2WF7A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf7A01
3DAOA 3QU4A 5ALFA 1ZD2P 3L8EA 4CNQA 2I34A 3WKDA 4CE6A 2GHQA 2R8EA 1TJ5A 2B30A 5AW2A 1EK2A 2HSZA 1RMYA 2OYCA 1ZRNA 1VJRA 1FEZA 3WK9A 1QH9A 5ALSA 3R09A 5A3RA 3SLRA 3EWIA 4KX5A 4AS2A 3NASA 2YMPA 2W11A 3HLTA 3A1EA 4FYPA 3SF0A 3MC1A 2YBDA 3FZQA 3OCXA 2YMMA 5AI4A 2C8LA 2GFHA 4NAVA 2FDRA 5ALPA 3FGOA 4XQ0A 3ZX4A 1T5SA 3L7YA 4Y2UA 2HF7A 1Z4QA 3BWVA 3ZW7A 2DQSA 2HF2A 2PR7A 3W5CA 2P11A 3KC2A 4KNVA 3BA6A 4E88A 2HX1A 3ESRA 5ALDA 5AKEA 2WF8A 4OFZA 4XOUA 3QUTA 1WVIA 2I33A 2X4DA 5AVQA 1TJ4A 5AHXA 4QJBA 5AW6A 4RESA 4GIBA 4EX7A 1MH9A 3N1UA 5ALLA 1Z5GA 4UMDA 5AKXA 4IG4A 3KZXA 3OCZA 2HEGA 1TJ3A 3I28A 1X42A 2EARA 3I1YA 3D6JA 2G07A 2WF5A 3WKAA 2ZBFA 4YCLA 5AVUA 1EK1A 1Y8AA 2W43A 3ZTWA 3QU9A 3A1CA 3WKCA 3F9RA 4BKMA 2YJ4A 5AKHA 5A3SA 2FPWA 3M9LA 5E0OA 3S6JA 3ET4A 3E58A 3EF1A 1RC8A 2G08A 3E8MA 3UM9A 3AR6A 4EZEA 5AESA 4UMVA 2R8YA 4C4RA 4IFTA 3QX7A 3KBBA 3M1YA 4Y2JA 2BDEA 3L5KA 2AMYA 5AI0A 5ALUA 2G0AA 2AGVA 4UM7A 5T41A 2B0CA 4CF3A 1Z4OA 1L6RA 2JAWA 4BX2A 1RQLA 3AR2A 1QQ5A 5ALXA 5AK4A 2FPRA 4KX3A 4L6AA 2CFTA 3OCWA 3A1DA 4UMFA 1XP5A 2Q5EA 5AM2A 5IT0A 3W5DA 3WK4A 3PGVA 3WK6A 4UU1A 5AM3A 3N07A 2MU1A 1YDFA 5AW4A 5ALIA 3B9RA 3OCUA 5ALMA 2NYVA 3ZVNA 4FFDA 2IOFA 4Y2QA 3KDPA 3ZTYA 2QYHA 5AIAA 1N9KA 2EAUA 3L1VA 4PNHA 4BEWA 1O03A 1Z4IA 5ALGA 4BNDA 3K1ZA 4ZEXA 4GXTA 3AR4A 4KN8A 1JUDA 1RDFA 3OCYA 4L6CA 3N5KA 2C4NA 1U2TA 2ZBGA 1NNLA 1L7OA 1NF2A 3VAYA 2WM8A 2O9JA 4YGYA 4HGOA 2GHTA 3FVVA 4F71A 2YN4A 2B1RA 4J2TA 4EENA 3IB6A 2B8JA 3FPSA 3L0BA 5AIBA 4HGNA 3SKYA 4YCNA 4BYGA 2BY4A 3R4CA 4OD0A 2PQ0A 4Y3UA 1KYTA 2MSNA 2FPXA 3QU2A 2Q4TA 1ZJJA 3QLEA 5AVYA 3WGUA 2HHLA 2RBKA 1ZOLA 2HO4A 1Z4PX 2JARA 4BEVA 5JJBA 3NIWA 2FUEA 3U7FB 3SHQA 3DV9A 4H1WA 2ZOSA 4XE5A 1K1EA 2QLTA 4Y2PA 2YFYA 1QYIA 1YNSA 3PCTA 3B8EA 3L1UA 4DCCA 1IWOA 1L8OA 3CZ4A 1Z4NA 3UMGA 4UMEA 3DDHA 1SWVA 1YS9A 3E84A 2OM6A 4JDPA 4OHFA 2YJ3A 2G1AA 1RQNA 5AKZA 5AI6A 1WZCA 1NRWA 2HI0A 4HGQA 2G06A 3DNPA 4CF4A 1Q91A 4Y2VA 3L8FA 3N28A 1S8OA 1Q92A 1Z5UA 2CFSA 2B8EA 1AQ6A 5AW9A 5ALRA 1LVHA 5AK3A 2YMQA 1L8LA 1L7MA 3SD7A 5AW8A 2VKQA 3AR7A 3EPRA 3QU5A 1PW5A 5ALTA 2R8ZA 2O2XA 3CNHA 4B6JA 3SMVA 2I6XA 2JGAA 2RAVA 2GO7A 3QYPA 4DWOA 4JB3A 3AR8A 2D2VA 4UM5A 4QQFA 2OA0A 2C9MA 1ZRMA 4J03A 4UW9A 3AR5A 3WGVA 3W5AA 2B82A 5AVRA 2AH5A 1L7PA 1Z4LA 1J8DA 3RF6A 2IYEA 1L7NA 5AW1A 3QNMA 5AI8A 3NANA 4Y2SA 3ESQA 4FE3A 4MWOA 1XPJA 2G80A 2WF9A 5ALZA 4Y2RA 3ZX5A 4XPZA 1T5TA 3AR9A 4UU0A 1YV9A 3FPBA 2C88A 4KNWA 5ALKA 4MUMA 1RRCA 2YJ6A 5AVSA 4YCMA 3ZVMA 3U19A 1RPZA 1WPGA 3ZUPA 3NALA 3OPXA 4C4SA 3PGLA 1Z88A 1RLTA 4UAVA 4YIHA 5AKIA 1TA0A 2YY6A 1TE2A 3EF0A 2CN1A 3N8GA 1ZD3A 5ALWA 1U2SA 1U02A 4UASA 2YMLA 1Z4JA 3ZWDA 3L8GA 3ONNA 1Z4KA 2I54A 3RFUA 2ZBDA 5AM4A 1CQZA 4HYTA 1QQ7A 5IS2A 2R8XA 3WKBA 3QU7A 2W4MA 5AM1A 5AW7A 3MPOA 3OCVA 2YJ5A 2CFRA 4RETA 5A3QA 1S2OA 3SKXA 4G9BA 4UAUA 2WF6A 3I76A 1RKQA 2GMWA 2NO4A 3ZU6A 3W5BA 4DW8A 1CR6A 4BNDB 1LTQA 2FI1A 5AVVA 3NAMA 1YJ5A 3QUQA 4I9GA 4AS3A 2RB5A 2RARA 5AI5A 3R9KA 3E81A 4O8CA 3NUQA 1ZD5A 4ZEVA 4NWIA 3WK5A 5AKGA 4UARA 4HGRA 2Q4RA 2JAUA 3MN1A 2P69A 4ZEWA 1RMTA 3NRJA 1QQ6A 5AVZA 2HOQA 1RKUA 3MMZA 5ALEA 2BDUA 4HGPA 1N8NA 4F72A 4NFLA 5ALYA 2G09A 3OTQA 2FUCA 3ZVLA 2FEAA 5IT4A 3ED5A 2C8KA 2ZBEA 3J7TA 4NV0A 2EATA 2WFAA 3P96A 5AKKA 2ODAA 1F5SA 2ZG6A 5AK5A 5ALOA 5AW0A 5AK6A 4Y2XA 2B1QA 3ZWKA 3KOOA 2HDOA 3L0CA 5AVXA 3KD3A 4Y2TA 1RLMA 3ZI4A 4EEKA 3AR3A 3IJ5A 4BBJA 3PDWA 5ALQA 2JAOA 2IA5A 3A3YA 3UMCA 1O08A 1U7PA 4DFDA 2IOFK 5ALJA 3U26A 3UMBA 1RKVA 3GYGA 3B9BA 1ZD4A 3QGMA 4L57A 3L8HA 2AUTA 2PKEA 4UATA 1RLOA 2WF7A 5ALNA 4BX3A 2MU2A 1YMQA 2I7DA 3QUBA 4EX6A 2ZXEA 3WKEA 1Z4MA 3U7GA 3WK7A 4YIKA 5AM0A 4I9FA 4NABA 4CF5A 4C4TA 1ZS9A 5AKLA 3L0YA 5FP0A 4OCZA 5AKJA 1U7OA 2IOHA 5AKYA 1VJ5A 4EELA 3HYCA 3QXGA 3U7EB 5AVWA 1SWWA 2WHEA 2FPUA 2P9JA 2HCFA 4HAIA 1VFPA 5AW3A 3U7HB 2NO5A 2FPSA 3WK8A 1RMQA 5AM5A 4AP9A 4KYTA 4Y2YA 2OBBA 5ALHA 4YH1A 3ET5A 1SU4A 3I6BA 5AW5A 4BX0A 3IRUA 5AICA 1WR8A 1T9ZA 1J97A 5ALVA 1XVIA 3TLMA 3FM9A 4G63A 5AVTA 3QUCA 3U13A 2I55A 2P27A 5AI9A
chains in the Genus database with same CATH superfamily
2QMYA 4FOLA 1Q1QA 1THGA 3PGA1 1SBYA 1C3EA 2P6PA 2RGWA 4PIPA 1B7GO 4MQUA 1UBSB 3QM1A 3GEIA 2ZJYA 4FQ8A 4IIJA 1FFWA 4IDQA 5BPFA 2NZVG 1D2RA 1U9JA 2CF6A 3DKKA 3ODPA 3URKA 5JAZA 3D5QA 3OPNA 5JCOC 1JQ5A 3MJRA 3NHRA 4B7AA 2WU1A 5JI3E 5G02A 4UD2A 3TIGA 3WLNA 4Q3NA 4MH0R 3RVRA 1SOUA 2JG3A 4D57A 5MGNA 4DY4A 3GP8A 2P2YA 5D49A 1H23A 1V9CA 4HYQA 5CLIA 2E1FA 1IUPA 3DBHA 4RJIA 2Z5LA 4O6VA 3MM4A 4ZYXA 1W4LA 1YRLA 1MJGM 3LY5A 3ZQ6A 4UDOA 4IAOA 3WR5A 5E7JA 2RAFA 1DCTA 1UMDB 4M0MA 4QU8A 1G2PA 1IB6A 1H3NA 3EIWA 1T36B 5A02A 5LOVA 4LJRA 3OE7A 1J5XA 1ZM3A 1DADA 1QAMA 2BUBA 4F2PA 3BX1A 3PO5A 1PGPA 1WTAA 1HNZB 1ZJMA 3WIVA 3L4PA 1MDFA 1Z28A 4IHKA 1JYEA 2D1SA 4YJ3A 5JHGB 1YDHA 5LP6A 3A10A 2BCVA 1ATZA 2QT0A 2QJOA 2F77X 2C5HA 4HN2A 4UBLA 3VOAA 3TM4A 2KIWA 2W8BA 2VRWA 1E8MA 3N05A 2FEKA 1Q14A 4EHJA 1Z15A 1I3CA 1IHOA 2GZMA 4OFZA 4C9BA 4UB3A 2DKFA 