2WF7A

Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf7A01
4E88A 3R9KA 1RKVA 1KYTA 1FEZA 4HGOA 5ALQA 2Q4RA 3PGLA 1Z4QA 5AKKA 2I54A 3NUQA 5FP0A 2FUCA 3PGVA 3QUQA 1CR6A 1SWWA 4EELA 3E58A 3L8HA 3OCXA 2B8JA 2R8YA 4FYPA 2RB5A 4BX2A 3WKCA 4J03A 3EF0A 2P27A 5AKGA 1XPJA 3N8GA 3N28A 1TA0A 1L7NA 2WM8A 3ZVMA 5AVSA 4XQ0A 2G1AA 2WHEA 2GHQA 4YCNA 5AM1A 3R09A 3MN1A 4MUMA 3U7FB 2NO5A 2YN4A 2VKQA 3DNPA 1Z88A 2WF8A 3HLTA 3U7EB 3KD3A 4OD0A 3E84A 1RQLA 3OCVA 3AR3A 3ZX5A 4RETA 5AKIA 5IS2A 2AUTA 3ED5A 1RMYA 2JARA 2P9JA 3L0CA 4H1WA 1LTQA 4NV0A 3SKXA 2NO4A 5AKJA 3FZQA 2ZXEA 2C88A 2GFHA 4UARA 3FPBA 2G07A 4KNVA 1RDFA 3QXGA 2RAVA 1SWVA 2G09A 2OA0A 3WK9A 1L6RA 4NFLA 2Q4TA 1ZD3A 2G06A 5ALRA 1ZJJA 1X42A 4DCCA 2OYCA 1J8DA 4I9FA 3OPXA 4IG4A 5E0OA 3SF0A 4UU1A 3WGVA 5ALGA 3DAOA 5AW7A 5AI5A 3EF1A 2B30A 3KBBA 2B82A 3M9LA 4CF4A 5ALIA 2O9JA 3QLEA 4QJBA 3FVVA 1WR8A 4UU0A 2FDRA 5AI8A 1TJ3A 2IYEA 4CNQA 2EARA 3QUCA 1Z4NA 4CF5A 3CNHA 5AVTA 3KZXA 4KNWA 3WK7A 3WK8A 1Z5UA 4ZEXA 2PQ0A 4C4RA 3QU2A 5ALPA 2HI0A 3IRUA 3WK4A 3W5BA 2ZBGA 2YMLA 5AK4A 5IT4A 4UMFA 3J7TA 4F72A 2ZBEA 2YMQA 2Q5EA 1N9KA 1RMQA 5AW2A 2YBDA 1IWOA 5AKZA 1J97A 1Y8AA 2FPUA 3UMGA 3AR4A 3ZW7A 1QQ7A 1LVHA 1U7OA 5AI0A 1VJRA 2FEAA 3NRJA 5AW6A 3A1CA 2B0CA 3WKDA 4PNHA 1U2TA 4Y2JA 5AVUA 4I9GA 4F71A 2C8KA 3N07A 2ZBFA 5AVRA 3ZWDA 4BNDB 3OCYA 2WFAA 5AW5A 2YJ5A 3ZTWA 4HGNA 2RBKA 5ALXA 3I76A 2BDUA 1RC8A 2EAUA 4L6AA 4CF3A 4KX3A 3ET5A 2IOFK 3SKYA 2B1RA 5ALJA 2OBBA 3QYPA 1RKUA 3U7HB 3F9RA 4NABA 1ZD4A 5ALKA 4XOUA 4AS2A 2WF7A 5AI6A 2RARA 4Y2PA 2P69A 5AW1A 4YCMA 5ALEA 3ONNA 4Y2TA 3NANA 1O03A 5AKYA 3QUTA 3PCTA 1Z4LA 5ALDA 4BNDA 2I55A 1NRWA 2HDOA 4NWIA 3WKAA 1QQ5A 3A1EA 3UMCA 2GHTA 1SU4A 4IFTA 3KDPA 2WF5A 5ALYA 1L8OA 2R8EA 5AK6A 2GMWA 3B9BA 1XP5A 4EENA 4JB3A 4BEVA 2HF2A 5ALTA 2BDEA 2FUEA 5ALHA 2R8ZA 3M1YA 4DW8A 5A3QA 3W5CA 4EX6A 1AQ6A 4O8CA 3SD7A 2W11A 3OTQA 1ZRMA 1T5TA 2HF7A 5ALVA 2MU1A 3N5KA 1ZRNA 1YNSA 5JJBA 2W43A 1WVIA 1VJ5A 5ALLA 3UMBA 1RLTA 3U26A 5AM4A 5AM5A 3NAMA 1Z4MA 3AR9A 4BX3A 1Z5GA 5AVQA 2OM6A 3R4CA 1U02A 4Y2VA 3VAYA 3P96A 4HGPA 3U7GA 5AIBA 2C4NA 3NASA 3RFUA 4UAVA 2R8XA 3W5DA 3QX7A 4BEWA 4KX5A 1NNLA 3L1VA 5AVVA 1TJ4A 3E81A 1Z4PX 1CQZA 2O2XA 2YMMA 4RESA 1YV9A 2ODAA 1WPGA 3ZTYA 3AR2A 2MSNA 3KC2A 1VFPA 3EWIA 2AMYA 4UMEA 2B8EA 2IOHA 3QU5A 3ZI4A 4Y2YA 2ZBDA 4Y2RA 2G80A 3L7YA 3S6JA 1RLMA 4AP9A 1RMTA 2I6XA 1YJ5A 4YCLA 4OFZA 3MPOA 1L7PA 4C4TA 5AK5A 3TLMA 4Y2SA 3OCZA 5AI4A 2AGVA 5AM2A 3L0YA 2GO7A 3A3YA 2JAUA 2P11A 2YFYA 4AS3A 5T41A 5AW0A 3AR5A 5AKHA 2CFSA 3PDWA 3U19A 2C8LA 4OHFA 4UM5A 2DQSA 3I6BA 5A3SA 1YDFA 2FPXA 1U7PA 5AKEA 1RQNA 1L8LA 3ZX4A 3ET4A 1Q91A 3W5AA 3WK6A 1RPZA 1PW5A 2QLTA 4HGRA 1ZS9A 5AW9A 5ALNA 4ZEWA 2IOFA 3L0BA 4YGYA 1S2OA 2QYHA 3NIWA 3QU4A 2YJ3A 1JUDA 5AW3A 1S8OA 3IJ5A 3ZU6A 3D6JA 3ZVLA 3SHQA 2HSZA 3QNMA 2PKEA 3L5KA 4BYGA 3DV9A 4UAUA 2PR7A 5AVXA 1TE2A 5AM0A 1Z4KA 5ALMA 1L7MA 4XE5A 1N8NA 4HGQA 4UATA 2JAWA 5AM3A 3FGOA 3KOOA 1EK2A 3OCUA 3GYGA 3OCWA 4BX0A 1ZD5A 3FM9A 5AW8A 2YJ4A 4L57A 3SLRA 1RRCA 2HCFA 3ESQA 5AIAA 2JAOA 4BBJA 1Q92A 3QGMA 3WGUA 4GXTA 2D2VA 5ALSA 3B8EA 4UMVA 2I33A 1XVIA 5AHXA 2MU2A 1RLOA 5AESA 3B9RA 2X4DA 2HX1A 4G63A 1EK1A 5AK3A 3ESRA 4ZEVA 3EPRA 3K1ZA 3AR7A 1RKQA 3E8MA 2HO4A 2JGAA 5AVZA 2FPRA 3NALA 5AI9A 1U2SA 1WZCA 1F5SA 4YIKA 5ALUA 1Z4OA 5AKLA 3A1DA 3L8GA 1QQ6A 4L6CA 2B1QA 1MH9A 4Y3UA 4EEKA 4HAIA 1O08A 2G0AA 5AICA 1K1EA 3DDHA 4EX7A 4UASA 2CFTA 4JDPA 1TJ5A 3QU7A 3I1YA 5ALZA 1L7OA 4C4SA 4FFDA 4Y2UA 2HEGA 2CN1A 2BY4A 2G08A 2FI1A 2HOQA 4XPZA 4GIBA 1T9ZA 5AKXA 2ZG6A 3ZWKA 3CZ4A 4YIHA 3FPSA 3WK5A 3WKBA 2EATA 2YMPA 3AR8A 4Y2XA 2FPWA 2HHLA 3L8EA 3MMZA 3BA6A 4DFDA 4FE3A 1Z4IA 4B6JA 3UM9A 2WF9A 4MWOA 3AR6A 2I34A 5ALWA 2YY6A 3QU9A 2YJ6A 3I28A 4HYTA 4G9BA 4YH1A 4CE6A 2AH5A 4NAVA 5ALFA 4UMDA 5A3RA 1T5SA 1QYIA 5IT0A 3SMVA 2CFRA 3ZVNA 3N1UA 2NYVA 2W4MA 5AW4A 5AVWA 2ZOSA 3HYCA 3RF6A 2IA5A 3ZUPA 1NF2A 4QQFA 4KN8A 1ZD2P 3U13A 3L8FA 4UW9A 4OCZA 2FPSA 1ZOLA 4KYTA 4UM7A 3IB6A 1YS9A 3BWVA 2I7DA 4BKMA 4EZEA 5AVYA 2WF6A 3WKEA 4Y2QA 1QH9A 3MC1A 3QUBA 3L1UA 5ALOA 4DWOA 1Z4JA 1YMQA 2C9MA 4J2TA
chains in the Genus database with same CATH superfamily
1SCIA 2XBUA 1Q46A 5JE8A 4JASB 3WISA 4ZDKA 3BS5A 4OX9Y 3LC1O 2VP4A 5EHNA 2BBTA 1P1JA 5TMBA 1FEZA 1YVRA 2Y66A 4PE5B 1E96A 4RC9A 2R1VA 3NHWA 1RPJA 3L84A 3QEMA 4E5UA 5DQHA 4ZOAA 5E3IA 3TQHA 4DM4A 3HA7A 2CF5A 1UC9A 1K4KA 5K0NA 3CKYA 1LI7A 3L8HA 3FB1A 5K6AA 2OGSA 2YL2A 2GPWA 2QX8A 4ARCA 4BX2A 4HTAA 5E3HA 4P3NA 1U0NA 3OX4A 1HT0A 3N8GA 3B2QA 3T4XA 3JASA 2EKDA 2R87A 2XVMA 1SBCA 3HGTA 3LAWA 4HAUA 5FRDA 1XL0A 5JBIA 3I2GA 2RHFA 1T1SA 2J48A 3F2IA 1Q83A 3OA0A 4IQ0A 2J3QA 4K3UA 4MO9A 1Z29A 3EXG2 4JLMA 4EG6A 3RTVA 4MUMA 3C48A 5F2EA 3ODPA 3M7DA 2I78A 3D7SA 3GLHE 4NOJA 4OL0A 3IPYA 4YFYA 1IHPA 3SHFA 2WF8A 3C29A 3ISBA 3LSYA 3PBKA 4QTXA 4U2KA 4X90A 3SXUA 3ZLTA 2Q4EA 5I4KA 1P1CA 2PWAA 3REQA 4R1SA 1EP3B 2NYUA 1WPXA 3V46A 5FUVA 1UWLA 3PG5A 4R4JA 4R9RA 3A3KA 3ICQB 1K6MA 1WDKA 2XAAA 4HBGA 4N5NA 2WAXA 2K7ZA 2JARA 4R1LA 3AL0C 3HVRA 4RGYA 