA 3NGLA 2PA3A 3WGHA 4RZHA 5L7YA 4AJKA 4CM7A 1H2BA 3IKTA 1LQUA 1DAPA 5JAZA 4II3A 1G6KA 1DFIA 5K9ZA 3DAFA 2B0JA 3VH1A 4KOAA 1DIRA 3Q9UA 3W6ZA 1WMBA 2CDBA 3FHLA 4A10A 3GZ4A 2A35A 3DAGA 3GF4A 3HE3A 2FWMX 1U3WA 1SEVA 5DN9A 4DIOA 2BI8A 3PP8A 2QYTA 2YQ5A 4IJVA 1SO8A 4CUJA 1VJTA 3RSHA 3U09A 3RJ9A 4L4SA 4E2YA 5U9CA 3GHYA 2Q46A 3ZU4A 3LSYA 1H6DA 3JQAD 4JJGA 3OHSX 1FF9A 1ISIA 1GPDG 1GAEO 4GWGA 1QYCA 2VHYA 4IS2A 4CQMD 3NYWA 2IXBA 4BGUA 2CVQA 4DRYA 1NASA 2R2GA 3WIEA 3D3EA 2LDBA 2P68A 4FBGA 1Z6ZA 3MJCA 4MVJA 4RVSA 1KEUA 3H4VA 3KV3O 3PVZA 4J0FA 1WLYA 1NQ5A 4L4XA 2G76A 3G3EA 4CM5A 1XDWA 2JAPA 1I3MA 4EDFA 1JN0A 5JDIC 2VWPA 3DMTA 1HTBA 1PQUA 3SC6A 1LC0A 4EITA 4FD3A 1Z7EA 4UULA 5DT9A 1DEHA 1P33A 4TVBA 1PQWA 1ZEJA 3HN2A 3VZPA 2GASA 1E1MA 1RYEA 2J3JA 3NKLA 3STHA 3GA0A 4FSHA 5KJ1A 1GR0A 4K26A 3RBZA 3N7UA 5EN4A 3FTPA 4WKGA 4PLYA 3QWIA 1DFHA 2O3SA 5HS6A 4ND1A 4PG6A 3TZ6A 3MTGA 4AICA 4A26A 2BFMA 1D4FA 5IDYA 4BO2A 2X9GA 3NT5A 5JFOA 5EESA 3ROMA 1U7TA 3VPGA 1N92A 2QRJA 1T4BA 3BHIA 1D7OA 4NPCA 1XIVA 2PNFA 1MFZA 3JD2A 2PGJA 2RH4A 2Y0DA 1F14A 4P4LA 4CMBA 5GZ3A 3WGIA 4BMVA 4CUKA 4OH1A 4CV3A 4WNIA 4I1IA 2B83A 1EVYA 1Y6JA 4CMIB 1XLTA 1Q7GA 1CEQA 4J7XA 2DUWA 2DBRA 4HKTA 3CEAA 2OFPA 3HHPA 2ZKLA 1XYGA 1ADGA 2NVUA 2OZPA 3I9LA 3LYLA 2ZCVA 5HWSA 5JCXA 4BIIA 2VCYA 3AFMA 1LU9A 3I9MA 5A03A 5G0SA 3VPHA 1KYQA 3ONDA 5TNXA 4D46A 1TT5B 1ZVMA 1PTJA 4JLWA 4CMEC 4YR9A 2GLXA 3FWZA 2Q4BA 5ADHA 4I08A 3OJEA 4UEJA 3TF5A 2HQ1A 3OIGA 4E2XA 1VC2A 4CR8A 5G0WA 4MDHA 1SOVA 3FWNA 1NFQA 2EHDA 2ZTMA 3KYCA 2GN8A 4W7HA 2Q1UA 1XSEA 2D8AA 2EW8A 4MOWA 3FF4A 4IQ0A 3RD5A 2Q3EA 1E3LA 4MKZA 4R5HA 1PGJA 1NHWA 2NU6A 1OBFO 1M6HA 3O4RA 2NSDA 4B7XA 4B7UA 4UAGA 3JQ8B 3PRJA 4BL5A 2CDCA 3KOUA 4HUJA 3ZGYA 3IJRA 4FGWA 2OL4A 5BSFA 2RBEA 3PWSA 1E7QA 4I9HA 4EEXA 3DTYA 4RPLA 4NG5A 1LDYA 1KVRA 1NM5A 1PS8A 3IIEA 5JO9A 1GYQA 3U4HA 1PL7A 4EYEA 1WZEA 3PPIA 3WTBA 1C3VA 2V6FA 3OMLA 3KBOA 1HE2A 3PYLA 3JSAA 4Z0TA 1P45A 2ZB7A 2ZJ1A 2FHSA 3AU9A 1P1JA 4MPDA 1BXZA 3I3OA 3CMMA 3U49A 2AMFA 1VPDA 4EBFA 5EINA 4N5MA 4NH4A 3RWBA 4FW8A 3DFZA 3PQEA 2PTGA 2VHXA 4QFDA 4FJ0A 1VI2A 3GLQA 5BSGA 4YACA 4OIMA 2EJVA 4RPJA 3OM9A 2H63A 3B1FA 3GFBA 3GGGA 4CMJA 3NDIA 5K6AC 2VYNA 3DOOA 4CLEA 3ASUA 2W2KA 1LLQA 3R3JA 4WK6A 1E7MA 4W82A 8ADHA 1NPTO 4FR5A 4GGPA 4HY3A 5CEEA 5A3VA 1RM0A 1PJLA 1NVTA 4EI2A 3G17A 3GVCA 1T2EA 3ABIA 2RAFA 4FC6A 5AXDA 4TRRA 3JQBA 3EDMA 3I6QA 4ALLA 4QSMA 4CMGA 5JMPA 4R16A 2J3KA 4NIMA 3W8FA 2P91A 1ISGA 3WGGA 1NFFA 2E48A 2QRKA 1PJ2A 3S2FA 1PJCA 4J6FA 2IZ1A 1C1XB 1OI7A 1RWBA 4KQWA 4E32A 1Y81A 4RL6A 1Z75A 3OQBA 1H6BA 3LDHA 5JBIA 3G1UA 3WIDA 2YYYA 1ZIDA 3DZHA 3IKVA 1WVGA 2ZYDA 3JYPA 3CKYA 2B5VA 1E7RA 1A4UA 3HDJA 4P8RA 5HBRA 2V65A 1A71A 4YEDA 2WD7A 4YCAA 3WGTA 5ICSA 1GYPA 1V6AA 4RF3A 1SMKA 4BNLA 1ZBQA 2DTEA 3QLJA 4NHEA 1A4IA 1LI4A 1YDEA 3HQ4O 5MDHA 3FNEA 1J5PA 3T4EA 1BW9A 1NXQA 2CF5A 5A02A 1JKJA 2E37A 4YT5A 5DZSA 2BMAA 2D5AA 3I23A 4Q3NA 4O59O 4ALKA 1YQXA 4G2NA 2CY0A 3ITDA 1ARZA 2J8ZA 2PD3A 2P5YA 5EERA 3JYQA 2HMUA 3WGQA 4YBZA 4YAGA 3EMKA 5G2OA 4CL8A 3QWAA 4Q9NA 2I67A 3GEMA 3OFSA 1JA9A 5A9RA 5FWNA 2WDZA 1LLUA 1JAYA 4OXNA 4GQAA 2JD2A 2HMWA 3AUTA 3LF2A 4II2A 4WE3A 3T4XA 3WLEA 1ISFA 2BGMA 1GUFA 1DC6A 2PWZA 2DBZA 3TZQA 4UUOA 2HU2A 5JDIA 5CDYA 4D43A 4ND4A 2BH9A 4OMUA 5FYDA 3BMQB 1Y8QA 4KUEA 4TWRA 4XGIA 6LDHA 3ON5A 5LC1A 1UH5A 4ND5A 4BO7A 4B4WA 4IJKA 1E5LA 3WG9A 1R6DA 4NBWA 1TLTA 3H2SA 5KJEA 5CDTA 1W8DA 1KVQA 3PGJA 2GCGA 3UUWA 3D4OA 1Q1NA 2GR9A 4PLGA 4FC7A 3F6YA 1MXHA 1ULUA 2G0TA 2WWRA 3ZI0A 2DFDA 3JD1A 4EJ6A 3FSRA 4GLLA 2HCTA 3HWRA 1EQUA 2NQTA 2VYVD 3PK0A 1MA0A 1C0PA 1CRWG 1QSGA 3OF2A 2Y1EA 4XYGA 3TFOA 3RI3A 3Q1LA 4IJUA 1NNUA 3DBRA 4XGKA 1VL0A 4FFLA 4XYMA 4YJFB 2O7QA 1JTVA 4B79A 2PV7A 3UW3A 2VRBA 3BA1A 3TDKA 1UXIA 1U3TA 4GBJA 1LNQA 1Z45A 1PJ4A 3EUWA 4L74A 1N7HA 1LA2A 4J9UE 3MOIA 4QQRA 4CM1A 4N5LA 3PQDA 4CQMA 1HE3A 2X22A 4NJMA 1EVZA 2GSDA 1T2AA 