3HR7A 1H2ZA 4D6YA 2R8KA 1K6IA 4FB5A 3N2GB 4B9TA 4HWRA 4KUEA 2ASLA 5KNBA 1GNQA 3CUKA 2ZJ6A 3EFOA 4G5QA 4NARA 4AJ9A 1T91A 3ES9A 4G67A 4ASUA 3H87A 3WL4A 4E5PA 1XNHA 1KFTA 5E1MA 3VVLA 1YMVA 3JPQA 1T3GA 2GSWA 4DLEA 3GY0A 3LDUA 4XSGA 4V1CB 4II7A 3I01M 3RJTA 4IUCS 3E0XA 4DFMA 1KBQA 1MORA 3DXZA 1OFGA 1TVKA 4DCNA 2IYLD 3A1CA 1Z00A 3EB9A 2X0EA 1PNTA 2AOVA 1Q1GA 2LM1A 2X2FA 2XZTA 3CISA 4I5IA 2CJYA 2OVFA 3R7AA 1L5VA 2XSZA 2FPWA 4JD5A 3F96A 5JXHA 2Q99A 3D6UA 3DHEA 2XVTA 1XDBA 9ICGA 5KFDA 1BH6A 2DUNA 2Z2IA 2HWYA 5HS6A 3KKLA 4IDHA 4ZYLA 3LQRA 1RC8A 3C16C 1QORA 4KQKA 3TDNA 4L3VA 4GX1A 3LVQE 4M6WA 4XFDA 4EZEA 2G1UA 4X41A 4QRDA 1VHLA 4LSMA 1SXGA 3OQVA 3DDSA 4X6YA 4YBRA 3RK0A 4PGXA 2VYVA 3UA4A 1Y1PA 5DNCA 1FW8A 1TNDA 3DLIA 1E1RD 3JAWB 4HWGA 1ZD1A 2OV3A 2Z57A 3PQ5A 2O2SA 3C3AA 3ZLTA 1A1VA 5FOTA 5J2HA 2R4UA 4UTXA 4C20A 2JXJA 3MYRA 1D9ZA 4H6XA 2ZWIA 2RGRA 4ZA2A 5B1SA 4QM6A 3O1JC 4CLXA 1Z4OA 3N39C 1PK7A 4K9OA 1R4ZA 2WWIA 4R68A 3H04A 4UOQA 5DWDA 1MAHA 5F5XA 2IWHA 3WGHA 3EG5A 1J2MA 1IONA 4FEAA 3RNOA 2HLPA 3ZCTA 1TKDA 1N0IA 3P4UA 4XB2A 2FPRA 2TYSB 5DM1A 1M74A 4EJFA 2QWXA 4C0KA 2RHFA 1EFDN 4RK4A 4DCPA 2R00A 1YJAA 3SR3A 2W83A 5BWBA 1C7QA 1NJSA 4B81A 2G72A 5C9ZA 3OO0A 1XP5A 2R6R1 4F6LA 5JXJA 2YQ5A 3TIIA 5DBGA 2IC5A 5G53C 1MGOA 4M55A 4KMOB 2OWEA 4J9NA 1ADJA 2XUZA 4Y2GA 3PICA 2AL7A 5FPSA 5KT6A 5KFCA 3GR6A 3FX2A 5TQ0A 3WWDA 3E3OA 3IELA 1I1HA 3LYAA 3LXXA 4I4LA 4QWCA 1LDYA 3UZUA 1YR9A 3RYTC 1XFDA 2DTXA 3G9ZA 5KCZA 4M60A 1LJ8A 1QH0A 1ZVKA 1QHGA 4EPWA 1GNSA 1S0UA 3IIEA 1KFKB 1RC1A 1NJXA 4B43A 1UKZA 1R4MB 3HDGA 4WIAA 5JE8A 3OE1A 4WA8A 5KFYA 2CLKB 1GT91 3T99A 2ADFA 3W6OA 1SVOA 4F11A 3ER8A 1XDUA 4UREA 1SKUA 2WM8A 1CUAA 1G8HA 3UHJA 1UKAA 4J0FA 3C74A 3GB9A 3KJEA 1DV1A 3OZEA 1DLJA 1AUVA 3W06A 1UADA 4IICA 1P2UA 4YAFA 4HZUB 4KWHA 3AHGA 5AIBA 3EPGA 1C3XA 2YHUA 4AMZA 3JD3A 4H6VA 1L7XA 2Q6IA 1Z16A 3IXMA 4RFSB 1S4MA 2HIAA 4X7RA 4CMAA 2UUPA 1K7XB 3AF1A 2G9NA 3EUAA 2B4YA 3BRCA 1ZFNA 2QTNA 3IX7A 2FQ1A 1GT6A 1ZH0A 3V5NA 2PEYA 8ICZA 1DWUA 4BBAA 2G8LA 4FFBA 3E9QA 3JVUA 2DHDA 3EXG2 4N41A 3TVYA 5KHLB 4JXZA 1TK3A 3MS2A 3DQZA 3VM6A 3BVPA 2JARA 1RJDA 4QL3A 2HA7A 4HV4A 4KGVA 1TUBA 3ID6C 5CK5A 1KL7A 2FGKA 9ABPA 1ZGCA 3U7FB 2O5CA 1U0FA 1DJLA 9ICVA 1VM6A 4KO1S 4PCVA 1SHLA 4YXJA 4EHFA 4WK6A 3ZY6A 1MR3F 1Q84A 2P1DA 1UCVA 1P9NA 4KN5A 1QTIA 3RKSA 3R44A 1DXSA 1L4GA 1WM1A 3HJNA 1KSGA 5B6PA 1K8QA 1VPVA 2QB5A 4LGYA 2JH3A 5I47A 1XEXB 1LPSA 2WJPA 4EO7A 3VUFA 2ZTMA 2C31A 4YLGA 2D5CA 4NRDA 5GOTA 1R1DA 4F3YA 4UEKA 2DTDA 5DN6A 5IMBA 3IVRA 4R83A 1WZCA 2P40A 4KGXA 2FEWB 4L8VA 4IG9A 4Y30A 4MQFA 5BVGB 4JR1A 4DLSA 1QDUA 1OFUA 1IC6A 2XTZA 2A67A 2YC2C 3NHWA 3DWEX 2DPIA 3CO0S 1XS9D 2DWOA 2FLKA 2NTEA 1KYQA 2YRWA 3ICOA 4U0KA 1MP0A 3MELA 4URZR 4Y6LA 5D1HA 2YKGA 3T3OA 2Q1TA 4WKCA 4GHWA 1T9BA 4IGAA 2Q9UA 2BGJA 3ORFA 1C9YA 4IIJF 4UAJA 4YVFA 1MB0A 2GARA 1U2GA 4E14A 2PS3A 2B99A 4L5CA 1YB6A 1ODKA 1ORDA 3LT1A 4E13A 4WLEA 3WRXA 2QG9A 1EHYA 1ZW1A 3KK0A 3AFHA 3N2YA 1KFSA 1J00A 4ZCTA 4AULA 1DRWA 4ME6A 3UJ6A 4B8YA 3IAEA 1SU6A 2NRVA 1ZYUA 2BMFA 3INYA 4JB3A 1B8UA 5DBHX 3E1SA 3JSAA 1UP7A 8ICOA 1JEJA 5KFPA 1U7UA 3CF0A 2GH1A 3GFTA 2IU0A 4QBKA 3TLZA 3VI4B 3CTPA 7REQB 4ZT3A 4U7DA 4JOCA 2D8MA 3DC2A 4UM5A 1E6LA 3WLJA 2EP7A 1Q20A 3ZH9B 3KOUA 2C9MA 2VJDA 4RLHA 4IEFB 4F3TA 1NGSA 1YQQA 2IEDA 4ALIA 5IABA 4RVOA 2BGMA 1VJDA 3UFXB 5CB4B 1V16A 5JI2E 3M7DA 2JGIA 4Q02A 3I5AA 4Q1FA 4TMYA 1KAHA 2O7SA 2PGIA 2CLDX 4U2DA 2LTAA 1W48A 5HBGA 1GVHA 4ZCSA 3TGPA 5CRXA 1H66A 4X8MA 4YXMA 1C80A 4LDZA 5B1HA 2NV2B 4MWOA 3Q11A 5K3FB 5GTHU 3LXUX 4N6OA 4IHJA 4V3BA 3VI3B 2LKCA 2IHTA 1M0TA 1XXHE 2XTJA 3AETB 4DPLA 2FW6A 3DEZA 3OQNA 2H9YA 3K1RB 3KV1A 4F8RA 1JEOA 1LNQA 3IDSA 2AC7A 3OSUA 1DVRA 4TXHA 3FZYA 2DLNA 2ZT6A 1K5DA 1U9CA 2BTQA 3QPAA 1UFQA 3PPYA 1BWQA 1P44A 3EDRA 3UUGA 4DL9A 2OC4A 4G37A 1VG1A 1YR7A 5F4ZA 3ADCA 2AOWA 1F9AA 2BFEA 3L07A 4FCWA 4DCSA 1F48A 4KRFA 4HUJA 1AO0A 4A26A 2CMKA 4CKBB 2BGWA 2DWQA 3R0JA 4OGLA 4P82A 4JP2A 4WESA 2W8ZA 1FUYB 1HMYA 5T6BA 1BKDR 3L93A 5AKIA 2LYHA 4IFBA 2ATLA 1IOLA 3EF0A 3WHPA 2IIPA 4NG5A 4RA9B 3PHLA 2X42A 3R7WB 1PLLA 2J9FB 2P2ZA 1UR5A 1PTJC 2QAGB 3MIZA 3WXMA 4HLDA 2GZSA 4EFLA 4GKKB 3PK0A 1JB1A 3R0QA 4NPHA 3GGGA 2WMDA 1TLTA 1X1QA 2AUNA 4K2HA 4GMDA 3WYAA 3DOUA 1AO3A 3KFXA 5FBRB 1E3WA 1XZCA 1B93A 1PR2A 4ZT5A 2FF7A 3TJRA 2BMJA 3UN1A 2I22A 3GMTA 1EPUA 4Q4LA 2WD7A 1NVFA 1YO6A 3OURA 2UZ1B 3RRNA 5CDGA 5A3QA 1S2OA 3MFYA 3LVWA 5A6VA 2J6TA 4F2RA 1Y1LA 1JU4A 1K6XA 4GQIA 4OL9A 4C7YA 3FWZA 1MRZA 4HWTA 2YV3A 4JBNA 4BMCA 1QIIA 2BGKA 2Y2UA 4G1MB 1VLMA 4KQHA 4GBMA 3G6KA 3SKVA 4EGAA 2YRFA 3GGOA 3OQHA 3OSZA 2C2BA 4PXAA 3AERA 3KELA 3OQ1A 1VXOA 3MLEA 4J1NA 4XDZA 5E8RA 2BFFB 5AI5A 1H1LB 2CL5A 3RR7A 3EBPA 3GJSA 1GTMA 4MLPA 4R8LA 1O9BA 2AJDA 2ZUBA 3QPVA 4ZQGA 1QPGA 5K6AC 4U00A 4XARA 4YRPA 3BMNB 4A0HA 3O95A 3JZFA 5LVAA 1E8NA 5KFHA 1CJVC 2JAUA 2ZJOA 4Z4QA 4WASA 4IS2A 2PHZA 4QGFA 1QQ6A 4ZIRB 2XUHA 2BZFA 3EWSA 5K3EA 1KQGA 4AN4A 1JDZA 3SVTA 2FHPA 3H2HA 4EBEA 3AFOA 3EG9A 4RHCA 2GR9A 2PMZC 4BVKA 1E5TA 