1OAKA 5TPZA 4R16A 2FWPA 2W93A 3G2IA 4HTFA 1YRLA 4LTNA 5JWOA 3CCBA 3EJWA 4GMXA 2IGTA 1EIZA 4DOBA 2G09A 2QYOA 4NS4A 1G4HA 2YWHA 1L6RA 1KYVA 2GPBA 1FTSA 4C5BA 3VHLB 3UT0A 2ZR0A 2W7OA 4HNVA 4DCVA 5DM4A 3H6GA 3LXXA 4G1VA 3R8XA 4XCQA 3EBOA 4H7IA 2PA0A 4FYXA 5K05A 1GR1A 2XGOA 3DD5A 1ZD1A 4IGFA 3UUGA 4X66B 3K70D 1XNQB 2P77A 5AH0A 3SYMA 5JHHB 2CV0A 2I91A 3HACA 1JZQA 1BN6A 4KE6A 4V0LA 3ZI0A 1FDVA 2NTYC 1QFYA 4QYSA 1VLVA 2Y0SC 2OK8A 5CRXA 1F5NA 2RAPA 1UFRA 2WM3A 1GITA 1WZ2A 3ETRA 3ZDDA 5ILGA 3TYXA 1T8YA 4F5RA 2O48X 2D1SA 5JROA 5JDIA 4CM1A 2E5LB 1QYVA 2O9JA 5AXBA 3MTJA 4WECA 1OTXA 4EBDA 2O20A 2VNSA 3NBKA 3EGXA 4G0QA 4WBSA 4I0WB 2I65A 3IIIA 3K6SA 4ZCTA 3T95A 4NCNA 4G0XA 4JL5A 1V6CA 3RRZA 3DE2X 4RPLA 5B30A 4W9NA 4IS2A 5L6MB 3GR6A 4ZT2A 1YKGA 5E9JA 3UH1A 3QBVA 5KDLA 4J0DA 1WW8A 1DC3A 4FEAA 1FSGA 4QGGA 4F4JA 1GAQA 3OLXA 3UVEA 4BRWA 4AF8A 1KI4A 1VQ1A 3WSTA 1BDBA 3CRVA 3OAAD 2VJAA 3OSUA 3HC7A 3DZCA 3BSFA 1VHDA 1OA0A 5KT6A 1X87A 1L5WA 1I5RA 2FEMA 2CUKA 3HKBB 3EZ2A 1ORHA 3BXHA 3RS0A 3OPYB 5IT4A 3THXA 3PNLA 3HNRA 1TAGA 3CXRA 1MDFA 1SOUA 1RZRD 3QFFA 4M83A 3NEYA 5IJAA 4OJ5A 1U3FA 1TZ2A 2Y0PA 4UFOA 4IHJA 4P4NA 1TKCA 4B7XA 3NEPX 4EVRA 1DJNA 2QOEA 2ODPA 5JXWA 2W8LA 1T2CA 3DBLB 5IMSA 5DX1A 1EXNA 3IRVA 2P62A 1KN5A 3F6EX 1KI7A 2QTAA 1N0HA 5LLTA 1YR1A 1ONNA 4TTAA 1E5VA 4HEQA 3EAQA 3QZUA 4QZVA 5BUQA 2BKEA 3KFVA 2A9JA 2W54A 1F9AA 4BE7B 3R7LA 1WXIA 5A4IS 1IN8A 4BMXA 1EMDA 4N3CA 2HN9A 5KFKA 2XY6A 2ZETA 2AEFA 3GJ8A 4MW6A 4ZU6X 5HIAA 1YZUA 2IH4A 2QRQA 3VAZA 2HMVA 1NUUA 1Q3UA 1NQTA 4WCFA 5BN3A 1BCRA 1Q12A 3PXXA 1DWOA 3JVEA 1H05A 2Q99A 2QZZA 2ZVPX 4HGNA 4TGLA 2IYAA 1QFSA 2YQEA 2RHJA 2JCBA 4WVFA 1RKUA 2HDNB 3UA4A 1WZEA 2BQUA 3H2BA 4LHWA 1IEXA 2EZZA 3IR6A 3NMUF 1IG0A 2CFCA 4OUDA 3ZXSA 4OXYA 1UA1A 1T3QA 3AF0A 3T4EA 4KI0A 2IU6A 2JBHA 1PEAA 5CA7A 2JI7A 2O2DA 3TLXA 4EGJA 2K8BB 4HDRA 5ULLA 3PPWA 4CDRA 4ZZ1A 5A5GA 1IQ0A 3DQZA 1XZNA 2P2CA 1M73E 1EFLA 3GVCA 5ALEA 3GJTA 4UJ3A 3VJKA 1ZJ6A 4WBNA 3UKOA 3NANA 2PT7A 3W8DA 4EUFA 1L3UA 3QUTA 1ZH8A 3DYBA 4Q3NA 4UQLA 1WXEA 1BU8A 2OTCA 1CUCA 2QRVA 2XE6A 1O96B 3D2LA 2JJ1D 1QBKC 3FN4A 3I2YX 3N2IA 3QOXA 1X6JA 2ERXA 2Y1FA 3EPPA 4WKCA 2I8CA 1XTPA 2QRZA 1LSOA 2AT1A 1XFDA 2X1HA 4WH0A 3RQIA 5FA8A 3BAFA 4NL9A 3HXTA 2PMDA 3E7PA 4EG5A 1P7WA 3AU9A 1W4CA 4JGBA 1NVXQ 3D6HA 5TEVA 2NSDA 4XA8A 1JE0A 3PXUA 4E09A 2GTHA 4ZQBA 3MAJA 1DEOA 4HN4B 1NMQA 1PR4A 2JGKA 3PZBA 4YXMA 1R5JA 1XCGB 4G0ZA 4JD5A 4PEVA 5C0OE 3VTZA 4NZOA 1I3KA 3PD0A 1N57A 3M1YA 1D9DA 8ICJA 1DB3A 1W46A 2W8BB 2ZE5A 4XYEA 13PKA 5AHRA 4MFCA 4P32A 2DKOA 2BQ3A 2ZU6A 2E21A 4N0QA 1HEYA 2W6ZA 2I4LA 1ZQIA 3K0EA 3L7JA 3CLKA 1OH7A 3Q7EA 1GQYA 2OHVA 3DF9A 4KTTE 4Z4CA 4F2WA 1L4UA 1UJ2A 4HFJA 2ATLA 4YJKA 3VYUB 4X6XA 1JKMA 2G4VA 2WILA 4ZI3A 5ABPA 5JAPA 1R5BA 4XCVA 5J2TF 2G82A 3OCCA 2ASJA 1YS4A 3UXPA 1TLFA 2FSGA 4YY3B 4R9VA 4WSOA 1N0VC 5JSHA 1LJLA 2GYVA 2OV3A 4WKOA 1LI4A 3LVRE 1Z00B 1LPOA 2C5EA 4K88A 2ZIUA 1V4NA 3KVNA 4HPWA 3PD1A 4JQCA 2GBFA 2CE2X 2VUTA 3LWZA 4J1QA 4KODA 4OJMX 1NR1A 3LHKA 3QIAA 5D7BA 4F4UA 1QONA 2VLIA 1CUXA 3KYIB 2MT9A 3UXEA 5DMHA 4C88A 3O94A 1XU7A 3EEYA 4MRMB 3UH0A 4BP8A 2QSYA 1KJZA 2VNHA 4G8DA 4Y2VA 7ICIA 3OJWA 4QWMA 1ARZA 1N1MA 3FPKA 4WDRA 4JI7B 4QZCA 3Q0IA 3BE6A 4Y1EA 1OX4A 2HJRA 3L18A 2PUCA 2OHGA 2P2SA 1CB7A 2PYIA 3B70A 1WQ4A 2PMZC 3T5MA 2A5JA 3V2IA 3V5NA 2Z5FA 3OKFA 3EPGA 4ER3A 3ZDCA 1ZK1A 2ID4A 2JCGA 2CXSA 3RFAA 1V1JA 1YV9A 2B7BA 2Q6IA 1Z6TA 2DM6A 3OZDA 4N8DA 3C2KA 3QXHA 5B2EA 4FP9A 3ZTYA 4F5WA 1JFSA 3BOSA 3DOOA 4RCYA 3EWIA 5B7PA 1ZN9A 3AHEA 4WA8A 2F8TA 2JDID 5LCXA 3QU5A 1I5EA 2BM8A 4O2BB 3T0FA 4EF6A 3K09A 1E9SA 1ZC3A 5KDDA 3M6AA 3LYUA 4HQNA 1EWTA 4OXIA 3ZZTA 5IVHA 1YBFA 4LVSA 4O5KA 2TYSB 4JB0A 1P7YA 2W5UA 4LHEA 4N7BA 4S1VA 1QTQA 1UINA 5DISB 3QE4A 1E60A 2JEOA 3E3AA 4TSFD 2FRDA 1B16A 3EVNA 3R8CA 4AF7A 4REQA 4CKZA 5IEJA 3K5HA 1K86A 1IHOA 4U7WA 3TRFA 1SC3A 4MKXA 1U4SA 3KE9A 5BN4A 5J2IA 3DBIA 4F4YA 1XRSB 4HYQA 4XH9B 3R77A 1YFLA 1T3HA 1RXYA 1F3OA 3COPA 5EP4A 2FG6C 3A3YA 3BSYA 1PYGA 1EG2A 4FC7A 2ZCUA 1ZLYA 4M1ZA 2EG5A 2Q8QA 4FDMA 1IAQA 2O4UX 4MPTA 2P11A 3WB1A 4MQ6A 1ZNQO 5I48A 4US1R 3RYCA 2PVCA 3QY9A 5I45A 2O8FB 2HREA 4URXR 4CXMA 4RTKA 2NXNA 3AZOA 3SOZA 3U39A 5DEIA 5EINA 3KXLA 2OAEA 4GNKA 1O89A 4QDZA 1Y4UA 1PWXA 1PP4A 5IC5A 2M1ZA 1NK0A 3E3NA 1KE1A 2UYYA 4B9MA 3RR2A 2V0NA 4B47A 4EB3A 5I7SA 2IRWA 3A6GA 4ROTA 4DRYA 4YQYA 3ZVKA 3H9CA 1ZJ5A 3QPDA 3VU1A 5KYYA 2PFGA 4HP8A 4OJ6A 2VZ9A 2EVWX 5IIJA 3K4GA 2QQEA 1E5DA 2ZRMA 1IG6A 2OM2A 3EGWA 3D4OA 4XGRA 5GAJA 4W5QA 1QCDA 3L6CA 1V9CA 3FF4A 3SQDA 7ADHA 1KZ1A 1JDPA 1Y8RB 2ZYHA 4B9SA 3N2GB 1QU2A 4C8LA 4TV8F 1G18A 1CP2A 5FI3A 1ESNA 3ELWA 4B0PA 2RKOA 3ZWVA 3QU4A 2G88A 4XB1A 3DE0X 5DB9A 2WUGA 2LR0A 3KKZA 4MIYA 4CLRA 3EGVA 2H2GA 2LYAA 5JANA 3WZLA 4W1RA 5TT0A 1NQVA 4M98A 2XF8A 3RSZA 2OKCA 2XBLA 3C8MA 4E1BA 5LJIA 4XLTA 4RO0A 3RUIA 3UAWA 2LI6A 5HRCA 5JU6A 4IX1A 1Q14A 2UYOA 3NIFB 1FDUA 4A0HA 2REOA 2DF4B 1BEUB 3BZWA 3KYBA 5AXDA 4BN5A 2FR8A 1MIHA 1P0CA 1ULBA 2HSEA 4RU1A 4B6FA 3UNXA 2ZRBA 2M9MA 3HVIA 4NBUA 