4J4HA 3LF1A 3JQ6A 3O8QA 3TZCA 1BSVA 1MLDA 4L75A 5JYDA 1C0IA 1C14A 3ONEA 3GAZA 3CZRA 1OFGA 3GGOA 5CEJA 2HLPA 1XCBA 1VKOA 1XGKA 4LK3A 5TJHA 2Y0CA 3KXDA 2R6JA 5IG2A 4U0KA 4R68A 1D3AA 4WLFA 2IXAA 1FDUA 2IYPA 2QQ5A 4GMGA 4YT2A 4CM6A 4J43A 4LMRA 5B4TA 4R69A 1HT0A 1SBYA 4Z0HO 4OHUA 4J16A 4ZQFA 4Y98A 1IE3A 3E6AA 2WE7A 5I7VA 1IL0A 1IHXA 1D8AA 1V8BA 1ZKMA 3HDHA 4CMAA 1B8UA 2VTEA 5AYVA 3NTRA 4D7AA 1F12A 2CUKA 3OH8A 4RF2A 4LN1A 2BI7A 4IIVA 1DLIA 3NUGA 4BNHA 2GO1A 5B4VA 1EK5A 2WYWA 3AY7A 2NACA 2WM3A 4CR6A 2AW5A 3IP3A 1PGNA 1QLHA 2AG5A 5A5EA 2GDZA 3JYNA 1S6YA 5T6BA 3PZBA 3X2FA 2YV2A 2C2XA 1GEEA 4WECA 4Z0PA 3SXPA 2OXIA 1QYWA 1R0SA 3ZZNA 3H5AA 1IZ9A 4RZIA 4E0BA 3UICA 3T7EA 3TL2A 1PZGA 1HDXA 3IL2A 3PJGA 1XQ1A 1SNYA 3TOXA 1A7AA 1EBFA 1DC4A 3UCXA 3MTJA 3C7DB 4DUPA 5I7FA 3UCEA 4TRNA 1H0KA 1RM5A 3LC7O 5CDGA 2EERA 3TOZA 3BXXA 1G0OA 2I99A 3I9NA 2VHWA 1P1IA 1IPFA 1CIVA 4CJXA 1ZK1A 5FEUA 1PZEA 2EP7A 2F00A 3E1KA 1ZSYA 5G4KB 3GRKA 2FPGA 1ADCA 3P2YA 3JD4A 5ILGA 1I2BA 5A9SA 4D44A 1DRUA 5ENVA 1ISJA 2C20A 4Q3DA 3VPXA 4WCFB 4UVDA 1I3LA 3JQFA 3MOGA 1ZCJA 1C1XA 4RVUA 4DMMA 1LEHA 3LZ6A 3CZMA 3C7AA 5HTOA 3UGKA 1E7YA 4GVXA 4MVJE 4YVFA 2B36A 4XQEA 3HNPA 5CP8A 5DCYA 4NDNE 3RIHA 4E5PA 2GERA 3ZWAA 2OUIA 3D4NA 2OOSA 4IZIA 1QYXA 2Q1WA 3QRWA 4YJHA 4I9UA 3H8VA 4BNTA 5I9NA 2AQHA 4XCVA 4WCDA 3QE3A 5TSDA 5G0TA 1GUZA 1Q0LA 3HDYA 3OICA 1X14A 5JSFA 2B4TO 3GAFA 3OJ0A 2AA3A 4YRDA 1ENPA 3INGA 4R1SA 4PLHA 1WDKA 1CF2O 4ZA2A 2BRUA 2FPIA 4IPTA 4CPDA 1BG6A 4YXFA 1R37A 3OJLA 2D59A 3KLPX 4RVHA 3V5NA 1UZNA 5A05A 1HF3A 1AUPA 2VZ9A 3CUKA 2QHXA 3OP4A 3LU1A 4OO3A 4BNUA 4AJ2A 2QYSA 3B1KA 3I5MA 1EMDA 4TVOA 3DONA 1D1SA 3E82A 3AK4A 1HSZA 2EIHA 3GEDA 1EK6A 1NQTA 1Z82A 3RCBA 4GPD1 4BGVA 3MJTA 3QY9A 5JW6A 2VN8A 3L4SO 3IAHA 3R6DA 2CVOA 2GPTA 4DVJA 4YRBA 4U6QA 1U4SA 2X9VA 1F8FA 4PGFA 1EDOA 1A7KA 1K89A 3ZNPA 1EFKA 1N1GA 1DC5A 2DU8A 4YT4A 5AXBA 1NTOA 4KUHA 2WJPA 5ITWA 3WGYA 1EUZA 3BTUA 4BNYA 5KJ6A 3ZV6A 5TGDA 4CLOB 4J1SA 2GF2A 1O0SA 1MC5A 3NX4A 2AQ8A 4IGFA 1KEWA 3JQ7B 1FDWA 2NVBA 1V35A 5CPBA 3VDQA 3GGPA 1Y8RB 4DGSA 3NGXA 4BO9A 1PS9A 3H9GA 5A04A 2Q2VA 3AY3A 4AJIA 9LDTA 1P3DA 5BNIA 2VHVA 3ZWVA 1IB6A 1RJWA 3W8DA 3DBHB 4Y6SA 1XELA 3K2EA 4JIGA 4IXWA 2O7SA 3INTA 5T8KC 3O8QB 1YL7A 1EE9A 2POQX 2ZYGA 3D3WA 2UAGA 1NR1A 4YWJA 4AFNA 4NI5A 2B4RO 5G0VA 2VZ8A 3KB6A 3ANNA 4M89A 4AJOA 2IE0A 4PLZA 4PG8A 3A9WA 4K6FA 1KC1A 1JKIA 2UVDA 1TT7A 2GZ1A 4RQTA 5L4LA 3K73O 4KTTE 1N9GB 2EGHA 5TX7A 2ZTVA 4WLVA 1X1EA 4LRSB 2CZCA 1EFLA 2E49A 4TKLA 4Q3CA 3L6EA 5KVVA 4H7PA 1R15A 3QVXA 2NWQA 2O4UX 2O4CA 3KYDB 4AG3A 1MXFA 3OEYA 5ENDA 2Y1CA 2GD1O 1HWYA 4TSKA 1XQ6A 4YJDA 3ETGA 2JFGA 3D64A 3E8XA 3W4IA 1OC2A 3ROKA 3SLKA 3GPDG 4RLSA 1UZMA 3OSUA 1ISHA 4WOJA 1R66A 4XR4A 3LC1O 3D7LA 7ADHA 2Z1MA 1J49A 3ETEA 3HADA 5KJCA 3FPLA 3NDRA 4QUKA 3PZRA 3V1TC 1H2HA 2PKQO 3ADOA 3VZSA 4J90A 4YJGA 3CTMA 1KETA 4AVYA 3DEYX 5AQ1A 3EZLA 1SC6A 4W4TA 4CQMB 3PHIA 1V3VA 1YRLA 4LGVA 3ANMA 1HDCA 4R5MA 4TQGA 2X58A 4BNNA 5TIIA 2OP1A 2C82A 2JCVA 2JKVA 3JQGB 1C1DA 3BMCA 4DPKA 1A9ZA 2EP5A 1KVUA 2Y1DA 4DMLA 1Y5RA 5IXYA 1I01A 1QLJA 1ZEMA 4BO6A 3ZWOA 1SPXA 4KMSA 2QZ9A 5C7LO 1H6CA 1RPNA 1PQPA 4FPXA 1T2CA 4ZN6A 1P1FA 2C7VA 4Q3BA 4UUMA 4BNWA 2A92A 1J6UA 3NTOA 2W4QA 4WLUA 5H83A 1EZ4A 1PR9A 2QG4A 4TZKA 3G49A 2FN7A 3A06A 4JNKA 4CL3A 3JCZA 3VZRA 2PD6A 3ZNNA 1LJ8A 4EEZA 2I3GA 1HRDA 3JTMA 1JVBA 3FN4A 3QVWA 4QFCA 3TNLA 2YV3A 2DPHA 3DFUA 1X15A 3PLNA 1PU2A 2HAEA 2JJYA 1NX6A 2P2SA 3RFVA 4HX5A 1O8CA 5BNFA 3UFXA 3H9JA 2YJZA 1SCUA 3E9NA 4YRAA 2X6TA 1DHTA 3AU8A 3P7MA 4DBZA 1DC3A 4RV9A 2NM0A 2RIRA 3WR5A 2VNSA 3IS3A 4BO3A 1R0LA 4CMIA 1LXCA 3RUHA 1NWHA 4E2ZA 5MGBA 3C3XA 4GVLA 3DB2A 3RUCA 4MO2A 1TXGA 2PY6A 2NVUB 1HLPA 4C7JA 1YWGO 3K31A 1N7GA 4P22A 2X86A 4BB5A 3GNSA 2Q99A 2Z95A 3C85A 1PGPA 2C2YA 4I5DA 1C1DB 4ESOA 2I6TA 3AOGA 3VC7A 4LVCA 2XOXA 4F3YA 4WASA 1QV7A 1E6WA 4JCOA 4RF5A 5L9AA 3KSUA 4RVDA 2ZTLA 4BKPA 