2BR5A 1R16A 1BJTA 4UUNA 3TNJA 4QPDA 3HH8A 2JF0A 3DHWC 2V6MA 3IOBA 4QO8A 4YJ2F 1GQ2A 3O3CA 2Q6TA 3AB7A 5JASA 3L4KA 3LNCA 3FNEA 2ON6A 3ZHVA 3VHQA 1GTSA 3CF4A 3Q87B 3ZDRA 4RBNA 1M10A 2HQOA 5BOVA 3PNPA 3EXAA 2HBQA 4OQLA 2ODAA 4LS3A 1M1YB 2GCOA 3ORQA 1CUCA 1EFUA 3G1WA 2IYVA 1O5OA 3RV3A 1TQ4A 2PPVA 1FPMA 3LOPA 4C22A 3A6FA 4H4EA 1WXIA 7ICMA 1M2GA 2AXEA 3GNTA 4OQNA 5EMMA 1T15A 5EP2A 4RCYA 5KNDH 4X9XA 3W90A 2NGRA 3KEOA 3JR7A 1RXUA 3TZ6A 3PNLA 5ILOA 3PHGA 4KHPB 1QC5A 2AFHE 3LCUA 1CETA 2ZIVB 2OR3A 3VR5A 5T67A 1H2WA 3UB4A 2GSDA 4M54A 1Y98A 4WT7A 4PR3A 4V38A 3VR4D 5J3JA 5BSHA 4RF2A 3CVYA 3HJCA 4ZKDA 1UQVA 1JPVA 2RGAA 1PJZA 3UMBA 1BG6A 1SRRA 4S2UA 3WJ1A 5KNCD 1NK5A 3EVTA 1UBRS 2WYVA 3ZQKA 4YCSA 5JS1A 1T94A 3KQPA 2BRUA 3QYJA 1QDLB 2HYDA 1PT7A 3D81A 1OD6A 5CGZA 3WXBA 4BIIA 4CCYA 5HOEA 2BHRA 2GXSA 1CQWA 4B1FA 5JANA 4XRGA 1KS2A 2VTVA 2K4IA 2QUKA 2XPCA 3NIDB 2ZSKA 4DLKA 1E0KA 1XYYA 1CNEA 3QUBA 4YHBA 3SS9X 1W581 1QU2A 4JYBA 1F1BA 3LKZA 1DTEA 4KWIA 3PR5B 1MABA 2W2VA 1CRZA 4E11A 2UYCA 2ZSHA 4BQEA 4ROTA 2FSFA 4OHCA 1VE3A 5BPHA 5IVHA 4P4NA 3WZMA 1QVVA 3ZWVA 2C4UA 2R79A 2QZ4A 3AUFA 3ZK9A 3V4RA 3E4CA 5L45A 1OIXA 1N8TA 4A6PA 1XMVA 4G8DA 1ZS9A 4BV9A 1RKXA 1UKEA 4A1FA 1HUZA 3U4QA 3L0PA 4C2BA 4DQVA 3ADBA 2F48A 3GRPA 3QY9A 3S8YA 3KBOA 4EMBA 4RJLA 1V9LA 2CDNA 1IN1A 2BEUA 3EGDA 5JVDF 1RBZA 4NZZA 4RPJA 3OM0A 4TZKA 3U7EB 3H6KA 3EIQA 4FFWA 1OYOA 4KQ9A 2D7DA 4OHYA 1OZFA 3MUNA 1Z3CA 4KOEC 2O1SA 2WU0A 2FR0A 4R2IA 5CBPB 4ABYA 2RH5A 5A4FS 1RQPA 2FEPA 5FJJA 2PMDA 3LUHA 5J2TB 3PLRA 3LGAA 1L7BA 3EWNA 4XYEA 2WJ4A 5IAGA 4OO1J 1NQTA 1S2MA 1A9XA 3PSPA 1D03A 3BUSA 3F4LA 1XVLA 1SUPA 1I24A 2JKYA 1CHDA 3IBCA 3QMVA 4PLPA 5DBOA 5KL1B 3NHJA 1N2JA 1QLJA 1RTTA 4HQ0A 4MW7A 3L0SA 3H9JA 3FC4A 5BYJA 1VP9A 1SKAA 3RVBA 1JXAA 1C3VA 1HY3A 4HDAA 1L3IA 3WB0A 3HCWA 3NVDA 3T9FA 4DSTA 3ZY3A 6ADHA 2AC4A 3MWJA 4WCVA 2CNLA 2I55A 3D6AA 1JHRA 3IOCA 2XV1A 2Z3WA 4GX0A 4RYLA 3S0JA 4F06A 3MG9A 1EFPB 2IBMA 3E3NA 1GGHA 2VATA 3A1VA 2VYNA 3JQBA 2PUAA 2F8KA 2ANCA 4KZPA 3PI7A 1N57A 1EK2A 2YXNA 5DRYA 2D59A 3LBFA 4YP9A 5BQPA 2HSZA 2G9RA 1NR5A 1OFTA 3OFSA 2Z4RA 1MT3A 3B3JA 4L0QA 1Q3HA 4LE2A 2WABA 4PRZA 4TVOA 4D8YA 4ES6A 4MDFA 3RVJA 2O8FA 3R0VA 2W2MA 1QH9A 1AKWA 8ICFA 1U65A 1UODA 1A5BB 3AFNA 4LISA 4FUTA 1G8AA 5CCDA 2OGWA 3I34X 1SKMA 4RTNA 9ICEA 3VC2A 4NCKA 2QARA 3O1IC 4E6PA 4Y98A 3DAYA 1DQRA 1YH3A 3KJHA 3OFND 3A1EA 3F8WA 5CYPA 4DABA 5JNLA 3E03A 5G0TA 3KWMA 5T3UA 2C04A 1DOHA 3MWYW 2HRDA 5KYVA 1HRKA 3RS9A 3LSYA 2VA9A 2NNWB 1AGYA 3C6QA 5CEFA 4MWDA 2H5LA 4Q6BA 2PU5A 1Z63A 5JTIA 2PWAA 1GRCA 2P6NA 3PWKA 4ZOCA 4BO5A 3HEMA 5B2FA 5C1BA 4XQ0A 3V1LA 2KSOB 1AT1A 1I33A 1PKXA 4Y2UA 5KAFU 3PW5A 3TAQA 1G9XA 1MFPA 3W6PA 1H69A 4DWVA 3CVUA 1MW9X 1B42A 2PZBA 1EM8B 1FE8A 1LQUA 4XM1A 1F8XA 4RMHA 5DNDA 3L5OA 3JPRA 1GXSB 3OH8A 3AV3A 3IUMA 1FS5A 2I6GA 2QN1A 3ESRA 1E60A 1ONNA 4HN9A 5CVDA 1KAMA 5FLYA 5JC1A 3RM3A 2CMGA 3QUTA 3HXKA 1TKBA 3C3KA 3OCCA 3LBNA 4A7PA 5I4IA 5JEEA 3MJ4A 4INJA 1DAOA 1TUBB 2A94A 4QEZA 4Q9DA 3RS4A 2QRMA 5KFNA 1ZQZA 2KFZA 1B15A 1IQPA 3CLTD 3D6MA 4G23A 2H3IA 4E31A 5BT8A 5C5DA 2H3VA 4D9CA 1KEEB 5B64A 5BYAA 1P61B 2XUFA 3W8RA 4IH1A 4MS1A 3M9MB 1HLGA 1WDLA 2XE7A 2H3FA 4I81A 3USZA 2EBUA 3V2IA 4GLXA 1WCLA 3AKZA 4B4OA 1K89A 4P33A 5H16A 4IL6U 3CNNA 5JQWA 2Z1DA 4XSHA 4PGMA 4XQ9A 4L76A 4DDKA 3P7MA 1R0ZA 1RZTA 4JFRA 1P77A 5LOVF 3QJ5A 1P6QA 1TEZA 1YRQA 4ICIA 3BN3A 4Y18A 2N1RA 3RFTA 3VV3A 4PX5A 4R1PA 4AMYA 2V9WA 1MQ2A 5FEUA 1BDBA 1M8GA 1BROA 2D1QA 3EC1A 3OKCA 5A3SA 1UEXC 3ZIAD 2VQFB 1TVCA 3BXEA 5F35A 4IJWA 1E4OA 2DKZA 3M83A 4MSUA 5E0OA 3HO8A 3NDRA 1CQIB 3W5UA 3NHYA 4KCGA 5LP6F 3AVXA 4BGUA 3E58A 3MCUA 3QTTA 1TK9A 3DM9B 3VSEA 1E9AA 4QIWC 1EE9A 1Q2XA 3GHHA 3HYLA 3AU6A 1GDHA 3PR3A 4BL5A 4DAOA 4E32A 2FOXA 8LDHA 1ZQDA 1RYSA 3P97A 4MKZA 1EJBA 1TCCA 2HBYA 1XXHA 2ID7A 3KQOA 5KYTA 4UQPA 2OYYA 2AE2A 1PGQA 2RCNA 1OLSA 4IDBA 2Z1MA 2DT5A 2AMYA 4O0IA 2YHBA 1J4AA 2VP6A 4N65A 5ELLA 1TV9A 1U1GA 5B58C 1P8AA 3UCFA 1L1RA 2XOXA 3T6KA 5T41A 1X1EA 3DZ8A 4EGQA 2R1UA 4I27A 3LK7A 5EQFA 3JD4A 1STOA 4LSGA 4NCXA 5H9WA 1DGJA 1ZQ1C 3UJAA 4F2WA 2XQJA 4G86A 4OJYA 1OLUA 5TQ0B 1RLIA 1XJQA 2GD6A 4RIGA 4ZCPA 1BXKA 1ZCFA 3PE6A 1XJ5A 4R1NA 4CM1A 3WLRA 2C42A 4UBKA 3FPAA 4NE9A 2QAGC 4J0GA 3A9CA 2PS9A 3SGLA 4WN9A 1TC2A 1VSBA 4OXXA 4HNRA 4C0ZA 4DIMA 4UMFA 3AF6A 1SKYB 2D7JA 2HADA 4QLOA 2PMEA 5LM3A 2OBFA 3OX2A 1AA6A 5A0VA 3QI2A 4OIFA 3ON5A 4R01A 4A8JA 2HCRA 2V96A 4FLFA 4CG0A 5CVEA 1RWVA 2VQ6A 1UC8A 5LYJF 1J8YF 3SCZA 2ZRAA 4C0JA 1OZGA 2BMVA 1QSSA 3ITKA 2KJ9A 3OQIA 2EJVA 4FX2A 2OBLA 5CFQA 2IOFA 3REFA 3ELDA 2H0AA 4NPCA 1Q16A 2A7QA 1PR0A 3FUWA 4O1MA 4P86A 1S89A 4YO8A 3WNVA 3LHFA 3VKGA 3P9NA 2O3RA 1O03A 1LLDA 4O2BB 1UBJS 5EWMB 3IPYA 4EG3A 1ULZA 1WD5A 1PT8A 1ZI6A 4DVJA 4Z8XA 3VUEA 4CM4B 1YDEA 5HRUA 3ROPA 4F92B 3N0WA 1O97D 4O4IB 2ZBGA 1FBTA 4DQPA 3IGFA 3WX0A 1GGEA 1QYDA 4BUGA 1R0LA 1XZKA 2AUMA 2O23A 3A3NA 4RTPA 4U5XA 3G2KA 521PA 3OMWA 5DTIA 5EJ2A 9ICJA 5IDXA 3INTA 2JIZD 2AFIB 1PJ2A 4M86A 3VGJA 4Z7NB 1CVIA 1N2HA 5DLFA 2E8NA 4IKEA 