4F5NA 2QMYA 1IZ8A 3TTUA 4PHDA 2XWPA 4H7JA 1E2NA 1QVZA 4BVFA 1WHSB 1F1BA 4XVCA 4CIYA 3GJ0A 2H5EA 1XF9A 3KSRA 3D7LA 4C3OB 3L3FX 1EP9A 3FM9A 2XXBA 5A5FA 3UC9A 3L8YA 2WWXA 4YD2A 3D3QA 4I1VA 1VBMA 4UC0A 4HI0E 3I37X 4YMLA 2LNDA 2X0EA 4XQCA 1YCGA 3FPAA 1O6ZA 1YZFA 4PG6A 3AXTA 3RVRA 3KLOA 1P3Y1 3OPQA 2RB4A 4PZDA 2WKPA 1PJBA 2KX7A 9ICBA 3EEIA 2GJ9A 4LY6A 4A03A 4KTQA 4FJ2A 3SDBA 5BWOA 1GCAA 2R79A 1Y89A 4UB8U 3BQ2A 2PEZA 1UM9B 1G8PA 2Z4SA 1I7QB 5IYZA 1KJ9A 4BECA 2QUBA 1PNVA 4G5QA 3TQOA 1OILA 1Y7TA 3VMFA 4EMTA 1KETA 5CU7A 4MVJH 3WZ2A 4D4GA 3QEKA 2Z4TA 4KXYA 1DO2A 4KLTA 2OWOA 2ZIXA 1RYYA 3IKVA 3R3JA 2QTZA 2HA7A 2I87A 1W44A 1JGTA 2B1JA 2BFFB 4KXVA 4II2A 3WLOA 1R6AA 5LOVA 2ENUA 2VYNA 3IOBA 4CPDA 2PMZF 1OI2A 3DC2A 1JH9A 1A9TA 2OV8A 2RHRA 1M5TA 4MR9A 4F50A 1VRCA 2O8NA 3NHBA 5C2JB 4ED1A 2NLOA 2JEIA 3AHFA 1YASA 4DGSA 3M6UA 5T6MA 2Y1XA 4BB5A 3MSCA 1ZD8A 3E9MA 1YI8A 4G1BA 5ITWA 1PK3A 3P27A 2BFDA 3R3UA 1PDOA 4OQDA 3UWDA 4EB6B 2ZTUA 3KB6A 4J4TA 1P5RA 3UFXA 3R5HA 4IRUB 2PGLA 3W1WA 2HK7A 1GKKA 5EWMB 4Y18A 3GBVA 2B7LA 3OM9A 2NRTA 1E2HA 1W5BA 4Y1GA 3DTTA 1QK4A 3PWTA 3RSGA 4MVJE 4TXLA 2F3UA 2QX4A 3WIUA 5G02A 3ZHRA 4RENA 4EG8A 4X7RA 3D7KA 3PX4A 4AMZA 2PCLA 4ETWA 1C3VA 4RFVA 2OV2A 3DMTC 1JHAA 2EFYA 3COWA 3OY7A 4B9EA 2QN8A 2VL7A 2X2PA 3FTCA 4IILA 3WYGA 3MSXA 3GX1A 3NUGA 4B0OA 3IUNA 1Q15A 3OI7A 4EHIA 4ZCIA 3EIHA 3V97A 5K03A 1N5OX 2ENWA 3ZZ0A 4IXWA 1M5RA 1TKBA 2DL0A 3K0CC 4B17A 1QGUA 1TM5E 1OW3B 4ECTA 1Z3IX 3ZGZA 2OHXA 3CNNA 2AE2A 2ADOA 3P71T 3GUCA 4Z7OB 9ICSA 4RNCA 2EYUA 4DG5A 3Q1LA 5BNIA 1YL5A 3U6KA 4D26A 1R8XA 2BEJA 1E18A 1T94A 3ANXA 3LWBA 3DEZA 1NXVA 3HQ4O 3KQWA 3Q3HA 3MGIA 1Q1BA 1QM5A 2C2XA 5JALA 4RTRA 1CXZA 2QU7A 5CK5A 1MXHA 2I6FA 1ECGA 1GXSA 2J30A 4FI3C 4MGEA 2OCAA 3JWJA 5K99A 5ED4A 1LW7A 5E4YA 4ZODA 1QG2A 3RKRA 1DWUA 4PZUA 1QHXA 2O23A 2ZDGA 3UF0A 5F4ZA 4ICAA 5BWCA 1C9YA 1OMOA 2HYDA 4OA5A 2BZ1A 3IN5A 4BCBA 1N4DA 2W70A 5CDUA 3GFRA 4I5GA 4RE5A 5ISMA 5LA6A 4EAQA 5J58A 4KQ2A 2O8EB 1JRPA 4A2QA 4OCZA 3QWFA 3URKA 2FEKA 3SYKA 1COOA 2R0QC 2NUTA 1ISSA 4S12A 5DW3A 4LF8B 4C8MA 1MQ8B 2GERA 3OCJA 4KVAA 1KTVA 1M2OA 3AKYA 3AVYA 1HR0B 2BFNA 2G7ZA 3HCFA 3UJ3X 2Z7JA 1G8JA 2AC2A 4P1ZA 3P2MA 1JPNA 4QIWF 2LM4A 1O77A 1U2EA 2K7FA 2GM4A 2VJBA 2WJ6A 1J99A 3EASA 3GAFA 2HC9A 3GK3A 1C30A 3L9WA 4XI9A 1N6IA 2PZAA 1XPRA 5IWCA 3UANA 5JU5A 4RVUA 4XJSA 3TW0A 1GL7A 2EV9A 3NU1A 4O2RA 2R8HA 1XQWA 3IT0A 3OHAA 5ALQA 3HUDA 3D4NA 3AN1A 3OLCX 4HGZA 1IJEA 3G8CA 4Q05A 3TGWA 2FFJA 3WQHA 4DA9A 4R2IA 5FP0A 1IY1A 5LFAA 1KJWA 1V2GA 1YBMA 4JI8B 2DPYA 3HDQA 1N2OA 1ZQAA 1HDEA 1XRQA 4L27A 5JATA 1F0PA 2Q6TA 2PMFA 4F4DA 1W76A 2JEYA 3K35A 4NLNA 3RYIA 4MH0R 2FFAA 3T1QA 4RAQA 2EG9A 4CCHA 1NQUA 1ZHOA 4MPRA 4TT8A 2I22A 1MFZA 1TMYA 2V7QA 1QRUA 2CY0A 1N48A 3KHRA 3AEYA 1V16A 4KGDA 4D9CA 4KN7A 1LDEA 1DPFA 4IOMA 2FG7C 3BE4A 5HE8A 1S8AA 1WKBA 2PFNA 1AK1A 4JODA 2K89A 4MTLA 1QH0A 5CLHA 1VLHA 2VJDA 4YUVA 3ZKWB 4U7FA 4KPEC 1E3WA 1P4JA 1UKYA 2G9UA 1AK2A 3FDSA 1Z7WA 3RS7A 2YZ2A 3IAHA 3TEFA 4ED6A 2IYRA 4F2PA 4OQLA 5GPBA 4RETA 4C80A 3WU2U 2IUFA 2WU4A 3SJBA 9ABPA 1F06A 3L0PA 5L4LA 2VVTA 3CZRA 4DA7A 3UG7A 1BGXT 4WWHA 5B2ZA 3FZQA 5KNBD 3PQ8A 1NK4A 3T15A 2KB0A 8ICEA 3SFZA 4ESOA 2D5LA 2XOKA 4PR0A 2FJPA 3D4BA 1UKZA 4M6WB 3TSCA 2FFBA 1S0UA 5JCPA 3FC4A 1W88B 3ENNA 4DA8A 1W0CA 1YR7A 3ONEA 2ZUCA 1FRQA 4NH4A 4DJTA 4JMPA 4MYCA 3ZQUA 2W2LD 2HMUA 4Q7EA 2NTEA 4WL0A 2H52A 5CVTA 2XA2A 2ONZA 1FBNA 2BBOA 4R65A 4DSUA 1Z2DA 2BQRA 2Q5QA 1NZDA 1YKSA 1X1EA 4PHCA 3RJMA 4ML3A 2HCTA 1P1BA 3STHA 1Z2OX 1Q7BA 2RK4A 1P19A 3UHAA 4D96A 4DMUB 1WCIB 4UBJA 2X8AA 4GL2A 1ONBA 1CRQA 3KKKA 4NIMA 3ORRA 5DU2A 1PR6A 3CP8A 5JEDA 4QJBA 1SGWA 2P0EA 2P1RA 3H5VA 2M6KA 1WR8A 4TZ0A 4IDAA 1QRRA 3ASZA 1L8QA 4J07A 2C4TA 2PXAA 5IAAA 1X8LA 1PVRA 1UMBB 1VHWA 5JMOA 2DB3A 3X1ZA 1FNDA 5EWJA 1S2IA 2GN1A 2ONYA 3ENWA 2EARA 3FETA 3R3WA 1EWRA 2VF2A 3BFXA 2OOKA 4LHVA 2EEPA 3TZHA 3LBHA 4PFJA 3SEQA 4GLJA 4BJ3A 4QUDA 4UZEA 3JPYA 1BZYA 4YJGB 3WK8A 5BSTA 3JASB 4QBIA 2REQB 2ZBPA 2Y99A 3WFJA 4A5OA 2UXDB 2V6MA 1J22A 5F76A 1SUAA 3KU4A 1ZQOA 3PHBE 4U0JA 2WUWE 4XIGS 3OSPA 4RHCA 4ECZA 2I6UA 4B6QA 3UGJA 5CB1A 1ZOOA 2L42A 2RHTA 4B82A 1PKEA 4IKOA 2AX3A 1Z22A 2VUIB 3J7TA 4UMFA 2FPGA 4FFVA 1N2CA 1DKLA 2YWCA 2DFVA 1GY8A 3HGQA 3N76A 1J97A 2WDPA 2XDWA 1RIFA 4Q3KA 5E4JA 1HGXA 2P6PA 1YQUA 1FUUA 2J0VA 2ODWA 4IEFB 2FX3A 1OXJA 1GZSA 3U3DA 1QQ7A 4AJNA 2W2VA 4Q7KA 4A26A 1E2QA 5JZOA 1XLWA 2C84A 1UM8A 4RTMA 3NRJA 3JPSA 4GKAA 1W36B 2WT9A 4UHFA 3DFMA 3W8RA 4LVNA 3TSYA 3DPUA 2JFYA 5KOYA 1KU0A 3H83A 1YHZA 3N0XA 4I9GA 4F71A 1WU8A 1IEVA 2AOWA 2FPMA 4JJZA 3THSA 3U17A 4ZYTA 5KNBA 4LSZA 1H2XA 6ABPA 4HVTA 5GM2A 4KOEC 5KG1A 3ZHXA 1I3CA 4H08A 1DTEA 2J5QA 4PQEA 1PFGA 4PHTA 4QIWC 1JDTA 3GRAA 5E1BA 5K8UA 2WVHA 2Q6OA 3JQ8B 1FX0A 1UIRA 5E7IA 3O3NB 1KEUA 1NVEA 3MBIA 3ZWDA 1OZGA 2BMEA 5F1PA 3TQ1A 1DS6A 3R3XA 2YJ5A 4MVJP 3F6PA 4LJ8A 2AZDA 1Q19A 4JL6A 5KIAA 1I1OA 1ZVKA 4EHDA 2OFXA 1O9HA 1P0QA 4JKYA 4CMHA 3NWEA 2FZCA 1CERA 4RLSA 3INTA 1YC5A 4S3MA 5K3OA 1AF7A 2C61A 2ZT7A 4XM1A 5IKMA 