4R01A 1ZMTA 5T5QA 3WX0A 1UZLA 2WMDA 3H9EO 3CE6A 4Q3EA 1GTMA 1E1KA 1YGYA 2C54A 4HP8A 3PDUA 4U6SA 1K6IA 4BO8A 4DC1A 4MKXA 1MFPA 3I9OA 1P0FA 4P4NA 1U8XX 2FR0A 3WMXA 1T1SA 3M1LA 1C0LA 4X54A 1XU9A 3O26A 2XXJA 3UF0A 5EJ2A 1PR3A 4R4JA 1DPGA 4NFSA 4RORA 4MINA 4AJEA 1O89A 3E5MA 1P31A 2B69A 3ZWPA 4E4YA 5G4LA 4GX5A 3B70A 2UUOA 4NU6A 5G4KA 5JDCA 4IZHA 1IYZA 2ZQZA 5A1TA 1OC4A 2G82A 2WTBA 1GY8A 5L4SA 3PIDA 3AM4A 2GNAA 3JQEA 1PWXA 3K9QO 3WSWA 2Q2QA 3F1KA 1PEDA 2OHXA 2DQ4A 4A27A 1P44A 4OM8A 4QX6A 3RC2A 3UH1A 4YYZA 1U2GA 2GZ3A 3B1JA 1HDZA 3IJPA 4NBTA 3RU7A 4CLDA 1W4ZA 5CEFA 2ZATA 2YQ4A 3AI2A 4LCJA 4AJ4A 1LDMA 2H1SA 2PLAA 2Z5LA 3GK3A 3PHJA 4RDHA 3WJAA 3WQQA 1XG5A 4J4BA 4JQCA 1FMCA 2O3UA 4N18A 2HRBA 1LDGA 1N2SA 2Q50A 4QECA 1F06A 3WFIA 4IDEA 3WYCA 2O3RA 2VQ3A 1V0JA 2Y1GA 1O9BA 3E18A 4U0JA 1XEAA 2YDYA 5CG2A 3ZNQA 2AEFA 4ZQEA 2EEZA 3KUXA 4BO5A 5EL0A 5IF3A 1ZJYA 2EXXA 4WEQA 2VRCA 1QXSA 1NFRA 1EE2A 4DLBA 1GUYA 4B3IA 4AJHA 4L73A 2WD8A 2NTVA 3WDSA 2PGLA 1MG5A 5EPOA 5H82A 5JC8A 4Q39A 1DRWA 3ZU3A 5JLAA 4W99A 3BTVA 4J1NA 1PJTA 4KWIA 4XA8A 4NMHA 3V1YA 4GSLA 4CLOA 4NK5A 1UAGA 2IEBA 1P74A 2X5KO 4L0QA 1I32A 3KRTA 3WGZA 1HZJA 3VH2A 3L9XA 2YHIA 3DR3A 2I3AA 4MJLA 4L76A 4I8XA 1XA0A 4JP3A 3H7AA 5DBIA 3MWEB 4PLWA 4E5MA 1GYRA 2VUSA 4YJGB 5EQFA 5JNLA 3GZNB 4R54A 3GVHA 1R4MA 5JXWA 1E7SA 2I66A 4LRTB 2EG9A 4YTEA 4KP7A 4OQZA 4Z6KA 4OJNA 2X9NA 1G0NA 4CM8B 1K0UA 1V9LA 1Y8RA 2X23A 4BNXA 1UAYA 3PTZA 1H9BA 3ZWYA 1VE9A 1DHRA 3VKUA 2D1YA 3DTTA 4LMPA 1M76A 1DJNA 2E6UX 3L77A 1O6ZA 4Z9FA 4EW6A 2X0IA 2DAPA 5GZ6A 4J7CA 2ZB8A 4U8GA 2CF6A 3NAQA 1E3WB 1N9GA 4HBGA 4MVJF 5JY6A 3U62A 1V3TA 4CM4B 4BVAA 3HZZA 2Y1FA 2AHRA 3ASVA 3F9IA 4NK4A 4RPGA 4RF4A 4S1VA 3DXFA 4PZCA 1ZZEA 4AJJA 2XF8A 3CXRA 1Q7CA 4RO0A 4BUCA 2PK3A 5I9LA 1BGVA 4MIOA 4D79A 5A4DA 1TA4A 5JAMA 3K96A 3DOJA 4RJTA 4DQXA 2PKQP 5DBFA 2RHCA 4QXMA 4YQZA 2Q49A 3NJ8A 1R4NA 4DBVO 1PJ3A 5COQA 1LBEA 2F1KA 3LT2A 1PGQA 1IULA 2QZZA 1R4MB 4YT8A 3G0OA 3I6IA 3RBXA 1X0VA 2OORA 5T64A 5KVCA 5A06A 1MG0A 4XZ3A 2DBQA 8LDHA 4IJWA 5IFLA 3PFFA 1KY5A 4J1TA 3U4DA 1GD1O 3RFXA 1K6JA 3WNVA 3ZU2A 2H6EA 2VYVA 3C1AA 3KZVA 3E03A 2OGUA 2NVWA 4J7UA 4MVJD 3MWDB 1MP0A 5L7TA 3BHMA 1NR7A 2BHLA 3AJRA 1UDBA 3GN1A 4IDCA 2Y93A 1FDSA 2PZMA 4DA9A 3EW7A 3HSKA 4M8SA 1LRKA 3L07A 1E3SA 5BT9A 4CMEA 2HJSA 1F17A 4WNCA 4DYVA 1KEPA 4NNJA 3D5TA 5B37A 1QYVA 3L4BC 1Y1PA 2VOJA 5C7IO 5KVQA 2OP0A 2G17A 5AOVA 4OXKA 4OXYA 3BMCB 3VTZA 4WUVA 2VZ0A 1B8VA 1HDYA 4CV2A 1GZ4A 1QP8A 4DYDA 1HZZA 2VYND 4E6PA 1KVTA 5IDWA 4IGEA 3JYOA 1PIWA 3MCVA 1GCOA 3QV1A 2W2LD 2E4AA 1YO6A 2I5PO 4BHTA 2B35A 4IINA 5L7WA 2BKAA 1NP3A 4J3FA 3AY6A 4JN6B 4D0RA 3GPIA 3PYMA 3AI3A 3SBOA 1WDLA 3HG7A 4MVJP 1E1NA 4NFYA 2ZB3A 4HXYA 1ADFA 3LLVA 3JV7A 4IQ8A 3Q2IA 2J5KA 4R3WA 3QJ5A 3WSVA 4BGEA 4XX0A 3JQ7A 3H9UA 2JD1A 1R16A 5F5NA 4G5HA 4B4OA 2NV6A 3ZWWA 3X2EA 4UUPA 4XDYA 5THKA 1IZ0A 2ZB4A 2AEMA 2VOEA 3RUAA 4BQRA 3RAJA 3ZHXA 2V6BA 2Z1NA 3F4BA 1H9AA 3C7CB 3VPFA 1JAXA 1Z73A 4JX8A 2Q1SA 2HJRA 1DBVO 2AXQA 2RH8A 5H81A 4ZICA 2X0RA 1PGOA 3GZNA 4JJFA 5EMHA 1JLLA 1EUDA 5TF4A 4EUEA 4BO4A 1FK8A 2C29D 4IDDA 4ROSA 1ZMOA 5DOZA 4HFNA 4YJFA 5I7EA 1R0KA 3UCFA 3UKOA 1BW9B 4O1MA 1O95A 4NQZA 1DIHA 4YAKA 2O48X 4OKIA 1T24A 4ZGWA 1T2FA 4XYLA 1FDVA 1SAYA 3WBBA 1LSJA 3RUEA 1BTOA 1G1AA 2AG8A 3MJEA 1GCUA 1SOWA 4ND2A 3ZWBA 1X13A 2EKQA 3CPSA 1X7GA 4Y8VA 2JFHA 3WLFA 1ENYA 2D0IA 1VM6A 3AUAA 4NBUA 3KSZO 2C59A 1EVIA 4B8WA 1B14A 4BNZA 4A73A 1RM4A 2DTXA 3KYDA 3GDGA 3FCOA 1QORA 1HYEA 1B7GO 3BMQA 1E3IA 4OKNA 4O63O 1WAMA 3PDJA 2DLDA 3ZN2A 4QT0A 3G79A 4HNGA 1QKIA 2VT2A 1EDZA 4BQPA 2I9PA 1U3UA 1M2WA 1TVEA 2GYYA 2EW2A 5F21A 3OECA 5CAEA 5KIAA 1UDCA 5BR7A 4GKBA 1ZSNA 5DDIP 4BS9A 4EJMA 1B3BA 4B4VA 2BLLA 1Q0HA 2C07A 2D3TA 1T1RA 4XRRA 3H5NA 5IN4A 2QX7A 1E0DA 4K28A 1HDOA 3EC7A 1DRVA 1BXGB 4RVFA 1WPQA 3KSDO 3KETA 1HE4A 4AJPA 1PWZA 4E30A 4HV4A 3FNFA 2PGDA 1LSUA 2ZYAA 3DBHA 1QYDA 1YB1A 4G65A 1AXGA 4N54A 5I8ZA 2ZJ0A 3ZWCA 4XJSA 3WQRA 2HO5A 4IDGA 4GSKA 3LVFO 1GU7A 3EYWA 1U7HA 4XQCA 4BV9A 3IC5A 3FI9A 3F1LA 4OOFA 3RBVA 5ICMA 4DIFA 2RHRA 4CLHA 5A3JA 3NV9A 3DMTC 1NVGA 2X0NA 1ZK0A 3K6JA 4IM7A 3HB5X 4DTIA 4UREA 3R1IA 1GQ2A 2DVMA 5F5LA 4K6CA