3Q1LA 1RTKA 4TWJA 1ZNYA 4TV8A 3HJHA 5DH9A 4HGNA 4RQ3A 4J9SA 1PJ4A 1X7HA 2JI7A 3V8PA 1J2UA 2XCLA 3N7TA 4TQAA 2QGZA 3B1WA 5E6UB 2XI4A 1SD1A 4M36A 2QM8A 5DTMA 3TQCA 7ICUA 3BORA 3AHJA 2JFHA 1CY4A 2WWWA 3H0EA 3R0ZA 4A6XA 4KQXA 2KOBA 1OBHA 5FOUA 1R4AA 3H84A 2ZUEA 4QXQA 4FR2A 2B35A 5IIJA 1X1SA 3TGLA 1IQUA 3D8RA 1FDRA 4N9WA 3J81A 3AI2A 1BW9A 2W3SA 2RBKA 3BDVA 4DV3B 1U0LA 1YVRA 4AIIA 5GPBA 4PHDA 1JFTA 3U3XA 3IHLA 2B98A 1H6AA 3TQOA 4KE9A 2NU9A 4IDEA 3DJYA 3L0DA 1JQEA 2D2FA 1S0NA 2QRKA 3H17A 4JLKA 1IH8A 2VDUE 3ITDA 2QPOA 4ZEOA 4FZLA 4PYOA 1LUAA 3KYIB 5B3LA 3O1HB 2B7LA 3Q85A 4OJ6A 4GXJA 1L7AA 2PWZA 5B30A 2E5SA 3B78A 1OWLA 1CNFA 2AI2A 1L8OA 3FHLA 2P4SA 4ZJYA 5HKKA 1Z4NA 2WA2A 4HLCA 1L9XA 1J2JA 1NYQA 1ZI8A 5EZYA 2VJPA 3P0IA 2GXQA 5ELMA 3G2OA 1E3IA 3O8OA 2JLYA 3I12A 1ACLA 5P21A 2FU5C 2PK3A 3G8AA 1VJTA 2G1AA 1ZQUA 3W78A 2PMFA 3PMLA 1BRMA 3A36A 3AVYA 3LQ1A 2AZ4A 1YDWA 4XQCA 4PO1A 2B0JA 3TX6A 3UHPA 3WYEA 4BFCA 5B7QA 2J9XB 1SBZA 1JG6A 3NEJA 4M1QA 4BU0A 3F73A 2P4QA 4XM2A 1P2DA 2EV9A 4UHCA 5TDHA 1NX6A 3RVMA 1F20A 4I8XA 1YZNA 2XNDA 3FYUC 1PJRA 2WD9A 4K6MA 4ARAA 2QNRA 3MZ0A 3VX3A 5L3SB 1ZOIA 2QPTA 3FOWA 3E82A 4UBBA 2XAUA 2VKQA 1WXEA 4ND6A 5HPYB 3H2KA 4TZ6A 3HWSA 4YUVA 2ZI9A 3UNXA 3TSOA 2ZRQA 2DWUA 1SVLA 3S2FA 3C3EA 3HY3A 3Q7PA 3OIUA 4IMJB 5B7PA 4DYHA 5J2CA 2E4XA 2GCNA 2ZJ1A 4WX2B 3I09A 2PUGA 1XLUA 3K9HA 4HB3A 2BFMA 5KNBD 4X66B 2O07A 1X80A 3OT5A 4BV8A 3EYWA 1UZAA 2RHDA 2L17A 2BZ0A 3Q3HA 5THKA 4JL6A 4GKAA 5IM5A 2P9EA 1Z8FA 3NVWA 2ZQYA 5KT2A 4JT8A 4JZYA 4YRQA 1O95C 5FUYA 5JCJD 2QLMA 2RGUA 2Y8EA 3W9UA 3O4JA 5KWJA 4LF8B 1KN5A 3WGVA 4NXNB 4U6PA 1YSCA 3C7AA 2XF8A 3BMOA 4ND7A 4WBXC 2ZI6A 4A0GA 1P2FA 2ZJZA 1I30A 3BULA 2WC1A 4MR9A 3QOXA 4B7CA 1U9IC 3B6MA 4LPSA 1KSFX 5AW1A 5AI8A 1NK9A 1T29A 4Y2SA 3CKKA 1P7DA 4O3MA 5BSVA 1JT9A 4EUEA 4MI1A 1QK4A 4YFVA 5DTRA 4B75A 2CE7A 2DPYA 2RCYA 2K7FA 2ID9A 4DDHA 3NIGB 3EEFA 4DL5A 4RF5A 3SBXA 3OKAA 1D4AA 5IRCD 5LB2A 4EA8A 2EDUA 3FDZA 1E69A 5BSKA 4NIMA 1O87A 4DNXA 5GJWC 1JH8A 3X44A 5L53A 4QUIA 3ZWQA 3QVUA 1WY5A 1A5SB 2GVDC 4LQDA 4RPGA 3V1UA 5I3ZA 4XWYA 4ZTBA 3V32A 2NACA 3ZHYA 5DGCA 2Z0MA 3ZWXA 2PZEA 3ZJTA 1XRQA 2BEWB 3ZXUB 4IFIA 3WAJA 1XC7A 2LNDA 1JSCA 3HDHA 2P9BA 3PXBA 3I8OA 1VB3A 3EZNA 3NALA 5REQA 2GHRA 4BZPA 3TRJA 1JG3A 3LP6A 2P8JA 4F2HA 3L6UA 1RJGA 1NVVQ 1LDMA 3LK9A 2CN1A 4GKBA 3SHTA 3O7MA 5D2CA 4ZYTA 5FUXA 2EKPA 3P0JA 1X15A 4C1BA 3AM1A 4FONA 4JI2B 4OP2A 2WIDA 3SLGA 3T15A 4OBBA 1LPAB 1MFZA 2XQFA 1IB0A 1RAGA 2VAMA 3R5KA 4OYHA 1PWXA 2BI4A 4HP8A 4MYRA 1L5WA 2HA6A 1WWVA 3FMGA 1ENPA 3N2KB 4WY2A 4XB6B 4ZRDA 2RKOA 4FHZA 4IH4A 4K6FA 4BX9C 3MPOA 4X62B 3O03A 4D0GA 4YJ2A 3TPCA 2FZLA 1D07A 3G49A 5DQIA 3KRTA 4GMHA 4TQRA 3L9WA 1AC5A 2MUTA 2ANBA 4QASA 3SKXA 3DW3X 3T7DA 2QTGA 2RI6A 3G2JA 1OV6A 1BVRA 2RDIA 3CYMA 1WSBA 4LZOA 2ZI7A 1SCDA 3NWPA 1X7WB 1EXNA 5GTDA 4NYJR 4MI3A 3TKLA 4EAAA 3HU3A 3PDIB 3V8NA 4CV2A 1SZDA 1VG9B 2GRJA 4J3JA 1NUTA 2HMWA 2I65A 5D6OA 4R84A 3WLHA 1XD9A 2BGUA 2Q3MA 4R1UA 1FFGA 3D64A 2PX2A 3IKMB 2OCXA 2A88A 5ELXA 3WSTA 5EJ9A 3I04M 1ZD5A 2FVYA 2D0DA 3I6QA 3MHPA 1ODSA 1Q77A 5JRJA 2VOJA 1LK5A 2G36A 2FETA 3A25A 3CN9A 3O38A 4I6GA 1HNWB 1PTKA 3A28A 4M9JA 2FMFA 4ZEWA 1OPXA 1NZDA 4PS0A 1QP0A 4EI7A 3OOHA 1N5DA 1QRDA 3DAHA 4IZOA 4D7AA 2ZIZA 1CQJB 3GBSA 4IDCA 4WECA 3VNRA 2VHCA 1EX1A 1V41E 2P0YA 3FCCA 4F72A 1ZNQO 3CT4A 5I7WA 2HMSA 3OQBA 4CMKA 5CG2A 1D2GA 1SGWA 1ZW6A 1ZEMA 3LC7O 3Q12A 3QLVA 3ZVLA 1AURA 2IQIA 2QTZA 3RREA 3K9GA 6Q21A 5K4GA 2X6QA 4D0LB 1A27A 1PLKA 1OI3A 3DEFA 4AKEA 2QM7A 3RHTA 4Q4DA 3M34A 3RJHA 4MQBA 2P30A 2QW1A 4PZOA 1SNYA 3P9IA 1AQUA 1ZR4A 2EZ4A 1MC5A 3OIGA 2QTAA 2A5JA 4N5IX 2HA4A 2IBSA 1ZNWA 4IRXA 5AVXA 5I7HA 1Z2NX 2UVDA 5EL0A 1B0XA 2YVAA 5I01A 1GP2A 1I1OA 2XTMA 4YRNA 3PDWA 4NLKA 1XZJA 3ZDQA 1BEUB 2ZB3A 1JHOA 1TZMA 2ZAMA 4FK8A 5AJZA 3PJGA 4LNUA 3GRKA 4L07A 1ETHA 1WABA 1NJ8A 1V5WA 2K4HA 1AKTA 4X24A 5BUSA 3DE4X 5CB4A 4QVGA 5JW6A 2FR8A 3QKRA 1MO2A 2RH4A 4GKVA 2GUGA 4TWAA 3TCKA 3WWEA 3FFAA 4YCJA 3RRXA 3BILA 2H4WA 1X6VA 5KU7A 3HDTA 1Z9BA 3E1GA 1R27A 1G7CA 1JDNA 1NK8A 1XRJA 3GL9A 4OBEA 3VHXA 2VF8A 4EX6A 3SEAA 1E7MA 4UQLA 1Z83A 4AMUA 1BDJA 2XGMA 1M8FA 1ZQCA 3D8TA 4XX0B 5ECGC 5G0UA 2C7PA 1P5JA 5TXGA 4BECA 3NTVA 1QGUB 3RF9A 2Q5LA 1IWPB 3PCRB 1XTTA 3TIVA 4ZYVA 2V9ZA 3EG9B 4RDXA 1FIQA 3P19A 4OX9Y 1CP3A 1C20A 1K06A 4PZ9A 1W52X 4BXOB 4PAQA 3CWZA 1ND6A 5DIZA 4G36A 2BEVA 2BISA 3RTEA 4FBUA 2PMZF 2BFDA 2ENWA 4JUIA 1NSTA 2I6QA 1W7AA 4J1TA 4Y6SA 3T9EA 4NCAA 3DZCA 3IUBA 3WDMA 1NDHA 4KRXA 1EZ4A 4H7FA 2OHGA 3UUFA 1SWWA 3UT5A 2PKQP 2IWRA 5JAHA 4OHPA 1YVEI 2HCBA 1TVMA 2P62A 3RGWS 3VR2D 5BV0A 1JZQA 3K4GA 4U7PB 3EPLA 4EQ6A 1GRQA 1IEVA 2WTMA 5D5HA 5DCWA 2FPSA 4YMNA 4F60A 3SY8A 5HJ5A 4YROA 4MVXA 3K70C 1NW8A 3G9TA 4F21A 5JNVA 1QHNA 2IJGX 2UV8A 3R9WA 1M6VA 4FKZA 3ZIAA 3CCBA 1JKIA 1MO6A 2SCUB 4PFKA 5FLEX 3KKOA 2WJIA 1R12A 3AUTA 4MKIA 5EQDA 3PX2A 3IKJA 1ESMA 3I8SA 1TB4A 3DFMA 4R8SA 2LBOA 3WLQA 2VTBA 1HXHA 2ZSEA 3B3QA 3D4OA 3DBOB 3M4NA 4J76A 4NJOA 2O8VA 5ALFA 4XGRA 3L8EA 5LYJB 3K8ZA 3T3EA 