4EBCA 3JQ7A 2I6GA 3D8BA 2QROA 4HUJA 1KYWA 4FFBA 5DGXA 2K4IA 1U90A 3HN2A 1VJGA 1CUEA 1KSPA 5J2GA 4C0SA 3NYIA 4FEYA 5C9ZA 1EGVB 1KWGA 4EQZA 5I9NA 2VJ4A 1P7CA 2QXTA 3I92A 4DCTA 2GETA 3A6PC 3AOEC 1Z0KA 4B9AA 1BVUA 1CE8A 1YZQA 2X0IA 2XCQA 4TKZA 3A6JA 5EERA 4Y2TA 4ZOHC 5DB8A 4DV7B 4I1PA 3P45A 4KC0A 5KYWB 1NN5A 3EQ9A 1KZGB 1A95A 1TF5A 3V3KA 1W4AA 1L4GA 1KQFA 5KYUA 3JALB 3FMOB 5ILQA 5KL8B 2WTFA 3DVAA 1P31A 3Q40A 2ZPAA 3EB9A 3HCCA 4RX1A 4GPTA 5E6UB 5E3JA 4UFPA 3JX9A 5DPMA 4Y6SA 4LV6A 2WF5A 1K2VN 3PR3A 4IAOA 2ORYA 5I5EA 1GGMA 2D3WA 1J8MF 3SX2A 4S1PA 5JSUA 3I1FA 3I32A 2CBZA 3E2PA 1VI6A 1CZNA 4YN3A 1XMOB 4QNNA 4L85A 4FMCB 5LYYA 2NOAA 4WVLA 3HU3A 3FUCA 3WV4A 2PU7A 1Q16A 2HPVA 2ZITA 2P2ZA 1ISRA 5EXXA 3AIOA 1VHQA 2ZR7A 4A16A 4MRRA 2GKOA 1JEOA 1NW5A 2PXXA 1IRXA 3SAFA 4KE8A 5H5JA 4HFNA 4F21A 3AQ4A 4F4KA 3DFZA 1W36C 3R9WA 2G0TA 1Y3CE 2KOBA 2QRJA 1GT91 2M2IA 2V7UA 4U9HS 3SSAA 3IG8A 1CFJA 1ZINA 3PX2A 1OXXK 3F97A 2PVSA 4MEXA 4KQFA 2HZBA 3FMFA 2GHRA 3JVVA 4RTSA 3T3PB 5EWLA 3BICA 1HDZA 4DV0B 3I0MA 1RRFA 1DXQA 1SXIA 5DB4A 1UAAA 3ISJA 3P0IA 4TN5A 4D8VA 1YQWA 4ZP1A 3VHXB 4LRUA 1JQAA 1WUYA 4G85A 1EAYA 4F4WA 1BRTA 2ERYA 3CUKA 3MA0A 3WMFA 4AZ3B 1PGNA 1Z5GA 2GZAA 4MYDA 1QTIA 5K8CA 4XWKA 2F1JA 2OM6A 2OD7A 1X7ZB 3IIKA 5F78A 4UDXX 5HJ7A 1VSUA 2W6PA 4US8A 1FSZA 4HGPA 5IIOA 4JDUA 4X3CA 1MEOA 4DWVA 1MA3A 1NWCA 2G7MC 4LOKA 3ACBA 4AJ1A 2RBEA 1X0VA 2W2QA 3DVRX 4BUGA 4RF4A 7ICPA 1NNLA 1Y6RA 4LK3A 2WSMA 3Q8LA 3C3PA 2W6JD 2RP5A 4IDFA 1PR3A 3B9PA 3ONWA 4UNRA 4QAQA 2Z9CA 1DG1G 1UP6A 1NASA 2QNBA 1FSFA 2HIAA 3K3PA 1H4SA 1A04A 2FXIA 4JA0A 3MTDA 5DGDA 2JD0A 1JKFA 1GGJA 4BKPA 5JXIA 4QYIA 4FZMA 1A8SA 3NGMA 1E2IA 2O2EA 2QVGA 2W2TA 2JD1A 1W34A 4XD7D 1T36A 4R9SA 4ZWNA 4G5RA 2ON6A 1GKYA 4BGEA 1G6OA 2W83A 5HGXA 4ZK2A 2YN2A 5EJ4A 1O6BA 3EOBI 3GRPA 3VU0A 1BH6A 3QMWA 1K1SA 2RGYA 4CETA 2OXIA 1UBOS 1BXGA 2AJLI 4QTUB 3ORFA 1VIDA 4F4CA 3CRXA 1VI2A 3EG5A 1UEIA 3LLUA 5DN9A 1ZK2A 3ZHOA 1UOEA 1P1RA 1Q3TA 2BUBA 2M98A 2NNWB 4LOJA 3SS8A 1MNQA 3WHPA 4DNFA 4DVGA 4DJFC 2J31A 5EZ5A 3TNFA 1ATZA 2FSPA 3BEDA 4KI7A 2ZAYA 4MWGA 5FD8A 1GO2A 4EJSB 1FY2A 3GMTA 4AS3A 3HMQA 4Y9RA 1QSLA 1YOVA 2VUHB 3SYZA 2WB4A 4L9AA 3VHRA 3JQGA 2ATVA 2YBEA 2DXIA 2DF8A 4JMLA 3ZJYA 4CEHA 4ZHQB 4YR3A 2XQIA 4OHFA 3AU6A 1QR2A 1YZYA 2A4KA 2E1PA 3EXAA 4MB2A 2F1HA 4Q24A 5G5GA 1YDFA 1ZQWA 1NBMD 4P92A 3WNCA 1U9CA 5CLFA 2GD2A 4U9IS 1SCKA 2CNLA 2IDMA 4E70A 3CZ5A 3QSYA 3LZDA 5C53B 3UEOA 5CT6A 3OT4A 5JUWA 2P30A 4H60A 1CY2A 1MAWA 4HGRA 4D7AA 2GFIA 2R11A 4LC9A 4XIIA 4PPGA 4UPEA 4O3QA 1YS7A 1NM5A 3B82A 4QRIA 2X3UA 3L93A 3BQ9A 2VC2B 1USGA 1Z5VA 1O95D 4JENA 3R0VA 5JI3E 1GV0A 1KY4A 1US8A 3MWEA 3RJJA 4E15A 3PW2A 2EFJA 3GLIA 2VPTA 4IXNA 3ZD8A 1OFUX 1O54A 2OGTA 4NOLA 2IHUA 5EPUA 3F9IA 4ER7A 5IF3A 3OQIA 1VPWA 4JJEA 4M9GA 1MAAA 1YCHA 3CPJB 4I28A 3NWJA 1YDMA 1FP7A 2VYCA 5K3CA 4CIWA 1C3OB 4XYLA 3WS7A 3RUEA 2HSZA 1JEYA 2CB0A 3L8MA 3QMPA 4A27A 4EW1A 4KXUA 3QTBA 5AM0A 4DREA 1JQ5A 3NBZC 1ZUNA 4EJMA 5KWSA 5DBEX 1F6BA 4RFSB 3EHDA 3DWGA 4EUSA 2E8MA 1A82A 3PB3A 2WHQA 4KWCA 1J1UA 1L0BA 1R0RE 2VYFA 3NHZA 4FFLA 2NXCA 4ZT6A 1Y3BE 1CUHA 2AJDA 3FGOA 3QKIA 3PEVA 4BMNA 1NUAA 2ZE6A 5KEIA 1ED1A 5FA6A 3P0RA 2CEAA 4RZHA 4RA9B 3EQ6A 1RM5A 3A1WA 5TLSA 4FS2A 4TLMB 4ZOEA 2XQFA 1PW7A 2O50A 3V32A 3GEPA 3NEAA 4NICA 1Z56C 2YWDA 2AFHB 1SKWA 1XU9A 1RAFA 3FLMA 2CUNA 2IXGA 4Q39A 1C1XA 1Q92A 3IBYA 5EQDA 1ENZA 3KQSA 4N0PA 1Z2PX 2SKDA 3HCOA 3DB1A 4ZVSA 1NLFA 4B6PA 4W7SA 4U39A 4OHWA 2QAIA 1QHFA 1ZFNA 3EUWA 4G4SP 4ANFA 3IR7A 3KHTA 4YP6A 4Q1FA 3RTEA 3K1RB 1MV8A 3I45A 1SD5A 1NJ1A 1HDOA 4OIFA 2W48A 4O4IF 4M9CA 4O2AA 3PQ2A 2FLKA 4RPCA 1BW9A 1HNXB 4LZZA 1E3DA 1EK1A 1WTAA 3D0QA 4K9SA 5EEHA 5WRFA 3TCKA 2IYVA 4BAZA 4FNOA 4ZEVA 1RXCA 3NKLA 4M60A 1RPLA 2OBNA 2VIIA 3JWPA 3KVYA 3QKWA 2Y1CA 3AERB 5LZ4A 4CEJA 2J3IA 2QG6A 5IK2A 1RKQA 4LDRA 5AJVB 1ISGA 1QLWA 3O95A 4WFQA 1AN9A 1TKAA 3ASVA 4CHTA 3O8CA 2YYAA 3DE1X 3FW1A 4IBOA 1U2SA 3PW7A 2JEFA 5CT4A 1KZ7B 5IJZA 1XVVA 1DUIA 4PANA 4LF9B 3A8TA 3MXTA 1N7GA 5JD6A 3E8XA 4B3FX 2QGZA 4PL1A 1B3BA 1BGVA 5SYNA 1MBZA 1J42A 4AKGA 4M53A 3KETA 3U4QA 2YR0A 4DL5A 4RFSA 5I8WA 4L6CA 1SGGA 1Y1SA 1O95A 3A3PA 3KKQA 5TB5A 3TO5A 1K5DA 2BUAA 2WD9A 1GZUA 4LJXA 3A31A 4DC1A 4B6SA 3HYTA 4BO9A 1QHHA 2C4KA 4UASA 2BPOA 3F6YA 4W7HA 5IVIA 4QHTA 1PR0A 4XJXA 3TINA 2DVMA 3UAVA 4BEJA 4F2RA 4Q19A 1KZHA 5KOJA 1EXVA 3VTFA 5F3XB 4MVJG 3BWMA 5F51A 1U2QA 3LDHA 2CVFA 4GUAA 4WFKA 2HOIA 1GNTA 2R751 1G1AA 3GVXA 2HEGA 1GTVA 5B66U 1Y48E 2QV0A 2ARKA 4HSEA 3HWSA 1L5ZA 2Y68A 4CZ2A 1GZ3A 1PWZA 2OLJA 4DVJA 3HBAA 5CR9A 5EZYA 2AF3C 4HQ6A 2IKSA 4XPIB 3G0BA 5FNVA 1CX9B 3ZV5A 1OBFO 4MKRA 4U4AA 4TKLA 3IOEA 1QIGA 3AEKA 3K1YA 3AR8A 4INJA 2FPWA 3C4JA 1DZIA 1R4MA 1Z0UA 4YR2A 1VMAA 4X1KB 1P2UA 3SHWA 1O9BA 4DDVA 4G24A 4KPYA 3H2IA 3RD5A 2GVZC 3ICOA 5B6PA 3PFCA 2HY7A 3SIWA 4K9NA 2YICA 3FYUC 4LEIA 3A06A 2FUNB 1WZNA 4O4HF 5GM1A 5E1DA 1VPTA 3TOCA 1M6VA 3H2JA 3ORSA 4M0PA 2XIQA 2GCGA 3I5YA 1MB3A 3AL2A 3GAAA 1KMHA 1HYHA 5IJ0B 4QQKA 1DINA 4GC6A 2VPZA 4GPEA 1U8TA 4CRXA 