chains in the Genus database with same CATH superfamily
4OLBA 4DREA 3PXXA 1UWCA 1W2WB 1Z22A 1WCWA 2GI4A 2OECA 4LG1A 4C2BA 4YMHA 4GX1A 5KTKA 2JFPA 4DYHA 4BKOA 1OMOA 1R0ZA 2ZBGA 5JJKA 1OA1A 1W36C 2O3JA 1HLDA 4PZYA 5HF9A 3C70A 2NGRA 3ROPA 3P96A 3SZGA 2PUEA 1PJSA 1DFGA 5P21A 1ZK4A 2GPNA 4HRAA 4AF8A 1OH5A 2PQ0A 3IVAA 2OBMA 1YOVA 1YFJA 1ZFNA 4PX3A 3I61A 3NHYA 2O20A 4RC9A 2RHJA 1KIFA 3C74A 3LY5A 4LQDA 4WBNB 1ZYUA 3WJ7A 3QSYA 1NT4A 3KZOA 5TF0A 6GPBA 3E0QA 3MZ0A 4D0LB 2A59A 4N0QA 4EG5A 3AW9A 1OH6A 5JS7A 1CUGA 3DTVB 2YVUA 4CKWA 3IPCA 3I58A 1SXJD 4PGGA 1Z74A 4U2FA 3F6EX 1L7VC 1I0LA 4H16A 1URPA 1GFIA 4GXQA 3VU3A 4G5YA 3AEYA 4ME6A 3BWCA 4OQYA 1QH8A 4WK4B 4NV3A 2EX4A 1HO3A 1VMIA 2DC1A 2XBLA 3BWMA 3K4PA 4RHUA 3CR7A 4XUEA 3ZXYA 1CERA 3AUYA 1C9YA 3W2GA 3EPKA 3E48A 3S1LA 5TC4A 4GAEA 1K2VN 2QA5A 3DO6A 3S3TA 2EEPA 2GN2A 4XOUA 5E7QA 1R5JA 4PR0A 1X1DA 1DBPA 3DMFA 5EFZA 4MYCA 3CU5A 1ZJ4A 1JNYA 2ZUUA 4E14A 3DCJA 1OOEA 1VRCA 4YCMA 1Z7BA 1ID1A 2XUQA 4XQGA 4RTRA 3KQTA 4CF4A 1SHTX 4E5YA 5K1SA 3HA2A 1JEQA 1GRCA 4LWQA 4MQ6A 4XFJA 3BTSA 3ZH2A 2WHPA 4U1RA 4PPGA 4W5NA 3E5HA 4UU8A 3ST7A 5DM1A 4X44A 4DA0A 3ZH9B 1G60A 5KNLA 1TFRA 1UOOA 3UT6A 2PBRA 3OD1A 1JPNA 2CNWA 3R0QA 2ONJA 4R2IA 1ONPA 1RYHA 3WQSB 4MLZA 1U2DA 2BJHA 5EJGA 2JARA 3G0BA 4MV0A 2VHQA 5IVIA 1E1RA 4JSTA 1UL1X 1DO0A 1YAJA 4UNIA 5C32A 3VRHA 3CIFA 3DA8A 4U6NA 5L53A 3GP8A 2YJ6A 4U2EA 3AUXA 3ULKA 4C0QC 2XOKD 5CFQA 3GC6A 1WXDA 3WL4A 4OTZA 5FOSA 4EGQA 4E3ZA 1H3NA 1KORA 5SV2A 4DPMA 2DETA 1S8FA 4Q93A 3DKPA 3QV2A 3G8CA 4JJAA 5DM2A 1QC5A 1WMEA 4BAUA 5FH9A 2F48A 1NUPA 2X4DA 4LJRA 1GL9B 1SVNA 2D8MA 2GEBA 2JFOA 1OFHA 1KP3A 2WIJA 3C8ZA 4X60A 4J76A 2JAHA 4JXZA 2ILTA 4ZO9A 4WZAB 4IH9A 1C7ZA 4XIGS 4NEHB 3UT5B 4QYIB 2C7PA 1U90A 3L0ZA 3OEWA 3ELUA 1TRHA 3L7IA 5C7OO 4GYJA 4MS1B 1EU1A 4O2BB 2BFAA 1GGEA 1RC1A 1SUBA 2WJGA 3WIUA 3LUKA 5L4NA 2BKXA 1XTBA 1SVIA 4MB6A 1B3RA 2QN1A 3UT0A 2WTEA 2NV0A 4MV7A 3BWBA 2DULA 4UOQA 5JNVA 1P39A 4GOJA 4Z53A 2BFDB 2I2XB 4L16A 4X64B 5SYNA 1GNVA 3ETJA 2I6UA 3PWZA 2Q45A 3BXZA 2C8VA 3H05A 3PI7A 4MQMA 4ZVVA 2IU0A 3VC3A 1K5PA 5C4MA 1QGUB 3FIJA 2OGWA 1V48A 3IVXA 3K9NA 1SUPA 3AKZA 2OHFA 3HFSA 4ML3A 3NM5A 2HK8A 1MJHA 4PCAA 1LUAA 1TD1A 2W22A 3HUDA 3MT9A 3PQ7A 5JZSA 1C9MA 3FOFC 1JHPA 5JI3E 1N0HA 2HHJA 3CVWA 4P3YA 2PZJA 4BMZA 1S5PA 3JZAA 5EXTA 3NS7A 2VJCA 3QTBA 5KTSA 1A27A 1C2YA 4BNIA 2DGDA 2NADA 1NPYA 4QE3A 1EM8A 2YHIB 4TMKA 3AF6A 4Y1RB 3DZBA 4XWYA 1MGOA 1VL2A 5EUQB 3HJCA 1OYOA 2BISA 5HIMA 4P3OA 1LSSA 1Q7EA 1FXUA 1U0JA 5J23A 4I36A 1GRNA 4G9EA 2MOKA 3KDSE 4KU4A 4N6GA 3FD8A 1NONA 4U3JA 2WVHA 1YH3A 1N9KA 3CMCO 3LFUA 2ODPA 2IYLD 3WKBA 3RTDA 3LWBA 3KQPA 4YJHB 3NXKA 2DMRA 3GEHA 5LB2A 3R44A 4YAOA 1IEXA 3SQWA 1N5MA 4OBBA 4AMBA 5BNTA 3PC8C 4Z0NA 4ZRNA 3KTDA 4KDRA 1B6GA 1EFRD 3CT4A 4C7KA 4HDMB 5KTRA 4NCBA 3JAMA 1YVDA 4IQGA 4ZDKA 4ZI5A 1XZQA 3DH0A 1BGXT 3CNEA 4B6GA 3C24A 3DHYA 4PLZA 4PG8A 1QQTA 3QKRB 1RT9A 3L8ZA 3B3JA 3F67A 3AOEA 4IX1A 1JDSA 2RARA 2OQVA 1Q74A 5HQ3B 1GT6A 2CLDX 2BTQB 3VDRA 1UKYA 5EIOA 1V26A 2W8BA 5ULLA 4X1IA 3RAGA 2ODAA 4A2CA 2FZVA 4HMPA 1FYFA 1AKRA 3STWA 1XPRA 4XDZA 1GNLA 2C4UA 2O2CA 3OZCA 2WE8A 5K01A 4BQNA 5DTQA 3BFKA 4S05A 1UMBB 2A8YA 4FOOA 1DQNA 2XBUA 5ALEA 2FDCA 4JC4A 5K8VA 2YJ5A 3I2HA 1MBZA 5F1KA 3M3DA 3CG0A 1DMRA 4BO1A 2PZKA 2R6DA 1U9CA 4U5QA 2O8CB 4D4IA 3JWIA 1ZQ9A 1QOPB 4B3XA 3NHZA 5FFFA 3NOVA 3Q9LA 3MWGA 1TC2A 4IYJA 3U39A 3W3ZB 2Q07A 3ZU5A 4AX4A 4BX9A 2C2KA 1JILA 3JPWA 5LXTF 2GN9A 5AHKA 5HQTA 5ITVA 1FW8A 2CD9A 3AG6A 3BIOA 5EHQA 3U4CA 3TTYA 3WMEA 5KS2A 3K70C 1NXXA 2HRZA 2OFWA 3TIVA 5TY0A 3PLRA 1UZAA 4RKWA 4CEJA 5LIPA 3I0ZA 1Y9AA 3RSGA 1PVOA 1U3VA 3B3FA 