4PFSA 5DP2A 2RK4A 3WNDA 3PGKA 3HJTA 4OK5A 1TJ5A 1N2SA 3JWPA 2FV8A 3TIXB 1YFZA 3DO8A 3QG5A 2XWSA 2RC6A 4GPD1 5EAIA 1ZAKA 4C78A 1EIWA 2EG9A 3WLEA 5JVDA 3GI1A 4NMLA 4IXWA 3S2EA 3I0MA 3P27A 4L4SA 4UEWA 1G5RA 3N2LA 3W2GA 4J43A 2EVWX 5HCUA 4DIBA 3INNA 5I9LA 4ZRNA 3LVBA 2FG7C 1TK8A 2QRVB 3ER6A 4TKUA 2WQ6A 4DJFC 2YMPA 1BOFA 2XYQA 2C96A 1EG2A 1ZH6A 3DBLB 4XXHA 2VVTA 3SF0A 4KR2A 2CBZA 1QWOA 3RSZA 4F1JA 1P7ZA 2WT4A 4TYNA 3SJCA 1CRLA 2BTQB 4BLRA 3ZWWA 3MBYA 4WN9B 3HVUA 3JRWA 1TPYA 4MUJA 4JEUA 2ZB2A 1MAWA 1Z0UA 2CLHB 3BH7A 4TLEA 5TPZD 4IJMA 5ALPA 1FS6A 1JVNA 3LQFA 3PTZA 1CIVA 1NVVR 1ZGAA 3E7FA 3IC5A 3OOJA 4MPRA 4DVGA 3ISJA 4JLMA 4R7GA 5ARBA 1P75A 2DECA 2VCYA 2HF7A 3K4QA 1AKEA 1LVUA 3BCHA 2C4VA 2DQSA 3MTAA 1NQOA 3DLPX 2WIGA 1ULBA 3SDSA 4O5KA 1JQAA 3DMTC 1UA0A 3WIBA 5CH8A 5DSXA 4CM9A 1D6MA 2QROA 2ZRLA 4ML3A 4Q34A 4V03A 4U4AA 2CW5A 2HSWA 5ALDA 3G9UA 3IEXA 5KFSA 4IQ8A 4M1EA 1V26A 3E48A 2R1ZA 1G16A 4WA7A 1CJSA 1FMJA 3NNSA 4B6PA 3BWEA 4DIDA 5AVQA 2G5GX 3E7DA 3VNVA 2HO5A 2OAEA 3QPDA 4MB0A 1QCYA 1VL6A 4TSFA 4GIBA 2ODTX 1LH0A 2Q07A 3I23A 4P08A 4TV8F 3ZOKA 4PLYA 4CKEB 3VDXA 2JRZA 4HLUA 4NMMA 2VYND 1U8CB 4Q4HB 3O8RA 1ZONA 3M2PA 4RD6A 4YRFA 1X42A 1Z13A 3AZOA 1A0OA 3K6JA 4ZAXA 3T4PA 1M9NA 3CLRC 2OORC 3UTDA 5HSGA 2BRUC 2X0NA 3WKAA 1Z7YA 2A0UA 4IJ6A 2GF0A 2NRZA 1O9GA 4ZYUA 1QKIA 1UDCA 3JQAA 5EGNA 1K4MA 4BKMA 4FZMA 4ZO7A 1QTNA 4P4UA 2XYGA 3WJAA 2PD4A 1NVMB 5A9RA 4GLFA 1KZHA 4Q7LA 4M04A 2FW9A 1KI4A 3T7AA 4YD2A 1RIFA 3L7KA 4RPCA 2JHGA 4CV0A 3VR3D 3H9UA 1GSAA 4J49A 3K5HA 4WKPA 3MT0A 1JQBA 4OQYA 1I13A 2XQVA 5F5LA 2EGUA 4OHVA 3KLNA 3B2NA 1CBUA 4V39A 5JYBA 4PYQA 4YACA 2V4RA 1J42A 5K9ZA 1KI6B 4JL5A 5C35A 1P2BA 3N4MB 3GVIA 5CX1B 1XNQB 4BFSA 2HRQA 3M1YA 1NXOA 4EUSA 3A27A 4W99A 3HO6A 4FEGA 1ISJA 1IZ8A 1H9AA 1L3CA 2X1HA 4HRVA 4W8GA 4RJ2A 2M6LA 1YL6A 3JQ6A 5MN6A 1NW4A 1K63A 1FZTA 2WG1A 5IFLA 5JPDA 3BZCA 1S10A 3HTXA 4YDRA 4A2PA 2VWGA 4ICAA 5CP2A 3QWBA 2R7MA 2IPOA 2IXDA 1DBRA 5CITA 4YJ3F 2I1WA 5A5VA 1YULA 2J09A 3EUWA 4WLOA 3QMWA 4NBLA 4NQZA 1FRZA 3SQMA 2CB0A 1NWCA 2RJ3A 4FYXA 5EHNA 4DSUA 5E4JA 1PK8A 2O05A 2RGCA 5IILA 3BH0A 3OCWA 3PNSA 3ZI0A 4ECSA 1V95A 4KK4A 4ZTUB 2ZSUA 1V6CA 1M2FA 5AM2A 3FOEC 5IT0A 1DIBA 1NQWA 2H63A 1U6IA 1ZN7A 9ICWA 3BMOB 1NN1A 3CF4G 3KQTA 3N07A 1G8YA 1DRUA 1YDFA 2Y1GA 3CX6A 1ONSA 2GT1A 2XNHA 3GVXA 4KP7A 1Z0KA 1PQUA 4GYJA 5EQJB 5LL6P 5C51B 5AHRA 1Y5LA 3O4FA 2BL4A 4ARCA 4NU5A 2AEEA 2QYHA 1TIBA 2ALJA 3BB4A 3IILA 4B74A 4QZGA 3PLNA 4YAEA 4OP3A 1UXHA 3BTSA 2AQ4A 1SC4A 4NJ8A 4RQ5A 4DHWA 2LIPA 3A1UA 5CHGA 2HUNA 2XQGA 2HHXA 1P7CA 1XU7A 4Q47A 1Q3VA 3SC2A 3CR3C 4JBLA 3V7FA 3EARA 3SZ3A 1KXJA 3QJGA 1NN3A 5ES3A 3RVLA 4DQDA 3OT1B 2DBZA 4F4UA 4WJ3B 1RYFA 2WEKA 5BRAA 3CU5A 2OV8A 2LDBA 5DXJA 1S8NA 3K1JA 1ZN9A 2PSDA 4E0BA 2O9JA 3F5MA 3MMNA 3QW2A 5G0SA 1WG8A 4N54A 4TYPA 2ZVQX 3HSYA 2JEFA 2B1RA 3B6ZA 2Y3IA 4DJJA 2XYRA 3LPCA 3RUPA 1J6UA 5K8VA 4DT1B 1OAOC 4CEJA 2YRXA 3GLGE 1W4BA 3ONEA 2BF7A 3CZAA 3VKUA 5L6LB 4BEJA 1PWEA 3MGGA 5J5AA 1W5EA 4I3HA 3FW1A 5FAKA 2IH5A 1SBTA 1L8XA 5FFNA 5BNFA 3C1AA 4LHYA 4Y6RA 5EWJA 4C0SA 1EM8A 2ADMA 2C20A 4U2KA 4JV2A 2Z6VA 2Q45A 4BB6A 3ETDA 3SYTA 2H3HA 4EYHB 1DMSA 2ZDQA 1B8OA 1G4UR 2FPMA 1N1MA 3I30X 4GI5A 5EZYB 1ZCZA 5FT9A 3T9DA 2MYNA 4ZH4A 2ZKIA 4J4BA 2V3WA 4LHZA 5HFNA 3ELWA 1J09A 4BJ1A 5C4MA 1NVEA 3MFIA 1AF4A 4ZREA 5CXUA 5CDFE 4P4LA 3NIWA 2NYAA 4IWYA 4M1SA 5KTYA 1LQTA 4BYMA 4RTJA 2C4WA 4Q7MB 3SSOA 5C8VA 2GF9A 4C8OA 3W7AA 2ASDA 4F5EA 3R75A 1JAHA 3M9NB 4R64A 2A9VA 1QYIA 1XU4A 2QARB 1RHKA 4QXRA 4PAWA 1YZUA 2IP4A 1SOMA 4MR7B 2Z8ZA 4CNBA 1R0RE 3O4RA 4NXZA 4H4DA 3KVOA 1TL7C 1VFNA 4ZOAA 4AY6A 4EEYA 3SNHA 1AZTA 4KRYA 8ICTA 2BQUA 4YPFA 2Z08A 2FCAA 2UVQA 3DO6A 1XSEA 2WIKA 1LWNA 4DOCA 2EW2A 4KI0A 2W9CA 2KZZA 1ES9A 1YE8A 3VO2A 3GLFE 3QKUA 4KXQA 1E1NA 4UTZA 4W1RA 4KLCA 9ICLA 1IN5A 3DBIA 1NAHA 2HLDD 2VRCD 3NM4A 4CFZA 4WXPA 4M53A 4F86A 2IPXA 3DF9A 2B8EA 2PL5A 3N8KA 1AQ6A 1KJ8A 2FW0A 3CVOA 3GG9A 3QVWA 4LKOA 2AFIA 5EXXA 1WBJB 5FLKA 2EKLA 3PV0A 1KJYA 3KEMA 1L8LA 3SD7A 1FFDA 5DMXA 2ZZMA 4DFPA 1PVRA 2B2XA 2QTVA 3GRRA 3GUYA 2A1AA 3VO9A 1VGRA 3W7VA 2QTWB 2OY0A 2BFCB 3RAJA 5JROA 2PLFA 2BM9A 2I2XB 3ASZA 4HH3C 4UKDA 3BQ7A 3GVCA 1HO3A 3D7LA 3PT5A 1FTNA 4DLRA 1OX5A 2OCEA 1PD1A 2PX4A 2OCKA 2B2CA 2H52A 3HU2A 4KAAA 2GZ2A 5J63A 4E15A 1XAHA 1ZDMA 4WEQA 5CFNA 1TKAA 3CE6A 4C06A 1Z12A 2RGBA 3T8YA 2CUTA 3MTGA 5KKAA 4B44A 3ZXSA 1I9GA 4NOLA 3VVBA 3GARA 3VKVA 1UQRA 5IEJA 1NOIA 4GR9A 1CY7A 4QBHA 3HPRA 3AL0C 2C94A 1S96A 4N49A 4MRVA 4KXYA 2QI9F 5CURA 4G5GA 3LQKA 1KDZA 3UQ2A 1EXVA 4W4TA 2W8BB 1G5QA 4B2LA 1MJ5A 1MNAA 4HXFB 4L27A 2OK8A 421PA 2GKSA 1O1YA 3EPPA 4K81B 2ORVA 1SXJB 1B16A 3CP8A 2PRYA 1Z19A 4FE3A 1NVGA 1YOBA 2EZ8A 3ESQA 3I73A 3W77A 2Z43A 4CTNA 1QRUA 4YFYA 5LXTA 1Z5VA 4FEYA 3IEVA 1BAPA 1MJFA 1FS4A 2PDAA 4R65A 3IP5A 4DTCA 8ICSA 2C3OA 2G8NA 3WVNA 1QTRA 4RQ1A 3VYTB 2VIIA 3P0FA 4KLSA 1E2QA 3NTLA 5DKWA 5J0PA 2HAEA 2QW8A 3SIWA 3G8CA 3TPFA 4JB8A 1KETA 1ZHFA 2QTBA 1I6WA 1MC1A 4NLBA 2Z9BA 3FCAA 5THQA 5CM2Z 2MYPA 3T5KA 1ZGZA 3MR5A 