2XCLA 3N3AC 5KG6A 3P4XA 1NZPA 3QVJA 4IHAA 4CIVA 5H2FU 3TPZA 3ETCA 1QYIA 4N8EA 4HUQB 1BMTA 3MUFA 4OBXA 2DUUA 2O2GA 3K4HA 1OXMA 1Y0BA 2LZ0A 3CGWA 3MJHA 3R3YA 4H16A 3TJMA 1TLTA 3Q6MA 3UXYA 2ZOSA 1TEVA 1FFXA 3NM5A 3PHHA 5BQXA 3RKUA 1D6JA 4KN8A 2VHQA 5KVVA 2AOXA 1REQA 1XD8A 3HKCB 1W4ZA 3I2KA 1RCTE 3W34A 1DQZA 4YT4A 3BBPA 3DKRA 2DEUA 5BQOA 4KBFA 5F1YA 4YPVA 4MWSA 1IXKA 4DCGA 2MINA 5HTKA 9ICVA 1YS9A 4LYDA 4TXNA 4DCSA 5IZ4A 2XF2A 3K92A 2X2EA 3QEOA 5KTQA 5F1OA 5DM70 4B7CA 2C9ZA 2JFWA 4CCSA 4ZHQF 1CCWA 4G5YA 4NOMA 2W6NA 4C9BA 4PG4A 1GA1A 1F6WA 3MLEA 4C0ZA 4A4DA 3ZY3A 4YAJA 1G4UR 9ICCA 1KGSA 4Z9YA 1P4GA 1DHRA 3CIOA 1LLDA 2CMKA 3TLKA 4K0RA 4P7FA 5FUMA 5L7WA 3E0QA 1N5MA 2RIPA 2RI6A 1FDRA 4QGFA 5HHHA 2HSGA 2HSWA 3BS4A 2H2WA 2C7OA 3GFSA 1JHYA 3B3GA 2OUIA 1KLNA 3KM0A 1K8YB 3STVA 4DMMA 4IXDA 4HZGA 2MAXA 1ZQVA 2JD2A 3GWZA 4FYPA 4ND4A 5DGBA 4TLBA 5TXGA 1ZM9A 4Q9NA 5ANRB 4Z4FA 5KFFA 4LBYA 4JOQA 4EKNB 3DTVD 3CF4G 4EHKA 3RCBA 2H4FA 4A8PA 2YASA 3MK31 4KMOA 5EJ7A 1A4XA 2JAQA 3EPIA 4NENB 1M9NA 4DOAA 1TK5A 4XLLA 4YJDA 4DMCA 2J5RA 5THKA 4Z9AA 5I7FA 4N41A 1DU4A 5E0KB 2CBXA 2OZEA 3OEWA 1G9XA 4LF7B 2GAAA 4L02A 1AV6A 1PSDA 3OTGA 1M8FA 1L4HA 1PFUA 1BIFA 1VL6A 3D64A 3FNHA 3JQ8A 4OMCA 1YAHA 4MF8A 2J45A 2GN8A 3CLSD 5TC4A 3ZE6A 3HU5A 5EESA 4JR1A 3MWDB 3A70A 2AFIA 4HATA 4KN6A 4LGVA 3RS3A 4RK4A 2NZJA 5K3DA 4CTMA 2R6HA 1IY8A 4Y2HA 5T5QA 5IDVA 2XBMA 3TD2A 1XDZA 4DS4A 1ZIXA 1IL0A 1CZRA 1UOPA 2B9EA 1PN3A 1LLUA 2OG1A 2ZR8A 3B48A 2P9JA 3EGDA 4QPDA 3A0BU 4G81A 4DQPA 4Q45A 2AOTB 3A1SA 4KMMA 3OD5A 2NO4A 4V1CA 1W0JA 5JS7A 4RTNA 2PH1A 2VHZA 1UHUA 2C88A 3O3CA 2XODA 1GWNA 3DHWC 4FOLA 5KFRA 4UU7A 3S68A 4CHGA 4WZBE 1RYMA 3MHTA 5B5EU 3JVDA 1N1GA 2XTAA 5KU7A 1DDGA 1XC9A 3PI6A 1CG6A 3ZWNA 5J2BA 1I4OA 3EIWA 2F1OA 3EGIA 1NVVQ 3JSXA 1DIGA 1OAAA 4JJAA 4ZIRA 4GKBA 2R44A 4NBLA 5F12A 2DGZA 3NNSA 3ZEAA 8ICAA 1AY0A 4RCZA 1XCBA 3L04A 4ZYYA 3AJ9A 3B1XA 4Y8VA 3GEDA 1GPDG 4AN0A 4ARUA 2XEXA 5LQMA 3ZWPA 2GNOA 4BZWA 2ID8A 5HHTA 3S2YA 5JYCA 8ICIA 1JWLA 2B30A 3ILSA 4N6NA 3RFTA 6GPBA 2B82A 4WACA 4CF4A 1JH8A 1GKUB 1HG0A 1NBOA 1P1KA 2F6RA 3MWLA 4KLCA 4ZARA 4O4IB 4MS3B 2DPJA 4I55B 3KZMA 4WT7A 3UHPA 4RXTA 1E2LA 4P4TA 1DBIA 1R4AA 1FQJA 3GZ4A 4RDXA 3QUCA 3PNYA 4MI9A 2FDCA 2AN4A 1ORDA 4UNSA 5EE9A 1RWBA 3I9OA 4BS9A 1J2RA 3QX9A 2OAP1 2XZDA 4Q3LA 4UHHA 3RYHA 1CEYA 4DT1B 1ECCA 4PXYA 4DUGA 1U0HC 4WRRA 2B1GA 2X4LA 4A2CA 4JBYA 4PTZA 5KFOA 3NGXA 1PIWA 2YYSA 3BGSA 3GRVA 1PK8A 1SG0A 1N3LA 2H1WA 4MRNA 4O0MA 3ZCRA 2M9NA 1E9DA 4JEHA 2XUJA 2KBFA 4HL6A 4KO8A 5DM2A 2X3FA 1CY4A 1LPNA 2PMEA 2ZBEA 3CNBA 2YMQA 2DX7A 1EFHA 2WD7A 4OMDA 2OECA 3HABA 2CLLB 4HQLA 1SVKA 5LBUA 3RT9A 4UQOA 4ZJPA 4EEXA 1AU9A 3C39A 1L1QA 2PT9A 2HSDA 4PC3A 4AULA 1WEHA 5JY6A 4MUXA 1CY7A 3LW7A 1F4LA 3CH5A 4FMDB 3RJFA 2KM1A 2PSDA 1CU1A 4ROSA 4EUNA 4MF2A 1VJRA 4ZVKA 5JWRA 2COEA 5F3DA 4R2HA 4DMHA 3L3BA 1YWGO 1Y9AA 4O5OA 5KTTA 4HLQB 5PNTA 5BUZA 5LXTB 1RYHA 1JAYA 5FOVA 1U2TA 3CO5A 1JA1A 2ZCJA 1EFVA 4BIMA 1Y8CA 3IA7A 4FNAA 4FOPA 1W0JD 4N40A 9ATCA 3R0XA 5JV5A 4URZR 2C8VA 4IQFA 5ADHA 2VUSA 2G8LA 4G3XA 2XUOA 4QGHA 3U3MA 4BFCA 1KDVA 2WJVA 3JQFA 4I1YA 2DT5A 5HHIA 2D59A 5BW5A 2EP5A 1O5OA 2YZGA 2E8PA 5KOHA 5AHKA 5YASA 4C6SA 4DNOA 1E63A 1S3GA 1WD5A 2AHOA 4Q93A 1BS1A 2GD0A 2WSYB 3AYXB 4XJTA 3ZTTA 2OG2A 3KEFA 4CQLA 4D0NA 2FMTA 4KXLA 4EYIB 4LWQA 4EGCB 1SKBA 2XMRA 1NUSA 4RMGA 3TQTA 2NT3A 1EVLA 2X0JA 2C2ZA 5JYDA 4LHSA 2UU9B 2JIZA 1ZD4A 2OXOA 3F2BA 4KXFB 4PFSA 4OVKA 4B9VA 3CINA 1Y1KE 1KY3A 3EIOA 4EHNA 2OCPA 4G5FA 1PAUA 4AJEA 3AI7A 3EMBA 2ZJFA 3MG9A 4CUZA 1JXQA 4EZBA 5AW1A 1NJ6A 5EFOA 1UWKA 5HF5A 4LFBB 5JAMA 2F2TA 1IXRA 2VDWB 5E38A 5M5BA 1R00A 1Z5ZA 2QB0A 1RRMA 3AGPA 4IMRA 4F8YA 1K7FB 2W00A 2IDJA 4L8LA 5JADA 2AYYA 5PGMA 1U63A 5DHUA 2R4QA 3A4IA 4NCAA 3RFFA 2C28A 3A6KA 4NWIA 2NV3A 1PFWA 2QM0A 3K4PA 4QDTA 2OAGA 4DF4A 2EP7A 2G9NA 5D87A 3RAPR 4DMLA 3QLVA 1GPNA 2BEKA 2CF6A 2J09A 5CJ2A 4YAOA 2K4MA 3TLGB 3TK1A 3OJLA 1FVHA 3G2MA 1MZVA 4DV1B 4EZ9A 2FWJA 1IULA 2VH5R 1E0AA 5KFSA 1E6EA 1R18A 2E4XA 2WJGA 2E6KA 2P5SA 3Q3IA 3MFYA 4JB3A 1Z36A 2B92A 4BEVA 1L7XA 2HF2A 3P19A 4JUDX 4OKIA 4O25A 4BATA 1UDAA 1ULTA 3HJRA 3OIFA 4CT0A 4YVFA 3OUZA 4KDFA 1OX5A 3ELBA 3NHMA 4O8CA 5T57A 1DFIA 1CQXA 1E64A 4GP7A 5DG8A 1B74A 2RSLA 4POAA 1SVNA 1P75A 1M8KA 2BV3A 2NU6A 1NVVR 3BMOB 1VHJA 4G5HA 4PC7A 4RM2A 1XRMA 5IH3A 3R1IA 2VANA 4B6EA 1T4MA 3N5KA 4UUNA 2QGNA 2ES6A 2FMHA 3ICXA 1QC5B 2NX2A 4JV5B 3KL2A 1SBHA 2VK8A 2W43A 3NKFA 2NO0A 1SL2A 4MIKA 2FWMX 3D6FA 5EZYF 5C1PA 4Z4IA 3A1TA 1ELOA 1U2GC 1OLUB 4PYKA 3NBXX 4RHFA 3L40A 3O8DA 3FWKA 2WYOA 1TUIA 2QRHA 1C50A 1LPPA 3QA3E 3OQOA 4HZUA 2E18A 4LXXA 3R4CA 4UREA 4AJ9A 2O5EA 3QVLA 6NULA 3VAYA 1SA0A 4CMEC 3U56A 4R68A 2OKGA 3GEIA 4ENSA 1TYBE 2QS9A 4LG1A 5KFIA 3ISDA 4OMFG 2Y2UA 4KDEA 2A67A 2AS0A 3DBOB 1NP6A 2CE7A 2H1SA 3DUFB 1OWOA 5KX5B 4QQRA 1T5DX 1V4VA 3KYJB 1RZUA 4PC6A 5G2OA 4LXIA 1JDNA 2ECQA 1A9XB 2B4YA 2XNCA 1T2EA 1GNQA 1Z4PX 2HTFA 3GGOA 4FZVA 4PCAA 2QZSA 2H1HA 3I52A 2BN4A 2ODAA 2B20A 1VECA 4XSVA 2ZIVA 2CXRA 4G56A 4L8WB 