3UUGA 1KWGA 3K5IA 4ZREA 4NMLA 2ZCUA 5AI4A 3QBJA 3BXOA 4Q03A 5IJAA 2RAVA 3C1UA 4LZPA 1U2EA 4WZAE 4X7PA 4EG3A 3O9MA 5FADA 1HETA 5GY7A 2XUIA 1SCDA 3E9MA 5KKCA 3I53A 1TQ6A 3LCCA 1V16B 1GTRA 1B15A 3EBOA 2WYHA 1X9IA 2E82A 1DIGA 2YFHA 3AESA 1LDBA 1RS0A 1SB9A 1Z88A 1ZNQO 3HLKA 1WSDA 3NAGA 4A8PA 2VDRB 4BLTA 3HNOA 4HNQA 4BCDA 4YRIA 3IUPA 4F93B 2C3YA 1TW3A 2GN1A 3OZ7A 2BKUA 1LF5A 1Y9EA 1ZUNA 4TZTA 4YCJA 1SHJA 1XAIA 2Q6VA 3C41J 3MSXA 3I30X 2W2VA 2BMJA 3K35A 2VO1A 2JJ2D 3QVGA 1XWWA 5FD8A 4JJZA 4R9RA 3JS5A 3ZZ1A 3HU5A 1ZGJA 4R3UC 3SR3A 1NBME 2FY8A 5A7HA 4FB5A 3TRFA 5EQDA 2O3QA 3AILA 1NAIA 4V0OA 3UMBA 5U1PA 3UC9A 2YWBA 1J4AA 2QD4A 5ERGB 3CLRD 1ODFA 2DYKA 4H7IA 4AS3A 4BV3A 4HDOB 3PL1A 5ALZA 3L84A 4XWOA 4Z3DA 4YMGA 4RDXA 2YDXA 3OIFA 5EZYA 5LZ2A 1AC5A 1ISMA 1DBWA 1MJNA 1M2VB 4G89A 1DLJA 4CTKA 2FRDA 2V7WA 3AX6A 4M0KA 4MITA 4UHJA 3T7CA 3UOAB 3B1ZA 3W4JA 3M70A 5CXSA 2GK3A 3BHJA 2IYXA 4FDUA 4MV8A 3OG9A 4O0LA 1O9GA 1WZ2A 3F7MA 4UEKA 1QRRA 4FCCA 3JD3A 1QHFA 3F6BX 1PZFA 4FKBA 4DZRA 4ENQA 3CZQA 5T7BA 3WLNA 2MJLA 3CX4A 5H59A 1IN1A 3SE7A 4I3FA 3KJZA 3I01M 5LWHA 1IAVA 4HI0E 1BMDA 3TB6A 4CMCA 2QUZA 1ZK3A 2FTKE 2WAOA 1TJ4A 3EE6A 3DFIA 4WLOA 1DEXA 2G5CA 3K0HA 3RHFA 3E3OA 3NTQA 1BRMA 1VZ2A 2AZTA 2PMFA 4Y2UA 2XADA 1XLVA 2R6AA 2W6OA 4QELA 3EMVA 5GM2A 4Q48A 2ILVA 5I7OA 3L93A 1UR5A 2G1AA 1WRBA 1ZK2A 1JYFA 1IY8A 1VSUA 3MCAA 1RAAA 4ALIA 1AN9A 2VC2B 1COWD 3KSBC 1VJ0A 2OZEA 1CZLA 2NXNA 4RY0A 3VR4H 5KNCA 2I2AA 1CY0A 4XSHA 3CURA 3BCRA 1KBQA 1W85A 3CKLA 4QL3A 4W9NA 2IE8A 4LSMA 2FPWA 2PZLA 3OOWA 1DO8A 4OQQA 3SI7A 3GI1A 4O2BA 1O95C 2G07A 1G6HA 4IIJA 4QTTB 1JWAB 5LA6B 4FBLA 4RPKA 2I76A 5L40A 2C9DA 2ISCA 4UASA 5I01A 2D2EA 2IUTA 3IAM6 3NT4A 3OU6A 1IQUA 4HN4B 1R6UA 1XVUA 1MOZA 4BX3A 2OCLA 3BWVA 1OJLA 3TRIA 1TM4E 4BTEA 4W9MC 3T5AA 1KOGA 1XZDA 4RW0A 1B26A 3X1YA 1TYEB 1XAHA 2YHAA 5COBA 5KYYB 3F47A 3P26A 4QARA 4UZSA 3D8NA 3PE6A 1JVSA 3QVOA 1A5ZA 5CTJA 1GZUA 1UQUA 3QHAA 5FLEX 4B3SB 1I3CA 1H93A 5ELMA 3DXZA 2C2MA 1XDBA 3LQ4A 2P69A 4OQXA 3X43A 4OHXA 2H1HA 5DYTA 1EJ6A 2PKWA 1QIGA 2FN9A 1QHSA 1JKXA 3R40A 4HLDA 1CD5A 3E9ZA 1IUKA 3I01A 4GOND 3S44A 1UEIA 1U7WA 1W5SA 1XWFA 4X61A 4CQLB 2IDKA 5IXSA 4KL8S 3CX3A 4ZT6A 1E62A 1O5IA 1QH9A 2XTZA 3IDSA 5CVCA 3MAAC 4H6XA 2V7TA 2ZXUA 1VHWA 1NC3A 2DTDA 3CM0A 2O8FA 3R7BA 3GGSA 3JQ8A 4ZK2A 4TVKA 5I47A 1LFDB 3BH6A 2BMEA 3GLHE 3Q1KA 3G2NA 5CBKA 3Q2KA 4WOKA 1NYLA 2GWRA 1A9PA 4L8VA 5LB4A 4CGYA 1XKTA 2VRCD 5KOHB 1VHTA 1MO6A 2Q6IA 1OI2A 4NBRA 4IHJA 4A3SA 5HSGA 2REQB 5BYKA 3G0IA 1XD9A 3A4TA 3KOXA 3QVSA 5EJIA 5B3JC 5JQGF 3RYCA 1NC1A 1BWRA 3G59A 4MUEA 4W8HA 1BS1A 3DO5A 3SEZA 3DQPA 3GEGA 3C3BA 4DLLA 1A69A 1E1RD 5IVDA 2DQZA 2YVKA 2F3UA 2FZ4A 3LBAA 3NGMA 3KLNA 3PUJA 4QFMA 4Y2GA 3HU3A 3MWDA 3ZIAD 3PSAA 3D59A 4MCHA 3DTVA 4PZDA 3UQZA 1QDUA 3I73A 4HYQA 1YI8A 3A2MA 3E9CA 4MVYA 2FPIB 2RGDA 2OC9A 3SBEA 2J87A 4H9GA 3NKFA 1TVMA 1P2FA 2M6SA 2VNIA 1VL6A 2YZKA 3HR4A 4LPKA 3PEVA 4YRFA 3SDSA 3UOGA 3OETA 5B2EA 4NMXB 3ENWA 3PQ6A 4KQFA 1XJQA 3AVPA 2XNSA 1XZIA 3OFJA 1IXZA 4TKUB 3WXBA 3A6LA 5HZKA 2ROQA 3WZMA 3LUCA 4GNKA 5JI2E 2W2QA 1UOEA 1Y8QB 2CWWA 5FUXA 2PSJA 2Z3ZA 4CM9D 3ZWQA 2BUBA 3GT0A 2GZSA 4B44A 2BGLA 4AY4A 5CB4A 1RRKA 4FEEA 3EXEA 4UAJA 1FEZA 2WNHA 1VL8A 4F8JA 5FIUA 2JFWA 4ZFNA 4RTPA 4I1OA 4KXQA 3URMA 1LVUA 2JFVA 3LVBA 1I4WA 3IXLA 2ZJAA 5JD3A 4GMXA 2ONCA 2FPGB 3PC4A 2Q5HA 1AT1A 2VK1A 3F2VA 5H3HA 2X5OA 4NHOA 3MHPA 1U28A 2XCOA 3W6PA 3ZWXA 2JLYA 4OHFA 1OKKD 4Z86A 1RD4A 1YRQA 2F59A 2H11A 3AFNA 4XJXA 2HC9A 3GJ7A 4ZCQA 1WDMA 3RFTA 3TZHA 3DP9A 4F1KA 4EATA 1QNLA 3DBVO 1N5RA 3ZE1B 3DBRB 4BKQA 3OIWA 3INYA 4ZU3A 8OHMA 4OL9A 1SWWA 4GX0A 2WU4A 4N6NA 2OR3A 1IVNA 1WXGA 3EAQA 3H6KA 4IBOA 4QUGA 1T36A 1XD2A 4MPRA 4Q9JA 3EASA 2YY7A 3S40A 3P9IA 4M0EA 3WC4A 4E6EA 1N5DA 2GFHA 4LY9A 5DMHA 2GF0A 2FLWA 2GJ4A 2EV9A 2GM5A 1L4GA 1GZDA 1XZGA 4LI0A 5ARCA 4RDIA 5TB5A 1J07A 2A0YA 1CQIB 5E2BA 1P7WA 2IYZA 1ZJJA 4IIHA 