1BGWA 3CNBA 1G41A 1WV0A 3FGZA 5CVJA 3NAGA 3VVCA 2K7ZA 4XWOA 4JJZA 2V6GA 3HQ4O 1UXOA 4RZHA 3ICQB 4YNBA 4LGVA 2F1HA 3DMHA 5A9SB 2UZ1A 1WOMA 3BEOA 4C4PA 1US8B 1FTSA 1JJ7A 3PFIA 1K27A 3STHA 2DKXA 3PW7A 3RJGA 1E4EA 5ALWA 2AFHA 3D9QX 4FSHA 4JX8A 4MXDA 4Q4HA 4EOGA 1DINA 1R0YA 4BKPA 2FWPA 4U6SA 1XZQA 4JN6B 5GQSA 1Z6XA 2HHJA 1UJ4A 2H16A 3E7WA 5LA6A 2J3IA 1DAMA 3RFUA 4EWLA 5CDUA 1YBVA 4IXNA 2NSJA 3DDWA 4KV7A 4TLCA 3CXUA 5C8YF 3RYCB 5C8YA 4WBNF 3MW8A 2R85A 3PMNA 3BDPA 3HT3A 1Z6AA 2IZOA 1KMMA 3WL3A 2Z2YA 5JCZA 2ZI4A 3JZDA 4LUCA 4UAUA 1V8DA 1M6YA 5B36A 4UTNA 4LK2A 3K0HA 5KNIA 1JZTA 2UZ0A 3OCJA 4N7MA 4BLTA 1LA2A 4PZNA 3FTFA 2ZYVX 3VNUA 1Y9EA 2H7XA 5CVCA 4PX9A 4GE0A 4MVYA 3EGXB 4JQOA 2Z1NA 1BQ4A 1XNJA 2C92A 3VZSA 3WGKA 3R9KA 4AQDA 1FSSA 1Y3DE 4Y6OA 4F8EA 3RHFA 1T1GA 4DEZA 4F4XA 2K87A 2VK4A 4EJ6A 2XBMA 1GA6A 4RLQA 1U1EA 3KAKA 4Q7JB 3LRPA 3NC0C 4UARA 4N8SA 1VHJA 1DG9A 3S7TA 1LSOA 1PWHA 1CEZA 5KT5A 1FW6A 1PNVA 3T0GA 4FYYA 3TLYA 5BQXA 4G8BA 5G1OA 3RRGA 1IMJA 3ROGA 4BP9A 4ER6A 5JDIA 3COYA 1YVUA 5ALEA 3SJ7A 1FFUA 2H4HA 2O8BB 3EXFA 3NORA 1DQYA 1GJRA 1DBWA 4M9CA 3S1AB 4BZXA 4N12A 3HPQA 1AG9A 1UMKA 2FB9A 4WHMA 3ZLVA 2H1VA 3GLQA 4FC6A 2I80A 1W8DA 3C5EA 5FI0B 3UWKA 3ITNA 4UTPA 5IT4A 4HVAA 2ZBEA 2CXHA 3BDIA 3AY7A 1P0FA 3C23A 1V1MB 2JGRA 4L7VA 1XCJA 4CCWA 3GJ7A 1IVYA 5KX5B 2A30A 2C2HA 1A2OA 3VCBA 1KBUA 3OJOA 1YR2A 5ALOA 1Z7WA 2VANA 4B9MA 2PT7A 2P8SA 3GLUA 4MUIA 4CCHA 1GXSA 5F1OA 5AW0A 3IQXA 1UFKA 3Q9UA 3BKWA 2O20A 4N0EA 3KHGA 2Y9UA 5KYYB 4DDTA 4PGAA 4Q3BA 4CI9A 3ENVA 4P3NA 4QDTA 3S2UA 5I7RA 1XKXA 4M21A 3BSYA 5ALQA 2JAOA 2X5JO 2J59A 5TJ9A 2A9FA 5EOVA 2A3RA 2Q3FA 3HBMA 3VHXB 1N2EA 1QSYA 4B8ZA 5C1OA 4DFDA 3H11A 2X8JB 5EXDA 3ZLBA 2GPNA 3BB3A 1DEKA 2SICE 3TLGA 2E4YA 3STYA 5KTKA 1NVUQ 1VBNA 4Q9JA 5FL7A 5GTIU 1O0CA 3FZGA 4X44A 1FXWF 2PWPA 1UDRA 2Q5IA 5IDVA 4ZAVA 4B3HA 3L8HA 1XVAA 4NHEA 1OHHA 4E2FA 4EPVA 2OV2A 9ICQA 3LPLA 1RRMA 2IW3A 3K09A 5FPYA 1V6AA 3EGIA 1Y8QA 4LQCA 4XUSA 3M0EA 1MPTA 1ZK2A 1QHEA 1D8TA 2C9ZA 2I7DA 4TYQA 5F4BA 5G1NA 1SV0C 1TO6A 1R6VA 2O2JA 3EVBA 3D5TA 1A7AA 4FKMA 3RD5A 3T1OA 5B1DA 4YDSA 4P7KA 4K2AA 3WK7A 4I4TB 4NFYA 4EF5A 2N9UA 4EM6A 1I0ZA 4JDUA 4KO8A 3IQIX 4YASA 3USES 2XXAB 1K88A 4GC7A 2GTPA 1JILA 2C8VA 2CXRA 3DB2A 5LJLA 3ZCPA 2ZJFA 4MRNA 3PIRA 3H4DA 1MF7A 1Z82A 3IPRA 2IHUA 3AKEA 3RSCA 1XZMA 3TKYA 1Y4ZA 1MJHA 3C98A 1QG4A 3L6OO 1X9HA 3L79A 3VH2A 4GNRA 2IOHA 1T4BA 2VYVD 2XGOA 4AK9A 3FHJA 2Q4OA 5IJ9A 4H9GA 2IIQA 3FPCA 2NUAB 1VLZA 2WHEA 1LTKA 4XLTA 2NU7A 3N3BC 1NJ5A 1NP7A 5GOZA 5DEIA 3KQHA 4FBTA 2JJ2D 4IILA 5KPDA 1PK3A 1MX3A 4NR0A 2AT1A 4L02A 4KLDA 9ICOA 3NNNA 5A6SA 4QXMA 5BW5A 3ZDBA 2OBBA 4B32A 4QVKA 1JQDA 4JROA 4Z0HO 4I2BA 4ZOHC 4YH1A 3SR0A 1M34A 4EVSA 3RRHA 2JJ1D 4HZUA 1EUCA 3EXIB 1PSDA 1FDSA 2X0KA 3MK31 4FFPA 4Q9IA 1M5RA 2BEUB 3DCIA 1WR8A 2OFFA 3B6JA 1CS0B 5B53A 3VBEA 1HDIA 2JRLA 4K9NA 5LLSA 4YV2A 4JSRA 3UPUA 3U60B 2BFPA 4MS3A 2Q2VA 2QJTA 5F7OA 2QV7A 1D6SA 1XNRB 4AG5A 4JIGA 2JH1A 1MVOA 3OLQA 4PXYA 3HPOA 4NXMB 1HEUA 2I2WA 5JYEA 2GN0A 2OILA 3PDIA 4XJXA 1C7EA 4M9XA 4WE3A 6CHYA 2R8EA 1M0EA 5BSGA 2XCPA 1C4XA 1Z08A 1AZSC 1CTQA 2J30A 2R87A 2OV1A 2XMBA 3NBMA 4LIPD 3IAHA 4UCWA 3ROFA 4YUWA 4ZJZA 4XD7D 2FCRA 2X41A 3G5UA 1F6WA 3IBTA 1QS0A 1BIFA 3PQ4A 4AJOA 2W8KA 1BXZA 3O9ZA 4MUXA 4G3XA 2QTLA 3H5WA 1UT5A 4GG1A 3L8CA 1CZHA 2P4EA 1RZVA 3COZA 3K0EA 1T3QA 3LBHA 3UIEA 4ECEA 5BWCA 4KX5A 1R6AA 3HXQA 1XK6A 4DV0B 1KMNA 4R6XA 2Q1XA 3EWAA 1G64A 1NXQA 3T7RA 5A5DA 2O6KA 2VEDA 3OX1A 4H08A 2JLSA 2J5RA 1OF1A 2XMGA 2PLNA 4KU4A 3ESDA 3GAMA 4MP8A 4RV5A 5HE9A 3RVOA 3PITA 3CRNA 5E4YA 1EFCA 2IUEA 4AF8A 2QMZA 1ECJA 4QC2A 3L49A 1A9SA 2OLKA 3T52A 3HKEB 3QLJA 2XWQA 5D5PA 3RBEA 1IDN1 1W85A 3M6IA 2ZVPX 1JPNA 3CWCA 3OIWA 4RY0A 2BN4A 1X7WA 2FOLA 2FWAA 2HF2A 2PR7A 1MX5A 1NC3A 2WVHA 3BK7A 3DA8A 3GMDA 4KXFB 4N3AA 3VPSA 2H6EA 3LTEA 1G2OA 1NJ1A 2NXWA 2WZDA 2X5OA 2BGIA 3PFNA 2YHAA 4D8TA 1EK0A 2ACWA 1Y9AA 2H4YA 2I4RA 1BEZA 1SMKA 3VPAA 4KR3A 4ERNA 2XWBF 2CXTA 1PG5A 3H05A 3EQ6A 2ZR7A 3V33A 4ER7A 1WYGA 3B48A 1C4KA 3EEYA 5CCXA 3TXXA 3EIFA 1E2EA 1Z39A 2GZ1A 2YIVX 5SICE 1P19A 4IQ0A 4DL4A 5DXAA 3V42A 4EW2A 4YT4A 1E5LA 4OJKA 4BFZA 3A11A 1M6WA 2EBHX 1QYVA 3GC6A 3GRAA 4QARA 4Z9FA 5HTKA 3HR4A 1EH5A 1ZLYA 2R4QA 4FIDA 2YXBA 1IK6A 4AJNA 4BVAA 5CIQA 1UAGA 2OYCA 1JG4A 2VDRB 3EIOA 1VGVA 2O7VA 2H06A 3I53A 2W2KA 4FGKA 5JY6A 2DL0A 2D5LA 4URWR 5EXTA 3ZEIA 2MMGA 2YJ4A 4MB2A 4MITA 3Q2OA 1YRHA 4LE1A 2C5FA 1U4OA 2MT9A 4JBYA 2R7KA 2XZOA 1TM4E 1JR3D 1ARZA 1NXTA 4IKOA 1F2DA 1CR0A 1UUFA 2BFFA 3DV2A 3IIMA 3BWCA 1J2YA 1OFIA 4KXUA 4M3NA 4R9SA 5CRIA 3X1YA 5HW0A 5BSUA 5FH9A 1ESDA 1HQYE 2VAVA 4EGFA 2HREA 2IMWP 3EQ8A 4HDSA 4OMUA 1WTCA 5DOZA 5J58A 4A27A 4YMTA 2I4LA 2W04A 2LPEA 1KVTA 1CU1A 1TEXA 2H5EA 2E4UA 2OZKA 1TUIA 2XA2A 4UMVA 4Y1FA 5LMNB 3CJRA 2MSCB 3VAZA 1O94D 3IIJA 1HR0B 3U44B 3KBBA 3RFCA 1KQFA 2I87A 1DCKA 2OZEA 2G7MC 4X6UA 5CDTA 2BDEA 3IJPA 4TM8A 1UBFA 3EASA 3WRVA 3GGDA 4EF4A 3CKMA 3B5JA 4U9UA 1LW6E 1WP4A 4KFRA 4CKCB 5TMBA 4UUAA 2NO1A 4KSYA 1XTRA 4Q4CA 1EUCB 3EXIA 