4RY9A 4ER6A 3SSMA 8MHTA 2BCVA 2LPMA 3AR2A 1N77A 1CF2O 2AG8A 4KNYA 1IPFA 4M04A 1NC1A 1Y34E 2R3SA 4UMEA 5IABA 2XDYA 2QT9A 4GI3A 1BAPA 4L4RA 2HU2A 2O2ZA 4CMKA 4EVQA 5CCBA 4ADSG 2Y1OA 3NJ8A 5J2UA 1RMTA 4J0HA 1GTJ1 5C7IO 2VJLA 4MI3A 5EIOA 3JYQA 1TUEA 4FMDF 4OUKX 2BM1A 1PFKA 4TROA 3KVRA 5LZ2A 2V6JA 3OKAA 1ACJA 4PM4A 2VYVA 1QKIA 4MCIA 1M75A 4DLXA 2BE9A 5C8YA 4B6RA 4BVEA 2JAUA 4O02B 1YH3A 1ND5A 1FUKA 3JQRA 1Z0AA 2BBSA 3ORQA 3BMCB 1T6ZA 1KL9A 1L3TA 2XNHA 2BMJA 2JHGA 2P75A 5HCIA 2GDZA 4ZD6A 4ZALA 5AKHA 2HV8A 4BCCA 4BUZA 1ZQEA 1SK9A 1ZGHA 2A1AA 3VAAA 3DWFA 4JP3A 3IEUA 4O5EA 1T35A 3UHOA 3WYFA 2IEBA 3HDTA 4TUPA 2F8MA 5L3QA 3V8NA 1Q95A 1UZUA 4WOKA 3UJHA 3HM9A 1HEUA 1XHFA 1X14A 1NXQA 4NPCA 1KVSA 1RPZA 1GUAA 1B26A 4J9KA 2QLTA 1JSXA 2PBFA 2XZPA 1I2CA 4NRDA 5JZ9A 1D2MA 4UTVA 4YR9A 4X65B 1C7IA 2QMQA 3IX7A 1X7ZA 2V58A 4CF6A 3HJFA 1MKYA 3ES9A 5B2FA 2NZVG 2VSNA 1QCZA 4N4AA 3JRXA 1NR7A 3QF7A 4POOA 4I5DA 1L5VA 2FN8A 4YXJA 1SXJD 2O3JA 3P9CA 4Q1AA 3RUPA 2UDPA 4DQSA 1VKOA 4IUDS 3ROKA 1E92A 1KY5A 2PJZA 3QOFA 4IIGA 4C76A 2XRFA 3ROMA 1UBGA 4ABYA 3D6JA 3LUGA 5I7VA 5KVCA 5H82A 5HS4A 2K4EA 1M83A 2ADMA 2WKQA 3OT1B 3QBJA 4X85A 2QUKA 1Z5PA 1WTCA 4P7GA 3UA3A 4M9UA 5A9SB 3SIRA 1OGJA 4RNNA 2HU8A 1OFTA 2WZDA 4MHVA 3K6RA 3Q12A 2NUPA 4PLYA 1JL3A 4UDOA 2OXEA 1KVUA 1NOIA 3SKVA 1IZ0A 3KQPA 1FNNA 4D4KA 1ZWLA 4HGQA 5GONB 1G7TA 2HHCA 4KCGA 1G19A 4X62B 3HUTA 2A94A 4TT3A 3IP5A 4JBXA 4MLPA 1COWA 4TYNA 5E2BA 1BVSA 4XGKA 4BX0A 1PG0A 3CU5A 1VXRA 3DLIA 3VFDA 1TYDE 1SH7A 1ZD5A 3BB1A 3RUCA 4E21A 5JISA 3C2MA 3PW5A 1F2VA 4OHOA 4RQ6A 4LY9A 1X19A 3PVSA 3UQ0A 1KPHA 3PPIA 4UEWA 1Y4AE 2GZDA 4J0EA 2O05A 4GXTA 1A88A 1P2DA 2D2VA 4CU2A 3EGCA 4TTQA 3QY0A 5A4AA 5AOAA 3C85A 2GK7A 3KWFA 1KO8A 5EE5B 1REQB 2D2XA 4RJLA 5C18A 1ZQNA 5IINA 1C30B 2HA5A 1GZ7A 3WYAA 4QDOA 5K8LA 1CQIB 1QG4A 1AKVA 2Q4DA 3TSAA 4AYWA 2ATCA 1U0LA 4PTYA 2W9CA 5IG2A 1PJQA 3E7FA 5KKCA 3K70B 4GM1A 1XL1A 3FKSA 4WZAE 4QZDA 2XMCA 4BX8A 4CFZA 5HR6A 4PLHA 4C7OA 3AJRA 3PIRA 4DWWA 1BE6A 1ZIDA 9ICRA 2W2OA 2C2BA 1NX9A 5BUSA 1SOVA 4WAUA 3TSZA 3FCXA 3GFVA 5JYBA 2AKEA 5KMGA 1KA9H 2SICE 1UJNA 5CTAA 5K0BA 1YFJA 1QMPA 1FW6A 3HP1A 3C14C 3OPNA 1H4VB 5EHXA 1I4EB 2YS6A 2ZYTX 1M74A 1W1UA 4OP2A 4ZAWA 2N47A 2DFTA 4JUBA 5ELLA 4DIUA 3KHGA 5K0EA 1CUDA 4YYZA 5JCOC 2DUMA 2AEJA 2B36A 2H48A 2XA1A 3HO6A 2HJHA 5AICA 3QW2A 4YUXA 4DR4B 3OICA 3C5CA 2W6QA 3LVBA 1Z26A 1LPMA 2QTCA 3OJ0A 4AJPA 2OY0A 4D42A 2PX0A 1TYZA 4IDCA 4OMUA 4DY4A 3B6MA 4E5DA 1L5LA 3QU7A 3GDWA 4ZYLA 1KDPA 2J32A 2QJFA 2P3LA 3BVPA 4G2TA 3SR0A 1DT5A 3OZIA 1ZAYA 4LF5B 5KC9A 4PY2A 5A3VA 2CN1A 3I2HA 3UIEA 8OHMA 1M2HA 4JJ7A 5J2TA 4KQWA 4TLAA 3NJ4A 2NTVA 3VYVA 2I6QA 1M1NB 1P5ZB 5KAMA 1QMGA 1KY2A 1R2QA 2QY6A 5J1TB 5C5CA 3Q72A 3RUHA 1VA4A 3RK1A 3LP8A 3JQDA 4DL9A 1XMSA 3MRSA 4TKUA 3TPFA 5C4MA 2HNBA 3B78A 3ECAA 3OPYA 1YVUA 4LC0A 1URPA 1Z34A 2HBYA 2XY7A 3AUUA 2FFHA 3OFND 5KYXB 3PNOA 2H1IA 5HF8A 5BNZA 1G59A 2A7XA 4M1MA 2KBEA 2WAOA 4UBBA 2J3DA 2G83A 5EL0A 2ZSAA 4MWOA 3U2QA 4B09A 3E1KA 4CLDA 1K08A 3VR6A 3W04A 3DBHA 1E6UA 3IT3A 3M33A 5GWXA 1L5NA 4RJJA 3KT8A 3PENA 1VC2A 3T4UA 1X77A 4P0QB 1Q0ZA 1LXCA 4N9WA 4YMTA 5FBVB 1KEKA 1NUPA 4J7XA 3I28A 4C8OA 1ZQHA 2OBMA 2XPCA 3QG1A 3WBBA 3MW8A 3VJRA 1HDXA 3DVAB 1ENYA 4WY5A 4RA6B 3ZS8A 1V6AA 4P3XA 2FR0A 2IHNA 5DV9A 3O8QA 2RHLA 5CM2Z 3SM3A 3VH1A 4E94A 4ECEA 3WE7A 1PX2A 2W4MA 7ICVA 3EMKA 2B8WA 2Y1GA 3FTNA 2I1QA 3KZKA 4XCXA 3SE7A 4A8JA 5B1YA 5C34B 4QQFA 4IVQA 4YUAA 2BHLA 3VZBA 4Z7NB 1GUBA 2QR5A 1E3WB 1HQDA 1Y3FE 4LMRA 4FLMA 5IVDA 3EW9A 1CRZA 3IPXA 5KQRA 3RAQA 1V2HE 2R96A 4M0EA 4L5IA 3BJZA 8ICNA 2ZXFA 1P3JA 3GFTA 4Y0VA 5G41A 2P2LA 4NAHA 1Y5RA 1CJBA 1ZY2A 4HDNB 4EZEA 4OHXA 3EEOA 1Q2UA 1JHPA 1UJ4A 2VRNA 3SZOA 1VJTA 4D25A 3WVNA 4HWTA 5T6BA 1YA4A 3EWAA 5JNUA 1U8FO 3CWZA 3OEHA 2YFKA 4M9RA 1P74A 1Y5IA 1QYDA 2DPLA 2NV2B 4YI5A 1X70A 3L5OA 3ZK7A 2CLCX 1P7DA 4YMUA 4TV8B 2TMDA 2B6HA 2WD7B 1DRKA 1WSWA 1T4GA 1YK1A 1UK7A 4KQIA 1P73A 4WCVA 5JDIC 1VE5A 1MC5A 4J1NA 2BSQA 4NLGA 2LUOA 2ZKIA 4MRAA 4E2WA 3DQPA 1ZX1A 2ZFUA 5IKEA 3HEMA 4AG5A 1U48A 2CNWA 2PZEA 2RK3A 3OCXA 5EIAA 4S0ZA 3SJUA 3VRHA 4O3RA 2I2BA 1WBDA 1R0ZA 2V45A 1IPEA 2PAAA 2YINC 3GEHA 1DGSA 4QWCA 1B0AA 2GPNA 3H65A 3IURA 3O93A 4ND8A 3IVCA 4OFWA 3FY4A 5AVSA 3V4SA 4NCBA 4UXHA 3RB8A 4EHLA 5A1JA 4YRCA 5KAFU 2VCHA 2VEDA 3BDAA 3MN1A 4FZJA 4IMPA 1AGYA 5KYYB 3SEIA 4MB0A 1A96A 3AFGA 4GEGA 3ZZMA 4L76A 3AXSA 2QLNA 3O74A 4AP5A 5A5VA 3U49A 1KWKA 4PO9A 5K51A 4NJMA 4LRWA 3VOBA 5BQFA 1QP8A 2PRIA 2OCEA 3PF9A 3SLGA 2I4TA 4PLTA 2PG3A 4QQNA 4H7KA 2H59A 3FOBA 3PQDA 1L9KA 1P7ZA 4M9SA 3W05A 1E3TA 4DQKA 3KKEA 1Z63A 5CFMA 3OX3A 4R98A 5ELXA 1ZW6A 1NXXA 4GGPA 4X7BA 1D2HA 3VX4A 1RMYA 5I7EA 2MYTA 2FKAA 3PITA 4YMIA 4FINA 1N6PA 1ISMA 1O3YA 1M66A 2ZANA 4I1SA 4LI3X 9ICIA 3DMGA 1MOZA 1FXSA 3JATB 4E12A 1LPAB 4KVZA 3ZCUA 4A6EA 2G07A 1DCMA 1QANA 4KN4A 4CLHA 4J90A 4ZI7B 4CF7A 2H11A 4GC7A 1QQAA 4O2BF 5IT9A 4YHBA 3DL0A 3RODA 4OHUA 5A4JA 2LD4A 2H5XA 3DMRA 1V1MB 1TI7A 2V7EA 3AF3A 5BWMA 4DABA 2Q3LA 3I04A 3GLQA 4M47A 4HDQB 5HFJA 