4J3NA 4EHNA 2MSDB 5EJ6A 2ZT7A 3GJ8A 1RHKA 3H13A 4PFSA 4X20B 2BGUA 4ZVOA 1N2GA 3LWDA 2AVNA 3MIIA 5AOBA 4YV1A 5AVRA 2W2PA 3HVHA 3ZD6A 1SUFA 1X8KA 3OA2A 3I9KA 3QUAA 3JX9A 3BORA 3F46A 3B52X 3EULA 2V7PA 4AJ1A 1R6XA 2W6IA 1LQ2A 1J9ZA 4P34A 1ZHHA 1PFUA 5A5FA 3BICA 3ZVNA 1PHPA 3TLGB 3FHOA 3KJNA 5FI5A 2CKDA 4J49A 1SPBS 2VT6A 1FRFS 3PQFA 4E5VA 2V96A 5E6RB 1HKUA 4MIKA 2Q1TA 2RHGB 3COSA 4G0VA 1I1NA 3AIKA 3GH3A 4DSAA 4RH0A 4LPSA 3N59A 4JENA 3ENZA 3SHTA 5HGJA 1CJVC 5GONB 3Q3CA 4UVHA 3GVIA 2ZVDA 1X7WB 4LTMA 5EZ5A 3TH5A 1RFLA 2H51A 5I8WA 4P35A 1KMIY 4N3AA 5AXCA 2BFFB 2GX6A 3F98A 4I5FA 5K2OA 3PGXA 5LP6B 3GFFA 4HQKA 3NB0A 1ABBA 4YP0A 2R1ZA 5CDUA 3ZIDA 2G71A 2MSKA 3OQIA 1F3OA 2EFHB 1PG5A 4M6WB 1W1IA 2A78A 5AUPB 3WA7A 5E4YA 1DKOA 1DIBA 1HOXA 3C0KA 4C30A 3EXIA 5AVWA 3EUAA 1F8GA 1QF7A 1JIJA 5B6IA 4BV8A 2AEEA 2Z2YA 1TGYA 3D3JA 5I5EA 4MGEA 5F9MA 2Y0EA 3PJDA 3RVSA 3U31A 2FQQA 5DOVA 2Y1OA 3NIFB 1CUFA 2IELA 2Z2JA 3H17A 1CQJA 2VDWB 2WWTA 3G82C 3DBLA 4HDKB 3ANTA 1C9NA 1GFWA 3K72B 4XIYA 2W5UA 4H0CA 1G5RA 1XEXA 3Q87B 4GDMA 4U7DA 3QG5A 2IUFA 1JQBA 1WHTA 4PPNA 1USUA 2Q21A 4C08A 1ZCZA 4HNVA 1JHVA 5CXUA 5T57A 4DA8A 1XNJA 2H9IA 1QFXA 4AZSA 4JC0A 1ZA2A 2B4KA 1EWKA 1U5CA 3F0TA 4QJ5A 3GLKA 1KBOA 1I3KA 1RNLA 2YJNA 3NNNA 5LZ5A 1O7JA 1WW3A 1K66A 2LVBA 4N76A 1C3LA 3PGLA 1LX6A 3IQGX 4IHAA 3NT2A 1MV5A 1OHHA 2NYVA 3NW9A 4G81A 4EVSA 3GLUA 4KR0A 4FI3C 1WCYA 4H15A 3MCZA 3KLBA 1HA3A 3PQ8A 4WKCA 2OENG 4PRYA 2VF2A 5T3YA 4GSYA 3V1MA 5HKLA 1ZKDA 2J7KA 4BOYA 4DKJA 1GG8A 4BNJA 1Z5OA 2EKPA 3HY4A 3USES 3VO1A 3SYTA 2PFGA 3VPDA 2V45A 1YZGA 3RFCA 3BJMA 4P2GA 4CU2A 1FSPA 1MRZA 4Y0NA 5LOVF 2WFMA 5SYAA 3Q0EA 2AC7A 2FMTA 4H6PA 4YN3A 3ZWDA 4P32A 1CRPA 2IYVA 1AQLA 1SU7A 2BELA 2A9JA 1DXQA 3AW8A 4HQ6A 2HPHA 5GONF 1FXSA 3PC2A 4CHTA 4WJLA 3VISA 1NLFA 3L1UA 1XXHB 3F3MA 2XW6A 4DV7B 1ESNA 4UBNA 3RR2A 2DFTA 2PQ6A 3JWPA 3NWOA 5CA0B 1R0YA 2IYUA 4K1XA 4RLHA 1H0RA 5FULA 5AW9A 3ZW9A 2GTPA 5FEMA 2J6BA 1W4CA 1USIA 1VRWA 3R20A 1I24A 2EZ9A 4FSXA 3MS2A 3CX6A 2DWQA 3ETDA 3D1LA 1VKZA 5M2QA 4UNRA 1OWLA 2HF9A 1ZXBA 2X6QA 3JZMA 1BDBA 3CXUA 3CLTC 4P4UA 5FP0A 1RRCA 4RACA 3DDOA 3P5SA 4K3VA 5KNCD 1V7CA 4ZRDA 1TKBA 4FFBA 4FFOA 1E6MA 4TV9A 4GBMA 1GQOA 4GOMD 1COWA 4B3JA 4NYMR 2Q7XA 2WVAA 3O1HB 3H42B 4MVJH 3UK0A 1SJ9A 4FZRA 4E11A 2XUOA 3IT1A 4HGOA 5G0UA 2RC6A 2GVZC 1AMNA 2ZAOA 1Z8FA 4C2TA 5AI8A 1DBIA 3QHPA 4M88A 4S3MA 4II7A 1DJOA 5AKGA 2J48A 5GV7A 5BQFA 5GZ1A 1T6XA 1BC5A 1ZITA 2P40A 5ER9A 3C3CA 2GTIA 5CUQA 1FVOA 1EK2A 3AEZA 2VTBA 3QU5A 4FX2A 5LVAA 1U0LA 3IHLA 2I4NA 4QBHA 3W7VA 2R4UA 2J9RA 3CQ9A 3KOYA 4JP2A 3CKMA 4IUYA 3Q41A 1KZ4A 2JI8A 3IH5A 4J0EA 1OV4A 1RAHA 3ND6A 4RMIA 1L6RA 3V1LA 5IZ4A 4XUDA 4DEXA 2QAGC 1PS0A 3KYCB 2Q5JA 2B0CA 2QUJA 3W79A 1YA8A 2A0XA 1DXHA 1PJAA 1YZVA 3GT4A 3HUUA 1J2EA 2A7XA 3LK7A 4FIDA 4IIXA 4JROA 5I7WA 2W98A 2X9QA 4NABA 5MGNA 3PPVA 3LCMA 1IVYA 1JECA 3RTCA 1PNTA 3D6NB 1RZUA 1K8YB 4X8MA 3OLWA 3VOSA 4WJKB 1KAMA 3H65A 4KN9S 5E4TA 2VPPA 4IV5A 3TTUA 2ZCJA 5JADA 4NWIA 2QI9C 2DKNA 3JQRA 4H31A 4BFVA 2TYSB 1W46A 4R0NA 2Q29A 3V9AA 5CA1F 1S9DA 3SLRA 4MHSA 2O2JA 3K2BA 4Y1FA 1QH0A 2HA4A 4QTZA 4C4OA 3AKCA 2VUTA 3KTAB 1WPXA 2POCA 5EIAA 1D6JA 3PIIA 4NESA 5J2TF 3MQ2A 3ROEA 1THTA 3USCS 4DDHA 4ZGBA 3K0SA 4GXNA 3SKYA 3ZQJA 3C3YA 1JJIA 1IBMB 1XTIA 2YWEA 4OUKX 5SZJA 4HYYA 4JI6B 5IH3A 3FBTA 3TLBA 1DDIA 4C14A 4ALMA 2BEVB 3ISVA 4ZVKA 5I6DA 2X2OA 4RPHA 3L7BA 2NUTA 3UH0A 2G9VA 5C1BA 1OAKA 2D7CA 3CE9A 3EVTA 2CK3A 2DM6A 3FUTA 3T7IA 4RUKA 2CLLB 1TAQA 3EEBA 3ZDFA 3ZGXA 3QE4A 4ZKDA 3D02A 4B75A 5IZCC 1MJ5A 1U7XA 1Y5IA 3DT6A 3OT1A 3TN7A 1OIXA 3E5NA 4BWGA 5JZOA 5EE5B 1FX0A 3SX0A 5FUMA 1NJSA 2Y4OA 5EZYF 4R3NA 2C98A 2YZ2A 1GSAA 2C9OA 3BKWA 4Z9XA 4PSAA 1V47A 1KE1A 4KIWA 5C52B 4B47A 2ZIEA 3WXMA 5HRUA 5ALKA 1DX9A 2W2LA 5L95A 1PEYA 1Z4KA 1ZRHA 1KIAA 5FF9A 4DE5A 4F2HA 4G56A 1WSAA 3PV0A 1NOIA 4MVJM 4JVLA 1Y6FA 3V00A 3GOQA 4MWDA 3V48A 3EY9A 4M83A 