1ZD9A 2PUCA 2HH9A 2HHCA 2VAPA 1M7BA 2DPHA 3BXGA 5CJ7A 3GEPA 1I7PA 4IQFA 4DV2B 1JKXA 5ALXA 1OA1A 1MKYA 3CLHA 4DQQA 3EOZA 3HCEA 4H31A 4Z9AA 5BW6B 3DHNA 3NTXA 4EI9A 5HCNA 1XA3A 4RA9A 2FPOA 3E5NA 2Q2WA 5AOAA 3WRWA 2I9KA 5EJAA 2JLVA 3RB0A 4R1SA 1U1DA 2I2AA 4G07A 1U2ZA 5KFAA 4MB6A 2WYHA 4S1VA 3F8SA 4XJSA 4KPYA 3KE9A 4FSDA 2C00A 1VSUA 2JGDB 3ILXA 1O6GA 3W04A 3QWHA 3GCDA 3EQ2A 4PHGA 4PLZA 5DLEA 4A03A 1MN6A 4BAGA 4EL0A 2PKCA 3ANMA 3RFFA 1P5FA 5KNCA 1G4HA 1SCUA 1K1SA 4FFDA 2BCGY 1PGOA 2D7CA 2V7XA 3T3HA 3TR6A 1N32B 2GJ8A 2X3UA 4HWOA 4CMCA 4NL9C 5C5JA 4D99A 2B7CA 1SXIA 4OLFA 4URFA 3TI9A 2EAUA 5E1BA 5TMPA 3BMQB 2UYQA 1YL7A 1USKA 1SC9A 4ND2A 4A4DA 4MRPA 2P7HA 2RIPA 5F3RA 1XPRA 3FUUA 4UMDA 4I1SA 1Z06A 4KN8A 2SHKA 2B69A 1WPXA 3OEED 3I9KA 1GZDA 4L6CA 5BMVA 3NJ8A 2C4NA 4HC4A 1W1UA 2ZPTX 2GK7A 3PRKE 4C01A 5FBQB 2AG0A 4MQ6A 1FXWA 3WICA 1V85A 4KUHA 5REQB 1L5LA 3RTGA 3F6YA 1XZLA 2HNAA 2OT3B 3ILHA 5M04A 2PGNA 3KP1A 1R18A 3WGZA 2WKRA 3SHFA 3AL3A 4CYMA 3AYZB 5C8YB 1FYWA 1NKTA 2OKGA 2ZTSA 4KDFA 4DLPA 4ED9A 1ISPA 5MF6A 3SKYA 5JT1A 1MIHA 1HZJA 3VYWA 5CIYA 5FBKA 1XJ0A 3FPEA 1SOWA 2BOVA 2J5KA 3TLGB 2JVJA 3SWWA 5UKDA 2WVGA 2Z04A 1Y3BE 2WM3A 1OJLA 1F2UB 3D0QA 3B3FA 3RS3A 5ENZA 3JVIA 3LNTA 2G71A 5C80A 4PSVA 2DLDA 5KAIU 3QTLA 3GJ3A 1GQYA 4MO2A 4HZGA 2VEOA 5CT8A 2C2DA 1QQAA 1GTG1 4YMHA 1UM8A 2OAP1 4IRUB 4QQ8A 3UHAA 4CIVA 4DNQA 1VLJA 3IHTA 2UVRA 5HFJA 2HO4A 3ZBPA 4K88A 4XD2A 3IHWA 1VSQA 1UINA 1REQB 3L6RA 3VZBA 2QUZA 4ZAWA 4I2FA 3ZKWA 3SQOA 4C0AC 4NM2A 4QODA 3ETJA 4DCJA 1JA1A 1Z5ZA 4FS1A 5H83A 2NO9A 2PNFA 1H22A 1USVA 2PZKA 4OSEA 4QREA 3OF5A 1V39A 1G5IA 1LBSA 1EJ0A 2FG6C 3GEGA 1MSWD 4JEIA 4O29A 1JTVA 4RMJA 3UH0A 5CEEA 4AQYB 5PNTA 4UBIA 4B2PA 4ZOEA 2GETA 1JNYA 1NJGA 3E84A 2OM6A 1V2HE 5JAOA 1V1JA 4AN0A 3DNMA 3UUEA 1I94B 3REQA 1KVRA 1KBZA 2ZUSA 1UWVA 3PPXA 4NE2A 1KEKA 2PG3A 2W4IA 4DA6A 1UPTA 1XZGA 3GLVA 2B3TA 3L8FA 2EOAA 3MR2A 2PZLA 3AUYA 3G2QA 4ILEA 2DQNB 1WMAA 5IX8A 1FTQA 1PS0A 2IK8A 2YZKA 3W3ZB 2V0GA 1T3NA 1NBWB 1TD9A 3A2KA 1OXJA 2EU8A 1AMNA 2JCVA 5EIOA 5ED0A 4AKIA 1CFZA 4LZLA 3QU5A 3FLAA 3NOXA 3Q3GE 3OE5A 4R1LA 3VPHA 3WLLA 2XB9A 4ELVA 2XECA 1VCHA 3D8BA 3RANA 3CV3A 2R8RA 3CX3A 2PRSA 2IIBA 3PPIA 1Y3IA 3NGMA 4HX5A 4DREA 1SUSA 3ISCA 2XT9A 5CNKA 1KYYA 1QRRA 2MHCA 4KWTA 4KXXA 3M9WA 1Y8RB 4XAQA 1GZ5A 1QJ4A 4AY4A 4DFJA 3Q5GA 1KHTA 1O6FA 3TANA 1PS9A 2CEAA 3A4TA 3JCZA 4UXHA 5CAEA 2IDZA 1BU8A 1DC7A 2R48A 3E23A 4H1HA 2ZYDA 1I4WA 4PLTA 4O08A 2X0DA 4DF3A 2ZM6B 4R8VA 2VF5X 2H51A 3T1QA 3JS5A 4EJ0A 4ED7A 3AR5A 1Z8DA 2E8OA 3WU2U 1GYRA 2H54A 2B82A 2QUIA 4MAAA 4F85A 4BMNA 3W5AA 2IS6A 5B37A 3KSBC 2I8AA 4PHFA 1F7UA 3HA7A 2JEZA 3H2YA 1EHIA 2VCHA 4KLZA 2BELA 1ZJ4A 5CA0B 4OHKA 3MBOA 3RRBA 4DSAA 2WHYA 5JYDA 5CVTA 2Q5OA 1CB7A 1NBIA 2VJKA 5JPCA 2FLVA 1JI3A 5T8KA 3MNFA 1NV9A 5F23A 4LF4B 3FNGA 4MFCA 1FVFA 2IHVA 1DJNA 4KLMA 2M9MA 2ZTUA 3CEJA 3OTGA 1CHNA 3IE2A 2Y71A 1SUFA 2XXBA 3MWGA 2VUTA 4QWBA 4JUAA 5CNIA 4WK2B 5L1MA 2YN2A 3ZJVA 1MA3A 3HKBA 4O4JB 4O5EA 1NLMA 3X2FA 4U7TB 2LDXA 2FFQA 4U2EA 4GPZA 2CLEB 5HQJA 3X2EA 4EDFA 2EFJA 4FGWA 3ETRA 3OJEA 3VPCA 2W58A 1F0NA 2KLHA 2H48A 3DZBA 1LF0A 2DY1A 2C4TA 3AUXA 1VDZA 2BZSA 2WIJA 3HRHA 1CPYA 3ZQJA 5GJBA 1FNDA 3ABOB 4CMEA 2JD0A 1TA0A 3K0CA 4PSAA 1R00A 2YY6A 3N97B 1HE8B 2D2XA 4D74A 3NTRA 4DWJA 5K2MA 3AMVA 2AFRA 3IR6A 3N9IA 3W3AA 4LHSA 1E1KA 1NDQA 4GQBA 2JI9A 4HS4A 4HDMB 4R0NA 1JDPA 3MDCA 5C0OE 4B6RA 1Z4JA 3LLVA 4AI6A 5AHOA 4RIHA 4YCBA 5KKCA 1K7FB 2E3JA 2CB9A 3F2VA 2G17A 3N8NA 5ARCA 4ZZIA 4WKNA 3MGIA 1HBJA 4HYTA 1DAKA 2EXXA 3R24A 1HYHA 1NSFA 5WRFA 1HUOA 3DVQX 3HI6A 3WLIA 2NQ2C 1FJHA 7ICLA 3JY6A 4TXLA 4NI5A 1MX9A 2JIPA 3OLYA 4DN6A 3H8JA 1Z0DA 3SFTA 3TXYA 4XUDA 2POCA 4K86A 3IXLA 3OA2A 4FDTA 1YQEA 4BS9A 3V4VB 3AW9A 3ZU6A 2X6TA 3DOOA 3U9SA 1V96A 2ZTEA 4DLLA 5AVVA 2BCUA 1SOAA 3IERA 2KK0A 3QXXA 1DFIA 2H4XA 4Z3KA 1P4SA 3WFIA 1JLLA 4Y0AA 4V0KA 5JAIA 2G04A 3OQJA 2PYDA 5H68A 5KJCA 3G5AA 2D2EA 4CODB 2IBTA 5HDBB 3O9MA 3S40A 4FW8A 1BGVA 5CXSA 3VH1A 2H5XA 1ODJA 5AKGA 4RACA 3BHMA 4UB1A 4YRTA 4FM9A 3QEMA 3MN1A 2OXTA 1ZJ5A 3NM6B 2A2ZA 1ISRA 4XYMA 4B0OA 1EDZA 3ZD7A 2J7PA 2WSMA 3NH6A 4LOHA 4Q16A 4DR7B 2PX5A 3ZS8A 3LL7A 3VJLA 4V1CA 3G5MA 3BYZA 2REQA 1OWNA 2HB6A 3C3CA 1PO7A 1PJ3A 2Q7OE 1SHKA 2KTQA 1JDVA 5T6MA 2NVOA 1N8SA 3B9JA 2M98A 2LWIA 1TTPB 4JVNA 1XN4A 4CLRB 5JSUA 3VU8A 3J7TA 4MJLA 3ZI7A 1USGA 3KQYA 2E3TA 4QW8A 3L40A 1DOQA 3I9OA 5H70A 1XTBA 4PG8A 3UXPA 2Q5FA 4O3RA 4GRDA 4MCJA 4X71A 3FAKA 3THXB 4QOGA 4MK4A 3D7MA 3LRTA 3QXJA 4B82A 2VJAA 1R3DA 1ADBA 4EPXA 2ZJ7A 1Z7BA 3T1HB 3ZU3A 5DB9A 3RAEC 2XUKA 3BE4A 3DOIA 4HNQA 1U0SY 4LDJA 1TQHA 1IG6A 3WS7A 3HV2A 2HBJA 4U0JA 3VU3A 4J4HA 1BHO1 1EB9A 2JHFA 1O08A 1YI8A 4QTUB 1CT9A 1Z2PX 3NDIA 4FLEA 4HSGA 1XOIA 3U26A 1Q0SA 2PMWB 3O4VA 2HA3A 2ZTVA 3NONA 1JJVA 1H4VB 2TS1A 3EAFA 4FGJA 5LCXA 3PE4A 2HVIA 5D87A 2GN9A 2UUOA 3L3BA 1TMGE 2WYOA 3VBCA 1FLAA 3I2IA 4HKTA 4K6CA 1SQ5A 1GUDA 3VKFA 1C9KA 4PZZA 3U40A 1IHUA 3RVQA 1WY7A 2A33A 2DR3A 1COOA 3JQAB 1RLOA 2OFXA 2WF7A 2MIIA 2OXEA 4U7FA 4A8HA 