3ZNQA 3AHGA 1AVTA 3K53A 3D1JA 3UJAA 4GXRA 1M2GA 1HL3A 1VCNA 2R48A 3DE4X 3VH2A 3OPXA 2VHJA 1U6IA 4IICA 4X71A 4WESA 3EVAA 4NTZA 2ZSUA 3SYNA 2J85A 3ADDA 3DP7A 4X1YA 1EK5A 2QARB 2X7HA 3EZGA 2JGMA 1XZFA 3M9LA 4EI8A 1CC1S 4HDRB 4KQ9A 3ABQB 4YFVA 4LGYA 3RBXA 5FXMA 2WE7A 1WDTA 4X60A 3WGZA 3O0TA 1JIVA 1MORA 2ACWA 3PL5A 3K31A 4H7FA 2O5VA 4ICIA 4TWIA 4HG2A 1Z4NA 1UPBA 1O95C 2CVZA 2OC9A 1TQHA 3F67A 3UAOA 4DMRA 5HKLA 1C4OA 3F6BX 4O4JA 3O4VA 4JP8A 2Z2XA 4U2FA 1HI9A 1W59A 1ZC4A 2BRUA 2QTRA 4L8FA 4CM5A 5B12A 1AURA 1SJ9A 2HCBA 3WK4A 3E9EA 3GGGA 1R27A 2PX8A 3KJXA 5CIQA 4E08A 4QKQA 5CG1A 4YJ2A 2Y1EA 4C4YA 5C46F 1V97A 3AVQA 1XP8A 2QUHA 2IUEA 2XB6A 4LKOA 3SVZA 1XJWA 1THTA 2YHBA 16PKA 3RVDA 4MV9A 5KFHA 1X1SA 4CKXA 4CIDA 1BFUA 1OHHA 3OX1A 1UMCB 3WGNA 4G9GA 2ZE8A 3EX7C 1PE0A 1KFTA 3E5NA 2GWHA 3LY5A 4JK1A 4H0CA 1NPTO 3QF4A 1ZONA 2EQ5A 4LXTA 2WPNA 1C7EA 2JFHA 3AJDA 5KHOC 5KS2A 3UQZA 1O0BA 2ID9A 2H5IA 3CJRA 3FDJA 4RY0A 5JRZA 4MEJA 1XTVA 2QZJA 2HCJB 2JJMA 3LCCA 4MXDA 3TOXA 3KQKA 3IIMA 2D5BA 1K0UA 1Q11A 1Q57A 1YJXA 2YS7A 3BMNA 1CIJA 1NIPA 3IOYA 5BXQC 3LBNA 4Q6WA 3WLFA 3AIIA 5TX7A 2E1FA 5HF9A 2QARA 2B2XA 2I9PA 5IAKA 4NZPA 1ZESA 2OA0A 2J6IA 3QK7A 2CVPA 5AW5A 5LP1A 5D49A 5HXAA 1KFBB 4O5AA 3NHFA 3OMLA 2O2IA 3F6RA 3EH2A 5BNFA 2C2OA 2ECPA 3HI4A 1TLLA 4FVTA 2PY6A 2VJMA 4BFXA 3TAUA 3TMAA 3VOSA 5BV7A 4ELVA 4LOAA 4BNFA 4Z53A 4ZOLF 4R1NA 3MB8A 2ACEA 4JT8A 4MITA 1PGJA 5AI6A 4QZIA 3DT6A 3H40A 1E0DA 1YI0A 3NCHA 3WMGA 4B35A 4B4DA 2DG2A 1ZQCA 2P69A 3QTLA 3LCMA 4RHYA 3W7BA 2EJTA 2H29A 3AU2A 5L95A 2PGIA 1V5WA 4WZAB 4MGKR 1LNZA 4NESA 1NBMA 2C5SA 2FMSA 1FYXA 2Y1WA 3BRQA 3NJRA 1LBQA 2X41A 3K0AA 3R6WA 3Q3CA 3ND9A 3ZXUB 5HWSA 2AQ0A 2EIHA 3UXHA 4KR9A 1AT1A 1GVNB 2DT8A 2WMNB 3A37A 4M7WA 4RVHA 4XX0A 3RVQA 5L3SB 4S2EA 3CB4A 1GZ6A 3C3WA 3CRW1 4HAVA 1KMQA 3JD3A 4D0RA 1CUIA 4IS3A 1NI4B 2IIQA 2Z6AA 4QEKA 1SBTA 1XYGA 2VAXA 3TD9A 1Z8DA 3LHFA 4DHEA 5AK6A 1YQGA 5DMXA 1DKOA 5HJ2A 4BY9E 1M6NA 4G6ZA 3IQDB 3TTTA 5JRDS 2YQ5A 3RARA 2N42A 3GUVA 2Z2YA 1PDVA 4CWAA 4QASA 2J4CA 3OZUA 3NHUA 4WXHA 2FUEA 4WV3A 5ALHA 2BTEA 2FFQA 3H5RA 5A3QA 3L6BA 4R84A 4NLZA 2AW3A 3F8SA 3R44A 1JEAA 1E3JA 5I8ZA 4DLNA 5C7YA 3SF8A 1QC5A 2GB4A 2X5OA 4PGGA 4I8XA 4DFJA 4MWBA 3WHKA 3ECSA 2V96A 3LOPA 1M2KA 1Y6QA 1NJZA 3AM9A 2HF7A 5EIBC 4NDZA 2P2YA 1BXGB 3TFSA 2X86A 3HFGA 3IEKA 3LL4A 4IP0A 4EIWA 4QNLA 4JT2A 1EE1A 5JJBA 1QTMA 2NAFA 9MHTA 2JH7A 1TT7A 1MW9X 4CM6A 1O58A 3HI6A 5ALLA 1YUMA 2P9CA 5LPNA 3F73A 1U3WA 3X1YA 1KO1A 4LQ4A 1JR3D 5T4HA 3ZLVA 1KL7A 2H7YA 4KQCA 4D41A 1Z4MA 1MB9A 2B0JA 3F4BA 2O59A 4KE9A 2D4AA 3C1UA 1CEXA 1E58A 1NFFA 1KYZA 1XLUA 2P3SA 3L6DA 1KMMA 4F4HA 1E2DA 4QVKA 2PPVA 3V7FA 1KMHB 3UATA 1GPYA 1I51A 1YL7A 4F04A 3UTDA 2BCSA 5CEEA 1GUZA 4N48A 3DL2A 1IWBB 3IO3A 5CP2A 4BX9C 3DTVA 4M0LA 4Q16A 3H2GA 4XX0B 4PGXA 3DZHA 5HE9A 5B37A 1H66A 2VDLB 4CLRB 3JD0A 4QJIA 2VLBA 4EDFA 1XRPA 3CSSA 1B93A 1X7WA 3T7RA 1I7DA 4OM7A 1LGYA 4B83A 2FPIA 3WMWA 1WV1A 4Z1MD 3L4JA 2P6UA 3CH6A 4KLAA 3B38A 3G17A 4JNCA 1P5FA 2WSIA 2BFCA 1HK7A 2X8LA 3KPYA 2VF4X 3ADKA 1JG3A 1OXSC 2BMAA 1KZ4A 1QZZA 4I1UA 5EOZA 4RMNA 1FIUA 2CLKB 2ZUFA 1T3GA 4WXPA 3T9FA 3JQBA 5H3CA 3MOGA 4MO2A 1T9AA 1QRTA 3MR5A 5FCDA 2O0JA 2JEGA 2WT8A 3OJXA 4BLTA 1HWYA 3DNFA 4FT4A 4C7JA 2Y0CA 2LTAA 4HEJA 2C95A 4MEBA 2G80A 4NV3A 2WQ6A 2HHUA 5IKXA 4PSAA 1MJ5A 1T8WA 4KR6A 3L7YA 4BDPA 2W4IA 3I6YA 4XJVA 2AIRA 5DCUA 2MHCA 1R74A 5EEGA 3RLIA 2DYKA 5FHQA 1U3VA 1RW4A 3WJAA 3WL4A 4PYQA 2AG0A 4FR0A 4O2BA 4QWWA 3K2IA 3CTPA 2AZTA 3CX4A 3KLMX 1TEXA 2XYGA 2EIXA 3Q7QA 2AB0A 2WYWA 5I47A 5B5SA 5C3UA 3DDCA 5DKWA 4RPXA 3BIFA 3BMOA 4JJGA 4WK0B 5BSHA 4CMJA 2EANA 1J2JA 4Q4JB 4XVUA 1R3UA 3PX7A 1VPLA 3JCZA 2PZ8A 4TL8A 2GPSA 4DBVO 4P3OA 4A8EA 1NONA 1PG5A 4UOQA 4D3YA 2GVNA 5K01A 2EBUA 2FQ1A 2QLLA 2VJYA 4QDKA 2JXJA 1HZJA 4QW9A 3FAHA 4L2IA 1W93A 1KOJA 2FPXA 3L1IA 1T8SA 3QV2A 4G1CA 2BR3A 3PP8A 3CUWA 4NVRA 2PGXA 5U1PA 1GYQA 2QL6A 2KYRA 2JJQA 3KJHA 4PHPA 3PXCX 1E1RA 1PWYE 3GUHA 3M6XA 4MR8A 4W63A 5K0SA 1DBWA 3BB3A 3KVOA 4JVMA 5CUQA 5ILOA 1W1IA 4F8RA 3C7CB 5F52A 3OJUA 2PU5A 3EVTA 4PQGA 5FTWA 1J1ZA 4YMSA 4EYGA 1GIAA 1R5OA 1S2OA 4DDKA 1Q3KA 3HWWA 4LC1A 4O4JF 2RGRA 3PTLA 5LVAA 3ILYA 2JZOA 3QPAA 1T6BY 4YDSA 1CUBA 1FUEA 1NA5A 3DEHA 2ONKA 5HRAA 4BMPB 2EWWA 4LWPA 1QFZA 3ZOKA 4DLPA 4YC7A 4IDNA 5ER6A 2C77A 3IPRA 4BWVA 2ZZNA 5TSDA 5KYXA 4MUFA 1NAIA 1JLHA 1K7EB 3FUUA 3RHTA 4DANA 4IYJA 3W0LB 1G8KA 4RHUA 1KPGA 4XGNA 4CJXA 2NPOA 4BYGA 1PV4A 2FQYA 2RI0A 221PA 2IZ7A 3PRYA 5NLLA 3EZYA 5EQFA 4H6XA 5HM6A 4DTCA 2YDYA 5JH7A 3TFOA 3KTFA 1I4DD 3FHTA 2GJ4A 1VE7A 5FUQA 4EG1A 4F3KA 4RK0A 5KNDD 1LB2B 1NLMA 4TUSA 3G5AA 2DCMA 1ZDMA 2FFRA 3L07A 4GR9A 5MN5A 5CFLA 2C2EA 4U6NA 5FWDA 3MJCA 4J91A 4BX9A 3NYWA 3OVMA 1I9GA 2F3SA 3UUEA 1MD9A 1OYOA 2COUA 3IAM1 3AEUB 4QU9A 3PUXA 5LZ5A 1L5HA 2CZCA 4RSMA 5J59A 1XWLA 5G0SA 3H7AA 2C2DA 5ELMA 1CIVA 1MO4A 1Z5WA 1W5EA 5IU6A 4M1SA 1GZ5A 1IRIA 4M9JA 3USES 3QJ5A 4BEWA 4CG3A 5A5EA 3NDIA 4RTJA 4D8YA 1CDOA 2PL9A 4ASUD 1KRWA 5EIEA 1T4CB 1ZQPA 4DQQA 1TMOA 1V9SA 2FSVA 