1USGA 1JQKA 2OA0A 4ZT4A 1A72A 3U7QB 1GQRA 1IM8A 1P6XA 2SKEA 4L78A 4ZAXA 3VR6A 5C51B 2NP6A 1UJMA 4D0SA 2IY9A 4JXXA 3N6VA 4OSPA 3T12A 1G3UA 1RI3A 1ZVKA 3BE4A 4FGJA 3S2SA 3SF8A 1QU3A 3BBPA 4U3JB 1FS5A 2DECA 3F3SA 2WABA 4BPBA 2DLNA 2PVPA 4I5IA 2I03A 3LHSA 5BQPA 2HSDA 1YQQA 3AIOA 4QDKA 3V6MA 1O03A 2IEGA 3TQSA 3ZLTA 2RCYA 2DFKB 4KHPB 2AFRA 2GUGA 4GRDA 3IBTA 5HKKA 4Q3AA 3RWOA 2BFPA 1ODTC 2FLVA 3L8HA 1L7RA 4P81A 3GV0A 1I6WA 3BE6A 3H5TA 5JJLA 3P9ZA 4GLOA 5JH7F 3ME5A 1AMUA 4M7WA 5FBZA 1XROA 1U0TA 4DLXA 2LGJA 1YTUA 1B93A 1IRIA 2HI0A 3AI1A 2ZRKA 1M75A 3OEED 2QI9F 3O31A 1DKUA 1IPHA 3TOCA 2G8NA 4B81A 1FOEB 3V2UA 2UZ3A 1JUDA 1FP4B 2ODQA 3ISJA 3UVEA 4ZMBA 4XGRA 1QMGA 2XVZA 4LZOA 3CIOA 3CVVA 3QUBA 1WHSA 5JNRA 3CG4A 1QZXA 3PXAA 2M6KA 3TL3A 3LKZA 3W4KA 4DLAA 5K51A 1LZKA 1PR2A 2N9UA 3KAKA 3P9KA 1L5VA 2XUJA 4HR7A 4J3JA 4OVKA 1FIUA 3U5TA 1VJ5A 5DNDA 2JJ8A 4R81A 4LJ9A 2OGSA 3T1HB 1OB2A 4IWXA 4H2DA 2UZ0A 4NPAA 1ZJZA 2PAFA 2PH5A 2CV1A 4DWVA 2G28A 2JB9A 3H18A 4KLRA 4KOEC 4Q7MB 2IU6A 3SJCA 3ZBUA 5JSHA 4UKDA 5JS6A 2I65A 4CQLA 1GITA 1VMKA 2FSVC 5SY4A 3VAZA 2JCYA 1G59A 2J3HA 1WTCA 2DKOA 4QASA 3N9IA 4ARAA 1JQ5A 2YZGA 3KZ1E 1WXQA 1DWPA 3GJ5A 3FM9A 1JMVA 2HWYA 5L7YA 4CM7A 1NUAA 1OX5A 1JHOA 2QM7A 4IKOA 2YY6A 2RGWA 1QGED 3S29A 2VSXA 1G6KA 3FPJA 1DFIA 1XOIA 1BFDA 2HH9A 2JVKA 3P4UA 4GPEA 1E8NA 3FG9A 4LQ4A 4KOAA 3EYAA 4RVNA 1DIRA 4ADSG 5J4VA 1OB5A 2OD9A 1YU9A 4IUBS 2OCDA 1OLUB 4KKVA 1T4MA 3QXSA 3VR5H 3SDZA 2EBHX 3GZ4A 4UXIA 4ZCPA 3ZIUA 1BVYF 1M8PA 2VPWA 3HE3A 4ZDJA 3W5BA 4F04A 2FWMX 1U3WA 2HFJA 1QHHB 4JI5B 4DIOA 5DM60 5IS2A 3A1SA 2BZGA 1QIHA 3ED1A 2YQ5A 3PP8A 2XTNA 2Y6UA 1DOZA 1RHJA 4JLOA 4QPDA 4PV7A 1TUEA 2P2CA 1XZBA 2VL7A 1N2ZA 1BS9A 1VPVA 3RJ9A 1SOMA 3HACA 4GT1A 1DAEA 5K99A 2IYFA 3ZU4A 1G3QA 1J7JA 1B2RA 2OEPA 4I1UA 4Q82A 3WLTA 1YVUA 3KQOA 1FF9A 4G4JA 3JATA 3ZLVA 3U6BA 4UJ5A 1GAEO 5CYOA 4BWVA 3NHFA 4GU5A 3WADA 4ZAVA 3ELBA 4CQMD 1ZM2A 1MENA 2R2GA 2VYQA 4F1JA 1L8LA 5CTAA 4IUCS 1UFKA 2P68A 2AOTA 2WJIA 2ZE6A 1RRVA 4FBGA 3V7NA 3RC8A 4HLCA 4MRRA 5JWOA 4JLNA 2HLNA 3DE6X 3H4VA 1JG3A 1KFEB 1SUAA 1T3SA 3QBEA 4RSHA 3PVZA 4D02A 1WLYA 1U8TA 1NQ5A 1X80B 3P0RA 4EFDA 5DNUA 3BPSA 2J41A 1YVRA 4GP7A 2KBFA 2NTYC 5JR3A 4DBLC 3IULA 1IOVA 3DTNA 2VHTA 2OAEA 3IQIX 1LC0A 4FD3A 2BDEA 4ZO6A 3PQ2A 2FEPA 4JOSA 2DLCX 3TO5A 1OLXB 4RZ3A 2RHOA 1CY8A 1J8YF 2BVNA 4EY5A 1RYEA 4TXHA 1F5NA 3M34A 1ADYA 5KJ1A 1GR0A 5M34A 1QK4A 3HV0A 3AF1A 1GILA 1H8EA 2H1LA 1TKCA 2AMVA 4FP9A 3I1YA 3QPUA 4WKGA 5D86A 3FMGA 3QWIA 5EKDA 4F5EA 2JHCA 3MIZA 4BATA 1U63A 5HS6A 3EVFA 4ND1A 1YZUA 2FCAA 4PG6A 1MIOA 4QUIA 4A26A 2EFYA 3U4MA 1SFRA 4JLSA 1MW9X 1UWVA 3OTQA 4CNBA 1GTL1 1B8NA 2V0CA 2W37A 3BGDA 1XQYA 1U7TA 2N3ZA 2OK8A 2ZBEA 3DLCA 5AJHA 5IBRA 3RBAA 5TPWB 2DWCA 3TRDA 4DCNA 2R79A 3D7MA 2YFYA 3E81A 1F8YA 4PW0A 3BHIA 1L5YA 4BCBA 2BEJA 4RTLA 3TMAA 4L8GA 4M98A 3HBFA 4NPCA 1XIVA 1M33A 2Z9CA 1FQWA 3B8EA 4J1TC 1TJ5A 3JD2A 5FQOA 1ZNXA 4AIIA 1F14A 4P4LA 4KDCA 2Y2VA 4ZAGA 4CMBA 1KQNA 2GM4A 4BMVA 4PM4A 1GZHB 1OYWA 4OH1A 3GLFB 4MUXA 3OMXA 5PNTA 1Y6JA 2A1IA 3VAAA 1IBCA 5KQSA 3OKAA 4G67A 4H3KB 1CEQA 1CJMA 3L4EA 4GZ3A 5TMEA 4HKTA 4F92B 1X7XB 5BY2A 2N1BA 1N32B 3I9LA 3LMKA 3T8YA 1CQJB 3P27A 2GEKA 5BN1A 4JLJA 2VCYA 2JLAA 4L1KA 1BFUA 3AGQA 4QOEA 3ZE0B 4BLUA 1R10A 1NJGA 1T9KA 4I1SA 1ZVMA 1H9CA 4CMEC 3NVMB 4ZOLA 1XRQA 3DE4X 3KT0A 3WRXC 4DQ0A 3AL2A 5ADHA 2P4SA 1DEAA 2Q5FA 2P62A 1ZNWA 4A0FA 1TCVA 4UEJA 5I7AA 1SVLA 4O4IB 3A6KA 3OEHA 3V2IA 4RESA 1CUBA 1QLWA 4GI5A 4NDZA 4E2XA 4CR8A 4KH1A 2PUDA 1Q0RA 3B9BA 1K5GA 3IFSA 1LBHA 1NFQA 2Q3HA 2EBUA 3CUTA 2EHDA 3KYCA 3WX0A 2GN8A 4TTQA 4WY2A 4HTAA 4KSCA 1XSEA 1XQ9A 2I4OA 4MQFA 5BSRA 3SZOA 4A23A 1FFCA 4GZLA 5FBKA 3GXBA 4IQ0A 4XLTA 1E3LA 3RT7A 2AW3A 1C4WA 1B74A 1EGVB 2NU6A 2QE7A 1M6HA 2WUDA 3MWKA 2G83A 1WOYA 3EGWA 4G1MB 3B2QA 4OGKA 1UM9A 4UAGA 1XK6A 3ZGYA 4HUJA 4LXYA 4I9HA 4P80A 4BBPA 1NP6A 2GETA 1GO2A 4PYMA 4NG5A 4RPLA 