4MA0A 4CPDA 4E5UA 4HEJA 4KR0A 4LFAB 3WOHA 2GLUA 1AUPA 3KZIU 1ZG3A 3WKEA 4ZOLB 5FV7A 5INTA 4ZD6A 2J0EA 2RGNA 2XQKA 3DCNA 4LEIA 4PLGA 4MW1A 3CVJA 5EIBC 5HIJA 5LP6B 3CY6A 5KMGB 1Y5NA 3JATA 4M1ZA 1G0NA 3MS4A 1C8VB 1KR5A 3AEQB 1QVRA 4ZCLA 1HPLA 2ZS7A 3IE1A 3R8FA 5B3KA 1KP3A 1N48A 5DX8A 4C4TA 3FNFA 4L6IA 3EZ7A 4LJ6A 2HPVA 2XIJA 3E8XA 3Q1KA 5FL7D 3W8EA 3LBAA 3T5GA 4POOA 5JFTA 4MUFA 2J41A 3PUXA 1J22A 2AZXA 4IQTA 5I9IA 3KUCA 1NKBA 3AF3A 2G67A 4JB0A 1Y7TA 2H7CA 4KWEA 4EPTA 4MKXA 3S2GA 2P91A 3QXGA 4FGUA 3QBTA 4OGGA 4JAVC 4X90A 3RSHA 5AVWA 2P9JA 3Q3IA 4BWMA 4OTZA 3RUEA 3DQQA 5E1OA 1PQYA 5GMOA 1PVDA 3SAGA 2R66A 3G13A 3PF9A 5DP1A 5E6RA 3K70B 1WJGA 4IXMA 2ZCVA 3FYDA 5HZGA 3P26A 5HVNA 4ZTZB 5K05A 2P3QA 5LNK1 2QKYA 3O73A 4CUZA 4AYBF 1BVUA 2GFQA 2JIMA 3KHKA 3NM5A 4HB0A 2QTTA 3CH5A 5I7VA 2LHTA 2ZBRA 3BS5A 3LGXA 3RG2A 1W25A 1F44A 1IVNA 3TINA 2B3DA 3C4QA 3K0KA 1BSVA 1GZHB 3TRKA 1M1UA 4B48A 4D5GA 1RPAA 1KAEA 3K71B 1IBKB 9ICBA 3LY7A 3FM9A 4NZYA 1RM5A 3IQGX 3ZNOA 3QUCA 3TSZA 1V25A 3UAXA 5DM60 1AMOA 3SVLA 3DAOA 2B36A 4CGZA 1L7DA 3TTWA 3QU4A 1C7IA 4ZZ2A 3SXUB 4OHMA 3OUZA 4DXDA 2PX6A 3PRYA 2FHSA 4XVQA 2OQVA 3SIXA 3WOVA 5B6IA 4KI7A 5E0KB 2A1UA 1EWKA 2B30A 2YWJA 2D8CA 1ECCA 3DHVA 2O3UA 3RV4A 4RMNA 2UDPA 3N76A 4U9IS 1XF9A 3GLSA 4EJSA 2OD9A 5HILA 2GAAA 5LU8A 4QVIA 1ZQ9A 5L1KA 1DIAA 3FI0A 4UJ3A 3WK9A 5KVQA 3TB4A 4AT1A 5D86A 1RKBA 1QHHA 4BE7B 2HZBA 2FWRA 4D4GA 3F3YA 9ATCA 1KOFA 3L4BA 4HNUA 5IZ4A 1V4NA 4OXNA 1A4RA 1S0OA 1E99A 1Z45A 2AJBA 1ZRHA 2MYUA 1CLEA 3HJUA 2W6ID 3RKRA 4CKCA 4ZOQI 2QDKA 1KK3A 1G17A 4TLLB 2EKDA 5HM6A 5JADA 4EZBA 3FYUA 3AEKA 3F3KA 3F6RA 2AWOA 4GFJA 1EGQA 4EUHA 3LRXA 1QRTA 1CR2A 1UBOS 4IHJB 1N2XA 2HRCA 3QVMA 1AQNA 4PN3A 1XYGA 1DO2A 4HNHA 3QELA 1TK5A 5CH5A 1QZ3A 4Q44A 2FPGB 3PYLA 1ZQVA 2FDRA 1YZ3A 3MA0A 4FMDF 3ZR4B 4E51A 3VO1A 3V1TC 1T0UA 2FRVA 3NWJA 3F4BA 2AV6A 5KVAA 1AHNA 5J2UB 4YP5A 1LLFA 2A5DA 4Z6DA 4TWIA 5DWQA 3C45A 3FSGA 3MFHA 4N6GA 3RBVA 4KREA 2JAHA 4YWHA 3B1ZA 2CHEA 1LB2B 3UJDA 1L5MA 3ZWPA 4D2IA 1ZPDA 1ESCA 5K6AA 1DKLA 4GC9A 3LUBA 1WVIA 4XOUA 1G2QA 2DAPA 3HBFA 4HQ6A 1QDEA 1M67A 4RSGA 3U3KA 1E64A 2O1WA 2XLBA 3N6XA 4RESA 1MH9A 1R0SA 1QVZA 4PU0A 2XMCA 3IAS6 2V6IA 2H5JA 3IDWA 4HEA1 4DSJA 5AKXA 2ACVA 1GY8A 1G9SA 2CD7A 4LBZA 4UFNA 4BFTA 1KQOA 3VOSA 2HGSA 2XE6A 5C7LO 3LECA 3D7NA 4MZDA 5BXYA 3UJ8A 4F12A 2V4QA 1EQAA 2KSQA 3S5UA 1UK9A 3DL2A 2HGZA 5FKJA 4YI5A 3FIUA 1WDWB 2CF5A 2BEWA 4FP9A 4FHGA 3WKCA 4PE5B 3FOFC 1Q74A 4FW9A 4ZP1A 4W1SA 4R5HA 5I4KA 2ZDGA 1J24A 3RS7A 3DFUA 2KZ3A 3H40A 2IZ6A 4ECWA 3LK6A 1RXIA 2H3QA 3CUWA 4ID3A 4L5IA 1X9WA 3AQFA 3JARA 4MHOA 4RF4A 3ZJUA 4BRZA 1F06A 1U3UA 3UYLA 2O0MA 4QUHA 4P0QA 2V58A 4OXYA 3EF1A 3OZTA 4R69A 2Q6OA 1E3WB 3WB1A 1A50B 4MAMA 2NV6A 1UJNA 4X20B 1DG3A 1ZXIA 5GWXA 3BJZA 4EW1A 4M9ZA 4TZ0A 2KV2A 1KMHB 5EUMA 1IUKA 5A4IS 4D4LA 1QIKA 3G0IA 3I4FA 3HKDB 5FBHA 1GGVA 2NU8A 4NNPA 5IVPA 3G7SA 4JC8A 4OF4A 2JEIA 2ZYAA 1FMLA 4F7DA 1U7ZA 1S2LA 2PI5A 2PZ8A 3MFQA 3N6RA 2G0AA 1BHJA 3S99A 4CN9A 3V2GA 1FRQA 4D4HA 4U2BA 2O59A 3LDGA 2HW3A 2EAOA 2PQMA 4UM7A 3W4JA 3HDYA 2Q9CA 1N0UA 3L1KA 3ZGVA 5KAPA 1H6CA 3HA3A 3NT2A 2D2IA 4U3JB 1NDUA 2PFQA 3KQVA 1IXKA 1U80A 1H1LA 1SB9A 3K1AA 3LWBA 3RODA 3B5IA 3Q3CA 4KFUA 5FWYA 2VPTA 1EFRA 2X9NA 3KAPA 4QYIB 4EVIA 4Z7QB 1KTIA 3MYYA 4PLVA 2V0CA 4MZXA 5KT4A 3UCXA 3VDRA 4O2AB 5EIXA 4OHOA 2EANA 4RDIA 2A92A 3LWDA 4FI3F 3KR0A 4N40A 5FDFA 2DR2A 1NURA 5G0VA 2LKYA 1UBKS 1KZ6A 1VYTA 3HU1A 4Q1DA 3R9XB 3IOMA 3U4CA 5DTQA 4GBGA 1PK1B 3HWTA 5EPEA 1YQUA 4K6GA 1TFRA 2H4ZA 9ICSA 4BMYA 1BMDA 4O4JF 4Q4AB 1PQWA 1JMYA 2R86A 2I7VA 3D6FA 2NYVA 5KFEA 2WJ3A 4HVTA 4R3NA 3HCAA 5ICFA 5C31A 5JD3A 5LQUA 4HX2A 1TQ2A 4RE6A 1JPJA 1WZIA 1TF5A 1V9SA 3C5VA 2PX0A 1E1QA 1G6KA 3IBGA 4YR0A 4MEJA 1BU5A 5DMHA 4JWKA 1TEHA 3RYIB 4AZSA 3K6KA 3II6X 3KLBA 4ZPXA 2HQRA 1YBHA 1QIJA 2Q3EA 1G3QA 1UZLA 2AQ8A 1NQUA 2OO5C 5ALGA 3BD6A 4X7PA 1D1SA 3D3EA 3LBIA 3VMMA 2CLMB 2J3QA 4JJ6A 3N5KA 2DUWA 2UYGA 3D0RA 4CDGA 3HCCA 4ZAGA 2PQ2A 1DC5A 4HFMA 1NMEA 2ECKA 3GLHB 5LDDC 2YVLA 5TZVA 1KC1A 1B2LA 1NF2A 1J23A 3HWRA 3IAAA 3RIHA 4L5YA 3GGCA 1T6NA 3JQEA 4FJ0A 4BVJA 4E94A 3AM3A 3P45A 1N2CA 4GECA 5KFVA 3D59A 2XUIA 2XUQA 1HSOA 5H5JA 1P4JA 1XHLA 4OHRA 3K5IA 3L4SO 1XMXA 2F1OA 2G82A 3D3NA 5LZ5A 2O7RA 3CEHA 3V1KA 1M6HA 2UVWA 4YCNA 4NZ9A 4M9UA 3SP1A 1ZC4A 3TMYA 3QOYA 4CQMD 4ECZA 1JA9A 4MGEA 2B4AA 2AR7A 2PQ0A 3CXRA 4Q7QA 1A8IA 2GEJA 2CDAA 2MSNA 2OCAA 2XUAA 4BMSA 2HYIC 4JLBA 9ICXA 3F2CA 1APBA 1MRSA 2CBXA 3N59A 1MB3A 1U3VA 2ZB7A 4IV0A 3VPFA 4X20A 2DGZA 2WOOA 2HHLA 1MC4A 1RLUA 3OAAD 4G5FA 2GJKA 2BPOA 2QVYX 3EPHA 2PSHA 2VQDA 7ICJA 2YYYA 3NZEA 2E8PA 5IYZB 3DFFA 1SL0A 1LI4A 2CUNA 4RVDA 4BQFA 2J6SA 1QHHB 1WWKA 1L4HA 2Q6LA 3T94A 3KHLA 4OXRA 2K60A 2YFYA 2YWFA 1LD3A 3AOGA 3DQPA 4FD3A 3BB1A 4J4TA 4K6KA 5ENDA 2AN3A 3PCTA 2HJRA 1KEPA 4HTFA 2ATEA 3RJJA 3CZ4A 2P3OA 3HFRA 4QWMA 3VR5D 1E3QA 2PJUA 1KK1A 2BFDB 3GCGA 3MRXA 1LPBB 1WB4A 1MQ8B 3SNKA 1PJBA 4GP7A 1V4BA 5KYUB 1B41A 1O7JA 1F8GA 4OSOA 1RXWA 1USIA 4CM9D 3W2TA 1NBME 2F43A 4RVUA 4R0VA