1AS3A 2KZ3A 1T0HB 2YZMA 2ZEJA 3TW8B 1YF3A 4R2MA 3HB4X 7ICSA 3CWCA 3SR4A 2IE8A 3GCGA 2JFZA 1DZ3A 2IITA 3PKIA 4GMGA 2WJAA 3TLAA 1UJCA 1Q5PA 3I42A 1FX1A 3WFZA 4E0BA 2BMDA 1K5GA 2IXDA 3AG6A 1U1EA 2JGAA 2XAUA 2ZXUA 3ZDZB 3EFHA 4BWFB 2X8WA 2K4HA 1JU3A 2D7CA 3C2QA 3HYNA 4OKNA 1WKCA 4EKGA 2BI4A 4LE1A 4EK9A 3MLBA 2V9WA 2UAGA 1EZ1A 3U4AA 1ZM4A 3KL4A 1VGVA 2MUTA 1HV8A 5F9NA 3LTNC 2GTPA 3VPHA 3N2GA 2ZSBA 4R66A 4F5OA 1USVA 4FCCA 1GGFA 3DHEA 2IYNA 2Z1MA 4KLFA 3D3NA 1NHGA 3FTQA 1P29A 1IXRC 2JHFA 4UTZA 1CYDA 4DPKA 1LWOA 1PL7A 3T0IA 4YAKA 3O47A 1OJLA 1UXKA 1QZXA 3FPLA 3UY4A 1RQXA 3BK2A 5IJXA 1ZMOA 1GP2A 1H4TA 2WMYA 4RLQA 5I7HA 2G72A 4PRLA 5TPWA 1N3YA 3OM0A 2GZMA 3LVFO 3ESXA 1KE2A 1NATA 5LA6F 2WVJA 3Q8PB 4WZBB 4QYXA 1CJCA 4Y2GA 2GRUA 5DHRA 4ZHQA 4RK5A 2ZSHA 1H0KA 3A2MA 4MDFA 2QRUA 3RV4A 3KQUA 1CJTC 3ZY4A 1K3UB 1QHIA 3CZ4A 5CJJA 3UT6A 1DUSA 1SCQA 1PJRA 5H16A 4YIHA 3A32A 3G7SA 3TGLA 3T3MB 2PL3A 1LF5A 2W55A 3O73A 4H3HB 1G291 1HORA 3Q0TA 1ONOA 2R5NA 1VE6A 3K6JA 4FYYA 4MRVA 4PYIA 2ASLA 2DFDA 5DI3B 2GCOA 4K9LA 4E5SA 1RYEA 5CFPA 2HA3A 1E2EA 5T14A 1BCSA 3WZMA 4QDUA 3F4LA 5B53A 4DCOA 4F4FA 5GZ3A 3PUJA 8ICLA 1PR9A 2C9BA 2IVZA 3RR7A 1VHLA 1ZGBA 2YY5A 3C7KA 3GGCA 1OA1A 1EDOA 4MUYA 4X94A 1UQTA 3UWKA 2WF9A 9ICOA 2BEUA 4WNAB 2CB9A 4ZICA 4O3SA 4JWTA 1Q1QA 3CLUC 3WXBA 3F74A 1DK2A 4E2FA 4MW5A 5TMDA 3QG5A 5K3FB 4JUIA 5I3CA 4R5HA 1MJFA 1A2BA 1B23P 4ZMBA 1QSSA 1C3OA 3TEJA 4K9DA 3I0NA 1NW3A 1P81A 2WJYA 3QHPA 3DE3X 4GW3A 5I9BA 1A77A 4GOND 1S97A 4MVWA 4PO8A 3BXGA 3J80A 5BSVA 1SQFA 1BFKA 2FSUA 2H17A 2OZLA 3V8VA 3BORA 1GGKA 5ICCA 1NW6A 1UKCA 3I6MA 5KWEA 5AVWA 4IRXA 2IPLA 5DE3A 2B4QA 3DUWA 4J49A 1SOAA 2LIPA 3UUWA 1CR1A 2XB8A 1Q0RA 5GMOA 4ZK6A 1X9IA 2A1TR 1P2TA 4XR4A 4BJ6A 1TQ2A 3TI0A 4D3SA 1XX6A 1U47A 2OQRA 4RUCA 3HBLA 2DY1A 2YXEA 5FKJA 3MT7A 2HNAA 3S2IA 4BVGA 1GRVA 1YVDA 2F9LA 3ZJVA 2QD4A 4HNAA 3V6LA 4KYTA 3TTYA 2A9VA 5CVVA 3T7KA 3UB2A 2CC2A 5FYQA 3ZNNA 2PFOA 1OI4A 3VR3A 1YJQA 4NYIQ 1EPUA 3I5MA 3WKEA 4YO7A 4PZPA 2HYIC 2IEDA 1NE2A 2BP7A 4IFIA 5KAIU 1M34A 4KUEA 3AGQA 5ADWA 1UCFA 4G37A 4LZDA 4PH5A 1EVQA 2FCAA 3VKHA 1F8XA 1V8OA 4IO0A 4D8TA 5JHGB 1U9YA 1SK8A 1BD3A 1EK6A 1OLSB 3VO9A 1DJLA 2KEYA 1UBFA 3AFOA 1K9SA 1U1GA 3LPCA 1ZOPA 5GQSA 1A69A 2JBWA 4B9TA 3QZ7A 2Q21A 3AG5A 4WXYB 2N1RA 4PBSA 4RUAA 4XB6B 1Z4QA 2XDQA 1U8CB 3O92A 3LUKA 5G0TA 5CDFE 2G5IB 3CXUA 4HAZA 4RPIA 2YFHA 2F3RA 5C1BA 3IXMA 1X7YA 3JARB 3LRPA 2ATIA 8ICHA 4IG9A 1RRGA 3O21A 4LZAA 4FE4A 2C2KA 2JHPA 3IALA 5G4LA 5REQA 1BHO1 1G8SA 2XQVA 4BGUA 3I1IA 3NVDA 1V3TA 2Y05A 1S1CA 1C1YA 3DAHA 2WYHA 3R0JA 3KUUA 2Q45A 2DSNA 2C42A 4M1KA 5B7NA 3ELYA 5D3MA 3VZCA 5DWVA 1U6KA 1KJYA 1KYQA 1NKSA 1SCUA 2EKBA 3FYSA 4P6VF 1WVMA 4ERXA 3KEOA 3KR2A 4K81B 3WRXC 2NO5A 2ACKA 1GL9B 1QIEA 2NW6A 3G7NA 2NU8A 2VKQA 4AP6A 1SMKA 2PS0A 4UCFA 5BORA 4GOMD 4JR0A 4JXKA 3T12A 4D8WA 2PMCA 4LYYA 4NK5A 5IDWA 5INTA 4N76A 4RHEA 4WFJA 3HFRA 2R8KA 4JLVA 4GFJA 5DDMA 4I3HA 3RS5A 3EWSA 3AY6A 3OLQA 3MGVA 3FSGD 1US8B 3MWEB 3AV3A 2EFGA 5AK0A 1VGRA 1TVEA 1U80A 3PE4A 1T1RA 4X6YA 4DN6A 4F97A 3G9XA 1M8PA 3QYFA 2CNOA 5JD4A 4M0AA 3RR8A 3RRGA 1PBNA 5H68A 4JQYA 2XVYA 1NLYA 3AB7A 4XGQA 4P4LA 4URHA 1Z0IA 1RBYA 2FWNA 2QYSA 2ZXEA 1NJYA 4BNWA 1IBKB 3PI7A 2WY2D 3PJEA 4RQ3A 2W2MA 2RAVA 3I8XA 4EWLA 4BNJA 2IHBA 3X1JA 4CR8A 3OOEA 1G3RA 1AQYA 5E7JA 3S44A 3DOUA 3GZJA 4FLFA 3R9XB 5K1ZA 3TLJA 7ICHA 1P6UA 5DDYA 1Z5OA 4TTIA 1CJKC 3ZW9A 2JASA 2O1WA 1O9GA 2XDQB 3EIXA 3M49A 3M7IA 1GOTA 5F1KA 2WUFA 4Q4LA 4AY5A 1EINA 1PQUA 4NY8A 3JZMA 2QK4A 3LM8A 3PC4A 1DP4A 4FM9A 1KOGA 2GXQA 4JV1A 1NBIA 2SCUA 2CHEA 3O82A 2IT1A 3HBMA 3VSCA 5T4BA 1JX6A 5IIKA 1YUBA 3NDJA 2W71A 4LECA 3QPWA 4LYGA 4TYMA 4OU5A 1XG5A 5KU1A 1MQ9A 1G2QA 2WRZA 4O6VA 2C1EA 3BFPA 3H9EO 4EG0A 1QS0A 3WLRA 4YAIA 1AA9A 2PSFA 1YMUA 2C8JA 3A6DA 1JHZA 4Q6BA 5AJHA 1RHRA 3K4QA 1N36B 4UCQA 2XMQA 3PXDA 1J1IA 2Q1WA 3KFXA 5L1IA 2I4OA 3HKDA 4CNQA 2JI4A 3O4GA 4AN4A 1E4EA 3E53A 1YB2A 3RSHA 4BJ1A 3UMYA 1NDQA 4BO7A 3H9GA 3KPUA 1X8XA 3GRCA 4IW3B 4LRXA 3T38A 1IIBA 2C7GA 5JQWA 5DBBA 1NZFA 2QSUA 4J7CA 4X1IB 3EH1A 1BE1A 1T3SA 3DLBA 1IHYA 4BFYA 1GTRA 3GUUA 3V72A 3WB0A 1L5RA 3IAS1 3IAS6 3WLQA 1O4WA 2A3VA 5TQJA 5IF9A 4HRAA 3LP6A 1W8IA 2SKCA 4JEMA 4ZVOA 4BV3A 5J23A 2FF5A 5JO0A 1KK2A 1N8TA 1II8B 1RMQA 1WOYA 2IK8A 2FKNA 2MMGA 3E70C 3H2HA 4C4XA 2DPIA 4RF2A 4KIJA 1H8EA 2PYDA 3LZ6A 3WR5A 4EPXA 1N32B 1WWVA 3SZUA 2Q6VA 4IQ8A 1P80A 3GRFA 2QVCA 4PSDA 4JLDA 4FJ1A 1FMTA 5HGJA 3B12A 2JRZA 1BOOA 2J87A 3JD4A 3MF4A 3NGLA 3A1CA 3PK0A 4P4UA 4W1SA 1CRWG 2MSCB 3E22B 4KL8S 1QO9A 1TZKA 3AUAA 3EGEA 4TMFA 4ZO8A 4QTZA 1WRBA 2ASDA 1XTJA 3KYDA 2WWTA 1NVBA 2EW2A 2QTNA 1EFPB 3MBKA 5CYOA 3VDRA 3BK7A 2QT0A 4S1NA 4M9ZA 1E9BA 4W5OA 1M0EA 3N6RA 1DSSG 4ZAYA 1A27A 4CKCB 5KWJA 1O0SA 1YA6A 2JLUA 4QUJA 2XKAA 5B55A 5C3MA 3UV6A 3HVKA 1IIPA 1RC8A 3MFHA 2EAUA 5ESWA 1IDN1 2BFWA 2B21A 3DULA 2KHVA 3PC8C 2ZIGA 2RG1A 5COAA 1FFHA 2H92A 2D3DA 3SYLA 4BRUA 2RJOA 1NJGA 2M6RA 2ZUEA 3QVKA 1C9EA 2YB4A 2YXPX 3L79A 4S24A 1M1YB 1QORA 3LT4A 1SPBS 3K9WA 1GARA 4HQOA 4NNJA