5ERYA 5EJ8A 3HJGA 1KVRA 1VHQA 2EX1A 3N07A 3QX9A 4ZVMA 4AF6A 2QRZA 2QDKA 1O97D 3OZVA 3K6RA 1NM5A 3IIEA 3PHBE 4EY7A 1PK8A 3QFRA 4D4MA 3OIYA 1GYQA 2WSYB 1ESCA 3OFVA 4TTPA 2PBFA 3TVYA 3WP0A 4CCAA 4BZWA 2D2XA 1WZEA 1ZJ6A 1BJRE 3TQOA 2V6FA 3OMLA 3I9V1 3KBOA 2Q3DA 4MPPA 3V80A 1GSOA 4CIVA 1GTVA 3DKRA 1R4AA 3GLHB 3LUJA 4B4KA 1DELA 2ERXA 2HSGA 2RHHA 3HKDA 3O1LA 2FHSA 1PG2A 2I4LA 1P1JA 3AU9A 1BXZA 4MPDA 3A1UA 4OP1A 3I3OA 2OD7A 3CMMA 4RK6A 2AMFA 2EJCA 4EBFA 3DJYA 3IBSA 4KODA 2W42A 4N5MA 1FX1A 5JSZA 4NH4A 4LVOA 2NXWA 3RWBA 1EXNA 1Z17A 3PT5A 3HZHA 5HCUA 4DANA 4XFDA 2WAMA 2J6CA 4PX2A 2RONA 4X8LA 5AHOA 1G7RA 2OZLB 1ODSA 2QQFA 2A5DA 2JRLA 3NIDB 4GPZA 4PIPA 3E7XA 4U39A 1JP7A 1J2RA 4Y2VA 3IUJA 3B1FA 4XXHA 1HTTA 3TZEA 1DAKA 3LDUA 3NDIA 3OOEA 4LC1A 4KR7A 5K6AC 2X40A 1H42A 4TN1A 3S5UA 3TAUA 2VYNA 3UAOA 4BPRA 4DRYA 5AVZA 2O8CA 1E1CA 3MRXA 3R5FA 2FWAA 3ASUA 4OHBA 3UUEA 4CLEA 1LLQA 4NEQA 2F8TA 1G38A 1P7PA 1BFKA 2ZUCA 3H2KA 3TI7A 3AV0B 4FWIB 1NPTO 3M83A 4GGPA 4RZ2A 1XMOB 1PJLA 4EI2A 3GVCA 4N1AA 1OIWA 4GLBA 4QYSA 3WK9A 3FX2A 3NV7A 4OHMA 2G0NA 3IX7A 1ZCBA 4QSMA 4ALLA 4CMGA 5KTTA 1JFSA 4R16A 3CUVA 2PU5A 3KFLA 5ARBA 3HPRA 4JUDX 3AFOA 3F2IA 1JBKA 2OBXA 2H57A 4KJZA 1GNPA 2OQ2A 1ISGA 3WGGA 1W5FA 3T34A 1NFFA 1MRNA 2YJGA 1TAUA 1G19A 2R8YA 1C1XB 3OCVA 1UPAA 4TOIA 3F3YA 1RWBA 2ACVA 3AYZB 3EXG1 4NECA 2AI3A 4RL6A 3ZWKA 2XNKA 2E5LB 1SCNE 4DR4B 3LDHA 1MGPA 5BXQC 4Y7CA 3RIMA 4Z7QB 3F6RA 2JVIA 5JNTA 4LBZA 1JEOA 4QAJA 4AMUA 3LDFA 1XNRB 2YYYA 3NYIA 1G18A 1QH1B 2NXCA 4NVRA 2PMCA 4HWOA 2AUTA 4GDFA 2MINB 3HDJA 4YC7A 2I4TA 4AU1A 1ZPDA 3K0AB 4YEDA 2WD7A 1GPAA 4FLFA 3WGTA 2PRJA 3DV2A 3AETA 2FSPA 2KE5A 1EUCB 2ZSBA 3GGJA 4MEAA 3ZQKA 4BNLA 2DTEA 2QRHA 5F7OA 1A4IA 1LI4A 5MDHA 3REQB 1A1VA 2IW1A 4UATA 5TGTA 2QBYA 3BK1A 4IDHA 1QJ4A 4I1RA 2JZNA 1BW9A 1MB2A 1Z36A 2C3OA 1BJKA 3R09A 1O95D 4QWWA 4A9AA 4A8JC 5A02A 1QHXA 2I1QA 2OO3A 4RMJA 3ORSA 3H1PA 1PR0A 4M1YA 4MR8A 2YHBA 4O59O 1KU0A 4Q3NA 3EG5A 2CY0A 3ITDA 1QZ3A 5FPQA 5C35A 1SUSA 2OESA 4IL5A 1TO1E 2QD3A 3PL5A 4LIPD 5AT1A 4D82A 2XCLA 3D3KA 3G2LA 3WYFA 4CL8A 3HSSA 3FPSA 3PNKA 4HDNA 2IS2A 2R7LA 4RADA 4G0ZA 4UTOA 1TU3A 1JDZA 2N0SA 1KAQA 2RGAA 4D92A 4P84A 3STUA 4QDTA 2V9CA 3ZCQA 3N8NA 3AUTA 3WLEA 4ENRA 5BV2P 5IKPA 1B6RA 2AZ4A 3A3NA 1HT1E 2B3TA 2HU2A 5EA2A 2HADA 4V1CB 4WESA 1RWOA 2XTMA 3AIIA 1AKVA 5D5QA 1IN8A 2BH9A 4RWZA 5FYDA 1HNZB 1HG0A 1JSLA 3W3AA 4PR3A 4WKPA 3AF0A 4KUEA 3L92A 4RJ2A 1NDQA 3ON5A 4ZZ1A 3W2TA 1M0WA 2EIXA 3PNSA 3FB1A 2VF7A 4J0KA 1E5LA 2H7YA 3AKDA 3GJ4A 4M7OA 3SY8A 4B4WA 1QQBA 3GDWA 1TLTA 4QOJA 3Q3JB 5DNVA 5ICFA 1JE0A 2P6RA 1WCV1 5CDTA 2J9GA 3PVSA 2V5VA 2GCGA 4H1UA 1UBNA 3UUWA 4YFVA 1NU8A 2HXYA 2ATIA 1XX6A 3RRJA 3OO1A 4IH1A 4FC7A 4JUCA 4NJEA 2G0TA 1II8B 3IPYA 3ZI0A 4DGQA 4BYMA 3VDNB 1QH1A 2HO4A 1Z6GA 4EJ6A 5JHHB 1T0HB 3FSRA 2HXSA 2AJTA 5BV0A 1RQRA 1YR6A 2AN4A 2HNAA 1MA0A 5JSKA 3QIAA 3SQNA 1XMJA 4HVLA 1PFQA 3NEYA 2Z2ZA 1T8WA 5LZ9A 1LZLA 3CLRC 4AP6A 2REQA 4MDEA 2UYGA 4ZT3A 4LV5B 1U3CA 3IO5A 4AN4A 1AURA 1Z25A 4LYAA 1P7ZA 2ORIA 4FFLA 5CU7A 3U7IA 2X5NA 4HPJB 3O8CA 2HDNB 4MYTA 1L4NA 2PV7A 3VZBA 3EDYA 3E23A 3QOYA 4LEIA 1ZONA 3BA1A 4PC2A 2Z08A 2ZBUA 4CTNA 2H2HA 1Z06A 3WLQA 4GBJA 1LNQA 2B8WA 1HBJA 4TMYA 1U0FA 4L74A 3LBIA 3NBYC 2QR3A 1XZKA 1EFVA 1WDWB 1AF7A 3MOIA 4N03A 2DE0X 2PLRA 3PQDA 4M9QA 1HE3A 3L49A 4PO3X 2IV7A 2CT8A 1T2AA 1T8RA 4J4HA 3TSYA 5FTKA 3Q8LA 2A88A 2JLWA 1XAGA 3VTKA 4WINA 4C89A 4L75A 2FFBA 4ZPJA 3BSSA 3ZBQA 2I6GA 3ONEA 3CZRA 2HRDA 3GLGA 3HB1A 1HZZC 4QEKA 1FJXA 3BS4A 1EKXA 4R31A 1XJCA 3VC2A 1GUBA 1PLLA 2OMKA 4KQHA 3W1WA 1GKYA 4E5SA 1XJWA 5TJHA 2Y0CA 3F3KA 2V1XA 1P2TA 1Q5PA 3OLCX 3LPDA 4X91A 4JYAB 3BRCA 2R6JA 2FSIA 4U0KA 3TQIA 4CG3A 2FZCA 4WLFA 1PVDA 4Q19A 3T5CA 1FDUA 2IYPA 3IJ5A 5HZMA 2Z6AA 4O4JA 1TQ4A 3SZLA 4IOJA 3VX4A 3NHPA 5LA6F 5D3QA 1VGVA 5AIAA 2ZSKA 3K9FC 1LK0A 4KQGA 3AR3A 4WGFA 5I7VA 1VPLA 4FKMA 4MWCA 1NW9B 1D8AA 2FX3A 3WYGA